4UDMA

Crystal structure of im3 in complex with y52a mutant of e3rnase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Consequences of Inducing Intrinsic Disorder in a High-Affinity Protein-Protein Interaction.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Translation
molecule keywords COLICIN-E3 IMMUNITY PROTEIN
total genus 21
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 4udmA00
1E44A 4UDMA 2B5UB 1JCHB 3EIPA
chains in the Genus database with same CATH superfamily
3AROA 3WH0A 3B9EA 5HBFA 2A3BA 1PINA 1Q6HA 2LPVA 1OGBA 4DRPA 3TCZA 2MLXA 3CZ8A 4NZCA 2KR7A 2RSEA 3O5PA 4O2TA 1E6ZA 3ARTA 1SYTA 1ZU8A 1W1TA 1FKFA 3W4RA 1UR9A 4BF8A 1M5YA 2DG4A 4LGXA 4MNKA 1KFWA 2ESCA 1ZBWA 1T11A 1HKMA 1FKKA 2OLHA 4P8XA 4C02B 1QZ2A 3KCEA 3RM9A 2PV2A 1W9UA 2XP4A 3OA5A 3TC5A 4JFMA 3CHDA 3UI4A 1KT0A 4L3NA 3WQVA 1W1VA 5BXJA 2RQSA 2F21A 3BMBA 4ODKA 4JFJA 1RD6A 4TW6A 1HXVA 4MGVA 4ODLA 1IX5A 1J6YA 2O9OA 3AS3A 5HKGA 3JYMA 1E6NA 4DZ3A 1BKFA 4LAXA 4ODNA 1D7HA 5HTGA 1D7IA 1HKJA 1ZCNA 2RUQA 2VN1A 3ARXA 5D75A 1W1PA 1B6CA 2YBTA 1YW5A 1FAPA 3WD2A 4MNMA 3ARYA 2PPOA 2OFNA 1FKJA 4IQCA 3O5MA 4R0XA 3WL1A 2DPEA 2B31A 2DSZA 3ALGA 1N1AA 3UQAA 1A7XA 1EDQA 2A3EA 3AS1A 3OOBA 3EIPA 1SR0A 3WD1A 1NWSA 2DT0A 2PBCA 1FKTA 5JH8A 3O5QA 1LJYA 1J4RA 4Z2HA 2ZQUA 1X6LA 3PRDA 2DT3A 1Q1CA 4MSPA 1R9HA 4ML4A 3AS2A 1NWTA 2WLYA 3CGMA 4AY1A 1W9VA 2MPHA 4DT4A 1HJXA 1CTNA 5HW6A 1FJDA 1E44A 4TNSA 3ARZA 2KE0A 1WB0A 3EY6A 4IQ2A 4DWSA 3WQWA 2F2DA 1ZBVA 3WD4A 5HWBA 3IK8A 4QT3A 1H0IA 4U85A 1BL4A 4U84A 5HW7A 1ITXA 2L2SA 4DRNA 4DRIA 3RGCA 1LL4A 1K9TA 2LJ4A 3WKZA 1J4HA 1ZL1A 1LG2A 3O5LA 1JNEA 3RMEA 4DH0A 2MLZA 4NSBA 4PTMA 2ZR4A 4ODMA 1ZK6A 4IT4A 4TX0A 4HARA 3UI6A 4U86A 4MNJA 3WL0A 4IPXA 4IT6A 3O5GA 3UQIA 5DIUA 2ZQSA 4DZ2A 4DIPA 3KACA 3KAGA 1ZBKA 1TCOC 1H0GA 2WM0A 1D7JA 1EYMA 4KQZA 4GGQA 4Q22A 1QPLA 4Z2KA 4ZPTR 2LGOA 4N19A 4ODPA 5DF0A 4Z2JA 4W5UA 3O5FA 4J4NA 1HKKA 1GPFA 1ZBCA 3ALFA 1FD9A 2LKNA 2A3CA 3O5OA 4URIA 3KZ7A 3NRKA 4G50A 3RM4A 3I6CA 3LUOA 1FKHA 3KAHA 5DITA 3JYJA 2PN0A 3RM8A 1FKGA 4W9OA 2G41A 2FDMA 2ZQVA 1W26A 4ODOA 3UF8A 3ARUA 1L1PA 3B7XA 4HBEA 2AOSA 2MF9A 4Z2GA 4S3KA 5HUAA 1OGGA 5J6EA 1NMWA 1FKSA 1VF8A 4QT2A 1W9PA 1F40A 3TDBA 2ZQTA 4KR0B 4ZS6A 2K8IA 1FFQA 2DT2A 3O5DA 4TW7A 2PV1A 1JNDA 4JFLA 2O92A 3AQUA 4JFIA 2ZR5A 1GUVA 2ETNA 1EQ3A 3B9DA 1GRJA 4GIVA 3CHFA 1NH6A 2FKEA 1JNSA 2DT1A 4HBOA 1E15A 1FKLA 2KI3A 5HWCA 3NI6A 1LG1A 4ZPWR 2WLZA 4G2PA 1U79A 5GPGA 4TYOA 1J4IA 2DG3A 3ARVA 1UR8A 1ZB5A 4MAVA 1JVWA 5DO2A 1FKDA 4WJXA 2VCDA 1W1YA 5HT1A 1E9LA 3IKGA 3ODKA 2XP9A 4MPKA 4Z2IA 4ITZA 3G6MA 2KGJA 3CHEA 1NWRA 2B5UB 1LL7A 1HKIA 4QZVB 3O5KA 2PI6A 3KADA 1HJVA 3PRAA 4DRHA 2JZVA 4DWSD 4FAPA 3UI5A 3WIJA 2XP5A 1HJWA 2DSWA 1D2KA 2M1IA 2UZ5A 4LAYA 1YATA 2DSVA 3VAWA 1TFVA 1NMVA 2IF4A 3JXVA 3B8SA 4DRMA 3MDYB 2WK2A 2DG9A 2F4EA 3KABA 2Y78A 2XP6A 1LL6A 4J4OA 4Q7NA 3CGNA 4DROA 4TW8A 3ARWA 1P5QA 1Q6UA 2D9FA 2F23A 4S3JA 1EIBA 2PPPA 2XPAA 3UQBA 3O5EA 2EULA 4P8WA 2RUCA 1E6RA 1NSGA 3CH9A 4QIBA 3ARPA 4DWSB 3IKDA 5GPRA 1JCHB 3WD0A 5I98A 1KT1A 3O5RA 2Q5AA 2M08A 3FY1A 2KFWA 4MTVA 2PPNA 2XP7A 3GPKA 3AS0A 5DEZA 1ROTA 2RUDA 3RFWA 1D6OA 1FKBA 3PR9A 2N87A 3BXWA 1E6PA 3H9RB 4Z2LA 3B9AA 1LQ0A 4WKFA 5GQBA 2XP3A 3QOKA 3ARRA 4XAKA 4NNRA 4ZPVR 3KAFA 1NWUA 5DIVA 1JNTA 3FAPA 2KO7A 4P8VA 2G8ZA 1XHGA 4ODQA 3IHZA 3FXYA 2XPBA 4JFKA 4WKAA 4W9QA 1GOIA 4DRKA 1F8AB 2PV3A 1OWQA 5HW8A 3O5IA 2IUZA 4MNLA 3WD3A 4DWSC 4DRQA 1O6IA 4P8UA 2MNTA 2FAPA 4WK9A 3NTPA 1X6NA 2P4VA 5B8IC 2QF8A 4UDMA 4W9PA 2AWGA 3KAIA 1ROUA 2XP8A 2RURA 4FN2A 3ARQA 4JYSA 1C9HA 1Q6IA 2ZR6A 3PRBA 4L72B 3GU0A 4WKHA 2M2AA 1QPFA 1PBKA 2DSUA 1EHNA 4LAWA 2ITKA 4R5EA 3ARSA 3O5JA 4WIWA 1WNOA 1Y0OA 3PA7A 4DRJA 3CHCA 1WAWA 3G6LA 1FKRA 2MLYA 4ODRA 4LAVA 3GTYX 1FKIA 2YBUA 1FFRA 2A3AA 1XRVA
chains in the Genus database with same CATH topology
1E44A 4UDMA 2B5UB 1JCHB 3EIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E44 A;  4UDM A;  2B5U B;  1JCH B;  3EIP A; 
#chains in the Genus database with same CATH topology
 3ARO A;  3WH0 A;  3B9E A;  5HBF A;  2A3B A;  1PIN A;  1Q6H A;  2LPV A;  1OGB A;  4DRP A;  3TCZ A;  2MLX A;  3CZ8 A;  4NZC A;  2KR7 A;  2RSE A;  3O5P A;  4O2T A;  1E6Z A;  3ART A;  1SYT A;  1ZU8 A;  1W1T A;  1FKF A;  3W4R A;  1UR9 A;  4BF8 A;  1M5Y A;  2DG4 A;  4LGX A;  4MNK A;  1KFW A;  2ESC A;  1ZBW A;  1T11 A;  1HKM A;  1FKK A;  2OLH A;  4P8X A;  4C02 B;  1QZ2 A;  3KCE A;  3RM9 A;  2PV2 A;  1W9U A;  2XP4 A;  3OA5 A;  3TC5 A;  4JFM A;  3CHD A;  3UI4 A;  1KT0 A;  4L3N A;  3WQV A;  1W1V A;  5BXJ A;  2RQS A;  2F21 A;  3BMB A;  4ODK A;  4JFJ A;  1RD6 A;  4TW6 A;  1HXV A;  4MGV A;  4ODL A;  1IX5 A;  1J6Y A;  2O9O A;  3AS3 A;  5HKG A;  3JYM A;  1E6N A;  4DZ3 A;  1BKF A;  4LAX A;  4ODN A;  1D7H A;  5HTG A;  1D7I A;  1HKJ A;  1ZCN A;  2RUQ A;  2VN1 A;  3ARX A;  5D75 A;  1W1P A;  1B6C A;  2YBT A;  1YW5 A;  1FAP A;  3WD2 A;  4MNM A;  3ARY A;  2PPO A;  2OFN A;  1FKJ A;  4IQC A;  3O5M A;  4R0X A;  3WL1 A;  2DPE A;  2B31 A;  2DSZ A;  3ALG A;  1N1A A;  3UQA A;  1A7X A;  1EDQ A;  2A3E A;  3AS1 A;  3OOB A;  3EIP A;  1SR0 A;  3WD1 A;  1NWS A;  2DT0 A;  2PBC A;  1FKT A;  5JH8 A;  3O5Q A;  1LJY A;  1J4R A;  4Z2H A;  2ZQU A;  1X6L A;  3PRD A;  2DT3 A;  1Q1C A;  4MSP A;  1R9H A;  4ML4 A;  3AS2 A;  1NWT A;  2WLY A;  3CGM A;  4AY1 A;  1W9V A;  2MPH A;  4DT4 A;  1HJX A;  1CTN A;  5HW6 A;  1FJD A;  1E44 A;  4TNS A;  3ARZ A;  2KE0 A;  1WB0 A;  3EY6 A;  4IQ2 A;  4DWS A;  3WQW A;  2F2D A;  1ZBV A;  3WD4 A;  5HWB A;  3IK8 A;  4QT3 A;  1H0I A;  4U85 A;  1BL4 A;  4U84 A;  5HW7 A;  1ITX A;  2L2S A;  4DRN A;  4DRI A;  3RGC A;  1LL4 A;  1K9T A;  2LJ4 A;  3WKZ A;  1J4H A;  1ZL1 A;  1LG2 A;  3O5L A;  1JNE A;  3RME A;  4DH0 A;  2MLZ A;  4NSB A;  4PTM A;  2ZR4 A;  4ODM A;  1ZK6 A;  4IT4 A;  4TX0 A;  4HAR A;  3UI6 A;  4U86 A;  4MNJ A;  3WL0 A;  4IPX A;  4IT6 A;  3O5G A;  3UQI A;  5DIU A;  2ZQS A;  4DZ2 A;  4DIP A;  3KAC A;  3KAG A;  1ZBK A;  1TCO C;  1H0G A;  2WM0 A;  1D7J A;  1EYM A;  4KQZ A;  4GGQ A;  4Q22 A;  1QPL A;  4Z2K A;  4ZPT R;  2LGO A;  4N19 A;  4ODP A;  5DF0 A;  4Z2J A;  4W5U A;  3O5F A;  4J4N A;  1HKK A;  1GPF A;  1ZBC A;  3ALF A;  1FD9 A;  2LKN A;  2A3C A;  3O5O A;  4URI A;  3KZ7 A;  3NRK A;  4G50 A;  3RM4 A;  3I6C A;  3LUO A;  1FKH A;  3KAH A;  5DIT A;  3JYJ A;  2PN0 A;  3RM8 A;  1FKG A;  4W9O A;  2G41 A;  2FDM A;  2ZQV A;  1W26 A;  4ODO A;  3UF8 A;  3ARU A;  1L1P A;  3B7X A;  4HBE A;  2AOS A;  2MF9 A;  4Z2G A;  4S3K A;  5HUA A;  1OGG A;  5J6E A;  1NMW A;  1FKS A;  1VF8 A;  4QT2 A;  1W9P A;  1F40 A;  3TDB A;  2ZQT A;  4KR0 B;  4ZS6 A;  2K8I A;  1FFQ A;  2DT2 A;  3O5D A;  4TW7 A;  2PV1 A;  1JND A;  4JFL A;  2O92 A;  3AQU A;  4JFI A;  2ZR5 A;  1GUV A;  2ETN A;  1EQ3 A;  3B9D A;  1GRJ A;  4GIV A;  3CHF A;  1NH6 A;  2FKE A;  1JNS A;  2DT1 A;  4HBO A;  1E15 A;  1FKL A;  2KI3 A;  5HWC A;  3NI6 A;  1LG1 A;  4ZPW R;  2WLZ A;  4G2P A;  1U79 A;  5GPG A;  4TYO A;  1J4I A;  2DG3 A;  3ARV A;  1UR8 A;  1ZB5 A;  4MAV A;  1JVW A;  5DO2 A;  1FKD A;  4WJX A;  2VCD A;  1W1Y A;  5HT1 A;  1E9L A;  3IKG A;  3ODK A;  2XP9 A;  4MPK A;  4Z2I A;  4ITZ A;  3G6M A;  2KGJ A;  3CHE A;  1NWR A;  2B5U B;  1LL7 A;  1HKI A;  4QZV B;  3O5K A;  2PI6 A;  3KAD A;  1HJV A;  3PRA A;  4DRH A;  2JZV A;  4DWS D;  4FAP A;  3UI5 A;  3WIJ A;  2XP5 A;  1HJW A;  2DSW A;  1D2K A;  2M1I A;  2UZ5 A;  4LAY A;  1YAT A;  2DSV A;  3VAW A;  1TFV A;  1NMV A;  2IF4 A;  3JXV A;  3B8S A;  4DRM A;  3MDY B;  2WK2 A;  2DG9 A;  2F4E A;  3KAB A;  2Y78 A;  2XP6 A;  1LL6 A;  4J4O A;  4Q7N A;  3CGN A;  4DRO A;  4TW8 A;  3ARW A;  1P5Q A;  1Q6U A;  2D9F A;  2F23 A;  4S3J A;  1EIB A;  2PPP A;  2XPA A;  3UQB A;  3O5E A;  2EUL A;  4P8W A;  2RUC A;  1E6R A;  1NSG A;  3CH9 A;  4QIB A;  3ARP A;  4DWS B;  3IKD A;  5GPR A;  1JCH B;  3WD0 A;  5I98 A;  1KT1 A;  3O5R A;  2Q5A A;  2M08 A;  3FY1 A;  2KFW A;  4MTV A;  2PPN A;  2XP7 A;  3GPK A;  3AS0 A;  5DEZ A;  1ROT A;  2RUD A;  3RFW A;  1D6O A;  1FKB A;  3PR9 A;  2N87 A;  3BXW A;  1E6P A;  3H9R B;  4Z2L A;  3B9A A;  1LQ0 A;  4WKF A;  5GQB A;  2XP3 A;  3QOK A;  3ARR A;  4XAK A;  4NNR A;  4ZPV R;  3KAF A;  1NWU A;  5DIV A;  1JNT A;  3FAP A;  2KO7 A;  4P8V A;  2G8Z A;  1XHG A;  4ODQ A;  3IHZ A;  3FXY A;  2XPB A;  4JFK A;  4WKA A;  4W9Q A;  1GOI A;  4DRK A;  1F8A B;  2PV3 A;  1OWQ A;  5HW8 A;  3O5I A;  2IUZ A;  4MNL A;  3WD3 A;  4DWS C;  4DRQ A;  1O6I A;  4P8U A;  2MNT A;  2FAP A;  4WK9 A;  3NTP A;  1X6N A;  2P4V A;  5B8I C;  2QF8 A;  4UDM A;  4W9P A;  2AWG A;  3KAI A;  1ROU A;  2XP8 A;  2RUR A;  4FN2 A;  3ARQ A;  4JYS A;  1C9H A;  1Q6I A;  2ZR6 A;  3PRB A;  4L72 B;  3GU0 A;  4WKH A;  2M2A A;  1QPF A;  1PBK A;  2DSU A;  1EHN A;  4LAW A;  2ITK A;  4R5E A;  3ARS A;  3O5J A;  4WIW A;  1WNO A;  1Y0O A;  3PA7 A;  4DRJ A;  3CHC A;  1WAW A;  3G6L A;  1FKR A;  2MLY A;  4ODR A;  4LAV A;  3GTY X;  1FKI A;  2YBU A;  1FFR A;  2A3A A;  1XRV A; 
#chains in the Genus database with same CATH homology
 1E44 A;  4UDM A;  2B5U B;  1JCH B;  3EIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...