4LAXA

Crystal structure analysis of fkbp52, complex with fk506
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
237
structure length
237
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 56
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA02
1PBKA 3O5QA 4IQ2A 4TX0A 3O5RA 4DH0A 2VCDA 2MNTA 2PPNA 3O5GA 3IKGA 2K8IA 1FJDA 2ITKA 2Q5AA 1J6YA 5J6EA 1BKFA 4QT2A 2MLZA 4DRJA 4DRPA 1FKGA 2KI3A 4BF8A 1Q6IA 4U85A 2PPOA 2UZ5A 3NI6A 2PV3A 1W26A 3KADA 1FAPA 1FKKA 5HKGA 5HW7A 3UQAA 3KAFA 3KABA 4DRMA 1FKJA 4JFMA 3UQIA 1JNSA 3O5LA 3RFWA 4LAYA 1FKSA 3H9RB 3IKDA 2FKEA 3GPKA 2PV1A 1YW5A 2MPHA 1R9HA 1J4IA 1JVWA 1T11A 1Y0OA 4FN2A 1HXVA 4ODLA 2ZQSA 4LAWA 1ROUA 1Q6UA 4ODNA 5B8IC 2XP3A 3JYMA 2PV2A 2XPAA 2M2AA 2FAPA 4W9PA 5BXJA 3KAHA 1FKDA 3NTPA 1L1PA 3MDYB 2N87A 2ZR6A 3PA7A 1ZCNA 3JYJA 3O5IA 1BL4A 3O5MA 2L2SA 2MLYA 3JXVA 4MGVA 4GIVA 4DRQA 3OOBA 1NSGA 4ODRA 4DRKA 5HTGA 1J4HA 4O2TA 4ODPA 2LGOA 4W9QA 5I98A 2RUDA 2RSEA 5DITA 2KR7A 3FAPA 1FKFA 2OFNA 4J4NA 3UI6A 4ODQA 2ZR4A 1D7IA 3O5PA 4U84A 1FKIA 5GPGA 1FKRA 1JNTA 2ZQTA 1M5YA 2LKNA 1P5QA 1FKTA 2D9FA 3IHZA 4DZ2A 3UQBA 2MLXA 4ODMA 2JZVA 4LAXA 3O5EA 4TYOA 3TC5A 4ODOA 4DT4A 1FKHA 2KE0A 4IPXA 4JFIA 4LAVA 3VAWA 2XPBA 4ODKA 3TDBA 3WH0A 1J4RA 1Q1CA 4JFJA 2XP4A 2M1IA 2XP8A 2RUCA 2XP9A 4NNRA 2PBCA 1D7HA 2XP7A 2Y78A 2DG3A 3KAGA 3KCEA 3PRBA 4G50A 4R0XA 5HWBA 1FKBA 2F21A 3O5JA 5HW8A 4DZ3A 1F40A 1U79A 1D6OA 1FKLA 1PINA 2RQSA 3KZ7A 3LUOA 3ODKA 3PRDA 4TW7A 1KT1A 2PPPA 4W9OA 1NMWA 4J4OA 3O5DA 3UI4A 2ZQVA 2KGJA 3RGCA 1KT0A 2MF9A 3EY6A 1D7JA 1FD9A 2LJ4A 4TNSA 1C9HA 1QZ2A 3CGMA 2VN1A 2M08A 3B7XA 3TCZA 5HW6A 1QPLA 1TCOC 1A7XA 4U86A 5D75A 1QPFA 2KO7A 2LPVA 2RUQA 3KACA 4DROA 1NMVA 1ROTA 4ITZA 4TW8A 5DIVA 4DRHA 4FAPA 1YATA 3O5OA 2DG4A 2F4EA 1F8AB 4QT3A 2ZQUA 5HT1A 2IF4A 2AWGA 2XP6A 1EQ3A 2KFWA 1EYMA 3O5FA 4JFKA 4N19A 1N1AA 4TW6A 2XP5A 4DRIA 4GGQA 2RURA 2F2DA 3O5KA 5HWCA 3IK8A 4G2PA 2DG9A 4JFLA 4MSPA 3UI5A 1B6CA 5HUAA 5DIUA 4C02B 3NRKA 1ZK6A 3UF8A 4JYSA 3I6CA 4DRNA 4DIPA 4IQCA 3KAIA 4QIBA 3CGNA 2ZR5A 1Q6HA
chains in the Genus database with same CATH superfamily
4TX0A 1W1TA 4KQZA 1LG1A 3PRAA 4MNJA 1JNDA 2DSVA 1FKGA 1Q6IA 4U85A 3AS1A 3BXWA 1W26A 5HKGA 1GPFA 1E44A 2DT0A 3O5LA 3RM8A 4R5EA 2ZQSA 1SR0A 1Q6UA 5JH8A 2F23A 4ODNA 5B8IC 4WJXA 2XP3A 3JYMA 2PV2A 5BXJA 1FKDA 3MDYB 4QZVB 1HJVA 4Z2KA 1ITXA 4MAVA 2A3CA 3O5MA 2L2SA 4MGVA 4GIVA 1EDQA 3OOBA 4DRKA 4ODPA 2WM0A 2RUDA 4J4NA 4ODQA 1D7IA 4Z2LA 1FKRA 3B9EA 4ZPWR 2G41A 4S3KA 3UQBA 1TFVA 1ZBVA 1FKHA 2KE0A 4IPXA 1ZBWA 4JFIA 3VAWA 2DT2A 3TDBA 3CHCA 3WD0A 1W1VA 2G8ZA 2RUCA 3WD2A 2PBCA 4URIA 4R0XA 1FKBA 1UR9A 2DT1A 1U79A 1D6OA 3ODKA 1JNSA 1KT1A 4W9OA 5HBFA 4J4OA 3O5DA 3UI4A 1KT0A 2MF9A 3WL0A 3WD1A 1H0IA 4NSBA 2VN1A 2M08A 1TCOC 1XRVA 2KO7A 1NMVA 4TW8A 4KR0B 4ZPTR 4WKFA 4DRHA 1NH6A 2DG4A 1F8AB 3CHDA 2AWGA 4N19A 4HBOA 3O5KA 4AY1A 3IK8A 2WK2A 2DG9A 4C02B 1ZB5A 4DRNA 4Z2HA 4QIBA 3ARTA 3ARWA 4XAKA 1FFQA 2PPNA 1KFWA 1OGBA 3B9AA 3GU0A 2ITKA 1E9LA 2Q5AA 1J6YA 1BKFA 4HARA 3WKZA 4DRJA 4BF8A 2A3EA 2PPOA 1GUVA 2UZ5A 1FAPA 3KAFA 1FKJA 3UQIA 4WIWA 3WQVA 4LAYA 5GQBA 1LL4A 2FKEA 4LGXA 1YW5A 2MPHA 3ARPA 2O9OA 1Y0OA 1HXVA 4P8VA 3QOKA 3PR9A 3KAHA 3NTPA 2ZR6A 4MNMA 1BL4A 4ML4A 3WQWA 4O2TA 5I98A 2OLHA 2RSEA 1GRJA 2DSWA 3UI6A 1HJWA 1JNTA 2ZQTA 1P5QA 1E6RA 2D9FA 1WB0A 2PN0A 2MLXA 2JZVA 4ODOA 1EHNA 1D2KA 4IT6A 1J4RA 1LJYA 4JFJA 1ZL1A 1CTNA 1D7HA 3KCEA 3PRBA 4G50A 1XHGA 1JCHB 2DSZA 2FDMA 3FXYA 1OGGA 4WKHA 3WD3A 1F40A 1LL6A 2RQSA 2PPPA 2DPEA 1UR8A 2KGJA 4DWSD 2LJ4A 4TNSA 2YBTA 4ZS6A 1QZ2A 3B7XA 1QPLA 1A7XA 4U86A 1QPFA 3EIPA 3O5OA 2F4EA 4QT3A 5HT1A 3W4RA 1EQ3A 2KFWA 1E15A 1WNOA 2WLYA 4Q7NA 5HWCA 2XP5A 4G2PA 5DIUA 1FFRA 4WKAA 3KAIA 4JFKA 3G6MA 2OFNA 1PBKA 3BMBA 3WD4A 3O5RA 4DH0A 4P8WA 2VCDA 3O5GA 3IKGA 2K8IA 3WIJA 1FJDA 3B8SA 1ZBCA 1IX5A 4L3NA 1HKIA 2MLZA 1W1PA 3ARZA 3NI6A 2PV3A 1LQ0A 3KADA 1FKKA 4W5UA 3KABA 4P8XA 3AS3A 3ARQA 2A3AA 2YBUA 1FKSA 2DSUA 3IKDA 1NWTA 2PV1A 4S3JA 1R9HA 1J4IA 4FN2A 4ODLA 5DEZA 2XPAA 1ZU8A 3CHFA 2FAPA 2B5UB 1L1PA 1ZCNA 3JYJA 4UDMA 3O5IA 3ARRA 1LL7A 1NSGA 2B31A 5HTGA 4W9QA 2LGOA 1HKKA 2ZR4A 3O5PA 1M5YA 3G6LA 1FKTA 3IHZA 4DZ2A 1E6PA 1JNEA 4LAXA 3O5EA 3TC5A 3AROA 1OWQA 4LAVA 2XPBA 4ODKA 4Z2JA 2XP8A 2XP9A 2Y78A 4MTVA 2DG3A 5DO2A 5HWBA 2PI6A 3AS2A 4L72B 5HW8A 3ALGA 4DZ3A 3KZ7A 4TW7A 5DF0A 3ARVA 2ZQVA 1EIBA 4PTMA 1E6NA 1FD9A 4MNLA 1C9HA 3CGMA 5HW6A 5D75A 3KACA 4DROA 4MNKA 5DIVA 1K9TA 1NWUA 4FAPA 1HKMA 2ZQUA 2IF4A 1LG2A 2XP6A 1EYMA 3O5FA 3CZ8A 4P8UA 4TW6A 4DRIA 3ARUA 4GGQA 3RMEA 2EULA 3ARYA 4JFLA 4MSPA 3UI5A 3UF8A 3OA5A 4JYSA 3RM4A 2P4VA 4ZPVR 3CGNA 2ZR5A 3O5QA 4IQ2A 1E6ZA 2MNTA 1HKJA 3WL1A 5J6EA 4QT2A 3AQUA 4DRPA 2KI3A 5HW7A 1GOIA 1HJXA 4DWSC 3RM9A 3UQAA 4DRMA 4JFMA 3CHEA 3RFWA 1W9UA 3H9RB 3GPKA 1W1YA 1JVWA 1T11A 4LAWA 1ROUA 4DWSB 2M2AA 1SYTA 4W9PA 1WAWA 2N87A 3PA7A 4HBEA 2MLYA 3JXVA 4DRQA 4ODRA 4Q22A 2ETNA 3AS0A 1J4HA 5DITA 2KR7A 3FAPA 1FKFA 4U84A 1FKIA 5GPGA 2DT3A 4Z2GA 5GPRA 2IUZA 2LKNA 1NWRA 3B9DA 4ODMA 4TYOA 4DT4A 4NZCA 1H0GA 4MPKA 3WH0A 1Q1CA 2XP4A 2M1IA 4NNRA 4Z2IA 2XP7A 3KAGA 1NWSA 4DWSA 1RD6A 3GTYX 2O92A 2F21A 2QF8A 3O5JA 1X6NA 4IT4A 1FKLA 1PINA 3LUOA 2A3BA 3PRDA 1ZBKA 1X6LA 1NMWA 3RGCA 3EY6A 1D7JA 1VF8A 3CH9A 3TCZA 2WLZA 2LPVA 2RUQA 1ROTA 4ITZA 1W9VA 4WK9A 1YATA 2ESCA 3FY1A 3ARSA 1O6IA 1W9PA 1N1AA 3ALFA 2RURA 2F2DA 1B6CA 5HUAA 3NRKA 1ZK6A 3ARXA 2AOSA 3I6CA 4DIPA 4IQCA 1Q6HA
chains in the Genus database with same CATH topology
4TX0A 1W1TA 4KQZA 1LG1A 3PRAA 4MNJA 1JNDA 2DSVA 1FKGA 1Q6IA 4U85A 3AS1A 3BXWA 1W26A 5HKGA 1GPFA 2DT0A 3O5LA 3RM8A 4R5EA 2ZQSA 1SR0A 1Q6UA 5JH8A 4ODNA 5B8IC 4WJXA 2XP3A 3JYMA 2PV2A 5BXJA 1FKDA 3MDYB 4QZVB 1HJVA 4Z2KA 1ITXA 4MAVA 2A3CA 3O5MA 2L2SA 4MGVA 4GIVA 1EDQA 3OOBA 4DRKA 4ODPA 2WM0A 2RUDA 4J4NA 4ODQA 1D7IA 4Z2LA 1FKRA 3B9EA 4ZPWR 2G41A 4S3KA 3UQBA 1TFVA 1ZBVA 1FKHA 2KE0A 4IPXA 1ZBWA 4JFIA 3VAWA 2DT2A 3TDBA 3CHCA 3WD0A 1W1VA 2G8ZA 2RUCA 3WD2A 2PBCA 4URIA 4R0XA 1FKBA 1UR9A 2DT1A 1U79A 1D6OA 3ODKA 1JNSA 1KT1A 4W9OA 5HBFA 4J4OA 3O5DA 3UI4A 1KT0A 2MF9A 3WL0A 3WD1A 1H0IA 4NSBA 2VN1A 2M08A 1TCOC 1XRVA 2KO7A 1NMVA 4TW8A 4KR0B 4ZPTR 4WKFA 4DRHA 1NH6A 2DG4A 1F8AB 3CHDA 2AWGA 4N19A 4HBOA 3O5KA 4AY1A 3IK8A 2WK2A 2DG9A 4C02B 1ZB5A 4DRNA 4Z2HA 4QIBA 3ARTA 3ARWA 4XAKA 1FFQA 2PPNA 1KFWA 1OGBA 3B9AA 2ITKA 1E9LA 2Q5AA 1J6YA 1BKFA 4HARA 3WKZA 4DRJA 4BF8A 2A3EA 2PPOA 1GUVA 2UZ5A 1FAPA 3KAFA 1FKJA 3UQIA 4WIWA 3WQVA 4LAYA 5GQBA 1LL4A 2FKEA 4LGXA 1YW5A 2MPHA 3ARPA 2O9OA 1Y0OA 1HXVA 4P8VA 3QOKA 3PR9A 3KAHA 3NTPA 2ZR6A 4MNMA 1BL4A 4ML4A 3WQWA 4O2TA 5I98A 2OLHA 2RSEA 2DSWA 3UI6A 1HJWA 1JNTA 2ZQTA 1P5QA 1E6RA 2D9FA 1WB0A 2MLXA 2JZVA 4ODOA 1EHNA 1D2KA 4IT6A 1J4RA 1LJYA 4JFJA 1ZL1A 1CTNA 1D7HA 3KCEA 3PRBA 4G50A 1XHGA 2DSZA 2FDMA 3FXYA 1OGGA 4WKHA 3WD3A 1F40A 1LL6A 2RQSA 2PPPA 2DPEA 1UR8A 2KGJA 4DWSD 2LJ4A 4TNSA 2YBTA 4ZS6A 1QZ2A 3B7XA 1QPLA 1A7XA 4U86A 1QPFA 3O5OA 2F4EA 4QT3A 5HT1A 3W4RA 1EQ3A 2KFWA 1E15A 1WNOA 2WLYA 4Q7NA 5HWCA 2XP5A 4G2PA 5DIUA 1FFRA 4WKAA 3KAIA 4JFKA 3G6MA 2OFNA 1PBKA 3WD4A 3O5RA 4DH0A 4P8WA 2VCDA 3O5GA 3IKGA 2K8IA 3WIJA 1FJDA 3B8SA 1ZBCA 1IX5A 4L3NA 1HKIA 2MLZA 1W1PA 3ARZA 3NI6A 2PV3A 1LQ0A 3KADA 1FKKA 4W5UA 3KABA 4P8XA 3AS3A 3ARQA 2A3AA 2YBUA 1FKSA 2DSUA 3IKDA 1NWTA 2PV1A 4S3JA 1R9HA 1J4IA 4FN2A 4ODLA 5DEZA 2XPAA 1ZU8A 3CHFA 2FAPA 1L1PA 1ZCNA 3JYJA 3O5IA 3ARRA 1LL7A 1NSGA 2B31A 5HTGA 4W9QA 2LGOA 1HKKA 2ZR4A 3O5PA 1M5YA 3G6LA 1FKTA 3IHZA 4DZ2A 1E6PA 1JNEA 4LAXA 3O5EA 3TC5A 3AROA 1OWQA 4LAVA 2XPBA 4ODKA 4Z2JA 2XP8A 2XP9A 2Y78A 4MTVA 2DG3A 5DO2A 5HWBA 2PI6A 3AS2A 4L72B 5HW8A 3ALGA 4DZ3A 3KZ7A 4TW7A 5DF0A 3ARVA 2ZQVA 1EIBA 4PTMA 1E6NA 1FD9A 4MNLA 1C9HA 3CGMA 5HW6A 5D75A 3KACA 4DROA 4MNKA 5DIVA 1K9TA 1NWUA 4FAPA 1HKMA 2ZQUA 2IF4A 1LG2A 2XP6A 1EYMA 3O5FA 3CZ8A 4P8UA 4TW6A 4DRIA 3ARUA 4GGQA 3RMEA 3ARYA 4JFLA 4MSPA 3UI5A 3UF8A 3OA5A 4JYSA 3RM4A 4ZPVR 3CGNA 2ZR5A 3O5QA 4IQ2A 1E6ZA 2MNTA 1HKJA 3WL1A 5J6EA 4QT2A 3AQUA 4DRPA 2KI3A 5HW7A 1GOIA 1HJXA 4DWSC 3RM9A 3UQAA 4DRMA 4JFMA 3CHEA 3RFWA 1W9UA 3H9RB 3GPKA 1W1YA 1JVWA 1T11A 4LAWA 1ROUA 4DWSB 2M2AA 1SYTA 4W9PA 1WAWA 2N87A 3PA7A 4HBEA 2MLYA 3JXVA 4DRQA 4ODRA 4Q22A 3AS0A 1J4HA 5DITA 2KR7A 3FAPA 1FKFA 4U84A 1FKIA 5GPGA 2DT3A 4Z2GA 5GPRA 2IUZA 2LKNA 1NWRA 3B9DA 4ODMA 4TYOA 4DT4A 4NZCA 1H0GA 4MPKA 3WH0A 1Q1CA 2XP4A 2M1IA 4NNRA 4Z2IA 2XP7A 3KAGA 1NWSA 4DWSA 1RD6A 2O92A 2F21A 2QF8A 3O5JA 1X6NA 4IT4A 1FKLA 1PINA 3LUOA 2A3BA 3PRDA 1ZBKA 1X6LA 1NMWA 3RGCA 3EY6A 1D7JA 1VF8A 3CH9A 3TCZA 2WLZA 2LPVA 2RUQA 1ROTA 4ITZA 1W9VA 4WK9A 1YATA 2ESCA 3FY1A 3ARSA 1O6IA 1W9PA 1N1AA 3ALFA 2RURA 2F2DA 1B6CA 5HUAA 3NRKA 1ZK6A 3ARXA 2AOSA 3I6CA 4DIPA 4IQCA 1Q6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBK A;  3O5Q A;  4IQ2 A;  4TX0 A;  3O5R A;  4DH0 A;  2VCD A;  2MNT A;  2PPN A;  3O5G A;  3IKG A;  2K8I A;  1FJD A;  2ITK A;  2Q5A A;  1J6Y A;  5J6E A;  1BKF A;  4QT2 A;  2MLZ A;  4DRJ A;  4DRP A;  1FKG A;  2KI3 A;  4BF8 A;  1Q6I A;  4U85 A;  2PPO A;  2UZ5 A;  3NI6 A;  2PV3 A;  1W26 A;  3KAD A;  1FAP A;  1FKK A;  5HKG A;  5HW7 A;  3UQA A;  3KAF A;  3KAB A;  4DRM A;  1FKJ A;  4JFM A;  3UQI A;  1JNS A;  3O5L A;  3RFW A;  4LAY A;  1FKS A;  3H9R B;  3IKD A;  2FKE A;  3GPK A;  2PV1 A;  1YW5 A;  2MPH A;  1R9H A;  1J4I A;  1JVW A;  1T11 A;  1Y0O A;  4FN2 A;  1HXV A;  4ODL A;  2ZQS A;  4LAW A;  1ROU A;  1Q6U A;  4ODN A;  5B8I C;  2XP3 A;  3JYM A;  2PV2 A;  2XPA A;  2M2A A;  2FAP A;  4W9P A;  5BXJ A;  3KAH A;  1FKD A;  3NTP A;  1L1P A;  3MDY B;  2N87 A;  2ZR6 A;  3PA7 A;  1ZCN A;  3JYJ A;  3O5I A;  1BL4 A;  3O5M A;  2L2S A;  2MLY A;  3JXV A;  4MGV A;  4GIV A;  4DRQ A;  3OOB A;  1NSG A;  4ODR A;  4DRK A;  5HTG A;  1J4H A;  4O2T A;  4ODP A;  2LGO A;  4W9Q A;  5I98 A;  2RUD A;  2RSE A;  5DIT A;  2KR7 A;  3FAP A;  1FKF A;  2OFN A;  4J4N A;  3UI6 A;  4ODQ A;  2ZR4 A;  1D7I A;  3O5P A;  4U84 A;  1FKI A;  5GPG A;  1FKR A;  1JNT A;  2ZQT A;  1M5Y A;  2LKN A;  1P5Q A;  1FKT A;  2D9F A;  3IHZ A;  4DZ2 A;  3UQB A;  2MLX A;  4ODM A;  2JZV A;  4LAX A;  3O5E A;  4TYO A;  3TC5 A;  4ODO A;  4DT4 A;  1FKH A;  2KE0 A;  4IPX A;  4JFI A;  4LAV A;  3VAW A;  2XPB A;  4ODK A;  3TDB A;  3WH0 A;  1J4R A;  1Q1C A;  4JFJ A;  2XP4 A;  2M1I A;  2XP8 A;  2RUC A;  2XP9 A;  4NNR A;  2PBC A;  1D7H A;  2XP7 A;  2Y78 A;  2DG3 A;  3KAG A;  3KCE A;  3PRB A;  4G50 A;  4R0X A;  5HWB A;  1FKB A;  2F21 A;  3O5J A;  5HW8 A;  4DZ3 A;  1F40 A;  1U79 A;  1D6O A;  1FKL A;  1PIN A;  2RQS A;  3KZ7 A;  3LUO A;  3ODK A;  3PRD A;  4TW7 A;  1KT1 A;  2PPP A;  4W9O A;  1NMW A;  4J4O A;  3O5D A;  3UI4 A;  2ZQV A;  2KGJ A;  3RGC A;  1KT0 A;  2MF9 A;  3EY6 A;  1D7J A;  1FD9 A;  2LJ4 A;  4TNS A;  1C9H A;  1QZ2 A;  3CGM A;  2VN1 A;  2M08 A;  3B7X A;  3TCZ A;  5HW6 A;  1QPL A;  1TCO C;  1A7X A;  4U86 A;  5D75 A;  1QPF A;  2KO7 A;  2LPV A;  2RUQ A;  3KAC A;  4DRO A;  1NMV A;  1ROT A;  4ITZ A;  4TW8 A;  5DIV A;  4DRH A;  4FAP A;  1YAT A;  3O5O A;  2DG4 A;  2F4E A;  1F8A B;  4QT3 A;  2ZQU A;  5HT1 A;  2IF4 A;  2AWG A;  2XP6 A;  1EQ3 A;  2KFW A;  1EYM A;  3O5F A;  4JFK A;  4N19 A;  1N1A A;  4TW6 A;  2XP5 A;  4DRI A;  4GGQ A;  2RUR A;  2F2D A;  3O5K A;  5HWC A;  3IK8 A;  4G2P A;  2DG9 A;  4JFL A;  4MSP A;  3UI5 A;  1B6C A;  5HUA A;  5DIU A;  4C02 B;  3NRK A;  1ZK6 A;  3UF8 A;  4JYS A;  3I6C A;  4DRN A;  4DIP A;  4IQC A;  3KAI A;  4QIB A;  3CGN A;  2ZR5 A;  1Q6H A; 
#chains in the Genus database with same CATH topology
 4TX0 A;  1W1T A;  4KQZ A;  1LG1 A;  3PRA A;  4MNJ A;  1JND A;  2DSV A;  1FKG A;  1Q6I A;  4U85 A;  3AS1 A;  3BXW A;  1W26 A;  5HKG A;  1GPF A;  1E44 A;  2DT0 A;  3O5L A;  3RM8 A;  4R5E A;  2ZQS A;  1SR0 A;  1Q6U A;  5JH8 A;  2F23 A;  4ODN A;  5B8I C;  4WJX A;  2XP3 A;  3JYM A;  2PV2 A;  5BXJ A;  1FKD A;  3MDY B;  4QZV B;  1HJV A;  4Z2K A;  1ITX A;  4MAV A;  2A3C A;  3O5M A;  2L2S A;  4MGV A;  4GIV A;  1EDQ A;  3OOB A;  4DRK A;  4ODP A;  2WM0 A;  2RUD A;  4J4N A;  4ODQ A;  1D7I A;  4Z2L A;  1FKR A;  3B9E A;  4ZPW R;  2G41 A;  4S3K A;  3UQB A;  1TFV A;  1ZBV A;  1FKH A;  2KE0 A;  4IPX A;  1ZBW A;  4JFI A;  3VAW A;  2DT2 A;  3TDB A;  3CHC A;  3WD0 A;  1W1V A;  2G8Z A;  2RUC A;  3WD2 A;  2PBC A;  4URI A;  4R0X A;  1FKB A;  1UR9 A;  2DT1 A;  1U79 A;  1D6O A;  3ODK A;  1JNS A;  1KT1 A;  4W9O A;  5HBF A;  4J4O A;  3O5D A;  3UI4 A;  1KT0 A;  2MF9 A;  3WL0 A;  3WD1 A;  1H0I A;  4NSB A;  2VN1 A;  2M08 A;  1TCO C;  1XRV A;  2KO7 A;  1NMV A;  4TW8 A;  4KR0 B;  4ZPT R;  4WKF A;  4DRH A;  1NH6 A;  2DG4 A;  1F8A B;  3CHD A;  2AWG A;  4N19 A;  4HBO A;  3O5K A;  4AY1 A;  3IK8 A;  2WK2 A;  2DG9 A;  4C02 B;  1ZB5 A;  4DRN A;  4Z2H A;  4QIB A;  3ART A;  3ARW A;  4XAK A;  1FFQ A;  2PPN A;  1KFW A;  1OGB A;  3B9A A;  3GU0 A;  2ITK A;  1E9L A;  2Q5A A;  1J6Y A;  1BKF A;  4HAR A;  3WKZ A;  4DRJ A;  4BF8 A;  2A3E A;  2PPO A;  1GUV A;  2UZ5 A;  1FAP A;  3KAF A;  1FKJ A;  3UQI A;  4WIW A;  3WQV A;  4LAY A;  5GQB A;  1LL4 A;  2FKE A;  4LGX A;  1YW5 A;  2MPH A;  3ARP A;  2O9O A;  1Y0O A;  1HXV A;  4P8V A;  3QOK A;  3PR9 A;  3KAH A;  3NTP A;  2ZR6 A;  4MNM A;  1BL4 A;  4ML4 A;  3WQW A;  4O2T A;  5I98 A;  2OLH A;  2RSE A;  1GRJ A;  2DSW A;  3UI6 A;  1HJW A;  1JNT A;  2ZQT A;  1P5Q A;  1E6R A;  2D9F A;  1WB0 A;  2PN0 A;  2MLX A;  2JZV A;  4ODO A;  1EHN A;  1D2K A;  4IT6 A;  1J4R A;  1LJY A;  4JFJ A;  1ZL1 A;  1CTN A;  1D7H A;  3KCE A;  3PRB A;  4G50 A;  1XHG A;  1JCH B;  2DSZ A;  2FDM A;  3FXY A;  1OGG A;  4WKH A;  3WD3 A;  1F40 A;  1LL6 A;  2RQS A;  2PPP A;  2DPE A;  1UR8 A;  2KGJ A;  4DWS D;  2LJ4 A;  4TNS A;  2YBT A;  4ZS6 A;  1QZ2 A;  3B7X A;  1QPL A;  1A7X A;  4U86 A;  1QPF A;  3EIP A;  3O5O A;  2F4E A;  4QT3 A;  5HT1 A;  3W4R A;  1EQ3 A;  2KFW A;  1E15 A;  1WNO A;  2WLY A;  4Q7N A;  5HWC A;  2XP5 A;  4G2P A;  5DIU A;  1FFR A;  4WKA A;  3KAI A;  4JFK A;  3G6M A;  2OFN A;  1PBK A;  3BMB A;  3WD4 A;  3O5R A;  4DH0 A;  4P8W A;  2VCD A;  3O5G A;  3IKG A;  2K8I A;  3WIJ A;  1FJD A;  3B8S A;  1ZBC A;  1IX5 A;  4L3N A;  1HKI A;  2MLZ A;  1W1P A;  3ARZ A;  3NI6 A;  2PV3 A;  1LQ0 A;  3KAD A;  1FKK A;  4W5U A;  3KAB A;  4P8X A;  3AS3 A;  3ARQ A;  2A3A A;  2YBU A;  1FKS A;  2DSU A;  3IKD A;  1NWT A;  2PV1 A;  4S3J A;  1R9H A;  1J4I A;  4FN2 A;  4ODL A;  5DEZ A;  2XPA A;  1ZU8 A;  3CHF A;  2FAP A;  2B5U B;  1L1P A;  1ZCN A;  3JYJ A;  4UDM A;  3O5I A;  3ARR A;  1LL7 A;  1NSG A;  2B31 A;  5HTG A;  4W9Q A;  2LGO A;  1HKK A;  2ZR4 A;  3O5P A;  1M5Y A;  3G6L A;  1FKT A;  3IHZ A;  4DZ2 A;  1E6P A;  1JNE A;  4LAX A;  3O5E A;  3TC5 A;  3ARO A;  1OWQ A;  4LAV A;  2XPB A;  4ODK A;  4Z2J A;  2XP8 A;  2XP9 A;  2Y78 A;  4MTV A;  2DG3 A;  5DO2 A;  5HWB A;  2PI6 A;  3AS2 A;  4L72 B;  5HW8 A;  3ALG A;  4DZ3 A;  3KZ7 A;  4TW7 A;  5DF0 A;  3ARV A;  2ZQV A;  1EIB A;  4PTM A;  1E6N A;  1FD9 A;  4MNL A;  1C9H A;  3CGM A;  5HW6 A;  5D75 A;  3KAC A;  4DRO A;  4MNK A;  5DIV A;  1K9T A;  1NWU A;  4FAP A;  1HKM A;  2ZQU A;  2IF4 A;  1LG2 A;  2XP6 A;  1EYM A;  3O5F A;  3CZ8 A;  4P8U A;  4TW6 A;  4DRI A;  3ARU A;  4GGQ A;  3RME A;  2EUL A;  3ARY A;  4JFL A;  4MSP A;  3UI5 A;  3UF8 A;  3OA5 A;  4JYS A;  3RM4 A;  2P4V A;  4ZPV R;  3CGN A;  2ZR5 A;  3O5Q A;  4IQ2 A;  1E6Z A;  2MNT A;  1HKJ A;  3WL1 A;  5J6E A;  4QT2 A;  3AQU A;  4DRP A;  2KI3 A;  5HW7 A;  1GOI A;  1HJX A;  4DWS C;  3RM9 A;  3UQA A;  4DRM A;  4JFM A;  3CHE A;  3RFW A;  1W9U A;  3H9R B;  3GPK A;  1W1Y A;  1JVW A;  1T11 A;  4LAW A;  1ROU A;  4DWS B;  2M2A A;  1SYT A;  4W9P A;  1WAW A;  2N87 A;  3PA7 A;  4HBE A;  2MLY A;  3JXV A;  4DRQ A;  4ODR A;  4Q22 A;  2ETN A;  3AS0 A;  1J4H A;  5DIT A;  2KR7 A;  3FAP A;  1FKF A;  4U84 A;  1FKI A;  5GPG A;  2DT3 A;  4Z2G A;  5GPR A;  2IUZ A;  2LKN A;  1NWR A;  3B9D A;  4ODM A;  4TYO A;  4DT4 A;  4NZC A;  1H0G A;  4MPK A;  3WH0 A;  1Q1C A;  2XP4 A;  2M1I A;  4NNR A;  4Z2I A;  2XP7 A;  3KAG A;  1NWS A;  4DWS A;  1RD6 A;  3GTY X;  2O92 A;  2F21 A;  2QF8 A;  3O5J A;  1X6N A;  4IT4 A;  1FKL A;  1PIN A;  3LUO A;  2A3B A;  3PRD A;  1ZBK A;  1X6L A;  1NMW A;  3RGC A;  3EY6 A;  1D7J A;  1VF8 A;  3CH9 A;  3TCZ A;  2WLZ A;  2LPV A;  2RUQ A;  1ROT A;  4ITZ A;  1W9V A;  4WK9 A;  1YAT A;  2ESC A;  3FY1 A;  3ARS A;  1O6I A;  1W9P A;  1N1A A;  3ALF A;  2RUR A;  2F2D A;  1B6C A;  5HUA A;  3NRK A;  1ZK6 A;  3ARX A;  2AOS A;  3I6C A;  4DIP A;  4IQC A;  1Q6H A; 
#chains in the Genus database with same CATH homology
 4TX0 A;  1W1T A;  4KQZ A;  1LG1 A;  3PRA A;  4MNJ A;  1JND A;  2DSV A;  1FKG A;  1Q6I A;  4U85 A;  3AS1 A;  3BXW A;  1W26 A;  5HKG A;  1GPF A;  2DT0 A;  3O5L A;  3RM8 A;  4R5E A;  2ZQS A;  1SR0 A;  1Q6U A;  5JH8 A;  4ODN A;  5B8I C;  4WJX A;  2XP3 A;  3JYM A;  2PV2 A;  5BXJ A;  1FKD A;  3MDY B;  4QZV B;  1HJV A;  4Z2K A;  1ITX A;  4MAV A;  2A3C A;  3O5M A;  2L2S A;  4MGV A;  4GIV A;  1EDQ A;  3OOB A;  4DRK A;  4ODP A;  2WM0 A;  2RUD A;  4J4N A;  4ODQ A;  1D7I A;  4Z2L A;  1FKR A;  3B9E A;  4ZPW R;  2G41 A;  4S3K A;  3UQB A;  1TFV A;  1ZBV A;  1FKH A;  2KE0 A;  4IPX A;  1ZBW A;  4JFI A;  3VAW A;  2DT2 A;  3TDB A;  3CHC A;  3WD0 A;  1W1V A;  2G8Z A;  2RUC A;  3WD2 A;  2PBC A;  4URI A;  4R0X A;  1FKB A;  1UR9 A;  2DT1 A;  1U79 A;  1D6O A;  3ODK A;  1JNS A;  1KT1 A;  4W9O A;  5HBF A;  4J4O A;  3O5D A;  3UI4 A;  1KT0 A;  2MF9 A;  3WL0 A;  3WD1 A;  1H0I A;  4NSB A;  2VN1 A;  2M08 A;  1TCO C;  1XRV A;  2KO7 A;  1NMV A;  4TW8 A;  4KR0 B;  4ZPT R;  4WKF A;  4DRH A;  1NH6 A;  2DG4 A;  1F8A B;  3CHD A;  2AWG A;  4N19 A;  4HBO A;  3O5K A;  4AY1 A;  3IK8 A;  2WK2 A;  2DG9 A;  4C02 B;  1ZB5 A;  4DRN A;  4Z2H A;  4QIB A;  3ART A;  3ARW A;  4XAK A;  1FFQ A;  2PPN A;  1KFW A;  1OGB A;  3B9A A;  2ITK A;  1E9L A;  2Q5A A;  1J6Y A;  1BKF A;  4HAR A;  3WKZ A;  4DRJ A;  4BF8 A;  2A3E A;  2PPO A;  1GUV A;  2UZ5 A;  1FAP A;  3KAF A;  1FKJ A;  3UQI A;  4WIW A;  3WQV A;  4LAY A;  5GQB A;  1LL4 A;  2FKE A;  4LGX A;  1YW5 A;  2MPH A;  3ARP A;  2O9O A;  1Y0O A;  1HXV A;  4P8V A;  3QOK A;  3PR9 A;  3KAH A;  3NTP A;  2ZR6 A;  4MNM A;  1BL4 A;  4ML4 A;  3WQW A;  4O2T A;  5I98 A;  2OLH A;  2RSE A;  2DSW A;  3UI6 A;  1HJW A;  1JNT A;  2ZQT A;  1P5Q A;  1E6R A;  2D9F A;  1WB0 A;  2MLX A;  2JZV A;  4ODO A;  1EHN A;  1D2K A;  4IT6 A;  1J4R A;  1LJY A;  4JFJ A;  1ZL1 A;  1CTN A;  1D7H A;  3KCE A;  3PRB A;  4G50 A;  1XHG A;  2DSZ A;  2FDM A;  3FXY A;  1OGG A;  4WKH A;  3WD3 A;  1F40 A;  1LL6 A;  2RQS A;  2PPP A;  2DPE A;  1UR8 A;  2KGJ A;  4DWS D;  2LJ4 A;  4TNS A;  2YBT A;  4ZS6 A;  1QZ2 A;  3B7X A;  1QPL A;  1A7X A;  4U86 A;  1QPF A;  3O5O A;  2F4E A;  4QT3 A;  5HT1 A;  3W4R A;  1EQ3 A;  2KFW A;  1E15 A;  1WNO A;  2WLY A;  4Q7N A;  5HWC A;  2XP5 A;  4G2P A;  5DIU A;  1FFR A;  4WKA A;  3KAI A;  4JFK A;  3G6M A;  2OFN A;  1PBK A;  3WD4 A;  3O5R A;  4DH0 A;  4P8W A;  2VCD A;  3O5G A;  3IKG A;  2K8I A;  3WIJ A;  1FJD A;  3B8S A;  1ZBC A;  1IX5 A;  4L3N A;  1HKI A;  2MLZ A;  1W1P A;  3ARZ A;  3NI6 A;  2PV3 A;  1LQ0 A;  3KAD A;  1FKK A;  4W5U A;  3KAB A;  4P8X A;  3AS3 A;  3ARQ A;  2A3A A;  2YBU A;  1FKS A;  2DSU A;  3IKD A;  1NWT A;  2PV1 A;  4S3J A;  1R9H A;  1J4I A;  4FN2 A;  4ODL A;  5DEZ A;  2XPA A;  1ZU8 A;  3CHF A;  2FAP A;  1L1P A;  1ZCN A;  3JYJ A;  3O5I A;  3ARR A;  1LL7 A;  1NSG A;  2B31 A;  5HTG A;  4W9Q A;  2LGO A;  1HKK A;  2ZR4 A;  3O5P A;  1M5Y A;  3G6L A;  1FKT A;  3IHZ A;  4DZ2 A;  1E6P A;  1JNE A;  4LAX A;  3O5E A;  3TC5 A;  3ARO A;  1OWQ A;  4LAV A;  2XPB A;  4ODK A;  4Z2J A;  2XP8 A;  2XP9 A;  2Y78 A;  4MTV A;  2DG3 A;  5DO2 A;  5HWB A;  2PI6 A;  3AS2 A;  4L72 B;  5HW8 A;  3ALG A;  4DZ3 A;  3KZ7 A;  4TW7 A;  5DF0 A;  3ARV A;  2ZQV A;  1EIB A;  4PTM A;  1E6N A;  1FD9 A;  4MNL A;  1C9H A;  3CGM A;  5HW6 A;  5D75 A;  3KAC A;  4DRO A;  4MNK A;  5DIV A;  1K9T A;  1NWU A;  4FAP A;  1HKM A;  2ZQU A;  2IF4 A;  1LG2 A;  2XP6 A;  1EYM A;  3O5F A;  3CZ8 A;  4P8U A;  4TW6 A;  4DRI A;  3ARU A;  4GGQ A;  3RME A;  3ARY A;  4JFL A;  4MSP A;  3UI5 A;  3UF8 A;  3OA5 A;  4JYS A;  3RM4 A;  4ZPV R;  3CGN A;  2ZR5 A;  3O5Q A;  4IQ2 A;  1E6Z A;  2MNT A;  1HKJ A;  3WL1 A;  5J6E A;  4QT2 A;  3AQU A;  4DRP A;  2KI3 A;  5HW7 A;  1GOI A;  1HJX A;  4DWS C;  3RM9 A;  3UQA A;  4DRM A;  4JFM A;  3CHE A;  3RFW A;  1W9U A;  3H9R B;  3GPK A;  1W1Y A;  1JVW A;  1T11 A;  4LAW A;  1ROU A;  4DWS B;  2M2A A;  1SYT A;  4W9P A;  1WAW A;  2N87 A;  3PA7 A;  4HBE A;  2MLY A;  3JXV A;  4DRQ A;  4ODR A;  4Q22 A;  3AS0 A;  1J4H A;  5DIT A;  2KR7 A;  3FAP A;  1FKF A;  4U84 A;  1FKI A;  5GPG A;  2DT3 A;  4Z2G A;  5GPR A;  2IUZ A;  2LKN A;  1NWR A;  3B9D A;  4ODM A;  4TYO A;  4DT4 A;  4NZC A;  1H0G A;  4MPK A;  3WH0 A;  1Q1C A;  2XP4 A;  2M1I A;  4NNR A;  4Z2I A;  2XP7 A;  3KAG A;  1NWS A;  4DWS A;  1RD6 A;  2O92 A;  2F21 A;  2QF8 A;  3O5J A;  1X6N A;  4IT4 A;  1FKL A;  1PIN A;  3LUO A;  2A3B A;  3PRD A;  1ZBK A;  1X6L A;  1NMW A;  3RGC A;  3EY6 A;  1D7J A;  1VF8 A;  3CH9 A;  3TCZ A;  2WLZ A;  2LPV A;  2RUQ A;  1ROT A;  4ITZ A;  1W9V A;  4WK9 A;  1YAT A;  2ESC A;  3FY1 A;  3ARS A;  1O6I A;  1W9P A;  1N1A A;  3ALF A;  2RUR A;  2F2D A;  1B6C A;  5HUA A;  3NRK A;  1ZK6 A;  3ARX A;  2AOS A;  3I6C A;  4DIP A;  4IQC A;  1Q6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...