4IPXA

Analyzing the visible conformational substates of the fk506 binding protein fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
molecule tags Isomerase
source organism Homo sapiens
publication title Analysing the visible conformational substates of the FK506-binding protein FKBP12.
pubmed doi rcsb
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4ipxA00
4TW6A 3IK8A 3JYMA 1KT1A 2RQSA 1W26A 1FKIA 2XP9A 4FN2A 2RUQA 2MLYA 5HUAA 1D6OA 2DG3A 3O5RA 2JZVA 3O5EA 3O5IA 3WH0A 4C02B 2KFWA 3UQAA 4TYOA 1L1PA 1FJDA 2F4EA 1QPLA 2L2SA 5HW6A 5HW7A 3I6CA 2VCDA 2ZR5A 3KADA 3OOBA 4LAWA 2RURA 2ZQTA 3NRKA 5HWCA 1FKKA 4LAXA 1F40A 4DRJA 3RGCA 2MPHA 4DRHA 5HKGA 4ODOA 3B7XA 3UF8A 1YATA 2F2DA 3H9RB 1FKDA 3JXVA 1Q6HA 2XP7A 1A7XA 2XP5A 1BKFA 3O5JA 3TCZA 1FD9A 1NSGA 1Q1CA 2LJ4A 2ZQSA 3KACA 4JFIA 4JFJA 2PV2A 4NNRA 1ZK6A 2OFNA 3PA7A 3JYJA 2ZQUA 4JFKA 1C9HA 4W9PA 1Q6UA 2D9FA 1J4HA 2M08A 2MNTA 2XPAA 3GPKA 4LAYA 5HT1A 2XPBA 3LUOA 4ODLA 4TW8A 4GGQA 1T11A 1FAPA 3UI6A 4DRQA 2KO7A 1M5YA 2N87A 1TCOC 1J4RA 1ZCNA 3O5LA 4O2TA 4ODQA 3IKGA 3TC5A 2UZ5A 4DT4A 1FKSA 4FAPA 1F8AB 2XP6A 1FKGA 3O5PA 1J6YA 1Y0OA 2XP4A 2LPVA 2Y78A 4DROA 2LGOA 3TDBA 1FKJA 1QZ2A 4JFMA 3UI4A 3VAWA 2ZR4A 1NMWA 3CGNA 3KAIA 1YW5A 3KABA 3NI6A 4IPXA 3UI5A 4QT3A 2PV1A 2PBCA 4JYSA 3FAPA 3PRBA 5DIVA 4QT2A 2AWGA 3NTPA 4DRNA 3UQBA 4DRMA 1PINA 1BL4A 1FKTA 2KI3A 4LAVA 3KAFA 3O5GA 3KAHA 3O5OA 1FKLA 4G2PA 4R0XA 4TW7A 1FKFA 5I98A 2MF9A 1FKBA 4U84A 4IQCA 2FAPA 1J4IA 2RSEA 4J4OA 4W9QA 2VN1A 2LKNA 3IKDA 5HTGA 3MDYB 1JNSA 1D7IA 1PBKA 2PPNA 3ODKA 2F21A 4MGVA 3O5MA 3UQIA 4TNSA 1R9HA 3IHZA 3CGMA 4GIVA 5D75A 5DIUA 1EQ3A 4DZ3A 3O5DA 4DH0A 1JVWA 2K8IA 4J4NA 4DRPA 1Q6IA 2XP8A 2DG9A 2PPPA 2PV3A 4ODRA 2ITKA 2M1IA 5HW8A 1P5QA 4G50A 5B8IC 5HWBA 2KE0A 3KCEA 2XP3A 2FKEA 4ODMA 1KT0A 4BF8A 3RFWA 2RUDA 4DIPA 4MSPA 3PRDA 4ODPA 2MLZA 1ROUA 2ZQVA 1FKHA 4ODKA 5DITA 5GPGA 1HXVA 4W9OA 4JFLA 3KZ7A 3O5QA 4ODNA 4DRIA 5J6EA 4ITZA 2IF4A 2Q5AA 2KGJA 1EYMA 4N19A 2MLXA 1NMVA 4QIBA 4TX0A 4U85A 3EY6A 1U79A 1QPFA 2KR7A 1N1AA 2DG4A 1ROTA 2ZR6A 2M2AA 4IQ2A 4DZ2A 5BXJA 1JNTA 1D7HA 1D7JA 3O5FA 1B6CA 4DRKA 2PPOA 1FKRA 2RUCA 3O5KA 3KAGA 4U86A
chains in the Genus database with same CATH superfamily
4TW6A 4KR0B 1W26A 1OGBA 1QPLA 2L2SA 5HW6A 3OOBA 4LAWA 3AS2A 4WKHA 2RURA 2ZQTA 5HWCA 1F40A 2F2DA 1LL7A 1W9VA 2DT1A 2A3AA 4S3JA 1Q1CA 4NNRA 1ZK6A 2OFNA 1W1PA 2ZQUA 3JYJA 4W9PA 1Q6UA 2FDMA 2MNTA 3GTYX 1ZBWA 5HT1A 2WK2A 3CHDA 1T11A 1FAPA 4WK9A 4NSBA 4ODQA 1TCOC 3WQWA 1SR0A 5DEZA 4FAPA 1F8AB 2XP6A 1J6YA 2P4VA 3G6MA 4JFMA 3TDBA 1JCHB 2ZR4A 3CGNA 2O92A 3B8SA 3UI5A 4JYSA 3PRBA 3UQBA 2B31A 3AS1A 1BL4A 1FKTA 3O5OA 2A3EA 3ARSA 4R0XA 1FKBA 4MAVA 3RM4A 2FAPA 4J4OA 5HTGA 1EIBA 3O5MA 1NWUA 4ZPVR 3WL0A 5DF0A 2K8IA 3GU0A 3KCEA 2FKEA 2IUZA 4P8UA 3RFWA 2RUDA 4ODPA 1FKHA 5DITA 1UR8A 2DSUA 3KZ7A 1LG2A 4Z2GA 4ITZA 2IF4A 2Q5AA 4MNKA 3ARQA 2G41A 1NMVA 3EY6A 4P8WA 1QPFA 2DG4A 2M2AA 1JNTA 1D7JA 4HBOA 1EDQA 2PPOA 4HBEA 3ARUA 1OGGA 1CTNA 3KAGA 2DPEA 1ZU8A 3IK8A 1KT1A 1FFRA 2XP9A 1XHGA 5HUAA 1D6OA 3O5RA 4IT4A 2JZVA 3O5EA 3O5IA 3UQAA 4TYOA 5HW7A 3CH9A 3WD1A 2ZR5A 4WKAA 4LAXA 2MPHA 5HKGA 1WB0A 4ODOA 3B7XA 2WLYA 3UF8A 1Q6HA 2XP7A 3O5JA 1LQ0A 3ARZA 1FD9A 4JFIA 4NZCA 1LG1A 3RM9A 4JFKA 1C9HA 2M08A 2B5UB 2XPAA 3ALFA 1KFWA 1ZBKA 2XPBA 4PTMA 1E6PA 4MNJA 2KO7A 1M5YA 1K9TA 3IKGA 1GUVA 1IX5A 1FKGA 3ALGA 4AY1A 3FY1A 1QZ2A 1YW5A 3NI6A 1E9LA 1HJVA 4WKFA 2AOSA 2PBCA 2PV1A 3CHEA 1O6IA 1HKKA 3WQVA 1PINA 2KI3A 4DWSC 4UDMA 1HKMA 2YBTA 1D2KA 5DO2A 1X6LA 1FKFA 4HARA 1VF8A 2MF9A 3B9AA 4U84A 4IQCA 2RSEA 4W9QA 2VN1A 1W1VA 3MDYB 3G6LA 4Q7NA 3UQIA 4TNSA 5DIUA 5D75A 3CGMA 3O5DA 4DWSA 3AS0A 2XP8A 3WD0A 2DG9A 1ITXA 1ZBCA 2PPPA 4ODRA 2M1IA 4WIWA 5B8IC 5HWBA 4ODMA 4Z2LA 3CHCA 2MLZA 2ZQVA 2YBUA 3ARTA 3O5QA 3RMEA 1WNOA 2F23A 1EYMA 2MLXA 4URIA 1U79A 1NWTA 4ZPTR 2KR7A 5BXJA 3WL1A 4DZ2A 5JH8A 3O5FA 3O5KA 1LJYA 4U86A 2ETNA 1FKIA 4FN2A 2RUQA 1FJDA 2F4EA 3I6CA 1EHNA 1X6NA 1LL6A 1FKKA 4DRJA 4DRHA 2OLHA 4W5UA 1YATA 3W4RA 1FKDA 1TFVA 3WD3A 2XP5A 2WM0A 1BKFA 1NSGA 2LJ4A 2ZQSA 3KACA 4JFJA 4LAYA 4MNMA 3LUOA 4TW8A 4GGQA 4MTVA 2N87A 1ZCNA 3TC5A 3BMBA 2UZ5A 4DT4A 1FKSA 3B9EA 1E44A 1W9UA 3AS3A 2XP4A 4DROA 4S3KA 3QOKA 1FKJA 3UI4A 3VAWA 2WLZA 3CZ8A 1OWQA 4IPXA 3ARYA 4QT2A 4Z2IA 4DRMA 4LAVA 1E6RA 2A3CA 3O5GA 4G2PA 4XAKA 1XRVA 2PN0A 3PRAA 1J4IA 3IKDA 2LKNA 1JNSA 1D7IA 3ODKA 4Z2JA 2F21A 4MGVA 1ZB5A 1EQ3A 4DZ3A 4DH0A 1JVWA 4J4NA 4DWSB 2PV3A 3ARXA 1P5QA 4G50A 2KE0A 4DIPA 1KT0A 1WAWA 4MSPA 3PRDA 1ROUA 4ODKA 4Z2HA 1E6ZA 1NWRA 4W9OA 4JFLA 4DRIA 1NWSA 4Z2KA 4N19A 4QIBA 1GPFA 3WIJA 5HBFA 1N1AA 1RD6A 1SYTA 2DT0A 1GRJA 1JNDA 4DRKA 2RUCA 2O9OA 2A3BA 1HKJA 4L72B 5GPRA 3JYMA 2RQSA 1JNEA 3EIPA 4MPKA 1UR9A 2MLYA 2DG3A 3CHFA 4C02B 1L1PA 2KFWA 1E15A 2VCDA 3KADA 1H0GA 3NRKA 3WD2A 3RGCA 4QZVB 3AQUA 3H9RB 3JXVA 4L3NA 1A7XA 3ARVA 3TCZA 3WD4A 2PV2A 4IT6A 2DSVA 3PA7A 2D9FA 1J4HA 4P8XA 3GPKA 1ZBVA 4ODLA 4LGXA 2G8ZA 4ZS6A 3UI6A 4DRQA 4O2TA 1J4RA 3O5LA 1LL4A 3O5PA 4KQZA 2DSZA 1Y0OA 2DT3A 3ARRA 2LPVA 2Y78A 3ARWA 2LGOA 4ML4A 2DT2A 4P8VA 1NMWA 3KAIA 1W9PA 3KABA 3FXYA 4QT3A 5GQBA 4MNLA 3FAPA 5DIVA 1ZL1A 2AWGA 3NTPA 4DRNA 3AROA 1NH6A 2PI6A 4R5EA 3KAFA 3KAHA 3WKZA 1FKLA 3ARPA 1GOIA 4TW7A 5I98A 1W1YA 1HJXA 1PBKA 2PPNA 4WJXA 1R9HA 3IHZA 4GIVA 3OA5A 1H0IA 2DSWA 1FFQA 4DRPA 1Q6IA 3PR9A 5HW8A 2ITKA 2EULA 2ESCA 2XP3A 4BF8A 5GPGA 1HXVA 1HJWA 1E6NA 4ODNA 5J6EA 2QF8A 3BXWA 4ZPWR 2KGJA 1HKIA 4TX0A 3B9DA 4U85A 2ZR6A 4IQ2A 1ROTA 1D7HA 1B6CA 1W1TA 4DWSD 1FKRA 3RM8A 3WH0A 4Q22A
chains in the Genus database with same CATH topology
4TW6A 4KR0B 1W26A 1OGBA 1QPLA 2L2SA 5HW6A 3OOBA 4LAWA 3AS2A 4WKHA 2RURA 2ZQTA 5HWCA 1F40A 2F2DA 1LL7A 1W9VA 2DT1A 2A3AA 4S3JA 1Q1CA 4NNRA 1ZK6A 2OFNA 1W1PA 2ZQUA 3JYJA 4W9PA 1Q6UA 2FDMA 2MNTA 5HT1A 1ZBWA 2WK2A 3CHDA 1T11A 1FAPA 4WK9A 4NSBA 4ODQA 1TCOC 3WQWA 1SR0A 5DEZA 4FAPA 1F8AB 2XP6A 1J6YA 3G6MA 4JFMA 3TDBA 2ZR4A 3CGNA 2O92A 3B8SA 3UI5A 4JYSA 3PRBA 3UQBA 2B31A 3AS1A 1BL4A 1FKTA 3O5OA 2A3EA 3ARSA 4R0XA 1FKBA 4MAVA 3RM4A 2FAPA 4J4OA 5HTGA 1EIBA 3O5MA 1NWUA 4ZPVR 3WL0A 5DF0A 2K8IA 3KCEA 2FKEA 2IUZA 4P8UA 3RFWA 2RUDA 4ODPA 1FKHA 5DITA 1UR8A 2DSUA 3KZ7A 1LG2A 4Z2GA 4ITZA 2IF4A 2Q5AA 4MNKA 3ARQA 2G41A 1NMVA 3EY6A 4P8WA 1QPFA 2DG4A 2M2AA 1JNTA 1D7JA 4HBOA 1EDQA 2PPOA 4HBEA 3ARUA 1OGGA 1CTNA 3KAGA 2DPEA 1ZU8A 3IK8A 1KT1A 1FFRA 2XP9A 1XHGA 5HUAA 1D6OA 3O5RA 4IT4A 2JZVA 3O5EA 3O5IA 3UQAA 4TYOA 5HW7A 3CH9A 3WD1A 2ZR5A 4WKAA 4LAXA 2MPHA 5HKGA 1WB0A 4ODOA 3B7XA 2WLYA 3UF8A 1Q6HA 2XP7A 3O5JA 1LQ0A 3ARZA 1FD9A 4JFIA 4NZCA 1LG1A 3RM9A 4JFKA 1C9HA 2M08A 2XPAA 3ALFA 1KFWA 1ZBKA 2XPBA 4PTMA 1E6PA 4MNJA 2KO7A 1M5YA 1K9TA 3IKGA 1GUVA 1IX5A 1FKGA 3ALGA 4AY1A 3FY1A 1QZ2A 1YW5A 3NI6A 1E9LA 1HJVA 4WKFA 2AOSA 2PBCA 2PV1A 3CHEA 1O6IA 1HKKA 3WQVA 1PINA 2KI3A 4DWSC 1HKMA 2YBTA 1D2KA 5DO2A 1X6LA 1FKFA 4HARA 1VF8A 2MF9A 3B9AA 4U84A 4IQCA 2RSEA 4W9QA 2VN1A 1W1VA 3MDYB 3G6LA 4Q7NA 3UQIA 4TNSA 5DIUA 5D75A 3CGMA 3O5DA 4DWSA 3AS0A 2XP8A 3WD0A 2DG9A 1ITXA 1ZBCA 2PPPA 4ODRA 2M1IA 4WIWA 5B8IC 5HWBA 4ODMA 4Z2LA 3CHCA 2MLZA 2ZQVA 2YBUA 3ARTA 3O5QA 3RMEA 1WNOA 1EYMA 2MLXA 4URIA 1U79A 1NWTA 4ZPTR 2KR7A 5BXJA 3WL1A 4DZ2A 5JH8A 3O5FA 3O5KA 1LJYA 4U86A 1FKIA 4FN2A 2RUQA 1FJDA 2F4EA 3I6CA 1EHNA 1X6NA 1LL6A 1FKKA 4DRJA 4DRHA 2OLHA 4W5UA 1YATA 3W4RA 1FKDA 1TFVA 3WD3A 2XP5A 2WM0A 1BKFA 1NSGA 2LJ4A 2ZQSA 3KACA 4JFJA 4LAYA 4MNMA 3LUOA 4TW8A 4GGQA 4MTVA 2N87A 1ZCNA 3TC5A 2UZ5A 4DT4A 1FKSA 3B9EA 1W9UA 3AS3A 2XP4A 4DROA 4S3KA 3QOKA 1FKJA 3UI4A 3VAWA 2WLZA 3CZ8A 1OWQA 4IPXA 3ARYA 4QT2A 4Z2IA 4DRMA 4LAVA 1E6RA 2A3CA 3O5GA 4G2PA 4XAKA 1XRVA 3PRAA 1J4IA 3IKDA 2LKNA 1JNSA 1D7IA 3ODKA 4Z2JA 2F21A 4MGVA 1ZB5A 1EQ3A 4DZ3A 4DH0A 1JVWA 4J4NA 4DWSB 2PV3A 3ARXA 1P5QA 4G50A 2KE0A 4DIPA 1KT0A 1WAWA 4MSPA 3PRDA 1ROUA 4ODKA 4Z2HA 1E6ZA 1NWRA 4W9OA 4JFLA 4DRIA 1NWSA 4Z2KA 4N19A 4QIBA 1GPFA 3WIJA 5HBFA 1N1AA 1RD6A 1SYTA 2DT0A 1JNDA 4DRKA 2RUCA 2O9OA 2A3BA 1HKJA 4L72B 5GPRA 3JYMA 2RQSA 1JNEA 4MPKA 1UR9A 2MLYA 2DG3A 3CHFA 4C02B 1L1PA 2KFWA 1E15A 2VCDA 3KADA 1H0GA 3NRKA 3WD2A 3RGCA 4QZVB 3AQUA 3H9RB 3JXVA 4L3NA 1A7XA 3ARVA 3TCZA 3WD4A 2PV2A 4IT6A 2DSVA 3PA7A 2D9FA 1J4HA 4P8XA 3GPKA 1ZBVA 4ODLA 4LGXA 2G8ZA 4ZS6A 3UI6A 4DRQA 4O2TA 1J4RA 3O5LA 1LL4A 3O5PA 4KQZA 2DSZA 1Y0OA 2DT3A 3ARRA 2LPVA 2Y78A 3ARWA 2LGOA 4ML4A 2DT2A 4P8VA 1NMWA 3KAIA 1W9PA 3KABA 3FXYA 4QT3A 5GQBA 4MNLA 3FAPA 5DIVA 1ZL1A 2AWGA 3NTPA 4DRNA 3AROA 1NH6A 2PI6A 4R5EA 3KAFA 3KAHA 3WKZA 1FKLA 3ARPA 1GOIA 4TW7A 5I98A 1W1YA 1HJXA 1PBKA 2PPNA 4WJXA 1R9HA 3IHZA 4GIVA 3OA5A 1H0IA 2DSWA 1FFQA 4DRPA 1Q6IA 3PR9A 5HW8A 2ITKA 2ESCA 2XP3A 4BF8A 5GPGA 1HXVA 1HJWA 1E6NA 4ODNA 5J6EA 2QF8A 3BXWA 4ZPWR 2KGJA 1HKIA 4TX0A 3B9DA 4U85A 2ZR6A 4IQ2A 1ROTA 1D7HA 1B6CA 1W1TA 4DWSD 1FKRA 3RM8A 3WH0A 4Q22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW6 A;  3IK8 A;  3JYM A;  1KT1 A;  2RQS A;  1W26 A;  1FKI A;  2XP9 A;  4FN2 A;  2RUQ A;  2MLY A;  5HUA A;  1D6O A;  2DG3 A;  3O5R A;  2JZV A;  3O5E A;  3O5I A;  3WH0 A;  4C02 B;  2KFW A;  3UQA A;  4TYO A;  1L1P A;  1FJD A;  2F4E A;  1QPL A;  2L2S A;  5HW6 A;  5HW7 A;  3I6C A;  2VCD A;  2ZR5 A;  3KAD A;  3OOB A;  4LAW A;  2RUR A;  2ZQT A;  3NRK A;  5HWC A;  1FKK A;  4LAX A;  1F40 A;  4DRJ A;  3RGC A;  2MPH A;  4DRH A;  5HKG A;  4ODO A;  3B7X A;  3UF8 A;  1YAT A;  2F2D A;  3H9R B;  1FKD A;  3JXV A;  1Q6H A;  2XP7 A;  1A7X A;  2XP5 A;  1BKF A;  3O5J A;  3TCZ A;  1FD9 A;  1NSG A;  1Q1C A;  2LJ4 A;  2ZQS A;  3KAC A;  4JFI A;  4JFJ A;  2PV2 A;  4NNR A;  1ZK6 A;  2OFN A;  3PA7 A;  3JYJ A;  2ZQU A;  4JFK A;  1C9H A;  4W9P A;  1Q6U A;  2D9F A;  1J4H A;  2M08 A;  2MNT A;  2XPA A;  3GPK A;  4LAY A;  5HT1 A;  2XPB A;  3LUO A;  4ODL A;  4TW8 A;  4GGQ A;  1T11 A;  1FAP A;  3UI6 A;  4DRQ A;  2KO7 A;  1M5Y A;  2N87 A;  1TCO C;  1J4R A;  1ZCN A;  3O5L A;  4O2T A;  4ODQ A;  3IKG A;  3TC5 A;  2UZ5 A;  4DT4 A;  1FKS A;  4FAP A;  1F8A B;  2XP6 A;  1FKG A;  3O5P A;  1J6Y A;  1Y0O A;  2XP4 A;  2LPV A;  2Y78 A;  4DRO A;  2LGO A;  3TDB A;  1FKJ A;  1QZ2 A;  4JFM A;  3UI4 A;  3VAW A;  2ZR4 A;  1NMW A;  3CGN A;  3KAI A;  1YW5 A;  3KAB A;  3NI6 A;  4IPX A;  3UI5 A;  4QT3 A;  2PV1 A;  2PBC A;  4JYS A;  3FAP A;  3PRB A;  5DIV A;  4QT2 A;  2AWG A;  3NTP A;  4DRN A;  3UQB A;  4DRM A;  1PIN A;  1BL4 A;  1FKT A;  2KI3 A;  4LAV A;  3KAF A;  3O5G A;  3KAH A;  3O5O A;  1FKL A;  4G2P A;  4R0X A;  4TW7 A;  1FKF A;  5I98 A;  2MF9 A;  1FKB A;  4U84 A;  4IQC A;  2FAP A;  1J4I A;  2RSE A;  4J4O A;  4W9Q A;  2VN1 A;  2LKN A;  3IKD A;  5HTG A;  3MDY B;  1JNS A;  1D7I A;  1PBK A;  2PPN A;  3ODK A;  2F21 A;  4MGV A;  3O5M A;  3UQI A;  4TNS A;  1R9H A;  3IHZ A;  3CGM A;  4GIV A;  5D75 A;  5DIU A;  1EQ3 A;  4DZ3 A;  3O5D A;  4DH0 A;  1JVW A;  2K8I A;  4J4N A;  4DRP A;  1Q6I A;  2XP8 A;  2DG9 A;  2PPP A;  2PV3 A;  4ODR A;  2ITK A;  2M1I A;  5HW8 A;  1P5Q A;  4G50 A;  5B8I C;  5HWB A;  2KE0 A;  3KCE A;  2XP3 A;  2FKE A;  4ODM A;  1KT0 A;  4BF8 A;  3RFW A;  2RUD A;  4DIP A;  4MSP A;  3PRD A;  4ODP A;  2MLZ A;  1ROU A;  2ZQV A;  1FKH A;  4ODK A;  5DIT A;  5GPG A;  1HXV A;  4W9O A;  4JFL A;  3KZ7 A;  3O5Q A;  4ODN A;  4DRI A;  5J6E A;  4ITZ A;  2IF4 A;  2Q5A A;  2KGJ A;  1EYM A;  4N19 A;  2MLX A;  1NMV A;  4QIB A;  4TX0 A;  4U85 A;  3EY6 A;  1U79 A;  1QPF A;  2KR7 A;  1N1A A;  2DG4 A;  1ROT A;  2ZR6 A;  2M2A A;  4IQ2 A;  4DZ2 A;  5BXJ A;  1JNT A;  1D7H A;  1D7J A;  3O5F A;  1B6C A;  4DRK A;  2PPO A;  1FKR A;  2RUC A;  3O5K A;  3KAG A;  4U86 A; 
#chains in the Genus database with same CATH topology
 4TW6 A;  4KR0 B;  1W26 A;  1OGB A;  1QPL A;  2L2S A;  5HW6 A;  3OOB A;  4LAW A;  3AS2 A;  4WKH A;  2RUR A;  2ZQT A;  5HWC A;  1F40 A;  2F2D A;  1LL7 A;  1W9V A;  2DT1 A;  2A3A A;  4S3J A;  1Q1C A;  4NNR A;  1ZK6 A;  2OFN A;  1W1P A;  2ZQU A;  3JYJ A;  4W9P A;  1Q6U A;  2FDM A;  2MNT A;  3GTY X;  1ZBW A;  5HT1 A;  2WK2 A;  3CHD A;  1T11 A;  1FAP A;  4WK9 A;  4NSB A;  4ODQ A;  1TCO C;  3WQW A;  1SR0 A;  5DEZ A;  4FAP A;  1F8A B;  2XP6 A;  1J6Y A;  2P4V A;  3G6M A;  4JFM A;  3TDB A;  1JCH B;  2ZR4 A;  3CGN A;  2O92 A;  3B8S A;  3UI5 A;  4JYS A;  3PRB A;  3UQB A;  2B31 A;  3AS1 A;  1BL4 A;  1FKT A;  3O5O A;  2A3E A;  3ARS A;  4R0X A;  1FKB A;  4MAV A;  3RM4 A;  2FAP A;  4J4O A;  5HTG A;  1EIB A;  3O5M A;  1NWU A;  4ZPV R;  3WL0 A;  5DF0 A;  2K8I A;  3GU0 A;  3KCE A;  2FKE A;  2IUZ A;  4P8U A;  3RFW A;  2RUD A;  4ODP A;  1FKH A;  5DIT A;  1UR8 A;  2DSU A;  3KZ7 A;  1LG2 A;  4Z2G A;  4ITZ A;  2IF4 A;  2Q5A A;  4MNK A;  3ARQ A;  2G41 A;  1NMV A;  3EY6 A;  4P8W A;  1QPF A;  2DG4 A;  2M2A A;  1JNT A;  1D7J A;  4HBO A;  1EDQ A;  2PPO A;  4HBE A;  3ARU A;  1OGG A;  1CTN A;  3KAG A;  2DPE A;  1ZU8 A;  3IK8 A;  1KT1 A;  1FFR A;  2XP9 A;  1XHG A;  5HUA A;  1D6O A;  3O5R A;  4IT4 A;  2JZV A;  3O5E A;  3O5I A;  3UQA A;  4TYO A;  5HW7 A;  3CH9 A;  3WD1 A;  2ZR5 A;  4WKA A;  4LAX A;  2MPH A;  5HKG A;  1WB0 A;  4ODO A;  3B7X A;  2WLY A;  3UF8 A;  1Q6H A;  2XP7 A;  3O5J A;  1LQ0 A;  3ARZ A;  1FD9 A;  4JFI A;  4NZC A;  1LG1 A;  3RM9 A;  4JFK A;  1C9H A;  2M08 A;  2B5U B;  2XPA A;  3ALF A;  1KFW A;  1ZBK A;  2XPB A;  4PTM A;  1E6P A;  4MNJ A;  2KO7 A;  1M5Y A;  1K9T A;  3IKG A;  1GUV A;  1IX5 A;  1FKG A;  3ALG A;  4AY1 A;  3FY1 A;  1QZ2 A;  1YW5 A;  3NI6 A;  1E9L A;  1HJV A;  4WKF A;  2AOS A;  2PBC A;  2PV1 A;  3CHE A;  1O6I A;  1HKK A;  3WQV A;  1PIN A;  2KI3 A;  4DWS C;  4UDM A;  1HKM A;  2YBT A;  1D2K A;  5DO2 A;  1X6L A;  1FKF A;  4HAR A;  1VF8 A;  2MF9 A;  3B9A A;  4U84 A;  4IQC A;  2RSE A;  4W9Q A;  2VN1 A;  1W1V A;  3MDY B;  3G6L A;  4Q7N A;  3UQI A;  4TNS A;  5DIU A;  5D75 A;  3CGM A;  3O5D A;  4DWS A;  3AS0 A;  2XP8 A;  3WD0 A;  2DG9 A;  1ITX A;  1ZBC A;  2PPP A;  4ODR A;  2M1I A;  4WIW A;  5B8I C;  5HWB A;  4ODM A;  4Z2L A;  3CHC A;  2MLZ A;  2ZQV A;  2YBU A;  3ART A;  3O5Q A;  3RME A;  1WNO A;  2F23 A;  1EYM A;  2MLX A;  4URI A;  1U79 A;  1NWT A;  4ZPT R;  2KR7 A;  5BXJ A;  3WL1 A;  4DZ2 A;  5JH8 A;  3O5F A;  3O5K A;  1LJY A;  4U86 A;  2ETN A;  1FKI A;  4FN2 A;  2RUQ A;  1FJD A;  2F4E A;  3I6C A;  1EHN A;  1X6N A;  1LL6 A;  1FKK A;  4DRJ A;  4DRH A;  2OLH A;  4W5U A;  1YAT A;  3W4R A;  1FKD A;  1TFV A;  3WD3 A;  2XP5 A;  2WM0 A;  1BKF A;  1NSG A;  2LJ4 A;  2ZQS A;  3KAC A;  4JFJ A;  4LAY A;  4MNM A;  3LUO A;  4TW8 A;  4GGQ A;  4MTV A;  2N87 A;  1ZCN A;  3TC5 A;  3BMB A;  2UZ5 A;  4DT4 A;  1FKS A;  3B9E A;  1E44 A;  1W9U A;  3AS3 A;  2XP4 A;  4DRO A;  4S3K A;  3QOK A;  1FKJ A;  3UI4 A;  3VAW A;  2WLZ A;  3CZ8 A;  1OWQ A;  4IPX A;  3ARY A;  4QT2 A;  4Z2I A;  4DRM A;  4LAV A;  1E6R A;  2A3C A;  3O5G A;  4G2P A;  4XAK A;  1XRV A;  2PN0 A;  3PRA A;  1J4I A;  3IKD A;  2LKN A;  1JNS A;  1D7I A;  3ODK A;  4Z2J A;  2F21 A;  4MGV A;  1ZB5 A;  1EQ3 A;  4DZ3 A;  4DH0 A;  1JVW A;  4J4N A;  4DWS B;  2PV3 A;  3ARX A;  1P5Q A;  4G50 A;  2KE0 A;  4DIP A;  1KT0 A;  1WAW A;  4MSP A;  3PRD A;  1ROU A;  4ODK A;  4Z2H A;  1E6Z A;  1NWR A;  4W9O A;  4JFL A;  4DRI A;  1NWS A;  4Z2K A;  4N19 A;  4QIB A;  1GPF A;  3WIJ A;  5HBF A;  1N1A A;  1RD6 A;  1SYT A;  2DT0 A;  1GRJ A;  1JND A;  4DRK A;  2RUC A;  2O9O A;  2A3B A;  1HKJ A;  4L72 B;  5GPR A;  3JYM A;  2RQS A;  1JNE A;  3EIP A;  4MPK A;  1UR9 A;  2MLY A;  2DG3 A;  3CHF A;  4C02 B;  1L1P A;  2KFW A;  1E15 A;  2VCD A;  3KAD A;  1H0G A;  3NRK A;  3WD2 A;  3RGC A;  4QZV B;  3AQU A;  3H9R B;  3JXV A;  4L3N A;  1A7X A;  3ARV A;  3TCZ A;  3WD4 A;  2PV2 A;  4IT6 A;  2DSV A;  3PA7 A;  2D9F A;  1J4H A;  4P8X A;  3GPK A;  1ZBV A;  4ODL A;  4LGX A;  2G8Z A;  4ZS6 A;  3UI6 A;  4DRQ A;  4O2T A;  1J4R A;  3O5L A;  1LL4 A;  3O5P A;  4KQZ A;  2DSZ A;  1Y0O A;  2DT3 A;  3ARR A;  2LPV A;  2Y78 A;  3ARW A;  2LGO A;  4ML4 A;  2DT2 A;  4P8V A;  1NMW A;  3KAI A;  1W9P A;  3KAB A;  3FXY A;  4QT3 A;  5GQB A;  4MNL A;  3FAP A;  5DIV A;  1ZL1 A;  2AWG A;  3NTP A;  4DRN A;  3ARO A;  1NH6 A;  2PI6 A;  4R5E A;  3KAF A;  3KAH A;  3WKZ A;  1FKL A;  3ARP A;  1GOI A;  4TW7 A;  5I98 A;  1W1Y A;  1HJX A;  1PBK A;  2PPN A;  4WJX A;  1R9H A;  3IHZ A;  4GIV A;  3OA5 A;  1H0I A;  2DSW A;  1FFQ A;  4DRP A;  1Q6I A;  3PR9 A;  5HW8 A;  2ITK A;  2EUL A;  2ESC A;  2XP3 A;  4BF8 A;  5GPG A;  1HXV A;  1HJW A;  1E6N A;  4ODN A;  5J6E A;  2QF8 A;  3BXW A;  4ZPW R;  2KGJ A;  1HKI A;  4TX0 A;  3B9D A;  4U85 A;  2ZR6 A;  4IQ2 A;  1ROT A;  1D7H A;  1B6C A;  1W1T A;  4DWS D;  1FKR A;  3RM8 A;  3WH0 A;  4Q22 A; 
#chains in the Genus database with same CATH homology
 4TW6 A;  4KR0 B;  1W26 A;  1OGB A;  1QPL A;  2L2S A;  5HW6 A;  3OOB A;  4LAW A;  3AS2 A;  4WKH A;  2RUR A;  2ZQT A;  5HWC A;  1F40 A;  2F2D A;  1LL7 A;  1W9V A;  2DT1 A;  2A3A A;  4S3J A;  1Q1C A;  4NNR A;  1ZK6 A;  2OFN A;  1W1P A;  2ZQU A;  3JYJ A;  4W9P A;  1Q6U A;  2FDM A;  2MNT A;  5HT1 A;  1ZBW A;  2WK2 A;  3CHD A;  1T11 A;  1FAP A;  4WK9 A;  4NSB A;  4ODQ A;  1TCO C;  3WQW A;  1SR0 A;  5DEZ A;  4FAP A;  1F8A B;  2XP6 A;  1J6Y A;  3G6M A;  4JFM A;  3TDB A;  2ZR4 A;  3CGN A;  2O92 A;  3B8S A;  3UI5 A;  4JYS A;  3PRB A;  3UQB A;  2B31 A;  3AS1 A;  1BL4 A;  1FKT A;  3O5O A;  2A3E A;  3ARS A;  4R0X A;  1FKB A;  4MAV A;  3RM4 A;  2FAP A;  4J4O A;  5HTG A;  1EIB A;  3O5M A;  1NWU A;  4ZPV R;  3WL0 A;  5DF0 A;  2K8I A;  3KCE A;  2FKE A;  2IUZ A;  4P8U A;  3RFW A;  2RUD A;  4ODP A;  1FKH A;  5DIT A;  1UR8 A;  2DSU A;  3KZ7 A;  1LG2 A;  4Z2G A;  4ITZ A;  2IF4 A;  2Q5A A;  4MNK A;  3ARQ A;  2G41 A;  1NMV A;  3EY6 A;  4P8W A;  1QPF A;  2DG4 A;  2M2A A;  1JNT A;  1D7J A;  4HBO A;  1EDQ A;  2PPO A;  4HBE A;  3ARU A;  1OGG A;  1CTN A;  3KAG A;  2DPE A;  1ZU8 A;  3IK8 A;  1KT1 A;  1FFR A;  2XP9 A;  1XHG A;  5HUA A;  1D6O A;  3O5R A;  4IT4 A;  2JZV A;  3O5E A;  3O5I A;  3UQA A;  4TYO A;  5HW7 A;  3CH9 A;  3WD1 A;  2ZR5 A;  4WKA A;  4LAX A;  2MPH A;  5HKG A;  1WB0 A;  4ODO A;  3B7X A;  2WLY A;  3UF8 A;  1Q6H A;  2XP7 A;  3O5J A;  1LQ0 A;  3ARZ A;  1FD9 A;  4JFI A;  4NZC A;  1LG1 A;  3RM9 A;  4JFK A;  1C9H A;  2M08 A;  2XPA A;  3ALF A;  1KFW A;  1ZBK A;  2XPB A;  4PTM A;  1E6P A;  4MNJ A;  2KO7 A;  1M5Y A;  1K9T A;  3IKG A;  1GUV A;  1IX5 A;  1FKG A;  3ALG A;  4AY1 A;  3FY1 A;  1QZ2 A;  1YW5 A;  3NI6 A;  1E9L A;  1HJV A;  4WKF A;  2AOS A;  2PBC A;  2PV1 A;  3CHE A;  1O6I A;  1HKK A;  3WQV A;  1PIN A;  2KI3 A;  4DWS C;  1HKM A;  2YBT A;  1D2K A;  5DO2 A;  1X6L A;  1FKF A;  4HAR A;  1VF8 A;  2MF9 A;  3B9A A;  4U84 A;  4IQC A;  2RSE A;  4W9Q A;  2VN1 A;  1W1V A;  3MDY B;  3G6L A;  4Q7N A;  3UQI A;  4TNS A;  5DIU A;  5D75 A;  3CGM A;  3O5D A;  4DWS A;  3AS0 A;  2XP8 A;  3WD0 A;  2DG9 A;  1ITX A;  1ZBC A;  2PPP A;  4ODR A;  2M1I A;  4WIW A;  5B8I C;  5HWB A;  4ODM A;  4Z2L A;  3CHC A;  2MLZ A;  2ZQV A;  2YBU A;  3ART A;  3O5Q A;  3RME A;  1WNO A;  1EYM A;  2MLX A;  4URI A;  1U79 A;  1NWT A;  4ZPT R;  2KR7 A;  5BXJ A;  3WL1 A;  4DZ2 A;  5JH8 A;  3O5F A;  3O5K A;  1LJY A;  4U86 A;  1FKI A;  4FN2 A;  2RUQ A;  1FJD A;  2F4E A;  3I6C A;  1EHN A;  1X6N A;  1LL6 A;  1FKK A;  4DRJ A;  4DRH A;  2OLH A;  4W5U A;  1YAT A;  3W4R A;  1FKD A;  1TFV A;  3WD3 A;  2XP5 A;  2WM0 A;  1BKF A;  1NSG A;  2LJ4 A;  2ZQS A;  3KAC A;  4JFJ A;  4LAY A;  4MNM A;  3LUO A;  4TW8 A;  4GGQ A;  4MTV A;  2N87 A;  1ZCN A;  3TC5 A;  2UZ5 A;  4DT4 A;  1FKS A;  3B9E A;  1W9U A;  3AS3 A;  2XP4 A;  4DRO A;  4S3K A;  3QOK A;  1FKJ A;  3UI4 A;  3VAW A;  2WLZ A;  3CZ8 A;  1OWQ A;  4IPX A;  3ARY A;  4QT2 A;  4Z2I A;  4DRM A;  4LAV A;  1E6R A;  2A3C A;  3O5G A;  4G2P A;  4XAK A;  1XRV A;  3PRA A;  1J4I A;  3IKD A;  2LKN A;  1JNS A;  1D7I A;  3ODK A;  4Z2J A;  2F21 A;  4MGV A;  1ZB5 A;  1EQ3 A;  4DZ3 A;  4DH0 A;  1JVW A;  4J4N A;  4DWS B;  2PV3 A;  3ARX A;  1P5Q A;  4G50 A;  2KE0 A;  4DIP A;  1KT0 A;  1WAW A;  4MSP A;  3PRD A;  1ROU A;  4ODK A;  4Z2H A;  1E6Z A;  1NWR A;  4W9O A;  4JFL A;  4DRI A;  1NWS A;  4Z2K A;  4N19 A;  4QIB A;  1GPF A;  3WIJ A;  5HBF A;  1N1A A;  1RD6 A;  1SYT A;  2DT0 A;  1JND A;  4DRK A;  2RUC A;  2O9O A;  2A3B A;  1HKJ A;  4L72 B;  5GPR A;  3JYM A;  2RQS A;  1JNE A;  4MPK A;  1UR9 A;  2MLY A;  2DG3 A;  3CHF A;  4C02 B;  1L1P A;  2KFW A;  1E15 A;  2VCD A;  3KAD A;  1H0G A;  3NRK A;  3WD2 A;  3RGC A;  4QZV B;  3AQU A;  3H9R B;  3JXV A;  4L3N A;  1A7X A;  3ARV A;  3TCZ A;  3WD4 A;  2PV2 A;  4IT6 A;  2DSV A;  3PA7 A;  2D9F A;  1J4H A;  4P8X A;  3GPK A;  1ZBV A;  4ODL A;  4LGX A;  2G8Z A;  4ZS6 A;  3UI6 A;  4DRQ A;  4O2T A;  1J4R A;  3O5L A;  1LL4 A;  3O5P A;  4KQZ A;  2DSZ A;  1Y0O A;  2DT3 A;  3ARR A;  2LPV A;  2Y78 A;  3ARW A;  2LGO A;  4ML4 A;  2DT2 A;  4P8V A;  1NMW A;  3KAI A;  1W9P A;  3KAB A;  3FXY A;  4QT3 A;  5GQB A;  4MNL A;  3FAP A;  5DIV A;  1ZL1 A;  2AWG A;  3NTP A;  4DRN A;  3ARO A;  1NH6 A;  2PI6 A;  4R5E A;  3KAF A;  3KAH A;  3WKZ A;  1FKL A;  3ARP A;  1GOI A;  4TW7 A;  5I98 A;  1W1Y A;  1HJX A;  1PBK A;  2PPN A;  4WJX A;  1R9H A;  3IHZ A;  4GIV A;  3OA5 A;  1H0I A;  2DSW A;  1FFQ A;  4DRP A;  1Q6I A;  3PR9 A;  5HW8 A;  2ITK A;  2ESC A;  2XP3 A;  4BF8 A;  5GPG A;  1HXV A;  1HJW A;  1E6N A;  4ODN A;  5J6E A;  2QF8 A;  3BXW A;  4ZPW R;  2KGJ A;  1HKI A;  4TX0 A;  3B9D A;  4U85 A;  2ZR6 A;  4IQ2 A;  1ROT A;  1D7H A;  1B6C A;  1W1T A;  4DWS D;  1FKR A;  3RM8 A;  3WH0 A;  4Q22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...