4UDMA

Crystal structure of im3 in complex with y52a mutant of e3rnase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Consequences of Inducing Intrinsic Disorder in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Translation
molecule keywords COLICIN-E3 IMMUNITY PROTEIN
total genus 21
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 4udmA00
2B5UB 3EIPA 1E44A 4UDMA 1JCHB
chains in the Genus database with same CATH superfamily
3UQIA 2XP4A 2MF9A 3ARSA 4MPKA 4Q7NA 2PN0A 4WIWA 2O9OA 3TDBA 4MGVA 3WD0A 3O5JA 2DSWA 5GQBA 1ZBKA 4DT4A 1XHGA 4DRNA 2ZQUA 1NMVA 1ZBVA 1L1PA 3ARXA 5HWBA 4ODQA 4KR0B 2N87A 1D7IA 1HKJA 3RM8A 1FFQA 2RUDA 4P8WA 5HW6A 3JYJA 3JXVA 1JNEA 4LAXA 4MTVA 3RMEA 1FKIA 1WB0A 2DPEA 2OFNA 3ARYA 1D2KA 1GRJA 3WL1A 3WKZA 4DRHA 2LKNA 3CGNA 1JNTA 1GUVA 1XRVA 4ODOA 4DRPA 1A7XA 1W1PA 4MAVA 4DRJA 1W9PA 2ZR4A 1ZCNA 3GPKA 1LG2A 1H0IA 1FKBA 2B31A 4TW8A 4ZS6A 1O6IA 2M1IA 3O5PA 2DSUA 1HKKA 4S3JA 1FKSA 1W1VA 1QZ2A 1CTNA 1FKDA 1W9UA 2DT0A 1GPFA 2MNTA 2PV3A 2DSVA 1ZU8A 3KAFA 2B5UB 1K9TA 3WQVA 1HXVA 2OLHA 4L72B 1EYMA 3KADA 4JYSA 3VAWA 2YBUA 2K8IA 3ALGA 2PV2A 1NMWA 3KAGA 1EDQA 2QF8A 1YATA 1KT1A 2PBCA 4DRMA 2P4VA 1PBKA 3WD2A 3ARPA 4JFKA 3B9DA 2F2DA 4ODRA 2ITKA 2RQSA 1E6RA 2G41A 4NZCA 3WD1A 1EIBA 4KQZA 2PPOA 3B8SA 5BXJA 4HBEA 4MNMA 4MNLA 2XP6A 1NWSA 3AS0A 2F21A 2WLYA 1Q6IA 1E6NA 1FKFA 2UZ5A 1P5QA 1J4RA 2A3EA 4QT2A 1W1YA 2YBTA 2LJ4A 4MSPA 4L3NA 4ITZA 4IT4A 1TFVA 4WKAA 1JCHB 2DG9A 3FXYA 3PA7A 1E6ZA 4JFIA 3RGCA 3WD3A 4ODNA 4J4OA 2PV1A 2XP7A 1QPLA 4W5UA 4S3KA 2PPPA 1T11A 3QOKA 3OOBA 1FKHA 2XP8A 1JNSA 4TX0A 4DH0A 1J4HA 2XP3A 2XP9A 3BXWA 4JFJA 4DRIA 2AOSA 1EHNA 1FD9A 4QT3A 1UR8A 1ZK6A 4DIPA 1ROTA 1OGBA 2DG4A 4R0XA 3G6MA 3O5KA 3TCZA 4URIA 2JZVA 2XPBA 2KO7A 5HT1A 2A3CA 3KABA 3ARTA 1LL7A 1VF8A 2LPVA 2ZQVA 3O5LA 1OGGA 4LAVA 2ZR5A 4G2PA 2LGOA 2KGJA 1FKKA 2A3BA 4DWSD 3O5IA 4HBOA 4QIBA 1ZB5A 4DRKA 3O5MA 1W1TA 2O92A 3UI6A 2DT2A 1Q1CA 2DT1A 3MDYB 1NWRA 2FKEA 4WKHA 5HW7A 5GPRA 4TNSA 3KAHA 1UR9A 4Z2LA 1N1AA 1FKLA 1KFWA 2FAPA 1YW5A 1R9HA 2M08A 4MNKA 2DSZA 4Z2HA 3NI6A 5DEZA 3WIJA 1D7HA 2VN1A 3EIPA 3WD4A 4Z2JA 3G6LA 4IPXA 4MNJA 4TW7A 4TW6A 5GPGA 2KFWA 1HJXA 2RSEA 5HUAA 3CGMA 2DG3A 1M5YA 2ESCA 4WK9A 5JH8A 1HJVA 4U84A 3CHCA 1SYTA 4ZPWR 2AWGA 3AROA 4U85A 2VCDA 3H9RB 2Q5AA 3PRBA 2ZQSA 1E6PA 3ARQA 3ARUA 1FKTA 3ALFA 4LGXA 1Y0OA 1F40A 1J6YA 1FAPA 5I98A 5HKGA 3AS3A 4ODPA 1JNDA 3KAIA 4W9OA 3UI5A 1W26A 1LL4A 3GTYX 2WK2A 3WL0A 5HBFA 4AY1A 1ZBCA 4Z2GA 1NSGA 3NTPA 3UI4A 1ZBWA 4P8XA 3ARZA 1HKMA 2PPNA 2Y78A 4W9QA 2MPHA 1OWQA 3JYMA 4J4NA 4XAKA 2RURA 3RM4A 4HARA 3KZ7A 3AS1A 4P8VA 1C9HA 4PTMA 1E44A 4LAWA 4R5EA 1LJYA 2KI3A 3BMBA 4NNRA 1WAWA 1EQ3A 4ML4A 1FKRA 4ODMA 3PRAA 5HWCA 2G8ZA 4JFMA 1KT0A 1NWTA 1FJDA 1HKIA 4GIVA 2MLXA 3KACA 2KE0A 5DO2A 4DZ3A 2MLYA 2ETNA 3AQUA 4DROA 1FFRA 1NH6A 3CHDA 4DWSC 3ARWA 4UDMA 1SR0A 1WNOA 4GGQA 3FAPA 4QZVB 1LG1A 2IF4A 3GU0A 3O5DA 4DWSB 5DITA 3FY1A 1HJWA 4LAYA 5B8IC 3RM9A 3ODKA 3CHEA 3IK8A 5DIVA 1RD6A 3PR9A 3RFWA 2L2SA 1IX5A 2D9FA 1D7JA 4N19A 2IUZA 3O5GA 4C02B 3UF8A 2MLZA 2WLZA 2KR7A 4ZPTR 3W4RA 4FN2A 2RUQA 5J6EA 1LQ0A 4Z2IA 2XP5A 1PINA 1FKGA 4U86A 3IHZA 4W9PA 3OA5A 3TC5A 3ARRA 3O5FA 1X6NA 1ZL1A 2A3AA 4BF8A 1LL6A 5HTGA 3PRDA 3B9EA 4JFLA 4IQCA 3IKDA 3CH9A 1ITXA 1Q6UA 4IT6A 1W9VA 3AS2A 1F8AB 4DZ2A 3UQAA 1U79A 1GOIA 3CZ8A 5DIUA 3O5EA 2F23A 2M2AA 4Q22A 2DT3A 1D6OA 4IQ2A 2ZQTA 4G50A 1TCOC 2PI6A 3ARVA 5DF0A 4O2TA 1Q6HA 2FDMA 3B7XA 4ODLA 3CHFA 3KCEA 4ZPVR 1E15A 3NRKA 4P8UA 1H0GA 2F4EA 3LUOA 3WQWA 4Z2KA 4DRQA 2WM0A 3I6CA 3O5RA 1JVWA 1QPFA 3EY6A 3WH0A 5HW8A 2RUCA 3O5OA 1B6CA 4WJXA 1BKFA 1E9LA 1ROUA 4NSBA 4WKFA 3O5QA 4FAPA 3B9AA 3UQBA 1J4IA 4ODKA 4DWSA 2EULA 5D75A 1FKJA 1X6LA 1BL4A 4TYOA 3IKGA 2XPAA 1NWUA 2ZR6A
chains in the Genus database with same CATH topology
2B5UB 3EIPA 1E44A 4UDMA 1JCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5U B;  3EIP A;  1E44 A;  4UDM A;  1JCH B; 
#chains in the Genus database with same CATH topology
 3UQI A;  2XP4 A;  2MF9 A;  3ARS A;  4MPK A;  4Q7N A;  2PN0 A;  4WIW A;  2O9O A;  3TDB A;  4MGV A;  3WD0 A;  3O5J A;  2DSW A;  5GQB A;  1ZBK A;  4DT4 A;  1XHG A;  4DRN A;  2ZQU A;  1NMV A;  1ZBV A;  1L1P A;  3ARX A;  5HWB A;  4ODQ A;  4KR0 B;  2N87 A;  1D7I A;  1HKJ A;  3RM8 A;  1FFQ A;  2RUD A;  4P8W A;  5HW6 A;  3JYJ A;  3JXV A;  1JNE A;  4LAX A;  4MTV A;  3RME A;  1FKI A;  1WB0 A;  2DPE A;  2OFN A;  3ARY A;  1D2K A;  1GRJ A;  3WL1 A;  3WKZ A;  4DRH A;  2LKN A;  3CGN A;  1JNT A;  1GUV A;  1XRV A;  4ODO A;  4DRP A;  1A7X A;  1W1P A;  4MAV A;  4DRJ A;  1W9P A;  2ZR4 A;  1ZCN A;  3GPK A;  1LG2 A;  1H0I A;  1FKB A;  2B31 A;  4TW8 A;  4ZS6 A;  1O6I A;  2M1I A;  3O5P A;  2DSU A;  1HKK A;  4S3J A;  1FKS A;  1W1V A;  1QZ2 A;  1CTN A;  1FKD A;  1W9U A;  2DT0 A;  1GPF A;  2MNT A;  2PV3 A;  2DSV A;  1ZU8 A;  3KAF A;  2B5U B;  1K9T A;  3WQV A;  1HXV A;  2OLH A;  4L72 B;  1EYM A;  3KAD A;  4JYS A;  3VAW A;  2YBU A;  2K8I A;  3ALG A;  2PV2 A;  1NMW A;  3KAG A;  1EDQ A;  2QF8 A;  1YAT A;  1KT1 A;  2PBC A;  4DRM A;  2P4V A;  1PBK A;  3WD2 A;  3ARP A;  4JFK A;  3B9D A;  2F2D A;  4ODR A;  2ITK A;  2RQS A;  1E6R A;  2G41 A;  4NZC A;  3WD1 A;  1EIB A;  4KQZ A;  2PPO A;  3B8S A;  5BXJ A;  4HBE A;  4MNM A;  4MNL A;  2XP6 A;  1NWS A;  3AS0 A;  2F21 A;  2WLY A;  1Q6I A;  1E6N A;  1FKF A;  2UZ5 A;  1P5Q A;  1J4R A;  2A3E A;  4QT2 A;  1W1Y A;  2YBT A;  2LJ4 A;  4MSP A;  4L3N A;  4ITZ A;  4IT4 A;  1TFV A;  4WKA A;  1JCH B;  2DG9 A;  3FXY A;  3PA7 A;  1E6Z A;  4JFI A;  3RGC A;  3WD3 A;  4ODN A;  4J4O A;  2PV1 A;  2XP7 A;  1QPL A;  4W5U A;  4S3K A;  2PPP A;  1T11 A;  3QOK A;  3OOB A;  1FKH A;  2XP8 A;  1JNS A;  4TX0 A;  4DH0 A;  1J4H A;  2XP3 A;  2XP9 A;  3BXW A;  4JFJ A;  4DRI A;  2AOS A;  1EHN A;  1FD9 A;  4QT3 A;  1UR8 A;  1ZK6 A;  4DIP A;  1ROT A;  1OGB A;  2DG4 A;  4R0X A;  3G6M A;  3O5K A;  3TCZ A;  4URI A;  2JZV A;  2XPB A;  2KO7 A;  5HT1 A;  2A3C A;  3KAB A;  3ART A;  1LL7 A;  1VF8 A;  2LPV A;  2ZQV A;  3O5L A;  1OGG A;  4LAV A;  2ZR5 A;  4G2P A;  2LGO A;  2KGJ A;  1FKK A;  2A3B A;  4DWS D;  3O5I A;  4HBO A;  4QIB A;  1ZB5 A;  4DRK A;  3O5M A;  1W1T A;  2O92 A;  3UI6 A;  2DT2 A;  1Q1C A;  2DT1 A;  3MDY B;  1NWR A;  2FKE A;  4WKH A;  5HW7 A;  5GPR A;  4TNS A;  3KAH A;  1UR9 A;  4Z2L A;  1N1A A;  1FKL A;  1KFW A;  2FAP A;  1YW5 A;  1R9H A;  2M08 A;  4MNK A;  2DSZ A;  4Z2H A;  3NI6 A;  5DEZ A;  3WIJ A;  1D7H A;  2VN1 A;  3EIP A;  3WD4 A;  4Z2J A;  3G6L A;  4IPX A;  4MNJ A;  4TW7 A;  4TW6 A;  5GPG A;  2KFW A;  1HJX A;  2RSE A;  5HUA A;  3CGM A;  2DG3 A;  1M5Y A;  2ESC A;  4WK9 A;  5JH8 A;  1HJV A;  4U84 A;  3CHC A;  1SYT A;  4ZPW R;  2AWG A;  3ARO A;  4U85 A;  2VCD A;  3H9R B;  2Q5A A;  3PRB A;  2ZQS A;  1E6P A;  3ARQ A;  3ARU A;  1FKT A;  3ALF A;  4LGX A;  1Y0O A;  1F40 A;  1J6Y A;  1FAP A;  5I98 A;  5HKG A;  3AS3 A;  4ODP A;  1JND A;  3KAI A;  4W9O A;  3UI5 A;  1W26 A;  1LL4 A;  3GTY X;  2WK2 A;  3WL0 A;  5HBF A;  4AY1 A;  1ZBC A;  4Z2G A;  1NSG A;  3NTP A;  3UI4 A;  1ZBW A;  4P8X A;  3ARZ A;  1HKM A;  2PPN A;  2Y78 A;  4W9Q A;  2MPH A;  1OWQ A;  3JYM A;  4J4N A;  4XAK A;  2RUR A;  3RM4 A;  4HAR A;  3KZ7 A;  3AS1 A;  4P8V A;  1C9H A;  4PTM A;  1E44 A;  4LAW A;  4R5E A;  1LJY A;  2KI3 A;  3BMB A;  4NNR A;  1WAW A;  1EQ3 A;  4ML4 A;  1FKR A;  4ODM A;  3PRA A;  5HWC A;  2G8Z A;  4JFM A;  1KT0 A;  1NWT A;  1FJD A;  1HKI A;  4GIV A;  2MLX A;  3KAC A;  2KE0 A;  5DO2 A;  4DZ3 A;  2MLY A;  2ETN A;  3AQU A;  4DRO A;  1FFR A;  1NH6 A;  3CHD A;  4DWS C;  3ARW A;  4UDM A;  1SR0 A;  1WNO A;  4GGQ A;  3FAP A;  4QZV B;  1LG1 A;  2IF4 A;  3GU0 A;  3O5D A;  4DWS B;  5DIT A;  3FY1 A;  1HJW A;  4LAY A;  5B8I C;  3RM9 A;  3ODK A;  3CHE A;  3IK8 A;  5DIV A;  1RD6 A;  3PR9 A;  3RFW A;  2L2S A;  1IX5 A;  2D9F A;  1D7J A;  4N19 A;  2IUZ A;  3O5G A;  4C02 B;  3UF8 A;  2MLZ A;  2WLZ A;  2KR7 A;  4ZPT R;  3W4R A;  4FN2 A;  2RUQ A;  5J6E A;  1LQ0 A;  4Z2I A;  2XP5 A;  1PIN A;  1FKG A;  4U86 A;  3IHZ A;  4W9P A;  3OA5 A;  3TC5 A;  3ARR A;  3O5F A;  1X6N A;  1ZL1 A;  2A3A A;  4BF8 A;  1LL6 A;  5HTG A;  3PRD A;  3B9E A;  4JFL A;  4IQC A;  3IKD A;  3CH9 A;  1ITX A;  1Q6U A;  4IT6 A;  1W9V A;  3AS2 A;  1F8A B;  4DZ2 A;  3UQA A;  1U79 A;  1GOI A;  3CZ8 A;  5DIU A;  3O5E A;  2F23 A;  2M2A A;  4Q22 A;  2DT3 A;  1D6O A;  4IQ2 A;  2ZQT A;  4G50 A;  1TCO C;  2PI6 A;  3ARV A;  5DF0 A;  4O2T A;  1Q6H A;  2FDM A;  3B7X A;  4ODL A;  3CHF A;  3KCE A;  4ZPV R;  1E15 A;  3NRK A;  4P8U A;  1H0G A;  2F4E A;  3LUO A;  3WQW A;  4Z2K A;  4DRQ A;  2WM0 A;  3I6C A;  3O5R A;  1JVW A;  1QPF A;  3EY6 A;  3WH0 A;  5HW8 A;  2RUC A;  3O5O A;  1B6C A;  4WJX A;  1BKF A;  1E9L A;  1ROU A;  4NSB A;  4WKF A;  3O5Q A;  4FAP A;  3B9A A;  3UQB A;  1J4I A;  4ODK A;  4DWS A;  2EUL A;  5D75 A;  1FKJ A;  1X6L A;  1BL4 A;  4TYO A;  3IKG A;  2XPA A;  1NWU A;  2ZR6 A; 
#chains in the Genus database with same CATH homology
 2B5U B;  3EIP A;  1E44 A;  4UDM A;  1JCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...