4UDMA

Crystal structure of im3 in complex with y52a mutant of e3rnase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-E3 IMMUNITY PROTEIN
publication title Consequences of Inducing Intrinsic Disorder in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Translation
total genus 21
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 4udmA00
2B5UB 4UDMA 1E44A 3EIPA 1JCHB
chains in the Genus database with same CATH superfamily
2YBTA 3B9EA 4URIA 2XP4A 4IT6A 2L2SA 5DITA 4KQZA 3KAHA 3O5EA 3UF8A 1GOIA 4BF8A 1B6CA 1T11A 4KR0B 3JYJA 1J4RA 1GUVA 1ZBKA 5DIVA 4NNRA 2KI3A 1W1VA 1E6ZA 2PPPA 3G6LA 3WQVA 2VCDA 4QZVB 2RURA 2WK2A 3W4RA 3WD2A 1D2KA 2EULA 3O5IA 1NWUA 2FDMA 1FJDA 1NWSA 1ZBCA 3UI4A 5JH8A 1U79A 2A3BA 2ZR5A 1LG1A 1FKJA 3RGCA 2M1IA 5HW6A 5D75A 3PRAA 2KO7A 4G2PA 4LAYA 5HT1A 1HJWA 1NWRA 3CHFA 3KAIA 4N19A 1XHGA 1VF8A 2RUCA 1OGGA 1FKSA 4ODLA 4ODNA 3UI6A 3AS2A 2DG9A 4W9OA 5DO2A 2F23A 3O5JA 1OWQA 2IF4A 4QT3A 3O5KA 5HWCA 1QPFA 3FY1A 2K8IA 2WLYA 1QPLA 2XPAA 1ZCNA 1EIBA 1Q6IA 4JFMA 4L72B 1EYMA 2XP5A 1IX5A 1LL7A 1E15A 1SYTA 2DPEA 5HUAA 3QOKA 1JNDA 3O5LA 2MLXA 2PV2A 5DIUA 3O5FA 1CTNA 4Z2LA 1ROUA 2FKEA 3JYMA 4WKFA 5DEZA 2DSWA 1FAPA 1X6NA 2F2DA 3VAWA 5BXJA 1A7XA 1FFQA 1KT1A 1HJXA 1FKBA 1EDQA 1BL4A 2OLHA 3AS1A 3KADA 4QIBA 2N87A 4JYSA 2ZR4A 4GGQA 4R0XA 1E6NA 4P8VA 3PA7A 3WKZA 1W9UA 4LAVA 3KAGA 3EIPA 4MSPA 4ODRA 3FAPA 2QF8A 2LGOA 4DZ3A 1C9HA 2LJ4A 1W26A 2ETNA 1RD6A 3JXVA 1PBKA 4PTMA 3ARPA 3KAFA 4ITZA 4DRKA 5J6EA 1Q1CA 1ZBVA 3UQIA 1ZU8A 3WL1A 4FAPA 2D9FA 2DSUA 1O6IA 4DRMA 4MNJA 2A3EA 4ODOA 5HW7A 1W9PA 4GIVA 3I6CA 1EQ3A 2UZ5A 2O9OA 1FKTA 1WNOA 2RUDA 4FN2A 1GRJA 5HBFA 3KABA 4WJXA 3EY6A 4ZPTR 4DRPA 1NH6A 5HW8A 3AROA 4IPXA 1W1YA 1ZBWA 4NSBA 1J4IA 2DG3A 1D7JA 1FKDA 4TYOA 2KGJA 3B7XA 3WH0A 1SR0A 3IKGA 3WD0A 2MLYA 5HTGA 3GU0A 4DRIA 3ARXA 1FKLA 4ZS6A 1ROTA 4DWSA 1TCOC 2MNTA 1J4HA 2KR7A 4WIWA 3OOBA 4ODMA 2JZVA 3ODKA 4L3NA 2B5UB 1P5QA 1FKFA 4XAKA 4DH0A 1FKKA 4ODKA 5GQBA 4WKHA 2ZQVA 4P8UA 3FXYA 2AOSA 3TDBA 2A3AA 1WB0A 3ARWA 1HKIA 3ARYA 2YBUA 1FKIA 3LUOA 2Y78A 4DRNA 2ZQTA 3O5QA 5HWBA 3O5DA 1D7HA 2ZR6A 2IUZA 4DWSC 4Z2KA 2G41A 1UR8A 4W9QA 2PV1A 1KT0A 3AQUA 1ZL1A 1D7IA 3GTYX 4UDMA 1HXVA 1X6LA 2DT0A 1LL4A 2RQSA 1F8AB 4MGVA 4U85A 3WD4A 2F4EA 2MPHA 4W5UA 2PBCA 3GPKA 1FKGA 2LPVA 4TW6A 4JFIA 3KCEA 1JVWA 4S3KA 4U86A 2G8ZA 4ODQA 4J4NA 3OA5A 4IQCA 3NTPA 1WAWA 1W9VA 1E9LA 3CH9A 1NMWA 2XP9A 2MF9A 2XP7A 2DG4A 3CGMA 3RFWA 4AY1A 1NWTA 3CZ8A 2F21A 4C02B 1W1TA 4P8WA 3IKDA 4Z2IA 2XPBA 4TW8A 3B8SA 3WL0A 1M5YA 4LGXA 3RM9A 2M2AA 1EHNA 1NSGA 4IT4A 4DROA 4MTVA 1JNTA 1W1PA 1H0GA 1E44A 3IHZA 2PI6A 4O2TA 1ITXA 2KFWA 4R5EA 4DWSB 2DT1A 2P4VA 5I98A 5HKGA 1K9TA 3WD3A 1L1PA 1LQ0A 2XP6A 1UR9A 1H0IA 2Q5AA 5DF0A 1ZK6A 3UQBA 3BMBA 4HBEA 3UI5A 4DRQA 3TC5A 2RSEA 2PPOA 2O92A 3ARTA 4JFKA 3RM8A 3ARQA 1JNEA 4TX0A 1XRVA 1Q6HA 4W9PA 4WK9A 2DSVA 4LAWA 2XP8A 4Z2GA 1HJVA 3O5GA 4JFJA 1KFWA 4DT4A 1HKKA 1YW5A 2ZQSA 3WIJA 3AS0A 3CHDA 2DSZA 2PPNA 5GPRA 2ZQUA 1Q6UA 2WM0A 2PN0A 3ARRA 2LKNA 4HARA 2M08A 3RMEA 4Z2JA 4Q22A 5B8IC 1J6YA 2MLZA 1LL6A 4Z2HA 1LJYA 1FKRA 4P8XA 4DZ2A 1FFRA 3CGNA 1TFVA 3ARSA 2DT3A 4MPKA 4DWSD 3NI6A 3O5OA 4U84A 3KACA 5GPGA 1LG2A 2AWGA 1YATA 3PRBA 2WLZA 3PRDA 4LAXA 2A3CA 2XP3A 3WQWA 1Y0OA 4J4OA 3TCZA 1FD9A 4S3JA 3RM4A 3MDYB 3ARVA 3BXWA 4MNLA 3G6MA 4ODPA 2B31A 3O5MA 3ARUA 1E6RA 3ARZA 4ML4A 1FKHA 4QT2A 4MNKA 1JCHB 2ITKA 3AS3A 2FAPA 1GPFA 3IK8A 4G50A 1JNSA 4Q7NA 4MAVA 2DT2A 1HKJA 3B9AA 4MNMA 4WKAA 4DRHA 2RUQA 4JFLA 4TW7A 3PR9A 3WD1A 3NRKA 3KZ7A 1D6OA 2ESCA 3UQAA 1QZ2A 3CHEA 3B9DA 1OGBA 2PV3A 4TNSA 1HKMA 2VN1A 4IQ2A 2KE0A 4HBOA 4ZPWR 1BKFA 3O5RA 4ZPVR 3O5PA 1E6PA 4NZCA 4DRJA 3H9RB 1PINA 1ZB5A 2OFNA 1N1AA 4DIPA 3ALGA 1NMVA 1R9HA 1F40A 3CHCA 3ALFA
chains in the Genus database with same CATH topology
2B5UB 4UDMA 1E44A 3EIPA 1JCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5U B;  4UDM A;  1E44 A;  3EIP A;  1JCH B; 
#chains in the Genus database with same CATH topology
 2YBT A;  3B9E A;  4URI A;  2XP4 A;  4IT6 A;  2L2S A;  5DIT A;  4KQZ A;  3KAH A;  3O5E A;  3UF8 A;  1GOI A;  4BF8 A;  1B6C A;  1T11 A;  4KR0 B;  3JYJ A;  1J4R A;  1GUV A;  1ZBK A;  5DIV A;  4NNR A;  2KI3 A;  1W1V A;  1E6Z A;  2PPP A;  3G6L A;  3WQV A;  2VCD A;  4QZV B;  2RUR A;  2WK2 A;  3W4R A;  3WD2 A;  1D2K A;  2EUL A;  3O5I A;  1NWU A;  2FDM A;  1FJD A;  1NWS A;  1ZBC A;  3UI4 A;  5JH8 A;  1U79 A;  2A3B A;  2ZR5 A;  1LG1 A;  1FKJ A;  3RGC A;  2M1I A;  5HW6 A;  5D75 A;  3PRA A;  2KO7 A;  4G2P A;  4LAY A;  5HT1 A;  1HJW A;  1NWR A;  3CHF A;  3KAI A;  4N19 A;  1XHG A;  1VF8 A;  2RUC A;  1OGG A;  1FKS A;  4ODL A;  4ODN A;  3UI6 A;  3AS2 A;  2DG9 A;  4W9O A;  5DO2 A;  2F23 A;  3O5J A;  1OWQ A;  2IF4 A;  4QT3 A;  3O5K A;  5HWC A;  1QPF A;  3FY1 A;  2K8I A;  2WLY A;  1QPL A;  2XPA A;  1ZCN A;  1EIB A;  1Q6I A;  4JFM A;  4L72 B;  1EYM A;  2XP5 A;  1IX5 A;  1LL7 A;  1E15 A;  1SYT A;  2DPE A;  5HUA A;  3QOK A;  1JND A;  3O5L A;  2MLX A;  2PV2 A;  5DIU A;  3O5F A;  1CTN A;  4Z2L A;  1ROU A;  2FKE A;  3JYM A;  4WKF A;  5DEZ A;  2DSW A;  1FAP A;  1X6N A;  2F2D A;  3VAW A;  5BXJ A;  1A7X A;  1FFQ A;  1KT1 A;  1HJX A;  1FKB A;  1EDQ A;  1BL4 A;  2OLH A;  3AS1 A;  3KAD A;  4QIB A;  2N87 A;  4JYS A;  2ZR4 A;  4GGQ A;  4R0X A;  1E6N A;  4P8V A;  3PA7 A;  3WKZ A;  1W9U A;  4LAV A;  3KAG A;  3EIP A;  4MSP A;  4ODR A;  3FAP A;  2QF8 A;  2LGO A;  4DZ3 A;  1C9H A;  2LJ4 A;  1W26 A;  2ETN A;  1RD6 A;  3JXV A;  1PBK A;  4PTM A;  3ARP A;  3KAF A;  4ITZ A;  4DRK A;  5J6E A;  1Q1C A;  1ZBV A;  3UQI A;  1ZU8 A;  3WL1 A;  4FAP A;  2D9F A;  2DSU A;  1O6I A;  4DRM A;  4MNJ A;  2A3E A;  4ODO A;  5HW7 A;  1W9P A;  4GIV A;  3I6C A;  1EQ3 A;  2UZ5 A;  2O9O A;  1FKT A;  1WNO A;  2RUD A;  4FN2 A;  1GRJ A;  5HBF A;  3KAB A;  4WJX A;  3EY6 A;  4ZPT R;  4DRP A;  1NH6 A;  5HW8 A;  3ARO A;  4IPX A;  1W1Y A;  1ZBW A;  4NSB A;  1J4I A;  2DG3 A;  1D7J A;  1FKD A;  4TYO A;  2KGJ A;  3B7X A;  3WH0 A;  1SR0 A;  3IKG A;  3WD0 A;  2MLY A;  5HTG A;  3GU0 A;  4DRI A;  3ARX A;  1FKL A;  4ZS6 A;  1ROT A;  4DWS A;  1TCO C;  2MNT A;  1J4H A;  2KR7 A;  4WIW A;  3OOB A;  4ODM A;  2JZV A;  3ODK A;  4L3N A;  2B5U B;  1P5Q A;  1FKF A;  4XAK A;  4DH0 A;  1FKK A;  4ODK A;  5GQB A;  4WKH A;  2ZQV A;  4P8U A;  3FXY A;  2AOS A;  3TDB A;  2A3A A;  1WB0 A;  3ARW A;  1HKI A;  3ARY A;  2YBU A;  1FKI A;  3LUO A;  2Y78 A;  4DRN A;  2ZQT A;  3O5Q A;  5HWB A;  3O5D A;  1D7H A;  2ZR6 A;  2IUZ A;  4DWS C;  4Z2K A;  2G41 A;  1UR8 A;  4W9Q A;  2PV1 A;  1KT0 A;  3AQU A;  1ZL1 A;  1D7I A;  3GTY X;  4UDM A;  1HXV A;  1X6L A;  2DT0 A;  1LL4 A;  2RQS A;  1F8A B;  4MGV A;  4U85 A;  3WD4 A;  2F4E A;  2MPH A;  4W5U A;  2PBC A;  3GPK A;  1FKG A;  2LPV A;  4TW6 A;  4JFI A;  3KCE A;  1JVW A;  4S3K A;  4U86 A;  2G8Z A;  4ODQ A;  4J4N A;  3OA5 A;  4IQC A;  3NTP A;  1WAW A;  1W9V A;  1E9L A;  3CH9 A;  1NMW A;  2XP9 A;  2MF9 A;  2XP7 A;  2DG4 A;  3CGM A;  3RFW A;  4AY1 A;  1NWT A;  3CZ8 A;  2F21 A;  4C02 B;  1W1T A;  4P8W A;  3IKD A;  4Z2I A;  2XPB A;  4TW8 A;  3B8S A;  3WL0 A;  1M5Y A;  4LGX A;  3RM9 A;  2M2A A;  1EHN A;  1NSG A;  4IT4 A;  4DRO A;  4MTV A;  1JNT A;  1W1P A;  1H0G A;  1E44 A;  3IHZ A;  2PI6 A;  4O2T A;  1ITX A;  2KFW A;  4R5E A;  4DWS B;  2DT1 A;  2P4V A;  5I98 A;  5HKG A;  1K9T A;  3WD3 A;  1L1P A;  1LQ0 A;  2XP6 A;  1UR9 A;  1H0I A;  2Q5A A;  5DF0 A;  1ZK6 A;  3UQB A;  3BMB A;  4HBE A;  3UI5 A;  4DRQ A;  3TC5 A;  2RSE A;  2PPO A;  2O92 A;  3ART A;  4JFK A;  3RM8 A;  3ARQ A;  1JNE A;  4TX0 A;  1XRV A;  1Q6H A;  4W9P A;  4WK9 A;  2DSV A;  4LAW A;  2XP8 A;  4Z2G A;  1HJV A;  3O5G A;  4JFJ A;  1KFW A;  4DT4 A;  1HKK A;  1YW5 A;  2ZQS A;  3WIJ A;  3AS0 A;  3CHD A;  2DSZ A;  2PPN A;  5GPR A;  2ZQU A;  1Q6U A;  2WM0 A;  2PN0 A;  3ARR A;  2LKN A;  4HAR A;  2M08 A;  3RME A;  4Z2J A;  4Q22 A;  5B8I C;  1J6Y A;  2MLZ A;  1LL6 A;  4Z2H A;  1LJY A;  1FKR A;  4P8X A;  4DZ2 A;  1FFR A;  3CGN A;  1TFV A;  3ARS A;  2DT3 A;  4MPK A;  4DWS D;  3NI6 A;  3O5O A;  4U84 A;  3KAC A;  5GPG A;  1LG2 A;  2AWG A;  1YAT A;  3PRB A;  2WLZ A;  3PRD A;  4LAX A;  2A3C A;  2XP3 A;  3WQW A;  1Y0O A;  4J4O A;  3TCZ A;  1FD9 A;  4S3J A;  3RM4 A;  3MDY B;  3ARV A;  3BXW A;  4MNL A;  3G6M A;  4ODP A;  2B31 A;  3O5M A;  3ARU A;  1E6R A;  3ARZ A;  4ML4 A;  1FKH A;  4QT2 A;  4MNK A;  1JCH B;  2ITK A;  3AS3 A;  2FAP A;  1GPF A;  3IK8 A;  4G50 A;  1JNS A;  4Q7N A;  4MAV A;  2DT2 A;  1HKJ A;  3B9A A;  4MNM A;  4WKA A;  4DRH A;  2RUQ A;  4JFL A;  4TW7 A;  3PR9 A;  3WD1 A;  3NRK A;  3KZ7 A;  1D6O A;  2ESC A;  3UQA A;  1QZ2 A;  3CHE A;  3B9D A;  1OGB A;  2PV3 A;  4TNS A;  1HKM A;  2VN1 A;  4IQ2 A;  2KE0 A;  4HBO A;  4ZPW R;  1BKF A;  3O5R A;  4ZPV R;  3O5P A;  1E6P A;  4NZC A;  4DRJ A;  3H9R B;  1PIN A;  1ZB5 A;  2OFN A;  1N1A A;  4DIP A;  3ALG A;  1NMV A;  1R9H A;  1F40 A;  3CHC A;  3ALF A; 
#chains in the Genus database with same CATH homology
 2B5U B;  4UDM A;  1E44 A;  3EIP A;  1JCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...