4ML4A

Crystal structure of the complex of signaling glycoprotein from buffalo (spb-40) with tetrahydropyran at 2.5 a resolution
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of signaling glycoprotein from buffalo (SPB-40) with tetrahydropyran at 2.5 A resolution
rcsb
total genus 122
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4ml4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ml4A01
3UEQA 3WQWA 3I3DA 4CN4A 2OSWA 3CUGA 1E6XM 3DECA 2D0GA 4JZ5A 2RGLA 4W5UA 3NYDA 4QLKA 3BAYA 1IZJA 4NRRA 2VVSA 1CGUA 4OBRA 1M04A 4LYRA 4JFSA 5C8BB 6TAAA 1BFNA 3N17A 3O6AA 1J0JA 4AD3A 4W5ZA 4M56A 4NF7A 4MB3A 1OGBA 2DSUA 4CD5A 1CXHA 2JEPA 2J7BA 4JFWA 2J7DA 4URIA 1JGIA 1Q6GA 2WCSA 3VIMA 2W66A 1HJWA 1VFOA 1W91A 1UOKA 5D9PA 1ZBVA 2A3CA 1IZKA 2WHKA 4CN6A 1JZ5A 1EQCA 3OLIA 1UR2A 3T2QA 3RJXA 2BXYA 2EBNA 3HMCA 4UOQA 2E8ZA 2EQDA 3VD9A 1B30A 1QVBA 1JZ4A 1OINA 1KCLA 3AIQA 2QV4A 4J3TA 1FH9A 1W9XA 3W37A 1TMQA 1UKQA 3M07A 6CGTA 5CLWA 3WKZA 1MFUA 2CCRA 2J75A 1KXQA 4KWUA 4WIWA 4YHEA 5A6AA 3WDIA 4WK9A 3W29A 2NW0A 4D6FA 4PMDA 4AZCA 1TA3A 1C92A 3MMWA 3MSDA 4ATWA 2ZIDA 1FFRA 1F4AA 3T2OA 1ZJBA 3UG4A 5A6JA 2PB1A 1QOXA 2X2YA 4GKLA 1GQJA 3POHA 4N0RA 5FL0A 1EO5A 5HBFA 4AC1X 2E3ZA 1Q6EA 2WB5A 2AAAA 5AC4A 4HZ6A 3W6LA 3MUZ1 1KGUA 2CEQA 1GJUA 2ZWZA 3CIVA 4RE3A 2B31A 3CMGA 4QCFA 3WH5A 4ZXLA 3CZEA 1SFSA 1W32A 1RP9A 1J9YA 2VVNA 4P7QA 4E8CA 3ZSTA 4DM1A 2G3NA 3FNDA 3AICA 3WL1A 3W4RA 2YJQA 5M5DA 1MW0A 2O92A 4JHOA 4CVUA 1CECA 2XWDA 3WDQA 5JBFA 1KWKA 5CXPA 4BS0A 5HPOA 3T0DA 1D2KA 4GQQA 4B15A 1J11A 4PMNA 1VRXA 2YA0A 3OB8A 1E4NA 1K9FA 4BQ3A 2BY0A 1QBBA 4K68A 4MNMA 1HNYA 3WF4A 3FXYA 4J3XA 1BHGA 4D6JA 3I3BA 1WZKA 3QHMA 1WDRA 4CCDA 4ML4A 1ITCA 1V3IA 3JUGA 1EH9A 1UD3A 2J8FA 5GPRA 4R27A 4TVDA 5EFDA 1FOBA 4EK7A 4CD6A 2QPSA 5E6ZA 3UR7A 3S6TA 5D9NA 2WVVB 1VB9A 3EMQA 5IFTA 4Z2HA 2BFGA 4H41A 3UG5A 3BAIA 4UFKA 4PSPA 5BWFA 1TVNA 4GIAA 2CKSA 1QW9A 5A6BD 4BQ5A 2W67A 1CXKA 1W9VA 1W1TA 4B3LA 3VGGA 2UY4A 1FP9A 3ZO9A 2A3BA 1OB0A 3ARZA 3O2LA 3PTKA 5CJ5A 4ACZA 3ZT5A 1R85A 4WSJA 1VIWA 4UCFA 1JYNA 1TUXA 4JCMA 5FD0A 2E8YA 1PIFA 3GDBA 1JZ6A 2W61A 2OYLA 4ZXOA 1DP0A 1EO7A 3K1DA 3RMEA 3AXHA 3CUHA 1W1YA 1VEMA 3VNZA 3A4AA 2C7FA 4GO8A 1I1WA 3DHPA 5KZ6A 3WF2A 4HMCA 3AIWA 1EDTA 2VCAA 2Z1SA 2VOTA 2TAAA 4J3WA 5A6MA 1MQQA 3LMYA 5FCZA 3SCSA 1QW8A 2X8RA 3PZNA 3W26A 4D72A 2UY3A 2CBJA 4MAZA 5C70A 2WC7A 3WQ4A 2AMGA 3ARPA 4OZOA 3VMPA 4GXPA 2V5CA 4CD8A 4F8XA 1MQRA 1J0KA 1PJ9A 4X0VA 1V6UA 4JIEA 5A8QA 1E43A 4BF7A 1O7AA 1QI0A 2FGLA 2AOSA 1QNRA 3MS8A 3ARWA 2ZXAA 4J3UA 2W63A 3CTTA 1UH4A 1UH3A 2G4FA 5A8PA 3ZT7A 4MNLA 5CPQA 5I3DA 3N13A 1B9ZA 1CZ1A 5IHRA 1JZ8A 1E73M 2VZOA 4M1RA 5GQBA 1KQYA 2D3NA 4WJXA 1FFQA 3MU7A 3KL0A 4MNJA 1HP4A 4W86A 2V5DA 3WNLA 4RL3A 4AIEA 1PPIA 5FIPA 4DUVA 1K6AA 4J27A 2XVPA 2VI0A 1R86A 4LXFA 1UZ4A 3NCOA 2XM1A 2BS9A 3BAKA 4PTXA 1AQ0A 1CTNA 2WWDA 3EBVA 4AD0A 2WZIA 2CETA 2YBUA 1FHDA 2EPOA 2VTFA 3L4ZA 1LWHA 1UD2A 3TA9A 1MXGA 2PC8A 1ISXA 3N1AA 2JEQA 3ZM8A 2VZSA 1E3XA 4PMVA 2WKGA 3VX1A 1LWJA 2XFFA 3SCOA 3TONA 4PSRA 5E0FA 5M17A 1QNOA 4CKQA 4S3JA 4TVCA 2DQXA 3PTQA 1WNOA 4TX8A 4MJ4A 1W3LA 3QHNA 4CN1A 2WNWA 3WMBA 4UOZA 4PTMA 4HMEA 4L4OA 2WMFA 3WFZA 3T09A 1GCYA 1H11A 3VM7A 2ZUNA 3AMCA 3EDJA 2VRJA 4HP5A 5CLTA 4A3HA 3CMJA 1SMAA 3WFLA 3AMGA 1X6LA 1VJZA 3CZ8A 1IT0A 3F4VA 4TVUA 3WNPA 4WKAA 3EDFA 3RDKA 2EJ1A 1HXJA 2WVUA 1B3ZA 2DPEA 4M8UA 4X0NA 2UWFA 4HU8A 1G0CA 3OZOA 3WBAA 1LLOA 2VX5A 2ZUMA 4GZEA 4H8UA 4BQ2A 2WMHA 3D5HA 1R7OA 3CUFA 3AHXA 5JBEA 2W92A 1W2VA 4W8AA 2G41A 3UCQA 1UKSA 3VO0A 3KL5A 2XHYA 3WDJA 1D3CA 4NSBA 5A6SA 1QI5A 4UFHA 4JL1A 2O9RA 2NSXA 4PCTA 3ALFA 3II1A 2XYLA 4F9JA 4CU8A 1VAHA 2F2HA 4D6CA 3GBDA 3CO4A 1E40A 4DWSD 3QHOA 4M24A 3AS0A 2CYGA 4LYQA 4AISA 2ZX8A 3WH8A 3M6DA 1NWSA 2VCBA 4HOZA 1MW1A 4S3KA 4PMQA 3BAWA 1NOFA 1FA2A 1WKYA 1IV8A 4PYSA 4MDOA 1JNEA 4F79A 5JIPA 4UNIA 2YKKA 1ISYA 2VUYA 1E15A 2C8NA 3WF3A 1BVNP 7TAAA 5A6LA 4MAVA 2EXOA 4U31A 5A94A 1V0MA 3WD2A 3WUGA 1OBAA 2E40A 3ARVA 5D8WA 2DH3A 4UOJA 2EPLX 3UG3A 3W6MA 3N15A 3EMZA 1N82A 4CVWA 1NM9A 4GO9A 5BXSA 2WK2A 4CGTA 1M01A 2VZVA 3AHVA 4PRWA 1GUVA 1GOKA 3W38A 3WF0A 1B0IA 3WEMA 3MO4A 1E6QM 1ZBWA 2CBUA 3W82A 3CHDA 3GBEA 4A3YA 3IK2A 1HL9A 1UH2A 1WPCA 1KR0A 4X9YA 1J0IA 1HKKA 2YL9A 4JCLA 2V3DA 2D3LA 5HXMA 5DF0A 1W9BM 3PZMA 3TTOA 1O6IA 1BYCA 3CUJA 1C8XA 3VIKA 1KCKA 3SCRA 3HN3A 3K8LA 4QP0A 3THDA 3G6LA 2D23A 3GNRA 2O9OA 2W62A 2MANA 4UQDA 1CGYA 3T0AA 5I77A 2BHUA 3VIPA 2J8GA 3AIUA 1XSJA 1HJQA 2CIPA 4TXEA 1UR1A 4C7DA 3PZIA 4WSKA 4DUXA 3VMNA 3IANA 4OBSA 1BYDA 5ABGA 3W53A 3NJ3A 3WMSA 3WD0A 5A3HA 1UWTA 2WYSA 4MB4A 3W25A 1E5NA 1NP0A 2XIBA 5EMYA 3WH9A 1JZ7A 2WVTA 3BAJA 3L2LA 2CHOA 1UR8A 4TOQA 4OOUA 3RM4A 8CGTA 3BXWA 1EXPA 4PMRA 4C7GA 3W28A 4AZ7A 1UQYA 4AW7A 1E56A 4AZGA 1V3JA 1ZJAA 1CGTA 4OUEA 1ECEA 3MUY1 2WLYA 2WMIA 3AI0A 4PUDA 3SURA 4NI3A 2DT0A 3VTRA 4W7UA 1TVPA 3A6OA 3EDKA 1NOUA 1F4HA 3ALGA 3AROA 3VUPA 5CZKA 2ZUVA 4R5EA 3VDHA 1XV8A 4JKMA 3FAWA 4Q7NA 1UUQA 2W5FA 5ABHA 2ZUTA 5AYBA 3WNNA 1V02A 4D6EA 1CXEA 1XCXA 2YDSA 3ZJ7A 5I0DA 2QMKA 2GK1B 1BTCA 4PMZA 2G8ZA 4AXNA 1E70M 4J28A 2EPKX 1Q4NX 4D6IA 3U7BA 2DSWA 3WELA 1WZAA 1VBRA 3HJEA 3BSGA 4JFTA 3L4TA 1LL4A 4PCSA 2Y8VA 2V3FA 4W88A 1KGWA 3SIMA 2WVSA 1UQZA 1UA3A 1V0KA 2JF7A 2PWHA 3DYPA 3RO8A 2YL6A 1ISWA 4M80A 3WQ6A 3VD4A 3EMCA 1KXVA 2YL5A 1BLIA 4D1IA 3MV01 2XGBA 4AZBA 1Q6DA 4W89A 2ZXQA 3WDHA 3TTSA 1KXTA 3SCQA 4E2OA 1HKIA 4BCEA 1OGSA 4D71A 1C8QA 1WO2A 2E0PA 1H09A 2FH8A 4DWSB 1DWAM 2PI6A 1UD5A 3AJ7A 5M3WA 2ESCA 1B90A 2CNCA 1WZLA 4J7RA 1LG1A 3BLPX 1WB0A 4XUYA 3LPPA 3OBAA 5GNXA 2FHFA 1HP5A 1NARA 1R8LA 2VRKA 5BXRA 2W91A 2DT3A 4HMDA 8A3HA 3SCUA 2J62A 1E0XA 2ZUSA 4ZE4A 3AFBA 1E6SM 1J0YA 2Q8XA 1XC6A 1V0LA 1SMDA 5DEZA 4Z2LA 4IISA 4PMYA 1OWQA 2QMJA 1PZ2A 2VL4A 1JF5A 3KZSA 3B9DA 1GOWA 3KE0A 5C71A 3RM8A 4GI6A 2GJXB 1W9DM 2DSKA 2VX7A 2DSVA 2CESA 3CLWA 3B8SA 2WAGA 3PZUA 2BVDA 3NSNA 3NSXA 2D1ZA 2DDXA 1JFXA 1CYGA 1W3JA 3PN8A 1L0PA 1GHRA 4HTYA 4V28A 1FH7A 4RE4A 5A69A 4Z2JA 1GJWA 2WHJA 2GFTA 1TG7A 4MNKA 2F8QA 4U3CA 3ECQA 2XSAA 2XIIA 1GOOA 3CH9A 3ZSSA 3WL0A 3PZOA 1GOQA 2YBTA 2XSBA 5ABFA 1DWHM 3ZQ9A 1R87A 3VDCA 1HVQA 4FK9A 4PTVA 1SR0A 3WSUA 1QI3A 1DTUA 4H7VA 3VD3A 2J78A 4IPLA 5BYWA 2GDVA 3ARRA 3BCFA 1LL6A 4UTFA 2OYKA 1WE5A 4D6HA 5JIWA 3K8MA 1CENA 4F9DA 5CG0A 3OA5A 1BG4A 2CHNA 3VIFA 3WH7A 3OLEA 3DC0A 2VJXA 1E3ZA 1JYWA 3AIVA 3L2MA 5I6SA 4W93A 4HPHA 1HF6A 4CD4A 2X1IA 1V6VA 3AYRA 4GI8A 1EQPA 1DEDA 4FMVA 4PMOA 5BROA 3VU2A 3VMOA 4TTUA 1K9DA 3AZRA 3FHQA 3WUEA 3NIYA 1YHTA 3WDPP 2WKLA 2VX4A 2ZWYA 2WPGA 3FAXA 2DIJA 5A6BA 1ZBCA 5E9AA 2DH2A 3F5KA 4L4PA 4P7LA 3F5LA 3VD7A 2WLZA 3RPMA 4YPJA 4XZWA 5FOOA 1XH1A 3A47A 3B9EA 1WDPA 3WQ5A 1P6WA 1E4MM 1EDGA 3PZGA 4JFUA 4IM4A 3MUIA 3T2PA 4UFJA 4P8WA 1ZS2A 3WIJA 1V3MA 2ZOXA 3CZGA 3F5JA 4NRSA 2O9TA 1UZ1A 3A4XA 4PBGA 1KBBA 1XH2A 1CWYA 1UWRA 2FH6A 1ODZA 4B3KA 5BRPA 1KQZA 5A2BA 4QCEA 1E0WA 1D7FA 3AS3A 4AZCB 1RP8A 3WEOA 1TA3B 3AOFA 4HA1A 3K46A 4PMUA 3M46A 3PZQA 2RGMA 4MADA 1HT6A 3OG2A 4ZEPA 3AQUA 4U33A 5AYIA 2G3MA 2QLYA 4GINA 3CZJA 4B9YA 1BVZA 3MSGA 1E4IA 1V03A 3AYSA 4H04A 2V3GA 4AY1A 1WCGA 2BVTA 1V02E 3VIHA 3TTYA 4YN5A 3BH4A 4KRTA 4MTVA 1C90A 1JD9A 5DT5A 4TX6A 1E4LA 2ZUUA 3NDZA 4F66A 5IXEA 1HJUA 1PZ3A 2Y2WA 3QOKA 4KMQA 1WZMA 3QR3A 4ZENA 2XVLA 3GYCA 2J7CA 3W0KA 3CZLA 5LA1A 1QPKA 1BGGA 3VPLA 1VEOA 2G3IA 2XVKA 1CXFA 2DSZA 1DWJM 3AMKA 1B3YA 3RJYA 3RILA 5LYRA 4QDMA 2XTKA 2JIEA 1C93A 4ZFMA 3VOCA 1GQKA 5A6KA 3GNPA 1V08A 3GZAA 1UD8A 5IFPA 1UD4A 1OCQA 5A1AA 1G9HA 1JF6A 1U2YA 3BMVA 2YDRA 7A3HA 3OIHA 1CXIA 4UFIA 3DHUA 1OIMA 5A8OA 4W8BA 3LPOA 3UR8A 4UQBA 1KBKA 1FHLA 2O9PA 4W7VA 3TOPA 2EPMX 4M82A 4AZ6A 1VENA 4ACZB 1E72M 3WD4A 2GDUA 4CU6A 4CD7A 4EKJA 1J0ZA 3GXMA 3PZ9A 1HN1A 5E6YA 2WBKA 6A3HA 1DHKA 1E6ZA 4JKKA 1MVYA 1XCWA 1GQLA 5I2UA 1PX8A 2WZEA 5CSUA 1BSIA 2WM0A 1X6NA 5E70A 1HKMA 3WY1A 2ZUWA 4LGXA 4N42A 1GOIA 3SUWA 3GH5A 1J01A 5IHSA 4H2CA 3PHAA 4UZUA 3IJ8A 1US3A 3SCVA 3ARYA 1MYRA 1VFFA 4P7RA 3WH6A 1H3GA 1GNXA 3AS2A 2PBOA 3AIBA 1EIBA 3THCA 1DWGM 4AEFA 1UYQA 1OT1A 2EEXA 5A8NA 1EOMA 1GW1A 1EGZA 3FHAA 1WAWA 1Q6FA 5BCAA 1US2A 2GJRA 1CGVA 1V6XA 2E4TA 2BY3A 3D3AA 1UD6A 3CHCA 2Y24A 2VURA 1UR0A 2FHBA 2JFEX 3VIJA 3AIRA 1XYZA 5FKYA 2IXUA 5HDRA 1CBGA 2J79A 1B1YA 1Y7VA 4FLQA 1V3LA 3N11A 1JDDA 1H41A 4GPNA 5CQ1A 4AYSA 3SCNA 4E4PA 2YLLA 1BF2A 2D0HA 3M7SA 1AQHA 5ECUA 3SCWA 2X09A 2J7FA 3VM5A 5I24A 3AXXA 3VDBA 2WCGA 2EO7A 3ARTA 1M53A 4KGJA 1E0VA 2BY2A 1W2PA 4LYPA 1GVYA 4PUEA 4XZBA 1GOMA 3BAXA 1ESWA 1UG6A 1BG9A 4W7WA 1PEZA 3N12A 1UWQA 4E8DA 1XD0A 4PEEA 1JXKA 5CGTA 2DEPA 2BHZA 5AY7A 1E6NA 4MPKA 2NT1A 2D22A 3L4VA 1G01A 4U5IA 1G94A 5KEZA 3U7VA 1UWIA 4IUGA 3AHZA 3N18A 1PX3A 2BXZA 2DGAA 5HOSA 2ZXDA 2XUCA 2WZHA 3W24A 1MW2A 3VGBA 3RIKA 1RH9A 1XH0A 4DUWA 2ZICA 3VGHA 3SCPA 2WVVA 2F61A 3W27A 1OM0A 2YA2A 3MANA 1HX0A 2WMJA 1NWTA 2GJPA 4QFUA 3BGAA 1MWOA 2XWEA 3WNKA 1MFVA 4AMCA 2VCCA 3GTNA 4PN2A 4UZSA 2XFYA 1QNQA 7CGTA 1HVXA 4AD2A 3DYOA 4W87A 2X0YA 3BC9A 4PMXA 4U2ZA 4CCEA 1ZBKA 3WUFA 3U57A 3AHTA 5BRQA 1JXJA 3BMWA 5EBAA 3OLGA 1K9TA 1CPUA 5AC5A 4KGLA 5DMYA 1CGXA 1H49A 1E6RA 3GXIA 1H1NA 1CGWA 4D1JA 1JI1A 1WDSA 5I5RA 1BYAA 4DM2A 1V3KA 4CCCA 4AD1A 2VRQA 1E71M 3MMDA 1W3KA 5IDIA 1CNVA 1MQPA 2ZXBA 5JUVA 2JF6A 4LX4A 4AZ5A 5LA2A 3NDYA 2A3EA 1VF8A 1EOKA 2VR4A 1AVAA 3ZJ6A 4KH2A 4LPCA 1TZ7A 4M29A 2PWEA 1TE1A 3VGDA 1LJYA 5LA0A 1HIZA 4P7NA 1XGZA 2Y5EA 2ZX9A 3APGA 3EYPA 1JD7A 2XVNA 2Z1KA 2D24A 1QI4A 1LQ0A 1ODUA 1B2YA 4FLOA 1JIBA 2E9MA 1QHPA 2JIWA 3WMCA 4WF7A 4OOZA 3IJ7A 5BXPA 1UWSA 1B3VA 1JNDA 1HKJA 1QI2A 1X1NA 3CUIA 2XPKA 3GH7A 4ACYA 4U2YA 4BZYA 2WHLA 4MB1A 5D4YA 3SEPA 1BPLB 3FW6A 1C7SA 4PTWA 3GXFA 1CLXA 1H5VA 4M81A 3VX0A 1GZJA 3QGVA 2XG9A 1NOWA 3K4DA 1GVIA 3KEHA 4V27A 2PF0A 1FP8A 4D6GA 2EPNA 2GUYA 3FN9A 5M03A 2BY1A 3ZR5A 4C7FA 1AMYA 3PZVA 2BHYA 3ZT6A 2D2OA 4ATDA 1E1FA 2E9LA 1DWIM 3CZKA 1HJVA 1XYFA 5CPTA 1JYXA 1VJSA 1QBAA 1Q6CA 2CXGA 3RM9A 4UQCA 1CXLA 4Z2KA 2GSJA 1W9PA 5E0CA 5BXTA 1JYVA 1FH8A 3ARUA 5DO8A 3VIGA 1J0HA 1ZL1A 4OKDA 3GM8A 2J74A 1G5AA 3QOMA 4HOWA 1KFWA 1VEPA 3VIIA 2QF8A 3ZR6A 3WD1A 3SCTA 1QNPA 1E9LA 1DWFM 2WW5A 2HISA 1UWUA 2DT2A 3T0BA 1ZB5A 1V6YA 2WXDM 2WBGA 4P8UA 3E1F1 3VGFA 1QHOA 2NT0A 3VD5A 4WKFA 3AXIA 2XVGA 3J7HA 4GZIA 3A3HA 2JALA 3SUTA 2WMIB 1NWRA 2DT1A 1JI2A 1JDCA 2ZX6A 2CITA 3MUAA 3OLDA 1NH6A 1MXDA 1I75A 3S2CA 1J18A 3AHYA 4W84A 3WN6A 2FGZA 3CHFA 4HA4A 3WNOA 4XV0A 9CGTA 2Y4SA 1XSIA 5A95A 1OGGA 4UR9A 2VR5A 5D9MA 1LL7A 2VZUA 4UFLA 1OD0A 4YHGA 2VO5A 2ZX5A 3ZJKA 2BVYA 2VX6A 1J12A 3AMDA 1K9EA 1WDQA 4XB3A 4OJYA 1TR1A 2YOCA 2C0HA 5CPSA 2IUZA 1KB3A 5GNZA 3VDAA 1ISVA 5ABEA 1CIUA 5E09A 4UQAA 3AZTA 3B9AA 4JHZA 3W81A 2CKRA 3GNOA 1LG2A 1QHZA 4CU7A 3VKKA 4AIOA 4AEEA 2WC3A 4HPGA 1UKOA 2YDQA 4P8XA 2HVMA 5EB8A 2VMFA 1S46A 3WD3A 3T08A 3EDEA 1C7TA 4GQRA 2XJ7A 2E9BA 3UETA 2VQUA 3AIEA 3I3EA 3CHEA 4FLRA 4LQ1A 4JKLA 4XX6A 2J7EA 3IJ9A 3L4UA 1BQCA 1R7AA 2G3JA 3AISA 3O9NA 3WNMA 4IPNB 3AS1A 2VNCA 1LF1A 3ZOAA 1XHGA 5D9OA 4HZ8A 1JDAA 1M7XA 4GI9A 4CUCA 3CBWA 3VILA 1B31A 2WCAA 4BQ4A 3SUUA 1HJSA 4OIFA 1YQ2A 3MMUA 2UY2A 3BSHA 1V6WA 3WUBA 1OSEA 2XFRA 1A47A 3VGEA 3AZSA 1UA7A 4HOXA 1CEOA 3PZTA 4H8HA 1EHAA 2JE8A 4BA0A 5DT7A 2OLHA 5JH8A 4Q22A 1J10A 4GZJA 1KWGA 1BYBA 5I78A 4JL2A 4HU0A 1JAEA 2V38A 4MJ2A 2J77A 2IXVA 1W9UA 1BGAA 1UHVA 3GXDA 1GPFA 4P7OA 2VT0A 1W3HA 5F7UA 1U33A 3UESA 4Y7EA 4V2XA 2YL8A 4J3SA 3NSMA 3VNYA 4TTGA 4WKHA 1OD8A 5JBDA 3WDRA 1WP6A 5D8ZA 2PWFA 4EANA 4RE2A 1GONA 3MV11 5ABFB 1ISZA 3WENA 3WQ8A 2WANA 2Y8KA 1OIFA 4FLSA 5I79A 1RPKA 3K8KA 3ZMRA 1SYTA 2XGIA 4AD5A 1AQMA 4Z2IA 2J25A 1H0IA 4UQ9A 1EHNA 3NUKA 3SUSA 1JAKA 2UY5A 2VZTA 1U30A 4U3AA 5DFAA 1M03A 2FDMA 1KR1A 3A4WA 4WLCA 3AMLA 3BLKA 1B3XA 3OGVA 4B9ZA 2J4GA 3HU7A 1E1EA 1W1PA 5CGMA 3N04A 2J47A 3VINA 2OSXA 1GQIA 2YLAA 3WEZA 4AWEA 1UR4A 2ZE0A 1E5JA 1VBUA 3POCA 2PBGA 2PWGA 1QNSA 4A4AA 3LPFA 2VC9A 3OZPA 4JFVA 3CPUA 3DYMA 2BNJA 4KRUA 4AZHA 1KXHA 1UKTA 2GK1A 4AIUA 2OWXA 1UR9A 4QAWA 1PX4A 3LPGA 4FF5A 1C3FA 3EDDA 5EFFA 1V3HA 4B16A 2OYMA 1E6PA 2DIEA 4DWSC 1EA9C 3L4XA 5A8MA 5GNYA 3WF1A 4NZCA 1NWUA 4MDPA 2W4XA 1CLVA 5FL1A 3RCNA 2J7GA 5I23A 5A2CA 1VFUA 2WC4A 1HL8A 3K4AA 4EAMA 2QPUA 4H8VA 1H0GA 3TP4A 1UKPA 2XM2A 3ARQA 4TUFA 3BCDA 1NQ6A 4DWSA 1XSKA 4HA3A 5HPCA 3PBGA 2WHMA 1XD1A 1CDGA 3WQVA 3L4YA 2J7HA 1G1YA 2WWCA 1PBGA 2CPUA 4W85A 1MW3A 1XRVA 3KL3A 4U5KA 3FY1A 2V3EA 4MB5A 4HZ7A 4JAWA 4QLLA 1RD6A 3IAPA 3N9KA 1ZU8A 1I1XA 5HNNA 2CBIA 2BV9A 2GJXA 2PWDA 1EDQA 1GORA 2YA1A 3ZIZA 1W1VA 4D6DA 1Z32X 3VIOA 3VVGA 3SUVA 3MKKA 4ATLA 2CERA 2VQTA 4P8VA 1JFHA 1OT2A 1H2JA 1JL8A 2OWCA 3ARSA 1C91A 1ITXA 5A2AA 4ZE5A 3PTMA 3TTQA 4AD4A 3GH4A 1L8NA 3ARXA 2D0FA 3KWXA 4Z2GA 1HJXA 4UQEA 1B3WA 1JZ3A 3L4WA 2WMGA 3OGSA 1A3HA 3UERA 3G6MA 2A3HA 2CBVA 2D20A 3U5UA 3CGTA 1TCMA 1E55A 1VFMA 1TFVA 2FHCA 3IAQA 2A3AA 1KGXA 4AZIA 2OWWA 1H4PA 1C8YA 1NP2A 1JZ2A 3WBEA 2X0HA 5TD4A 4W8LA 2YIHA 3U5YA 1V0NA 3ZJ8A 2QHAA 5CSYA 2OSYA 4QLJA 4UFMA 4EE9A 3OGRA 2X05A 2WSKA 1PIGA 2WMKA 4J3VA 1JG9A 1GHSA 1BAGA 1PAMA 2GVYA 2WSPA 2ZX7A
chains in the Genus database with same CATH superfamily
3UEQA 4ODOA 3R94A 4CN4A 4C6PA 2OZ8A 1E6XM 4W5UA 2PCEA 3BAYA 4QDPA 2VVSA 3BG3A 8RUCA 1WXJA 3M0ZA 1Q7QA 1M04A 1EKOA 1YEYA 2RDTA 1J0JA 4W5ZA 3KBNA 4YCPA 4JBRA 1AH4A 2IMRA 1QU4A 3TSBA 2DUAA 5G1TA 4H9TA 4CD5A 1CXHA 2JEPA 2J7BA 2J7DA 2R1KA 1JGIA 3LV6A 3VIMA 3R12A 5LNSA 1W91A 1Q13A 2I14A 4LU0A 1TQXA 4K36A 3EB2A 5DMNA 2A3CA 4DZ3A 1IZKA 3IUIA 4CN6A 1JZ5A 3SECA 3VABA 4R85A 1GZGA 2CZEA 3SR7A 3HMCA 4IX2A 1B30A 4GQ0A 1QVBA 1BF6A 1VR6A 2QCMA 4DF0A 1DKWA 1EEXA 1KCLA 2QV4A 1FH9A 3W37A 1DPMA 4LF1A 4Z08A 3TLLA 2GQAA 6CGTA 5CLWA 2AL2B 2E6FA 3LZ3A 1MFUA 3HG3A 4KWUA 4BI5A 3D6NA 2WSQA 3INPA 5A6AA 3DFSA 2JK2A 3URBA 3WQDA 4F0MA 1TPDA 1VKFA 3EXRA 1TA3A 4I5XA 4UTHA 3HIJA 4GYKA 4IMDA 3S3GA 3T2OA 1OFBA 1ZJBA 2X2YA 1VLWA 3LSBA 1EX1A 2Z28A 3JXVA 1OCNA 1EO5A 3NZ1A 3MCMA 3VOJA 3GAYA 2AAAA 3QY7A 1AODA 3W6LA 4OV4A 4WY0B 2V8ZA 1GWJA 3MUZ1 1DVJA 3CIVA 1UCWA 4ORIA 3NRKA 2XPAA 1GGOA 3LSCA 4QCFA 3WH5A 3UI4A 1A5UA 2AGKA 2VVNA 4P7QA 1H63A 3H2EA 1PKNA 4UCGA 1X38A 2G3NA 2X42A 5KTLA 2FTWA 3CL8A 3LA4A 3NG3A 1TPUA 1N7KA 1MW0A 2O92A 5FEWA 5JBFA 2PP1A 5CXPA 3URAA 3JZUA 3T0DA 3P8IA 4IFKB 4I6KA 1VRXA 2YZRA 3KZ7A 3PFMA 4MNMA 1HNYA 3WK0A 2ZQTA 1RY8A 4HBEA 4J3XA 2VFIA 3QHMA 4CCDA 1ITCA 1V3IA 1DORA 1UD3A 4B5UA 3MTWA 3RRXA 4TVDA 2J88A 1FOBA 4CD6A 5LHEA 1HGYA 1CI1A 4JYSA 2BFGA 4H9VA 2WZMA 2P8BA 4UFKA 2GVGA 5BWFA 1HKVA 1TVNA 4GHRA 4L6OA 1W9VA 4NHVA 3U4FA 3KADA 2UY4A 1HL2A 2F84A 1OB0A 4PC8A 3KWSA 3RYSA 1D6OA 1TPB1 3ANYA 1VIWA 5F2GA 4IP4A 3U4AA 3KHJA 4KIRA 4ECLA 2WKJA 1TKKA 2DFAA 4ZXOA 1DP0A 3AXKA 1O95A 3N73A 2B7NA 3RMEA 3AXHA 2XP3A 4GO8A 4NX0A 3VXGA 4A8IA 5K4ZA 2Y5JA 4H2HA 4XSMA 2QCDA 1SVDA 2Z1SA 3KZPA 1DXEA 1MQQA 3A3XA 3SCSA 3EXTA 3PZNA 2CBJA 1XIIA 1A5LC 3I10A 2HE5A 1MRQA 3QY6A 5C70A 1A4LA 2OVLA 3TW6A 3WQ4A 3GHTA 3BW4A 3NQ6A 1G67A 1XISA 1IEVA 2C91A 1SO5A 2E67A 4IQCA 3O3RA 3BARA 1MQRA 4X0VA 1V6UA 1OFDA 5REQB 1JUKA 4H7CA 4S38A 1E43A 4BF7A 2FGLA 1QNRA 3NZPA 3W1PA 4DEFA 4J3UA 2W63A 2G4FA 4EP8C 3ZVHB 2DVXA 5A8PA 5CPQA 3EB3A 3VNDA 5IHRA 1JZ8A 2VZOA 4GGBA 1KQYA 2D3NA 4WJXA 3MU7A 3KL0A 5AVHA 4WJEA 3CGNA 2VFEA 4W86A 3FYPA 4HMNA 4KF1A 2NWRA 4RL3A 2Z7GA 4A3UA 1PPIA 4AIEA 4DUVA 5J8LA 4EXQA 4KT2A 4PRRA 4BF5A 3KRSA 1UZ4A 1WOBA 2XM1A 4GUGA 3CK5A 1CTNA 4JYFA 3EBVA 1XLMA 2YBUA 3N34A 4C6KA 1MZRA 5D03A 3LERA 1QJWA 4DQWA 4AG0A 1NDVA 2XIMA 1XIHA 4RV3A 3QLDA 1E3XA 1JRCA 2VUNA 4PMVA 3VX1A 3WJWA 1LWJA 2XFFA 1EJVC 1XRFA 2FZBA 5E0FA 2A7RA 1PBKA 2C15A 2Q09A 1AD1A 4TVCA 1FKSA 2DQXA 1B9BA 3PTQA 2HJPA 4I5UA 4CN1A 4AEOA 4JEQA 3USBA 2NLYA 3SRDA 5D37A 4NILA 4RZ6A 2WMFA 2VEFA 1GCYA 1H11A 3K2GA 2ZUNA 3VM7A 5C9WA 1A5KC 3R11A 2VRJA 4HIBA 4L3NA 3CMJA 4JQ1A 1SMAA 2ZRXA 1VJZA 3CZ8A 2E1WA 3F4VA 3VA8A 4GYFA 1F05A 1QWGA 3GG8A 3BCJA 3MSYA 1VZWA 2GQ3A 2W27A 2C71A 4PBEA 2FQIA 1G0CA 1TX0A 4XD6A 3GHRA 1PCWA 3EWCA 2NQLA 4H8UA 4GZEA 4H83A 4CCZA 2A3LA 5JBEA 1FKKA 3P0XA 1FWTA 1P4CA 4GH1A 1UKSA 3THAA 2QVNA 5CEWA 3ZYZA 1OFPA 2OEJA 2PU1A 3WDJA 1D3CA 2Y78A 5A6SA 3E5PA 4M3PA 3HPSA 3HPXA 3LZ5A 4HNNA 1FWCC 3TEVA 1FKDA 4PB5A 3L5AA 1VAHA 2D2HA 1QASA 1XPGA 3K4WA 1N55A 1UP0A 1XIEA 1VHCA 1E40A 3NL2A 2CLFA 3QHOA 4QT3A 4M24A 3AYTA 4N19A 1KLYA 4LYQA 4AISA 3FDKA 2PWUA 3WH8A 1MW1A 4GC4A 1KCXA 1JDFA 2CFFA 5BXJA 3BAWA 1WKYA 4LBRA 3VZYA 4GJIA 1HG3A 2IPWA 3PJWA 4YWSA 2GOUA 1CCWB 2PD5A 3RITA 5D75A 3BURA 1FDJA 2EXOA 5KSWA 4MWAE 1AH3A 2FGBA 1V0MA 3N14A 3GKFA 1OBAA 1XDMA 1SZNA 3S5YA 2DH3A 4HA0A 2EPLX 2ASHA 1Z42A 3BZJA 3M0IA 4MPQA 5BXSA 1TR9A 4KWWA 4HK5A 4PRWA 1YE6A 3A22A 1RJPA 1Z44A 2X16A 4FF7A 2QDDA 1S2CA 1ZBWA 2CBUA 4ZOAA 1ZAHA 3CH0A 3UQBA 3CQ0A 3KCJA 4GNKB 3VOGA 3IK2A 1UH2A 4G7FA 3EB4A 1EF3A 1KR0A 1J0IA 2D3LA 1W9BM 3DN5A 1BYCA 3SCRA 2Z1VA 2X1SA 2O9OA 2ISDA 2QCEA 4QHRA 4UQDA 5C9ZA 2OOGA 3O06A 2G0WA 1CGYA 3VIPA 3HG4A 1F8MA 2YZ5A 2A85A 1O5XA 2A4AA 2BASA 3T05A 3VDGA 5HMFA 1BYDA 3W53A 1J4HA 1QW7A 1A4MA 1JRBA 2XN1A 3BQ5A 3QMSA 5XIAA 3W25A 1E5NA 1GKQA 2XIBA 5EMYA 3PUDA 1JZ7A 3PB2A 1ADSA 5B7YA 2PCQA 2WVTA 4C6EA 5AC6A 4RNJA 2GSHA 2X0SA 3N6QA 4ODQA 4CNSA 4PH6A 4X2PA 3MI6A 1EXPA 4C7GA 1JPDX 3W28A 2A1YA 3TJXA 1JQXA 2WLYA 4G8TA 4NU7A 2WMIA 3SURA 5DO2A 2VGIA 1J8VA 3VNIA 3VTRA 1P6BA 1QPOA 3FA5A 3VUPA 3BG5A 2J6VA 1XV8A 4JFJA 4Q7BA 5ABHA 3R13A 1SQ7A 3WNNA 2DW7A 2QMKA 3WJYA 3M64A 2G8ZA 3NL5A 5FJIA 4AXNA 3MYPA 2RFGA 1ZALA 3Q37A 4I3GA 3U7BA 4LUSB 1L6FA 2DSWA 4JHMA 1WZAA 1X1ZA 2N87A 1FUYA 2J8TA 1M7JA 1KRCC 3L4TA 4IICA 3C3NA 4PCSA 3SQLA 4IMCA 1UQZA 4CQBA 1R9YA 1L6SA 4NZJA 1V0KA 4ALDA 3W1QA 3NYZA 4MLJA 4UIOA 4ZQNA 3V3WA 3RLUA 3WQ6A 2PLKA 1Q6HA 1XIBA 1S2TA 4ADTA 3TYAA 1Q6DA 2HROA 4XBJA 3DG7A 1W3NA 3SCQA 4E2OA 4BCEA 2C16A 3HQNA 2R91A 1TV5A 2PI6A 3AJ7A 3DHFA 1WDWA 1WZLA 4J7RA 3BLPX 2FMOA 4MFDA 2KGJA 3FK4A 3LPPA 3WMLA 3OBAA 3E3HA 3ITXA 3ZVIA 2I9EA 3H2AA 4QAIA 2FHFA 2VRKA 3GDTA 2W91A 4GIRA 1AL8A 2ON3A 2ZUSA 3GTIA 4ZOEA 2XIJA 2F21A 1SMDA 2EULA 1BTMA 4IISA 1OWQA 1JDEA 3E12A 1OFRA 4IIHA 1PTGA 4LC6A 2POTA 2WOQA 2ITKA 2QCFA 4EOUA 3WYZA 3KE0A 4GI6A 1W9DM 2DSKA 3UVIA 3TC5A 4ZQCA 1F07A 1VJIA 2NQ9A 3CLWA 2WAGA 3TCEA 2BVDA 4HK7A 1TPC1 1H7NA 2BOEX 1W3JA 3BLEA 4HTYA 4P2VA 2NSOA 4C1NA 4LUJA 2WHJA 1LWIA 1VFLA 5D05A 1IF2A 1WUFA 2NQ5A 4CNNA 3CH9A 3TXZA 4Z1CA 4BKNA 2XSBA 3KP1A 1GZ1A 3ZQ9A 5CZ0A 4MY9A 1O4UA 7ODCA 4PTVA 3Q58A 2J78A 1TV8A 2PDQA 4XAKA 3BDKA 3W1NA 2OZ0A 3BCFA 2LGOA 4KCTA 2OYKA 1GEHA 1XPYA 5JIWA 5CG0A 1R9HA 2WJFA 3IIVA 3PF3A 3OLEA 4G1KA 2DZTA 2VJXA 4G2PA 1JYWA 3AIVA 4XZHA 4XZ9A 3MWCA 3PPHA 1K4HA 2PRHA 1V4YA 4HPHA 4CD4A 3AYRA 3W9ZA 4GI8A 1GVOA 2X1UA 1EQPA 4LS0A 1DEDA 4FMVA 3WQEA 3O7UA 5HINA 3QYQA 4LAMA 4Y8EA 1BL4A 3NIYA 4N6EA 1YHTA 3P61A 3S1UA 3RAOA 4O28A 4PL1A 1VBJA 1IE7C 5CGQA 1X1OA 4Q4QA 3HTWA 3F5KA 1KFJA 3EOEA 1UMLA 4YPJA 3SGZA 1XH1A 2Z29A 1P5BA 4K7YA 3B9EA 3RPTA 1WDPA 4NP7A 1S2AA 3GTHA 1U79A 1TQJA 4JFUA 4KETA 5FJPA 4IM4A 3QBUA 3MUIA 2Q8LA 4UFJA 3WIJA 2ZQUA 5PTDA 2HVOA 3P84A 4MUPA 3A4XA 4PBGA 3TYBA 4RUBA 1UWRA 1P1MA 4GFIA 2YCIX 1OQFA 1XLLA 3CV6A 2NX9A 3MJMA 5BRPA 5A2BA 1YPXA 2I5QA 4KQNA 4DI8A 3I6EA 3B9OA 1TVLA 3M46A 2UBPC 3IJDA 3HA1A 2G3MA 3QKEA 1ROUA 4IFOA 1BVZA 5BRBA 3HGSA 4UUIA 2R1MA 1E51A 4MMWA 2BVTA 4NJKA 3L67A 5HNTA 4JQ2A 1C90A 2F4EA 3B0YA 5DT5A 5HJLA 4LCQA 3NURA 4XTDA 4LRSA 5AECA 4C5YA 3E6EA 3QOKA 1U22A 4NNBA 3W1MA 1ME9A 1OFOA 3QR3A 1XBVA 1Q5MA 2XVLA 4QIUA 2J7CA 1GOXA 4IOTA 4QSHA 3CZLA 3W0KA 5I00A 1H60A 4JFKA 2F6XA 2I57A 4JFLA 3VPLA 4WXZA 1VEOA 2DSZA 1B3YA 4RPQA 1AQFA 3N4EA 5LYRA 1T99A 2JIEA 3PRDA 2HNHA 5DANA 4FA3A 4E4FA 1V08A 5IFPA 1VYRA 5G4WA 5A1AA 5F1UA 4AIBA 1U2YA 1EP2A 3C56A 1H1ZA 7A3HA 4F40A 4HTBA 2QXWA 1CXIA 3MP3A 4V15A 4QEHA 5E93A 4F0SA 2O9PA 4MWAB 4QT2A 2J9ZA 4I8DA 1DJHA 4AZ6A 1VENA 4ENLA 1H61A 5BZAA 4QROA 4CD7A 5CCZA 4IX0A 4FNPA 5JMUA 2HRWA 1J0ZA 4NY2A 3GXMA 1L8PA 4WGHA 4A6GA 4MFEA 4JFMA 3G1AA 1MVYA 4JDYA 4N9EA 1F6PA 2UZ9A 4XAPA 3NWRA 5CSUA 1BSIA 1Q85A 4C6QA 3P82A 4QS5A 2PRLA 2ZUWA 4N42A 3JZEA 3QLLA 4HQVA 3SUWA 3NQMA 1J01A 3TAOA 3OP2A 3QR1A 4QQ3A 1UBPC 5HWNA 4UZUA 3G0XA 4DRHA 1US3A 3SCVA 3PUEA 2ABAA 5FA5A 1F5ZA 3WH6A 1H3GA 2PBOA 3N6JA 3THCA 3NI6A 3IKGA 3UGVA 1TIMA 1UYQA 4IF2A 3HB9A 4FNUA 5A8NA 5DY2A 1I8JA 1O5QA 5FJRA 1ZP4A 4H3DA 5FSEC 2GJRA 3B0UX 1V6XA 2E4TA 2Y7EA 1MXSA 2BY3A 1UD6A 5D38A 3CHCA 2GVEA 4S23A 2Y24A 1UR0A 1N1AA 3VIJA 2PV2A 3KRBA 3DKLA 5FKYA 2RJGA 1Z8AA 4HBOA 3C2RA 5GJMA 4P5UA 1HTIA 1B1YA 3SFWA 1V3LA 2QKFA 1JDDA 4AVNA 5DMMA 1BF2A 5BOFA 1TTPA 3PWGA 4JTKA 3M7SA 2E5CA 1AQHA 4B3ZA 4X2RA 4PL2A 3ARTA 1M53A 2VGGA 3S1XA 4LYPA 3IARA 4LV9A 4PUEA 5AZ0A 1TZ9A 1XG4A 3TFXA 4MIMA 3SY8A 1EC7A 1W26A 3N12A 4F0LA 1XBYA 4FHAA 4KCWA 4S3EA 4E8DA 1XD0A 4PEEA 5CGTA 5AY7A 3HJZA 3L4VA 1ALDA 3RGTA 4J1OA 1WA3A 4PRTA 3STGA 3N18A 3E9AA 2CLLA 4E3VA 3UF9A 1SPQA 2GLKA 1MW2A 2ZICA 3LN3A 4IMEA 6ALDA 2F61A 2IW0A 1L1PA 1GQNA 1HX0A 2ZTKA 4NJHA 3NTPA 4XZMX 4UNKA 4C1KA 4ZGYA 3G77A 4QFUA 4GLEA 1LBMA 3BGAA 1MWOA 2XWEA 3GVWA 2PA6A 3WBYA 3W7DA 3WNKA 5I3HA 4AMCA 2VCCA 4QE4A 4NJGA 3BC9A 4PMXA 4U2ZA 3QV6A 1U5VA 3MW7A 4YMZA 1FKTA 1XFCA 1JXJA 5EBAA 3H12A 1K9TA 3L9CA 2H9AB 1CPUA 3M44A 2CWNA 5AC5A 3QMRA 4TNSA 4KGLA 5DMYA 1E6RA 2PDHA 3PBUA 1CGWA 1P43A 1EIXA 4D1JA 1JI1A 2QT3A 1BYAA 3ABZA 3TH6A 1GTEA 5DLCA 1SUXA 6TIMA 3G1DA 1W1IE 3GR8A 4AD1A 1LLZA 3BQ6A 3OU8A 2DY3A 4ZVJA 3KXQA 4OUIA 2JGYA 1MQPA 4US5D 2PZ0A 4LX4A 1LQAA 4REQA 3NDYA 1EOKA 3WLSA 1AVAA 3W07A 4KH2A 2PODA 4NX5A 1A7XA 3MHFA 5MHBA 3AXMA 4L4MA 1MNSA 3QPYA 1TZ7A 3COTA 4XWUA 3VKCA 3GD6A 5LA0A 1JPHA 1S5MA 3QN3A 4GUJA 4LC8A 4O4VA 4JXCA 4ZCWA 1LQ0A 4NVTA 3MZ2A 4FLOA 2E9MA 2QGYA 3W01A 3TC3A 3IJ7A 4L9YA 1JNDA 1ZRQA 3PB0A 4U2YA 3TLQA 2WHLA 4MB1A 3LNPA 1Q6LA 5D4YA 3RXZA 1A5NC 3SEPA 3FW6A 1C7SA 4JIRA 1TYGA 1U83A 2XG9A 4H6RA 4HSNA 5JXQA 3GFYA 3PZVA 1AFSA 3AO0A 3ZT6A 1I2OA 4D8AA 2D2OA 5I06A 2IPGA 4ATDA 3SIZA 1DWIM 2VXNA 3CZKA 3U6WA 4ZO8A 1B4EA 3U8GA 3MPGA 4MWAD 5G5IA 2OOFA 1REQB 3T6CA 2FAPA 4AHOA 2OTDA 4TX0A 2QULA 3FJ4A 1JYVA 1M68A 4ODPA 4MM1A 1VYSX 3W7CA 1J0HA 3B03A 5GPGA 4DZ2A 3WK3A 1G5AA 1KFWA 1KLZA 4Z1AA 3ZR6A 4Q8UA 3SCTA 1QNPA 1DWFM 4O1AA 1AW2A 4IQLA 4W9TA 2WBGA 1BVWA 4O15A 3GSMA 3D46A 2ZZ5A 4JTQA 4QRNA 5DY3A 2C1GA 3J7HA 3LHYA 4WZHA 3G0UA 1FY6A 1AJ2A 4B5WA 3R8RA 3C2VA 3UBPC 3MUAA 3S2CA 4MVAA 1M41A 1W8GA 3LM3A 2NXHA 2V68A 2FZ9A 3WNOA 1XYBA 2Y4SA 4MYXA 1OFEA 5K3VA 3KOFA 2OELA 1LL7A 4Y9PA 1AG1O 1OD0A 1N2VA 3CV2A 2EGZA 3S4TA 2ZX5A 3ZJKA 2BVYA 1WDQA 2YOCA 1I2PA 3MO7A 1MMFA 4JTJA 3EX6A 2YXGA 4EF9A 3WBXA 2AGTA 1NQKA 2GL5A 2I5IA 3LXAA 4GQBA 2CKRA 4I7UA 1LG2A 2B5UB 1OG6A 3NR0A 4IFRA 5HQEA 3V5CA 3FCPA 2WC3A 4HPGA 5K7JA 2HS6A 4PMJA 3W83A 4DYJA 3GU9A 2IQTA 3G18A 1GYNA 3TQ0A 1YXCA 3UVAA 2VQUA 3AIEA 4LQ1A 1E1CA 1R7AA 4ZL1A 4WEVX 3O9NA 3WNMA 1OFQA 3IJLA 2PMQA 3AS1A 3MI3A 5D9OA 1Y0EA 2CC0A 3OYZA 5D32A 1YATA 3C3UA 3T81A 2QCGA 3VILA 4OIFA 2R82A 2HXTA 4LVFA 4FOKA 1YQ2A 3TYEA 1TV3A 1I45A 4HCLA 3WUBA 1OSEA 3LI0A 4Y6GA 1KRBC 3MSRA 4ICNA 5MKGB 1RQHA 4HNTA 1P0EA 1D9EA 1J96A 5JH8A 3DFQA 4GZJA 2IXVA 4KCUA 1BGAA 3KOZA 1UHVA 4ERAA 4ZZ9A 3QV9A 4DT4A 2VT0A 1A3WA 3UF8A 1U33A 3NQ8A 3LV5A 3VCCA 2YL8A 1JPMA 2YSWA 2I16A 4WKHA 4C6MA 4ASTA 2WNNA 2XP7A 3I4EA 3F4CA 1AJZA 1XLEA 4DO4A 3JYJA 2E1DA 4YL2A 1OFAA 3WENA 4ZQPA 3QVQA 3ZMRA 3PNUA 2ZFAA 2IPJA 3GIPA 1SYTA 4AD5A 4DZIA 1AQMA 1J79A 2J25A 4UQ9A 4F0RA 1EHNA 1F9CA 1W6TA 3BOLA 5K2ZA 1EPVA 4WLCA 3BLKA 1D7HA 3HU7A 1W1PA 2R8WA 3N04A 4PUNA 3IKDA 4BF8A 1HUVA 1RY0A 1RHCA 3POCA 3N2CA 2PGWA 2VC9A 2HEJA 2MLXA 1T6MA 2AAMA 1XCFA 3DYMA 3GVVA 3H7RA 3ITYA 1T96A 3OYXA 4FX8A 1M6JA 1EEPA 1SM9A 4B2DD 5AYYA 3EDDA 4B16A 3TMLA 3B8UA 2ALDA 3LUTA 1FWDC 2OLAA 3PANA 4M1BA 2QVHA 4I8YA 3RU6A 5HTGA 3WF1A 4PEKA 3NVTA 3MY9A 3UW6A 5XIMA 4E3TA 4YS1A 5A2CA 3W7JA 3GK0A 3TQVA 4H9XA 3CASA 4EAMA 1JCMP 1F40A 4IGNA 1LBFA 1ZHAA 3CS2A 5SWUA 2YCLA 4HA3A 1LT7A 4R33A 1EZWA 3WQVA 1CDGA 2XH4A 2PTYA 4CNOA 2WWCA 3BV4A 2ATSA 4N2YA 2I7GA 3HURA 4H7ZA 5BOOA 5L9FA 4MB5A 2FLIA 2QUNA 4PCFA 1RLCL 2VEGA 1JCYA 3OVRA 3BGGA 1ZU8A 4Q4RA 2CBIA 4HCDA 3N2TA 1LZOA 1K8YA 1GORA 2Q01A 4A3RA 3N6HA 3VIOA 3S47A 4GZ7A 1DBTA 3VVGA 3EWWA 4H9ZA 3MKKA 3APYA 1F3TA 4P8VA 5AHIA 1C91A 3KAHA 3TTQA 1K4GA 4LUTB 1TX2A 4Z2GA 1ZCOA 4RR4A 1POJA 3L4WA 2XP5A 2J13A 2PTZA 3EX4A 3B4YA 4OQVA 1JVWA 4UWMA 3G6MA 3CGTA 4NZ1A 1W8SA 2FHCA 3IAQA 3A3WA 1FWAC 1KGXA 2OWWA 1O94A 2FZDA 1H5YA 3WBEA 1FHUA 2HTMA 3BL3A 3U5YA 3ZJ8A 1KKRA 5CSYA 3UWQA 1W3IA 3KAIA 4QLJA 4FNTA 4DJFD 1SW0A 4UFMA 3G3MA 4EE9A 3UJRA 3VC6A 4DLMA 1PIGA 3KAOA 2ZADA 1S3HA 4F2TA 1BAGA 1VLIA 1PAMA 2WSPA 1EYEA 4YXGA 1MEWA 1GYLA 3CEUA 3NYDA 5E0KA 5FESA 1GPWA 3NQAA 4L80A 2GGIA 3UXAA 4OBRA 1JJKA 4LYRA 2YB4A 1G4SA 1BFNA 1UZDA 3N17A 4NAFA 4NF7A 2E5BA 2MNRA 4MB3A 4G7EA 3LGEA 3BK0A 5AOUA 4JFWA 1B6CA 1OC6A 4URIA 1Q1CA 2PU0A 3VE9A 1TPH1 2WCSA 3O5FA 1HJWA 3OPSA 1POKA 3EEGA 3EOOA 3LYEA 4NZ3A 4FOUA 3JS3A 4PB3A 3OLIA 4MSSA 1UR2A 3W7GA 3T2QA 4GISA 2BXYA 2E8ZA 2HZGA 3VD9A 1ITQA 3CU2A 3WG6A 1OINA 3WLQA 3RX2A 3IJ6A 3FA4A 3AIQA 4J3TA 1W9XA 2E09A 1GG1A 1TMQA 1UKQA 4JX4A 4NZFA 3M0VA 4ROQA 5C2XA 1DL3A 1KXQA 3S6DA 1V77A 4H9MA 4LS1A 4HPJA 4W9OA 4B5NA 1NMVA 4WK9A 3MDWA 3S1GA 5BU6A 2PLMA 3GTFA 2ZA2A 2NW0A 3SW6A 4D6FA 4AZCA 1XINA 3MMWA 1R2RA 3MSDA 5C9RA 2ZIDA 4ZMGA 3C86A 3UG4A 5J5RA 1BKSA 4S1FA 3IGHX 3VOIA 4N0RA 1Y5XA 5FL0A 3XINA 7PTDA 4DRSA 4Q8VA 4AC1X 2F2KA 4C65A 3GTYX 3B0XA 2FFCA 2WM1A 3AU6A 3LHZA 2WB5A 4N4PA 3RMJA 2BP1A 5AC4A 1BRLA 1XM3A 1KGUA 3PJXA 1GJUA 4O1DA 2B31A 1OZMA 2EKGA 1TE6A 3CZEA 4C02B 1SFSA 1RP9A 4E8CA 3ZSTA 4FAMA 3CM4A 2RUQA 2Y7GA 3FNDA 5AHMA 2X30A 2Z6IA 3WL1A 2QIWA 1VPQA 3LDVA 3O5OA 1TJ2A 3OA3A 4BS0A 4DYKA 4B15A 5HA7A 5ABTA 1J11A 3CTLA 1ADOA 2YA0A 1E4NA 1UPPA 1K9FA 2DP3A 2REQA 1KTBA 1BHGA 4LNYA 1LROA 1WZKA 1R3VA 1WDRA 5C9XA 4ML4A 3QQ0A 3VUSA 3O16A 1EH9A 1VPXA 2PBCA 2CLEA 4K1WA 2E5DA 4ML9A 3GKAA 5E6ZA 3JR2A 2WVVB 2VM8A 1VB9A 4KEUA 4H41A 3UG5A 5MF5A 3BAIA 3WQGA 1QW9A 3TN3A 2CLHA 5A6BD 3W22A 2YCJA 5FEZA 1TJ0A 1CXKA 1YBQA 3M0HA 1OX4B 3ABRA 4H19A 1A5OC 4JTHA 3VGGA 1N8WA 4HZMA 2A3BA 2B81A 4YLWA 3ARZA 3O2LA 3GVQA 2VELA 3ZT5A 1K8ZA 4UTKA 4LV4A 3GDKA 3LCLA 1JUBA 4WSJA 3B9NA 3TDBA 4UCFA 1JYNA 3LCFA 1TUXA 3LLXA 5CPNA 1S3TC 4GVGA 2W61A 2OYLA 3TYZA 4S2BA 2Y61A 3K1DA 3CUHA 4OVXA 4JFIA 3IGUA 4Z17A 5C54A 4EX4A 3O5IA 3HQPA 1KV8A 4AMAA 3AIWA 5M1TA 5J6EA 2VOTA 4IG2B 1S2VA 3TYDA 3PY2A 3RUBL 2X8RA 2NQZA 5AC7A 3VCNA 3GRIA 4D72A 4ITZA 2XH2A 2A79A 4MAZA 5GJNA 1DE5A 2WC7A 3OOQA 1FD9A 5LIUX 3NQ7A 3VMPA 4O57A 5TQLA 4R53A 1QR7A 2PDPA 3BV7A 4GXPA 2V5CA 4F8XA 1J0KA 2FPTA 4JIEA 5A8QA 3UZYA 1LRQA 3EPNA 1WDDA 2ZZ7A 2ZXAA 1IGWA 3W72A 3W7RA 1CZ1A 1S5WA 1HO4A 5GQBA 4NJJA 5ECVA 3QSTA 1P48A 7REQA 3TWBA 2BG5A 4P61A 5T9BG 5BOEA 1FWIC 5FIPA 3BWWA 4HSHA 3SQMA 5D04C 3PR2A 1B3OA 2FVLA 3FEMA 2BS9A 3BAKA 4PTXA 3LCHA 3SB0A 5C2GA 5TIMA 2CETA 2BOGX 2G95A 4R0XA 3TA9A 1JNSA 1B57A 1MXGA 2XH7A 4EIVA 4Q7IA 4DELA 2P0IA 3N1AA 3ZM8A 4O0QA 3TVAA 4D9PA 3CWNA 1PKMA 3SCOA 2FTPA 4PSRA 3OVQA 1H51A 3M9YA 2ZZ6A 4J2PA 4O13A 2ZRZA 5M17A 3WLMA 5LGXA 3C52A 4NXKA 1WNOA 2BTMA 3PPCA 4DAFA 3WLJA 3WMBA 4MYAA 1LORA 3F1QA 3F2DA 3WFZA 2PDMA 1XLHA 4N4QA 4ROPA 1VPYA 4GD0A 2DZUA 3AMCA 1BXNA 5CLTA 2VKZG 2HWGA 3W7EA 1IT0A 3WNPA 4WKAA 2ZYFA 3H70A 2YW4A 4LY8A 3HMJG 1B3ZA 4M8UA 5B7ZA 4ZB0A 1J6PA 2UWFA 4MKNA 4Q4PA 3TIMA 1P6CA 4F48A 5DCDA 3WBAA 2EKCA 1LLOA 3QXBA 2VX5A 1J4IA 2WMHA 3CL6A 1R7OA 2ZA3A 3W23A 2WQDA 3CUFA 4L61A 3G0SA 3QPEA 5GJPA 2LJ4A 1ZAIA 3PRBA 1GKPA 3QW4B 4IIDA 5G2WA 5H91A 4NSBA 3IEBA 4E2DA 2FB3A 3FS2A 1SW7A 4UFHA 3II1A 4GA8A 4ADUA 4CU8A 2F2HA 2NX1A 1YDOA 4DWSD 3MCNA 3AS0A 3UJFA 3RN6A 2PPOA 2NUYA 4V1YA 2ZX8A 4YYCA 1NWSA 4F3HA 4HOZA 4S3KA 4XAFA 1FA2A 2PWVA 4ZO7A 1JNEA 2PZNA 3OQEA 3UZWA 1SZGA 5CPOA 3R4IA 5FI8A 4E6MA 1HGWA 2ABBA 4UNIA 2YW3A 2YKKA 2OU4A 3KW3A 2VUYA 1E15A 2PRMA 3W7KA 7TAAA 4PUUA 5A6LA 1G7UA 3CWHA 4MAVA 4U31A 3RHGA 5A94A 4Q4OA 4FR1A 4J4OA 3MZNA 3UQNA 3ARVA 2ZR4A 3DFNA 1DIEA 3UG3A 3QPZA 3OJGA 3W6MA 4JD4A 2OKTA 4CVWA 1L6YA 3O15A 2VEKA 1NM9A 3EPOA 4GO9A 3SZ8A 2FKPA 1EC9A 4JN7A 2VZVA 3AHVA 2EG6A 3NGFA 3H2FA 2CU0A 1RJRA 3NQDA 2Q71A 5DQPA 5GVJA 3GXTA 4FNQA 3USZA 5B80A 4EWJA 4CQAA 1WPCA 8TIMA 1H7OA 4NT0A 1HKKA 4JCLA 3FYYA 2BMBA 3CUJA 2LPVA 4I6VA 4ZTYA 3HN3A 3K8LA 1VD6A 4QP0A 3I68A 2HBXA 4LEQA 3GUGA 3LUOA 3T0AA 4ADSA 2B4GA 1XSJA 1Q6OA 1UR1A 1AA1B 3E0IA 4UTTC 4HVXA 4DUXA 5G4HC 1T40A 4IMAA 3NJ3A 5A3HA 1MNZA 1TV2A 1UWTA 3QTPA 3HPZA 1FKIA 1NP0A 4IPIA 5EMLA 1I4NA 1ONRA 1YTKA 1RR2A 4TOQA 4XD5A 4OOUA 1SR9A 3R8HA 3RF9A 5CJNA 8CGTA 4PMRA 3B8VA 1UQYA 4AW7A 5KETA 4L1WA 1E56A 4AZGA 4UTTA 1V3JA 1D7JA 3SO7A 3CC1A 4OUEA 1ECEA 3MUY1 4PUDA 3CUZA 4GGHA 4NI3A 5LIWX 4IL0A 3SDOA 1KTNA 4L1XA 3WX7A 3EDKA 1F4HA 1TWWA 4GY0A 1KO0A 2ZUVA 4R5EA 3FAWA 5LIKX 3VI2A 4MGVA 1UUQA 3MC5A 5KMYA 5AYBA 3S9IA 3ZJ7A 1XCXA 2OMAA 2YDSA 3W7QA 3O5KA 5I0DA 4NI8A 2GK1B 4PMZA 3PSWA 2EPKX 2VEPA 3GIYA 5LNUA 4D6IA 3H6OA 2J9YA 4UTWC 1Y8BA 3LS9A 1LM1A 2FFIA 1VBRA 3VOFA 3HJEA 3BSGA 2DQWA 4J4NA 1S38A 1LL4A 4KWOA 1KGWA 4H9UA 2GYIA 3WQOA 3VKDA 3RO8A 3BTNA 2YL6A 4K8GA 3VKJA 2JKPA 1VP5A 5DBUA 1JCNA 4IQJA 1BWLA 2PDFA 4AZBA 2Q3OA 4CQCA 2ZXQA 4UTWA 1XDLA 1KXTA 2PE4A 3H2MA 3VK5A 2PDCA 2E0PA 2FH8A 4QEEA 3I7RA 4ICMA 4UTIA 1IXPA 2FJKA 5DCBA 1WB0A 4FNSA 1RBLA 1R8LA 5BXRA 3LTSA 4JX5A 4WDXA 2HPMA 4MOZA 1AW1A 1E0XA 4RNHA 1PE1A 1DJNA 4Z2LA 4PMYA 1D3GA 2VL4A 1PZ2A 4LVBA 3O5QA 3B9DA 1GOWA 4JX6A 5C71A 5I02A 1YDYA 2GJXB 2DSVA 3PPFA 2CESA 2PTDA 3B8TA 3NSNA 2ISSA 2HMCA 2CLPA 2DDXA 3ZLFA 1L0PA 4ODKA 4ZPTR 3LEPA 3V0SA 5A69A 1GJWA 3S8HA 1TG7A 3P0WA 2F8QA 2WJZA 3ECQA 2O0TA 3DXIA 2XIIA 3WJSA 1GOOA 3DENA 3DEQA 3FIGA 3G24A 3TAKA 3LQGA 3PZOA 1GOQA 1FKGA 5ABFA 1F3WA 1R87A 3VDCA 1K7FA 2QJNA 4FK9A 3SM0A 5BYWA 3PULA 2W6RA 4RJEA 2MF9A 2HCVA 2EAWA 4XO7A 2GDVA 2OODA 1QZ2A 1RBAA 4ZPWR 4O53A 1WE5A 4ZO9A 4UC5A 1I0BA 4XISA 1CENA 3ABXA 4DJEC 1PTDA 3EA3A 1E3ZA 4XKYA 2XN0A 3L2MA 4JTTA 2CZVA 4JTGA 2ISVA 1XLKA 3GZ3A 4K8EA 2YXOA 4A29A 1Z41A 1HF6A 4R34A 3KRUA 3MDYB 5KZMA 3GO2A 2I1OA 3P7YA 3BJTA 1Y5WA 2G97A 3WJXA 3MJYA 3AZRA 1P1XA 4ERGA 1TV7A 1RSCA 1RPXA 1UJPA 3WUEA 4H6EA 1KD0A 2QGHA 4XAZA 1NDZA 4IP5A 3MI2A 3XIMA 2YYUA 5TNVA 2BZNA 4DJEA 2ZWYA 3W1LA 4M6UA 2QCCA 1EZ2A 5EU9A 3IS4A 3QTGA 1FKHA 4H6QA 1O66A 2DH2A 1IXOA 4L4PA 1KFLA 2QW5A 3W02A 2R9RA 2WLZA 4ORMA 5FJJA 4HT3A 3A47A 4CLMA 3UT0A 2A6NA 1OG0A 4BI6A 3UWWA 4JNZA 1PDYA 4P8WA 1TO3A 1V3MA 3F5JA 4NRSA 4IJCA 4LY4A 1KBBA 2KE0A 3NPUA 3LOTA 2FH6A 1XF0A 1KQZA 4QCEA 1E0WA 4HGXA 1WXZA 1DJXA 2WQPA 3WEOA 3E0WA 1TA3B 2Z24A 4HA1A 3K46A 3U2CA 4AVFA 1NY1A 4RDWA 3QYSA 4ZEPA 2OG9A 3EX3A 1RLDA 1R3TA 1FCBA 2QLYA 4GINA 1U1HA 1GT8A 1V03A 1YLVA 1O60A 1WCGA 3LG3A 3TTYA 2VEIA 3Q94A 4OT7A 3KLKA 3KLLA 4KRTA 1YXYA 3P5YA 2X41A 2QDEA 4TX6A 3H7UA 3KVJA 2ZUUA 3NDZA 1NELA 3UY7A 3IV8A 3CIWA 4F66A 5L6UA 5IXEA 1HJUA 1PZ3A 2V5LA 3W7MA 1OADA 4KMQA 2Y1HA 2Y85A 1YXDA 4LWWA 1WZMA 4J9JA 4QDWA 1FWHC 3GYCA 1YTDA 2ZDSA 4TV5A 4XKMA 3W2NA 1CXFA 3VAVA 3BJSA 4B5VA 2I56A 1F3XA 1FRBA 5BU9A 4QDMA 2XTKA 2XIQA 3HM7A 4GJ1A 5FF3A 4ZFMA 3VOCA 5A6KA 3UU0A 2PV3A 2ANUA 1G9HA 3H4WA 3WLRA 4FP1A 5HQMA 3DGRA 3LD5A 3OIHA 4PBFA 4IPXA 3O0KA 4G9PA 3OO2A 1OIMA 5A8OA 4W8BA 3LPOA 4UQBA 1KBKA 4B91A 1FHLA 2OT1A 4W7VA 1R38A 2R1LA 3ISIX 4HB7A 4M82A 1P0BA 4INFA 3EGJA 1E72M 1SO6A 4HN4A 3WD4A 4JY8A 1VCVA 4WRHA 5HK4A 2Z1XA 2P76A 2VD8A 3FOKA 4EKJA 1F3EA 4M5PA 3ZWTA 3N3TA 1S2UA 1TUFA 3R10A 3KHDA 2DUXA 6A3HA 5E1QA 4AC7C 3I6TA 4ZPVR 4JKKA 1AMKA 2PD9A 3TDFA 1GQLA 4QX4A 1TTJA 2QCDB 5C7VA 3BZGA 4IT1A 3P3BA 4DX3A 4EPEC 4JTCA 1UUMA 1P0KA 2QUUA 3PHAA 4DZ5A 1XLIA 3PAOA 3CL7A 1JEZA 3OQ8A 1EUNA 4B2DA 4AEFA 1OT1A 1I0DA 2EEXA 1EOMA 3C2FA 1IT8A 2DZPA 5K4XA 1QK2A 4QG9A 4CNUA 5BCAA 3G1XA 1ME8A 3D3AA 4GUHA 1M5WA 2VURA 1NTHA 1XYZA 3HPFA 3QRHA 1CBGA 3N19B 3UQIA 4E4UA 1LOLA 1Y7VA 3LGGA 3N11A 3LM7A 1XS2A 2G3FA 3DU0A 3SCNA 4DRPA 4L6HA 3TUUA 3ZZ1A 2R94A 2V2HA 2HPIA 3SCWA 1ICPA 2X09A 3VM5A 5I24A 2EO7A 1XLDA 1Y65A 1E0VA 2INFA 2BY2A 1W2PA 1GVYA 4A8LA 3THUA 4XZBA 1GOMA 4A2RA 1TWDA 1UG6A 2TRSA 1PINA 1EFZA 3MP5A 1A5SA 3C2EA 2BHZA 4MPKA 2NT1A 2D22A 1G01A 3H24A 3ITGA 1K7XA 2GVLA 1W1A1 4O1BA 4MUZA 3U7VA 1UWIA 1PX3A 2BXZA 2DGAA 3REQB 1WKDA 4LS2A 3NO1A 4HNOA 1FCUA 3VGHA 3W27A 2YCEA 4JN6A 4DNMA 2BGSA 1U5JA 3DFOA 5CZSA 3LHVA 1NWTA 5FSDC 1KBJA 1R9ZA 3NEVA 3STPA 2MUCA 3EAUA 3CB3A 2UZ5A 2RUCA 4IP7A 2QAFA 3CWOX 1Y5VA 2XFYA 4RNIA 2V5BA 3DYOA 4FN2A 4LANA 1BKHA 1S1RA 5HW6A 2E68A 4HBKA 1PVNA 3O0FA 3BMWA 3N2OA 2P4VA 3T0TA 3TQKA 4OWGA 4HN8A 4L56A 1CGXA 3UZ5A 1H1NA 1UASA 5I5RA 3A13A 2HQAA 1KT0A 1RK5A 4E5TA 3M16A 1CNVA 4PZVA 4FIQA 5LA2A 1VF8A 2VR4A 5DRIA 4N9CA 4LPCA 1DXFA 1FWNA 2PWEA 1TE1A 3VGDA 4I5RA 4GQGA 4LRTA 2G37A 1JCHB 3VZXA 2Y5EA 5EMJA 1QPRA 3APGA 3EYPA 1JD7A 2UV8G 3R43A 2Z1KA 3O6YX 3CAQA 4YVXA 1BXBA 1QI4A 5LZLA 3C0SA 1B2YA 1P5QA 3V0UA 1JIBA 3S2LA 2J66A 3L0GA 4OOZA 4I9MA 5BXPA 3IIPA 1UWSA 1E0UA 1HKJA 3GH7A 1OCBA 4ACYA 4O2TA 1BPLB 5DIVA 5JH2A 4L72B 1T8QA 1EJSC 3LI1A 1GZJA 1GVFA 3QGVA 2GPTA 3W71A 1NOWA 3K4DA 1PKYA 4DPPA 2PF0A 1US0A 2YBVA 3AWNA 1FP8A 4D6GA 1HO1A 2GUYA 3FN9A 2R24A 5M03A 2ZDRA 1QO5A 3ZR5A 2BHYA 4GCAA 1O5RA 3ELFA 4DO7A 1TWSA 1E1FA 1ZQ5A 1UPMB 1XRSA 5CPTA 1F61A 1VJSA 1SO3A 1TCOC 1Q6CA 2ZQSA 2CXGA 3S6OA 1Q6QA 1SFJA 5U4NA 4LVAA 2OX1A 4QS6A 2GSJA 4JYDA 2V82A 2V5JA 1FKBA 5EBUA 5E5CA 5F1VA 3RR4A 3LBOA 3TMQA 3W7NA 3P6LA 4C60A 1KCZA 3WD1A 4AUBA 1A0CA 1E9LA 2WW5A 4L1GA 2PLCA 1UWUA 3T0BA 4QIBA 1ONWA 1V6YA 2IQ0A 2XH0A 6XIAA 3E1F1 4O17A 3H53A 4W9QA 2NT0A 3EWDA 1SFTA 4WKFA 2RHGA 2XVGA 3N2MA 2TSYA 3XISA 4E2BA 3TR9A 2JALA 2WMIB 2P0OA 1GVSA 1JDCA 4GNVA 2ZX6A 2KR7A 3BLOA 3AHYA 3WN6A 1LRTA 2FGZA 3CHFA 1FWWA 1Q2SA 4UR9A 5I98A 4PUJA 2VO5A 4H1ZA 1K9EA 2H3BA 4NKCA 4OJYA 3F4WA 5JQ9A 2EHHA 1KB3A 5ABEA 5E09A 2HVNA 4EPBC 2RUDA 1XLFA 1QHZA 4CU7A 2ZRUA 4AEEA 3UI5A 5CG7A 1WBJA 2YDQA 2X1RA 2D69A 2IF4A 4O14A 1C7TA 4UXDA 4GQRA 3UETA 4IGHA 3CHEA 4WDUA 2VC7A 4XX6A 2J7EA 3LCGA 3IJ9A 1BQCA 4M19A 1FVPA 3E0LA 5T91A 2ZRVA 3GFXA 4IPNB 3KAGA 1EP1A 3GR7A 2WV8A 4O8RA 1JDAA 1M7XA 4GI9A 1ROTA 2NVCA 3CMFA 1Q6RA 3GNNA 4JN8A 4DRNA 5HJXA 2MLZA 4BQ4A 3SUUA 3PRAA 4PTDA 4JQ3A 1NMWA 9XIAA 1A47A 3WLLA 3O5RA 1UA7A 1CEOA 4H8HA 2JE8A 3ID7A 4XD3A 2ZZ3A 2OLHA 1J6YA 2Y7FA 1BYBA 1HXVA 1GTHA 3NM3A 2V38A 4MJ2A 4AHPA 3S5NA 5HWBA 1IWAA 2AQVA 3GXDA 3EWUA 1GPFA 3GX9A 3WCZA 1W3HA 4JOMA 5F7UA 4C1NB 4V2XA 3VNYA 4TTGA 3I7SA 4S3AA 3WDRA 4M7SA 2F7FA 3L65A 2V0TA 3LXCA 4EANA 3MV11 3TNOA 1EXBA 2O55A 1Q65A 4UTJA 1H62A 1FXQA 3WQ8A 2Y8KA 3MWAA 1A5MC 1RPKA 3REQA 4RCXA 2J9XA 3P67A 2X40A 1M65A 2PURA 4Z2IA 5I07A 2LKNA 3NUKA 1DQUA 1JAKA 1NEYA 4I9AA 1U30A 2GDQA 3FEQA 1KR1A 2FZNA 2EG8A 1B3XA 3C0LA 3OGVA 3TKFA 4B9ZA 2J4GA 3EA2A 1E1EA 2W3ZA 2J47A 4AX7A 1FKWA 1GQIA 4XAGA 3WEZA 4AWEA 1VQTA 2ZE0A 2PDJA 4IWWA 2PWGA 4A4AA 3LPFA 2VFHA 1S5VA 2Z4GA 2BNJA 4IMGA 1OHLA 4B5XA 2Y88A 3DFPA 4L65A 4XK2A 4DBUA 5LSMA 1KXHA 2RAGA 2ZZ4A 4MGGA 4O16A 1XLGA 3PBYA 2JQXA 2OWXA 4XVEA 1PZ0A 5CH9A 2W0UA 1OF6A 3KTCA 1PX4A 2Z27A 5EFFA 4DUOA 3A21A 1IEQA 3KVLA 1V3HA 2OYMA 1XIJA 2QAPA 4OBTA 1KM5A 4C6IA 4DWSC 2P5NA 3DUGA 4JQAA 5A8MA 1FWFC 1K02A 4N9DA 4KESA 1NWUA 2NUXA 4MSPA 2GZXA 2JGQA 3HG2A 1SGJA 1ZUAX 2J7GA 2E6DA 2V67A 5I23A 1K8CA 4EF8A 1HL8A 3O6DA 3ES7A 3GU2A 2CHRA 5DIUA 3TP4A 2XM2A 3SAZA 4TUFA 4V33A 4DWSA 2DG3A 3PBGA 2WHMA 5TF0A 3L4YA 2PGEA 1NDYA 4IQ2A 1XW8A 3S5ZA 3T78A 1TB3A 2A0NA 3FVMA 4W85A 1D3HA 3FY1A 1I2RA 2DW6A 1SJDA 1RD6A 1YTEA 1JCXA 4U85A 1GJPA 1QPQA 4DZAA 1I1XA 5HNNA 2YA1A 2TODA 4RDYA 4D6DA 4BWLC 4FOJA 1P7TA 3EIPA 3W87A 3GTXA 3K13A 4CQ9A 4ATLA 2CERA 2R14A 5LIXX 2VQTA 3T8QA 3EOLA 1XJBA 1JFHA 4YCOA 1PWLA 1JL8A 2OWCA 2GQ9A 3G8RA 5FF0A 5A2AA 3GH4A 4FNRA 3NQEA 1W5QA 1J6OA 3OGSA 1IZCA 3UERA 1AD4A 2XU2A 2Z2BA 3FX4A 2NWSA 1VFMA 4BWLA 3WBWA 3KAFA 2A3AA 2OX4A 4DJDC 1NP2A 1JZ2A 4W8LA 2YIHA 3U2ZA 3H9RB 1IIGA 4JTAA 5IBXC 3OGRA 1JPKA 2WSKA 4Y90A 2WMKA 1JG9A 4U84A 2GVYA 3RLVA 2BBFA 1UBSA 2OSWA 3CUGA 1V51A 4O50A 4HYWA 5HWMA 2ISFA 4QLKA 1IZJA 1TTQA 4DJDA 3W86A 3HF3A 3VKAA 4JTEA 4JFSA 5C8BB 6TAAA 4GYPC 4M56A 3TQPA 3ODKA 5IBXA 1OGBA 4O12A 3DZ1A 3G1FA 3BE7A 2G50A 4F2BA 1VRDA 3MYOA 2W66A 5RUBA 4E2VA 2RURA 1UOKA 5D9PA 1EQCA 1X96A 4DB7A 2EBNA 4UOQA 2EQDA 2IQDA 4GYPA 1MRAA 3NFUA 1LUCA 3ZXWA 5I3FA 4JYEA 4L7ZA 4AX6A 5HMSA 3UNDA 4ICCX 1OYAA 5CC3A 2PDLA 1FKLA 1ONXA 4WIWA 2QR6A 2FDSA 1J4EA 4AYGA 2BGNE 4Y2WA 3W29A 1RAKA 3U48A 1C9WA 4U28A 1C92A 3MB9A 1Q63A 1QRQA 3P8JA 4ATWA 5CC7A 3B0VC 4Y9OA 2WSYA 2GJNA 1F4AA 3L2IA 2PB1A 1QOXA 3E0VA 1GQJA 3POHA 4YTTA 2HK0A 3TJLA 1ZCNA 5HKGA 4UR8A 1Q6EA 4J4KA 1ENUA 2ZWZA 4O18A 4WVXA 4RE3A 3UCDA 1Z89A 4AHQA 3CMGA 4O0ZA 3S1WA 1K8XA 1C9HA 3IVUA 1IHIA 1W32A 1M7PA 4DM1A 5LNRA 3RCYA 3B06A 2VP8A 2YFNA 3NQFA 1D7KA 3G1VA 1YPIA 1TWIA 3TJIA 2A5HA 5M5DA 4HHLA 3RR1A 1KTCA 4JHOA 1KWKA 2Z1BA 2F9RA 3WDQA 2RDWA 5HPOA 1D2KA 4GQQA 2F38A 4RKAA 3KVKA 3EZ4A 1WYIA 2PDXA 2BY0A 1ITUA 3DGBA 3ABSA 3K1GA 1I9CB 3WF4A 1V7AA 4D6JA 1X8FA 3I3BA 2FIQA 3TTEA 3JUGA 2XGZA 2J8FA 5GPRA 2EPHA 4R9OA 2RSEA 4ODMA 5EFDA 4MF4A 2QPSA 3UR7A 4QE1A 4DRJA 5D9NA 5CZJA 4K2SA 4F4RA 6REQA 5IFTA 4Z2HA 3QH2A 3KVMA 1BXCA 5CBJA 3TC7A 2RKXA 3M0LA 2CKSA 3MT1A 4BQ5A 5D2YA 2PP3A 3P60A 3W70A 2BB0A 1W1TA 4ZQOA 3ZO9A 4C6DA 2L5HA 3PTKA 2PV1A 4ACZA 3PNZA 1ONEA 1R85A 8XIMA 3IACA 3IVTA 4YTSA 4G50A 4LAKA 2E8YA 1PIFA 2DZBA 3TC6A 3A9BA 3PVFA 2JBMA 5G2HA 1W1YA 3U9IA 3VNZA 2C7FA 7XIMA 3LLFA 1A0EA 1T11A 1OEPA 3DHPA 4A8NA 4IH3A 4RZ4A 3WF2A 5H2ZA 2FYMA 5E9XA 2TAAA 5A6MA 2QJGA 3LMYA 5FCZA 4IXHA 4REQB 1QW8A 3W26A 3M6YA 2UY3A 1NSGA 3OG3A 4WOQA 1E44A 3TYUA 3FKRA 3L12A 3QGKC 4C6OA 2GWGA 2AMGA 3ARPA 5HATA 5AZ1A 2VFDA 3T42A 4NASA 4B5TA 4A22A 3LCIA 1KBLA 3KBJA 2OGYA 1QI0A 1B5TA 3ARWA 5DBTA 3A9IA 3VNMA 3CTTA 3TN6A 1UH3A 5LHFA 3R2GA 3WQFA 1V8EA 3W1XA 4YTRA 5EPDA 5I3DA 3F4DA 3B04A 3RFWA 2OKOA 3G2GA 2NVDA 4TMBA 5KITA 4MNJA 3GDLA 3WNLA 2YR1A 4R7OA 1PB0A 3URQA 2B0MA 1R86A 1XC4A 3GWQA 2QS8A 4LXFA 4GKTA 2P50A 3EKGA 3EX1A 2ZQ0A 2FJUB 2WWDA 2KFWA 4US6A 3RG6A 4BF9A 2WZIA 1XUZA 1FHDA 2EPOA 2VTFA 2ACSA 2EG7A 3QMTA 1LQ2A 1UD2A 1FWSA 3GPKA 2PC8A 1ISXA 4A21A 2JEQA 3ZWSA 3L5MA 2VZSA 2G5WA 4UBPC 4LAYA 3TONA 1XIDA 3DX5A 1QNOA 4CKQA 4S3JA 3GAKA 1OCJA 4CQ8A 3LLDA 3LHUA 4UOZA 4PTMA 1FQ0A 3W76A 5T26A 4F0HA 1W3TA 3EDJA 2B7PA 1K77A 2PEVA 6XIMA 4HP5A 4A3HA 1SZFA 2E6AA 4OV9A 1X6LA 4TVUA 4YWIA 4EVZA 3EDFA 3LCXA 3V5FA 1KM4A 2WVUA 1F76A 2DPEA 2ADAA 4X0NA 4A05A 1IEWA 1QXLA 4HU8A 3V1PA 3V7PA 5HT1A 2V2DA 4IIFA 2OGJA 4M6VA 4BQ2A 1QT1A 1Q3NA 3T44A 4TIMA 3D0CA 2C14A 2W92A 3CHVA 3WFAA 3IUHA 4W8AA 3VO0A 3AJXA 3EEZA 4HSOA 5AB3A 3KL5A 5I09A 4FS9A 3W73A 1QI5A 4JL1A 2PDYA 1YW1A 2O9RA 2NSXA 4PCTA 4F9JA 2XP4A 1YPFA 5IDZA 1RQEA 4D2JA 3NNTA 3GBDA 3O5MA 3CO4A 2HBVA 2CYGA 3E02A 2OFJA 1KFEA 3BGJA 2PC4A 3QQWA 4DHGA 3GC5A 2C0AA 3M6DA 3SN1A 2Z0IA 2C79A 2VHLA 1NOFA 4PYSA 5FAGA 4MDOA 4JGDA 4S3DA 3R0KA 2ZKMX 1ISYA 1E1CB 5CBIA 1V93A 3TW9A 2PF8A 1FWRA 2E40A 4O52A 2VGFA 3IJIA 4UOJA 3QJAA 5D8WA 2YCKX 2PDKA 3OHMB 4NAEA 3N15A 1N82A 2O4QA 2WK2A 4ZS6A 5F4XA 4PTNA 1GUVA 1GOKA 4H00A 3WLHA 3BOXA 3W38A 3WF0A 1B0IA 3IIXA 1E6QM 4ZB2A 2NLIA 4IHCA 4CQDA 3CHDA 3GBEA 1XGEA 1GEQA 2PDNA 4H8NA 3V75A 3URNA 4IGMA 4X9YA 3VE7A 4K6AA 3KUMA 2V3DA 5HXMA 5LGZA 2OFNA 4I90A 2OQLA 4PCPA 1KCKA 1QPLA 2EF9A 3Q45A 1RJQA 3THDA 2D23A 3GNRA 4AU0A 1TPWA 4NG3A 5I77A 5HR7A 2V69A 1EJTC 3DKJA 1HJQA 2CIPA 2DVTA 3PZIA 3HGJA 1UZHA 5CSRA 5G1MA 4OBSA 3VNJA 5ABGA 3WMSA 3VFLA 4MB4A 3S2MA 3MUCA 1ZENA 1DJYA 3WH9A 1ME7A 2VC5A 4Q8NA 1KM3A 3BAJA 1EGMA 1YRRA 2CHOA 3CAKA 1UR8A 4QR6A 4Z0SA 3NM1A 3SY1A 5A6TC 4WJ8A 4D8ZA 1E0TA 2PTXA 2ZZ1A 5I3IA 1XGDA 1CGTA 5AFDA 4J35A 1QPNA 2DT0A 4HU4A 4W7UA 4YU1A 2OEMA 3A6OA 3EOUA 2GGGA 3C4UA 3ALGA 3KCEA 4JKMA 1ZSXA 1WUEA 2ZUTA 1V02A 5LIYX 3O8AA 3MBFA 5HWJA 1BTCA 4WQ6A 1E70M 1MEIA 3O5GA 3FGCA 1WAUA 4S3CA 5D02A 3FLUA 3OHIA 3OVPA 1NF0A 4Q32A 3WELA 2V5KA 4X60A 3UWYA 1C8VA 5HAOA 4W88A 2V3FA 1HKWA 2TPSA 3SIMA 3C8NA 1Q7ZA 1TTIA 4GXMA 1LT8A 1RUSA 6PTDA 2JF7A 2PWHA 4M80A 3NOYA 3EMCA 1KXVA 3PK7A 1S2WA 5D33A 3MV01 4RDVA 1UUOA 3KRZA 4W89A 3TTSA 1FWEC 2PTWA 1HKIA 1XWYA 4D71A 4QQUA 1C8QA 1WO2A 1FKRA 3M5YA 4GGQA 1FX6A 4Q6JA 1H09A 2YCLB 3U3HA 1UD5A 5C5YA 5M3WA 2ESCA 1R3SA 1XR2A 1LG1A 4TX9A 4DO6A 1DJQA 4XUYA 3QW3A 3C2YA 5GNXA 1X97A 3PG9A 2DT3A 4HMDA 8A3HA 3SCUA 1EB3A 2RJHA 1E6SM 1XC6A 1V0LA 3W7OA 5DEZA 2ACRA 2Y5SA 1JF5A 2ICSA 5HNUA 2XP6A 2QCLA 4XAYA 3EX2A 1TPVA 4TW7A 3SI9A 3LENA 1RA0A 3B8SA 3PZUA 3SSJA 3GE7A 5D30A 4Y9AA 1L2UA 3GHSA 3PN8A 4IPPA 3V4BA 1GHRA 4RE4A 1HW6A 3WQCA 2PDWA 1QPFA 3KS6A 4XZLX 3WLNA 3WL0A 3M7WA 3BSMA 3CJPA 1DWHM 2R1NA 1XIGA 3MP4A 2K8IA 1OC5A 1HVQA 2Z25A 4O19A 4RXFA 3I65A 1SR0A 4D8LA 1QI3A 4NNCA 3VD3A 2Y62A 2QCHA 4UB9A 1MZHA 2XP9A 3ARRA 3W1TA 1LL6A 1UC5A 3IGSA 4WGXA 3K8MA 1U1JA 3Q65A 2CHNA 2OZ3A 1FAPA 2PPPA 3OBKA 3QZAA 3H26A 1JPIA 1TJ1A 1NFGA 4GC3A 1H50A 3GY1A 3KDNA 5I6SA 4W93A 3LU2A 4KW2A 3FSTA 3CYVA 2X1IA 2Y8UA 4Y9NA 2VC6A 1XQKA 4NAFB 3B4UA 5BROA