4LAXA

Crystal structure analysis of fkbp52, complex with fk506
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
237
structure length
237
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 56
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA02
1YATA 1FKJA 3NI6A 2VCDA 1NMVA 5I98A 1PINA 5GPGA 1FAPA 2M08A 5HW8A 4U86A 2XP7A 2ZQVA 2PV2A 3UQBA 3I6CA 3KAIA 4JFKA 1F40A 1FKRA 1FKBA 1FKTA 1BL4A 2DG3A 2AWGA 2RQSA 4NNRA 1M5YA 2PBCA 1U79A 4W9OA 3H9RB 3UI4A 2XP9A 5DITA 4LAVA 4DRKA 3RFWA 4J4OA 2ZQTA 4TW8A 4ODQA 1EQ3A 3NRKA 2M2AA 4GIVA 3O5OA 3UI6A 4DZ3A 1Q1CA 2ZQSA 1J4RA 1FD9A 3IHZA 4IPXA 1JNSA 5DIVA 4BF8A 2PPOA 1A7XA 2PV3A 3O5EA 4IQCA 4LAWA 4DRIA 4TW7A 1Q6HA 5DIUA 1ZCNA 2MPHA 4N19A 4ODOA 3TDBA 3JYJA 1P5QA 3UQIA 4J4NA 1Q6IA 2D9FA 1QZ2A 1BKFA 1JVWA 1R9HA 3KCEA 4JFLA 4ODKA 4QIBA 4JFIA 2KI3A 1FKIA 2LKNA 3WH0A 4DRNA 1FJDA 3TCZA 1ROTA 5HW7A 1W26A 1C9HA 3PRBA 1FKDA 2KR7A 1F8AB 1KT1A 2N87A 4DZ2A 1TCOC 2MNTA 3O5MA 4DH0A 2Q5AA 1ROUA 3O5FA 1FKGA 2RSEA 2RUDA 3LUOA 4JYSA 4DRJA 1FKFA 2UZ5A 4ODMA 3PRDA 3B7XA 2DG4A 1D7IA 3O5JA 4DRHA 2XPBA 3CGMA 2IF4A 2RUQA 4LAYA 4ODNA 2LPVA 2Y78A 1D7HA 3TC5A 2ZR6A 2XP5A 2ZR5A 4O2TA 4R0XA 4DRPA 5HKGA 4U85A 4DIPA 1KT0A 3O5PA 3O5QA 2FKEA 1JNTA 2MLZA 4TNSA 2ZR4A 4C02B 1HXVA 3UF8A 3KACA 2OFNA 3ODKA 4DROA 3EY6A 1N1AA 1PBKA 4G50A 2K8IA 4W9QA 1L1PA 1QPFA 2XP4A 1Y0OA 5D75A 2RURA 3O5GA 5HWCA 2MLXA 3NTPA 5BXJA 2MLYA 5B8IC 5HW6A 2M1IA 4JFMA 1J4IA 4MSPA 1D6OA 5HUAA 1QPLA 3CGNA 1NMWA 4U84A 2JZVA 4IQ2A 4W9PA 2KE0A 2XP6A 2ZQUA 4QT2A 2XPAA 3O5IA 4QT3A 3IKDA 3O5LA 3FAPA 3O5DA 2PPPA 2VN1A 3OOBA 4FN2A 2PV1A 3O5KA 1Q6UA 3O5RA 2F21A 4GGQA 3JXVA 2LJ4A 4ODRA 4ODPA 2KGJA 2F2DA 5HWBA 3KADA 2ITKA 1T11A 1NSGA 1FKKA 2DG9A 3KABA 3UI5A 4ODLA 4DT4A 3UQAA 3KAHA 1B6CA 1D7JA 1FKLA 2PPNA 3KZ7A 2F4EA 3GPKA 4DRQA 4G2PA 4FAPA 3RGCA 2FAPA 3JYMA 4TYOA 1J4HA 1YW5A 2XP8A 3MDYB 4DRMA 5HTGA 5HT1A 3VAWA 1FKSA 4TW6A 2L2SA 2KO7A 4MGVA 2XP3A 3IKGA 3KAGA 4LAXA 3PA7A 2MF9A 4ITZA 2RUCA 3KAFA 4TX0A 1J6YA 4JFJA 2LGOA 5J6EA 1EYMA 3IK8A 1FKHA 1ZK6A 2KFWA
chains in the Genus database with same CATH superfamily
3ARZA 2VCDA 4Z2GA 1FAPA 2A3BA 5HW8A 2XP7A 1JNDA 2PV2A 3AS2A 3UQBA 1F40A 1FKRA 4DRKA 2DG3A 1SYTA 1M5YA 1KFWA 4QZVB 3UI4A 1X6LA 4ML4A 4LGXA 3AS0A 2G41A 1EQ3A 4DZ3A 4GIVA 1D2KA 2ZQSA 2FDMA 1JNSA 3GTYX 1A7XA 3B9EA 3O5EA 4IQCA 2P4VA 4TW7A 3TDBA 1EHNA 1HKJA 2D9FA 2ESCA 4HARA 1FKIA 2LKNA 3WH0A 4P8VA 1HJWA 1W26A 3ARYA 1SR0A 4P8WA 2RSEA 3LUOA 4JYSA 3BXWA 1FKFA 5GPRA 2B31A 3B7XA 4LAYA 2DT3A 3ARWA 2YBTA 3FY1A 1H0GA 4O2TA 4DIPA 1KT0A 3PR9A 3O5QA 2MLZA 2ZR4A 3ODKA 1PBKA 4WKHA 4MNKA 3OA5A 2XP4A 1W9PA 5D75A 2RURA 2IUZA 2MLYA 5DEZA 4MSPA 4U84A 1NMWA 2JZVA 3CZ8A 4WIWA 2XP6A 2DSUA 2XPAA 1K9TA 3FAPA 2VN1A 1X6NA 1ITXA 1Q6UA 4GGQA 3JXVA 2LJ4A 1OGBA 2KGJA 5HWBA 3CHEA 1T11A 1NSGA 3UI5A 2DG9A 4ODLA 4WKFA 3KAHA 4PTMA 1WAWA 4G2PA 1XRVA 4NZCA 4ZPTR 1ZBVA 1J4HA 1YW5A 3MDYB 2O92A 3GU0A 3RMEA 4AY1A 3AQUA 1FKSA 2F23A 3WD0A 4S3JA 4L72B 5DIVA 1ZK6A 1ZCNA 1E6RA 4DWSD 1HJXA 1NMVA 5HBFA 2PN0A 4Q22A 2G8ZA 5DITA 2YBUA 1J4RA 4IPXA 3ARUA 2PV3A 4LAWA 4DRIA 1W1YA 1W1TA 3WIJA 5DIUA 2MPHA 2DT1A 4N19A 1RD6A 1ZU8A 1NH6A 3KCEA 1E44A 1JVWA 1R9HA 4JFLA 4ODKA 4P8XA 4DRNA 1VF8A 2KI3A 4Z2IA 3TCZA 1ROTA 5HW7A 3PRBA 3G6LA 3WL1A 4DZ2A 4DH0A 2Q5AA 1ROUA 3O5FA 2RUDA 1ZL1A 2A3AA 2UZ5A 4ODMA 3WD1A 2XPBA 1CTNA 2LPVA 4WJXA 1UR9A 1LG2A 3BMBA 1JNTA 3FXYA 4C02B 2OFNA 1N1AA 1L1PA 1Y0OA 5HWCA 1HJVA 1HKKA 4IT4A 4KR0B 5B8IC 1EIBA 4Z2JA 1E15A 4Z2KA 1GPFA 4HBEA 5HUAA 4ZPVR 4W9PA 2KE0A 3B9DA 1ZBKA 4IT6A 4MNLA 5DF0A 4FN2A 3O5DA 3B8SA 3ALGA 3ARSA 1O6IA 1JNEA 3B9AA 3O5RA 3CHDA 3KABA 1W9UA 3UQAA 2WK2A 1FKLA 3GPKA 3ALFA 4FAPA 2XP8A 4DRMA 3CHCA 3WD4A 4TW6A 1GOIA 2L2SA 2KO7A 1EDQA 2XP3A 3ARTA 3KAGA 4TX0A 1J6YA 3CHFA 2LGOA 2WLZA 5J6EA 1EYMA 1ZBCA 4P8UA 2KFWA 1YATA 1FKJA 3NI6A 3WL0A 5I98A 5GPGA 2M08A 1LL6A 3I6CA 3KAIA 1H0IA 3ARXA 4NNRA 2AWGA 1E6NA 2PBCA 1U79A 3H9RB 4Z2LA 4WK9A 4MNMA 4J4OA 2ZQTA 4TW8A 5GQBA 3IHZA 1NWSA 4BF8A 2PPOA 2DT0A 1Q6HA 3AS3A 3QOKA 2ETNA 2AOSA 4ODOA 1GUVA 1FFRA 4QIBA 2A3EA 1FFQA 1FJDA 1C9HA 1FKDA 1F8AB 1KT1A 3O5MA 4DRJA 3PRDA 2DG4A 1D7IA 3O5JA 1W1PA 3CGMA 2IF4A 2EULA 2Y78A 4URIA 3WQVA 3EIPA 3AS1A 4R0XA 3O5PA 2FKEA 1HXVA 3EY6A 4ZS6A 3RM9A 1GRJA 1LQ0A 1E6PA 3O5GA 2MLXA 2A3CA 4W5UA 5HW6A 4JFMA 4Q7NA 1J4IA 3CGNA 4IQ2A 1HKMA 1WB0A 3ARQA 2ZQUA 4DWSB 4QT3A 3IKDA 3O5LA 4MPKA 2PV1A 3O5KA 1LJYA 2F21A 4ODRA 4ODPA 3KADA 3WKZA 4ZPWR 4R5EA 1B6CA 2PPNA 3KZ7A 2F4EA 3G6MA 3JYMA 4HBOA 3RM4A 3VAWA 4NSBA 4MGVA 4MNJA 1OWQA 3IKGA 1NWTA 4LAXA 2RUCA 1LL7A 1FKHA 1PINA 1HKIA 3AROA 1ZB5A 2OLHA 4XAKA 1E6ZA 4U86A 2ZQVA 3ARPA 2QF8A 4JFKA 5DO2A 1LL4A 1FKBA 1FKTA 1BL4A 2RQSA 4Z2HA 4W9OA 4S3KA 2XP9A 4LAVA 3RFWA 1E9LA 4ODQA 3NRKA 2M2AA 3UI6A 3O5OA 1Q1CA 1FD9A 4MAVA 1ZBWA 1XHGA 3ARVA 3JYJA 1P5QA 3UQIA 4J4NA 1Q6IA 1QZ2A 1BKFA 4JFIA 4WKAA 1W9VA 2KR7A 2N87A 1TCOC 2MNTA 2PI6A 1FKGA 3ARRA 1LG1A 1NWUA 4DRHA 2RUQA 4ODNA 2DSVA 3W4RA 4MTVA 3TC5A 1D7HA 2ZR6A 3RM8A 2O9OA 2XP5A 2ZR5A 4DRPA 5HKGA 4U85A 2DPEA 2WM0A 4TNSA 3UF8A 3KACA 4DROA 4G50A 4DWSA 5JH8A 2K8IA 4W9QA 1QPFA 2DSWA 1TFVA 1NWRA 3NTPA 5BXJA 2M1IA 1JCHB 3WQWA 4KQZA 1D6OA 1QPLA 1UR8A 4DWSC 4QT2A 3O5IA 2PPPA 1W1VA 2DSZA 3OOBA 2F2DA 2ITKA 1FKKA 3WD3A 4DT4A 2WLYA 1D7JA 2DT2A 1IX5A 4L3NA 4DRQA 3RGCA 2FAPA 4TYOA 5HTGA 5HT1A 1WNOA 4UDMA 3PRAA 2B5UB 3PA7A 2MF9A 4ITZA 3KAFA 3WD2A 1OGGA 3CH9A 4JFJA 3IK8A
chains in the Genus database with same CATH topology
3ARZA 2VCDA 4Z2GA 1FAPA 2A3BA 5HW8A 2XP7A 1JNDA 2PV2A 3AS2A 3UQBA 1F40A 1FKRA 4DRKA 2DG3A 1SYTA 1M5YA 1KFWA 4QZVB 3UI4A 1X6LA 4ML4A 4LGXA 3AS0A 2G41A 1EQ3A 4DZ3A 4GIVA 1D2KA 2ZQSA 2FDMA 1JNSA 1A7XA 3B9EA 3O5EA 4IQCA 4TW7A 3TDBA 1EHNA 1HKJA 2D9FA 2ESCA 4HARA 1FKIA 2LKNA 3WH0A 4P8VA 1HJWA 1W26A 3ARYA 1SR0A 4P8WA 2RSEA 3LUOA 4JYSA 3BXWA 1FKFA 5GPRA 2B31A 3B7XA 4LAYA 2DT3A 3ARWA 2YBTA 3FY1A 1H0GA 4O2TA 4DIPA 1KT0A 3PR9A 3O5QA 2MLZA 2ZR4A 3ODKA 1PBKA 4WKHA 4MNKA 3OA5A 2XP4A 1W9PA 5D75A 2RURA 2IUZA 2MLYA 5DEZA 4MSPA 4U84A 1NMWA 2JZVA 3CZ8A 4WIWA 2XP6A 2DSUA 2XPAA 1K9TA 3FAPA 2VN1A 1X6NA 1ITXA 1Q6UA 4GGQA 3JXVA 2LJ4A 1OGBA 2KGJA 5HWBA 3CHEA 1T11A 1NSGA 3UI5A 2DG9A 4ODLA 4WKFA 3KAHA 4PTMA 1WAWA 4G2PA 1XRVA 4NZCA 4ZPTR 1ZBVA 1J4HA 1YW5A 3MDYB 2O92A 3RMEA 4AY1A 3AQUA 1FKSA 3WD0A 4S3JA 4L72B 5DIVA 1ZK6A 1ZCNA 1E6RA 4DWSD 1HJXA 1NMVA 5HBFA 4Q22A 2G8ZA 5DITA 2YBUA 1J4RA 4IPXA 3ARUA 2PV3A 4LAWA 4DRIA 1W1YA 1W1TA 3WIJA 5DIUA 2MPHA 2DT1A 4N19A 1RD6A 1ZU8A 1NH6A 3KCEA 4JFLA 1JVWA 1R9HA 4ODKA 4P8XA 4Z2IA 4DRNA 1VF8A 2KI3A 3TCZA 1ROTA 5HW7A 3PRBA 3G6LA 3WL1A 4DZ2A 4DH0A 2Q5AA 1ROUA 3O5FA 2RUDA 1ZL1A 2A3AA 2UZ5A 4ODMA 3WD1A 2XPBA 1CTNA 2LPVA 4WJXA 1UR9A 1LG2A 1JNTA 3FXYA 4C02B 2OFNA 1N1AA 1L1PA 1Y0OA 5HWCA 1HJVA 1HKKA 4IT4A 4KR0B 5B8IC 1EIBA 4Z2JA 1E15A 4Z2KA 1GPFA 4HBEA 5HUAA 4ZPVR 4W9PA 2KE0A 3B9DA 1ZBKA 4IT6A 4MNLA 5DF0A 4FN2A 3O5DA 3B8SA 3ALGA 3ARSA 1O6IA 1JNEA 3B9AA 3O5RA 3CHDA 3KABA 1W9UA 3UQAA 2WK2A 1FKLA 3GPKA 3ALFA 4FAPA 2XP8A 4DRMA 3CHCA 3WD4A 4TW6A 1GOIA 2L2SA 2KO7A 1EDQA 2XP3A 3ARTA 3KAGA 4TX0A 1J6YA 3CHFA 2LGOA 2WLZA 5J6EA 1EYMA 1ZBCA 4P8UA 2KFWA 1YATA 1FKJA 3NI6A 3WL0A 5I98A 5GPGA 2M08A 1LL6A 3I6CA 3KAIA 1H0IA 3ARXA 4NNRA 2AWGA 1E6NA 2PBCA 1U79A 3H9RB 4Z2LA 4WK9A 4MNMA 4J4OA 2ZQTA 4TW8A 5GQBA 3IHZA 1NWSA 4BF8A 2PPOA 2DT0A 1Q6HA 3AS3A 3QOKA 2AOSA 4ODOA 1GUVA 1FFRA 4QIBA 2A3EA 1FFQA 1FJDA 1C9HA 1FKDA 1F8AB 1KT1A 3O5MA 4DRJA 3PRDA 2DG4A 1D7IA 3O5JA 1W1PA 3CGMA 2IF4A 2Y78A 4URIA 3WQVA 3AS1A 4R0XA 3O5PA 2FKEA 1HXVA 3EY6A 4ZS6A 3RM9A 1LQ0A 1E6PA 3O5GA 2MLXA 2A3CA 4W5UA 5HW6A 4JFMA 4Q7NA 1J4IA 3CGNA 4IQ2A 1HKMA 1WB0A 3ARQA 2ZQUA 4DWSB 4QT3A 3IKDA 3O5LA 4MPKA 2PV1A 3O5KA 1LJYA 2F21A 4ODRA 4ODPA 3KADA 3WKZA 4ZPWR 4R5EA 1B6CA 2PPNA 3KZ7A 2F4EA 3G6MA 3JYMA 4HBOA 3RM4A 3VAWA 4NSBA 4MGVA 4MNJA 1OWQA 3IKGA 1NWTA 4LAXA 2RUCA 1LL7A 1FKHA 1PINA 1HKIA 3AROA 1ZB5A 2OLHA 4XAKA 1E6ZA 4U86A 2ZQVA 3ARPA 2QF8A 4JFKA 5DO2A 1LL4A 1FKBA 1FKTA 1BL4A 2RQSA 4Z2HA 4W9OA 4S3KA 2XP9A 4LAVA 3RFWA 1E9LA 4ODQA 3NRKA 2M2AA 3UI6A 3O5OA 1Q1CA 1FD9A 4MAVA 1ZBWA 1XHGA 3ARVA 3JYJA 1P5QA 3UQIA 4J4NA 1Q6IA 1QZ2A 1BKFA 4JFIA 4WKAA 1W9VA 2KR7A 2N87A 1TCOC 2MNTA 2PI6A 1FKGA 3ARRA 1LG1A 1NWUA 4DRHA 2RUQA 4ODNA 2DSVA 3W4RA 4MTVA 3TC5A 1D7HA 2ZR6A 3RM8A 2O9OA 2XP5A 2ZR5A 4DRPA 5HKGA 4U85A 2DPEA 2WM0A 4TNSA 3UF8A 3KACA 4DROA 4G50A 4DWSA 5JH8A 2K8IA 4W9QA 1QPFA 2DSWA 1TFVA 1NWRA 3NTPA 5BXJA 2M1IA 3WQWA 4KQZA 1D6OA 1QPLA 1UR8A 4DWSC 4QT2A 3O5IA 2PPPA 1W1VA 2DSZA 3OOBA 2F2DA 2ITKA 1FKKA 3WD3A 4DT4A 2WLYA 1D7JA 2DT2A 1IX5A 4L3NA 4DRQA 3RGCA 2FAPA 4TYOA 5HTGA 5HT1A 1WNOA 3PRAA 3PA7A 2MF9A 4ITZA 3KAFA 3WD2A 1OGGA 3CH9A 4JFJA 3IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAT A;  1FKJ A;  3NI6 A;  2VCD A;  1NMV A;  5I98 A;  1PIN A;  5GPG A;  1FAP A;  2M08 A;  5HW8 A;  4U86 A;  2XP7 A;  2ZQV A;  2PV2 A;  3UQB A;  3I6C A;  3KAI A;  4JFK A;  1F40 A;  1FKR A;  1FKB A;  1FKT A;  1BL4 A;  2DG3 A;  2AWG A;  2RQS A;  4NNR A;  1M5Y A;  2PBC A;  1U79 A;  4W9O A;  3H9R B;  3UI4 A;  2XP9 A;  5DIT A;  4LAV A;  4DRK A;  3RFW A;  4J4O A;  2ZQT A;  4TW8 A;  4ODQ A;  1EQ3 A;  3NRK A;  2M2A A;  4GIV A;  3O5O A;  3UI6 A;  4DZ3 A;  1Q1C A;  2ZQS A;  1J4R A;  1FD9 A;  3IHZ A;  4IPX A;  1JNS A;  5DIV A;  4BF8 A;  2PPO A;  1A7X A;  2PV3 A;  3O5E A;  4IQC A;  4LAW A;  4DRI A;  4TW7 A;  1Q6H A;  5DIU A;  1ZCN A;  2MPH A;  4N19 A;  4ODO A;  3TDB A;  3JYJ A;  1P5Q A;  3UQI A;  4J4N A;  1Q6I A;  2D9F A;  1QZ2 A;  1BKF A;  1JVW A;  1R9H A;  3KCE A;  4JFL A;  4ODK A;  4QIB A;  4JFI A;  2KI3 A;  1FKI A;  2LKN A;  3WH0 A;  4DRN A;  1FJD A;  3TCZ A;  1ROT A;  5HW7 A;  1W26 A;  1C9H A;  3PRB A;  1FKD A;  2KR7 A;  1F8A B;  1KT1 A;  2N87 A;  4DZ2 A;  1TCO C;  2MNT A;  3O5M A;  4DH0 A;  2Q5A A;  1ROU A;  3O5F A;  1FKG A;  2RSE A;  2RUD A;  3LUO A;  4JYS A;  4DRJ A;  1FKF A;  2UZ5 A;  4ODM A;  3PRD A;  3B7X A;  2DG4 A;  1D7I A;  3O5J A;  4DRH A;  2XPB A;  3CGM A;  2IF4 A;  2RUQ A;  4LAY A;  4ODN A;  2LPV A;  2Y78 A;  1D7H A;  3TC5 A;  2ZR6 A;  2XP5 A;  2ZR5 A;  4O2T A;  4R0X A;  4DRP A;  5HKG A;  4U85 A;  4DIP A;  1KT0 A;  3O5P A;  3O5Q A;  2FKE A;  1JNT A;  2MLZ A;  4TNS A;  2ZR4 A;  4C02 B;  1HXV A;  3UF8 A;  3KAC A;  2OFN A;  3ODK A;  4DRO A;  3EY6 A;  1N1A A;  1PBK A;  4G50 A;  2K8I A;  4W9Q A;  1L1P A;  1QPF A;  2XP4 A;  1Y0O A;  5D75 A;  2RUR A;  3O5G A;  5HWC A;  2MLX A;  3NTP A;  5BXJ A;  2MLY A;  5B8I C;  5HW6 A;  2M1I A;  4JFM A;  1J4I A;  4MSP A;  1D6O A;  5HUA A;  1QPL A;  3CGN A;  1NMW A;  4U84 A;  2JZV A;  4IQ2 A;  4W9P A;  2KE0 A;  2XP6 A;  2ZQU A;  4QT2 A;  2XPA A;  3O5I A;  4QT3 A;  3IKD A;  3O5L A;  3FAP A;  3O5D A;  2PPP A;  2VN1 A;  3OOB A;  4FN2 A;  2PV1 A;  3O5K A;  1Q6U A;  3O5R A;  2F21 A;  4GGQ A;  3JXV A;  2LJ4 A;  4ODR A;  4ODP A;  2KGJ A;  2F2D A;  5HWB A;  3KAD A;  2ITK A;  1T11 A;  1NSG A;  1FKK A;  2DG9 A;  3KAB A;  3UI5 A;  4ODL A;  4DT4 A;  3UQA A;  3KAH A;  1B6C A;  1D7J A;  1FKL A;  2PPN A;  3KZ7 A;  2F4E A;  3GPK A;  4DRQ A;  4G2P A;  4FAP A;  3RGC A;  2FAP A;  3JYM A;  4TYO A;  1J4H A;  1YW5 A;  2XP8 A;  3MDY B;  4DRM A;  5HTG A;  5HT1 A;  3VAW A;  1FKS A;  4TW6 A;  2L2S A;  2KO7 A;  4MGV A;  2XP3 A;  3IKG A;  3KAG A;  4LAX A;  3PA7 A;  2MF9 A;  4ITZ A;  2RUC A;  3KAF A;  4TX0 A;  1J6Y A;  4JFJ A;  2LGO A;  5J6E A;  1EYM A;  3IK8 A;  1FKH A;  1ZK6 A;  2KFW A; 
#chains in the Genus database with same CATH topology
 3ARZ A;  2VCD A;  4Z2G A;  1FAP A;  2A3B A;  5HW8 A;  2XP7 A;  1JND A;  2PV2 A;  3AS2 A;  3UQB A;  1F40 A;  1FKR A;  4DRK A;  2DG3 A;  1SYT A;  1M5Y A;  1KFW A;  4QZV B;  3UI4 A;  1X6L A;  4ML4 A;  4LGX A;  3AS0 A;  2G41 A;  1EQ3 A;  4DZ3 A;  4GIV A;  1D2K A;  2ZQS A;  2FDM A;  1JNS A;  3GTY X;  1A7X A;  3B9E A;  3O5E A;  4IQC A;  2P4V A;  4TW7 A;  3TDB A;  1EHN A;  1HKJ A;  2D9F A;  2ESC A;  4HAR A;  1FKI A;  2LKN A;  3WH0 A;  4P8V A;  1HJW A;  1W26 A;  3ARY A;  1SR0 A;  4P8W A;  2RSE A;  3LUO A;  4JYS A;  3BXW A;  1FKF A;  5GPR A;  2B31 A;  3B7X A;  4LAY A;  2DT3 A;  3ARW A;  2YBT A;  3FY1 A;  1H0G A;  4O2T A;  4DIP A;  1KT0 A;  3PR9 A;  3O5Q A;  2MLZ A;  2ZR4 A;  3ODK A;  1PBK A;  4WKH A;  4MNK A;  3OA5 A;  2XP4 A;  1W9P A;  5D75 A;  2RUR A;  2IUZ A;  2MLY A;  5DEZ A;  4MSP A;  4U84 A;  1NMW A;  2JZV A;  3CZ8 A;  4WIW A;  2XP6 A;  2DSU A;  2XPA A;  1K9T A;  3FAP A;  2VN1 A;  1X6N A;  1ITX A;  1Q6U A;  4GGQ A;  3JXV A;  2LJ4 A;  1OGB A;  2KGJ A;  5HWB A;  3CHE A;  1T11 A;  1NSG A;  3UI5 A;  2DG9 A;  4ODL A;  4WKF A;  3KAH A;  4PTM A;  1WAW A;  4G2P A;  1XRV A;  4NZC A;  4ZPT R;  1ZBV A;  1J4H A;  1YW5 A;  3MDY B;  2O92 A;  3GU0 A;  3RME A;  4AY1 A;  3AQU A;  1FKS A;  2F23 A;  3WD0 A;  4S3J A;  4L72 B;  5DIV A;  1ZK6 A;  1ZCN A;  1E6R A;  4DWS D;  1HJX A;  1NMV A;  5HBF A;  2PN0 A;  4Q22 A;  2G8Z A;  5DIT A;  2YBU A;  1J4R A;  4IPX A;  3ARU A;  2PV3 A;  4LAW A;  4DRI A;  1W1Y A;  1W1T A;  3WIJ A;  5DIU A;  2MPH A;  2DT1 A;  4N19 A;  1RD6 A;  1ZU8 A;  1NH6 A;  3KCE A;  1E44 A;  1JVW A;  1R9H A;  4JFL A;  4ODK A;  4P8X A;  4DRN A;  1VF8 A;  2KI3 A;  4Z2I A;  3TCZ A;  1ROT A;  5HW7 A;  3PRB A;  3G6L A;  3WL1 A;  4DZ2 A;  4DH0 A;  2Q5A A;  1ROU A;  3O5F A;  2RUD A;  1ZL1 A;  2A3A A;  2UZ5 A;  4ODM A;  3WD1 A;  2XPB A;  1CTN A;  2LPV A;  4WJX A;  1UR9 A;  1LG2 A;  3BMB A;  1JNT A;  3FXY A;  4C02 B;  2OFN A;  1N1A A;  1L1P A;  1Y0O A;  5HWC A;  1HJV A;  1HKK A;  4IT4 A;  4KR0 B;  5B8I C;  1EIB A;  4Z2J A;  1E15 A;  4Z2K A;  1GPF A;  4HBE A;  5HUA A;  4ZPV R;  4W9P A;  2KE0 A;  3B9D A;  1ZBK A;  4IT6 A;  4MNL A;  5DF0 A;  4FN2 A;  3O5D A;  3B8S A;  3ALG A;  3ARS A;  1O6I A;  1JNE A;  3B9A A;  3O5R A;  3CHD A;  3KAB A;  1W9U A;  3UQA A;  2WK2 A;  1FKL A;  3GPK A;  3ALF A;  4FAP A;  2XP8 A;  4DRM A;  3CHC A;  3WD4 A;  4TW6 A;  1GOI A;  2L2S A;  2KO7 A;  1EDQ A;  2XP3 A;  3ART A;  3KAG A;  4TX0 A;  1J6Y A;  3CHF A;  2LGO A;  2WLZ A;  5J6E A;  1EYM A;  1ZBC A;  4P8U A;  2KFW A;  1YAT A;  1FKJ A;  3NI6 A;  3WL0 A;  5I98 A;  5GPG A;  2M08 A;  1LL6 A;  3I6C A;  3KAI A;  1H0I A;  3ARX A;  4NNR A;  2AWG A;  1E6N A;  2PBC A;  1U79 A;  3H9R B;  4Z2L A;  4WK9 A;  4MNM A;  4J4O A;  2ZQT A;  4TW8 A;  5GQB A;  3IHZ A;  1NWS A;  4BF8 A;  2PPO A;  2DT0 A;  1Q6H A;  3AS3 A;  3QOK A;  2ETN A;  2AOS A;  4ODO A;  1GUV A;  1FFR A;  4QIB A;  2A3E A;  1FFQ A;  1FJD A;  1C9H A;  1FKD A;  1F8A B;  1KT1 A;  3O5M A;  4DRJ A;  3PRD A;  2DG4 A;  1D7I A;  3O5J A;  1W1P A;  3CGM A;  2IF4 A;  2EUL A;  2Y78 A;  4URI A;  3WQV A;  3EIP A;  3AS1 A;  4R0X A;  3O5P A;  2FKE A;  1HXV A;  3EY6 A;  4ZS6 A;  3RM9 A;  1GRJ A;  1LQ0 A;  1E6P A;  3O5G A;  2MLX A;  2A3C A;  4W5U A;  5HW6 A;  4JFM A;  4Q7N A;  1J4I A;  3CGN A;  4IQ2 A;  1HKM A;  1WB0 A;  3ARQ A;  2ZQU A;  4DWS B;  4QT3 A;  3IKD A;  3O5L A;  4MPK A;  2PV1 A;  3O5K A;  1LJY A;  2F21 A;  4ODR A;  4ODP A;  3KAD A;  3WKZ A;  4ZPW R;  4R5E A;  1B6C A;  2PPN A;  3KZ7 A;  2F4E A;  3G6M A;  3JYM A;  4HBO A;  3RM4 A;  3VAW A;  4NSB A;  4MGV A;  4MNJ A;  1OWQ A;  3IKG A;  1NWT A;  4LAX A;  2RUC A;  1LL7 A;  1FKH A;  1PIN A;  1HKI A;  3ARO A;  1ZB5 A;  2OLH A;  4XAK A;  1E6Z A;  4U86 A;  2ZQV A;  3ARP A;  2QF8 A;  4JFK A;  5DO2 A;  1LL4 A;  1FKB A;  1FKT A;  1BL4 A;  2RQS A;  4Z2H A;  4W9O A;  4S3K A;  2XP9 A;  4LAV A;  3RFW A;  1E9L A;  4ODQ A;  3NRK A;  2M2A A;  3UI6 A;  3O5O A;  1Q1C A;  1FD9 A;  4MAV A;  1ZBW A;  1XHG A;  3ARV A;  3JYJ A;  1P5Q A;  3UQI A;  4J4N A;  1Q6I A;  1QZ2 A;  1BKF A;  4JFI A;  4WKA A;  1W9V A;  2KR7 A;  2N87 A;  1TCO C;  2MNT A;  2PI6 A;  1FKG A;  3ARR A;  1LG1 A;  1NWU A;  4DRH A;  2RUQ A;  4ODN A;  2DSV A;  3W4R A;  4MTV A;  3TC5 A;  1D7H A;  2ZR6 A;  3RM8 A;  2O9O A;  2XP5 A;  2ZR5 A;  4DRP A;  5HKG A;  4U85 A;  2DPE A;  2WM0 A;  4TNS A;  3UF8 A;  3KAC A;  4DRO A;  4G50 A;  4DWS A;  5JH8 A;  2K8I A;  4W9Q A;  1QPF A;  2DSW A;  1TFV A;  1NWR A;  3NTP A;  5BXJ A;  2M1I A;  1JCH B;  3WQW A;  4KQZ A;  1D6O A;  1QPL A;  1UR8 A;  4DWS C;  4QT2 A;  3O5I A;  2PPP A;  1W1V A;  2DSZ A;  3OOB A;  2F2D A;  2ITK A;  1FKK A;  3WD3 A;  4DT4 A;  2WLY A;  1D7J A;  2DT2 A;  1IX5 A;  4L3N A;  4DRQ A;  3RGC A;  2FAP A;  4TYO A;  5HTG A;  5HT1 A;  1WNO A;  4UDM A;  3PRA A;  2B5U B;  3PA7 A;  2MF9 A;  4ITZ A;  3KAF A;  3WD2 A;  1OGG A;  3CH9 A;  4JFJ A;  3IK8 A; 
#chains in the Genus database with same CATH homology
 3ARZ A;  2VCD A;  4Z2G A;  1FAP A;  2A3B A;  5HW8 A;  2XP7 A;  1JND A;  2PV2 A;  3AS2 A;  3UQB A;  1F40 A;  1FKR A;  4DRK A;  2DG3 A;  1SYT A;  1M5Y A;  1KFW A;  4QZV B;  3UI4 A;  1X6L A;  4ML4 A;  4LGX A;  3AS0 A;  2G41 A;  1EQ3 A;  4DZ3 A;  4GIV A;  1D2K A;  2ZQS A;  2FDM A;  1JNS A;  1A7X A;  3B9E A;  3O5E A;  4IQC A;  4TW7 A;  3TDB A;  1EHN A;  1HKJ A;  2D9F A;  2ESC A;  4HAR A;  1FKI A;  2LKN A;  3WH0 A;  4P8V A;  1HJW A;  1W26 A;  3ARY A;  1SR0 A;  4P8W A;  2RSE A;  3LUO A;  4JYS A;  3BXW A;  1FKF A;  5GPR A;  2B31 A;  3B7X A;  4LAY A;  2DT3 A;  3ARW A;  2YBT A;  3FY1 A;  1H0G A;  4O2T A;  4DIP A;  1KT0 A;  3PR9 A;  3O5Q A;  2MLZ A;  2ZR4 A;  3ODK A;  1PBK A;  4WKH A;  4MNK A;  3OA5 A;  2XP4 A;  1W9P A;  5D75 A;  2RUR A;  2IUZ A;  2MLY A;  5DEZ A;  4MSP A;  4U84 A;  1NMW A;  2JZV A;  3CZ8 A;  4WIW A;  2XP6 A;  2DSU A;  2XPA A;  1K9T A;  3FAP A;  2VN1 A;  1X6N A;  1ITX A;  1Q6U A;  4GGQ A;  3JXV A;  2LJ4 A;  1OGB A;  2KGJ A;  5HWB A;  3CHE A;  1T11 A;  1NSG A;  3UI5 A;  2DG9 A;  4ODL A;  4WKF A;  3KAH A;  4PTM A;  1WAW A;  4G2P A;  1XRV A;  4NZC A;  4ZPT R;  1ZBV A;  1J4H A;  1YW5 A;  3MDY B;  2O92 A;  3RME A;  4AY1 A;  3AQU A;  1FKS A;  3WD0 A;  4S3J A;  4L72 B;  5DIV A;  1ZK6 A;  1ZCN A;  1E6R A;  4DWS D;  1HJX A;  1NMV A;  5HBF A;  4Q22 A;  2G8Z A;  5DIT A;  2YBU A;  1J4R A;  4IPX A;  3ARU A;  2PV3 A;  4LAW A;  4DRI A;  1W1Y A;  1W1T A;  3WIJ A;  5DIU A;  2MPH A;  2DT1 A;  4N19 A;  1RD6 A;  1ZU8 A;  1NH6 A;  3KCE A;  4JFL A;  1JVW A;  1R9H A;  4ODK A;  4P8X A;  4Z2I A;  4DRN A;  1VF8 A;  2KI3 A;  3TCZ A;  1ROT A;  5HW7 A;  3PRB A;  3G6L A;  3WL1 A;  4DZ2 A;  4DH0 A;  2Q5A A;  1ROU A;  3O5F A;  2RUD A;  1ZL1 A;  2A3A A;  2UZ5 A;  4ODM A;  3WD1 A;  2XPB A;  1CTN A;  2LPV A;  4WJX A;  1UR9 A;  1LG2 A;  1JNT A;  3FXY A;  4C02 B;  2OFN A;  1N1A A;  1L1P A;  1Y0O A;  5HWC A;  1HJV A;  1HKK A;  4IT4 A;  4KR0 B;  5B8I C;  1EIB A;  4Z2J A;  1E15 A;  4Z2K A;  1GPF A;  4HBE A;  5HUA A;  4ZPV R;  4W9P A;  2KE0 A;  3B9D A;  1ZBK A;  4IT6 A;  4MNL A;  5DF0 A;  4FN2 A;  3O5D A;  3B8S A;  3ALG A;  3ARS A;  1O6I A;  1JNE A;  3B9A A;  3O5R A;  3CHD A;  3KAB A;  1W9U A;  3UQA A;  2WK2 A;  1FKL A;  3GPK A;  3ALF A;  4FAP A;  2XP8 A;  4DRM A;  3CHC A;  3WD4 A;  4TW6 A;  1GOI A;  2L2S A;  2KO7 A;  1EDQ A;  2XP3 A;  3ART A;  3KAG A;  4TX0 A;  1J6Y A;  3CHF A;  2LGO A;  2WLZ A;  5J6E A;  1EYM A;  1ZBC A;  4P8U A;  2KFW A;  1YAT A;  1FKJ A;  3NI6 A;  3WL0 A;  5I98 A;  5GPG A;  2M08 A;  1LL6 A;  3I6C A;  3KAI A;  1H0I A;  3ARX A;  4NNR A;  2AWG A;  1E6N A;  2PBC A;  1U79 A;  3H9R B;  4Z2L A;  4WK9 A;  4MNM A;  4J4O A;  2ZQT A;  4TW8 A;  5GQB A;  3IHZ A;  1NWS A;  4BF8 A;  2PPO A;  2DT0 A;  1Q6H A;  3AS3 A;  3QOK A;  2AOS A;  4ODO A;  1GUV A;  1FFR A;  4QIB A;  2A3E A;  1FFQ A;  1FJD A;  1C9H A;  1FKD A;  1F8A B;  1KT1 A;  3O5M A;  4DRJ A;  3PRD A;  2DG4 A;  1D7I A;  3O5J A;  1W1P A;  3CGM A;  2IF4 A;  2Y78 A;  4URI A;  3WQV A;  3AS1 A;  4R0X A;  3O5P A;  2FKE A;  1HXV A;  3EY6 A;  4ZS6 A;  3RM9 A;  1LQ0 A;  1E6P A;  3O5G A;  2MLX A;  2A3C A;  4W5U A;  5HW6 A;  4JFM A;  4Q7N A;  1J4I A;  3CGN A;  4IQ2 A;  1HKM A;  1WB0 A;  3ARQ A;  2ZQU A;  4DWS B;  4QT3 A;  3IKD A;  3O5L A;  4MPK A;  2PV1 A;  3O5K A;  1LJY A;  2F21 A;  4ODR A;  4ODP A;  3KAD A;  3WKZ A;  4ZPW R;  4R5E A;  1B6C A;  2PPN A;  3KZ7 A;  2F4E A;  3G6M A;  3JYM A;  4HBO A;  3RM4 A;  3VAW A;  4NSB A;  4MGV A;  4MNJ A;  1OWQ A;  3IKG A;  1NWT A;  4LAX A;  2RUC A;  1LL7 A;  1FKH A;  1PIN A;  1HKI A;  3ARO A;  1ZB5 A;  2OLH A;  4XAK A;  1E6Z A;  4U86 A;  2ZQV A;  3ARP A;  2QF8 A;  4JFK A;  5DO2 A;  1LL4 A;  1FKB A;  1FKT A;  1BL4 A;  2RQS A;  4Z2H A;  4W9O A;  4S3K A;  2XP9 A;  4LAV A;  3RFW A;  1E9L A;  4ODQ A;  3NRK A;  2M2A A;  3UI6 A;  3O5O A;  1Q1C A;  1FD9 A;  4MAV A;  1ZBW A;  1XHG A;  3ARV A;  3JYJ A;  1P5Q A;  3UQI A;  4J4N A;  1Q6I A;  1QZ2 A;  1BKF A;  4JFI A;  4WKA A;  1W9V A;  2KR7 A;  2N87 A;  1TCO C;  2MNT A;  2PI6 A;  1FKG A;  3ARR A;  1LG1 A;  1NWU A;  4DRH A;  2RUQ A;  4ODN A;  2DSV A;  3W4R A;  4MTV A;  3TC5 A;  1D7H A;  2ZR6 A;  3RM8 A;  2O9O A;  2XP5 A;  2ZR5 A;  4DRP A;  5HKG A;  4U85 A;  2DPE A;  2WM0 A;  4TNS A;  3UF8 A;  3KAC A;  4DRO A;  4G50 A;  4DWS A;  5JH8 A;  2K8I A;  4W9Q A;  1QPF A;  2DSW A;  1TFV A;  1NWR A;  3NTP A;  5BXJ A;  2M1I A;  3WQW A;  4KQZ A;  1D6O A;  1QPL A;  1UR8 A;  4DWS C;  4QT2 A;  3O5I A;  2PPP A;  1W1V A;  2DSZ A;  3OOB A;  2F2D A;  2ITK A;  1FKK A;  3WD3 A;  4DT4 A;  2WLY A;  1D7J A;  2DT2 A;  1IX5 A;  4L3N A;  4DRQ A;  3RGC A;  2FAP A;  4TYO A;  5HTG A;  5HT1 A;  1WNO A;  3PRA A;  3PA7 A;  2MF9 A;  4ITZ A;  3KAF A;  3WD2 A;  1OGG A;  3CH9 A;  4JFJ A;  3IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...