4IPXA

Analyzing the visible conformational substates of the fk506 binding protein fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Analysing the visible conformational substates of the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4ipxA00
1D7JA 2IF4A 4DRQA 1U79A 4DZ2A 1R9HA 3O5QA 4DRHA 5HKGA 3OOBA 4NNRA 4G2PA 2XP5A 2MLXA 2LKNA 2XP9A 3UF8A 3JYMA 3KCEA 2PBCA 2PPNA 4TYOA 2ZQUA 5D75A 1J6YA 4DRKA 3KAHA 1M5YA 3UI6A 4JFLA 4TNSA 1QPLA 5HW7A 3UI4A 2KGJA 1W26A 2ZQSA 4DH0A 5HTGA 1FKKA 3CGMA 1ZK6A 3O5IA 1BL4A 3O5JA 1ROTA 2KR7A 1F40A 4DT4A 3RFWA 3JYJA 5HWBA 1J4HA 3IK8A 2ZR6A 3KAFA 4BF8A 1Q1CA 1Y0OA 1FKBA 1JNTA 3O5MA 4G50A 3O5EA 2F21A 2F2DA 3UQAA 1FKRA 3O5RA 2L2SA 1KT1A 4DZ3A 4LAXA 1N1AA 2DG3A 2DG9A 5HT1A 1BKFA 1FKTA 2M08A 4QIBA 1EYMA 4ODLA 4LAWA 1QPFA 1JNSA 4DRMA 1A7XA 3NRKA 2M2AA 4QT3A 2DG4A 4JYSA 2ITKA 3KABA 4JFMA 1HXVA 3KADA 4O2TA 2VCDA 2PPPA 1QZ2A 2K8IA 4DRNA 2XP7A 2JZVA 2PV1A 2MF9A 4JFKA 4IQ2A 2PV2A 4GIVA 3TC5A 2AWGA 1FKSA 2MLZA 3TDBA 4DRIA 4J4NA 1Q6IA 5HWCA 4ODPA 2LPVA 3O5DA 4DROA 3O5PA 4DRPA 3FAPA 1FAPA 2MNTA 4ITZA 1T11A 3O5FA 1PINA 4N19A 3KAIA 1D6OA 1F8AB 1J4RA 1FKJA 4W9PA 1Q6HA 2XP6A 3B7XA 1D7HA 2RUCA 4TX0A 1L1PA 2Q5AA 3KAGA 1NMVA 3PA7A 3IKDA 2N87A 4MSPA 1D7IA 3O5KA 2RSEA 4TW6A 1YW5A 1B6CA 4W9OA 2XP4A 3TCZA 3O5LA 1YATA 4ODKA 3ODKA 3EY6A 5HW8A 5HUAA 1PBKA 3KZ7A 3NTPA 3O5OA 4ODQA 5DIVA 2FKEA 3I6CA 2KE0A 4ODMA 4DRJA 4U84A 2VN1A 4R0XA 1FKGA 4TW8A 3IKGA 3GPKA 4TW7A 5DIUA 2MPHA 2ZR4A 3CGNA 1NSGA 4JFJA 2F4EA 4W9QA 4C02B 2XPAA 1FJDA 1FD9A 1ROUA 2ZR5A 2KO7A 1FKDA 1FKHA 1NMWA 2PV3A 1KT0A 4JFIA 2M1IA 2RUDA 3LUOA 4IPXA 4ODRA 4QT2A 5GPGA 2XPBA 5BXJA 2FAPA 1Q6UA 2ZQTA 1EQ3A 2LJ4A 2MLYA 1TCOC 5B8IC 4ODOA 2KI3A 3NI6A 4J4OA 1J4IA 5I98A 3O5GA 4MGVA 4DIPA 4LAYA 3WH0A 2Y78A 3UQIA 3RGCA 2LGOA 4U85A 5DITA 2KFWA 2RURA 1FKLA 4U86A 3KACA 4ODNA 2D9FA 4IQCA 5J6EA 1FKFA 1C9HA 2RUQA 1JVWA 1P5QA 1ZCNA 2RQSA 3UQBA 2UZ5A 3IHZA 3H9RB 3UI5A 4FAPA 3PRDA 3MDYB 4FN2A 2ZQVA 2PPOA 5HW6A 3VAWA 3JXVA 1FKIA 4GGQA 2XP3A 3PRBA 4LAVA 2XP8A 2OFNA
chains in the Genus database with same CATH superfamily
2IF4A 3WD2A 1U79A 4DZ2A 3WL1A 4DRHA 1OWQA 4G2PA 3B9AA 4UDMA 2MLXA 4DRPA 3UF8A 5D75A 3KCEA 4ZPWR 3UI6A 1FFRA 1M5YA 5HTGA 2ZQSA 1LG1A 3O5JA 1ROTA 3ARUA 2KR7A 1HJVA 3JYJA 4P8XA 4QZVB 1J4HA 1ZBCA 2ZR6A 1Q1CA 4Z2KA 3ARRA 3UQAA 1KT1A 4LAXA 1E44A 3WD0A 2DG9A 4LAWA 1A7XA 2M2AA 3GTYX 3KABA 2PPPA 2K8IA 2JZVA 2DSVA 2PV2A 2AWGA 1FKSA 2WK2A 4DROA 1FAPA 3O5FA 3WD1A 2DT2A 1D6OA 2A3EA 5DO2A 4W9PA 2DT0A 3G6LA 1Q6HA 2XP6A 4TX0A 2RUCA 3KAGA 4PTMA 3PA7A 4MSPA 4MPKA 4TW6A 1NWUA 4P8VA 3TCZA 1YATA 5HUAA 5HW8A 5DEZA 2FKEA 3I6CA 3CH9A 3FXYA 3CHFA 4U84A 2VN1A 4R0XA 4TW8A 4TW7A 4WJXA 2ZR4A 1ZU8A 3ARXA 2XPAA 1ROUA 1E6ZA 1FKDA 1NMWA 2LJ4A 1W1PA 4ODOA 1J4IA 2YBUA 5I98A 3RGCA 2LGOA 4U85A 2KFWA 1FKLA 1H0IA 1X6LA 2RUQA 3ALGA 2WLYA 4MNMA 3B9DA 3QOKA 4XAKA 3MDYB 1W1TA 1TFVA 1EHNA 4ZPVR 2XP8A 4DRQA 1HKJA 3O5QA 4DWSA 2PPNA 2ZQUA 3KAHA 3PRAA 1QPLA 3RM9A 3UI4A 5HW7A 1FKKA 1W9UA 1HKIA 4HARA 3WL0A 1LQ0A 4ML4A 5HWBA 3IK8A 4BF8A 1ZL1A 1Y0OA 1FKBA 1OGBA 4L72B 3AS3A 2L2SA 4DZ3A 2DG3A 4WKFA 1W1VA 1JNSA 4ZS6A 3FY1A 2DG4A 1W9PA 4R5EA 4JFMA 1HXVA 4O2TA 4KR0B 4NSBA 3B8SA 2A3AA 4IQ2A 4GIVA 2MLZA 4J4NA 1X6NA 4Z2HA 3FAPA 4ITZA 4DWSD 4Z2LA 1OGGA 3KAIA 2A3BA 4ZPTR 2A3CA 1WAWA 1ZBKA 1O6IA 2Q5AA 2G8ZA 2ETNA 4W9OA 1NWSA 1LJYA 3AQUA 1ZB5A 1W1YA 4ODQA 4WKHA 5DIVA 2DSZA 4Z2IA 3IKGA 3GPKA 3CGNA 3AS0A 1JCHB 2F4EA 4JFJA 4W9QA 2FDMA 2DT3A 1FJDA 3ARVA 2ZR5A 1FKHA 2PV3A 4P8UA 1KT0A 5B8IC 4ODRA 1H0GA 1XHGA 4WKAA 4J4OA 2F23A 4DIPA 3WH0A 4MNJA 3UQIA 2ESCA 5DITA 2O9OA 5J6EA 1P5QA 1E6RA 1FFQA 2UZ5A 3IHZA 3UI5A 1XRVA 2G41A 3PRDA 3ALFA 4FN2A 1WNOA 2ZQVA 1ITXA 1K9TA 5HW6A 4KQZA 3VAWA 3PRBA 4LAVA 1LL4A 4HBEA 2B31A 1R9HA 5HBFA 5HKGA 4NNRA 2XP5A 2LKNA 1SYTA 4TYOA 4IT4A 1J6YA 4DRKA 1JNDA 1WB0A 3CHDA 4JFLA 4TNSA 3CZ8A 2DSWA 4WK9A 3ARSA 3CGMA 1ZK6A 3O5IA 1BL4A 3RFWA 3G6MA 1LG2A 3WD4A 4LGXA 1JNTA 4G50A 3B9EA 3O5EA 2F21A 1FKRA 3O5RA 1RD6A 3ARYA 4QIBA 1IX5A 3AROA 1QPFA 3WQWA 4Q22A 3NRKA 4JYSA 1UR9A 4AY1A 1KFWA 1QZ2A 2DSUA 2XP7A 4DRNA 2PV1A 2MF9A 3ARPA 3TC5A 3ARZA 1Q6IA 4ODPA 2LPVA 2YBTA 3O5DA 1HJWA 3O5PA 5DF0A 2MNTA 1PINA 1ZBWA 1F8AB 1HKKA 1L1PA 2PI6A 4S3KA 1NMVA 5JH8A 2N87A 2RSEA 3EIPA 2WM0A 2XP4A 3O5LA 3PR9A 3KZ7A 3O5OA 4MNLA 2KE0A 1FKGA 2MPHA 3RM4A 1FD9A 1NH6A 2KO7A 4DRIA 4JFIA 4QT2A 4MNKA 3OA5A 5BXJA 1Q6UA 2FAPA 5GQBA 3BMBA 4L3NA 3GU0A 2KI3A 3NI6A 1E9LA 1E15A 2Y78A 2RURA 3KACA 4ODNA 1FKFA 1C9HA 2RQSA 1E6NA 1D2KA 4MTVA 1EIBA 3ARQA 1FKIA 2XP3A 3W4RA 3AS2A 2OLHA 4URIA 1ZBVA 4NZCA 1D7JA 1HKMA 1GPFA 3WQVA 2QF8A 3ARTA 3OOBA 2XP9A 3JYMA 2PBCA 2AOSA 5GPRA 4DH0A 2KGJA 1W26A 2DT1A 4Z2JA 1F40A 4DT4A 2PN0A 1VF8A 3KAFA 4WIWA 3O5MA 2F2DA 3WIJA 1LL7A 1N1AA 5HT1A 1LL6A 1BKFA 1FKTA 2M08A 1EYMA 4ODLA 1GOIA 4DRMA 4P8WA 3AS1A 4DWSB 1NWTA 4QT3A 2ITKA 3BXWA 3KADA 2VCDA 3CHEA 1HJXA 4JFKA 3TDBA 3RMEA 5HWCA 1JNEA 2B5UB 1T11A 4S3JA 4N19A 1CTNA 4W5UA 3WKZA 1J4RA 1FKJA 1EDQA 3B7XA 1D7HA 4Z2GA 4Q7NA 3IKDA 1D7IA 3O5KA 1GRJA 1YW5A 1B6CA 4ODKA 1GUVA 3EY6A 3ODKA 1PBKA 3NTPA 1E6PA 4ODMA 4DRJA 5DIUA 4HBOA 4DWSC 1NSGA 2WLZA 4C02B 2M1IA 2RUDA 3LUOA 4IPXA 1EQ3A 5GPGA 2XPBA 2ZQTA 3WD3A 2MLYA 1TCOC 3ARWA 4MAVA 2DPEA 3RM8A 3O5GA 4MGVA 4LAYA 4IT6A 4U86A 2IUZA 2D9FA 4IQCA 2O92A 1JVWA 1ZCNA 3UQBA 3H9RB 4FAPA 1UR8A 1NWRA 2PPOA 2P4VA 3JXVA 1W9VA 3CHCA 1SR0A 4GGQA 2EULA 2OFNA
chains in the Genus database with same CATH topology
2IF4A 3WD2A 1U79A 4DZ2A 3WL1A 4DRHA 1OWQA 4G2PA 3B9AA 2MLXA 4DRPA 3UF8A 5D75A 3KCEA 4ZPWR 3UI6A 1FFRA 1M5YA 5HTGA 2ZQSA 1LG1A 3O5JA 1ROTA 3ARUA 2KR7A 1HJVA 3JYJA 4P8XA 4QZVB 1J4HA 1ZBCA 2ZR6A 1Q1CA 4Z2KA 3ARRA 3UQAA 1KT1A 4LAXA 3WD0A 2DG9A 4LAWA 1A7XA 2M2AA 3KABA 2PPPA 2K8IA 2JZVA 2DSVA 2PV2A 2AWGA 1FKSA 2WK2A 4DROA 1FAPA 3O5FA 3WD1A 2DT2A 1D6OA 2A3EA 5DO2A 4W9PA 2DT0A 3G6LA 1Q6HA 2XP6A 4TX0A 2RUCA 3KAGA 4PTMA 3PA7A 4MSPA 4MPKA 4TW6A 1NWUA 4P8VA 3TCZA 1YATA 5HUAA 5HW8A 5DEZA 2FKEA 3I6CA 3CH9A 3FXYA 3CHFA 4U84A 2VN1A 4R0XA 4TW8A 4TW7A 4WJXA 2ZR4A 1ZU8A 3ARXA 2XPAA 1ROUA 1E6ZA 1FKDA 1NMWA 2LJ4A 1W1PA 4ODOA 1J4IA 2YBUA 5I98A 3RGCA 2LGOA 4U85A 2KFWA 1FKLA 1H0IA 1X6LA 2RUQA 3ALGA 2WLYA 4MNMA 3B9DA 3QOKA 4XAKA 3MDYB 1W1TA 1TFVA 1EHNA 4ZPVR 2XP8A 4DRQA 1HKJA 3O5QA 4DWSA 2PPNA 2ZQUA 3KAHA 3PRAA 1QPLA 3RM9A 3UI4A 5HW7A 1FKKA 1W9UA 1HKIA 4HARA 3WL0A 1LQ0A 4ML4A 5HWBA 3IK8A 4BF8A 1ZL1A 1Y0OA 1FKBA 1OGBA 4L72B 3AS3A 2L2SA 4DZ3A 2DG3A 4WKFA 1W1VA 1JNSA 4ZS6A 3FY1A 2DG4A 1W9PA 4R5EA 4JFMA 1HXVA 4O2TA 4KR0B 4NSBA 3B8SA 2A3AA 4IQ2A 4GIVA 2MLZA 4J4NA 1X6NA 4Z2HA 3FAPA 4ITZA 4DWSD 4Z2LA 1OGGA 3KAIA 2A3BA 4ZPTR 2A3CA 1WAWA 1ZBKA 1O6IA 2Q5AA 2G8ZA 4W9OA 1NWSA 1LJYA 3AQUA 1ZB5A 1W1YA 4ODQA 4WKHA 5DIVA 2DSZA 4Z2IA 3IKGA 3GPKA 3CGNA 3AS0A 4JFJA 2F4EA 4W9QA 2FDMA 2DT3A 1FJDA 3ARVA 2ZR5A 1FKHA 2PV3A 4P8UA 1KT0A 5B8IC 4ODRA 1H0GA 1XHGA 4WKAA 4J4OA 4DIPA 3WH0A 4MNJA 3UQIA 2ESCA 5DITA 2O9OA 5J6EA 1P5QA 1E6RA 1FFQA 2UZ5A 3IHZA 3UI5A 1XRVA 2G41A 3PRDA 3ALFA 4FN2A 1WNOA 2ZQVA 1ITXA 1K9TA 5HW6A 4KQZA 3VAWA 3PRBA 4LAVA 1LL4A 4HBEA 2B31A 1R9HA 5HBFA 5HKGA 4NNRA 2XP5A 2LKNA 1SYTA 4TYOA 4IT4A 1J6YA 4DRKA 1JNDA 1WB0A 3CHDA 4JFLA 4TNSA 3CZ8A 2DSWA 4WK9A 3ARSA 3CGMA 1ZK6A 3O5IA 1BL4A 3RFWA 3G6MA 1LG2A 3WD4A 4LGXA 1JNTA 4G50A 3B9EA 3O5EA 2F21A 1FKRA 3O5RA 1RD6A 3ARYA 4QIBA 1IX5A 3AROA 1QPFA 3WQWA 4Q22A 3NRKA 4JYSA 1UR9A 4AY1A 1KFWA 1QZ2A 2DSUA 2XP7A 4DRNA 2PV1A 2MF9A 3ARPA 3TC5A 3ARZA 1Q6IA 4ODPA 2LPVA 2YBTA 3O5DA 1HJWA 3O5PA 5DF0A 2MNTA 1PINA 1ZBWA 1F8AB 1HKKA 1L1PA 2PI6A 4S3KA 1NMVA 5JH8A 2N87A 2RSEA 2WM0A 2XP4A 3O5LA 3PR9A 3KZ7A 3O5OA 4MNLA 2KE0A 1FKGA 2MPHA 3RM4A 1FD9A 1NH6A 2KO7A 4DRIA 4JFIA 4QT2A 4MNKA 3OA5A 5BXJA 1Q6UA 2FAPA 5GQBA 4L3NA 2KI3A 3NI6A 1E9LA 1E15A 2Y78A 2RURA 3KACA 4ODNA 1FKFA 1C9HA 2RQSA 1E6NA 1D2KA 4MTVA 1EIBA 3ARQA 1FKIA 2XP3A 3W4RA 3AS2A 2OLHA 4URIA 1ZBVA 4NZCA 1D7JA 1HKMA 1GPFA 3WQVA 2QF8A 3ARTA 3OOBA 2XP9A 3JYMA 2PBCA 2AOSA 5GPRA 4DH0A 2KGJA 1W26A 2DT1A 4Z2JA 1F40A 4DT4A 1VF8A 3KAFA 4WIWA 3O5MA 2F2DA 3WIJA 1LL7A 1N1AA 5HT1A 1LL6A 1BKFA 1FKTA 2M08A 1EYMA 4ODLA 1GOIA 4DRMA 4P8WA 3AS1A 4DWSB 1NWTA 4QT3A 2ITKA 3BXWA 3KADA 2VCDA 3CHEA 1HJXA 4JFKA 3TDBA 3RMEA 5HWCA 1JNEA 1T11A 4S3JA 4N19A 1CTNA 4W5UA 3WKZA 1J4RA 1FKJA 1EDQA 3B7XA 1D7HA 4Z2GA 4Q7NA 3IKDA 1D7IA 3O5KA 1YW5A 1B6CA 4ODKA 1GUVA 3EY6A 3ODKA 1PBKA 3NTPA 1E6PA 4ODMA 4DRJA 5DIUA 4HBOA 4DWSC 1NSGA 2WLZA 4C02B 2M1IA 2RUDA 3LUOA 4IPXA 1EQ3A 5GPGA 2XPBA 2ZQTA 3WD3A 2MLYA 1TCOC 3ARWA 4MAVA 2DPEA 3RM8A 3O5GA 4MGVA 4LAYA 4IT6A 4U86A 2IUZA 2D9FA 4IQCA 2O92A 1JVWA 1ZCNA 3UQBA 3H9RB 4FAPA 1UR8A 1NWRA 2PPOA 3JXVA 1W9VA 3CHCA 1SR0A 4GGQA 2OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7J A;  2IF4 A;  4DRQ A;  1U79 A;  4DZ2 A;  1R9H A;  3O5Q A;  4DRH A;  5HKG A;  3OOB A;  4NNR A;  4G2P A;  2XP5 A;  2MLX A;  2LKN A;  2XP9 A;  3UF8 A;  3JYM A;  3KCE A;  2PBC A;  2PPN A;  4TYO A;  2ZQU A;  5D75 A;  1J6Y A;  4DRK A;  3KAH A;  1M5Y A;  3UI6 A;  4JFL A;  4TNS A;  1QPL A;  5HW7 A;  3UI4 A;  2KGJ A;  1W26 A;  2ZQS A;  4DH0 A;  5HTG A;  1FKK A;  3CGM A;  1ZK6 A;  3O5I A;  1BL4 A;  3O5J A;  1ROT A;  2KR7 A;  1F40 A;  4DT4 A;  3RFW A;  3JYJ A;  5HWB A;  1J4H A;  3IK8 A;  2ZR6 A;  3KAF A;  4BF8 A;  1Q1C A;  1Y0O A;  1FKB A;  1JNT A;  3O5M A;  4G50 A;  3O5E A;  2F21 A;  2F2D A;  3UQA A;  1FKR A;  3O5R A;  2L2S A;  1KT1 A;  4DZ3 A;  4LAX A;  1N1A A;  2DG3 A;  2DG9 A;  5HT1 A;  1BKF A;  1FKT A;  2M08 A;  4QIB A;  1EYM A;  4ODL A;  4LAW A;  1QPF A;  1JNS A;  4DRM A;  1A7X A;  3NRK A;  2M2A A;  4QT3 A;  2DG4 A;  4JYS A;  2ITK A;  3KAB A;  4JFM A;  1HXV A;  3KAD A;  4O2T A;  2VCD A;  2PPP A;  1QZ2 A;  2K8I A;  4DRN A;  2XP7 A;  2JZV A;  2PV1 A;  2MF9 A;  4JFK A;  4IQ2 A;  2PV2 A;  4GIV A;  3TC5 A;  2AWG A;  1FKS A;  2MLZ A;  3TDB A;  4DRI A;  4J4N A;  1Q6I A;  5HWC A;  4ODP A;  2LPV A;  3O5D A;  4DRO A;  3O5P A;  4DRP A;  3FAP A;  1FAP A;  2MNT A;  4ITZ A;  1T11 A;  3O5F A;  1PIN A;  4N19 A;  3KAI A;  1D6O A;  1F8A B;  1J4R A;  1FKJ A;  4W9P A;  1Q6H A;  2XP6 A;  3B7X A;  1D7H A;  2RUC A;  4TX0 A;  1L1P A;  2Q5A A;  3KAG A;  1NMV A;  3PA7 A;  3IKD A;  2N87 A;  4MSP A;  1D7I A;  3O5K A;  2RSE A;  4TW6 A;  1YW5 A;  1B6C A;  4W9O A;  2XP4 A;  3TCZ A;  3O5L A;  1YAT A;  4ODK A;  3ODK A;  3EY6 A;  5HW8 A;  5HUA A;  1PBK A;  3KZ7 A;  3NTP A;  3O5O A;  4ODQ A;  5DIV A;  2FKE A;  3I6C A;  2KE0 A;  4ODM A;  4DRJ A;  4U84 A;  2VN1 A;  4R0X A;  1FKG A;  4TW8 A;  3IKG A;  3GPK A;  4TW7 A;  5DIU A;  2MPH A;  2ZR4 A;  3CGN A;  1NSG A;  4JFJ A;  2F4E A;  4W9Q A;  4C02 B;  2XPA A;  1FJD A;  1FD9 A;  1ROU A;  2ZR5 A;  2KO7 A;  1FKD A;  1FKH A;  1NMW A;  2PV3 A;  1KT0 A;  4JFI A;  2M1I A;  2RUD A;  3LUO A;  4IPX A;  4ODR A;  4QT2 A;  5GPG A;  2XPB A;  5BXJ A;  2FAP A;  1Q6U A;  2ZQT A;  1EQ3 A;  2LJ4 A;  2MLY A;  1TCO C;  5B8I C;  4ODO A;  2KI3 A;  3NI6 A;  4J4O A;  1J4I A;  5I98 A;  3O5G A;  4MGV A;  4DIP A;  4LAY A;  3WH0 A;  2Y78 A;  3UQI A;  3RGC A;  2LGO A;  4U85 A;  5DIT A;  2KFW A;  2RUR A;  1FKL A;  4U86 A;  3KAC A;  4ODN A;  2D9F A;  4IQC A;  5J6E A;  1FKF A;  1C9H A;  2RUQ A;  1JVW A;  1P5Q A;  1ZCN A;  2RQS A;  3UQB A;  2UZ5 A;  3IHZ A;  3H9R B;  3UI5 A;  4FAP A;  3PRD A;  3MDY B;  4FN2 A;  2ZQV A;  2PPO A;  5HW6 A;  3VAW A;  3JXV A;  1FKI A;  4GGQ A;  2XP3 A;  3PRB A;  4LAV A;  2XP8 A;  2OFN A; 
#chains in the Genus database with same CATH topology
 2IF4 A;  3WD2 A;  1U79 A;  4DZ2 A;  3WL1 A;  4DRH A;  1OWQ A;  4G2P A;  3B9A A;  4UDM A;  2MLX A;  4DRP A;  3UF8 A;  5D75 A;  3KCE A;  4ZPW R;  3UI6 A;  1FFR A;  1M5Y A;  5HTG A;  2ZQS A;  1LG1 A;  3O5J A;  1ROT A;  3ARU A;  2KR7 A;  1HJV A;  3JYJ A;  4P8X A;  4QZV B;  1J4H A;  1ZBC A;  2ZR6 A;  1Q1C A;  4Z2K A;  3ARR A;  3UQA A;  1KT1 A;  4LAX A;  1E44 A;  3WD0 A;  2DG9 A;  4LAW A;  1A7X A;  2M2A A;  3GTY X;  3KAB A;  2PPP A;  2K8I A;  2JZV A;  2DSV A;  2PV2 A;  2AWG A;  1FKS A;  2WK2 A;  4DRO A;  1FAP A;  3O5F A;  3WD1 A;  2DT2 A;  1D6O A;  2A3E A;  5DO2 A;  4W9P A;  2DT0 A;  3G6L A;  1Q6H A;  2XP6 A;  4TX0 A;  2RUC A;  3KAG A;  4PTM A;  3PA7 A;  4MSP A;  4MPK A;  4TW6 A;  1NWU A;  4P8V A;  3TCZ A;  1YAT A;  5HUA A;  5HW8 A;  5DEZ A;  2FKE A;  3I6C A;  3CH9 A;  3FXY A;  3CHF A;  4U84 A;  2VN1 A;  4R0X A;  4TW8 A;  4TW7 A;  4WJX A;  2ZR4 A;  1ZU8 A;  3ARX A;  2XPA A;  1ROU A;  1E6Z A;  1FKD A;  1NMW A;  2LJ4 A;  1W1P A;  4ODO A;  1J4I A;  2YBU A;  5I98 A;  3RGC A;  2LGO A;  4U85 A;  2KFW A;  1FKL A;  1H0I A;  1X6L A;  2RUQ A;  3ALG A;  2WLY A;  4MNM A;  3B9D A;  3QOK A;  4XAK A;  3MDY B;  1W1T A;  1TFV A;  1EHN A;  4ZPV R;  2XP8 A;  4DRQ A;  1HKJ A;  3O5Q A;  4DWS A;  2PPN A;  2ZQU A;  3KAH A;  3PRA A;  1QPL A;  3RM9 A;  3UI4 A;  5HW7 A;  1FKK A;  1W9U A;  1HKI A;  4HAR A;  3WL0 A;  1LQ0 A;  4ML4 A;  5HWB A;  3IK8 A;  4BF8 A;  1ZL1 A;  1Y0O A;  1FKB A;  1OGB A;  4L72 B;  3AS3 A;  2L2S A;  4DZ3 A;  2DG3 A;  4WKF A;  1W1V A;  1JNS A;  4ZS6 A;  3FY1 A;  2DG4 A;  1W9P A;  4R5E A;  4JFM A;  1HXV A;  4O2T A;  4KR0 B;  4NSB A;  3B8S A;  2A3A A;  4IQ2 A;  4GIV A;  2MLZ A;  4J4N A;  1X6N A;  4Z2H A;  3FAP A;  4ITZ A;  4DWS D;  4Z2L A;  1OGG A;  3KAI A;  2A3B A;  4ZPT R;  2A3C A;  1WAW A;  1ZBK A;  1O6I A;  2Q5A A;  2G8Z A;  2ETN A;  4W9O A;  1NWS A;  1LJY A;  3AQU A;  1ZB5 A;  1W1Y A;  4ODQ A;  4WKH A;  5DIV A;  2DSZ A;  4Z2I A;  3IKG A;  3GPK A;  3CGN A;  3AS0 A;  1JCH B;  2F4E A;  4JFJ A;  4W9Q A;  2FDM A;  2DT3 A;  1FJD A;  3ARV A;  2ZR5 A;  1FKH A;  2PV3 A;  4P8U A;  1KT0 A;  5B8I C;  4ODR A;  1H0G A;  1XHG A;  4WKA A;  4J4O A;  2F23 A;  4DIP A;  3WH0 A;  4MNJ A;  3UQI A;  2ESC A;  5DIT A;  2O9O A;  5J6E A;  1P5Q A;  1E6R A;  1FFQ A;  2UZ5 A;  3IHZ A;  3UI5 A;  1XRV A;  2G41 A;  3PRD A;  3ALF A;  4FN2 A;  1WNO A;  2ZQV A;  1ITX A;  1K9T A;  5HW6 A;  4KQZ A;  3VAW A;  3PRB A;  4LAV A;  1LL4 A;  4HBE A;  2B31 A;  1R9H A;  5HBF A;  5HKG A;  4NNR A;  2XP5 A;  2LKN A;  1SYT A;  4TYO A;  4IT4 A;  1J6Y A;  4DRK A;  1JND A;  1WB0 A;  3CHD A;  4JFL A;  4TNS A;  3CZ8 A;  2DSW A;  4WK9 A;  3ARS A;  3CGM A;  1ZK6 A;  3O5I A;  1BL4 A;  3RFW A;  3G6M A;  1LG2 A;  3WD4 A;  4LGX A;  1JNT A;  4G50 A;  3B9E A;  3O5E A;  2F21 A;  1FKR A;  3O5R A;  1RD6 A;  3ARY A;  4QIB A;  1IX5 A;  3ARO A;  1QPF A;  3WQW A;  4Q22 A;  3NRK A;  4JYS A;  1UR9 A;  4AY1 A;  1KFW A;  1QZ2 A;  2DSU A;  2XP7 A;  4DRN A;  2PV1 A;  2MF9 A;  3ARP A;  3TC5 A;  3ARZ A;  1Q6I A;  4ODP A;  2LPV A;  2YBT A;  3O5D A;  1HJW A;  3O5P A;  5DF0 A;  2MNT A;  1PIN A;  1ZBW A;  1F8A B;  1HKK A;  1L1P A;  2PI6 A;  4S3K A;  1NMV A;  5JH8 A;  2N87 A;  2RSE A;  3EIP A;  2WM0 A;  2XP4 A;  3O5L A;  3PR9 A;  3KZ7 A;  3O5O A;  4MNL A;  2KE0 A;  1FKG A;  2MPH A;  3RM4 A;  1FD9 A;  1NH6 A;  2KO7 A;  4DRI A;  4JFI A;  4QT2 A;  4MNK A;  3OA5 A;  5BXJ A;  1Q6U A;  2FAP A;  5GQB A;  3BMB A;  4L3N A;  3GU0 A;  2KI3 A;  3NI6 A;  1E9L A;  1E15 A;  2Y78 A;  2RUR A;  3KAC A;  4ODN A;  1FKF A;  1C9H A;  2RQS A;  1E6N A;  1D2K A;  4MTV A;  1EIB A;  3ARQ A;  1FKI A;  2XP3 A;  3W4R A;  3AS2 A;  2OLH A;  4URI A;  1ZBV A;  4NZC A;  1D7J A;  1HKM A;  1GPF A;  3WQV A;  2QF8 A;  3ART A;  3OOB A;  2XP9 A;  3JYM A;  2PBC A;  2AOS A;  5GPR A;  4DH0 A;  2KGJ A;  1W26 A;  2DT1 A;  4Z2J A;  1F40 A;  4DT4 A;  2PN0 A;  1VF8 A;  3KAF A;  4WIW A;  3O5M A;  2F2D A;  3WIJ A;  1LL7 A;  1N1A A;  5HT1 A;  1LL6 A;  1BKF A;  1FKT A;  2M08 A;  1EYM A;  4ODL A;  1GOI A;  4DRM A;  4P8W A;  3AS1 A;  4DWS B;  1NWT A;  4QT3 A;  2ITK A;  3BXW A;  3KAD A;  2VCD A;  3CHE A;  1HJX A;  4JFK A;  3TDB A;  3RME A;  5HWC A;  1JNE A;  2B5U B;  1T11 A;  4S3J A;  4N19 A;  1CTN A;  4W5U A;  3WKZ A;  1J4R A;  1FKJ A;  1EDQ A;  3B7X A;  1D7H A;  4Z2G A;  4Q7N A;  3IKD A;  1D7I A;  3O5K A;  1GRJ A;  1YW5 A;  1B6C A;  4ODK A;  1GUV A;  3EY6 A;  3ODK A;  1PBK A;  3NTP A;  1E6P A;  4ODM A;  4DRJ A;  5DIU A;  4HBO A;  4DWS C;  1NSG A;  2WLZ A;  4C02 B;  2M1I A;  2RUD A;  3LUO A;  4IPX A;  1EQ3 A;  5GPG A;  2XPB A;  2ZQT A;  3WD3 A;  2MLY A;  1TCO C;  3ARW A;  4MAV A;  2DPE A;  3RM8 A;  3O5G A;  4MGV A;  4LAY A;  4IT6 A;  4U86 A;  2IUZ A;  2D9F A;  4IQC A;  2O92 A;  1JVW A;  1ZCN A;  3UQB A;  3H9R B;  4FAP A;  1UR8 A;  1NWR A;  2PPO A;  2P4V A;  3JXV A;  1W9V A;  3CHC A;  1SR0 A;  4GGQ A;  2EUL A;  2OFN A; 
#chains in the Genus database with same CATH homology
 2IF4 A;  3WD2 A;  1U79 A;  4DZ2 A;  3WL1 A;  4DRH A;  1OWQ A;  4G2P A;  3B9A A;  2MLX A;  4DRP A;  3UF8 A;  5D75 A;  3KCE A;  4ZPW R;  3UI6 A;  1FFR A;  1M5Y A;  5HTG A;  2ZQS A;  1LG1 A;  3O5J A;  1ROT A;  3ARU A;  2KR7 A;  1HJV A;  3JYJ A;  4P8X A;  4QZV B;  1J4H A;  1ZBC A;  2ZR6 A;  1Q1C A;  4Z2K A;  3ARR A;  3UQA A;  1KT1 A;  4LAX A;  3WD0 A;  2DG9 A;  4LAW A;  1A7X A;  2M2A A;  3KAB A;  2PPP A;  2K8I A;  2JZV A;  2DSV A;  2PV2 A;  2AWG A;  1FKS A;  2WK2 A;  4DRO A;  1FAP A;  3O5F A;  3WD1 A;  2DT2 A;  1D6O A;  2A3E A;  5DO2 A;  4W9P A;  2DT0 A;  3G6L A;  1Q6H A;  2XP6 A;  4TX0 A;  2RUC A;  3KAG A;  4PTM A;  3PA7 A;  4MSP A;  4MPK A;  4TW6 A;  1NWU A;  4P8V A;  3TCZ A;  1YAT A;  5HUA A;  5HW8 A;  5DEZ A;  2FKE A;  3I6C A;  3CH9 A;  3FXY A;  3CHF A;  4U84 A;  2VN1 A;  4R0X A;  4TW8 A;  4TW7 A;  4WJX A;  2ZR4 A;  1ZU8 A;  3ARX A;  2XPA A;  1ROU A;  1E6Z A;  1FKD A;  1NMW A;  2LJ4 A;  1W1P A;  4ODO A;  1J4I A;  2YBU A;  5I98 A;  3RGC A;  2LGO A;  4U85 A;  2KFW A;  1FKL A;  1H0I A;  1X6L A;  2RUQ A;  3ALG A;  2WLY A;  4MNM A;  3B9D A;  3QOK A;  4XAK A;  3MDY B;  1W1T A;  1TFV A;  1EHN A;  4ZPV R;  2XP8 A;  4DRQ A;  1HKJ A;  3O5Q A;  4DWS A;  2PPN A;  2ZQU A;  3KAH A;  3PRA A;  1QPL A;  3RM9 A;  3UI4 A;  5HW7 A;  1FKK A;  1W9U A;  1HKI A;  4HAR A;  3WL0 A;  1LQ0 A;  4ML4 A;  5HWB A;  3IK8 A;  4BF8 A;  1ZL1 A;  1Y0O A;  1FKB A;  1OGB A;  4L72 B;  3AS3 A;  2L2S A;  4DZ3 A;  2DG3 A;  4WKF A;  1W1V A;  1JNS A;  4ZS6 A;  3FY1 A;  2DG4 A;  1W9P A;  4R5E A;  4JFM A;  1HXV A;  4O2T A;  4KR0 B;  4NSB A;  3B8S A;  2A3A A;  4IQ2 A;  4GIV A;  2MLZ A;  4J4N A;  1X6N A;  4Z2H A;  3FAP A;  4ITZ A;  4DWS D;  4Z2L A;  1OGG A;  3KAI A;  2A3B A;  4ZPT R;  2A3C A;  1WAW A;  1ZBK A;  1O6I A;  2Q5A A;  2G8Z A;  4W9O A;  1NWS A;  1LJY A;  3AQU A;  1ZB5 A;  1W1Y A;  4ODQ A;  4WKH A;  5DIV A;  2DSZ A;  4Z2I A;  3IKG A;  3GPK A;  3CGN A;  3AS0 A;  4JFJ A;  2F4E A;  4W9Q A;  2FDM A;  2DT3 A;  1FJD A;  3ARV A;  2ZR5 A;  1FKH A;  2PV3 A;  4P8U A;  1KT0 A;  5B8I C;  4ODR A;  1H0G A;  1XHG A;  4WKA A;  4J4O A;  4DIP A;  3WH0 A;  4MNJ A;  3UQI A;  2ESC A;  5DIT A;  2O9O A;  5J6E A;  1P5Q A;  1E6R A;  1FFQ A;  2UZ5 A;  3IHZ A;  3UI5 A;  1XRV A;  2G41 A;  3PRD A;  3ALF A;  4FN2 A;  1WNO A;  2ZQV A;  1ITX A;  1K9T A;  5HW6 A;  4KQZ A;  3VAW A;  3PRB A;  4LAV A;  1LL4 A;  4HBE A;  2B31 A;  1R9H A;  5HBF A;  5HKG A;  4NNR A;  2XP5 A;  2LKN A;  1SYT A;  4TYO A;  4IT4 A;  1J6Y A;  4DRK A;  1JND A;  1WB0 A;  3CHD A;  4JFL A;  4TNS A;  3CZ8 A;  2DSW A;  4WK9 A;  3ARS A;  3CGM A;  1ZK6 A;  3O5I A;  1BL4 A;  3RFW A;  3G6M A;  1LG2 A;  3WD4 A;  4LGX A;  1JNT A;  4G50 A;  3B9E A;  3O5E A;  2F21 A;  1FKR A;  3O5R A;  1RD6 A;  3ARY A;  4QIB A;  1IX5 A;  3ARO A;  1QPF A;  3WQW A;  4Q22 A;  3NRK A;  4JYS A;  1UR9 A;  4AY1 A;  1KFW A;  1QZ2 A;  2DSU A;  2XP7 A;  4DRN A;  2PV1 A;  2MF9 A;  3ARP A;  3TC5 A;  3ARZ A;  1Q6I A;  4ODP A;  2LPV A;  2YBT A;  3O5D A;  1HJW A;  3O5P A;  5DF0 A;  2MNT A;  1PIN A;  1ZBW A;  1F8A B;  1HKK A;  1L1P A;  2PI6 A;  4S3K A;  1NMV A;  5JH8 A;  2N87 A;  2RSE A;  2WM0 A;  2XP4 A;  3O5L A;  3PR9 A;  3KZ7 A;  3O5O A;  4MNL A;  2KE0 A;  1FKG A;  2MPH A;  3RM4 A;  1FD9 A;  1NH6 A;  2KO7 A;  4DRI A;  4JFI A;  4QT2 A;  4MNK A;  3OA5 A;  5BXJ A;  1Q6U A;  2FAP A;  5GQB A;  4L3N A;  2KI3 A;  3NI6 A;  1E9L A;  1E15 A;  2Y78 A;  2RUR A;  3KAC A;  4ODN A;  1FKF A;  1C9H A;  2RQS A;  1E6N A;  1D2K A;  4MTV A;  1EIB A;  3ARQ A;  1FKI A;  2XP3 A;  3W4R A;  3AS2 A;  2OLH A;  4URI A;  1ZBV A;  4NZC A;  1D7J A;  1HKM A;  1GPF A;  3WQV A;  2QF8 A;  3ART A;  3OOB A;  2XP9 A;  3JYM A;  2PBC A;  2AOS A;  5GPR A;  4DH0 A;  2KGJ A;  1W26 A;  2DT1 A;  4Z2J A;  1F40 A;  4DT4 A;  1VF8 A;  3KAF A;  4WIW A;  3O5M A;  2F2D A;  3WIJ A;  1LL7 A;  1N1A A;  5HT1 A;  1LL6 A;  1BKF A;  1FKT A;  2M08 A;  1EYM A;  4ODL A;  1GOI A;  4DRM A;  4P8W A;  3AS1 A;  4DWS B;  1NWT A;  4QT3 A;  2ITK A;  3BXW A;  3KAD A;  2VCD A;  3CHE A;  1HJX A;  4JFK A;  3TDB A;  3RME A;  5HWC A;  1JNE A;  1T11 A;  4S3J A;  4N19 A;  1CTN A;  4W5U A;  3WKZ A;  1J4R A;  1FKJ A;  1EDQ A;  3B7X A;  1D7H A;  4Z2G A;  4Q7N A;  3IKD A;  1D7I A;  3O5K A;  1YW5 A;  1B6C A;  4ODK A;  1GUV A;  3EY6 A;  3ODK A;  1PBK A;  3NTP A;  1E6P A;  4ODM A;  4DRJ A;  5DIU A;  4HBO A;  4DWS C;  1NSG A;  2WLZ A;  4C02 B;  2M1I A;  2RUD A;  3LUO A;  4IPX A;  1EQ3 A;  5GPG A;  2XPB A;  2ZQT A;  3WD3 A;  2MLY A;  1TCO C;  3ARW A;  4MAV A;  2DPE A;  3RM8 A;  3O5G A;  4MGV A;  4LAY A;  4IT6 A;  4U86 A;  2IUZ A;  2D9F A;  4IQC A;  2O92 A;  1JVW A;  1ZCN A;  3UQB A;  3H9R B;  4FAP A;  1UR8 A;  1NWR A;  2PPO A;  3JXV A;  1W9V A;  3CHC A;  1SR0 A;  4GGQ A;  2OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...