4UDMA

Crystal structure of im3 in complex with y52a mutant of e3rnase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
b'GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-E3 IMMUNITY PROTEIN
publication title Consequences of Inducing Intrinsic Disorder in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Translation
total genus 21
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 4udmA00
4UDMA 2B5UB 3EIPA 1E44A 1JCHB
chains in the Genus database with same CATH superfamily
2PPPA 3WKZA 4C02B 3VAWA 3RMEA 5DO2A 5J6EA 4Z2GA 2N87A 3RM4A 1Q6IA 1L1PA 1HKJA 1NMVA 4ML4A 1EHNA 1FFQA 4NZCA 3ARWA 1QZ2A 2PPOA 4JFJA 1ZBCA 4ODPA 1FFRA 4DH0A 4TW8A 3CHDA 1FKBA 2ETNA 2DG3A 1PBKA 1HKKA 3WD2A 1E6RA 3RM8A 2AOSA 3KAFA 1J6YA 4DWSD 1E6NA 1HKMA 4ZS6A 1E6PA 1YATA 3O5FA 1VF8A 3WQVA 3ALGA 3GPKA 2DSVA 1D7IA 1TCOC 2DPEA 2ZQVA 1BKFA 2OFNA 4WKAA 1NSGA 3TDBA 4DRKA 2ZQUA 3ARXA 2B5UB 3BXWA 2RSEA 5HWCA 3KCEA 4LAWA 1D6OA 3LUOA 1W9PA 4MNMA 1ITXA 3NTPA 3RM9A 4L3NA 4ODLA 1ROTA 4ZPWR 3PRBA 4DZ3A 5DF0A 4DRNA 4MSPA 2LPVA 3FY1A 4W9QA 1W9VA 3KABA 3B9EA 4G50A 3UF8A 3GU0A 2DT3A 3AROA 3WD0A 4LAVA 5D75A 2UZ5A 4W5UA 4WK9A 2Y78A 3WD1A 1NWSA 3RFWA 2DT1A 3WD3A 4S3KA 2K8IA 3KACA 2F2DA 1F8AB 4PTMA 4QZVB 3UQBA 3EY6A 1E44A 4GIVA 4BF8A 4P8XA 2QF8A 4JFKA 1RD6A 1R9HA 4HBEA 4IQCA 4DWSA 5HT1A 1WB0A 1T11A 2F23A 2LJ4A 4W9PA 3UI4A 1OGGA 1NH6A 4DRQA 5DIVA 2YBUA 1FKRA 2DSWA 2ZR4A 4ODQA 1A7XA 3UQIA 1HXVA 2IUZA 5GPRA 5HWBA 2AWGA 3BMBA 3CH9A 1SR0A 1JNDA 4DWSB 4Z2JA 2XP7A 1IX5A 3UQAA 2DT0A 1N1AA 2DSZA 2MNTA 3O5MA 1HJXA 1K9TA 1X6NA 1ZBKA 4DRPA 2MPHA 1HJVA 4Q7NA 3KAIA 3OOBA 1M5YA 3NRKA 3FAPA 3CZ8A 1HKIA 4QIBA 1H0IA 4ODOA 4Z2KA 2LGOA 3KAGA 3H9RB 4WKFA 3CHEA 3O5QA 4TW7A 2FAPA 2WLZA 1FKGA 3JXVA 4IT4A 3O5IA 3G6LA 3IK8A 4S3JA 1ZBWA 1JCHB 4P8VA 5GQBA 3GTYX 1W26A 4O2TA 4DT4A 4DRJA 3EIPA 4MPKA 4ZPTR 3I6CA 1NWTA 2KI3A 4W9OA 2VCDA 1F40A 1BL4A 4JFMA 2XP8A 4DZ2A 4MNLA 2A3AA 4XAKA 3ARUA 5DITA 2MLZA 2B31A 3O5EA 4UDMA 3O5KA 4P8WA 1LL4A 3KAHA 1ZBVA 2O92A 2FKEA 3B9DA 4L72B 3MDYB 1JNTA 1JNEA 2WM0A 1LL7A 5DIUA 1OGBA 1Q6UA 2PV3A 2DG9A 2PBCA 3ARVA 1D7JA 5HUAA 4Z2LA 4ODMA 1GUVA 4HARA 4U85A 1PINA 1Q1CA 1LJYA 1W1TA 2RUCA 2KO7A 2RUQA 4MAVA 1E6ZA 1FKSA 3ARZA 3ARYA 3ARQA 1FKFA 2XPAA 2F4EA 2KE0A 3TC5A 4J4NA 3O5PA 2XP9A 1LG2A 4AY1A 2XP4A 3O5GA 4DROA 4G2PA 1CTNA 1LG1A 3ARRA 1NMWA 1Q6HA 3PA7A 4TX0A 1EIBA 1P5QA 3AS1A 3O5RA 1LQ0A 2G8ZA 2ZQTA 3B9AA 2VN1A 2MLYA 1J4IA 1FKJA 1UR9A 4NSBA 3IKGA 2A3CA 1FKLA 1GOIA 2DG4A 2MF9A 3WL1A 3O5JA 4JFIA 3UI5A 2FDMA 3AS2A 3JYJA 2PV2A 4FAPA 3ODKA 3CGMA 4DRHA 1XHGA 1J4RA 4QT2A 1YW5A 2L2SA 3G6MA 4Z2HA 2PPNA 1FD9A 3QOKA 3AQUA 3O5LA 3O5DA 1XRVA 2JZVA 5HW8A 3B8SA 5HBFA 3WH0A 1H0GA 2ITKA 2PI6A 1W1PA 1FJDA 4MGVA 1JVWA 3OA5A 4R0XA 1D7HA 1NWUA 2DSUA 1FKHA 3AS3A 1WAWA 4MTVA 4WJXA 1ZK6A 4IQ2A 1OWQA 2YBTA 1GRJA 2KFWA 4FN2A 4MNJA 1ZU8A 1KFWA 4MNKA 4IT6A 1W1YA 4LAXA 4WIWA 3CHFA 2P4VA 2XP3A 1O6IA 3WQWA 2M1IA 5JH8A 1E15A 1HJWA 2WK2A 4GGQA 3KZ7A 4TYOA 1TFVA 1W9UA 1ROUA 2RURA 3ALFA 3FXYA 2XP6A 1FKKA 3ARSA 4JYSA 2O9OA 1FAPA 1QPFA 3KADA 3B7XA 3PRDA 1ZL1A 2KR7A 4LAYA 3CGNA 3CHCA 3JYMA 4IPXA 3IHZA 5HKGA 3PR9A 2RUDA 1D2KA 4DWSC 1LL6A 5HW7A 2ZR6A 1X6LA 1KT0A 2ESCA 3RGCA 5GPGA 4KR0B 3WL0A 1C9HA 2A3EA 3WIJA 4URIA 2EULA 1J4HA 1FKDA 4Z2IA 1EQ3A 2F21A 2ZQSA 3W4RA 3IKDA 4ZPVR 1SYTA 1FKIA 4ODRA 4N19A 4QT3A 1ZCNA 2XPBA 1GPFA 3ARPA 5BXJA 4DIPA 4J4OA 2G41A 3UI6A 2RQSA 4U86A 2LKNA 4NNRA 2PV1A 2M08A 3O5OA 1B6CA 5HW6A 2IF4A 2MLXA 2Q5AA 3ARTA 3WD4A 1QPLA 5DEZA 1Y0OA 4R5EA 4WKHA 1W1VA 4DRIA 4KQZA 1FKTA 2OLHA 1EYMA 3NI6A 4JFLA 1EDQA 4LGXA 4U84A 5I98A 2KGJA 1KT1A 5B8IC 2M2AA 4ODNA 4TNSA 2XP5A 1E9LA 3TCZA 1NWRA 2PN0A 4P8UA 1WNOA 2DT2A 2D9FA 4ODKA 4HBOA 2WLYA 1U79A 4DRMA 1UR8A 4TW6A 1ZB5A 3AS0A 1JNSA 4Q22A 5HTGA 2ZR5A 3PRAA 4ITZA 2A3BA
chains in the Genus database with same CATH topology
4UDMA 2B5UB 3EIPA 1E44A 1JCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UDM A;  2B5U B;  3EIP A;  1E44 A;  1JCH B; 
#chains in the Genus database with same CATH topology
 2PPP A;  3WKZ A;  4C02 B;  3VAW A;  3RME A;  5DO2 A;  5J6E A;  4Z2G A;  2N87 A;  3RM4 A;  1Q6I A;  1L1P A;  1HKJ A;  1NMV A;  4ML4 A;  1EHN A;  1FFQ A;  4NZC A;  3ARW A;  1QZ2 A;  2PPO A;  4JFJ A;  1ZBC A;  4ODP A;  1FFR A;  4DH0 A;  4TW8 A;  3CHD A;  1FKB A;  2ETN A;  2DG3 A;  1PBK A;  1HKK A;  3WD2 A;  1E6R A;  3RM8 A;  2AOS A;  3KAF A;  1J6Y A;  4DWS D;  1E6N A;  1HKM A;  4ZS6 A;  1E6P A;  1YAT A;  3O5F A;  1VF8 A;  3WQV A;  3ALG A;  3GPK A;  2DSV A;  1D7I A;  1TCO C;  2DPE A;  2ZQV A;  1BKF A;  2OFN A;  4WKA A;  1NSG A;  3TDB A;  4DRK A;  2ZQU A;  3ARX A;  2B5U B;  3BXW A;  2RSE A;  5HWC A;  3KCE A;  4LAW A;  1D6O A;  3LUO A;  1W9P A;  4MNM A;  1ITX A;  3NTP A;  3RM9 A;  4L3N A;  4ODL A;  1ROT A;  4ZPW R;  3PRB A;  4DZ3 A;  5DF0 A;  4DRN A;  4MSP A;  2LPV A;  3FY1 A;  4W9Q A;  1W9V A;  3KAB A;  3B9E A;  4G50 A;  3UF8 A;  3GU0 A;  2DT3 A;  3ARO A;  3WD0 A;  4LAV A;  5D75 A;  2UZ5 A;  4W5U A;  4WK9 A;  2Y78 A;  3WD1 A;  1NWS A;  3RFW A;  2DT1 A;  3WD3 A;  4S3K A;  2K8I A;  3KAC A;  2F2D A;  1F8A B;  4PTM A;  4QZV B;  3UQB A;  3EY6 A;  1E44 A;  4GIV A;  4BF8 A;  4P8X A;  2QF8 A;  4JFK A;  1RD6 A;  1R9H A;  4HBE A;  4IQC A;  4DWS A;  5HT1 A;  1WB0 A;  1T11 A;  2F23 A;  2LJ4 A;  4W9P A;  3UI4 A;  1OGG A;  1NH6 A;  4DRQ A;  5DIV A;  2YBU A;  1FKR A;  2DSW A;  2ZR4 A;  4ODQ A;  1A7X A;  3UQI A;  1HXV A;  2IUZ A;  5GPR A;  5HWB A;  2AWG A;  3BMB A;  3CH9 A;  1SR0 A;  1JND A;  4DWS B;  4Z2J A;  2XP7 A;  1IX5 A;  3UQA A;  2DT0 A;  1N1A A;  2DSZ A;  2MNT A;  3O5M A;  1HJX A;  1K9T A;  1X6N A;  1ZBK A;  4DRP A;  2MPH A;  1HJV A;  4Q7N A;  3KAI A;  3OOB A;  1M5Y A;  3NRK A;  3FAP A;  3CZ8 A;  1HKI A;  4QIB A;  1H0I A;  4ODO A;  4Z2K A;  2LGO A;  3KAG A;  3H9R B;  4WKF A;  3CHE A;  3O5Q A;  4TW7 A;  2FAP A;  2WLZ A;  1FKG A;  3JXV A;  4IT4 A;  3O5I A;  3G6L A;  3IK8 A;  4S3J A;  1ZBW A;  1JCH B;  4P8V A;  5GQB A;  3GTY X;  1W26 A;  4O2T A;  4DT4 A;  4DRJ A;  3EIP A;  4MPK A;  4ZPT R;  3I6C A;  1NWT A;  2KI3 A;  4W9O A;  2VCD A;  1F40 A;  1BL4 A;  4JFM A;  2XP8 A;  4DZ2 A;  4MNL A;  2A3A A;  4XAK A;  3ARU A;  5DIT A;  2MLZ A;  2B31 A;  3O5E A;  4UDM A;  3O5K A;  4P8W A;  1LL4 A;  3KAH A;  1ZBV A;  2O92 A;  2FKE A;  3B9D A;  4L72 B;  3MDY B;  1JNT A;  1JNE A;  2WM0 A;  1LL7 A;  5DIU A;  1OGB A;  1Q6U A;  2PV3 A;  2DG9 A;  2PBC A;  3ARV A;  1D7J A;  5HUA A;  4Z2L A;  4ODM A;  1GUV A;  4HAR A;  4U85 A;  1PIN A;  1Q1C A;  1LJY A;  1W1T A;  2RUC A;  2KO7 A;  2RUQ A;  4MAV A;  1E6Z A;  1FKS A;  3ARZ A;  3ARY A;  3ARQ A;  1FKF A;  2XPA A;  2F4E A;  2KE0 A;  3TC5 A;  4J4N A;  3O5P A;  2XP9 A;  1LG2 A;  4AY1 A;  2XP4 A;  3O5G A;  4DRO A;  4G2P A;  1CTN A;  1LG1 A;  3ARR A;  1NMW A;  1Q6H A;  3PA7 A;  4TX0 A;  1EIB A;  1P5Q A;  3AS1 A;  3O5R A;  1LQ0 A;  2G8Z A;  2ZQT A;  3B9A A;  2VN1 A;  2MLY A;  1J4I A;  1FKJ A;  1UR9 A;  4NSB A;  3IKG A;  2A3C A;  1FKL A;  1GOI A;  2DG4 A;  2MF9 A;  3WL1 A;  3O5J A;  4JFI A;  3UI5 A;  2FDM A;  3AS2 A;  3JYJ A;  2PV2 A;  4FAP A;  3ODK A;  3CGM A;  4DRH A;  1XHG A;  1J4R A;  4QT2 A;  1YW5 A;  2L2S A;  3G6M A;  4Z2H A;  2PPN A;  1FD9 A;  3QOK A;  3AQU A;  3O5L A;  3O5D A;  1XRV A;  2JZV A;  5HW8 A;  3B8S A;  5HBF A;  3WH0 A;  1H0G A;  2ITK A;  2PI6 A;  1W1P A;  1FJD A;  4MGV A;  1JVW A;  3OA5 A;  4R0X A;  1D7H A;  1NWU A;  2DSU A;  1FKH A;  3AS3 A;  1WAW A;  4MTV A;  4WJX A;  1ZK6 A;  4IQ2 A;  1OWQ A;  2YBT A;  1GRJ A;  2KFW A;  4FN2 A;  4MNJ A;  1ZU8 A;  1KFW A;  4MNK A;  4IT6 A;  1W1Y A;  4LAX A;  4WIW A;  3CHF A;  2P4V A;  2XP3 A;  1O6I A;  3WQW A;  2M1I A;  5JH8 A;  1E15 A;  1HJW A;  2WK2 A;  4GGQ A;  3KZ7 A;  4TYO A;  1TFV A;  1W9U A;  1ROU A;  2RUR A;  3ALF A;  3FXY A;  2XP6 A;  1FKK A;  3ARS A;  4JYS A;  2O9O A;  1FAP A;  1QPF A;  3KAD A;  3B7X A;  3PRD A;  1ZL1 A;  2KR7 A;  4LAY A;  3CGN A;  3CHC A;  3JYM A;  4IPX A;  3IHZ A;  5HKG A;  3PR9 A;  2RUD A;  1D2K A;  4DWS C;  1LL6 A;  5HW7 A;  2ZR6 A;  1X6L A;  1KT0 A;  2ESC A;  3RGC A;  5GPG A;  4KR0 B;  3WL0 A;  1C9H A;  2A3E A;  3WIJ A;  4URI A;  2EUL A;  1J4H A;  1FKD A;  4Z2I A;  1EQ3 A;  2F21 A;  2ZQS A;  3W4R A;  3IKD A;  4ZPV R;  1SYT A;  1FKI A;  4ODR A;  4N19 A;  4QT3 A;  1ZCN A;  2XPB A;  1GPF A;  3ARP A;  5BXJ A;  4DIP A;  4J4O A;  2G41 A;  3UI6 A;  2RQS A;  4U86 A;  2LKN A;  4NNR A;  2PV1 A;  2M08 A;  3O5O A;  1B6C A;  5HW6 A;  2IF4 A;  2MLX A;  2Q5A A;  3ART A;  3WD4 A;  1QPL A;  5DEZ A;  1Y0O A;  4R5E A;  4WKH A;  1W1V A;  4DRI A;  4KQZ A;  1FKT A;  2OLH A;  1EYM A;  3NI6 A;  4JFL A;  1EDQ A;  4LGX A;  4U84 A;  5I98 A;  2KGJ A;  1KT1 A;  5B8I C;  2M2A A;  4ODN A;  4TNS A;  2XP5 A;  1E9L A;  3TCZ A;  1NWR A;  2PN0 A;  4P8U A;  1WNO A;  2DT2 A;  2D9F A;  4ODK A;  4HBO A;  2WLY A;  1U79 A;  4DRM A;  1UR8 A;  4TW6 A;  1ZB5 A;  3AS0 A;  1JNS A;  4Q22 A;  5HTG A;  2ZR5 A;  3PRA A;  4ITZ A;  2A3B A; 
#chains in the Genus database with same CATH homology
 4UDM A;  2B5U B;  3EIP A;  1E44 A;  1JCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...