4IPXA

Analyzing the visible conformational substates of the fk506 binding protein fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Analysing the visible conformational substates of the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4ipxA00
1YW5A 3NI6A 5I98A 5HW8A 5GPGA 1B6CA 1P5QA 1F40A 2LKNA 1NSGA 2LGOA 1JNTA 2M2AA 1J4RA 1FKHA 1PINA 4N19A 3PRBA 1J4HA 3IK8A 1D7JA 1Q6UA 1FKFA 1FKBA 2PPPA 3KAGA 2RUCA 4JFLA 2XPAA 4DRIA 2XP5A 1ROTA 5HT1A 5HW6A 5HUAA 3O5OA 2XP3A 4ODKA 1QPFA 3KAIA 4ODLA 4TW8A 3JXVA 4LAXA 2F2DA 4FAPA 4IPXA 4GIVA 3O5LA 4DT4A 1R9HA 2KFWA 2OFNA 5J6EA 3O5KA 4G2PA 4NNRA 1NMVA 2DG4A 3RFWA 3O5GA 1ZCNA 2RURA 2ZQUA 3TC5A 1W26A 2UZ5A 3KADA 4TW7A 5DITA 1BKFA 5BXJA 2MF9A 2D9FA 3JYJA 4DRMA 5HW7A 1HXVA 2F4EA 2ZQVA 3I6CA 3NRKA 3O5JA 2KGJA 2XPBA 4IQCA 4LAWA 2VN1A 3FAPA 4TX0A 4DH0A 2XP9A 4LAVA 3B7XA 4G50A 2LJ4A 3O5EA 3O5MA 2PV3A 1NMWA 2PPNA 4LAYA 4JFKA 4O2TA 5B8IC 3UQAA 4IQ2A 2Q5AA 3LUOA 2N87A 4W9PA 1BL4A 3UI5A 1M5YA 4J4OA 1ROUA 4JYSA 4BF8A 2XP4A 4FN2A 4JFIA 3IKDA 4ITZA 2XP7A 3O5DA 1ZK6A 1FD9A 4ODPA 1Q1CA 3KABA 4C02B 3O5RA 4DROA 2ZQSA 4QT3A 1QZ2A 3IHZA 4TNSA 4R0XA 1D7HA 2DG9A 1PBKA 3H9RB 5DIUA 2DG3A 1FKSA 3RGCA 2PV1A 1FKIA 2KE0A 1D6OA 3JYMA 3VAWA 2ZR5A 3MDYB 1YATA 2ZQTA 3PRDA 2M08A 4DRHA 2KR7A 5HKGA 1QPLA 2FKEA 4DRKA 4W9OA 2L2SA 4MSPA 3UQBA 2RSEA 1J6YA 3KAHA 3KCEA 2VCDA 2JZVA 1FAPA 2MPHA 4MGVA 2MNTA 4TYOA 5D75A 4ODQA 2PV2A 1FKRA 5HWCA 1TCOC 1A7XA 1KT0A 2F21A 2KI3A 3EY6A 3OOBA 4ODRA 3KZ7A 5DIVA 4DZ2A 3CGNA 1U79A 1FKJA 3PA7A 3UQIA 1Y0OA 4QT2A 4DRJA 3TDBA 1EQ3A 1J4IA 1Q6IA 2AWGA 1FKGA 3CGMA 4DRQA 1KT1A 2RQSA 4GGQA 1FKDA 1D7IA 2LPVA 1JVWA 3O5PA 4U86A 2MLZA 1L1PA 2ZR6A 4U84A 4DRNA 1C9HA 2MLXA 4DRPA 1EYMA 2XP6A 2KO7A 3IKGA 4JFMA 4ODOA 3O5QA 3NTPA 3WH0A 2XP8A 1FKKA 1JNSA 1FKLA 2FAPA 4U85A 3O5FA 5HTGA 3O5IA 3GPKA 1FKTA 2IF4A 3KACA 5HWBA 1N1AA 4JFJA 2Y78A 3UF8A 4DIPA 4W9QA 2RUQA 2K8IA 4ODMA 3KAFA 3UI4A 4DZ3A 3ODKA 3TCZA 1Q6HA 1FJDA 2RUDA 4J4NA 2M1IA 2PBCA 2PPOA 3UI6A 1F8AB 1T11A 2ZR4A 4ODNA 4QIBA 2MLYA 4TW6A 2ITKA
chains in the Genus database with same CATH superfamily
3NI6A 1B6CA 3GTYX 2LKNA 1SR0A 2M2AA 1J4RA 1FKHA 4N19A 3WKZA 1FKBA 3WD0A 4MNLA 5HUAA 1QPFA 4TW8A 4KQZA 1LG1A 2F2DA 2AOSA 4HARA 3ARWA 4DT4A 2O9OA 1R9HA 4NNRA 2OLHA 3OA5A 5GPRA 5DITA 5HW7A 1ZBWA 3JYJA 1HXVA 1W1TA 1X6NA 3NRKA 4TX0A 4IQCA 4DH0A 4LAVA 4G50A 3O5MA 4JFKA 4IQ2A 2N87A 3UI5A 4ZPTR 4J4OA 1ROUA 1HJXA 2ETNA 4JFIA 4FN2A 3RM9A 1ZK6A 3ARQA 1W1PA 3KABA 4ODPA 3ARVA 4C02B 2ZQSA 4ML4A 4QT3A 3WQVA 4R0XA 1LL7A 3H9RB 4PTMA 1FKSA 3RGCA 1XRVA 3JYMA 2ZR5A 3MDYB 2ZQTA 4W9OA 4WKHA 3UQBA 3KCEA 2JZVA 4TYOA 1OWQA 4UDMA 1FKRA 5HWCA 1A7XA 1KT0A 2F21A 2KI3A 2WM0A 3EY6A 3OOBA 4ODRA 3B9EA 4KR0B 3W4RA 1J4IA 1FKGA 1KT1A 1W9VA 1E9LA 4HBEA 4U86A 1JVWA 1L1PA 2ZR6A 2FDMA 2A3CA 2MLXA 1GOIA 2XP6A 3B8SA 3IKGA 4JFMA 1TFVA 3O5QA 4MNJA 3WL1A 2XP8A 1O6IA 4ZPVR 1GUVA 5HTGA 2IF4A 4S3JA 3WD2A 2DT2A 2RUDA 2PPOA 3UI6A 1YW5A 4Z2GA 4Z2IA 3WIJA 5HW8A 1P5QA 1NSGA 4QZVB 5DEZA 1PINA 3FXYA 3AS1A 1Q6UA 1FKFA 2XPAA 4DRIA 4WJXA 5HT1A 4ODKA 3ARYA 3WQWA 4FAPA 1W9PA 4GIVA 1ZBCA 3O5LA 2OFNA 2WLZA 2DG4A 2RURA 3KADA 2QF8A 2MF9A 2D9FA 2DSUA 1E6NA 3I6CA 4ZS6A 2KGJA 3FY1A 2A3AA 3B7XA 2LJ4A 2PN0A 4LAYA 3ALGA 3AS3A 5B8IC 1ITXA 1EIBA 3ARXA 4IT4A 3CHCA 2Q5AA 4W9PA 4WKAA 2O92A 1M5YA 3AQUA 4W5UA 2DT0A 3IKDA 4Q22A 3IHZA 4LGXA 2PV1A 1FKIA 1W1YA 3WD1A 3CHFA 3EIPA 4DRHA 3PRDA 2M08A 5HKGA 1QPLA 1RD6A 4WK9A 2L2SA 3ARSA 2RSEA 1J6YA 2VCDA 1FAPA 2MNTA 3WL0A 2PV2A 5DIVA 2ESCA 4DZ2A 3PA7A 1Y0OA 4QT2A 2DSVA 1Q6IA 2B31A 4DRQA 2RQSA 2DPEA 4GGQA 1FKDA 2LPVA 2MLZA 4DRNA 3G6LA 1C9HA 1HJVA 4DRPA 1EYMA 2KO7A 4ODOA 1NWTA 4L3NA 1ZBVA 3WH0A 1IX5A 2P4VA 1JNSA 1NH6A 3CHDA 4U85A 3O5FA 3RM8A 1HKMA 2DSZA 5HWBA 4JFJA 1NWUA 2WLYA 3UI4A 2K8IA 1JNEA 4DZ3A 1NWRA 2PBCA 2WK2A 2F23A 1F8AB 1NWSA 4HBOA 3AS2A 4XAKA 5I98A 5GPGA 4NSBA 1HKJA 2LGOA 1JNTA 1J4HA 3IK8A 1H0GA 4Z2HA 4JFLA 2RUCA 2XP5A 1ROTA 5HW6A 3O5OA 3JXVA 2KFWA 5J6EA 3PRAA 3O5KA 1WAWA 4G2PA 1NMVA 3RFWA 3O5GA 2EULA 1W26A 2UZ5A 3WD4A 4DWSA 5BXJA 2ZQVA 4LAWA 2XPBA 1GRJA 3FAPA 1VF8A 3CZ8A 4P8WA 3O5EA 3WD3A 3UQAA 2PPNA 1FFRA 1HKKA 3LUOA 1BL4A 4R5EA 1HKIA 4Q7NA 1LQ0A 3ARPA 4BF8A 2XP4A 3RMEA 2XP7A 1FD9A 3O5RA 1D7HA 2DG9A 1PBKA 1EDQA 1E6ZA 4ZPWR 2DG3A 4WKFA 2KE0A 3RM4A 1D6OA 1KFWA 1E6PA 1JNDA 4DWSD 1YATA 3ARUA 3ALFA 3AS0A 4MSPA 4AY1A 3KAHA 1UR9A 2MPHA 4MGVA 4ODQA 2DT3A 1HJWA 1TCOC 4P8UA 3KZ7A 3CGNA 1U79A 2IUZA 3PR9A 3UQIA 4DRJA 1ZBKA 1UR8A 4MNKA 3O5PA 5GQBA 4NZCA 4WIWA 4U84A 1LJYA 3ARTA 3QOKA 1FKLA 2FAPA 2G8ZA 1OGBA 1H0IA 2YBTA 1FKTA 2PI6A 3KACA 3GU0A 1LL6A 1E44A 2Y78A 1WB0A 3UF8A 4DIPA 5HBFA 4W9QA 3KAFA 3ODKA 3TCZA 1Q6HA 1FJDA 2M1IA 3B9AA 1T11A 2ZR4A 4TW6A 2ITKA 1F40A 3BXWA 4DWSB 3PRBA 3ARRA 1D7JA 4S3KA 4DWSC 2PPPA 3KAGA 1D2KA 1X6LA 2G41A 2XP3A 4ODLA 3KAIA 4L72B 4LAXA 1E15A 4IPXA 3TC5A 3ARZA 1ZCNA 2ZQUA 2DT1A 3G6MA 4TW7A 1BKFA 2DSWA 4DRMA 2F4EA 4Z2LA 2A3EA 3O5JA 2VN1A 2XP9A 1WNOA 2PV3A 1NMWA 4O2TA 2A3BA 2B5UB 1JCHB 4JYSA 4ITZA 3O5DA 1E6RA 1XHGA 1Q1CA 4DROA 1QZ2A 3B9DA 3CHEA 1W1VA 4TNSA 4Z2KA 5DIUA 1ZL1A 3VAWA 1FFQA 4P8VA 1GPFA 2KR7A 2FKEA 4DRKA 5DO2A 4MTVA 5D75A 1FKJA 1CTNA 4Z2JA 1ZU8A 3TDBA 4IT6A 1EQ3A 2AWGA 3CGMA 1EHNA 1ZB5A 3AROA 4P8XA 1LL4A 2YBUA 1D7IA 3BMBA 3CH9A 4MPKA 1OGGA 4URIA 3NTPA 5DF0A 1SYTA 1FKKA 1LG2A 1W9UA 3O5IA 3GPKA 1K9TA 1N1AA 2RUQA 4ODMA 4MAVA 4J4NA 4MNMA 5JH8A 4ODNA 4QIBA 2MLYA
chains in the Genus database with same CATH topology
3NI6A 1B6CA 2LKNA 1SR0A 2M2AA 1J4RA 1FKHA 4N19A 3WKZA 1FKBA 3WD0A 4MNLA 5HUAA 1QPFA 4TW8A 4KQZA 1LG1A 2F2DA 2AOSA 4HARA 3ARWA 4DT4A 2O9OA 1R9HA 4NNRA 2OLHA 3OA5A 5GPRA 5DITA 5HW7A 1ZBWA 3JYJA 1HXVA 1W1TA 1X6NA 3NRKA 4TX0A 4IQCA 4DH0A 4LAVA 4G50A 3O5MA 4JFKA 4IQ2A 2N87A 3UI5A 4ZPTR 4J4OA 1ROUA 1HJXA 4JFIA 4FN2A 3RM9A 1ZK6A 3ARQA 1W1PA 3KABA 4ODPA 3ARVA 4C02B 2ZQSA 4ML4A 4QT3A 3WQVA 4R0XA 1LL7A 3H9RB 4PTMA 1FKSA 3RGCA 1XRVA 3JYMA 2ZR5A 3MDYB 2ZQTA 4W9OA 4WKHA 3UQBA 3KCEA 2JZVA 4TYOA 1OWQA 1FKRA 5HWCA 1A7XA 1KT0A 2F21A 2KI3A 2WM0A 3EY6A 3OOBA 4ODRA 3B9EA 4KR0B 3W4RA 1J4IA 1FKGA 1KT1A 1W9VA 1E9LA 4HBEA 4U86A 1JVWA 1L1PA 2ZR6A 2FDMA 2A3CA 2MLXA 1GOIA 2XP6A 3B8SA 3IKGA 4JFMA 1TFVA 3O5QA 4MNJA 3WL1A 2XP8A 1O6IA 4ZPVR 1GUVA 5HTGA 2IF4A 4S3JA 3WD2A 2DT2A 2RUDA 2PPOA 3UI6A 1YW5A 4Z2GA 4Z2IA 3WIJA 5HW8A 1P5QA 1NSGA 4QZVB 5DEZA 1PINA 3FXYA 3AS1A 1Q6UA 1FKFA 2XPAA 4DRIA 4WJXA 5HT1A 4ODKA 3ARYA 3WQWA 4FAPA 1W9PA 4GIVA 1ZBCA 3O5LA 2OFNA 2WLZA 2DG4A 2RURA 3KADA 2QF8A 2MF9A 2D9FA 2DSUA 1E6NA 3I6CA 4ZS6A 2KGJA 3FY1A 2A3AA 3B7XA 2LJ4A 4LAYA 3ALGA 3AS3A 5B8IC 1ITXA 1EIBA 3ARXA 4IT4A 3CHCA 2Q5AA 4W9PA 4WKAA 2O92A 1M5YA 3AQUA 4W5UA 2DT0A 3IKDA 4Q22A 3IHZA 4LGXA 2PV1A 1FKIA 1W1YA 3WD1A 3CHFA 4DRHA 3PRDA 2M08A 5HKGA 1QPLA 1RD6A 4WK9A 2L2SA 3ARSA 2RSEA 1J6YA 2VCDA 1FAPA 2MNTA 3WL0A 2PV2A 5DIVA 2ESCA 4DZ2A 3PA7A 1Y0OA 4QT2A 2DSVA 1Q6IA 2B31A 4DRQA 2RQSA 2DPEA 4GGQA 1FKDA 2LPVA 2MLZA 4DRNA 3G6LA 1C9HA 1HJVA 4DRPA 1EYMA 2KO7A 4ODOA 1NWTA 4L3NA 1ZBVA 3WH0A 1IX5A 1JNSA 1NH6A 3CHDA 4U85A 3O5FA 3RM8A 1HKMA 2DSZA 5HWBA 4JFJA 1NWUA 2WLYA 3UI4A 2K8IA 1JNEA 4DZ3A 1NWRA 2PBCA 2WK2A 1F8AB 1NWSA 4HBOA 3AS2A 4XAKA 5I98A 5GPGA 4NSBA 1HKJA 2LGOA 1JNTA 1J4HA 3IK8A 1H0GA 4Z2HA 4JFLA 2RUCA 2XP5A 1ROTA 5HW6A 3O5OA 3JXVA 2KFWA 5J6EA 3PRAA 3O5KA 1WAWA 4G2PA 1NMVA 3RFWA 3O5GA 1W26A 2UZ5A 3WD4A 4DWSA 5BXJA 2ZQVA 4LAWA 2XPBA 3FAPA 1VF8A 3CZ8A 4P8WA 3O5EA 3WD3A 3UQAA 2PPNA 1FFRA 1HKKA 3LUOA 1BL4A 4R5EA 1HKIA 4Q7NA 1LQ0A 3ARPA 4BF8A 2XP4A 3RMEA 2XP7A 1FD9A 3O5RA 1D7HA 2DG9A 1PBKA 1EDQA 1E6ZA 4ZPWR 2DG3A 4WKFA 2KE0A 3RM4A 1D6OA 1KFWA 1E6PA 1JNDA 4DWSD 1YATA 3ARUA 3ALFA 3AS0A 4MSPA 4AY1A 3KAHA 1UR9A 2MPHA 4MGVA 4ODQA 2DT3A 1HJWA 1TCOC 4P8UA 3KZ7A 3CGNA 1U79A 2IUZA 3PR9A 3UQIA 4DRJA 1ZBKA 1UR8A 4MNKA 3O5PA 5GQBA 4NZCA 4WIWA 4U84A 1LJYA 3ARTA 3QOKA 1FKLA 2FAPA 2G8ZA 1OGBA 1H0IA 1FKTA 2PI6A 2YBTA 3KACA 1LL6A 2Y78A 1WB0A 3UF8A 4DIPA 5HBFA 4W9QA 3KAFA 3ODKA 3TCZA 1Q6HA 1FJDA 2M1IA 3B9AA 1T11A 2ZR4A 4TW6A 2ITKA 1F40A 3BXWA 4DWSB 3PRBA 3ARRA 1D7JA 4S3KA 4DWSC 2PPPA 3KAGA 1D2KA 1X6LA 2G41A 2XP3A 4ODLA 3KAIA 4L72B 4LAXA 1E15A 4IPXA 3TC5A 3ARZA 1ZCNA 2ZQUA 2DT1A 3G6MA 4TW7A 1BKFA 2DSWA 4DRMA 2F4EA 4Z2LA 2A3EA 3O5JA 2VN1A 2XP9A 1WNOA 2PV3A 1NMWA 4O2TA 2A3BA 4JYSA 4ITZA 3O5DA 1E6RA 1XHGA 1Q1CA 4DROA 1QZ2A 3B9DA 3CHEA 1W1VA 4TNSA 4Z2KA 5DIUA 1ZL1A 3VAWA 1FFQA 4P8VA 1GPFA 2KR7A 2FKEA 4DRKA 5DO2A 4MTVA 5D75A 1FKJA 1CTNA 4Z2JA 1ZU8A 3TDBA 4IT6A 1EQ3A 2AWGA 3CGMA 1EHNA 1ZB5A 3AROA 4P8XA 1LL4A 2YBUA 1D7IA 3CH9A 4MPKA 1OGGA 4URIA 3NTPA 5DF0A 1SYTA 1FKKA 1LG2A 1W9UA 3O5IA 3GPKA 1K9TA 1N1AA 2RUQA 4ODMA 4MAVA 4J4NA 4MNMA 5JH8A 4ODNA 4QIBA 2MLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW5 A;  3NI6 A;  5I98 A;  5HW8 A;  5GPG A;  1B6C A;  1P5Q A;  1F40 A;  2LKN A;  1NSG A;  2LGO A;  1JNT A;  2M2A A;  1J4R A;  1FKH A;  1PIN A;  4N19 A;  3PRB A;  1J4H A;  3IK8 A;  1D7J A;  1Q6U A;  1FKF A;  1FKB A;  2PPP A;  3KAG A;  2RUC A;  4JFL A;  2XPA A;  4DRI A;  2XP5 A;  1ROT A;  5HT1 A;  5HW6 A;  5HUA A;  3O5O A;  2XP3 A;  4ODK A;  1QPF A;  3KAI A;  4ODL A;  4TW8 A;  3JXV A;  4LAX A;  2F2D A;  4FAP A;  4IPX A;  4GIV A;  3O5L A;  4DT4 A;  1R9H A;  2KFW A;  2OFN A;  5J6E A;  3O5K A;  4G2P A;  4NNR A;  1NMV A;  2DG4 A;  3RFW A;  3O5G A;  1ZCN A;  2RUR A;  2ZQU A;  3TC5 A;  1W26 A;  2UZ5 A;  3KAD A;  4TW7 A;  5DIT A;  1BKF A;  5BXJ A;  2MF9 A;  2D9F A;  3JYJ A;  4DRM A;  5HW7 A;  1HXV A;  2F4E A;  2ZQV A;  3I6C A;  3NRK A;  3O5J A;  2KGJ A;  2XPB A;  4IQC A;  4LAW A;  2VN1 A;  3FAP A;  4TX0 A;  4DH0 A;  2XP9 A;  4LAV A;  3B7X A;  4G50 A;  2LJ4 A;  3O5E A;  3O5M A;  2PV3 A;  1NMW A;  2PPN A;  4LAY A;  4JFK A;  4O2T A;  5B8I C;  3UQA A;  4IQ2 A;  2Q5A A;  3LUO A;  2N87 A;  4W9P A;  1BL4 A;  3UI5 A;  1M5Y A;  4J4O A;  1ROU A;  4JYS A;  4BF8 A;  2XP4 A;  4FN2 A;  4JFI A;  3IKD A;  4ITZ A;  2XP7 A;  3O5D A;  1ZK6 A;  1FD9 A;  4ODP A;  1Q1C A;  3KAB A;  4C02 B;  3O5R A;  4DRO A;  2ZQS A;  4QT3 A;  1QZ2 A;  3IHZ A;  4TNS A;  4R0X A;  1D7H A;  2DG9 A;  1PBK A;  3H9R B;  5DIU A;  2DG3 A;  1FKS A;  3RGC A;  2PV1 A;  1FKI A;  2KE0 A;  1D6O A;  3JYM A;  3VAW A;  2ZR5 A;  3MDY B;  1YAT A;  2ZQT A;  3PRD A;  2M08 A;  4DRH A;  2KR7 A;  5HKG A;  1QPL A;  2FKE A;  4DRK A;  4W9O A;  2L2S A;  4MSP A;  3UQB A;  2RSE A;  1J6Y A;  3KAH A;  3KCE A;  2VCD A;  2JZV A;  1FAP A;  2MPH A;  4MGV A;  2MNT A;  4TYO A;  5D75 A;  4ODQ A;  2PV2 A;  1FKR A;  5HWC A;  1TCO C;  1A7X A;  1KT0 A;  2F21 A;  2KI3 A;  3EY6 A;  3OOB A;  4ODR A;  3KZ7 A;  5DIV A;  4DZ2 A;  3CGN A;  1U79 A;  1FKJ A;  3PA7 A;  3UQI A;  1Y0O A;  4QT2 A;  4DRJ A;  3TDB A;  1EQ3 A;  1J4I A;  1Q6I A;  2AWG A;  1FKG A;  3CGM A;  4DRQ A;  1KT1 A;  2RQS A;  4GGQ A;  1FKD A;  1D7I A;  2LPV A;  1JVW A;  3O5P A;  4U86 A;  2MLZ A;  1L1P A;  2ZR6 A;  4U84 A;  4DRN A;  1C9H A;  2MLX A;  4DRP A;  1EYM A;  2XP6 A;  2KO7 A;  3IKG A;  4JFM A;  4ODO A;  3O5Q A;  3NTP A;  3WH0 A;  2XP8 A;  1FKK A;  1JNS A;  1FKL A;  2FAP A;  4U85 A;  3O5F A;  5HTG A;  3O5I A;  3GPK A;  1FKT A;  2IF4 A;  3KAC A;  5HWB A;  1N1A A;  4JFJ A;  2Y78 A;  3UF8 A;  4DIP A;  4W9Q A;  2RUQ A;  2K8I A;  4ODM A;  3KAF A;  3UI4 A;  4DZ3 A;  3ODK A;  3TCZ A;  1Q6H A;  1FJD A;  2RUD A;  4J4N A;  2M1I A;  2PBC A;  2PPO A;  3UI6 A;  1F8A B;  1T11 A;  2ZR4 A;  4ODN A;  4QIB A;  2MLY A;  4TW6 A;  2ITK A; 
#chains in the Genus database with same CATH topology
 3NI6 A;  1B6C A;  3GTY X;  2LKN A;  1SR0 A;  2M2A A;  1J4R A;  1FKH A;  4N19 A;  3WKZ A;  1FKB A;  3WD0 A;  4MNL A;  5HUA A;  1QPF A;  4TW8 A;  4KQZ A;  1LG1 A;  2F2D A;  2AOS A;  4HAR A;  3ARW A;  4DT4 A;  2O9O A;  1R9H A;  4NNR A;  2OLH A;  3OA5 A;  5GPR A;  5DIT A;  5HW7 A;  1ZBW A;  3JYJ A;  1HXV A;  1W1T A;  1X6N A;  3NRK A;  4TX0 A;  4IQC A;  4DH0 A;  4LAV A;  4G50 A;  3O5M A;  4JFK A;  4IQ2 A;  2N87 A;  3UI5 A;  4ZPT R;  4J4O A;  1ROU A;  1HJX A;  2ETN A;  4JFI A;  4FN2 A;  3RM9 A;  1ZK6 A;  3ARQ A;  1W1P A;  3KAB A;  4ODP A;  3ARV A;  4C02 B;  2ZQS A;  4ML4 A;  4QT3 A;  3WQV A;  4R0X A;  1LL7 A;  3H9R B;  4PTM A;  1FKS A;  3RGC A;  1XRV A;  3JYM A;  2ZR5 A;  3MDY B;  2ZQT A;  4W9O A;  4WKH A;  3UQB A;  3KCE A;  2JZV A;  4TYO A;  1OWQ A;  4UDM A;  1FKR A;  5HWC A;  1A7X A;  1KT0 A;  2F21 A;  2KI3 A;  2WM0 A;  3EY6 A;  3OOB A;  4ODR A;  3B9E A;  4KR0 B;  3W4R A;  1J4I A;  1FKG A;  1KT1 A;  1W9V A;  1E9L A;  4HBE A;  4U86 A;  1JVW A;  1L1P A;  2ZR6 A;  2FDM A;  2A3C A;  2MLX A;  1GOI A;  2XP6 A;  3B8S A;  3IKG A;  4JFM A;  1TFV A;  3O5Q A;  4MNJ A;  3WL1 A;  2XP8 A;  1O6I A;  4ZPV R;  1GUV A;  5HTG A;  2IF4 A;  4S3J A;  3WD2 A;  2DT2 A;  2RUD A;  2PPO A;  3UI6 A;  1YW5 A;  4Z2G A;  4Z2I A;  3WIJ A;  5HW8 A;  1P5Q A;  1NSG A;  4QZV B;  5DEZ A;  1PIN A;  3FXY A;  3AS1 A;  1Q6U A;  1FKF A;  2XPA A;  4DRI A;  4WJX A;  5HT1 A;  4ODK A;  3ARY A;  3WQW A;  4FAP A;  1W9P A;  4GIV A;  1ZBC A;  3O5L A;  2OFN A;  2WLZ A;  2DG4 A;  2RUR A;  3KAD A;  2QF8 A;  2MF9 A;  2D9F A;  2DSU A;  1E6N A;  3I6C A;  4ZS6 A;  2KGJ A;  3FY1 A;  2A3A A;  3B7X A;  2LJ4 A;  2PN0 A;  4LAY A;  3ALG A;  3AS3 A;  5B8I C;  1ITX A;  1EIB A;  3ARX A;  4IT4 A;  3CHC A;  2Q5A A;  4W9P A;  4WKA A;  2O92 A;  1M5Y A;  3AQU A;  4W5U A;  2DT0 A;  3IKD A;  4Q22 A;  3IHZ A;  4LGX A;  2PV1 A;  1FKI A;  1W1Y A;  3WD1 A;  3CHF A;  3EIP A;  4DRH A;  3PRD A;  2M08 A;  5HKG A;  1QPL A;  1RD6 A;  4WK9 A;  2L2S A;  3ARS A;  2RSE A;  1J6Y A;  2VCD A;  1FAP A;  2MNT A;  3WL0 A;  2PV2 A;  5DIV A;  2ESC A;  4DZ2 A;  3PA7 A;  1Y0O A;  4QT2 A;  2DSV A;  1Q6I A;  2B31 A;  4DRQ A;  2RQS A;  2DPE A;  4GGQ A;  1FKD A;  2LPV A;  2MLZ A;  4DRN A;  3G6L A;  1C9H A;  1HJV A;  4DRP A;  1EYM A;  2KO7 A;  4ODO A;  1NWT A;  4L3N A;  1ZBV A;  3WH0 A;  1IX5 A;  2P4V A;  1JNS A;  1NH6 A;  3CHD A;  4U85 A;  3O5F A;  3RM8 A;  1HKM A;  2DSZ A;  5HWB A;  4JFJ A;  1NWU A;  2WLY A;  3UI4 A;  2K8I A;  1JNE A;  4DZ3 A;  1NWR A;  2PBC A;  2WK2 A;  2F23 A;  1F8A B;  1NWS A;  4HBO A;  3AS2 A;  4XAK A;  5I98 A;  5GPG A;  4NSB A;  1HKJ A;  2LGO A;  1JNT A;  1J4H A;  3IK8 A;  1H0G A;  4Z2H A;  4JFL A;  2RUC A;  2XP5 A;  1ROT A;  5HW6 A;  3O5O A;  3JXV A;  2KFW A;  5J6E A;  3PRA A;  3O5K A;  1WAW A;  4G2P A;  1NMV A;  3RFW A;  3O5G A;  2EUL A;  1W26 A;  2UZ5 A;  3WD4 A;  4DWS A;  5BXJ A;  2ZQV A;  4LAW A;  2XPB A;  1GRJ A;  3FAP A;  1VF8 A;  3CZ8 A;  4P8W A;  3O5E A;  3WD3 A;  3UQA A;  2PPN A;  1FFR A;  1HKK A;  3LUO A;  1BL4 A;  4R5E A;  1HKI A;  4Q7N A;  1LQ0 A;  3ARP A;  4BF8 A;  2XP4 A;  3RME A;  2XP7 A;  1FD9 A;  3O5R A;  1D7H A;  2DG9 A;  1PBK A;  1EDQ A;  1E6Z A;  4ZPW R;  2DG3 A;  4WKF A;  2KE0 A;  3RM4 A;  1D6O A;  1KFW A;  1E6P A;  1JND A;  4DWS D;  1YAT A;  3ARU A;  3ALF A;  3AS0 A;  4MSP A;  4AY1 A;  3KAH A;  1UR9 A;  2MPH A;  4MGV A;  4ODQ A;  2DT3 A;  1HJW A;  1TCO C;  4P8U A;  3KZ7 A;  3CGN A;  1U79 A;  2IUZ A;  3PR9 A;  3UQI A;  4DRJ A;  1ZBK A;  1UR8 A;  4MNK A;  3O5P A;  5GQB A;  4NZC A;  4WIW A;  4U84 A;  1LJY A;  3ART A;  3QOK A;  1FKL A;  2FAP A;  2G8Z A;  1OGB A;  1H0I A;  2YBT A;  1FKT A;  2PI6 A;  3KAC A;  3GU0 A;  1LL6 A;  1E44 A;  2Y78 A;  1WB0 A;  3UF8 A;  4DIP A;  5HBF A;  4W9Q A;  3KAF A;  3ODK A;  3TCZ A;  1Q6H A;  1FJD A;  2M1I A;  3B9A A;  1T11 A;  2ZR4 A;  4TW6 A;  2ITK A;  1F40 A;  3BXW A;  4DWS B;  3PRB A;  3ARR A;  1D7J A;  4S3K A;  4DWS C;  2PPP A;  3KAG A;  1D2K A;  1X6L A;  2G41 A;  2XP3 A;  4ODL A;  3KAI A;  4L72 B;  4LAX A;  1E15 A;  4IPX A;  3TC5 A;  3ARZ A;  1ZCN A;  2ZQU A;  2DT1 A;  3G6M A;  4TW7 A;  1BKF A;  2DSW A;  4DRM A;  2F4E A;  4Z2L A;  2A3E A;  3O5J A;  2VN1 A;  2XP9 A;  1WNO A;  2PV3 A;  1NMW A;  4O2T A;  2A3B A;  2B5U B;  1JCH B;  4JYS A;  4ITZ A;  3O5D A;  1E6R A;  1XHG A;  1Q1C A;  4DRO A;  1QZ2 A;  3B9D A;  3CHE A;  1W1V A;  4TNS A;  4Z2K A;  5DIU A;  1ZL1 A;  3VAW A;  1FFQ A;  4P8V A;  1GPF A;  2KR7 A;  2FKE A;  4DRK A;  5DO2 A;  4MTV A;  5D75 A;  1FKJ A;  1CTN A;  4Z2J A;  1ZU8 A;  3TDB A;  4IT6 A;  1EQ3 A;  2AWG A;  3CGM A;  1EHN A;  1ZB5 A;  3ARO A;  4P8X A;  1LL4 A;  2YBU A;  1D7I A;  3BMB A;  3CH9 A;  4MPK A;  1OGG A;  4URI A;  3NTP A;  5DF0 A;  1SYT A;  1FKK A;  1LG2 A;  1W9U A;  3O5I A;  3GPK A;  1K9T A;  1N1A A;  2RUQ A;  4ODM A;  4MAV A;  4J4N A;  4MNM A;  5JH8 A;  4ODN A;  4QIB A;  2MLY A; 
#chains in the Genus database with same CATH homology
 3NI6 A;  1B6C A;  2LKN A;  1SR0 A;  2M2A A;  1J4R A;  1FKH A;  4N19 A;  3WKZ A;  1FKB A;  3WD0 A;  4MNL A;  5HUA A;  1QPF A;  4TW8 A;  4KQZ A;  1LG1 A;  2F2D A;  2AOS A;  4HAR A;  3ARW A;  4DT4 A;  2O9O A;  1R9H A;  4NNR A;  2OLH A;  3OA5 A;  5GPR A;  5DIT A;  5HW7 A;  1ZBW A;  3JYJ A;  1HXV A;  1W1T A;  1X6N A;  3NRK A;  4TX0 A;  4IQC A;  4DH0 A;  4LAV A;  4G50 A;  3O5M A;  4JFK A;  4IQ2 A;  2N87 A;  3UI5 A;  4ZPT R;  4J4O A;  1ROU A;  1HJX A;  4JFI A;  4FN2 A;  3RM9 A;  1ZK6 A;  3ARQ A;  1W1P A;  3KAB A;  4ODP A;  3ARV A;  4C02 B;  2ZQS A;  4ML4 A;  4QT3 A;  3WQV A;  4R0X A;  1LL7 A;  3H9R B;  4PTM A;  1FKS A;  3RGC A;  1XRV A;  3JYM A;  2ZR5 A;  3MDY B;  2ZQT A;  4W9O A;  4WKH A;  3UQB A;  3KCE A;  2JZV A;  4TYO A;  1OWQ A;  1FKR A;  5HWC A;  1A7X A;  1KT0 A;  2F21 A;  2KI3 A;  2WM0 A;  3EY6 A;  3OOB A;  4ODR A;  3B9E A;  4KR0 B;  3W4R A;  1J4I A;  1FKG A;  1KT1 A;  1W9V A;  1E9L A;  4HBE A;  4U86 A;  1JVW A;  1L1P A;  2ZR6 A;  2FDM A;  2A3C A;  2MLX A;  1GOI A;  2XP6 A;  3B8S A;  3IKG A;  4JFM A;  1TFV A;  3O5Q A;  4MNJ A;  3WL1 A;  2XP8 A;  1O6I A;  4ZPV R;  1GUV A;  5HTG A;  2IF4 A;  4S3J A;  3WD2 A;  2DT2 A;  2RUD A;  2PPO A;  3UI6 A;  1YW5 A;  4Z2G A;  4Z2I A;  3WIJ A;  5HW8 A;  1P5Q A;  1NSG A;  4QZV B;  5DEZ A;  1PIN A;  3FXY A;  3AS1 A;  1Q6U A;  1FKF A;  2XPA A;  4DRI A;  4WJX A;  5HT1 A;  4ODK A;  3ARY A;  3WQW A;  4FAP A;  1W9P A;  4GIV A;  1ZBC A;  3O5L A;  2OFN A;  2WLZ A;  2DG4 A;  2RUR A;  3KAD A;  2QF8 A;  2MF9 A;  2D9F A;  2DSU A;  1E6N A;  3I6C A;  4ZS6 A;  2KGJ A;  3FY1 A;  2A3A A;  3B7X A;  2LJ4 A;  4LAY A;  3ALG A;  3AS3 A;  5B8I C;  1ITX A;  1EIB A;  3ARX A;  4IT4 A;  3CHC A;  2Q5A A;  4W9P A;  4WKA A;  2O92 A;  1M5Y A;  3AQU A;  4W5U A;  2DT0 A;  3IKD A;  4Q22 A;  3IHZ A;  4LGX A;  2PV1 A;  1FKI A;  1W1Y A;  3WD1 A;  3CHF A;  4DRH A;  3PRD A;  2M08 A;  5HKG A;  1QPL A;  1RD6 A;  4WK9 A;  2L2S A;  3ARS A;  2RSE A;  1J6Y A;  2VCD A;  1FAP A;  2MNT A;  3WL0 A;  2PV2 A;  5DIV A;  2ESC A;  4DZ2 A;  3PA7 A;  1Y0O A;  4QT2 A;  2DSV A;  1Q6I A;  2B31 A;  4DRQ A;  2RQS A;  2DPE A;  4GGQ A;  1FKD A;  2LPV A;  2MLZ A;  4DRN A;  3G6L A;  1C9H A;  1HJV A;  4DRP A;  1EYM A;  2KO7 A;  4ODO A;  1NWT A;  4L3N A;  1ZBV A;  3WH0 A;  1IX5 A;  1JNS A;  1NH6 A;  3CHD A;  4U85 A;  3O5F A;  3RM8 A;  1HKM A;  2DSZ A;  5HWB A;  4JFJ A;  1NWU A;  2WLY A;  3UI4 A;  2K8I A;  1JNE A;  4DZ3 A;  1NWR A;  2PBC A;  2WK2 A;  1F8A B;  1NWS A;  4HBO A;  3AS2 A;  4XAK A;  5I98 A;  5GPG A;  4NSB A;  1HKJ A;  2LGO A;  1JNT A;  1J4H A;  3IK8 A;  1H0G A;  4Z2H A;  4JFL A;  2RUC A;  2XP5 A;  1ROT A;  5HW6 A;  3O5O A;  3JXV A;  2KFW A;  5J6E A;  3PRA A;  3O5K A;  1WAW A;  4G2P A;  1NMV A;  3RFW A;  3O5G A;  1W26 A;  2UZ5 A;  3WD4 A;  4DWS A;  5BXJ A;  2ZQV A;  4LAW A;  2XPB A;  3FAP A;  1VF8 A;  3CZ8 A;  4P8W A;  3O5E A;  3WD3 A;  3UQA A;  2PPN A;  1FFR A;  1HKK A;  3LUO A;  1BL4 A;  4R5E A;  1HKI A;  4Q7N A;  1LQ0 A;  3ARP A;  4BF8 A;  2XP4 A;  3RME A;  2XP7 A;  1FD9 A;  3O5R A;  1D7H A;  2DG9 A;  1PBK A;  1EDQ A;  1E6Z A;  4ZPW R;  2DG3 A;  4WKF A;  2KE0 A;  3RM4 A;  1D6O A;  1KFW A;  1E6P A;  1JND A;  4DWS D;  1YAT A;  3ARU A;  3ALF A;  3AS0 A;  4MSP A;  4AY1 A;  3KAH A;  1UR9 A;  2MPH A;  4MGV A;  4ODQ A;  2DT3 A;  1HJW A;  1TCO C;  4P8U A;  3KZ7 A;  3CGN A;  1U79 A;  2IUZ A;  3PR9 A;  3UQI A;  4DRJ A;  1ZBK A;  1UR8 A;  4MNK A;  3O5P A;  5GQB A;  4NZC A;  4WIW A;  4U84 A;  1LJY A;  3ART A;  3QOK A;  1FKL A;  2FAP A;  2G8Z A;  1OGB A;  1H0I A;  1FKT A;  2PI6 A;  2YBT A;  3KAC A;  1LL6 A;  2Y78 A;  1WB0 A;  3UF8 A;  4DIP A;  5HBF A;  4W9Q A;  3KAF A;  3ODK A;  3TCZ A;  1Q6H A;  1FJD A;  2M1I A;  3B9A A;  1T11 A;  2ZR4 A;  4TW6 A;  2ITK A;  1F40 A;  3BXW A;  4DWS B;  3PRB A;  3ARR A;  1D7J A;  4S3K A;  4DWS C;  2PPP A;  3KAG A;  1D2K A;  1X6L A;  2G41 A;  2XP3 A;  4ODL A;  3KAI A;  4L72 B;  4LAX A;  1E15 A;  4IPX A;  3TC5 A;  3ARZ A;  1ZCN A;  2ZQU A;  2DT1 A;  3G6M A;  4TW7 A;  1BKF A;  2DSW A;  4DRM A;  2F4E A;  4Z2L A;  2A3E A;  3O5J A;  2VN1 A;  2XP9 A;  1WNO A;  2PV3 A;  1NMW A;  4O2T A;  2A3B A;  4JYS A;  4ITZ A;  3O5D A;  1E6R A;  1XHG A;  1Q1C A;  4DRO A;  1QZ2 A;  3B9D A;  3CHE A;  1W1V A;  4TNS A;  4Z2K A;  5DIU A;  1ZL1 A;  3VAW A;  1FFQ A;  4P8V A;  1GPF A;  2KR7 A;  2FKE A;  4DRK A;  5DO2 A;  4MTV A;  5D75 A;  1FKJ A;  1CTN A;  4Z2J A;  1ZU8 A;  3TDB A;  4IT6 A;  1EQ3 A;  2AWG A;  3CGM A;  1EHN A;  1ZB5 A;  3ARO A;  4P8X A;  1LL4 A;  2YBU A;  1D7I A;  3CH9 A;  4MPK A;  1OGG A;  4URI A;  3NTP A;  5DF0 A;  1SYT A;  1FKK A;  1LG2 A;  1W9U A;  3O5I A;  3GPK A;  1K9T A;  1N1A A;  2RUQ A;  4ODM A;  4MAV A;  4J4N A;  4MNM A;  5JH8 A;  4ODN A;  4QIB A;  2MLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...