4IPXA

Analyzing the visible conformational substates of the fk506 binding protein fkbp12
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysing the visible conformational substates of the FK506-binding protein FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
total genus 28
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4ipxA00
3TDBA 3TCZA 1YATA 4C02B 2FKEA 1T11A 4IQ2A 3O5JA 1D7HA 1KT1A 1Q6HA 2LPVA 2XP5A 1P5QA 2KI3A 4IPXA 5HW8A 4DRIA 1PBKA 3I6CA 3PRBA 2M1IA 4LAVA 2VCDA 1EYMA 1NSGA 3CGNA 4G2PA 2MLZA 3IK8A 3KZ7A 4QIBA 1B6CA 3O5PA 4JFMA 2ZQSA 3IHZA 2LKNA 3UF8A 1NMWA 1FKTA 2PV1A 4ODQA 3O5KA 3TC5A 4DRHA 3O5FA 1FKBA 1A7XA 3O5MA 2N87A 4TW6A 5HW7A 3NI6A 2PV2A 5DIUA 3KADA 3GPKA 2RSEA 3PA7A 1QPLA 1FAPA 3LUOA 3KAIA 4J4OA 1FKJA 1Q1CA 2JZVA 1BKFA 1ZK6A 2F2DA 2XP3A 2XPBA 4ODRA 4U85A 4W9QA 5GPGA 2XP8A 4MSPA 3RFWA 4N19A 4U86A 4W9OA 1N1AA 4JFIA 4R0XA 4DZ3A 5HTGA 1F40A 2PV3A 2XP6A 3PRDA 1D6OA 4GGQA 2XP7A 1U79A 4TW8A 5BXJA 2ZQUA 2F4EA 2RUDA 1FJDA 2XP4A 1Q6UA 4BF8A 3O5IA 2RUCA 1FKHA 3KAHA 2ZR6A 3UI6A 2KO7A 4TNSA 1FKGA 2Y78A 1J6YA 1JVWA 3O5GA 2F21A 1J4HA 4NNRA 1D7IA 1PINA 4GIVA 2M08A 2RURA 4DRJA 2ZR4A 3KABA 1NMVA 1Y0OA 1J4IA 5HWBA 3NTPA 3O5EA 4ODNA 3B7XA 4ODOA 1ROUA 4DZ2A 4DT4A 2ZQVA 1FKRA 4TYOA 4LAWA 5DITA 1EQ3A 1HXVA 2LJ4A 2MNTA 3UI5A 5HW6A 4TW7A 3UQIA 5I98A 1QPFA 3JXVA 3O5OA 5HWCA 3KCEA 2KGJA 1M5YA 2RQSA 2FAPA 1J4RA 4IQCA 4JFKA 4DROA 3O5DA 2IF4A 3VAWA 4JFJA 4JYSA 2ITKA 2RUQA 2ZR5A 2KFWA 4FN2A 1L1PA 1Q6IA 1ZCNA 1TCOC 2L2SA 1KT0A 1FKDA 2K8IA 1FKFA 2LGOA 3KAFA 2OFNA 4O2TA 4JFLA 4QT2A 2UZ5A 2D9FA 1F8AB 4DRQA 1ROTA 3KAGA 3KACA 3IKDA 3UI4A 2Q5AA 1R9HA 2MLYA 3NRKA 2DG3A 4ODMA 4LAYA 2DG9A 1D7JA 4U84A 4DRPA 2KR7A 4J4NA 2ZQTA 2M2AA 3EY6A 3O5QA 4FAPA 5HUAA 2MF9A 5HKGA 1FKLA 1FKIA 2MLXA 3IKGA 3WH0A 4TX0A 3FAPA 3MDYB 4MGVA 2PBCA 4DRKA 3H9RB 3OOBA 3O5RA 3UQAA 2VN1A 3UQBA 1JNTA 1QZ2A 2DG4A 5D75A 4DRNA 3JYJA 2KE0A 4G50A 3ODKA 4LAXA 2XPAA 3O5LA 2PPOA 4DH0A 1W26A 2MPHA 1JNSA 3JYMA 5B8IC 1BL4A 4DIPA 5DIVA 5HT1A 4ODLA 5J6EA 1FD9A 2PPNA 4QT3A 3RGCA 1FKSA 3CGMA 1YW5A 1FKKA 2XP9A 4ODKA 4W9PA 1C9HA 2AWGA 4DRMA 4ODPA 4ITZA 2PPPA
chains in the Genus database with same CATH superfamily
3TDBA 1IX5A 4C02B 4IQ2A 3O5JA 1P5QA 4IPXA 3PRBA 4QZVB 4LAVA 4Q7NA 4Z2KA 5GPRA 4QIBA 1B6CA 4JFMA 1NMWA 2EULA 2PV1A 4DRHA 1FKBA 1ZBKA 2DSVA 3NI6A 2DSWA 3B9EA 4L72B 3LUOA 4J4OA 5DEZA 3KAIA 4ODRA 2JZVA 4KQZA 1NWSA 4MNLA 2WLYA 4R5EA 4W9QA 3RFWA 1XRVA 4U86A 1ZBCA 1FJDA 3AS1A 1NWRA 2RUCA 2ZR6A 4WKAA 4S3JA 4TNSA 1E9LA 1FKGA 3AS2A 1J6YA 4MPKA 1D7IA 2FDMA 2ZR4A 4WJXA 1UR9A 5HWBA 1EIBA 1ZB5A 3NTPA 3B9AA 4DZ2A 3CHCA 4DT4A 2ZQVA 1FKRA 1NH6A 4LAWA 1D2KA 2DPEA 1TFVA 5HW6A 1HKJA 2YBUA 5HWCA 1M5YA 4JFKA 4DROA 3O5DA 2ZR5A 3BXWA 3PRAA 1KT0A 2WK2A 4UDMA 3B8SA 1HKKA 2LGOA 3WIJA 4Z2HA 3KACA 3IKDA 4ML4A 4MNKA 1JNEA 1W9PA 5GQBA 4LAYA 1D7JA 3RMEA 2KR7A 4J4NA 3WH0A 3ARVA 3FAPA 3WD3A 2DT2A 1LG1A 1JNTA 2DG4A 4DRNA 3WL1A 1XHGA 1HKMA 1LL7A 2PPOA 2MPHA 5DIVA 5HT1A 3WD0A 5J6EA 3RGCA 4P8UA 1WAWA 2AOSA 4W9PA 4DRMA 4ODPA 3VAWA 3ARPA 1FFRA 1KT1A 1K9TA 1HJWA 4DRIA 4G2PA 1EYMA 3CGNA 3IK8A 3ARXA 3O5PA 2LKNA 3UF8A 4DWSB 2OLHA 1FKTA 4ZPVR 1LG2A 1A7XA 4TW6A 3GPKA 3PA7A 1QPLA 2ETNA 1FKJA 1ZK6A 2F2DA 1NWUA 4IT4A 3ARYA 1EHNA 4JFIA 4R0XA 3CZ8A 2PV3A 3PRDA 4TW8A 5BXJA 2RUDA 3ALGA 1Q6UA 2A3EA 1X6LA 1PINA 4GIVA 1NMVA 1Y0OA 3GTYX 3O5EA 4URIA 3B7XA 1ROUA 1EQ3A 4LGXA 3JXVA 1W1TA 2RQSA 2FAPA 1J4RA 3RM4A 2ITKA 2RUQA 4FN2A 1Q6IA 1ZL1A 1HJXA 2K8IA 1FKFA 3KAFA 2OFNA 3EIPA 1ROTA 3FXYA 2Q5AA 1LQ0A 2M2AA 2MF9A 4WKHA 1FKIA 4TX0A 2G41A 2F23A 2YBTA 2PBCA 3H9RB 1E6RA 3O5RA 2KE0A 2A3AA 3QOKA 2P4VA 4HBOA 3O5LA 1JNSA 1SR0A 2QF8A 3FY1A 1ITXA 2DT1A 1FKKA 2XP9A 1C9HA 3AQUA 4MGVA 3TCZA 2FKEA 3ARQA 1T11A 4HBEA 1D7HA 3ALFA 2XP5A 3I6CA 2M1IA 2O92A 1O6IA 1NSGA 3WD1A 3KZ7A 2ZQSA 4ODQA 1WB0A 3O5KA 3TC5A 2N87A 1E44A 3ARTA 2PV2A 5DIUA 3KADA 1JCHB 2WLZA 1BKFA 2XPBA 2XP3A 4U85A 5GPGA 4DWSD 4MSPA 2A3CA 4W9OA 1KFWA 1GUVA 4DZ3A 1F40A 2XP6A 3CHDA 2XP7A 1U79A 5JH8A 1OGBA 1WNOA 2XP4A 4BF8A 3O5IA 1E6ZA 1FKHA 3ARUA 3KAHA 3UI6A 2KO7A 4S3KA 2Y78A 1GPFA 1JVWA 3O5GA 1W9UA 1J4HA 4NNRA 1W9VA 2DT3A 2RURA 1ZU8A 3KABA 1J4IA 1GRJA 4P8VA 3CHFA 5HBFA 3WQWA 1SYTA 4TYOA 3G6LA 2LJ4A 4NSBA 2MNTA 4TW7A 3UQIA 1QPFA 1HXVA 3KCEA 4IQCA 4JFJA 1OWQA 1L1PA 1TCOC 3W4RA 4MTVA 1OGGA 4JFLA 4QT2A 4DWSC 1F8AB 1ZBWA 4DRQA 3KAGA 3RM8A 1W1PA 2MLYA 5DO2A 4ODMA 2DG3A 4DRPA 2ZQTA 3AS3A 3EY6A 3O5QA 5HKGA 2MLXA 1E6PA 3WQVA 4Z2IA 2ESCA 3OOBA 4ZPWR 3UQBA 4ZPTR 4WK9A 1W1VA 4G50A 3ODKA 4MNJA 4DH0A 1W26A 4KR0B 3ARSA 3AS0A 3CHEA 1BL4A 4DIPA 4QT3A 2PPNA 1LL6A 1FKSA 4HARA 4Z2GA 3ARRA 1CTNA 1UR8A 1GOIA 4ODKA 1FFQA 4ITZA 3OA5A 5I98A 1YATA 2PI6A 1LL4A 1Q6HA 2LPVA 1E6NA 2KI3A 5HW8A 1PBKA 2O9OA 2VCDA 2MLZA 4Q22A 3ARZA 3IHZA 4IT6A 4P8XA 3O5FA 3CH9A 2PN0A 2A3BA 2G8ZA 3O5MA 2B5UB 3WKZA 5HW7A 4Z2JA 3GU0A 2RSEA 1FAPA 4WIWA 1HKIA 1Q1CA 3WD2A 2XP8A 1JNDA 4N19A 4WKFA 1N1AA 5DF0A 5HTGA 1X6NA 1D6OA 4GGQA 2ZQUA 2F4EA 4W5UA 3G6MA 3RM9A 3PR9A 1RD6A 2DSZA 1H0IA 2F21A 2DSUA 2M08A 4DRJA 4ODNA 1LJYA 4ODOA 1ZBVA 5DITA 3UI5A 3O5OA 2KGJA 4Z2LA 4DWSA 2IF4A 4ZS6A 4JYSA 3BMBA 2IUZA 1H0GA 2KFWA 4XAKA 1ZCNA 3AROA 2L2SA 4P8WA 1FKDA 1VF8A 4O2TA 4L3NA 2UZ5A 2D9FA 1HJVA 3UI4A 1R9HA 3NRKA 2DG9A 1EDQA 4U84A 5HUAA 4FAPA 2B31A 1FKLA 4AY1A 1NWTA 3IKGA 3MDYB 1W1YA 3WD4A 4DRKA 4PTMA 3UQAA 2DT0A 2VN1A 1QZ2A 5D75A 3JYJA 3B9DA 3WL0A 4MNMA 4LAXA 2XPAA 1E15A 3JYMA 2WM0A 5B8IC 3ARWA 4ODLA 1FD9A 3CGMA 4MAVA 1YW5A 4NZCA 2AWGA 2PPPA
chains in the Genus database with same CATH topology
3TDBA 1IX5A 4C02B 4IQ2A 3O5JA 1P5QA 4IPXA 3PRBA 4QZVB 4LAVA 4Q7NA 4Z2KA 5GPRA 4QIBA 1B6CA 4JFMA 1NMWA 2PV1A 4DRHA 1FKBA 1ZBKA 2DSVA 3NI6A 2DSWA 3B9EA 4L72B 3LUOA 4J4OA 5DEZA 3KAIA 4ODRA 2JZVA 4KQZA 1NWSA 4MNLA 2WLYA 4R5EA 4W9QA 3RFWA 1XRVA 4U86A 1ZBCA 1FJDA 3AS1A 1NWRA 2RUCA 2ZR6A 4WKAA 4S3JA 4TNSA 1E9LA 1FKGA 3AS2A 1J6YA 4MPKA 1D7IA 2FDMA 2ZR4A 4WJXA 1UR9A 5HWBA 1EIBA 1ZB5A 3NTPA 3B9AA 4DZ2A 3CHCA 4DT4A 2ZQVA 1FKRA 1NH6A 4LAWA 1D2KA 2DPEA 1TFVA 5HW6A 1HKJA 2YBUA 5HWCA 1M5YA 4JFKA 4DROA 3O5DA 2ZR5A 3BXWA 3PRAA 1KT0A 2WK2A 3B8SA 1HKKA 2LGOA 3WIJA 4Z2HA 3KACA 3IKDA 4ML4A 4MNKA 1JNEA 1W9PA 5GQBA 4LAYA 1D7JA 3RMEA 2KR7A 4J4NA 3WH0A 3ARVA 3FAPA 3WD3A 2DT2A 1LG1A 1JNTA 2DG4A 4DRNA 3WL1A 1XHGA 1HKMA 1LL7A 2PPOA 2MPHA 5DIVA 5HT1A 3WD0A 5J6EA 3RGCA 4P8UA 1WAWA 2AOSA 4W9PA 4DRMA 4ODPA 3VAWA 3ARPA 1FFRA 1KT1A 1K9TA 1HJWA 4DRIA 4G2PA 1EYMA 3CGNA 3IK8A 3ARXA 3O5PA 2LKNA 3UF8A 4DWSB 2OLHA 1FKTA 4ZPVR 1LG2A 1A7XA 4TW6A 3GPKA 3PA7A 1QPLA 1FKJA 1ZK6A 2F2DA 1NWUA 4IT4A 3ARYA 1EHNA 4JFIA 4R0XA 3CZ8A 2PV3A 3PRDA 4TW8A 5BXJA 2RUDA 3ALGA 1Q6UA 2A3EA 1X6LA 1PINA 4GIVA 1NMVA 1Y0OA 3O5EA 4URIA 3B7XA 1ROUA 1EQ3A 4LGXA 3JXVA 1W1TA 2RQSA 2FAPA 1J4RA 3RM4A 2ITKA 2RUQA 4FN2A 1Q6IA 1ZL1A 1HJXA 2K8IA 1FKFA 3KAFA 2OFNA 1ROTA 3FXYA 2Q5AA 1LQ0A 2M2AA 2MF9A 4WKHA 1FKIA 4TX0A 2G41A 2YBTA 2PBCA 3H9RB 1E6RA 3O5RA 2KE0A 2A3AA 3QOKA 4HBOA 3O5LA 1JNSA 1SR0A 2QF8A 3FY1A 1ITXA 2DT1A 1FKKA 2XP9A 1C9HA 3AQUA 4MGVA 3TCZA 2FKEA 3ARQA 1T11A 4HBEA 1D7HA 3ALFA 2XP5A 3I6CA 2M1IA 2O92A 1O6IA 1NSGA 3WD1A 3KZ7A 2ZQSA 4ODQA 1WB0A 3O5KA 3TC5A 2N87A 3ARTA 2PV2A 5DIUA 3KADA 2WLZA 2XP3A 1BKFA 2XPBA 4U85A 5GPGA 4DWSD 4MSPA 2A3CA 4W9OA 1KFWA 1GUVA 4DZ3A 1F40A 2XP6A 3CHDA 2XP7A 1U79A 5JH8A 1OGBA 1WNOA 2XP4A 4BF8A 3O5IA 1E6ZA 1FKHA 3ARUA 3KAHA 3UI6A 2KO7A 4S3KA 2Y78A 1GPFA 1JVWA 3O5GA 1W9UA 1J4HA 4NNRA 1W9VA 2DT3A 2RURA 1ZU8A 3KABA 1J4IA 4P8VA 3CHFA 5HBFA 3WQWA 1SYTA 4TYOA 3G6LA 2LJ4A 4NSBA 2MNTA 4TW7A 3UQIA 1QPFA 1HXVA 3KCEA 4IQCA 4JFJA 1OWQA 1L1PA 1TCOC 3W4RA 4MTVA 1OGGA 4JFLA 4QT2A 4DWSC 1F8AB 1ZBWA 4DRQA 3KAGA 3RM8A 1W1PA 2MLYA 5DO2A 4ODMA 2DG3A 4DRPA 2ZQTA 3AS3A 3EY6A 3O5QA 5HKGA 2MLXA 1E6PA 3WQVA 4Z2IA 2ESCA 3OOBA 4ZPWR 3UQBA 4ZPTR 4WK9A 1W1VA 4G50A 3ODKA 4MNJA 4DH0A 1W26A 4KR0B 3ARSA 3AS0A 3CHEA 1BL4A 4DIPA 4QT3A 2PPNA 1LL6A 1FKSA 4HARA 4Z2GA 3ARRA 1CTNA 1UR8A 1GOIA 4ODKA 1FFQA 4ITZA 3OA5A 5I98A 1YATA 2PI6A 1LL4A 1Q6HA 2LPVA 1E6NA 2KI3A 5HW8A 1PBKA 2O9OA 2VCDA 2MLZA 4Q22A 3ARZA 3IHZA 4IT6A 4P8XA 3O5FA 3CH9A 2A3BA 2G8ZA 3O5MA 3WKZA 5HW7A 4Z2JA 2RSEA 1FAPA 4WIWA 1HKIA 1Q1CA 3WD2A 2XP8A 1JNDA 4N19A 4WKFA 1N1AA 5DF0A 5HTGA 1X6NA 1D6OA 4GGQA 2ZQUA 2F4EA 4W5UA 3G6MA 3RM9A 3PR9A 1RD6A 2DSZA 1H0IA 2F21A 2DSUA 2M08A 4DRJA 4ODNA 1LJYA 4ODOA 1ZBVA 5DITA 3UI5A 3O5OA 2KGJA 4Z2LA 4DWSA 2IF4A 4ZS6A 4JYSA 2IUZA 1H0GA 2KFWA 4XAKA 1ZCNA 3AROA 2L2SA 4P8WA 1FKDA 1VF8A 4O2TA 4L3NA 2UZ5A 2D9FA 1HJVA 3UI4A 1R9HA 3NRKA 2DG9A 1EDQA 4U84A 5HUAA 4FAPA 2B31A 1FKLA 4AY1A 1NWTA 3IKGA 3MDYB 1W1YA 3WD4A 4DRKA 4PTMA 3UQAA 2DT0A 2VN1A 1QZ2A 5D75A 3JYJA 3B9DA 3WL0A 4MNMA 4LAXA 2XPAA 1E15A 3JYMA 2WM0A 5B8IC 3ARWA 4ODLA 1FD9A 3CGMA 4MAVA 1YW5A 4NZCA 2AWGA 2PPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDB A;  3TCZ A;  1YAT A;  4C02 B;  2FKE A;  1T11 A;  4IQ2 A;  3O5J A;  1D7H A;  1KT1 A;  1Q6H A;  2LPV A;  2XP5 A;  1P5Q A;  2KI3 A;  4IPX A;  5HW8 A;  4DRI A;  1PBK A;  3I6C A;  3PRB A;  2M1I A;  4LAV A;  2VCD A;  1EYM A;  1NSG A;  3CGN A;  4G2P A;  2MLZ A;  3IK8 A;  3KZ7 A;  4QIB A;  1B6C A;  3O5P A;  4JFM A;  2ZQS A;  3IHZ A;  2LKN A;  3UF8 A;  1NMW A;  1FKT A;  2PV1 A;  4ODQ A;  3O5K A;  3TC5 A;  4DRH A;  3O5F A;  1FKB A;  1A7X A;  3O5M A;  2N87 A;  4TW6 A;  5HW7 A;  3NI6 A;  2PV2 A;  5DIU A;  3KAD A;  3GPK A;  2RSE A;  3PA7 A;  1QPL A;  1FAP A;  3LUO A;  3KAI A;  4J4O A;  1FKJ A;  1Q1C A;  2JZV A;  1BKF A;  1ZK6 A;  2F2D A;  2XP3 A;  2XPB A;  4ODR A;  4U85 A;  4W9Q A;  5GPG A;  2XP8 A;  4MSP A;  3RFW A;  4N19 A;  4U86 A;  4W9O A;  1N1A A;  4JFI A;  4R0X A;  4DZ3 A;  5HTG A;  1F40 A;  2PV3 A;  2XP6 A;  3PRD A;  1D6O A;  4GGQ A;  2XP7 A;  1U79 A;  4TW8 A;  5BXJ A;  2ZQU A;  2F4E A;  2RUD A;  1FJD A;  2XP4 A;  1Q6U A;  4BF8 A;  3O5I A;  2RUC A;  1FKH A;  3KAH A;  2ZR6 A;  3UI6 A;  2KO7 A;  4TNS A;  1FKG A;  2Y78 A;  1J6Y A;  1JVW A;  3O5G A;  2F21 A;  1J4H A;  4NNR A;  1D7I A;  1PIN A;  4GIV A;  2M08 A;  2RUR A;  4DRJ A;  2ZR4 A;  3KAB A;  1NMV A;  1Y0O A;  1J4I A;  5HWB A;  3NTP A;  3O5E A;  4ODN A;  3B7X A;  4ODO A;  1ROU A;  4DZ2 A;  4DT4 A;  2ZQV A;  1FKR A;  4TYO A;  4LAW A;  5DIT A;  1EQ3 A;  1HXV A;  2LJ4 A;  2MNT A;  3UI5 A;  5HW6 A;  4TW7 A;  3UQI A;  5I98 A;  1QPF A;  3JXV A;  3O5O A;  5HWC A;  3KCE A;  2KGJ A;  1M5Y A;  2RQS A;  2FAP A;  1J4R A;  4IQC A;  4JFK A;  4DRO A;  3O5D A;  2IF4 A;  3VAW A;  4JFJ A;  4JYS A;  2ITK A;  2RUQ A;  2ZR5 A;  2KFW A;  4FN2 A;  1L1P A;  1Q6I A;  1ZCN A;  1TCO C;  2L2S A;  1KT0 A;  1FKD A;  2K8I A;  1FKF A;  2LGO A;  3KAF A;  2OFN A;  4O2T A;  4JFL A;  4QT2 A;  2UZ5 A;  2D9F A;  1F8A B;  4DRQ A;  1ROT A;  3KAG A;  3KAC A;  3IKD A;  3UI4 A;  2Q5A A;  1R9H A;  2MLY A;  3NRK A;  2DG3 A;  4ODM A;  4LAY A;  2DG9 A;  1D7J A;  4U84 A;  4DRP A;  2KR7 A;  4J4N A;  2ZQT A;  2M2A A;  3EY6 A;  3O5Q A;  4FAP A;  5HUA A;  2MF9 A;  5HKG A;  1FKL A;  1FKI A;  2MLX A;  3IKG A;  3WH0 A;  4TX0 A;  3FAP A;  3MDY B;  4MGV A;  2PBC A;  4DRK A;  3H9R B;  3OOB A;  3O5R A;  3UQA A;  2VN1 A;  3UQB A;  1JNT A;  1QZ2 A;  2DG4 A;  5D75 A;  4DRN A;  3JYJ A;  2KE0 A;  4G50 A;  3ODK A;  4LAX A;  2XPA A;  3O5L A;  2PPO A;  4DH0 A;  1W26 A;  2MPH A;  1JNS A;  3JYM A;  5B8I C;  1BL4 A;  4DIP A;  5DIV A;  5HT1 A;  4ODL A;  5J6E A;  1FD9 A;  2PPN A;  4QT3 A;  3RGC A;  1FKS A;  3CGM A;  1YW5 A;  1FKK A;  2XP9 A;  4ODK A;  4W9P A;  1C9H A;  2AWG A;  4DRM A;  4ODP A;  4ITZ A;  2PPP A; 
#chains in the Genus database with same CATH topology
 3TDB A;  1IX5 A;  4C02 B;  4IQ2 A;  3O5J A;  1P5Q A;  4IPX A;  3PRB A;  4QZV B;  4LAV A;  4Q7N A;  4Z2K A;  5GPR A;  4QIB A;  1B6C A;  4JFM A;  1NMW A;  2EUL A;  2PV1 A;  4DRH A;  1FKB A;  1ZBK A;  2DSV A;  3NI6 A;  2DSW A;  3B9E A;  4L72 B;  3LUO A;  4J4O A;  5DEZ A;  3KAI A;  4ODR A;  2JZV A;  4KQZ A;  1NWS A;  4MNL A;  2WLY A;  4R5E A;  4W9Q A;  3RFW A;  1XRV A;  4U86 A;  1ZBC A;  1FJD A;  3AS1 A;  1NWR A;  2RUC A;  2ZR6 A;  4WKA A;  4S3J A;  4TNS A;  1E9L A;  1FKG A;  3AS2 A;  1J6Y A;  4MPK A;  1D7I A;  2FDM A;  2ZR4 A;  4WJX A;  1UR9 A;  5HWB A;  1EIB A;  1ZB5 A;  3NTP A;  3B9A A;  4DZ2 A;  3CHC A;  4DT4 A;  2ZQV A;  1FKR A;  1NH6 A;  4LAW A;  1D2K A;  2DPE A;  1TFV A;  5HW6 A;  1HKJ A;  2YBU A;  5HWC A;  1M5Y A;  4JFK A;  4DRO A;  3O5D A;  2ZR5 A;  3BXW A;  3PRA A;  1KT0 A;  2WK2 A;  4UDM A;  3B8S A;  1HKK A;  2LGO A;  3WIJ A;  4Z2H A;  3KAC A;  3IKD A;  4ML4 A;  4MNK A;  1JNE A;  1W9P A;  5GQB A;  4LAY A;  1D7J A;  3RME A;  2KR7 A;  4J4N A;  3WH0 A;  3ARV A;  3FAP A;  3WD3 A;  2DT2 A;  1LG1 A;  1JNT A;  2DG4 A;  4DRN A;  3WL1 A;  1XHG A;  1HKM A;  1LL7 A;  2PPO A;  2MPH A;  5DIV A;  5HT1 A;  3WD0 A;  5J6E A;  3RGC A;  4P8U A;  1WAW A;  2AOS A;  4W9P A;  4DRM A;  4ODP A;  3VAW A;  3ARP A;  1FFR A;  1KT1 A;  1K9T A;  1HJW A;  4DRI A;  4G2P A;  1EYM A;  3CGN A;  3IK8 A;  3ARX A;  3O5P A;  2LKN A;  3UF8 A;  4DWS B;  2OLH A;  1FKT A;  4ZPV R;  1LG2 A;  1A7X A;  4TW6 A;  3GPK A;  3PA7 A;  1QPL A;  2ETN A;  1FKJ A;  1ZK6 A;  2F2D A;  1NWU A;  4IT4 A;  3ARY A;  1EHN A;  4JFI A;  4R0X A;  3CZ8 A;  2PV3 A;  3PRD A;  4TW8 A;  5BXJ A;  2RUD A;  3ALG A;  1Q6U A;  2A3E A;  1X6L A;  1PIN A;  4GIV A;  1NMV A;  1Y0O A;  3GTY X;  3O5E A;  4URI A;  3B7X A;  1ROU A;  1EQ3 A;  4LGX A;  3JXV A;  1W1T A;  2RQS A;  2FAP A;  1J4R A;  3RM4 A;  2ITK A;  2RUQ A;  4FN2 A;  1Q6I A;  1ZL1 A;  1HJX A;  2K8I A;  1FKF A;  3KAF A;  2OFN A;  3EIP A;  1ROT A;  3FXY A;  2Q5A A;  1LQ0 A;  2M2A A;  2MF9 A;  4WKH A;  1FKI A;  4TX0 A;  2G41 A;  2F23 A;  2YBT A;  2PBC A;  3H9R B;  1E6R A;  3O5R A;  2KE0 A;  2A3A A;  3QOK A;  2P4V A;  4HBO A;  3O5L A;  1JNS A;  1SR0 A;  2QF8 A;  3FY1 A;  1ITX A;  2DT1 A;  1FKK A;  2XP9 A;  1C9H A;  3AQU A;  4MGV A;  3TCZ A;  2FKE A;  3ARQ A;  1T11 A;  4HBE A;  1D7H A;  3ALF A;  2XP5 A;  3I6C A;  2M1I A;  2O92 A;  1O6I A;  1NSG A;  3WD1 A;  3KZ7 A;  2ZQS A;  4ODQ A;  1WB0 A;  3O5K A;  3TC5 A;  2N87 A;  1E44 A;  3ART A;  2PV2 A;  5DIU A;  3KAD A;  1JCH B;  2WLZ A;  1BKF A;  2XPB A;  2XP3 A;  4U85 A;  5GPG A;  4DWS D;  4MSP A;  2A3C A;  4W9O A;  1KFW A;  1GUV A;  4DZ3 A;  1F40 A;  2XP6 A;  3CHD A;  2XP7 A;  1U79 A;  5JH8 A;  1OGB A;  1WNO A;  2XP4 A;  4BF8 A;  3O5I A;  1E6Z A;  1FKH A;  3ARU A;  3KAH A;  3UI6 A;  2KO7 A;  4S3K A;  2Y78 A;  1GPF A;  1JVW A;  3O5G A;  1W9U A;  1J4H A;  4NNR A;  1W9V A;  2DT3 A;  2RUR A;  1ZU8 A;  3KAB A;  1J4I A;  1GRJ A;  4P8V A;  3CHF A;  5HBF A;  3WQW A;  1SYT A;  4TYO A;  3G6L A;  2LJ4 A;  4NSB A;  2MNT A;  4TW7 A;  3UQI A;  1QPF A;  1HXV A;  3KCE A;  4IQC A;  4JFJ A;  1OWQ A;  1L1P A;  1TCO C;  3W4R A;  4MTV A;  1OGG A;  4JFL A;  4QT2 A;  4DWS C;  1F8A B;  1ZBW A;  4DRQ A;  3KAG A;  3RM8 A;  1W1P A;  2MLY A;  5DO2 A;  4ODM A;  2DG3 A;  4DRP A;  2ZQT A;  3AS3 A;  3EY6 A;  3O5Q A;  5HKG A;  2MLX A;  1E6P A;  3WQV A;  4Z2I A;  2ESC A;  3OOB A;  4ZPW R;  3UQB A;  4ZPT R;  4WK9 A;  1W1V A;  4G50 A;  3ODK A;  4MNJ A;  4DH0 A;  1W26 A;  4KR0 B;  3ARS A;  3AS0 A;  3CHE A;  1BL4 A;  4DIP A;  4QT3 A;  2PPN A;  1LL6 A;  1FKS A;  4HAR A;  4Z2G A;  3ARR A;  1CTN A;  1UR8 A;  1GOI A;  4ODK A;  1FFQ A;  4ITZ A;  3OA5 A;  5I98 A;  1YAT A;  2PI6 A;  1LL4 A;  1Q6H A;  2LPV A;  1E6N A;  2KI3 A;  5HW8 A;  1PBK A;  2O9O A;  2VCD A;  2MLZ A;  4Q22 A;  3ARZ A;  3IHZ A;  4IT6 A;  4P8X A;  3O5F A;  3CH9 A;  2PN0 A;  2A3B A;  2G8Z A;  3O5M A;  2B5U B;  3WKZ A;  5HW7 A;  4Z2J A;  3GU0 A;  2RSE A;  1FAP A;  4WIW A;  1HKI A;  1Q1C A;  3WD2 A;  2XP8 A;  1JND A;  4N19 A;  4WKF A;  1N1A A;  5DF0 A;  5HTG A;  1X6N A;  1D6O A;  4GGQ A;  2ZQU A;  2F4E A;  4W5U A;  3G6M A;  3RM9 A;  3PR9 A;  1RD6 A;  2DSZ A;  1H0I A;  2F21 A;  2DSU A;  2M08 A;  4DRJ A;  4ODN A;  1LJY A;  4ODO A;  1ZBV A;  5DIT A;  3UI5 A;  3O5O A;  2KGJ A;  4Z2L A;  4DWS A;  2IF4 A;  4ZS6 A;  4JYS A;  3BMB A;  2IUZ A;  1H0G A;  2KFW A;  4XAK A;  1ZCN A;  3ARO A;  2L2S A;  4P8W A;  1FKD A;  1VF8 A;  4O2T A;  4L3N A;  2UZ5 A;  2D9F A;  1HJV A;  3UI4 A;  1R9H A;  3NRK A;  2DG9 A;  1EDQ A;  4U84 A;  5HUA A;  4FAP A;  2B31 A;  1FKL A;  4AY1 A;  1NWT A;  3IKG A;  3MDY B;  1W1Y A;  3WD4 A;  4DRK A;  4PTM A;  3UQA A;  2DT0 A;  2VN1 A;  1QZ2 A;  5D75 A;  3JYJ A;  3B9D A;  3WL0 A;  4MNM A;  4LAX A;  2XPA A;  1E15 A;  3JYM A;  2WM0 A;  5B8I C;  3ARW A;  4ODL A;  1FD9 A;  3CGM A;  4MAV A;  1YW5 A;  4NZC A;  2AWG A;  2PPP A; 
#chains in the Genus database with same CATH homology
 3TDB A;  1IX5 A;  4C02 B;  4IQ2 A;  3O5J A;  1P5Q A;  4IPX A;  3PRB A;  4QZV B;  4LAV A;  4Q7N A;  4Z2K A;  5GPR A;  4QIB A;  1B6C A;  4JFM A;  1NMW A;  2PV1 A;  4DRH A;  1FKB A;  1ZBK A;  2DSV A;  3NI6 A;  2DSW A;  3B9E A;  4L72 B;  3LUO A;  4J4O A;  5DEZ A;  3KAI A;  4ODR A;  2JZV A;  4KQZ A;  1NWS A;  4MNL A;  2WLY A;  4R5E A;  4W9Q A;  3RFW A;  1XRV A;  4U86 A;  1ZBC A;  1FJD A;  3AS1 A;  1NWR A;  2RUC A;  2ZR6 A;  4WKA A;  4S3J A;  4TNS A;  1E9L A;  1FKG A;  3AS2 A;  1J6Y A;  4MPK A;  1D7I A;  2FDM A;  2ZR4 A;  4WJX A;  1UR9 A;  5HWB A;  1EIB A;  1ZB5 A;  3NTP A;  3B9A A;  4DZ2 A;  3CHC A;  4DT4 A;  2ZQV A;  1FKR A;  1NH6 A;  4LAW A;  1D2K A;  2DPE A;  1TFV A;  5HW6 A;  1HKJ A;  2YBU A;  5HWC A;  1M5Y A;  4JFK A;  4DRO A;  3O5D A;  2ZR5 A;  3BXW A;  3PRA A;  1KT0 A;  2WK2 A;  3B8S A;  1HKK A;  2LGO A;  3WIJ A;  4Z2H A;  3KAC A;  3IKD A;  4ML4 A;  4MNK A;  1JNE A;  1W9P A;  5GQB A;  4LAY A;  1D7J A;  3RME A;  2KR7 A;  4J4N A;  3WH0 A;  3ARV A;  3FAP A;  3WD3 A;  2DT2 A;  1LG1 A;  1JNT A;  2DG4 A;  4DRN A;  3WL1 A;  1XHG A;  1HKM A;  1LL7 A;  2PPO A;  2MPH A;  5DIV A;  5HT1 A;  3WD0 A;  5J6E A;  3RGC A;  4P8U A;  1WAW A;  2AOS A;  4W9P A;  4DRM A;  4ODP A;  3VAW A;  3ARP A;  1FFR A;  1KT1 A;  1K9T A;  1HJW A;  4DRI A;  4G2P A;  1EYM A;  3CGN A;  3IK8 A;  3ARX A;  3O5P A;  2LKN A;  3UF8 A;  4DWS B;  2OLH A;  1FKT A;  4ZPV R;  1LG2 A;  1A7X A;  4TW6 A;  3GPK A;  3PA7 A;  1QPL A;  1FKJ A;  1ZK6 A;  2F2D A;  1NWU A;  4IT4 A;  3ARY A;  1EHN A;  4JFI A;  4R0X A;  3CZ8 A;  2PV3 A;  3PRD A;  4TW8 A;  5BXJ A;  2RUD A;  3ALG A;  1Q6U A;  2A3E A;  1X6L A;  1PIN A;  4GIV A;  1NMV A;  1Y0O A;  3O5E A;  4URI A;  3B7X A;  1ROU A;  1EQ3 A;  4LGX A;  3JXV A;  1W1T A;  2RQS A;  2FAP A;  1J4R A;  3RM4 A;  2ITK A;  2RUQ A;  4FN2 A;  1Q6I A;  1ZL1 A;  1HJX A;  2K8I A;  1FKF A;  3KAF A;  2OFN A;  1ROT A;  3FXY A;  2Q5A A;  1LQ0 A;  2M2A A;  2MF9 A;  4WKH A;  1FKI A;  4TX0 A;  2G41 A;  2YBT A;  2PBC A;  3H9R B;  1E6R A;  3O5R A;  2KE0 A;  2A3A A;  3QOK A;  4HBO A;  3O5L A;  1JNS A;  1SR0 A;  2QF8 A;  3FY1 A;  1ITX A;  2DT1 A;  1FKK A;  2XP9 A;  1C9H A;  3AQU A;  4MGV A;  3TCZ A;  2FKE A;  3ARQ A;  1T11 A;  4HBE A;  1D7H A;  3ALF A;  2XP5 A;  3I6C A;  2M1I A;  2O92 A;  1O6I A;  1NSG A;  3WD1 A;  3KZ7 A;  2ZQS A;  4ODQ A;  1WB0 A;  3O5K A;  3TC5 A;  2N87 A;  3ART A;  2PV2 A;  5DIU A;  3KAD A;  2WLZ A;  2XP3 A;  1BKF A;  2XPB A;  4U85 A;  5GPG A;  4DWS D;  4MSP A;  2A3C A;  4W9O A;  1KFW A;  1GUV A;  4DZ3 A;  1F40 A;  2XP6 A;  3CHD A;  2XP7 A;  1U79 A;  5JH8 A;  1OGB A;  1WNO A;  2XP4 A;  4BF8 A;  3O5I A;  1E6Z A;  1FKH A;  3ARU A;  3KAH A;  3UI6 A;  2KO7 A;  4S3K A;  2Y78 A;  1GPF A;  1JVW A;  3O5G A;  1W9U A;  1J4H A;  4NNR A;  1W9V A;  2DT3 A;  2RUR A;  1ZU8 A;  3KAB A;  1J4I A;  4P8V A;  3CHF A;  5HBF A;  3WQW A;  1SYT A;  4TYO A;  3G6L A;  2LJ4 A;  4NSB A;  2MNT A;  4TW7 A;  3UQI A;  1QPF A;  1HXV A;  3KCE A;  4IQC A;  4JFJ A;  1OWQ A;  1L1P A;  1TCO C;  3W4R A;  4MTV A;  1OGG A;  4JFL A;  4QT2 A;  4DWS C;  1F8A B;  1ZBW A;  4DRQ A;  3KAG A;  3RM8 A;  1W1P A;  2MLY A;  5DO2 A;  4ODM A;  2DG3 A;  4DRP A;  2ZQT A;  3AS3 A;  3EY6 A;  3O5Q A;  5HKG A;  2MLX A;  1E6P A;  3WQV A;  4Z2I A;  2ESC A;  3OOB A;  4ZPW R;  3UQB A;  4ZPT R;  4WK9 A;  1W1V A;  4G50 A;  3ODK A;  4MNJ A;  4DH0 A;  1W26 A;  4KR0 B;  3ARS A;  3AS0 A;  3CHE A;  1BL4 A;  4DIP A;  4QT3 A;  2PPN A;  1LL6 A;  1FKS A;  4HAR A;  4Z2G A;  3ARR A;  1CTN A;  1UR8 A;  1GOI A;  4ODK A;  1FFQ A;  4ITZ A;  3OA5 A;  5I98 A;  1YAT A;  2PI6 A;  1LL4 A;  1Q6H A;  2LPV A;  1E6N A;  2KI3 A;  5HW8 A;  1PBK A;  2O9O A;  2VCD A;  2MLZ A;  4Q22 A;  3ARZ A;  3IHZ A;  4IT6 A;  4P8X A;  3O5F A;  3CH9 A;  2A3B A;  2G8Z A;  3O5M A;  3WKZ A;  5HW7 A;  4Z2J A;  2RSE A;  1FAP A;  4WIW A;  1HKI A;  1Q1C A;  3WD2 A;  2XP8 A;  1JND A;  4N19 A;  4WKF A;  1N1A A;  5DF0 A;  5HTG A;  1X6N A;  1D6O A;  4GGQ A;  2ZQU A;  2F4E A;  4W5U A;  3G6M A;  3RM9 A;  3PR9 A;  1RD6 A;  2DSZ A;  1H0I A;  2F21 A;  2DSU A;  2M08 A;  4DRJ A;  4ODN A;  1LJY A;  4ODO A;  1ZBV A;  5DIT A;  3UI5 A;  3O5O A;  2KGJ A;  4Z2L A;  4DWS A;  2IF4 A;  4ZS6 A;  4JYS A;  2IUZ A;  1H0G A;  2KFW A;  4XAK A;  1ZCN A;  3ARO A;  2L2S A;  4P8W A;  1FKD A;  1VF8 A;  4O2T A;  4L3N A;  2UZ5 A;  2D9F A;  1HJV A;  3UI4 A;  1R9H A;  3NRK A;  2DG9 A;  1EDQ A;  4U84 A;  5HUA A;  4FAP A;  2B31 A;  1FKL A;  4AY1 A;  1NWT A;  3IKG A;  3MDY B;  1W1Y A;  3WD4 A;  4DRK A;  4PTM A;  3UQA A;  2DT0 A;  2VN1 A;  1QZ2 A;  5D75 A;  3JYJ A;  3B9D A;  3WL0 A;  4MNM A;  4LAX A;  2XPA A;  1E15 A;  3JYM A;  2WM0 A;  5B8I C;  3ARW A;  4ODL A;  1FD9 A;  3CGM A;  4MAV A;  1YW5 A;  4NZC A;  2AWG A;  2PPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...