4UDMA

Crystal structure of im3 in complex with y52a mutant of e3rnase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords COLICIN-E3 IMMUNITY PROTEIN
publication title Consequences of Inducing Intrinsic Disorder in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
total genus 21
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 4udmA00
2B5UB 1JCHB 1E44A 3EIPA 4UDMA
chains in the Genus database with same CATH superfamily
4ODKA 2FDMA 4QZVB 3AS3A 2IUZA 4FAPA 3O5LA 1ZB5A 3KCEA 3TDBA 5HW8A 4O2TA 3ARPA 4WK9A 4ZS6A 4MAVA 4MNKA 3AQUA 2XP6A 3O5GA 1D7IA 1SYTA 1LG1A 1ITXA 2WLYA 4DWSD 2PV2A 1IX5A 3WIJA 2DT2A 3EIPA 1ZBKA 4TW7A 3KAFA 3NRKA 1UR8A 5GPRA 3FY1A 3RM4A 1CTNA 5HTGA 2AWGA 3ARTA 3ARZA 4R0XA 4IT6A 2XP5A 4DRPA 4J4OA 4XAKA 1EIBA 2L2SA 2KGJA 2PPNA 3I6CA 3NI6A 2PN0A 1GOIA 3CHDA 1QZ2A 4QT2A 1NWRA 3LUOA 1WAWA 2A3EA 4C02B 1SR0A 4Z2IA 3O5OA 3B9DA 1EHNA 1T11A 1M5YA 4GGQA 2KI3A 5D75A 2XP7A 4PTMA 1XHGA 3UI6A 2RUDA 2MLZA 4LAYA 2YBTA 1BL4A 2DT0A 4G2PA 1K9TA 4BF8A 4DRNA 4DWSC 1H0IA 3PRBA 3FAPA 3AS2A 2PPOA 2ZQTA 1WNOA 4U84A 1F40A 1R9HA 4DH0A 4DRIA 3PRAA 1E6RA 4Z2HA 2DT3A 4TW6A 3WD1A 2XPBA 4Z2JA 3VAWA 3UQBA 4GIVA 4R5EA 5JH8A 2DSZA 5BXJA 1E6ZA 1W9UA 1HJVA 1Q6UA 4FN2A 1FKBA 3O5FA 2MLXA 3IK8A 2G41A 2WK2A 4TYOA 3RMEA 4Q22A 1OGBA 1N1AA 4DRHA 1OGGA 3WQVA 4ODPA 2O92A 4P8VA 3GPKA 3UI5A 5HBFA 4IPXA 4DRKA 1C9HA 2WM0A 2DT1A 2YBUA 3O5PA 3RM8A 3CH9A 1Q6HA 4WKHA 4HARA 3H9RB 4Z2KA 3UF8A 3ARWA 1QPFA 1J6YA 2Y78A 1J4IA 3RGCA 1W1VA 4Z2LA 3PR9A 4U85A 3CHFA 3B9AA 4NSBA 5DO2A 2DSWA 1FKLA 1ZCNA 2D9FA 1HXVA 1JNTA 2KR7A 1WB0A 2LPVA 2OFNA 5B8IC 5I98A 2JZVA 5DF0A 3WD2A 1LJYA 1JNEA 1D6OA 1GRJA 3G6LA 3PRDA 1W1YA 2VN1A 1Q1CA 1W1TA 1HKKA 3WD0A 1FKGA 4ZPWR 2PV3A 1E15A 2AOSA 4ML4A 2F23A 3KACA 2XP3A 4G50A 1P5QA 1J4HA 1FKFA 3ALGA 4KQZA 3BMBA 4MSPA 1U79A 4P8WA 2F21A 2XPAA 3ARUA 1GUVA 3O5MA 4HBEA 4ODRA 5HWBA 4WKAA 1TCOC 3UI4A 2FAPA 2DSUA 4W9PA 3GU0A 2MPHA 1W1PA 2OLHA 3KABA 5HW6A 5J6EA 1A7XA 1FKTA 2F4EA 1E6PA 1HKJA 4NNRA 4MGVA 3OA5A 2Q5AA 3ARYA 4MNLA 3ALFA 4L72B 1FKKA 3JYJA 4LAXA 2B31A 3WQWA 2LKNA 3O5JA 1FKHA 1FKRA 4JFKA 2ITKA 4N19A 1OWQA 3ARQA 2DG9A 3CZ8A 3NTPA 1FFRA 2O9OA 2QF8A 1HKIA 4DT4A 4JFLA 3IKDA 2IF4A 3RFWA 4JYSA 1KT0A 4IT4A 4ODLA 4MPKA 2B5UB 4MNJA 3KADA 1NWTA 3KZ7A 4ODQA 3TC5A 3MDYB 2PBCA 1ZBWA 2KFWA 3PA7A 2DG4A 3B8SA 4IQ2A 1D7HA 1F8AB 3UQIA 4U86A 1FFQA 4ITZA 2FKEA 3WH0A 2MLYA 5DEZA 1NWUA 4DWSA 5GPGA 3RM9A 3KAHA 5HKGA 1EQ3A 1LG2A 3WD4A 4L3NA 3IKGA 1W9PA 1EDQA 2RQSA 1ROUA 3CHCA 3QOKA 1QPLA 3ARRA 5HW7A 2ESCA 2DPEA 1JVWA 2A3AA 1E6NA 5DIUA 4AY1A 1BKFA 1FKIA 1O6IA 4URIA 4DROA 2PPPA 1X6NA 4S3JA 4WIWA 1Q6IA 2RSEA 2VCDA 1ZBVA 1H0GA 4TW8A 1E9LA 5DITA 4Z2GA 1JNSA 2ZQUA 4TX0A 1PINA 1LL6A 2LGOA 1NMVA 1ZL1A 2UZ5A 4ZPTR 4ZPVR 4LGXA 4DZ2A 1D7JA 2N87A 4JFIA 2ZR6A 3TCZA 2ZR5A 3EY6A 1FD9A 2M2AA 3IHZA 3W4RA 1KT1A 2G8ZA 4JFMA 3UQAA 2EULA 1ZK6A 4QT3A 3OOBA 3WL1A 3B9EA 4DWSB 1NWSA 1X6LA 4KR0B 1YATA 3GTYX 3WKZA 5HWCA 1FJDA 3CGNA 4P8UA 4W9QA 3O5DA 4WKFA 1TFVA 2A3CA 3ODKA 3O5IA 1E44A 1HJWA 4J4NA 2MNTA 2ETNA 2P4VA 3CGMA 4WJXA 1VF8A 1W26A 4HBOA 2RURA 3O5KA 3O5EA 4W5UA 1KFWA 4ODMA 1Y0OA 1B6CA 3FXYA 3ARSA 4UDMA 3WL0A 2ZR4A 3AS0A 4MNMA 2XP4A 1NH6A 4ODOA 2RUQA 1NSGA 3G6MA 1LQ0A 2M1IA 4IQCA 1NMWA 1PBKA 4DRQA 1JCHB 1LL7A 1FKSA 1RD6A 3KAIA 3O5QA 1YW5A 2DG3A 3BXWA 4MTVA 4TNSA 3O5RA 2F2DA 3ARVA 4Q7NA 3JXVA 1J4RA 2K8IA 2XP8A 3B7XA 2ZQVA 4LAWA 4NZCA 2PI6A 4QIBA 1GPFA 1UR9A 2KE0A 3AS1A 4P8XA 5HT1A 2A3BA 1HKMA 2MF9A 3KAGA 3CHEA 4W9OA 2RUCA 3JYMA 2LJ4A 2M08A 4JFJA 1FKDA 5GQBA 1JNDA 1L1PA 2KO7A 3AROA 2WLZA 2DSVA 1LL4A 4S3KA 1ROTA 3WD3A 1ZU8A 1W9VA 1ZBCA 4DIPA 5DIVA 2ZQSA 4DRMA 1D2KA 2XP9A 1FAPA 4DZ3A 5HUAA 1EYMA 1HJXA 4ODNA 1FKJA 3ARXA 4LAVA 2PV1A 1XRVA 4DRJA
chains in the Genus database with same CATH topology
2B5UB 1JCHB 1E44A 3EIPA 4UDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5U B;  1JCH B;  1E44 A;  3EIP A;  4UDM A; 
#chains in the Genus database with same CATH topology
 4ODK A;  2FDM A;  4QZV B;  3AS3 A;  2IUZ A;  4FAP A;  3O5L A;  1ZB5 A;  3KCE A;  3TDB A;  5HW8 A;  4O2T A;  3ARP A;  4WK9 A;  4ZS6 A;  4MAV A;  4MNK A;  3AQU A;  2XP6 A;  3O5G A;  1D7I A;  1SYT A;  1LG1 A;  1ITX A;  2WLY A;  4DWS D;  2PV2 A;  1IX5 A;  3WIJ A;  2DT2 A;  3EIP A;  1ZBK A;  4TW7 A;  3KAF A;  3NRK A;  1UR8 A;  5GPR A;  3FY1 A;  3RM4 A;  1CTN A;  5HTG A;  2AWG A;  3ART A;  3ARZ A;  4R0X A;  4IT6 A;  2XP5 A;  4DRP A;  4J4O A;  4XAK A;  1EIB A;  2L2S A;  2KGJ A;  2PPN A;  3I6C A;  3NI6 A;  2PN0 A;  1GOI A;  3CHD A;  1QZ2 A;  4QT2 A;  1NWR A;  3LUO A;  1WAW A;  2A3E A;  4C02 B;  1SR0 A;  4Z2I A;  3O5O A;  3B9D A;  1EHN A;  1T11 A;  1M5Y A;  4GGQ A;  2KI3 A;  5D75 A;  2XP7 A;  4PTM A;  1XHG A;  3UI6 A;  2RUD A;  2MLZ A;  4LAY A;  2YBT A;  1BL4 A;  2DT0 A;  4G2P A;  1K9T A;  4BF8 A;  4DRN A;  4DWS C;  1H0I A;  3PRB A;  3FAP A;  3AS2 A;  2PPO A;  2ZQT A;  1WNO A;  4U84 A;  1F40 A;  1R9H A;  4DH0 A;  4DRI A;  3PRA A;  1E6R A;  4Z2H A;  2DT3 A;  4TW6 A;  3WD1 A;  2XPB A;  4Z2J A;  3VAW A;  3UQB A;  4GIV A;  4R5E A;  5JH8 A;  2DSZ A;  5BXJ A;  1E6Z A;  1W9U A;  1HJV A;  1Q6U A;  4FN2 A;  1FKB A;  3O5F A;  2MLX A;  3IK8 A;  2G41 A;  2WK2 A;  4TYO A;  3RME A;  4Q22 A;  1OGB A;  1N1A A;  4DRH A;  1OGG A;  3WQV A;  4ODP A;  2O92 A;  4P8V A;  3GPK A;  3UI5 A;  5HBF A;  4IPX A;  4DRK A;  1C9H A;  2WM0 A;  2DT1 A;  2YBU A;  3O5P A;  3RM8 A;  3CH9 A;  1Q6H A;  4WKH A;  4HAR A;  3H9R B;  4Z2K A;  3UF8 A;  3ARW A;  1QPF A;  1J6Y A;  2Y78 A;  1J4I A;  3RGC A;  1W1V A;  4Z2L A;  3PR9 A;  4U85 A;  3CHF A;  3B9A A;  4NSB A;  5DO2 A;  2DSW A;  1FKL A;  1ZCN A;  2D9F A;  1HXV A;  1JNT A;  2KR7 A;  1WB0 A;  2LPV A;  2OFN A;  5B8I C;  5I98 A;  2JZV A;  5DF0 A;  3WD2 A;  1LJY A;  1JNE A;  1D6O A;  1GRJ A;  3G6L A;  3PRD A;  1W1Y A;  2VN1 A;  1Q1C A;  1W1T A;  1HKK A;  3WD0 A;  1FKG A;  4ZPW R;  2PV3 A;  1E15 A;  2AOS A;  4ML4 A;  2F23 A;  3KAC A;  2XP3 A;  4G50 A;  1P5Q A;  1J4H A;  1FKF A;  3ALG A;  4KQZ A;  3BMB A;  4MSP A;  1U79 A;  4P8W A;  2F21 A;  2XPA A;  3ARU A;  1GUV A;  3O5M A;  4HBE A;  4ODR A;  5HWB A;  4WKA A;  1TCO C;  3UI4 A;  2FAP A;  2DSU A;  4W9P A;  3GU0 A;  2MPH A;  1W1P A;  2OLH A;  3KAB A;  5HW6 A;  5J6E A;  1A7X A;  1FKT A;  2F4E A;  1E6P A;  1HKJ A;  4NNR A;  4MGV A;  3OA5 A;  2Q5A A;  3ARY A;  4MNL A;  3ALF A;  4L72 B;  1FKK A;  3JYJ A;  4LAX A;  2B31 A;  3WQW A;  2LKN A;  3O5J A;  1FKH A;  1FKR A;  4JFK A;  2ITK A;  4N19 A;  1OWQ A;  3ARQ A;  2DG9 A;  3CZ8 A;  3NTP A;  1FFR A;  2O9O A;  2QF8 A;  1HKI A;  4DT4 A;  4JFL A;  3IKD A;  2IF4 A;  3RFW A;  4JYS A;  1KT0 A;  4IT4 A;  4ODL A;  4MPK A;  2B5U B;  4MNJ A;  3KAD A;  1NWT A;  3KZ7 A;  4ODQ A;  3TC5 A;  3MDY B;  2PBC A;  1ZBW A;  2KFW A;  3PA7 A;  2DG4 A;  3B8S A;  4IQ2 A;  1D7H A;  1F8A B;  3UQI A;  4U86 A;  1FFQ A;  4ITZ A;  2FKE A;  3WH0 A;  2MLY A;  5DEZ A;  1NWU A;  4DWS A;  5GPG A;  3RM9 A;  3KAH A;  5HKG A;  1EQ3 A;  1LG2 A;  3WD4 A;  4L3N A;  3IKG A;  1W9P A;  1EDQ A;  2RQS A;  1ROU A;  3CHC A;  3QOK A;  1QPL A;  3ARR A;  5HW7 A;  2ESC A;  2DPE A;  1JVW A;  2A3A A;  1E6N A;  5DIU A;  4AY1 A;  1BKF A;  1FKI A;  1O6I A;  4URI A;  4DRO A;  2PPP A;  1X6N A;  4S3J A;  4WIW A;  1Q6I A;  2RSE A;  2VCD A;  1ZBV A;  1H0G A;  4TW8 A;  1E9L A;  5DIT A;  4Z2G A;  1JNS A;  2ZQU A;  4TX0 A;  1PIN A;  1LL6 A;  2LGO A;  1NMV A;  1ZL1 A;  2UZ5 A;  4ZPT R;  4ZPV R;  4LGX A;  4DZ2 A;  1D7J A;  2N87 A;  4JFI A;  2ZR6 A;  3TCZ A;  2ZR5 A;  3EY6 A;  1FD9 A;  2M2A A;  3IHZ A;  3W4R A;  1KT1 A;  2G8Z A;  4JFM A;  3UQA A;  2EUL A;  1ZK6 A;  4QT3 A;  3OOB A;  3WL1 A;  3B9E A;  4DWS B;  1NWS A;  1X6L A;  4KR0 B;  1YAT A;  3GTY X;  3WKZ A;  5HWC A;  1FJD A;  3CGN A;  4P8U A;  4W9Q A;  3O5D A;  4WKF A;  1TFV A;  2A3C A;  3ODK A;  3O5I A;  1E44 A;  1HJW A;  4J4N A;  2MNT A;  2ETN A;  2P4V A;  3CGM A;  4WJX A;  1VF8 A;  1W26 A;  4HBO A;  2RUR A;  3O5K A;  3O5E A;  4W5U A;  1KFW A;  4ODM A;  1Y0O A;  1B6C A;  3FXY A;  3ARS A;  4UDM A;  3WL0 A;  2ZR4 A;  3AS0 A;  4MNM A;  2XP4 A;  1NH6 A;  4ODO A;  2RUQ A;  1NSG A;  3G6M A;  1LQ0 A;  2M1I A;  4IQC A;  1NMW A;  1PBK A;  4DRQ A;  1JCH B;  1LL7 A;  1FKS A;  1RD6 A;  3KAI A;  3O5Q A;  1YW5 A;  2DG3 A;  3BXW A;  4MTV A;  4TNS A;  3O5R A;  2F2D A;  3ARV A;  4Q7N A;  3JXV A;  1J4R A;  2K8I A;  2XP8 A;  3B7X A;  2ZQV A;  4LAW A;  4NZC A;  2PI6 A;  4QIB A;  1GPF A;  1UR9 A;  2KE0 A;  3AS1 A;  4P8X A;  5HT1 A;  2A3B A;  1HKM A;  2MF9 A;  3KAG A;  3CHE A;  4W9O A;  2RUC A;  3JYM A;  2LJ4 A;  2M08 A;  4JFJ A;  1FKD A;  5GQB A;  1JND A;  1L1P A;  2KO7 A;  3ARO A;  2WLZ A;  2DSV A;  1LL4 A;  4S3K A;  1ROT A;  3WD3 A;  1ZU8 A;  1W9V A;  1ZBC A;  4DIP A;  5DIV A;  2ZQS A;  4DRM A;  1D2K A;  2XP9 A;  1FAP A;  4DZ3 A;  5HUA A;  1EYM A;  1HJX A;  4ODN A;  1FKJ A;  3ARX A;  4LAV A;  2PV1 A;  1XRV A;  4DRJ A; 
#chains in the Genus database with same CATH homology
 2B5U B;  1JCH B;  1E44 A;  3EIP A;  4UDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...