4IPXA

Analyzing the visible conformational substates of the fk506 binding protein fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Analysing the visible conformational substates of the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4ipxA00
1J4RA 2FAPA 3OOBA 3I6CA 4DRPA 3O5JA 2Y78A 2M08A 3LUOA 4JFLA 3KCEA 3TDBA 5HT1A 3TCZA 4N19A 1NMWA 2MLYA 1FKFA 1F8AB 2IF4A 3UI5A 1Y0OA 4DT4A 1ROTA 1P5QA 4LAVA 3KADA 1Q6IA 4O2TA 4TW6A 4IQ2A 2N87A 2XP8A 1T11A 2JZVA 2LGOA 2F21A 4ODMA 4DIPA 4TW8A 1U79A 2DG9A 3IHZA 1FKHA 3FAPA 2PV1A 3O5DA 2MLZA 4QIBA 2OFNA 3PA7A 4GIVA 3RFWA 4LAYA 1YATA 2DG4A 2PBCA 3TC5A 2ZQSA 4ODNA 1J4HA 3O5EA 4JYSA 3O5QA 2KFWA 1FKRA 1FAPA 2PPOA 5HWBA 1HXVA 4U86A 2L2SA 1C9HA 3PRDA 5HWCA 2MNTA 1Q6HA 5HW6A 3KZ7A 3UQAA 2LKNA 4TW7A 1J6YA 5DIVA 2KGJA 3IKGA 3CGNA 4U85A 1D7JA 4DRIA 2LPVA 1FKGA 5HUAA 3UQBA 1D7IA 4MGVA 3KAIA 1FKTA 2XP3A 3WH0A 2XPAA 4MSPA 5I98A 1D6OA 1FKDA 1FKLA 1JVWA 3NRKA 1QPLA 4DRKA 1ZCNA 2RSEA 2ZQUA 3KAGA 4DRMA 5B8IC 3UI4A 1FKSA 1KT1A 1PBKA 3KACA 4TNSA 5BXJA 1BKFA 1NMVA 2XPBA 4J4OA 1BL4A 2ZR4A 1QPFA 4G2PA 4ODRA 3JYJA 2M2AA 5DITA 2RUQA 2PPNA 4LAWA 3O5OA 4ODLA 1Q1CA 4W9OA 4NNRA 1TCOC 2XP5A 4GGQA 5D75A 1FJDA 1J4IA 3O5MA 4JFJA 2RUCA 2PV3A 2ZR5A 4C02B 1FKBA 1NSGA 3IK8A 3VAWA 1YW5A 5HTGA 2RUDA 2KE0A 2AWGA 2PV2A 1ZK6A 3IKDA 1FKIA 4BF8A 2ZQTA 2MPHA 2F4EA 5HW7A 3UI6A 3O5RA 4JFMA 3JXVA 1B6CA 2KO7A 2RURA 4QT2A 4DRHA 2LJ4A 3JYMA 4R0XA 4FN2A 1D7HA 1FKJA 3O5GA 2PPPA 4W9QA 5DIUA 1ROUA 2F2DA 2Q5AA 3NI6A 4ITZA 4J4NA 2VN1A 2XP6A 4LAXA 1L1PA 1W26A 3O5IA 4TYOA 4U84A 3O5KA 4JFKA 4IQCA 4DRQA 5HW8A 4ODKA 3UQIA 2ITKA 1A7XA 2M1IA 4IPXA 1JNTA 2MF9A 3B7XA 3KABA 2UZ5A 4DZ3A 4G50A 1M5YA 2ZR6A 2RQSA 2FKEA 2XP4A 3NTPA 3UF8A 4ODQA 3GPKA 2VCDA 1EYMA 3EY6A 3O5LA 5GPGA 4DRNA 2K8IA 3O5FA 1PINA 2XP9A 3ODKA 5HKGA 2KR7A 4JFIA 2KI3A 4FAPA 4ODPA 4DRJA 4DH0A 3MDYB 2D9FA 4DZ2A 1FKKA 5J6EA 2DG3A 4QT3A 3CGMA 3PRBA 3O5PA 1JNSA 1QZ2A 2XP7A 4TX0A 3KAHA 1FD9A 4ODOA 4DROA 1R9HA 3H9RB 1F40A 1N1AA 3RGCA 2ZQVA 1EQ3A 1Q6UA 2MLXA 3KAFA 4W9PA 1KT0A
chains in the Genus database with same CATH superfamily
1NH6A 3I6CA 3O5JA 1E6NA 3ARVA 4JFLA 3TCZA 5DO2A 3WD3A 1W1TA 1O6IA 1LG1A 1ZBWA 3ARPA 2P4VA 2PI6A 4Z2LA 2N87A 1ZBKA 2XP8A 1ZBCA 1UR9A 1CTNA 3O5DA 4GIVA 4NZCA 1OGGA 4QIBA 4WKFA 3O5EA 4JYSA 2O92A 4NSBA 3AROA 1HKKA 3CZ8A 2MNTA 4TW7A 3ARSA 2A3AA 3B9DA 4U85A 1FKGA 3WQVA 4MTVA 1D7IA 4MGVA 1NWTA 3RM4A 3WH0A 2XPAA 1X6LA 1JNDA 4UDMA 1ZCNA 2G41A 3KAGA 1LG2A 5GQBA 4Q7NA 4TNSA 4IT6A 2XPBA 4G2PA 1JNEA 2RUQA 4LAWA 1Q1CA 2XP5A 2B5UB 2DSVA 1WNOA 2RUCA 4P8WA 4S3JA 2KE0A 2ZQTA 4P8UA 3JXVA 3ARWA 1B6CA 4KR0B 1EIBA 1X6NA 3OA5A 3RM9A 1D7HA 1FKJA 2Q5AA 4MNJA 1L1PA 4TYOA 1ZBVA 2ITKA 2M1IA 1JNTA 3B7XA 4G50A 2RQSA 2FKEA 3NTPA 3WQWA 3GPKA 2VCDA 1EYMA 3ARQA 5HKGA 2XP9A 3BMBA 1GOIA 3GTYX 4FAPA 4ODPA 3MDYB 4DZ2A 1FKKA 5J6EA 3CGMA 2B31A 4W5UA 3KAHA 1R9HA 3H9RB 4DWSA 3RMEA 1N1AA 3RGCA 1E15A 4ZPVR 4DH0A 3CHDA 2FAPA 3WIJA 4DRPA 3B9EA 2Y78A 4Z2KA 3LUOA 2WLZA 2WLYA 1Q6IA 4MNKA 3ARXA 4ODMA 4DIPA 1OWQA 3WL1A 1U79A 3IHZA 3RFWA 2DT1A 2YBUA 1HJXA 1YATA 3TC5A 2YBTA 3ALGA 2KFWA 1FKRA 2O9OA 2PPOA 5HWBA 1HXVA 2OLHA 4U86A 2L2SA 3PRDA 5HWCA 2DT2A 2ESCA 1Q6HA 1GUVA 1J6YA 3IKGA 1EDQA 1D7JA 2QF8A 3KAIA 5I98A 4PTMA 1UR8A 1FKLA 2RSEA 3ARRA 1E6PA 4DRMA 4L72B 1FKSA 4DWSB 1BKFA 1KT0A 4J4OA 4ODRA 1QPFA 1RD6A 5DITA 1GRJA 4ODLA 4GGQA 4JFJA 2PV3A 3ALFA 3VAWA 1NWSA 3AS2A 3BXWA 1HJVA 2F4EA 3UI6A 2KO7A 2RURA 4MNMA 4QT2A 3CHFA 2LJ4A 3PRAA 3O5GA 5DIUA 1ROUA 3NI6A 4J4NA 4ITZA 1ZB5A 3O5IA 1W1PA 4ODKA 3G6MA 1A7XA 1XRVA 4WJXA 2XP4A 3AS1A 1EHNA 3UF8A 3FXYA 4HBEA 4WKHA 3ODKA 4HBOA 4P8XA 4HARA 1JNSA 1FD9A 4DROA 3ARZA 2DT3A 4ZPWR 3W4RA 4W9PA 1J4RA 3KCEA 5HT1A 3AS0A 1FKFA 1F8AB 3UI5A 1Y0OA 1ROTA 4LAVA 4TW6A 3KADA 2LGOA 1LL6A 2DPEA 1HKMA 1FKHA 4Z2GA 2MLZA 3CHEA 4LAYA 2PBCA 1HKJA 3O5QA 1FAPA 3ARTA 1C9HA 1OGBA 5HW6A 3KZ7A 2LKNA 4ZS6A 5DIVA 4QZVB 3CGNA 3UQBA 4DRIA 2LPVA 5HUAA 4R5EA 4ML4A 1FKTA 2XP3A 5DF0A 1D6OA 2A3BA 3NRKA 4WK9A 3ARUA 2PN0A 4DRKA 4P8VA 2G8ZA 5B8IC 2A3CA 3UI4A 1KT1A 2FDMA 3PR9A 1NMVA 1BL4A 3JYJA 2M2AA 2EULA 4W9OA 1K9TA 1TCOC 5DEZA 5D75A 1FJDA 3O5MA 2ZR5A 1FFRA 1FKBA 1VF8A 1E6ZA 2AWGA 2PV2A 4BF8A 3EIPA 5HW7A 2IUZA 3O5RA 4DRHA 4FN2A 1GPFA 1TFVA 2PPPA 4W9QA 2F2DA 1W9PA 2VN1A 2XP6A 5HW8A 1NWRA 4IPXA 1NWUA 2MF9A 2DT0A 2UZ5A 3KABA 3QOKA 1M5YA 2ZR6A 1E44A 4IT4A 3O5LA 5GPGA 1W9UA 3O5FA 2KR7A 1KFWA 4DRJA 2D9FA 1FFQA 2DSWA 2DG3A 4QT3A 1H0GA 4WIWA 2ETNA 2WK2A 4MAVA 4TX0A 3B9AA 1IX5A 4ODOA 5JH8A 1Q6UA 2MLXA 2ZQUA 3OOBA 2DSUA 2M08A 3WD2A 3TDBA 3WKZA 3G6LA 1E9LA 4N19A 4DWSC 1NMWA 2MLYA 1LJYA 2IF4A 4DT4A 3WD0A 1P5QA 4O2TA 4IQ2A 1T11A 2JZVA 2F21A 4TW8A 2DG9A 3FAPA 2PV1A 2OFNA 3PA7A 2DG4A 3FY1A 2ZQSA 2WM0A 1J4HA 4ODNA 4ZPTR 1W1YA 4L3NA 1H0IA 5GPRA 1ITXA 3UQAA 4Z2IA 2KGJA 1LL4A 3CHCA 4MSPA 1XHGA 4LGXA 4Z2JA 1FKDA 4Z2HA 1JVWA 5HBFA 3WD1A 1QPLA 1SR0A 4S3KA 1ZL1A 1PBKA 3KACA 2A3EA 5BXJA 3RM8A 2ZR4A 1HKIA 2PPNA 3O5OA 1E6RA 2AOSA 4NNRA 1J4IA 4C02B 1W1VA 1D2KA 1NSGA 3IK8A 5HTGA 1YW5A 4Q22A 2RUDA 1LQ0A 1WB0A 3IKDA 1ZK6A 1FKIA 3WL0A 2MPHA 1ZU8A 3WD4A 4JFMA 2DSZA 3GU0A 3JYMA 4R0XA 4XAKA 3B8SA 4LAXA 1W26A 4U84A 3ARYA 3O5KA 4JFKA 4IQCA 4DRQA 3UQIA 4MPKA 1SYTA 1LL7A 1W9VA 4DZ3A 3CH9A 4ODQA 2F23A 3EY6A 4DRNA 4WKAA 1JCHB 2K8IA 1PINA 4JFIA 4AY1A 2KI3A 1HJWA 4DWSD 3PRBA 4MNLA 3O5PA 1QZ2A 2XP7A 4KQZA 1WAWA 3AS3A 4URIA 1F40A 1EQ3A 2ZQVA 3KAFA 3AQUA
chains in the Genus database with same CATH topology
1NH6A 3I6CA 3O5JA 1E6NA 3ARVA 4JFLA 3TCZA 5DO2A 3WD3A 1W1TA 1O6IA 1LG1A 1ZBWA 3ARPA 2PI6A 4Z2LA 2N87A 1ZBKA 2XP8A 1ZBCA 1UR9A 1CTNA 3O5DA 4GIVA 4NZCA 1OGGA 4QIBA 4WKFA 3O5EA 4JYSA 2O92A 4NSBA 3AROA 1HKKA 3CZ8A 2MNTA 4TW7A 3ARSA 2A3AA 3B9DA 4U85A 1FKGA 3WQVA 4MTVA 1D7IA 4MGVA 1NWTA 3RM4A 3WH0A 2XPAA 1X6LA 1JNDA 1ZCNA 2G41A 3KAGA 1LG2A 5GQBA 4Q7NA 4TNSA 4IT6A 2XPBA 4G2PA 1JNEA 2RUQA 4LAWA 1Q1CA 2XP5A 2DSVA 1WNOA 2RUCA 4P8WA 4S3JA 2KE0A 2ZQTA 4P8UA 3JXVA 3ARWA 1B6CA 4KR0B 1EIBA 1X6NA 3OA5A 3RM9A 1D7HA 1FKJA 2Q5AA 4MNJA 1L1PA 4TYOA 1ZBVA 2ITKA 2M1IA 1JNTA 3B7XA 4G50A 2RQSA 2FKEA 3NTPA 3WQWA 3GPKA 2VCDA 1EYMA 3ARQA 5HKGA 2XP9A 1GOIA 4FAPA 4ODPA 3MDYB 4DZ2A 1FKKA 5J6EA 3CGMA 2B31A 4W5UA 3KAHA 1R9HA 3H9RB 4DWSA 3RMEA 1N1AA 3RGCA 1E15A 4ZPVR 4DH0A 3CHDA 2FAPA 3WIJA 4DRPA 3B9EA 2Y78A 4Z2KA 3LUOA 2WLZA 2WLYA 1Q6IA 4MNKA 3ARXA 4ODMA 4DIPA 1OWQA 3WL1A 1U79A 3IHZA 3RFWA 2DT1A 2YBUA 1HJXA 1YATA 3TC5A 2YBTA 3ALGA 2KFWA 1FKRA 2O9OA 2PPOA 5HWBA 1HXVA 2OLHA 4U86A 2L2SA 3PRDA 5HWCA 2DT2A 2ESCA 1Q6HA 1GUVA 1J6YA 3IKGA 1EDQA 1D7JA 2QF8A 3KAIA 5I98A 4PTMA 1UR8A 1FKLA 2RSEA 3ARRA 1E6PA 4DRMA 4L72B 1FKSA 4DWSB 1BKFA 1KT0A 4J4OA 4ODRA 1QPFA 1RD6A 5DITA 4ODLA 4GGQA 4JFJA 2PV3A 3ALFA 3VAWA 1NWSA 3AS2A 3BXWA 1HJVA 2F4EA 3UI6A 2KO7A 2RURA 4MNMA 4QT2A 3CHFA 2LJ4A 3PRAA 3O5GA 5DIUA 1ROUA 3NI6A 4J4NA 4ITZA 1ZB5A 3O5IA 1W1PA 4ODKA 3G6MA 1A7XA 1XRVA 4WJXA 2XP4A 3AS1A 1EHNA 3UF8A 3FXYA 4HBEA 4WKHA 3ODKA 4HBOA 4P8XA 4HARA 1JNSA 1FD9A 4DROA 3ARZA 2DT3A 4ZPWR 3W4RA 4W9PA 1J4RA 3KCEA 5HT1A 3AS0A 1FKFA 1F8AB 3UI5A 1Y0OA 1ROTA 4LAVA 4TW6A 3KADA 2LGOA 1LL6A 2DPEA 1HKMA 1FKHA 4Z2GA 2MLZA 3CHEA 4LAYA 2PBCA 1HKJA 3O5QA 1FAPA 3ARTA 1C9HA 1OGBA 5HW6A 3KZ7A 2LKNA 4ZS6A 5DIVA 4QZVB 3CGNA 3UQBA 4DRIA 2LPVA 5HUAA 4R5EA 4ML4A 1FKTA 2XP3A 5DF0A 1D6OA 2A3BA 3NRKA 4WK9A 3ARUA 4DRKA 4P8VA 2G8ZA 5B8IC 2A3CA 3UI4A 1KT1A 2FDMA 3PR9A 1NMVA 1BL4A 3JYJA 2M2AA 4W9OA 1K9TA 1TCOC 5DEZA 5D75A 1FJDA 3O5MA 2ZR5A 1FFRA 1FKBA 1VF8A 1E6ZA 2AWGA 2PV2A 4BF8A 5HW7A 2IUZA 3O5RA 4DRHA 4FN2A 1GPFA 1TFVA 2PPPA 4W9QA 2F2DA 1W9PA 2VN1A 2XP6A 5HW8A 1NWRA 4IPXA 1NWUA 2MF9A 2DT0A 2UZ5A 3KABA 3QOKA 1M5YA 2ZR6A 4IT4A 3O5LA 5GPGA 1W9UA 3O5FA 2KR7A 1KFWA 4DRJA 2D9FA 1FFQA 2DSWA 2DG3A 4QT3A 1H0GA 4WIWA 2WK2A 4MAVA 4TX0A 3B9AA 1IX5A 4ODOA 5JH8A 1Q6UA 2MLXA 2ZQUA 3OOBA 2DSUA 2M08A 3WD2A 3TDBA 3WKZA 3G6LA 1E9LA 4N19A 4DWSC 1NMWA 2MLYA 1LJYA 2IF4A 4DT4A 3WD0A 1P5QA 4O2TA 4IQ2A 1T11A 2JZVA 2F21A 4TW8A 2DG9A 3FAPA 2PV1A 2OFNA 3PA7A 2DG4A 3FY1A 2ZQSA 2WM0A 1J4HA 4ODNA 4ZPTR 1W1YA 4L3NA 1H0IA 5GPRA 1ITXA 3UQAA 4Z2IA 2KGJA 1LL4A 3CHCA 4MSPA 1XHGA 4LGXA 4Z2JA 1FKDA 4Z2HA 1JVWA 5HBFA 3WD1A 1QPLA 1SR0A 4S3KA 1ZL1A 1PBKA 3KACA 2A3EA 5BXJA 3RM8A 2ZR4A 1HKIA 2PPNA 3O5OA 1E6RA 2AOSA 4NNRA 1J4IA 4C02B 1W1VA 1D2KA 1NSGA 3IK8A 5HTGA 1YW5A 4Q22A 2RUDA 1LQ0A 1WB0A 3IKDA 1ZK6A 1FKIA 3WL0A 2MPHA 1ZU8A 3WD4A 4JFMA 2DSZA 3JYMA 4R0XA 4XAKA 3B8SA 4LAXA 1W26A 4U84A 3ARYA 3O5KA 4JFKA 4IQCA 4DRQA 3UQIA 4MPKA 1SYTA 1LL7A 1W9VA 4DZ3A 3CH9A 4ODQA 3EY6A 4DRNA 4WKAA 2K8IA 1PINA 4JFIA 4AY1A 2KI3A 1HJWA 4DWSD 3PRBA 4MNLA 3O5PA 1QZ2A 2XP7A 4KQZA 1WAWA 3AS3A 4URIA 1F40A 1EQ3A 2ZQVA 3KAFA 3AQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4R A;  2FAP A;  3OOB A;  3I6C A;  4DRP A;  3O5J A;  2Y78 A;  2M08 A;  3LUO A;  4JFL A;  3KCE A;  3TDB A;  5HT1 A;  3TCZ A;  4N19 A;  1NMW A;  2MLY A;  1FKF A;  1F8A B;  2IF4 A;  3UI5 A;  1Y0O A;  4DT4 A;  1ROT A;  1P5Q A;  4LAV A;  3KAD A;  1Q6I A;  4O2T A;  4TW6 A;  4IQ2 A;  2N87 A;  2XP8 A;  1T11 A;  2JZV A;  2LGO A;  2F21 A;  4ODM A;  4DIP A;  4TW8 A;  1U79 A;  2DG9 A;  3IHZ A;  1FKH A;  3FAP A;  2PV1 A;  3O5D A;  2MLZ A;  4QIB A;  2OFN A;  3PA7 A;  4GIV A;  3RFW A;  4LAY A;  1YAT A;  2DG4 A;  2PBC A;  3TC5 A;  2ZQS A;  4ODN A;  1J4H A;  3O5E A;  4JYS A;  3O5Q A;  2KFW A;  1FKR A;  1FAP A;  2PPO A;  5HWB A;  1HXV A;  4U86 A;  2L2S A;  1C9H A;  3PRD A;  5HWC A;  2MNT A;  1Q6H A;  5HW6 A;  3KZ7 A;  3UQA A;  2LKN A;  4TW7 A;  1J6Y A;  5DIV A;  2KGJ A;  3IKG A;  3CGN A;  4U85 A;  1D7J A;  4DRI A;  2LPV A;  1FKG A;  5HUA A;  3UQB A;  1D7I A;  4MGV A;  3KAI A;  1FKT A;  2XP3 A;  3WH0 A;  2XPA A;  4MSP A;  5I98 A;  1D6O A;  1FKD A;  1FKL A;  1JVW A;  3NRK A;  1QPL A;  4DRK A;  1ZCN A;  2RSE A;  2ZQU A;  3KAG A;  4DRM A;  5B8I C;  3UI4 A;  1FKS A;  1KT1 A;  1PBK A;  3KAC A;  4TNS A;  5BXJ A;  1BKF A;  1NMV A;  2XPB A;  4J4O A;  1BL4 A;  2ZR4 A;  1QPF A;  4G2P A;  4ODR A;  3JYJ A;  2M2A A;  5DIT A;  2RUQ A;  2PPN A;  4LAW A;  3O5O A;  4ODL A;  1Q1C A;  4W9O A;  4NNR A;  1TCO C;  2XP5 A;  4GGQ A;  5D75 A;  1FJD A;  1J4I A;  3O5M A;  4JFJ A;  2RUC A;  2PV3 A;  2ZR5 A;  4C02 B;  1FKB A;  1NSG A;  3IK8 A;  3VAW A;  1YW5 A;  5HTG A;  2RUD A;  2KE0 A;  2AWG A;  2PV2 A;  1ZK6 A;  3IKD A;  1FKI A;  4BF8 A;  2ZQT A;  2MPH A;  2F4E A;  5HW7 A;  3UI6 A;  3O5R A;  4JFM A;  3JXV A;  1B6C A;  2KO7 A;  2RUR A;  4QT2 A;  4DRH A;  2LJ4 A;  3JYM A;  4R0X A;  4FN2 A;  1D7H A;  1FKJ A;  3O5G A;  2PPP A;  4W9Q A;  5DIU A;  1ROU A;  2F2D A;  2Q5A A;  3NI6 A;  4ITZ A;  4J4N A;  2VN1 A;  2XP6 A;  4LAX A;  1L1P A;  1W26 A;  3O5I A;  4TYO A;  4U84 A;  3O5K A;  4JFK A;  4IQC A;  4DRQ A;  5HW8 A;  4ODK A;  3UQI A;  2ITK A;  1A7X A;  2M1I A;  4IPX A;  1JNT A;  2MF9 A;  3B7X A;  3KAB A;  2UZ5 A;  4DZ3 A;  4G50 A;  1M5Y A;  2ZR6 A;  2RQS A;  2FKE A;  2XP4 A;  3NTP A;  3UF8 A;  4ODQ A;  3GPK A;  2VCD A;  1EYM A;  3EY6 A;  3O5L A;  5GPG A;  4DRN A;  2K8I A;  3O5F A;  1PIN A;  2XP9 A;  3ODK A;  5HKG A;  2KR7 A;  4JFI A;  2KI3 A;  4FAP A;  4ODP A;  4DRJ A;  4DH0 A;  3MDY B;  2D9F A;  4DZ2 A;  1FKK A;  5J6E A;  2DG3 A;  4QT3 A;  3CGM A;  3PRB A;  3O5P A;  1JNS A;  1QZ2 A;  2XP7 A;  4TX0 A;  3KAH A;  1FD9 A;  4ODO A;  4DRO A;  1R9H A;  3H9R B;  1F40 A;  1N1A A;  3RGC A;  2ZQV A;  1EQ3 A;  1Q6U A;  2MLX A;  3KAF A;  4W9P A;  1KT0 A; 
#chains in the Genus database with same CATH topology
 1NH6 A;  3I6C A;  3O5J A;  1E6N A;  3ARV A;  4JFL A;  3TCZ A;  5DO2 A;  3WD3 A;  1W1T A;  1O6I A;  1LG1 A;  1ZBW A;  3ARP A;  2P4V A;  2PI6 A;  4Z2L A;  2N87 A;  1ZBK A;  2XP8 A;  1ZBC A;  1UR9 A;  1CTN A;  3O5D A;  4GIV A;  4NZC A;  1OGG A;  4QIB A;  4WKF A;  3O5E A;  4JYS A;  2O92 A;  4NSB A;  3ARO A;  1HKK A;  3CZ8 A;  2MNT A;  4TW7 A;  3ARS A;  2A3A A;  3B9D A;  4U85 A;  1FKG A;  3WQV A;  4MTV A;  1D7I A;  4MGV A;  1NWT A;  3RM4 A;  3WH0 A;  2XPA A;  1X6L A;  1JND A;  4UDM A;  1ZCN A;  2G41 A;  3KAG A;  1LG2 A;  5GQB A;  4Q7N A;  4TNS A;  4IT6 A;  2XPB A;  4G2P A;  1JNE A;  2RUQ A;  4LAW A;  1Q1C A;  2XP5 A;  2B5U B;  2DSV A;  1WNO A;  2RUC A;  4P8W A;  4S3J A;  2KE0 A;  2ZQT A;  4P8U A;  3JXV A;  3ARW A;  1B6C A;  4KR0 B;  1EIB A;  1X6N A;  3OA5 A;  3RM9 A;  1D7H A;  1FKJ A;  2Q5A A;  4MNJ A;  1L1P A;  4TYO A;  1ZBV A;  2ITK A;  2M1I A;  1JNT A;  3B7X A;  4G50 A;  2RQS A;  2FKE A;  3NTP A;  3WQW A;  3GPK A;  2VCD A;  1EYM A;  3ARQ A;  5HKG A;  2XP9 A;  3BMB A;  1GOI A;  3GTY X;  4FAP A;  4ODP A;  3MDY B;  4DZ2 A;  1FKK A;  5J6E A;  3CGM A;  2B31 A;  4W5U A;  3KAH A;  1R9H A;  3H9R B;  4DWS A;  3RME A;  1N1A A;  3RGC A;  1E15 A;  4ZPV R;  4DH0 A;  3CHD A;  2FAP A;  3WIJ A;  4DRP A;  3B9E A;  2Y78 A;  4Z2K A;  3LUO A;  2WLZ A;  2WLY A;  1Q6I A;  4MNK A;  3ARX A;  4ODM A;  4DIP A;  1OWQ A;  3WL1 A;  1U79 A;  3IHZ A;  3RFW A;  2DT1 A;  2YBU A;  1HJX A;  1YAT A;  3TC5 A;  2YBT A;  3ALG A;  2KFW A;  1FKR A;  2O9O A;  2PPO A;  5HWB A;  1HXV A;  2OLH A;  4U86 A;  2L2S A;  3PRD A;  5HWC A;  2DT2 A;  2ESC A;  1Q6H A;  1GUV A;  1J6Y A;  3IKG A;  1EDQ A;  1D7J A;  2QF8 A;  3KAI A;  5I98 A;  4PTM A;  1UR8 A;  1FKL A;  2RSE A;  3ARR A;  1E6P A;  4DRM A;  4L72 B;  1FKS A;  4DWS B;  1BKF A;  1KT0 A;  4J4O A;  4ODR A;  1QPF A;  1RD6 A;  5DIT A;  1GRJ A;  4ODL A;  4GGQ A;  4JFJ A;  2PV3 A;  3ALF A;  3VAW A;  1NWS A;  3AS2 A;  3BXW A;  1HJV A;  2F4E A;  3UI6 A;  2KO7 A;  2RUR A;  4MNM A;  4QT2 A;  3CHF A;  2LJ4 A;  3PRA A;  3O5G A;  5DIU A;  1ROU A;  3NI6 A;  4J4N A;  4ITZ A;  1ZB5 A;  3O5I A;  1W1P A;  4ODK A;  3G6M A;  1A7X A;  1XRV A;  4WJX A;  2XP4 A;  3AS1 A;  1EHN A;  3UF8 A;  3FXY A;  4HBE A;  4WKH A;  3ODK A;  4HBO A;  4P8X A;  4HAR A;  1JNS A;  1FD9 A;  4DRO A;  3ARZ A;  2DT3 A;  4ZPW R;  3W4R A;  4W9P A;  1J4R A;  3KCE A;  5HT1 A;  3AS0 A;  1FKF A;  1F8A B;  3UI5 A;  1Y0O A;  1ROT A;  4LAV A;  4TW6 A;  3KAD A;  2LGO A;  1LL6 A;  2DPE A;  1HKM A;  1FKH A;  4Z2G A;  2MLZ A;  3CHE A;  4LAY A;  2PBC A;  1HKJ A;  3O5Q A;  1FAP A;  3ART A;  1C9H A;  1OGB A;  5HW6 A;  3KZ7 A;  2LKN A;  4ZS6 A;  5DIV A;  4QZV B;  3CGN A;  3UQB A;  4DRI A;  2LPV A;  5HUA A;  4R5E A;  4ML4 A;  1FKT A;  2XP3 A;  5DF0 A;  1D6O A;  2A3B A;  3NRK A;  4WK9 A;  3ARU A;  2PN0 A;  4DRK A;  4P8V A;  2G8Z A;  5B8I C;  2A3C A;  3UI4 A;  1KT1 A;  2FDM A;  3PR9 A;  1NMV A;  1BL4 A;  3JYJ A;  2M2A A;  2EUL A;  4W9O A;  1K9T A;  1TCO C;  5DEZ A;  5D75 A;  1FJD A;  3O5M A;  2ZR5 A;  1FFR A;  1FKB A;  1VF8 A;  1E6Z A;  2AWG A;  2PV2 A;  4BF8 A;  3EIP A;  5HW7 A;  2IUZ A;  3O5R A;  4DRH A;  4FN2 A;  1GPF A;  1TFV A;  2PPP A;  4W9Q A;  2F2D A;  1W9P A;  2VN1 A;  2XP6 A;  5HW8 A;  1NWR A;  4IPX A;  1NWU A;  2MF9 A;  2DT0 A;  2UZ5 A;  3KAB A;  3QOK A;  1M5Y A;  2ZR6 A;  1E44 A;  4IT4 A;  3O5L A;  5GPG A;  1W9U A;  3O5F A;  2KR7 A;  1KFW A;  4DRJ A;  2D9F A;  1FFQ A;  2DSW A;  2DG3 A;  4QT3 A;  1H0G A;  4WIW A;  2ETN A;  2WK2 A;  4MAV A;  4TX0 A;  3B9A A;  1IX5 A;  4ODO A;  5JH8 A;  1Q6U A;  2MLX A;  2ZQU A;  3OOB A;  2DSU A;  2M08 A;  3WD2 A;  3TDB A;  3WKZ A;  3G6L A;  1E9L A;  4N19 A;  4DWS C;  1NMW A;  2MLY A;  1LJY A;  2IF4 A;  4DT4 A;  3WD0 A;  1P5Q A;  4O2T A;  4IQ2 A;  1T11 A;  2JZV A;  2F21 A;  4TW8 A;  2DG9 A;  3FAP A;  2PV1 A;  2OFN A;  3PA7 A;  2DG4 A;  3FY1 A;  2ZQS A;  2WM0 A;  1J4H A;  4ODN A;  4ZPT R;  1W1Y A;  4L3N A;  1H0I A;  5GPR A;  1ITX A;  3UQA A;  4Z2I A;  2KGJ A;  1LL4 A;  3CHC A;  4MSP A;  1XHG A;  4LGX A;  4Z2J A;  1FKD A;  4Z2H A;  1JVW A;  5HBF A;  3WD1 A;  1QPL A;  1SR0 A;  4S3K A;  1ZL1 A;  1PBK A;  3KAC A;  2A3E A;  5BXJ A;  3RM8 A;  2ZR4 A;  1HKI A;  2PPN A;  3O5O A;  1E6R A;  2AOS A;  4NNR A;  1J4I A;  4C02 B;  1W1V A;  1D2K A;  1NSG A;  3IK8 A;  5HTG A;  1YW5 A;  4Q22 A;  2RUD A;  1LQ0 A;  1WB0 A;  3IKD A;  1ZK6 A;  1FKI A;  3WL0 A;  2MPH A;  1ZU8 A;  3WD4 A;  4JFM A;  2DSZ A;  3GU0 A;  3JYM A;  4R0X A;  4XAK A;  3B8S A;  4LAX A;  1W26 A;  4U84 A;  3ARY A;  3O5K A;  4JFK A;  4IQC A;  4DRQ A;  3UQI A;  4MPK A;  1SYT A;  1LL7 A;  1W9V A;  4DZ3 A;  3CH9 A;  4ODQ A;  2F23 A;  3EY6 A;  4DRN A;  4WKA A;  1JCH B;  2K8I A;  1PIN A;  4JFI A;  4AY1 A;  2KI3 A;  1HJW A;  4DWS D;  3PRB A;  4MNL A;  3O5P A;  1QZ2 A;  2XP7 A;  4KQZ A;  1WAW A;  3AS3 A;  4URI A;  1F40 A;  1EQ3 A;  2ZQV A;  3KAF A;  3AQU A; 
#chains in the Genus database with same CATH homology
 1NH6 A;  3I6C A;  3O5J A;  1E6N A;  3ARV A;  4JFL A;  3TCZ A;  5DO2 A;  3WD3 A;  1W1T A;  1O6I A;  1LG1 A;  1ZBW A;  3ARP A;  2PI6 A;  4Z2L A;  2N87 A;  1ZBK A;  2XP8 A;  1ZBC A;  1UR9 A;  1CTN A;  3O5D A;  4GIV A;  4NZC A;  1OGG A;  4QIB A;  4WKF A;  3O5E A;  4JYS A;  2O92 A;  4NSB A;  3ARO A;  1HKK A;  3CZ8 A;  2MNT A;  4TW7 A;  3ARS A;  2A3A A;  3B9D A;  4U85 A;  1FKG A;  3WQV A;  4MTV A;  1D7I A;  4MGV A;  1NWT A;  3RM4 A;  3WH0 A;  2XPA A;  1X6L A;  1JND A;  1ZCN A;  2G41 A;  3KAG A;  1LG2 A;  5GQB A;  4Q7N A;  4TNS A;  4IT6 A;  2XPB A;  4G2P A;  1JNE A;  2RUQ A;  4LAW A;  1Q1C A;  2XP5 A;  2DSV A;  1WNO A;  2RUC A;  4P8W A;  4S3J A;  2KE0 A;  2ZQT A;  4P8U A;  3JXV A;  3ARW A;  1B6C A;  4KR0 B;  1EIB A;  1X6N A;  3OA5 A;  3RM9 A;  1D7H A;  1FKJ A;  2Q5A A;  4MNJ A;  1L1P A;  4TYO A;  1ZBV A;  2ITK A;  2M1I A;  1JNT A;  3B7X A;  4G50 A;  2RQS A;  2FKE A;  3NTP A;  3WQW A;  3GPK A;  2VCD A;  1EYM A;  3ARQ A;  5HKG A;  2XP9 A;  1GOI A;  4FAP A;  4ODP A;  3MDY B;  4DZ2 A;  1FKK A;  5J6E A;  3CGM A;  2B31 A;  4W5U A;  3KAH A;  1R9H A;  3H9R B;  4DWS A;  3RME A;  1N1A A;  3RGC A;  1E15 A;  4ZPV R;  4DH0 A;  3CHD A;  2FAP A;  3WIJ A;  4DRP A;  3B9E A;  2Y78 A;  4Z2K A;  3LUO A;  2WLZ A;  2WLY A;  1Q6I A;  4MNK A;  3ARX A;  4ODM A;  4DIP A;  1OWQ A;  3WL1 A;  1U79 A;  3IHZ A;  3RFW A;  2DT1 A;  2YBU A;  1HJX A;  1YAT A;  3TC5 A;  2YBT A;  3ALG A;  2KFW A;  1FKR A;  2O9O A;  2PPO A;  5HWB A;  1HXV A;  2OLH A;  4U86 A;  2L2S A;  3PRD A;  5HWC A;  2DT2 A;  2ESC A;  1Q6H A;  1GUV A;  1J6Y A;  3IKG A;  1EDQ A;  1D7J A;  2QF8 A;  3KAI A;  5I98 A;  4PTM A;  1UR8 A;  1FKL A;  2RSE A;  3ARR A;  1E6P A;  4DRM A;  4L72 B;  1FKS A;  4DWS B;  1BKF A;  1KT0 A;  4J4O A;  4ODR A;  1QPF A;  1RD6 A;  5DIT A;  4ODL A;  4GGQ A;  4JFJ A;  2PV3 A;  3ALF A;  3VAW A;  1NWS A;  3AS2 A;  3BXW A;  1HJV A;  2F4E A;  3UI6 A;  2KO7 A;  2RUR A;  4MNM A;  4QT2 A;  3CHF A;  2LJ4 A;  3PRA A;  3O5G A;  5DIU A;  1ROU A;  3NI6 A;  4J4N A;  4ITZ A;  1ZB5 A;  3O5I A;  1W1P A;  4ODK A;  3G6M A;  1A7X A;  1XRV A;  4WJX A;  2XP4 A;  3AS1 A;  1EHN A;  3UF8 A;  3FXY A;  4HBE A;  4WKH A;  3ODK A;  4HBO A;  4P8X A;  4HAR A;  1JNS A;  1FD9 A;  4DRO A;  3ARZ A;  2DT3 A;  4ZPW R;  3W4R A;  4W9P A;  1J4R A;  3KCE A;  5HT1 A;  3AS0 A;  1FKF A;  1F8A B;  3UI5 A;  1Y0O A;  1ROT A;  4LAV A;  4TW6 A;  3KAD A;  2LGO A;  1LL6 A;  2DPE A;  1HKM A;  1FKH A;  4Z2G A;  2MLZ A;  3CHE A;  4LAY A;  2PBC A;  1HKJ A;  3O5Q A;  1FAP A;  3ART A;  1C9H A;  1OGB A;  5HW6 A;  3KZ7 A;  2LKN A;  4ZS6 A;  5DIV A;  4QZV B;  3CGN A;  3UQB A;  4DRI A;  2LPV A;  5HUA A;  4R5E A;  4ML4 A;  1FKT A;  2XP3 A;  5DF0 A;  1D6O A;  2A3B A;  3NRK A;  4WK9 A;  3ARU A;  4DRK A;  4P8V A;  2G8Z A;  5B8I C;  2A3C A;  3UI4 A;  1KT1 A;  2FDM A;  3PR9 A;  1NMV A;  1BL4 A;  3JYJ A;  2M2A A;  4W9O A;  1K9T A;  1TCO C;  5DEZ A;  5D75 A;  1FJD A;  3O5M A;  2ZR5 A;  1FFR A;  1FKB A;  1VF8 A;  1E6Z A;  2AWG A;  2PV2 A;  4BF8 A;  5HW7 A;  2IUZ A;  3O5R A;  4DRH A;  4FN2 A;  1GPF A;  1TFV A;  2PPP A;  4W9Q A;  2F2D A;  1W9P A;  2VN1 A;  2XP6 A;  5HW8 A;  1NWR A;  4IPX A;  1NWU A;  2MF9 A;  2DT0 A;  2UZ5 A;  3KAB A;  3QOK A;  1M5Y A;  2ZR6 A;  4IT4 A;  3O5L A;  5GPG A;  1W9U A;  3O5F A;  2KR7 A;  1KFW A;  4DRJ A;  2D9F A;  1FFQ A;  2DSW A;  2DG3 A;  4QT3 A;  1H0G A;  4WIW A;  2WK2 A;  4MAV A;  4TX0 A;  3B9A A;  1IX5 A;  4ODO A;  5JH8 A;  1Q6U A;  2MLX A;  2ZQU A;  3OOB A;  2DSU A;  2M08 A;  3WD2 A;  3TDB A;  3WKZ A;  3G6L A;  1E9L A;  4N19 A;  4DWS C;  1NMW A;  2MLY A;  1LJY A;  2IF4 A;  4DT4 A;  3WD0 A;  1P5Q A;  4O2T A;  4IQ2 A;  1T11 A;  2JZV A;  2F21 A;  4TW8 A;  2DG9 A;  3FAP A;  2PV1 A;  2OFN A;  3PA7 A;  2DG4 A;  3FY1 A;  2ZQS A;  2WM0 A;  1J4H A;  4ODN A;  4ZPT R;  1W1Y A;  4L3N A;  1H0I A;  5GPR A;  1ITX A;  3UQA A;  4Z2I A;  2KGJ A;  1LL4 A;  3CHC A;  4MSP A;  1XHG A;  4LGX A;  4Z2J A;  1FKD A;  4Z2H A;  1JVW A;  5HBF A;  3WD1 A;  1QPL A;  1SR0 A;  4S3K A;  1ZL1 A;  1PBK A;  3KAC A;  2A3E A;  5BXJ A;  3RM8 A;  2ZR4 A;  1HKI A;  2PPN A;  3O5O A;  1E6R A;  2AOS A;  4NNR A;  1J4I A;  4C02 B;  1W1V A;  1D2K A;  1NSG A;  3IK8 A;  5HTG A;  1YW5 A;  4Q22 A;  2RUD A;  1LQ0 A;  1WB0 A;  3IKD A;  1ZK6 A;  1FKI A;  3WL0 A;  2MPH A;  1ZU8 A;  3WD4 A;  4JFM A;  2DSZ A;  3JYM A;  4R0X A;  4XAK A;  3B8S A;  4LAX A;  1W26 A;  4U84 A;  3ARY A;  3O5K A;  4JFK A;  4IQC A;  4DRQ A;  3UQI A;  4MPK A;  1SYT A;  1LL7 A;  1W9V A;  4DZ3 A;  3CH9 A;  4ODQ A;  3EY6 A;  4DRN A;  4WKA A;  2K8I A;  1PIN A;  4JFI A;  4AY1 A;  2KI3 A;  1HJW A;  4DWS D;  3PRB A;  4MNL A;  3O5P A;  1QZ2 A;  2XP7 A;  4KQZ A;  1WAW A;  3AS3 A;  4URI A;  1F40 A;  1EQ3 A;  2ZQV A;  3KAF A;  3AQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...