4LAXA

Crystal structure analysis of fkbp52, complex with fk506
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
237
structure length
237
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
total genus 56
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA02
3JXVA 3UF8A 1FKJA 2PV2A 3KACA 4ODMA 4DRPA 1FKTA 3NTPA 3RFWA 5J6EA 4GGQA 2D9FA 4JFMA 1J6YA 4LAYA 1L1PA 1NMWA 3KAGA 1QZ2A 2MLXA 3CGMA 2KFWA 2F21A 5HWCA 2RUDA 1Y0OA 1EQ3A 3KABA 1ZK6A 3ODKA 2KGJA 2PPOA 2UZ5A 3O5EA 4G50A 5HW6A 3UQBA 4TW8A 1T11A 5HW8A 1FKBA 4IQCA 2ZR4A 4TYOA 3CGNA 3O5QA 4ITZA 2M1IA 1C9HA 2MF9A 4W9PA 2XP4A 3H9RB 1J4IA 3O5JA 1NMVA 2PPPA 1FKFA 3PRDA 2IF4A 3KAIA 2JZVA 4ODKA 1Q6IA 3KAFA 4J4OA 4JYSA 1F40A 4J4NA 1FKRA 4MSPA 5HT1A 2ZQVA 5GPGA 1YW5A 2KR7A 2F4EA 4R0XA 4DRKA 2RQSA 2ZR5A 3IKGA 1JNSA 2MPHA 2ZQUA 1W26A 3GPKA 4JFLA 1BKFA 2F2DA 2VCDA 1PBKA 3LUOA 2KE0A 2M08A 3IKDA 4DZ3A 4ODNA 1ZCNA 3I6CA 3UI6A 1A7XA 5I98A 1ROTA 1FKKA 4MGVA 5DIVA 1HXVA 2MNTA 4JFKA 2OFNA 3JYJA 1JNTA 2DG9A 2Y78A 3JYMA 2XP5A 4W9OA 1N1AA 4GIVA 4BF8A 5BXJA 2LKNA 1FKLA 3RGCA 4DRHA 3IHZA 1TCOC 4LAWA 1J4RA 2RUQA 4U84A 1KT0A 4C02B 4NNRA 1P5QA 3TCZA 5HW7A 5HUAA 2N87A 1FKDA 2Q5AA 3NRKA 4FN2A 4O2TA 4DRNA 4ODRA 3O5KA 1FKHA 4QIBA 2LJ4A 3UI4A 1KT1A 1D7IA 2M2AA 3IK8A 3O5OA 4N19A 2PV1A 1Q6UA 4FAPA 4LAVA 2AWGA 4TW6A 2FAPA 1M5YA 2PBCA 2FKEA 3O5LA 1FD9A 2KO7A 2L2SA 3TC5A 1ROUA 5B8IC 2DG3A 1U79A 4IQ2A 1F8AB 3OOBA 3O5GA 2ITKA 1JVWA 1D7JA 2ZQTA 3PRBA 1Q1CA 2RURA 1NSGA 4TW7A 1D7HA 2XPBA 4DRJA 4ODOA 2XP7A 4TX0A 3VAWA 4DRMA 2PV3A 2MLZA 1QPFA 4W9QA 1QPLA 2K8IA 5DITA 1EYMA 3O5IA 1PINA 4ODLA 3O5RA 5HWBA 1J4HA 3KZ7A 4LAXA 4TNSA 4DRIA 3TDBA 3UI5A 2ZR6A 3UQAA 2VN1A 2XP8A 2RUCA 4JFJA 2KI3A 1B6CA 3KADA 4DRQA 4DH0A 4ODQA 3FAPA 4U86A 3PA7A 3O5DA 2MLYA 2RSEA 2XP6A 1FJDA 2DG4A 4ODPA 1FKGA 4U85A 4DROA 3NI6A 4DIPA 3O5FA 1FKSA 2PPNA 4QT3A 4QT2A 5HKGA 2XP9A 2LPVA 3O5PA 4IPXA 2ZQSA 2LGOA 3O5MA 4JFIA 1Q6HA 5HTGA 4G2PA 3B7XA 3EY6A 1BL4A 4DT4A 4DZ2A 1R9HA 3KAHA 5DIUA 2XPAA 3MDYB 5D75A 3WH0A 3KCEA 1D6OA 1YATA 2XP3A 1FKIA 3UQIA 1FAPA
chains in the Genus database with same CATH superfamily
3ARPA 3JXVA 1FKJA 2PV2A 4ODMA 1O6IA 3CHFA 4P8VA 3KAGA 1QZ2A 2DT3A 2MLXA 4MNMA 1ZK6A 2UZ5A 2O9OA 3O5EA 1T11A 3B9AA 1NH6A 4IQCA 3CGNA 1C9HA 1W1PA 4W9PA 1FKFA 2IF4A 4ODKA 1H0GA 4IT4A 4JYSA 1NWSA 5HT1A 2DSUA 3AROA 4DWSB 3UQBA 1FFRA 4Z2IA 3LUOA 2F2DA 3CZ8A 2EULA 5DIVA 2OFNA 4W9OA 2DG9A 2Y78A 5BXJA 3RGCA 1FKLA 2A3AA 1TCOC 4XAKA 1J4RA 4U84A 1E9LA 5HW7A 1FKDA 3ARSA 4FN2A 1FKHA 4WKFA 2LJ4A 1KT1A 4N19A 1EDQA 2PV1A 1ZBWA 1LL6A 3ARTA 2AWGA 2G8ZA 4S3KA 5B8IC 1E6PA 1OGGA 4IT6A 3OOBA 3O5GA 3AS2A 4P8WA 4ODOA 2XP7A 2AOSA 1QPLA 3O5IA 5DEZA 2G41A 3KZ7A 4LAXA 1D2KA 1KFWA 4L3NA 3TDBA 1W9VA 4L72B 4MNLA 1H0IA 4Q7NA 4DH0A 3FXYA 1ITXA 1ZBVA 2MLYA 2XP6A 1JCHB 1FKGA 1W1YA 4LGXA 1HKKA 4QT3A 5HKGA 2P4VA 3RM4A 3O5MA 4JFIA 1Q6HA 5HTGA 3B7XA 3AQUA 1R9HA 3ARUA 3KAHA 1LJYA 1W1TA 5D75A 1HJWA 4DRMA 4NZCA 3ARXA 3NTPA 4JFMA 2ESCA 3PRAA 4HBEA 2DSWA 1FFQA 3ARYA 1LL4A 5HBFA 3KABA 4W5UA 4G50A 3BXWA 4TW8A 1FKBA 2B5UB 4DWSD 3O5QA 4ITZA 2MF9A 3H9RB 1EIBA 3KAIA 1IX5A 4J4OA 1F40A 1SYTA 3EIPA 1WB0A 3BMBA 4ZPVR 5GPGA 4MAVA 1YW5A 4R0XA 4DRKA 2QF8A 1BKFA 2KE0A 2M08A 1JNEA 5I98A 1HXVA 1GRJA 3JYJA 3ARVA 1N1AA 4DRHA 4LAWA 3WD1A 1W9UA 1GUVA 3NRKA 4WIWA 4MNKA 4ODRA 2M2AA 3IK8A 4DWSC 3ARWA 2DT2A 1ZBKA 1Q6UA 4LAVA 4MTVA 4TW6A 2FAPA 3B9EA 2FKEA 2WLZA 2KO7A 1ROUA 1E6ZA 4HARA 1UR8A 2ITKA 1Q1CA 4DRJA 1D7HA 1HJXA 4HBOA 1K9TA 2PV3A 2MLZA 1EYMA 1PINA 4ODLA 3WD0A 4DRIA 1EHNA 2ETNA 1HKIA 3UI5A 3UQAA 1B6CA 3WD3A 4DRQA 5DF0A 3GU0A 3FAPA 3PA7A 1TFVA 2RSEA 3WKZA 2DG4A 4DROA 3WQVA 4QT2A 2XP9A 3O5PA 4IPXA 4Z2JA 2B31A 4DZ2A 2XPAA 1D6OA 1YATA 2WK2A 1FKIA 4WK9A 2FDMA 2WLYA 3UF8A 3ALGA 4GGQA 4P8UA 1J6YA 4LAYA 2A3BA 2KFWA 3CHEA 2A3CA 3ODKA 2KGJA 5HW6A 3B9DA 2PI6A 5HW8A 4TYOA 2M1IA 1NWUA 1NMVA 3WIJA 3KAFA 3WQWA 1FKRA 1ZU8A 3G6LA 3ARQA 1SR0A 1XHGA 4ML4A 2O92A 1JNSA 2ZQUA 4JFLA 1W26A 3GPKA 2F23A 2VCDA 1CTNA 4DZ3A 1OGBA 3IKDA 3G6MA 3I6CA 1ROTA 3WL0A 1FKKA 2MNTA 4JFKA 1JNTA 2XP5A 3W4RA 4NSBA 4ZS6A 3IHZA 2YBTA 3ARRA 3OA5A 1LL7A 1P5QA 3B8SA 3WD4A 4AY1A 2A3EA 4DRNA 4ZPTR 1GOIA 4ZPWR 1X6NA 1NWRA 4Z2LA 1E15A 2PBCA 3TC5A 1LG1A 1D7JA 2ZQTA 3PRBA 2RURA 1NSGA 4TW7A 2XPBA 4TX0A 3VAWA 2K8IA 3O5RA 1J4HA 1E44A 2PN0A 2VN1A 4Q22A 2RUCA 4JFJA 3KADA 1W9PA 4U86A 3O5DA 3PR9A 4U85A 3CHDA 3NI6A 2DPEA 1FKSA 3FY1A 2LPVA 1VF8A 2ZQSA 1GPFA 4WJXA 1X6LA 1XRVA 4DT4A 2DT0A 5GPRA 4S3JA 3KCEA 2OLHA 4KQZA 3AS1A 3UQIA 4R5EA 5DO2A 3ALFA 4DRPA 3KACA 1FKTA 3RFWA 3CHCA 2D9FA 1L1PA 4URIA 3AS0A 1NMWA 3CGMA 2F21A 5HWCA 2RUDA 1Y0OA 3ARZA 1EQ3A 2PPOA 2YBUA 2ZR4A 1WAWA 4WKAA 2XP4A 1J4IA 1RD6A 3O5JA 2PPPA 3PRDA 1ZL1A 2JZVA 1Q6IA 4P8XA 4J4NA 4PTMA 1JNDA 4MSPA 4Z2HA 2ZQVA 2F4EA 2KR7A 3AS3A 2RQSA 2ZR5A 3IKGA 2MPHA 5JH8A 2WM0A 1PBKA 4ODNA 1ZCNA 1E6RA 3UI6A 1A7XA 1ZBCA 3RMEA 3WL1A 4MGVA 5J6EA 3JYMA 5GQBA 1OWQA 4BF8A 4GIVA 2LKNA 2RUQA 4C02B 1KT0A 3QOKA 1LQ0A 4NNRA 5HUAA 3TCZA 2N87A 2DT1A 2Q5AA 4O2TA 3RM9A 1HKMA 3O5KA 4QIBA 3UI4A 1ZB5A 4QZVB 3O5OA 1D7IA 4UDMA 4FAPA 3CH9A 1NWTA 1M5YA 3RM8A 3O5LA 1FD9A 2L2SA 2DSVA 2DG3A 1U79A 4IQ2A 1F8AB 4Z2GA 1JVWA 4MNJA 1HKJA 1QPFA 4W9QA 3GTYX 5DITA 1E6NA 4KR0B 5HWBA 4TNSA 1W1VA 1WNOA 2ZR6A 2XP8A 2KI3A 4ODQA 2DSZA 1FJDA 4ODPA 4WKHA 1LG2A 4DIPA 3O5FA 2PPNA 3WD2A 2LGOA 2IUZA 4DWSA 4Z2KA 4G2PA 1UR9A 3EY6A 1BL4A 5DIUA 3MDYB 3WH0A 4MPKA 2XP3A 1FAPA 1HJVA
chains in the Genus database with same CATH topology
3ARPA 3JXVA 1FKJA 2PV2A 4ODMA 1O6IA 3CHFA 4P8VA 3KAGA 1QZ2A 2DT3A 2MLXA 4MNMA 1ZK6A 2UZ5A 2O9OA 3O5EA 1T11A 3B9AA 1NH6A 4IQCA 3CGNA 1C9HA 1W1PA 4W9PA 1FKFA 2IF4A 4ODKA 1H0GA 4IT4A 4JYSA 1NWSA 5HT1A 2DSUA 3AROA 4DWSB 3UQBA 1FFRA 4Z2IA 3LUOA 2F2DA 3CZ8A 5DIVA 2OFNA 4W9OA 2DG9A 2Y78A 5BXJA 3RGCA 1FKLA 2A3AA 1TCOC 4XAKA 1J4RA 4U84A 1E9LA 5HW7A 1FKDA 3ARSA 4FN2A 1FKHA 4WKFA 2LJ4A 1KT1A 4N19A 1EDQA 2PV1A 1ZBWA 1LL6A 3ARTA 2AWGA 2G8ZA 4S3KA 5B8IC 1E6PA 1OGGA 4IT6A 3OOBA 3O5GA 3AS2A 4P8WA 4ODOA 2XP7A 2AOSA 1QPLA 3O5IA 5DEZA 2G41A 3KZ7A 4LAXA 1D2KA 1KFWA 4L3NA 3TDBA 1W9VA 4L72B 4MNLA 1H0IA 4Q7NA 4DH0A 3FXYA 1ITXA 1ZBVA 2MLYA 2XP6A 1W1YA 1FKGA 4LGXA 1HKKA 4QT3A 5HKGA 3RM4A 3O5MA 4JFIA 1Q6HA 5HTGA 3B7XA 3AQUA 1R9HA 3ARUA 3KAHA 1LJYA 1W1TA 5D75A 1HJWA 4DRMA 4NZCA 3ARXA 3NTPA 4JFMA 2ESCA 3PRAA 4HBEA 2DSWA 1FFQA 3ARYA 1LL4A 5HBFA 3KABA 4W5UA 4G50A 3BXWA 4TW8A 1FKBA 4DWSD 3O5QA 4ITZA 2MF9A 3H9RB 1EIBA 3KAIA 1IX5A 4J4OA 1F40A 1SYTA 1WB0A 4ZPVR 5GPGA 4MAVA 1YW5A 4R0XA 4DRKA 2QF8A 1BKFA 2KE0A 2M08A 1JNEA 5I98A 1HXVA 3JYJA 3ARVA 1N1AA 4DRHA 4LAWA 3WD1A 1W9UA 1GUVA 3NRKA 4WIWA 4MNKA 4ODRA 2M2AA 3IK8A 4DWSC 3ARWA 2DT2A 1ZBKA 1Q6UA 4LAVA 4MTVA 4TW6A 2FAPA 3B9EA 2FKEA 2WLZA 2KO7A 1ROUA 1E6ZA 4HARA 1UR8A 2ITKA 1Q1CA 4DRJA 1D7HA 1HJXA 4HBOA 1K9TA 2PV3A 2MLZA 1EYMA 1PINA 4ODLA 3WD0A 4DRIA 1EHNA 1HKIA 3UI5A 3UQAA 1B6CA 3WD3A 4DRQA 5DF0A 3FAPA 3PA7A 1TFVA 2RSEA 3WKZA 2DG4A 4DROA 3WQVA 4QT2A 2XP9A 3O5PA 4IPXA 4Z2JA 2B31A 4DZ2A 2XPAA 1D6OA 1YATA 2WK2A 1FKIA 4WK9A 2FDMA 2WLYA 3UF8A 3ALGA 4GGQA 4P8UA 1J6YA 4LAYA 2A3BA 2KFWA 3CHEA 2A3CA 3ODKA 2KGJA 5HW6A 3B9DA 2PI6A 5HW8A 4TYOA 2M1IA 1NWUA 1NMVA 3WIJA 3KAFA 3WQWA 1FKRA 1ZU8A 3G6LA 3ARQA 1SR0A 1XHGA 4ML4A 2O92A 1JNSA 2ZQUA 4JFLA 1W26A 3GPKA 2VCDA 1CTNA 4DZ3A 1OGBA 3IKDA 3G6MA 3I6CA 1ROTA 3WL0A 1FKKA 2MNTA 4JFKA 1JNTA 2XP5A 3W4RA 4NSBA 4ZS6A 3IHZA 2YBTA 3ARRA 3OA5A 1LL7A 1P5QA 3B8SA 3WD4A 4AY1A 2A3EA 4DRNA 4ZPTR 1GOIA 4ZPWR 1X6NA 1NWRA 4Z2LA 1E15A 2PBCA 3TC5A 1LG1A 1D7JA 2ZQTA 3PRBA 2RURA 1NSGA 4TW7A 2XPBA 4TX0A 3VAWA 2K8IA 3O5RA 1J4HA 2VN1A 4Q22A 2RUCA 4JFJA 3KADA 1W9PA 4U86A 3O5DA 3PR9A 4U85A 3CHDA 3NI6A 2DPEA 1FKSA 3FY1A 2LPVA 1VF8A 2ZQSA 1GPFA 4WJXA 1X6LA 1XRVA 4DT4A 2DT0A 5GPRA 4S3JA 3KCEA 2OLHA 4KQZA 3AS1A 3UQIA 4R5EA 5DO2A 3ALFA 4DRPA 3KACA 1FKTA 3RFWA 3CHCA 2D9FA 1L1PA 4URIA 3AS0A 1NMWA 3CGMA 2F21A 5HWCA 2RUDA 1Y0OA 3ARZA 1EQ3A 2PPOA 2YBUA 2ZR4A 1WAWA 4WKAA 2XP4A 1J4IA 1RD6A 3O5JA 2PPPA 3PRDA 1ZL1A 2JZVA 1Q6IA 4P8XA 4J4NA 4PTMA 1JNDA 4MSPA 4Z2HA 2ZQVA 2F4EA 2KR7A 3AS3A 2RQSA 2ZR5A 3IKGA 2MPHA 5JH8A 2WM0A 1PBKA 4ODNA 1ZCNA 1E6RA 3UI6A 1A7XA 1ZBCA 3RMEA 3WL1A 4MGVA 5J6EA 3JYMA 5GQBA 1OWQA 4BF8A 4GIVA 2LKNA 2RUQA 4C02B 1KT0A 3QOKA 1LQ0A 4NNRA 5HUAA 3TCZA 2N87A 2DT1A 2Q5AA 4O2TA 3RM9A 1HKMA 3O5KA 4QIBA 3UI4A 1ZB5A 4QZVB 3O5OA 1D7IA 4FAPA 3CH9A 1NWTA 1M5YA 3RM8A 3O5LA 1FD9A 2L2SA 2DSVA 2DG3A 1U79A 4IQ2A 1F8AB 4Z2GA 1JVWA 4MNJA 1HKJA 1QPFA 4W9QA 5DITA 1E6NA 4KR0B 5HWBA 4TNSA 1W1VA 1WNOA 2ZR6A 2XP8A 2KI3A 4ODQA 2DSZA 1FJDA 4ODPA 4WKHA 1LG2A 4DIPA 3O5FA 2PPNA 3WD2A 2LGOA 2IUZA 4DWSA 4Z2KA 4G2PA 1UR9A 3EY6A 1BL4A 5DIUA 3MDYB 3WH0A 4MPKA 2XP3A 1FAPA 1HJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXV A;  3UF8 A;  1FKJ A;  2PV2 A;  3KAC A;  4ODM A;  4DRP A;  1FKT A;  3NTP A;  3RFW A;  5J6E A;  4GGQ A;  2D9F A;  4JFM A;  1J6Y A;  4LAY A;  1L1P A;  1NMW A;  3KAG A;  1QZ2 A;  2MLX A;  3CGM A;  2KFW A;  2F21 A;  5HWC A;  2RUD A;  1Y0O A;  1EQ3 A;  3KAB A;  1ZK6 A;  3ODK A;  2KGJ A;  2PPO A;  2UZ5 A;  3O5E A;  4G50 A;  5HW6 A;  3UQB A;  4TW8 A;  1T11 A;  5HW8 A;  1FKB A;  4IQC A;  2ZR4 A;  4TYO A;  3CGN A;  3O5Q A;  4ITZ A;  2M1I A;  1C9H A;  2MF9 A;  4W9P A;  2XP4 A;  3H9R B;  1J4I A;  3O5J A;  1NMV A;  2PPP A;  1FKF A;  3PRD A;  2IF4 A;  3KAI A;  2JZV A;  4ODK A;  1Q6I A;  3KAF A;  4J4O A;  4JYS A;  1F40 A;  4J4N A;  1FKR A;  4MSP A;  5HT1 A;  2ZQV A;  5GPG A;  1YW5 A;  2KR7 A;  2F4E A;  4R0X A;  4DRK A;  2RQS A;  2ZR5 A;  3IKG A;  1JNS A;  2MPH A;  2ZQU A;  1W26 A;  3GPK A;  4JFL A;  1BKF A;  2F2D A;  2VCD A;  1PBK A;  3LUO A;  2KE0 A;  2M08 A;  3IKD A;  4DZ3 A;  4ODN A;  1ZCN A;  3I6C A;  3UI6 A;  1A7X A;  5I98 A;  1ROT A;  1FKK A;  4MGV A;  5DIV A;  1HXV A;  2MNT A;  4JFK A;  2OFN A;  3JYJ A;  1JNT A;  2DG9 A;  2Y78 A;  3JYM A;  2XP5 A;  4W9O A;  1N1A A;  4GIV A;  4BF8 A;  5BXJ A;  2LKN A;  1FKL A;  3RGC A;  4DRH A;  3IHZ A;  1TCO C;  4LAW A;  1J4R A;  2RUQ A;  4U84 A;  1KT0 A;  4C02 B;  4NNR A;  1P5Q A;  3TCZ A;  5HW7 A;  5HUA A;  2N87 A;  1FKD A;  2Q5A A;  3NRK A;  4FN2 A;  4O2T A;  4DRN A;  4ODR A;  3O5K A;  1FKH A;  4QIB A;  2LJ4 A;  3UI4 A;  1KT1 A;  1D7I A;  2M2A A;  3IK8 A;  3O5O A;  4N19 A;  2PV1 A;  1Q6U A;  4FAP A;  4LAV A;  2AWG A;  4TW6 A;  2FAP A;  1M5Y A;  2PBC A;  2FKE A;  3O5L A;  1FD9 A;  2KO7 A;  2L2S A;  3TC5 A;  1ROU A;  5B8I C;  2DG3 A;  1U79 A;  4IQ2 A;  1F8A B;  3OOB A;  3O5G A;  2ITK A;  1JVW A;  1D7J A;  2ZQT A;  3PRB A;  1Q1C A;  2RUR A;  1NSG A;  4TW7 A;  1D7H A;  2XPB A;  4DRJ A;  4ODO A;  2XP7 A;  4TX0 A;  3VAW A;  4DRM A;  2PV3 A;  2MLZ A;  1QPF A;  4W9Q A;  1QPL A;  2K8I A;  5DIT A;  1EYM A;  3O5I A;  1PIN A;  4ODL A;  3O5R A;  5HWB A;  1J4H A;  3KZ7 A;  4LAX A;  4TNS A;  4DRI A;  3TDB A;  3UI5 A;  2ZR6 A;  3UQA A;  2VN1 A;  2XP8 A;  2RUC A;  4JFJ A;  2KI3 A;  1B6C A;  3KAD A;  4DRQ A;  4DH0 A;  4ODQ A;  3FAP A;  4U86 A;  3PA7 A;  3O5D A;  2MLY A;  2RSE A;  2XP6 A;  1FJD A;  2DG4 A;  4ODP A;  1FKG A;  4U85 A;  4DRO A;  3NI6 A;  4DIP A;  3O5F A;  1FKS A;  2PPN A;  4QT3 A;  4QT2 A;  5HKG A;  2XP9 A;  2LPV A;  3O5P A;  4IPX A;  2ZQS A;  2LGO A;  3O5M A;  4JFI A;  1Q6H A;  5HTG A;  4G2P A;  3B7X A;  3EY6 A;  1BL4 A;  4DT4 A;  4DZ2 A;  1R9H A;  3KAH A;  5DIU A;  2XPA A;  3MDY B;  5D75 A;  3WH0 A;  3KCE A;  1D6O A;  1YAT A;  2XP3 A;  1FKI A;  3UQI A;  1FAP A; 
#chains in the Genus database with same CATH topology
 3ARP A;  3JXV A;  1FKJ A;  2PV2 A;  4ODM A;  1O6I A;  3CHF A;  4P8V A;  3KAG A;  1QZ2 A;  2DT3 A;  2MLX A;  4MNM A;  1ZK6 A;  2UZ5 A;  2O9O A;  3O5E A;  1T11 A;  3B9A A;  1NH6 A;  4IQC A;  3CGN A;  1C9H A;  1W1P A;  4W9P A;  1FKF A;  2IF4 A;  4ODK A;  1H0G A;  4IT4 A;  4JYS A;  1NWS A;  5HT1 A;  2DSU A;  3ARO A;  4DWS B;  3UQB A;  1FFR A;  4Z2I A;  3LUO A;  2F2D A;  3CZ8 A;  2EUL A;  5DIV A;  2OFN A;  4W9O A;  2DG9 A;  2Y78 A;  5BXJ A;  3RGC A;  1FKL A;  2A3A A;  1TCO C;  4XAK A;  1J4R A;  4U84 A;  1E9L A;  5HW7 A;  1FKD A;  3ARS A;  4FN2 A;  1FKH A;  4WKF A;  2LJ4 A;  1KT1 A;  4N19 A;  1EDQ A;  2PV1 A;  1ZBW A;  1LL6 A;  3ART A;  2AWG A;  2G8Z A;  4S3K A;  5B8I C;  1E6P A;  1OGG A;  4IT6 A;  3OOB A;  3O5G A;  3AS2 A;  4P8W A;  4ODO A;  2XP7 A;  2AOS A;  1QPL A;  3O5I A;  5DEZ A;  2G41 A;  3KZ7 A;  4LAX A;  1D2K A;  1KFW A;  4L3N A;  3TDB A;  1W9V A;  4L72 B;  4MNL A;  1H0I A;  4Q7N A;  4DH0 A;  3FXY A;  1ITX A;  1ZBV A;  2MLY A;  2XP6 A;  1JCH B;  1FKG A;  1W1Y A;  4LGX A;  1HKK A;  4QT3 A;  5HKG A;  2P4V A;  3RM4 A;  3O5M A;  4JFI A;  1Q6H A;  5HTG A;  3B7X A;  3AQU A;  1R9H A;  3ARU A;  3KAH A;  1LJY A;  1W1T A;  5D75 A;  1HJW A;  4DRM A;  4NZC A;  3ARX A;  3NTP A;  4JFM A;  2ESC A;  3PRA A;  4HBE A;  2DSW A;  1FFQ A;  3ARY A;  1LL4 A;  5HBF A;  3KAB A;  4W5U A;  4G50 A;  3BXW A;  4TW8 A;  1FKB A;  2B5U B;  4DWS D;  3O5Q A;  4ITZ A;  2MF9 A;  3H9R B;  1EIB A;  3KAI A;  1IX5 A;  4J4O A;  1F40 A;  1SYT A;  3EIP A;  1WB0 A;  3BMB A;  4ZPV R;  5GPG A;  4MAV A;  1YW5 A;  4R0X A;  4DRK A;  2QF8 A;  1BKF A;  2KE0 A;  2M08 A;  1JNE A;  5I98 A;  1HXV A;  1GRJ A;  3JYJ A;  3ARV A;  1N1A A;  4DRH A;  4LAW A;  3WD1 A;  1W9U A;  1GUV A;  3NRK A;  4WIW A;  4MNK A;  4ODR A;  2M2A A;  3IK8 A;  4DWS C;  3ARW A;  2DT2 A;  1ZBK A;  1Q6U A;  4LAV A;  4MTV A;  4TW6 A;  2FAP A;  3B9E A;  2FKE A;  2WLZ A;  2KO7 A;  1ROU A;  1E6Z A;  4HAR A;  1UR8 A;  2ITK A;  1Q1C A;  4DRJ A;  1D7H A;  1HJX A;  4HBO A;  1K9T A;  2PV3 A;  2MLZ A;  1EYM A;  1PIN A;  4ODL A;  3WD0 A;  4DRI A;  1EHN A;  2ETN A;  1HKI A;  3UI5 A;  3UQA A;  1B6C A;  3WD3 A;  4DRQ A;  5DF0 A;  3GU0 A;  3FAP A;  3PA7 A;  1TFV A;  2RSE A;  3WKZ A;  2DG4 A;  4DRO A;  3WQV A;  4QT2 A;  2XP9 A;  3O5P A;  4IPX A;  4Z2J A;  2B31 A;  4DZ2 A;  2XPA A;  1D6O A;  1YAT A;  2WK2 A;  1FKI A;  4WK9 A;  2FDM A;  2WLY A;  3UF8 A;  3ALG A;  4GGQ A;  4P8U A;  1J6Y A;  4LAY A;  2A3B A;  2KFW A;  3CHE A;  2A3C A;  3ODK A;  2KGJ A;  5HW6 A;  3B9D A;  2PI6 A;  5HW8 A;  4TYO A;  2M1I A;  1NWU A;  1NMV A;  3WIJ A;  3KAF A;  3WQW A;  1FKR A;  1ZU8 A;  3G6L A;  3ARQ A;  1SR0 A;  1XHG A;  4ML4 A;  2O92 A;  1JNS A;  2ZQU A;  4JFL A;  1W26 A;  3GPK A;  2F23 A;  2VCD A;  1CTN A;  4DZ3 A;  1OGB A;  3IKD A;  3G6M A;  3I6C A;  1ROT A;  3WL0 A;  1FKK A;  2MNT A;  4JFK A;  1JNT A;  2XP5 A;  3W4R A;  4NSB A;  4ZS6 A;  3IHZ A;  2YBT A;  3ARR A;  3OA5 A;  1LL7 A;  1P5Q A;  3B8S A;  3WD4 A;  4AY1 A;  2A3E A;  4DRN A;  4ZPT R;  1GOI A;  4ZPW R;  1X6N A;  1NWR A;  4Z2L A;  1E15 A;  2PBC A;  3TC5 A;  1LG1 A;  1D7J A;  2ZQT A;  3PRB A;  2RUR A;  1NSG A;  4TW7 A;  2XPB A;  4TX0 A;  3VAW A;  2K8I A;  3O5R A;  1J4H A;  1E44 A;  2PN0 A;  2VN1 A;  4Q22 A;  2RUC A;  4JFJ A;  3KAD A;  1W9P A;  4U86 A;  3O5D A;  3PR9 A;  4U85 A;  3CHD A;  3NI6 A;  2DPE A;  1FKS A;  3FY1 A;  2LPV A;  1VF8 A;  2ZQS A;  1GPF A;  4WJX A;  1X6L A;  1XRV A;  4DT4 A;  2DT0 A;  5GPR A;  4S3J A;  3KCE A;  2OLH A;  4KQZ A;  3AS1 A;  3UQI A;  4R5E A;  5DO2 A;  3ALF A;  4DRP A;  3KAC A;  1FKT A;  3RFW A;  3CHC A;  2D9F A;  1L1P A;  4URI A;  3AS0 A;  1NMW A;  3CGM A;  2F21 A;  5HWC A;  2RUD A;  1Y0O A;  3ARZ A;  1EQ3 A;  2PPO A;  2YBU A;  2ZR4 A;  1WAW A;  4WKA A;  2XP4 A;  1J4I A;  1RD6 A;  3O5J A;  2PPP A;  3PRD A;  1ZL1 A;  2JZV A;  1Q6I A;  4P8X A;  4J4N A;  4PTM A;  1JND A;  4MSP A;  4Z2H A;  2ZQV A;  2F4E A;  2KR7 A;  3AS3 A;  2RQS A;  2ZR5 A;  3IKG A;  2MPH A;  5JH8 A;  2WM0 A;  1PBK A;  4ODN A;  1ZCN A;  1E6R A;  3UI6 A;  1A7X A;  1ZBC A;  3RME A;  3WL1 A;  4MGV A;  5J6E A;  3JYM A;  5GQB A;  1OWQ A;  4BF8 A;  4GIV A;  2LKN A;  2RUQ A;  4C02 B;  1KT0 A;  3QOK A;  1LQ0 A;  4NNR A;  5HUA A;  3TCZ A;  2N87 A;  2DT1 A;  2Q5A A;  4O2T A;  3RM9 A;  1HKM A;  3O5K A;  4QIB A;  3UI4 A;  1ZB5 A;  4QZV B;  3O5O A;  1D7I A;  4UDM A;  4FAP A;  3CH9 A;  1NWT A;  1M5Y A;  3RM8 A;  3O5L A;  1FD9 A;  2L2S A;  2DSV A;  2DG3 A;  1U79 A;  4IQ2 A;  1F8A B;  4Z2G A;  1JVW A;  4MNJ A;  1HKJ A;  1QPF A;  4W9Q A;  3GTY X;  5DIT A;  1E6N A;  4KR0 B;  5HWB A;  4TNS A;  1W1V A;  1WNO A;  2ZR6 A;  2XP8 A;  2KI3 A;  4ODQ A;  2DSZ A;  1FJD A;  4ODP A;  4WKH A;  1LG2 A;  4DIP A;  3O5F A;  2PPN A;  3WD2 A;  2LGO A;  2IUZ A;  4DWS A;  4Z2K A;  4G2P A;  1UR9 A;  3EY6 A;  1BL4 A;  5DIU A;  3MDY B;  3WH0 A;  4MPK A;  2XP3 A;  1FAP A;  1HJV A; 
#chains in the Genus database with same CATH homology
 3ARP A;  3JXV A;  1FKJ A;  2PV2 A;  4ODM A;  1O6I A;  3CHF A;  4P8V A;  3KAG A;  1QZ2 A;  2DT3 A;  2MLX A;  4MNM A;  1ZK6 A;  2UZ5 A;  2O9O A;  3O5E A;  1T11 A;  3B9A A;  1NH6 A;  4IQC A;  3CGN A;  1C9H A;  1W1P A;  4W9P A;  1FKF A;  2IF4 A;  4ODK A;  1H0G A;  4IT4 A;  4JYS A;  1NWS A;  5HT1 A;  2DSU A;  3ARO A;  4DWS B;  3UQB A;  1FFR A;  4Z2I A;  3LUO A;  2F2D A;  3CZ8 A;  5DIV A;  2OFN A;  4W9O A;  2DG9 A;  2Y78 A;  5BXJ A;  3RGC A;  1FKL A;  2A3A A;  1TCO C;  4XAK A;  1J4R A;  4U84 A;  1E9L A;  5HW7 A;  1FKD A;  3ARS A;  4FN2 A;  1FKH A;  4WKF A;  2LJ4 A;  1KT1 A;  4N19 A;  1EDQ A;  2PV1 A;  1ZBW A;  1LL6 A;  3ART A;  2AWG A;  2G8Z A;  4S3K A;  5B8I C;  1E6P A;  1OGG A;  4IT6 A;  3OOB A;  3O5G A;  3AS2 A;  4P8W A;  4ODO A;  2XP7 A;  2AOS A;  1QPL A;  3O5I A;  5DEZ A;  2G41 A;  3KZ7 A;  4LAX A;  1D2K A;  1KFW A;  4L3N A;  3TDB A;  1W9V A;  4L72 B;  4MNL A;  1H0I A;  4Q7N A;  4DH0 A;  3FXY A;  1ITX A;  1ZBV A;  2MLY A;  2XP6 A;  1W1Y A;  1FKG A;  4LGX A;  1HKK A;  4QT3 A;  5HKG A;  3RM4 A;  3O5M A;  4JFI A;  1Q6H A;  5HTG A;  3B7X A;  3AQU A;  1R9H A;  3ARU A;  3KAH A;  1LJY A;  1W1T A;  5D75 A;  1HJW A;  4DRM A;  4NZC A;  3ARX A;  3NTP A;  4JFM A;  2ESC A;  3PRA A;  4HBE A;  2DSW A;  1FFQ A;  3ARY A;  1LL4 A;  5HBF A;  3KAB A;  4W5U A;  4G50 A;  3BXW A;  4TW8 A;  1FKB A;  4DWS D;  3O5Q A;  4ITZ A;  2MF9 A;  3H9R B;  1EIB A;  3KAI A;  1IX5 A;  4J4O A;  1F40 A;  1SYT A;  1WB0 A;  4ZPV R;  5GPG A;  4MAV A;  1YW5 A;  4R0X A;  4DRK A;  2QF8 A;  1BKF A;  2KE0 A;  2M08 A;  1JNE A;  5I98 A;  1HXV A;  3JYJ A;  3ARV A;  1N1A A;  4DRH A;  4LAW A;  3WD1 A;  1W9U A;  1GUV A;  3NRK A;  4WIW A;  4MNK A;  4ODR A;  2M2A A;  3IK8 A;  4DWS C;  3ARW A;  2DT2 A;  1ZBK A;  1Q6U A;  4LAV A;  4MTV A;  4TW6 A;  2FAP A;  3B9E A;  2FKE A;  2WLZ A;  2KO7 A;  1ROU A;  1E6Z A;  4HAR A;  1UR8 A;  2ITK A;  1Q1C A;  4DRJ A;  1D7H A;  1HJX A;  4HBO A;  1K9T A;  2PV3 A;  2MLZ A;  1EYM A;  1PIN A;  4ODL A;  3WD0 A;  4DRI A;  1EHN A;  1HKI A;  3UI5 A;  3UQA A;  1B6C A;  3WD3 A;  4DRQ A;  5DF0 A;  3FAP A;  3PA7 A;  1TFV A;  2RSE A;  3WKZ A;  2DG4 A;  4DRO A;  3WQV A;  4QT2 A;  2XP9 A;  3O5P A;  4IPX A;  4Z2J A;  2B31 A;  4DZ2 A;  2XPA A;  1D6O A;  1YAT A;  2WK2 A;  1FKI A;  4WK9 A;  2FDM A;  2WLY A;  3UF8 A;  3ALG A;  4GGQ A;  4P8U A;  1J6Y A;  4LAY A;  2A3B A;  2KFW A;  3CHE A;  2A3C A;  3ODK A;  2KGJ A;  5HW6 A;  3B9D A;  2PI6 A;  5HW8 A;  4TYO A;  2M1I A;  1NWU A;  1NMV A;  3WIJ A;  3KAF A;  3WQW A;  1FKR A;  1ZU8 A;  3G6L A;  3ARQ A;  1SR0 A;  1XHG A;  4ML4 A;  2O92 A;  1JNS A;  2ZQU A;  4JFL A;  1W26 A;  3GPK A;  2VCD A;  1CTN A;  4DZ3 A;  1OGB A;  3IKD A;  3G6M A;  3I6C A;  1ROT A;  3WL0 A;  1FKK A;  2MNT A;  4JFK A;  1JNT A;  2XP5 A;  3W4R A;  4NSB A;  4ZS6 A;  3IHZ A;  2YBT A;  3ARR A;  3OA5 A;  1LL7 A;  1P5Q A;  3B8S A;  3WD4 A;  4AY1 A;  2A3E A;  4DRN A;  4ZPT R;  1GOI A;  4ZPW R;  1X6N A;  1NWR A;  4Z2L A;  1E15 A;  2PBC A;  3TC5 A;  1LG1 A;  1D7J A;  2ZQT A;  3PRB A;  2RUR A;  1NSG A;  4TW7 A;  2XPB A;  4TX0 A;  3VAW A;  2K8I A;  3O5R A;  1J4H A;  2VN1 A;  4Q22 A;  2RUC A;  4JFJ A;  3KAD A;  1W9P A;  4U86 A;  3O5D A;  3PR9 A;  4U85 A;  3CHD A;  3NI6 A;  2DPE A;  1FKS A;  3FY1 A;  2LPV A;  1VF8 A;  2ZQS A;  1GPF A;  4WJX A;  1X6L A;  1XRV A;  4DT4 A;  2DT0 A;  5GPR A;  4S3J A;  3KCE A;  2OLH A;  4KQZ A;  3AS1 A;  3UQI A;  4R5E A;  5DO2 A;  3ALF A;  4DRP A;  3KAC A;  1FKT A;  3RFW A;  3CHC A;  2D9F A;  1L1P A;  4URI A;  3AS0 A;  1NMW A;  3CGM A;  2F21 A;  5HWC A;  2RUD A;  1Y0O A;  3ARZ A;  1EQ3 A;  2PPO A;  2YBU A;  2ZR4 A;  1WAW A;  4WKA A;  2XP4 A;  1J4I A;  1RD6 A;  3O5J A;  2PPP A;  3PRD A;  1ZL1 A;  2JZV A;  1Q6I A;  4P8X A;  4J4N A;  4PTM A;  1JND A;  4MSP A;  4Z2H A;  2ZQV A;  2F4E A;  2KR7 A;  3AS3 A;  2RQS A;  2ZR5 A;  3IKG A;  2MPH A;  5JH8 A;  2WM0 A;  1PBK A;  4ODN A;  1ZCN A;  1E6R A;  3UI6 A;  1A7X A;  1ZBC A;  3RME A;  3WL1 A;  4MGV A;  5J6E A;  3JYM A;  5GQB A;  1OWQ A;  4BF8 A;  4GIV A;  2LKN A;  2RUQ A;  4C02 B;  1KT0 A;  3QOK A;  1LQ0 A;  4NNR A;  5HUA A;  3TCZ A;  2N87 A;  2DT1 A;  2Q5A A;  4O2T A;  3RM9 A;  1HKM A;  3O5K A;  4QIB A;  3UI4 A;  1ZB5 A;  4QZV B;  3O5O A;  1D7I A;  4FAP A;  3CH9 A;  1NWT A;  1M5Y A;  3RM8 A;  3O5L A;  1FD9 A;  2L2S A;  2DSV A;  2DG3 A;  1U79 A;  4IQ2 A;  1F8A B;  4Z2G A;  1JVW A;  4MNJ A;  1HKJ A;  1QPF A;  4W9Q A;  5DIT A;  1E6N A;  4KR0 B;  5HWB A;  4TNS A;  1W1V A;  1WNO A;  2ZR6 A;  2XP8 A;  2KI3 A;  4ODQ A;  2DSZ A;  1FJD A;  4ODP A;  4WKH A;  1LG2 A;  4DIP A;  3O5F A;  2PPN A;  3WD2 A;  2LGO A;  2IUZ A;  4DWS A;  4Z2K A;  4G2P A;  1UR9 A;  3EY6 A;  1BL4 A;  5DIU A;  3MDY B;  3WH0 A;  4MPK A;  2XP3 A;  1FAP A;  1HJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...