4LAXA

Crystal structure analysis of fkbp52, complex with fk506
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
237
structure length
237
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA02
2DG3A 2FAPA 2MLXA 1KT1A 3VAWA 4J4OA 5BXJA 4ODRA 2XPAA 4DRIA 4DRQA 2Y78A 2AWGA 2PV2A 3O5EA 5HTGA 5HUAA 3O5IA 4IPXA 2IF4A 2F21A 2MLZA 4TW6A 2XP3A 4TX0A 2MF9A 4FN2A 4TW8A 2XP5A 4NNRA 1FKFA 2LJ4A 2Q5AA 2ZQTA 3KAFA 3O5KA 2ZR4A 4ODOA 4DRNA 3NRKA 4QIBA 4DH0A 2RUQA 1EQ3A 4W9PA 2KFWA 3IHZA 4JFJA 1BL4A 3NI6A 1FJDA 2RUDA 5GPGA 3O5DA 2XP4A 3RGCA 2ZQSA 3OOBA 1L1PA 2XP7A 3JXVA 2RUCA 4QT2A 4ODPA 1J4IA 4N19A 1BKFA 2RSEA 2XPBA 3RFWA 4ODLA 4O2TA 3O5GA 3EY6A 4ODNA 4DRMA 4IQ2A 1J4RA 2XP6A 4LAVA 5D75A 1ZK6A 4LAWA 4LAXA 3UQIA 2XP9A 4DRHA 4JFIA 1JNTA 4DZ3A 5DITA 4DZ2A 3KAGA 4GGQA 4J4NA 1D7JA 5HW6A 3TCZA 2F2DA 2M1IA 2OFNA 4MSPA 3UI4A 5DIVA 3JYMA 5HW8A 1ZCNA 1A7XA 2ZQVA 3TC5A 1QPLA 5I98A 4DT4A 2FKEA 1ROTA 1FKSA 1FKGA 2KR7A 5B8IC 3O5QA 1NMWA 2DG9A 2PV3A 4FAPA 1C9HA 3I6CA 4LAYA 4G50A 3KZ7A 1YW5A 4JFLA 3UF8A 1Q6IA 2RURA 3B7XA 5DIUA 3TDBA 3KAHA 3CGMA 2JZVA 4R0XA 1M5YA 1QZ2A 1EYMA 4ITZA 3IKGA 1FKKA 2M08A 3H9RB 4TNSA 4ODMA 2XP8A 1KT0A 2KE0A 2PPNA 2N87A 3O5LA 3LUOA 4GIVA 5HW7A 4U86A 2D9FA 3FAPA 1P5QA 3UQAA 2DG4A 2UZ5A 3KACA 3O5RA 5HT1A 3CGNA 1PBKA 1HXVA 2KGJA 3PRBA 5J6EA 2K8IA 2VCDA 4JYSA 3KADA 2MNTA 4C02B 1Q6HA 4G2PA 2VN1A 1N1AA 1JNSA 1R9HA 1PINA 2MLYA 1Y0OA 4IQCA 4DIPA 4DRPA 4JFKA 3PA7A 1FKDA 2ZR5A 3O5OA 2ZQUA 2ZR6A 1YATA 2LGOA 2PPOA 4W9QA 3UI6A 3KAIA 1FKJA 2ITKA 2M2AA 1U79A 1B6CA 1JVWA 1F8AB 1Q1CA 1Q6UA 3JYJA 4JFMA 5HWBA 1J6YA 3PRDA 2PV1A 4QT3A 1FKBA 5HKGA 4U85A 3KABA 2F4EA 3ODKA 3KCEA 4MGVA 1F40A 1D7IA 4DRKA 1FKRA 3UI5A 1FD9A 3O5MA 4U84A 5HWCA 1QPFA 1D7HA 1FKIA 4ODKA 1TCOC 3O5FA 3NTPA 3O5PA 4TW7A 1ROUA 1J4HA 1T11A 2KO7A 4TYOA 3UQBA 2PPPA 2PBCA 4BF8A 3IK8A 1FKHA 2RQSA 4DROA 2L2SA 1FAPA 1W26A 3MDYB 2KI3A 2LPVA 3O5JA 3WH0A 4DRJA 3GPKA 1FKTA 1NMVA 3IKDA 1D6OA 4ODQA 1FKLA 2LKNA 1NSGA 2MPHA 4W9OA
chains in the Genus database with same CATH superfamily
3ARQA 3ALGA 5BXJA 2Y78A 3ARVA 1ZL1A 2AWGA 4PTMA 2IF4A 2MLZA 1JNEA 1D2KA 1X6LA 3O5KA 3ARRA 1XHGA 2PI6A 4IT6A 4ODOA 4DH0A 3WD0A 1EQ3A 3CHFA 4W9PA 3AROA 1CTNA 3G6MA 4JFJA 1LG1A 2RUCA 4P8UA 4ODPA 4N19A 2XPBA 4L72B 4ODLA 4HARA 3EY6A 4ODNA 4DRMA 2XP9A 1NWSA 1JCHB 2M1IA 1SR0A 1ZCNA 2ZQVA 1QPLA 5I98A 1ROTA 1FKSA 1E15A 4Q7NA 1W9VA 1C9HA 4FAPA 5DIUA 3B7XA 2IUZA 2JZVA 1ZB5A 3IKGA 4ODMA 1KT0A 4GIVA 2WLYA 1E6NA 2O9OA 2DG4A 3ARTA 3KACA 1E6RA 1WB0A 1LQ0A 3CGNA 1HXVA 3PRBA 4ZPWR 2K8IA 1Q6HA 4IQCA 2MLYA 2DSUA 4JFKA 1ZBCA 1LL6A 4W9QA 3UI6A 2ITKA 1B6CA 1W1PA 1F8AB 1Q6UA 4NZCA 2PV1A 5HKGA 1HJWA 1OWQA 1W9UA 1F40A 3KCEA 1FD9A 5HWCA 2G41A 3WD2A 3AS3A 1TCOC 4ODKA 4URIA 4HBEA 1T11A 2EULA 2PBCA 4DROA 4KQZA 4MPKA 1JNDA 3G6LA 4DRJA 3GPKA 2ETNA 3KAGA 4MTVA 2FAPA 1KT1A 2XPAA 1K9TA 3O5EA 5HTGA 4IPXA 2F21A 4TW8A 3WD3A 2XP5A 1FKFA 2Q5AA 2ESCA 2ZR4A 4MNMA 3NRKA 2AOSA 2RUQA 3BXWA 3CHEA 3CHDA 3RM8A 1HKIA 1W1YA 5GPGA 3O5DA 2P4VA 3BMBA 3JXVA 4QT2A 5DF0A 2RSEA 3O5GA 4ZS6A 4LAVA 5D75A 1ZK6A 4LAXA 1GPFA 3UQIA 1JNTA 5HW6A 2OFNA 4MSPA 3UI4A 2DSZA 2A3CA 1A7XA 4DT4A 2FKEA 2KR7A 1EIBA 2FDMA 3O5QA 2DG9A 2OLHA 2YBUA 4G50A 5DEZA 3TDBA 2RURA 3KAHA 4ITZA 1FKKA 4TNSA 2XP8A 3UQAA 5DO2A 3B9EA 1PBKA 4DWSB 1TFVA 4WK9A 4P8XA 3AS1A 2MNTA 1UR8A 1OGBA 2VN1A 1N1AA 1JNSA 1R9HA 4DRPA 4WKHA 3O5OA 2ZQUA 2ZR6A 1YATA 4LGXA 4MNKA 2LGOA 2PPOA 1GUVA 1NWTA 2M2AA 1U79A 1HKMA 3OA5A 1JVWA 4JFMA 1J6YA 5HWBA 1LL7A 1E6PA 4AY1A 1FKBA 4Q22A 1FKRA 3WKZA 1HKKA 4U84A 3ARWA 1LG2A 1QPFA 1FKIA 1ROUA 1ZU8A 1KFWA 2RQSA 4P8WA 1W26A 3WIJA 1E6ZA 2KI3A 2LPVA 3O5JA 1HKJA 1NH6A 4S3KA 2LKNA 4KR0B 2MPHA 4W9OA 2DG3A 5GQBA 2MLXA 3VAWA 4WKAA 4ODRA 4Z2IA 2PV2A 3WL1A 1LJYA 1E9LA 1H0GA 1X6NA 3ARPA 4TX0A 4NNRA 2LJ4A 2ZQTA 3KAFA 4Z2KA 4DRNA 2O92A 4MAVA 2PN0A 2KFWA 1BL4A 4P8VA 3AQUA 3RGCA 2ZQSA 1L1PA 2XP7A 3WD4A 1J4IA 1H0IA 3RFWA 1XRVA 4IQ2A 4LAWA 4JFIA 4GGQA 4J4NA 1D7JA 3TCZA 1SYTA 3JYMA 5HW8A 1UR9A 2A3AA 1ZBVA 3GTYX 1FFRA 2DT2A 3I6CA 4LAYA 3KZ7A 4JFLA 3UF8A 1IX5A 3B8SA 3CGMA 3WQWA 1HJVA 2WM0A 3H9RB 1WNOA 2PPNA 3O5LA 4U86A 2D9FA 3FAPA 2UZ5A 3O5RA 4IT4A 3KADA 4XAKA 4G2PA 3EIPA 1W1TA 1Y0OA 4R5EA 4DWSA 3PA7A 4UDMA 2YBTA 3GU0A 3KAIA 1FKJA 5GPRA 3QOKA 4Z2LA 3RMEA 1Q1CA 1WAWA 4QT3A 3ODKA 4MGVA 4L3NA 1D7HA 4ZPVR 3NTPA 1J4HA 3UQBA 1EHNA 1FKTA 1NMVA 1D6OA 5HBFA 3B9AA 2DT0A 4J4OA 3CH9A 4DRIA 3FY1A 4DRQA 3B9DA 5HUAA 3O5IA 4TW6A 2XP3A 2MF9A 4FN2A 1RD6A 4MNJA 1LL4A 2B31A 4QIBA 1OGGA 1GOIA 3PR9A 4WKFA 3IHZA 3NI6A 1FJDA 2RUDA 2XP4A 3PRAA 3OOBA 3ARUA 2A3EA 2WLZA 3ARXA 1ZBWA 4NSBA 1BKFA 3RM4A 1HJXA 4O2TA 1W9PA 2DT3A 4Z2HA 1J4RA 3WQVA 2XP6A 4DRHA 4WIWA 1ZBKA 4DZ2A 4DZ3A 5DITA 2DPEA 2F23A 2F2DA 3RM9A 5DIVA 3TC5A 3AS2A 1EDQA 2DSWA 5B8IC 1FKGA 1NMWA 3FXYA 1O6IA 2PV3A 4ZPTR 2DSVA 1YW5A 1Q6IA 4QZVB 4R0XA 1M5YA 1EYMA 1QZ2A 1ITXA 1NWUA 2M08A 2KE0A 2N87A 3LUOA 5HW7A 1P5QA 3CZ8A 4HBOA 5HT1A 2B5UB 2KGJA 5J6EA 2VCDA 4JYSA 4C02B 1NWRA 2G8ZA 5JH8A 3AS0A 3WL0A 3ALFA 1PINA 4DIPA 1FKDA 2ZR5A 4Z2GA 4DWSC 4S3JA 4Z2JA 1FFQA 1GRJA 3WD1A 4WJXA 2A3BA 3CHCA 4DWSD 3JYJA 4ML4A 3PRDA 4U85A 3KABA 2F4EA 1W1VA 3ARZA 4MNLA 1D7IA 4DRKA 2QF8A 3UI5A 3O5MA 1E44A 3O5FA 4TW7A 3O5PA 4W5UA 2KO7A 3ARSA 2WK2A 3ARYA 4TYOA 2PPPA 2DT1A 4BF8A 3IK8A 1FKHA 1VF8A 2L2SA 1FAPA 3MDYB 3WH0A 3IKDA 4ODQA 3W4RA 1FKLA 1NSGA
chains in the Genus database with same CATH topology
3ARQA 3ALGA 5BXJA 2Y78A 3ARVA 1ZL1A 2AWGA 4PTMA 2IF4A 2MLZA 1JNEA 1D2KA 1X6LA 3O5KA 3ARRA 1XHGA 2PI6A 4IT6A 4ODOA 4DH0A 3WD0A 1EQ3A 3CHFA 4W9PA 3AROA 1CTNA 3G6MA 4JFJA 1LG1A 2RUCA 4P8UA 4ODPA 4N19A 2XPBA 4L72B 4ODLA 4HARA 3EY6A 4ODNA 4DRMA 2XP9A 1NWSA 2M1IA 1SR0A 1ZCNA 2ZQVA 1QPLA 5I98A 1ROTA 1FKSA 1E15A 4Q7NA 1W9VA 1C9HA 4FAPA 5DIUA 3B7XA 2IUZA 2JZVA 1ZB5A 3IKGA 4ODMA 1KT0A 4GIVA 2WLYA 1E6NA 2O9OA 2DG4A 3ARTA 3KACA 1E6RA 1WB0A 1LQ0A 3CGNA 1HXVA 3PRBA 4ZPWR 2K8IA 1Q6HA 4IQCA 2MLYA 2DSUA 4JFKA 1ZBCA 1LL6A 4W9QA 3UI6A 2ITKA 1B6CA 1W1PA 1F8AB 1Q6UA 4NZCA 2PV1A 5HKGA 1HJWA 1OWQA 1W9UA 1F40A 3KCEA 1FD9A 5HWCA 2G41A 3WD2A 3AS3A 1TCOC 4ODKA 4URIA 4HBEA 1T11A 2PBCA 4DROA 4KQZA 4MPKA 1JNDA 3G6LA 4DRJA 3GPKA 3KAGA 4MTVA 2FAPA 1KT1A 2XPAA 1K9TA 3O5EA 5HTGA 4IPXA 2F21A 4TW8A 3WD3A 2XP5A 1FKFA 2Q5AA 2ESCA 2ZR4A 4MNMA 3NRKA 2AOSA 2RUQA 3BXWA 3CHEA 3CHDA 3RM8A 1HKIA 1W1YA 5GPGA 3O5DA 3JXVA 4QT2A 5DF0A 2RSEA 3O5GA 4ZS6A 4LAVA 5D75A 1ZK6A 4LAXA 1GPFA 3UQIA 1JNTA 5HW6A 2OFNA 4MSPA 3UI4A 2DSZA 2A3CA 1A7XA 4DT4A 2FKEA 2KR7A 1EIBA 2FDMA 3O5QA 2DG9A 2OLHA 2YBUA 4G50A 5DEZA 3TDBA 2RURA 3KAHA 4ITZA 1FKKA 4TNSA 2XP8A 3UQAA 5DO2A 3B9EA 1PBKA 4DWSB 1TFVA 4WK9A 4P8XA 3AS1A 2MNTA 1UR8A 1OGBA 2VN1A 1N1AA 1JNSA 1R9HA 4DRPA 4WKHA 3O5OA 2ZQUA 2ZR6A 1YATA 4LGXA 4MNKA 2LGOA 2PPOA 1GUVA 1NWTA 2M2AA 1U79A 1HKMA 3OA5A 1JVWA 4JFMA 1J6YA 5HWBA 1LL7A 1E6PA 4AY1A 1FKBA 4Q22A 1FKRA 3WKZA 1HKKA 4U84A 3ARWA 1LG2A 1QPFA 1FKIA 1ROUA 1ZU8A 1KFWA 2RQSA 4P8WA 1W26A 3WIJA 1E6ZA 2KI3A 2LPVA 3O5JA 1HKJA 1NH6A 4S3KA 2LKNA 4KR0B 2MPHA 4W9OA 2DG3A 5GQBA 2MLXA 3VAWA 4WKAA 4ODRA 4Z2IA 2PV2A 3WL1A 1LJYA 1E9LA 1H0GA 1X6NA 3ARPA 4TX0A 4NNRA 2LJ4A 2ZQTA 3KAFA 4Z2KA 4DRNA 2O92A 4MAVA 2KFWA 1BL4A 4P8VA 3AQUA 3RGCA 2ZQSA 1L1PA 2XP7A 3WD4A 1J4IA 1H0IA 3RFWA 1XRVA 4IQ2A 4LAWA 4JFIA 4GGQA 4J4NA 1D7JA 3TCZA 1SYTA 3JYMA 5HW8A 1UR9A 2A3AA 1ZBVA 1FFRA 2DT2A 3I6CA 4LAYA 3KZ7A 4JFLA 3UF8A 1IX5A 3B8SA 3CGMA 3WQWA 1HJVA 2WM0A 3H9RB 1WNOA 2PPNA 3O5LA 4U86A 2D9FA 3FAPA 2UZ5A 3O5RA 4IT4A 3KADA 4XAKA 4G2PA 1W1TA 1Y0OA 4R5EA 4DWSA 3PA7A 2YBTA 3KAIA 1FKJA 5GPRA 3QOKA 4Z2LA 3RMEA 1Q1CA 1WAWA 4QT3A 3ODKA 4MGVA 4L3NA 1D7HA 4ZPVR 3NTPA 1J4HA 3UQBA 1EHNA 1FKTA 1NMVA 1D6OA 5HBFA 3B9AA 2DT0A 4J4OA 3CH9A 4DRIA 3FY1A 4DRQA 3B9DA 5HUAA 3O5IA 4TW6A 2XP3A 2MF9A 4FN2A 1RD6A 4MNJA 1LL4A 2B31A 4QIBA 1OGGA 1GOIA 3PR9A 4WKFA 3IHZA 3NI6A 1FJDA 2RUDA 2XP4A 3PRAA 3OOBA 3ARUA 2A3EA 2WLZA 3ARXA 1ZBWA 4NSBA 1BKFA 3RM4A 1HJXA 4O2TA 1W9PA 2DT3A 4Z2HA 1J4RA 3WQVA 2XP6A 4DRHA 4WIWA 1ZBKA 4DZ2A 4DZ3A 5DITA 2DPEA 2F2DA 3RM9A 5DIVA 3TC5A 3AS2A 1EDQA 2DSWA 5B8IC 1FKGA 1NMWA 3FXYA 1O6IA 2PV3A 4ZPTR 2DSVA 1YW5A 1Q6IA 4QZVB 4R0XA 1M5YA 1EYMA 1QZ2A 1ITXA 1NWUA 2M08A 2KE0A 2N87A 3LUOA 5HW7A 1P5QA 3CZ8A 4HBOA 5HT1A 2KGJA 5J6EA 2VCDA 4JYSA 4C02B 1NWRA 2G8ZA 5JH8A 3AS0A 3WL0A 3ALFA 1PINA 4DIPA 1FKDA 2ZR5A 4Z2GA 4DWSC 4S3JA 4Z2JA 1FFQA 3WD1A 4WJXA 2A3BA 3CHCA 4DWSD 3JYJA 4ML4A 3PRDA 4U85A 3KABA 2F4EA 1W1VA 3ARZA 4MNLA 1D7IA 4DRKA 2QF8A 3UI5A 3O5MA 3O5FA 4TW7A 3O5PA 4W5UA 2KO7A 3ARSA 2WK2A 3ARYA 4TYOA 2PPPA 2DT1A 4BF8A 3IK8A 1FKHA 1VF8A 2L2SA 1FAPA 3MDYB 3WH0A 3IKDA 4ODQA 3W4RA 1FKLA 1NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG3 A;  2FAP A;  2MLX A;  1KT1 A;  3VAW A;  4J4O A;  5BXJ A;  4ODR A;  2XPA A;  4DRI A;  4DRQ A;  2Y78 A;  2AWG A;  2PV2 A;  3O5E A;  5HTG A;  5HUA A;  3O5I A;  4IPX A;  2IF4 A;  2F21 A;  2MLZ A;  4TW6 A;  2XP3 A;  4TX0 A;  2MF9 A;  4FN2 A;  4TW8 A;  2XP5 A;  4NNR A;  1FKF A;  2LJ4 A;  2Q5A A;  2ZQT A;  3KAF A;  3O5K A;  2ZR4 A;  4ODO A;  4DRN A;  3NRK A;  4QIB A;  4DH0 A;  2RUQ A;  1EQ3 A;  4W9P A;  2KFW A;  3IHZ A;  4JFJ A;  1BL4 A;  3NI6 A;  1FJD A;  2RUD A;  5GPG A;  3O5D A;  2XP4 A;  3RGC A;  2ZQS A;  3OOB A;  1L1P A;  2XP7 A;  3JXV A;  2RUC A;  4QT2 A;  4ODP A;  1J4I A;  4N19 A;  1BKF A;  2RSE A;  2XPB A;  3RFW A;  4ODL A;  4O2T A;  3O5G A;  3EY6 A;  4ODN A;  4DRM A;  4IQ2 A;  1J4R A;  2XP6 A;  4LAV A;  5D75 A;  1ZK6 A;  4LAW A;  4LAX A;  3UQI A;  2XP9 A;  4DRH A;  4JFI A;  1JNT A;  4DZ3 A;  5DIT A;  4DZ2 A;  3KAG A;  4GGQ A;  4J4N A;  1D7J A;  5HW6 A;  3TCZ A;  2F2D A;  2M1I A;  2OFN A;  4MSP A;  3UI4 A;  5DIV A;  3JYM A;  5HW8 A;  1ZCN A;  1A7X A;  2ZQV A;  3TC5 A;  1QPL A;  5I98 A;  4DT4 A;  2FKE A;  1ROT A;  1FKS A;  1FKG A;  2KR7 A;  5B8I C;  3O5Q A;  1NMW A;  2DG9 A;  2PV3 A;  4FAP A;  1C9H A;  3I6C A;  4LAY A;  4G50 A;  3KZ7 A;  1YW5 A;  4JFL A;  3UF8 A;  1Q6I A;  2RUR A;  3B7X A;  5DIU A;  3TDB A;  3KAH A;  3CGM A;  2JZV A;  4R0X A;  1M5Y A;  1QZ2 A;  1EYM A;  4ITZ A;  3IKG A;  1FKK A;  2M08 A;  3H9R B;  4TNS A;  4ODM A;  2XP8 A;  1KT0 A;  2KE0 A;  2PPN A;  2N87 A;  3O5L A;  3LUO A;  4GIV A;  5HW7 A;  4U86 A;  2D9F A;  3FAP A;  1P5Q A;  3UQA A;  2DG4 A;  2UZ5 A;  3KAC A;  3O5R A;  5HT1 A;  3CGN A;  1PBK A;  1HXV A;  2KGJ A;  3PRB A;  5J6E A;  2K8I A;  2VCD A;  4JYS A;  3KAD A;  2MNT A;  4C02 B;  1Q6H A;  4G2P A;  2VN1 A;  1N1A A;  1JNS A;  1R9H A;  1PIN A;  2MLY A;  1Y0O A;  4IQC A;  4DIP A;  4DRP A;  4JFK A;  3PA7 A;  1FKD A;  2ZR5 A;  3O5O A;  2ZQU A;  2ZR6 A;  1YAT A;  2LGO A;  2PPO A;  4W9Q A;  3UI6 A;  3KAI A;  1FKJ A;  2ITK A;  2M2A A;  1U79 A;  1B6C A;  1JVW A;  1F8A B;  1Q1C A;  1Q6U A;  3JYJ A;  4JFM A;  5HWB A;  1J6Y A;  3PRD A;  2PV1 A;  4QT3 A;  1FKB A;  5HKG A;  4U85 A;  3KAB A;  2F4E A;  3ODK A;  3KCE A;  4MGV A;  1F40 A;  1D7I A;  4DRK A;  1FKR A;  3UI5 A;  1FD9 A;  3O5M A;  4U84 A;  5HWC A;  1QPF A;  1D7H A;  1FKI A;  4ODK A;  1TCO C;  3O5F A;  3NTP A;  3O5P A;  4TW7 A;  1ROU A;  1J4H A;  1T11 A;  2KO7 A;  4TYO A;  3UQB A;  2PPP A;  2PBC A;  4BF8 A;  3IK8 A;  1FKH A;  2RQS A;  4DRO A;  2L2S A;  1FAP A;  1W26 A;  3MDY B;  2KI3 A;  2LPV A;  3O5J A;  3WH0 A;  4DRJ A;  3GPK A;  1FKT A;  1NMV A;  3IKD A;  1D6O A;  4ODQ A;  1FKL A;  2LKN A;  1NSG A;  2MPH A;  4W9O A; 
#chains in the Genus database with same CATH topology
 3ARQ A;  3ALG A;  5BXJ A;  2Y78 A;  3ARV A;  1ZL1 A;  2AWG A;  4PTM A;  2IF4 A;  2MLZ A;  1JNE A;  1D2K A;  1X6L A;  3O5K A;  3ARR A;  1XHG A;  2PI6 A;  4IT6 A;  4ODO A;  4DH0 A;  3WD0 A;  1EQ3 A;  3CHF A;  4W9P A;  3ARO A;  1CTN A;  3G6M A;  4JFJ A;  1LG1 A;  2RUC A;  4P8U A;  4ODP A;  4N19 A;  2XPB A;  4L72 B;  4ODL A;  4HAR A;  3EY6 A;  4ODN A;  4DRM A;  2XP9 A;  1NWS A;  1JCH B;  2M1I A;  1SR0 A;  1ZCN A;  2ZQV A;  1QPL A;  5I98 A;  1ROT A;  1FKS A;  1E15 A;  4Q7N A;  1W9V A;  1C9H A;  4FAP A;  5DIU A;  3B7X A;  2IUZ A;  2JZV A;  1ZB5 A;  3IKG A;  4ODM A;  1KT0 A;  4GIV A;  2WLY A;  1E6N A;  2O9O A;  2DG4 A;  3ART A;  3KAC A;  1E6R A;  1WB0 A;  1LQ0 A;  3CGN A;  1HXV A;  3PRB A;  4ZPW R;  2K8I A;  1Q6H A;  4IQC A;  2MLY A;  2DSU A;  4JFK A;  1ZBC A;  1LL6 A;  4W9Q A;  3UI6 A;  2ITK A;  1B6C A;  1W1P A;  1F8A B;  1Q6U A;  4NZC A;  2PV1 A;  5HKG A;  1HJW A;  1OWQ A;  1W9U A;  1F40 A;  3KCE A;  1FD9 A;  5HWC A;  2G41 A;  3WD2 A;  3AS3 A;  1TCO C;  4ODK A;  4URI A;  4HBE A;  1T11 A;  2EUL A;  2PBC A;  4DRO A;  4KQZ A;  4MPK A;  1JND A;  3G6L A;  4DRJ A;  3GPK A;  2ETN A;  3KAG A;  4MTV A;  2FAP A;  1KT1 A;  2XPA A;  1K9T A;  3O5E A;  5HTG A;  4IPX A;  2F21 A;  4TW8 A;  3WD3 A;  2XP5 A;  1FKF A;  2Q5A A;  2ESC A;  2ZR4 A;  4MNM A;  3NRK A;  2AOS A;  2RUQ A;  3BXW A;  3CHE A;  3CHD A;  3RM8 A;  1HKI A;  1W1Y A;  5GPG A;  3O5D A;  2P4V A;  3BMB A;  3JXV A;  4QT2 A;  5DF0 A;  2RSE A;  3O5G A;  4ZS6 A;  4LAV A;  5D75 A;  1ZK6 A;  4LAX A;  1GPF A;  3UQI A;  1JNT A;  5HW6 A;  2OFN A;  4MSP A;  3UI4 A;  2DSZ A;  2A3C A;  1A7X A;  4DT4 A;  2FKE A;  2KR7 A;  1EIB A;  2FDM A;  3O5Q A;  2DG9 A;  2OLH A;  2YBU A;  4G50 A;  5DEZ A;  3TDB A;  2RUR A;  3KAH A;  4ITZ A;  1FKK A;  4TNS A;  2XP8 A;  3UQA A;  5DO2 A;  3B9E A;  1PBK A;  4DWS B;  1TFV A;  4WK9 A;  4P8X A;  3AS1 A;  2MNT A;  1UR8 A;  1OGB A;  2VN1 A;  1N1A A;  1JNS A;  1R9H A;  4DRP A;  4WKH A;  3O5O A;  2ZQU A;  2ZR6 A;  1YAT A;  4LGX A;  4MNK A;  2LGO A;  2PPO A;  1GUV A;  1NWT A;  2M2A A;  1U79 A;  1HKM A;  3OA5 A;  1JVW A;  4JFM A;  1J6Y A;  5HWB A;  1LL7 A;  1E6P A;  4AY1 A;  1FKB A;  4Q22 A;  1FKR A;  3WKZ A;  1HKK A;  4U84 A;  3ARW A;  1LG2 A;  1QPF A;  1FKI A;  1ROU A;  1ZU8 A;  1KFW A;  2RQS A;  4P8W A;  1W26 A;  3WIJ A;  1E6Z A;  2KI3 A;  2LPV A;  3O5J A;  1HKJ A;  1NH6 A;  4S3K A;  2LKN A;  4KR0 B;  2MPH A;  4W9O A;  2DG3 A;  5GQB A;  2MLX A;  3VAW A;  4WKA A;  4ODR A;  4Z2I A;  2PV2 A;  3WL1 A;  1LJY A;  1E9L A;  1H0G A;  1X6N A;  3ARP A;  4TX0 A;  4NNR A;  2LJ4 A;  2ZQT A;  3KAF A;  4Z2K A;  4DRN A;  2O92 A;  4MAV A;  2PN0 A;  2KFW A;  1BL4 A;  4P8V A;  3AQU A;  3RGC A;  2ZQS A;  1L1P A;  2XP7 A;  3WD4 A;  1J4I A;  1H0I A;  3RFW A;  1XRV A;  4IQ2 A;  4LAW A;  4JFI A;  4GGQ A;  4J4N A;  1D7J A;  3TCZ A;  1SYT A;  3JYM A;  5HW8 A;  1UR9 A;  2A3A A;  1ZBV A;  3GTY X;  1FFR A;  2DT2 A;  3I6C A;  4LAY A;  3KZ7 A;  4JFL A;  3UF8 A;  1IX5 A;  3B8S A;  3CGM A;  3WQW A;  1HJV A;  2WM0 A;  3H9R B;  1WNO A;  2PPN A;  3O5L A;  4U86 A;  2D9F A;  3FAP A;  2UZ5 A;  3O5R A;  4IT4 A;  3KAD A;  4XAK A;  4G2P A;  3EIP A;  1W1T A;  1Y0O A;  4R5E A;  4DWS A;  3PA7 A;  4UDM A;  2YBT A;  3GU0 A;  3KAI A;  1FKJ A;  5GPR A;  3QOK A;  4Z2L A;  3RME A;  1Q1C A;  1WAW A;  4QT3 A;  3ODK A;  4MGV A;  4L3N A;  1D7H A;  4ZPV R;  3NTP A;  1J4H A;  3UQB A;  1EHN A;  1FKT A;  1NMV A;  1D6O A;  5HBF A;  3B9A A;  2DT0 A;  4J4O A;  3CH9 A;  4DRI A;  3FY1 A;  4DRQ A;  3B9D A;  5HUA A;  3O5I A;  4TW6 A;  2XP3 A;  2MF9 A;  4FN2 A;  1RD6 A;  4MNJ A;  1LL4 A;  2B31 A;  4QIB A;  1OGG A;  1GOI A;  3PR9 A;  4WKF A;  3IHZ A;  3NI6 A;  1FJD A;  2RUD A;  2XP4 A;  3PRA A;  3OOB A;  3ARU A;  2A3E A;  2WLZ A;  3ARX A;  1ZBW A;  4NSB A;  1BKF A;  3RM4 A;  1HJX A;  4O2T A;  1W9P A;  2DT3 A;  4Z2H A;  1J4R A;  3WQV A;  2XP6 A;  4DRH A;  4WIW A;  1ZBK A;  4DZ2 A;  4DZ3 A;  5DIT A;  2DPE A;  2F23 A;  2F2D A;  3RM9 A;  5DIV A;  3TC5 A;  3AS2 A;  1EDQ A;  2DSW A;  5B8I C;  1FKG A;  1NMW A;  3FXY A;  1O6I A;  2PV3 A;  4ZPT R;  2DSV A;  1YW5 A;  1Q6I A;  4QZV B;  4R0X A;  1M5Y A;  1EYM A;  1QZ2 A;  1ITX A;  1NWU A;  2M08 A;  2KE0 A;  2N87 A;  3LUO A;  5HW7 A;  1P5Q A;  3CZ8 A;  4HBO A;  5HT1 A;  2B5U B;  2KGJ A;  5J6E A;  2VCD A;  4JYS A;  4C02 B;  1NWR A;  2G8Z A;  5JH8 A;  3AS0 A;  3WL0 A;  3ALF A;  1PIN A;  4DIP A;  1FKD A;  2ZR5 A;  4Z2G A;  4DWS C;  4S3J A;  4Z2J A;  1FFQ A;  1GRJ A;  3WD1 A;  4WJX A;  2A3B A;  3CHC A;  4DWS D;  3JYJ A;  4ML4 A;  3PRD A;  4U85 A;  3KAB A;  2F4E A;  1W1V A;  3ARZ A;  4MNL A;  1D7I A;  4DRK A;  2QF8 A;  3UI5 A;  3O5M A;  1E44 A;  3O5F A;  4TW7 A;  3O5P A;  4W5U A;  2KO7 A;  3ARS A;  2WK2 A;  3ARY A;  4TYO A;  2PPP A;  2DT1 A;  4BF8 A;  3IK8 A;  1FKH A;  1VF8 A;  2L2S A;  1FAP A;  3MDY B;  3WH0 A;  3IKD A;  4ODQ A;  3W4R A;  1FKL A;  1NSG A; 
#chains in the Genus database with same CATH homology
 3ARQ A;  3ALG A;  5BXJ A;  2Y78 A;  3ARV A;  1ZL1 A;  2AWG A;  4PTM A;  2IF4 A;  2MLZ A;  1JNE A;  1D2K A;  1X6L A;  3O5K A;  3ARR A;  1XHG A;  2PI6 A;  4IT6 A;  4ODO A;  4DH0 A;  3WD0 A;  1EQ3 A;  3CHF A;  4W9P A;  3ARO A;  1CTN A;  3G6M A;  4JFJ A;  1LG1 A;  2RUC A;  4P8U A;  4ODP A;  4N19 A;  2XPB A;  4L72 B;  4ODL A;  4HAR A;  3EY6 A;  4ODN A;  4DRM A;  2XP9 A;  1NWS A;  2M1I A;  1SR0 A;  1ZCN A;  2ZQV A;  1QPL A;  5I98 A;  1ROT A;  1FKS A;  1E15 A;  4Q7N A;  1W9V A;  1C9H A;  4FAP A;  5DIU A;  3B7X A;  2IUZ A;  2JZV A;  1ZB5 A;  3IKG A;  4ODM A;  1KT0 A;  4GIV A;  2WLY A;  1E6N A;  2O9O A;  2DG4 A;  3ART A;  3KAC A;  1E6R A;  1WB0 A;  1LQ0 A;  3CGN A;  1HXV A;  3PRB A;  4ZPW R;  2K8I A;  1Q6H A;  4IQC A;  2MLY A;  2DSU A;  4JFK A;  1ZBC A;  1LL6 A;  4W9Q A;  3UI6 A;  2ITK A;  1B6C A;  1W1P A;  1F8A B;  1Q6U A;  4NZC A;  2PV1 A;  5HKG A;  1HJW A;  1OWQ A;  1W9U A;  1F40 A;  3KCE A;  1FD9 A;  5HWC A;  2G41 A;  3WD2 A;  3AS3 A;  1TCO C;  4ODK A;  4URI A;  4HBE A;  1T11 A;  2PBC A;  4DRO A;  4KQZ A;  4MPK A;  1JND A;  3G6L A;  4DRJ A;  3GPK A;  3KAG A;  4MTV A;  2FAP A;  1KT1 A;  2XPA A;  1K9T A;  3O5E A;  5HTG A;  4IPX A;  2F21 A;  4TW8 A;  3WD3 A;  2XP5 A;  1FKF A;  2Q5A A;  2ESC A;  2ZR4 A;  4MNM A;  3NRK A;  2AOS A;  2RUQ A;  3BXW A;  3CHE A;  3CHD A;  3RM8 A;  1HKI A;  1W1Y A;  5GPG A;  3O5D A;  3JXV A;  4QT2 A;  5DF0 A;  2RSE A;  3O5G A;  4ZS6 A;  4LAV A;  5D75 A;  1ZK6 A;  4LAX A;  1GPF A;  3UQI A;  1JNT A;  5HW6 A;  2OFN A;  4MSP A;  3UI4 A;  2DSZ A;  2A3C A;  1A7X A;  4DT4 A;  2FKE A;  2KR7 A;  1EIB A;  2FDM A;  3O5Q A;  2DG9 A;  2OLH A;  2YBU A;  4G50 A;  5DEZ A;  3TDB A;  2RUR A;  3KAH A;  4ITZ A;  1FKK A;  4TNS A;  2XP8 A;  3UQA A;  5DO2 A;  3B9E A;  1PBK A;  4DWS B;  1TFV A;  4WK9 A;  4P8X A;  3AS1 A;  2MNT A;  1UR8 A;  1OGB A;  2VN1 A;  1N1A A;  1JNS A;  1R9H A;  4DRP A;  4WKH A;  3O5O A;  2ZQU A;  2ZR6 A;  1YAT A;  4LGX A;  4MNK A;  2LGO A;  2PPO A;  1GUV A;  1NWT A;  2M2A A;  1U79 A;  1HKM A;  3OA5 A;  1JVW A;  4JFM A;  1J6Y A;  5HWB A;  1LL7 A;  1E6P A;  4AY1 A;  1FKB A;  4Q22 A;  1FKR A;  3WKZ A;  1HKK A;  4U84 A;  3ARW A;  1LG2 A;  1QPF A;  1FKI A;  1ROU A;  1ZU8 A;  1KFW A;  2RQS A;  4P8W A;  1W26 A;  3WIJ A;  1E6Z A;  2KI3 A;  2LPV A;  3O5J A;  1HKJ A;  1NH6 A;  4S3K A;  2LKN A;  4KR0 B;  2MPH A;  4W9O A;  2DG3 A;  5GQB A;  2MLX A;  3VAW A;  4WKA A;  4ODR A;  4Z2I A;  2PV2 A;  3WL1 A;  1LJY A;  1E9L A;  1H0G A;  1X6N A;  3ARP A;  4TX0 A;  4NNR A;  2LJ4 A;  2ZQT A;  3KAF A;  4Z2K A;  4DRN A;  2O92 A;  4MAV A;  2KFW A;  1BL4 A;  4P8V A;  3AQU A;  3RGC A;  2ZQS A;  1L1P A;  2XP7 A;  3WD4 A;  1J4I A;  1H0I A;  3RFW A;  1XRV A;  4IQ2 A;  4LAW A;  4JFI A;  4GGQ A;  4J4N A;  1D7J A;  3TCZ A;  1SYT A;  3JYM A;  5HW8 A;  1UR9 A;  2A3A A;  1ZBV A;  1FFR A;  2DT2 A;  3I6C A;  4LAY A;  3KZ7 A;  4JFL A;  3UF8 A;  1IX5 A;  3B8S A;  3CGM A;  3WQW A;  1HJV A;  2WM0 A;  3H9R B;  1WNO A;  2PPN A;  3O5L A;  4U86 A;  2D9F A;  3FAP A;  2UZ5 A;  3O5R A;  4IT4 A;  3KAD A;  4XAK A;  4G2P A;  1W1T A;  1Y0O A;  4R5E A;  4DWS A;  3PA7 A;  2YBT A;  3KAI A;  1FKJ A;  5GPR A;  3QOK A;  4Z2L A;  3RME A;  1Q1C A;  1WAW A;  4QT3 A;  3ODK A;  4MGV A;  4L3N A;  1D7H A;  4ZPV R;  3NTP A;  1J4H A;  3UQB A;  1EHN A;  1FKT A;  1NMV A;  1D6O A;  5HBF A;  3B9A A;  2DT0 A;  4J4O A;  3CH9 A;  4DRI A;  3FY1 A;  4DRQ A;  3B9D A;  5HUA A;  3O5I A;  4TW6 A;  2XP3 A;  2MF9 A;  4FN2 A;  1RD6 A;  4MNJ A;  1LL4 A;  2B31 A;  4QIB A;  1OGG A;  1GOI A;  3PR9 A;  4WKF A;  3IHZ A;  3NI6 A;  1FJD A;  2RUD A;  2XP4 A;  3PRA A;  3OOB A;  3ARU A;  2A3E A;  2WLZ A;  3ARX A;  1ZBW A;  4NSB A;  1BKF A;  3RM4 A;  1HJX A;  4O2T A;  1W9P A;  2DT3 A;  4Z2H A;  1J4R A;  3WQV A;  2XP6 A;  4DRH A;  4WIW A;  1ZBK A;  4DZ2 A;  4DZ3 A;  5DIT A;  2DPE A;  2F2D A;  3RM9 A;  5DIV A;  3TC5 A;  3AS2 A;  1EDQ A;  2DSW A;  5B8I C;  1FKG A;  1NMW A;  3FXY A;  1O6I A;  2PV3 A;  4ZPT R;  2DSV A;  1YW5 A;  1Q6I A;  4QZV B;  4R0X A;  1M5Y A;  1EYM A;  1QZ2 A;  1ITX A;  1NWU A;  2M08 A;  2KE0 A;  2N87 A;  3LUO A;  5HW7 A;  1P5Q A;  3CZ8 A;  4HBO A;  5HT1 A;  2KGJ A;  5J6E A;  2VCD A;  4JYS A;  4C02 B;  1NWR A;  2G8Z A;  5JH8 A;  3AS0 A;  3WL0 A;  3ALF A;  1PIN A;  4DIP A;  1FKD A;  2ZR5 A;  4Z2G A;  4DWS C;  4S3J A;  4Z2J A;  1FFQ A;  3WD1 A;  4WJX A;  2A3B A;  3CHC A;  4DWS D;  3JYJ A;  4ML4 A;  3PRD A;  4U85 A;  3KAB A;  2F4E A;  1W1V A;  3ARZ A;  4MNL A;  1D7I A;  4DRK A;  2QF8 A;  3UI5 A;  3O5M A;  3O5F A;  4TW7 A;  3O5P A;  4W5U A;  2KO7 A;  3ARS A;  2WK2 A;  3ARY A;  4TYO A;  2PPP A;  2DT1 A;  4BF8 A;  3IK8 A;  1FKH A;  1VF8 A;  2L2S A;  1FAP A;  3MDY B;  3WH0 A;  3IKD A;  4ODQ A;  3W4R A;  1FKL A;  1NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...