4LAXA

Crystal structure analysis of fkbp52, complex with fk506
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
237
structure length
237
Chain Sequence
b'GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
molecule tags Isomerase
source organism Homo sapiens
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
total genus 56
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4laxA02
2VCDA 3I6CA 2PPOA 1Y0OA 3CGNA 2PPPA 4G50A 3IK8A 5HKGA 2ZR5A 3H9RB 4J4OA 2D9FA 4JFJA 4QIBA 2LJ4A 2FAPA 3TCZA 5HW6A 4JFMA 2ZQVA 2AWGA 3KACA 3KAIA 3RFWA 3NI6A 2ZR4A 4DH0A 2ZQSA 1A7XA 4R0XA 1BKFA 4DT4A 3VAWA 1JNSA 5DIVA 1FD9A 2F4EA 3IHZA 4TW6A 1ZK6A 5BXJA 2XP7A 1P5QA 3NTPA 3UI5A 2RQSA 3IKGA 2KI3A 4IQ2A 1EYMA 1F8AB 4TX0A 2XPAA 4J4NA 4ODLA 3PA7A 1Q6HA 3IKDA 5HWBA 1QZ2A 5HWCA 1J6YA 4JFIA 4LAWA 4DROA 3UQBA 3GPKA 2XP4A 3O5FA 5I98A 4DZ3A 3O5QA 4JYSA 1FKJA 1Q6UA 2Q5AA 4ODKA 2F2DA 1BL4A 2K8IA 5GPGA 2LGOA 4U85A 1L1PA 2XP5A 2RUCA 1TCOC 3OOBA 3LUOA 1NMVA 2LPVA 4LAXA 4ODOA 1ZCNA 5HUAA 1J4HA 3UQIA 1Q6IA 1FKKA 2MPHA 4O2TA 2ITKA 1FKRA 4TW7A 3O5LA 4C02B 1J4RA 4JFKA 2UZ5A 4LAYA 1JNTA 1JVWA 1R9HA 2VN1A 3B7XA 1FKFA 3KZ7A 4LAVA 2M1IA 4TYOA 2ZQTA 4ODQA 4W9QA 4DIPA 5HW7A 1J4IA 2RSEA 2FKEA 1C9HA 2RURA 4DRNA 2XP6A 3JXVA 1Q1CA 3JYJA 3TDBA 1ROTA 3O5DA 4ODPA 3O5JA 4DZ2A 1FKIA 1FKBA 2LKNA 1HXVA 4IPXA 4NNRA 4DRIA 3O5PA 2XP8A 2XP9A 1KT0A 1QPFA 1T11A 2OFNA 2DG3A 4JFLA 2PV2A 2RUQA 3PRBA 3O5MA 4MSPA 3O5OA 2PV1A 4TNSA 5HT1A 1ROUA 4DRQA 1W26A 4ODNA 4BF8A 1EQ3A 3O5GA 1B6CA 2DG9A 1D7JA 1NMWA 1PBKA 2N87A 4ODMA 1YW5A 5D75A 5HW8A 3EY6A 2XPBA 3KCEA 3PRDA 2MLXA 1FKGA 1FKLA 1YATA 4GIVA 4U86A 4W9PA 5HTGA 4DRHA 3UQAA 1M5YA 4W9OA 2DG4A 1FJDA 2IF4A 3O5KA 2F21A 4FN2A 4ODRA 3KAHA 1FKHA 1KT1A 2KFWA 3O5RA 3UF8A 4MGVA 1D7IA 4DRKA 1D7HA 2KGJA 2PV3A 1FKTA 1FKSA 2XP3A 3ODKA 4G2PA 5DITA 4U84A 3UI4A 2RUDA 2JZVA 2ZR6A 2MF9A 1U79A 2M08A 4GGQA 1FAPA 4DRPA 2ZQUA 3KADA 1FKDA 3KAFA 3MDYB 3O5EA 3KAGA 1NSGA 2MNTA 1D6OA 4QT2A 3UI6A 3WH0A 5B8IC 5J6EA 2Y78A 2MLZA 1QPLA 4FAPA 4IQCA 3RGCA 5DIUA 3O5IA 1F40A 4TW8A 2MLYA 2L2SA 3NRKA 4QT3A 3FAPA 4DRJA 3KABA 2PPNA 2M2AA 4DRMA 1N1AA 2PBCA 2KE0A 1PINA 3CGMA 4ITZA 4N19A 3JYMA 2KO7A 2KR7A 3TC5A
chains in the Genus database with same CATH superfamily
2VCDA 2DSVA 3OA5A 1Y0OA 2O92A 2PPPA 4G50A 5HKGA 2ZR5A 4Q22A 4WK9A 2D9FA 4QIBA 4PTMA 3RFWA 4DH0A 2ZQSA 1ZB5A 4R0XA 1BKFA 1FD9A 2F4EA 1ZK6A 4MNJA 2XP7A 4N19A 2RQSA 3IKGA 2KI3A 2XPAA 3IKDA 1J6YA 1QZ2A 3CH9A 4JFIA 1H0IA 1W1TA 2Q5AA 5GQBA 2B5UB 2K8IA 2XP5A 1L1PA 1W1YA 5HUAA 4QZVB 3ARPA 3ARRA 4O2TA 3FY1A 4TW7A 4C02B 4JFKA 4P8UA 1JVWA 3WD1A 2VN1A 3KZ7A 5HW7A 2ZQTA 4ODQA 4URIA 1LG2A 1XRVA 1ROTA 4ODPA 1E6RA 4Q7NA 4DWSA 2DPEA 1E15A 1QPFA 1T11A 4DWSD 4JFLA 3PRBA 4MSPA 2PI6A 4WKHA 1WB0A 4ML4A 4P8VA 4IT6A 1NMWA 1PBKA 2OLHA 1GRJA 2XPBA 1OGBA 2QF8A 3UQAA 1ZBKA 3CHFA 4DRHA 4W9OA 2DG4A 3ARWA 2WK2A 4FN2A 4ODRA 3KAHA 1HKMA 2IUZA 4P8XA 1FKSA 3ODKA 1HJWA 4U84A 2A3CA 1H0GA 1ITXA 1FAPA 3O5EA 3MDYB 4S3KA 2MNTA 3WD3A 5B8IC 2Y78A 1UR9A 4DRJA 1CTNA 2WM0A 1PINA 1ZBWA 4ITZA 1W1VA 3CHDA 1JNSA 1NH6A 2P4VA 2PPOA 4Z2KA 3CGNA 3WQVA 1VF8A 3H9RB 4J4OA 2LJ4A 2ZQVA 3KACA 3KAIA 4P8WA 3NI6A 1RD6A 2G41A 3B9AA 1A7XA 1LL6A 5DIVA 4HARA 4Z2JA 4TW6A 3ARYA 4WIWA 5BXJA 3GU0A 3AS2A 4IQ2A 1EYMA 3ARVA 5HWBA 3UQBA 4Z2GA 3CZ8A 3O5FA 4LGXA 3O5QA 1FKJA 1SR0A 2F2DA 2LGOA 4MPKA 1ZU8A 1W1PA 1Q6IA 1FKKA 3O5LA 3B7XA 4LAVA 2M1IA 4TYOA 4W9QA 3CHCA 1J4IA 1SYTA 1JNEA 1C9HA 2DT2A 5DO2A 4IT4A 3B8SA 1GUVA 1XHGA 1EIBA 3AS0A 2LKNA 1HXVA 4IPXA 2XP9A 3WIJA 1KT0A 3RM8A 1E6PA 1LG1A 2OFNA 1E9LA 3RM9A 5JH8A 4L3NA 3ARUA 2A3BA 4ZPTR 3O5MA 1W9VA 4L72B 1ZBVA 1NWTA 5D75A 3WKZA 3PRDA 4U86A 1FKLA 4W9PA 1KFWA 2F21A 4XAKA 1X6LA 1KT1A 3UF8A 2ESCA 4DRKA 5DEZA 1D7HA 2PV3A 3ARZA 1K9TA 1NWUA 5DITA 3AROA 3UI4A 2RUDA 2JZVA 1LL4A 2MF9A 4GGQA 2M08A 4DRPA 2ZQUA 2B31A 4QT2A 3WH0A 1HJVA 2MLZA 4IQCA 3RGCA 3O5IA 1F40A 4TW8A 2MLYA 2L2SA 2WLYA 3NRKA 3FAPA 4DRMA 3KABA 2PPNA 2M2AA 2PBCA 4S3JA 3JYMA 1J4RA 1EHNA 3I6CA 4AY1A 2DT1A 3IK8A 5HW6A 4JFJA 3TCZA 2AWGA 2FDMA 2ZR4A 3AQUA 5DF0A 3AS1A 1E44A 3VAWA 2PN0A 3IHZA 3G6MA 1P5QA 3NTPA 4ZPWR 1F8AB 2YBUA 4TX0A 4UDMA 5HWCA 3FXYA 4LAWA 1LL7A 4DROA 1EDQA 2DT3A 3GPKA 2WLZA 4ODKA 3ALFA 2F23A 1UR8A 2A3EA 2RUCA 1TCOC 3LUOA 4ODOA 1ZCNA 2ITKA 1E6ZA 2UZ5A 4LAYA 1JNTA 2FKEA 2RURA 4DRNA 3O5DA 2DSUA 3O5JA 4DZ2A 1FKIA 1LJYA 3ARSA 4WKAA 5HBFA 1FKBA 4NNRA 4DRIA 4HBOA 3O5PA 2XP8A 4WKFA 2DG3A 1HKJA 5GPRA 2RUQA 4MNMA 1GOIA 4TNSA 1ROUA 1OGGA 1W26A 3AS3A 4ODNA 3O5GA 1B6CA 1W9UA 4R5EA 1YW5A 1W9PA 3EY6A 4NZCA 3KCEA 1FKGA 1JNDA 1FJDA 1M5YA 1E6NA 2AOSA 2IF4A 3WD2A 2A3AA 1FKHA 2KFWA 4W5UA 4MGVA 1D7IA 4NSBA 2KGJA 2XP3A 3QOKA 2ZR6A 1U79A 4DRQA 3UI6A 3ARTA 3KAGA 3CHEA 4FAPA 5DIUA 2O9OA 3W4RA 1D2KA 4QT3A 4WJXA 2G8ZA 1N1AA 3WD0A 2KO7A 3RM4A 1ZBCA 2FAPA 4JFMA 2DSWA 1JCHB 4DT4A 4MAVA 4HBEA 3UI5A 3B9DA 2EULA 1O6IA 4J4NA 4ODLA 3PA7A 1Q6HA 1GPFA 1HJXA 2XP4A 5I98A 4DZ3A 4JYSA 1Q6UA 1WAWA 1BL4A 5GPGA 4U85A 2DT0A 3OOBA 4LAXA 1NMVA 2LPVA 1J4HA 3UQIA 3ALGA 2MPHA 4DWSC 4Z2IA 3WD4A 1FKRA 1R9HA 1ZL1A 1FKFA 4DIPA 1X6NA 2ETNA 2RSEA 2XP6A 3JXVA 1Q1CA 1TFVA 3JYJA 3TDBA 1NWSA 4KR0B 1WNOA 4DWSB 3G6LA 2PV2A 3WQWA 3O5OA 2PV1A 4ZPVR 5HT1A 4ZS6A 1HKIA 4BF8A 1EQ3A 2DG9A 1D7JA 2N87A 4KQZA 4ODMA 5HW8A 1FFRA 2MLXA 1YATA 4GIVA 5HTGA 4MNLA 3O5KA 3B9EA 2DSZA 3O5RA 3ARQA 3EIPA 1LQ0A 1FKTA 3BXWA 4G2PA 2YBTA 3PR9A 4MNKA 3KADA 1FKDA 3KAFA 1NSGA 1D6OA 5J6EA 4MTVA 3WL1A 1QPLA 4Z2HA 1HKKA 3BMBA 1IX5A 3ARXA 1NWRA 4Z2LA 1OWQA 1FFQA 3GTYX 3WL0A 3RMEA 2KE0A 3CGMA 3PRAA 2KR7A 3TC5A
chains in the Genus database with same CATH topology
2VCDA 2DSVA 3OA5A 1Y0OA 2O92A 2PPPA 4G50A 5HKGA 2ZR5A 4Q22A 4WK9A 2D9FA 4QIBA 4PTMA 3RFWA 4DH0A 2ZQSA 1ZB5A 4R0XA 1BKFA 1FD9A 2F4EA 1ZK6A 4MNJA 2XP7A 4N19A 2RQSA 3IKGA 2KI3A 2XPAA 3IKDA 1J6YA 1QZ2A 3CH9A 4JFIA 1H0IA 1W1TA 2Q5AA 5GQBA 2K8IA 2XP5A 1L1PA 1W1YA 5HUAA 4QZVB 3ARPA 3ARRA 4O2TA 3FY1A 4TW7A 4C02B 4JFKA 4P8UA 1JVWA 3WD1A 2VN1A 3KZ7A 5HW7A 2ZQTA 4ODQA 4URIA 1LG2A 1XRVA 1ROTA 4ODPA 1E6RA 4Q7NA 4DWSA 2DPEA 1E15A 1QPFA 1T11A 4DWSD 4JFLA 3PRBA 4MSPA 2PI6A 4WKHA 1WB0A 4ML4A 4P8VA 4IT6A 1NMWA 1PBKA 2OLHA 2XPBA 1OGBA 2QF8A 3UQAA 1ZBKA 3CHFA 4DRHA 4W9OA 2DG4A 3ARWA 2WK2A 4FN2A 4ODRA 3KAHA 1HKMA 2IUZA 4P8XA 1FKSA 3ODKA 1HJWA 4U84A 2A3CA 1H0GA 1ITXA 1FAPA 3O5EA 3MDYB 4S3KA 2MNTA 3WD3A 5B8IC 2Y78A 1UR9A 4DRJA 1CTNA 2WM0A 1PINA 1ZBWA 4ITZA 1W1VA 3CHDA 1JNSA 1NH6A 2PPOA 4Z2KA 3CGNA 3WQVA 1VF8A 3H9RB 4J4OA 2LJ4A 2ZQVA 3KACA 3KAIA 4P8WA 3NI6A 1RD6A 2G41A 3B9AA 1A7XA 1LL6A 5DIVA 4HARA 4Z2JA 4TW6A 3ARYA 4WIWA 5BXJA 3AS2A 4IQ2A 1EYMA 3ARVA 5HWBA 3UQBA 4Z2GA 3CZ8A 3O5FA 4LGXA 3O5QA 1FKJA 1SR0A 2F2DA 2LGOA 4MPKA 1ZU8A 1W1PA 1Q6IA 1FKKA 3O5LA 3B7XA 4LAVA 2M1IA 4TYOA 4W9QA 3CHCA 1J4IA 1SYTA 1JNEA 1C9HA 2DT2A 5DO2A 4IT4A 3B8SA 1GUVA 1XHGA 1EIBA 3AS0A 2LKNA 1HXVA 4IPXA 2XP9A 3WIJA 1KT0A 3RM8A 1E6PA 1LG1A 2OFNA 1E9LA 3RM9A 5JH8A 4L3NA 3ARUA 2A3BA 4ZPTR 3O5MA 1W9VA 4L72B 1ZBVA 1NWTA 5D75A 3WKZA 3PRDA 4U86A 1FKLA 4W9PA 1KFWA 2F21A 4XAKA 1X6LA 1KT1A 3UF8A 2ESCA 4DRKA 5DEZA 1D7HA 2PV3A 3ARZA 1K9TA 1NWUA 5DITA 3AROA 3UI4A 2RUDA 2JZVA 1LL4A 2MF9A 4GGQA 2M08A 4DRPA 2ZQUA 2B31A 4QT2A 3WH0A 1HJVA 2MLZA 4IQCA 3RGCA 3O5IA 1F40A 4TW8A 2MLYA 2L2SA 2WLYA 3NRKA 3FAPA 4DRMA 3KABA 2PPNA 2M2AA 2PBCA 4S3JA 3JYMA 1J4RA 1EHNA 3I6CA 4AY1A 2DT1A 3IK8A 5HW6A 4JFJA 3TCZA 2AWGA 2FDMA 2ZR4A 3AQUA 5DF0A 3AS1A 3VAWA 3IHZA 3G6MA 1P5QA 3NTPA 4ZPWR 1F8AB 2YBUA 4TX0A 5HWCA 3FXYA 4LAWA 1LL7A 4DROA 1EDQA 2DT3A 3GPKA 2WLZA 4ODKA 3ALFA 1UR8A 2A3EA 2RUCA 1TCOC 3LUOA 4ODOA 1ZCNA 2ITKA 1E6ZA 2UZ5A 4LAYA 1JNTA 2FKEA 2RURA 4DRNA 3O5DA 2DSUA 3O5JA 4DZ2A 1FKIA 1LJYA 3ARSA 4WKAA 5HBFA 1FKBA 4NNRA 4DRIA 4HBOA 3O5PA 2XP8A 4WKFA 2DG3A 1HKJA 5GPRA 2RUQA 4MNMA 1GOIA 4TNSA 1ROUA 1OGGA 1W26A 3AS3A 4ODNA 3O5GA 1B6CA 1W9UA 4R5EA 1YW5A 1W9PA 3EY6A 4NZCA 3KCEA 1FKGA 1JNDA 1FJDA 1M5YA 1E6NA 2AOSA 2IF4A 3WD2A 2A3AA 1FKHA 2KFWA 4W5UA 4MGVA 1D7IA 4NSBA 2KGJA 2XP3A 3QOKA 2ZR6A 1U79A 4DRQA 3UI6A 3ARTA 3KAGA 3CHEA 4FAPA 5DIUA 2O9OA 3W4RA 1D2KA 4QT3A 4WJXA 2G8ZA 1N1AA 3WD0A 2KO7A 3RM4A 1ZBCA 2FAPA 4JFMA 2DSWA 4DT4A 4MAVA 4HBEA 3UI5A 3B9DA 1O6IA 4J4NA 4ODLA 3PA7A 1Q6HA 1GPFA 1HJXA 2XP4A 5I98A 4DZ3A 4JYSA 1Q6UA 1WAWA 1BL4A 5GPGA 4U85A 2DT0A 3OOBA 4LAXA 1NMVA 2LPVA 1J4HA 3UQIA 3ALGA 2MPHA 4DWSC 4Z2IA 3WD4A 1FKRA 1R9HA 1ZL1A 1FKFA 4DIPA 1X6NA 2RSEA 2XP6A 3JXVA 1Q1CA 1TFVA 3JYJA 3TDBA 1NWSA 4KR0B 1WNOA 4DWSB 3G6LA 2PV2A 3WQWA 3O5OA 2PV1A 4ZPVR 5HT1A 4ZS6A 1HKIA 4BF8A 1EQ3A 2DG9A 1D7JA 2N87A 4KQZA 4ODMA 5HW8A 1FFRA 2MLXA 1YATA 4GIVA 5HTGA 4MNLA 3O5KA 3B9EA 2DSZA 3O5RA 3ARQA 1LQ0A 1FKTA 3BXWA 4G2PA 2YBTA 3PR9A 4MNKA 3KADA 1FKDA 3KAFA 1NSGA 1D6OA 5J6EA 4MTVA 3WL1A 1QPLA 4Z2HA 1HKKA 1IX5A 3ARXA 1NWRA 4Z2LA 1OWQA 1FFQA 3WL0A 3RMEA 2KE0A 3CGMA 3PRAA 2KR7A 3TC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCD A;  3I6C A;  2PPO A;  1Y0O A;  3CGN A;  2PPP A;  4G50 A;  3IK8 A;  5HKG A;  2ZR5 A;  3H9R B;  4J4O A;  2D9F A;  4JFJ A;  4QIB A;  2LJ4 A;  2FAP A;  3TCZ A;  5HW6 A;  4JFM A;  2ZQV A;  2AWG A;  3KAC A;  3KAI A;  3RFW A;  3NI6 A;  2ZR4 A;  4DH0 A;  2ZQS A;  1A7X A;  4R0X A;  1BKF A;  4DT4 A;  3VAW A;  1JNS A;  5DIV A;  1FD9 A;  2F4E A;  3IHZ A;  4TW6 A;  1ZK6 A;  5BXJ A;  2XP7 A;  1P5Q A;  3NTP A;  3UI5 A;  2RQS A;  3IKG A;  2KI3 A;  4IQ2 A;  1EYM A;  1F8A B;  4TX0 A;  2XPA A;  4J4N A;  4ODL A;  3PA7 A;  1Q6H A;  3IKD A;  5HWB A;  1QZ2 A;  5HWC A;  1J6Y A;  4JFI A;  4LAW A;  4DRO A;  3UQB A;  3GPK A;  2XP4 A;  3O5F A;  5I98 A;  4DZ3 A;  3O5Q A;  4JYS A;  1FKJ A;  1Q6U A;  2Q5A A;  4ODK A;  2F2D A;  1BL4 A;  2K8I A;  5GPG A;  2LGO A;  4U85 A;  1L1P A;  2XP5 A;  2RUC A;  1TCO C;  3OOB A;  3LUO A;  1NMV A;  2LPV A;  4LAX A;  4ODO A;  1ZCN A;  5HUA A;  1J4H A;  3UQI A;  1Q6I A;  1FKK A;  2MPH A;  4O2T A;  2ITK A;  1FKR A;  4TW7 A;  3O5L A;  4C02 B;  1J4R A;  4JFK A;  2UZ5 A;  4LAY A;  1JNT A;  1JVW A;  1R9H A;  2VN1 A;  3B7X A;  1FKF A;  3KZ7 A;  4LAV A;  2M1I A;  4TYO A;  2ZQT A;  4ODQ A;  4W9Q A;  4DIP A;  5HW7 A;  1J4I A;  2RSE A;  2FKE A;  1C9H A;  2RUR A;  4DRN A;  2XP6 A;  3JXV A;  1Q1C A;  3JYJ A;  3TDB A;  1ROT A;  3O5D A;  4ODP A;  3O5J A;  4DZ2 A;  1FKI A;  1FKB A;  2LKN A;  1HXV A;  4IPX A;  4NNR A;  4DRI A;  3O5P A;  2XP8 A;  2XP9 A;  1KT0 A;  1QPF A;  1T11 A;  2OFN A;  2DG3 A;  4JFL A;  2PV2 A;  2RUQ A;  3PRB A;  3O5M A;  4MSP A;  3O5O A;  2PV1 A;  4TNS A;  5HT1 A;  1ROU A;  4DRQ A;  1W26 A;  4ODN A;  4BF8 A;  1EQ3 A;  3O5G A;  1B6C A;  2DG9 A;  1D7J A;  1NMW A;  1PBK A;  2N87 A;  4ODM A;  1YW5 A;  5D75 A;  5HW8 A;  3EY6 A;  2XPB A;  3KCE A;  3PRD A;  2MLX A;  1FKG A;  1FKL A;  1YAT A;  4GIV A;  4U86 A;  4W9P A;  5HTG A;  4DRH A;  3UQA A;  1M5Y A;  4W9O A;  2DG4 A;  1FJD A;  2IF4 A;  3O5K A;  2F21 A;  4FN2 A;  4ODR A;  3KAH A;  1FKH A;  1KT1 A;  2KFW A;  3O5R A;  3UF8 A;  4MGV A;  1D7I A;  4DRK A;  1D7H A;  2KGJ A;  2PV3 A;  1FKT A;  1FKS A;  2XP3 A;  3ODK A;  4G2P A;  5DIT A;  4U84 A;  3UI4 A;  2RUD A;  2JZV A;  2ZR6 A;  2MF9 A;  1U79 A;  2M08 A;  4GGQ A;  1FAP A;  4DRP A;  2ZQU A;  3KAD A;  1FKD A;  3KAF A;  3MDY B;  3O5E A;  3KAG A;  1NSG A;  2MNT A;  1D6O A;  4QT2 A;  3UI6 A;  3WH0 A;  5B8I C;  5J6E A;  2Y78 A;  2MLZ A;  1QPL A;  4FAP A;  4IQC A;  3RGC A;  5DIU A;  3O5I A;  1F40 A;  4TW8 A;  2MLY A;  2L2S A;  3NRK A;  4QT3 A;  3FAP A;  4DRJ A;  3KAB A;  2PPN A;  2M2A A;  4DRM A;  1N1A A;  2PBC A;  2KE0 A;  1PIN A;  3CGM A;  4ITZ A;  4N19 A;  3JYM A;  2KO7 A;  2KR7 A;  3TC5 A; 
#chains in the Genus database with same CATH topology
 2VCD A;  2DSV A;  3OA5 A;  1Y0O A;  2O92 A;  2PPP A;  4G50 A;  5HKG A;  2ZR5 A;  4Q22 A;  4WK9 A;  2D9F A;  4QIB A;  4PTM A;  3RFW A;  4DH0 A;  2ZQS A;  1ZB5 A;  4R0X A;  1BKF A;  1FD9 A;  2F4E A;  1ZK6 A;  4MNJ A;  2XP7 A;  4N19 A;  2RQS A;  3IKG A;  2KI3 A;  2XPA A;  3IKD A;  1J6Y A;  1QZ2 A;  3CH9 A;  4JFI A;  1H0I A;  1W1T A;  2Q5A A;  5GQB A;  2B5U B;  2K8I A;  2XP5 A;  1L1P A;  1W1Y A;  5HUA A;  4QZV B;  3ARP A;  3ARR A;  4O2T A;  3FY1 A;  4TW7 A;  4C02 B;  4JFK A;  4P8U A;  1JVW A;  3WD1 A;  2VN1 A;  3KZ7 A;  5HW7 A;  2ZQT A;  4ODQ A;  4URI A;  1LG2 A;  1XRV A;  1ROT A;  4ODP A;  1E6R A;  4Q7N A;  4DWS A;  2DPE A;  1E15 A;  1QPF A;  1T11 A;  4DWS D;  4JFL A;  3PRB A;  4MSP A;  2PI6 A;  4WKH A;  1WB0 A;  4ML4 A;  4P8V A;  4IT6 A;  1NMW A;  1PBK A;  2OLH A;  1GRJ A;  2XPB A;  1OGB A;  2QF8 A;  3UQA A;  1ZBK A;  3CHF A;  4DRH A;  4W9O A;  2DG4 A;  3ARW A;  2WK2 A;  4FN2 A;  4ODR A;  3KAH A;  1HKM A;  2IUZ A;  4P8X A;  1FKS A;  3ODK A;  1HJW A;  4U84 A;  2A3C A;  1H0G A;  1ITX A;  1FAP A;  3O5E A;  3MDY B;  4S3K A;  2MNT A;  3WD3 A;  5B8I C;  2Y78 A;  1UR9 A;  4DRJ A;  1CTN A;  2WM0 A;  1PIN A;  1ZBW A;  4ITZ A;  1W1V A;  3CHD A;  1JNS A;  1NH6 A;  2P4V A;  2PPO A;  4Z2K A;  3CGN A;  3WQV A;  1VF8 A;  3H9R B;  4J4O A;  2LJ4 A;  2ZQV A;  3KAC A;  3KAI A;  4P8W A;  3NI6 A;  1RD6 A;  2G41 A;  3B9A A;  1A7X A;  1LL6 A;  5DIV A;  4HAR A;  4Z2J A;  4TW6 A;  3ARY A;  4WIW A;  5BXJ A;  3GU0 A;  3AS2 A;  4IQ2 A;  1EYM A;  3ARV A;  5HWB A;  3UQB A;  4Z2G A;  3CZ8 A;  3O5F A;  4LGX A;  3O5Q A;  1FKJ A;  1SR0 A;  2F2D A;  2LGO A;  4MPK A;  1ZU8 A;  1W1P A;  1Q6I A;  1FKK A;  3O5L A;  3B7X A;  4LAV A;  2M1I A;  4TYO A;  4W9Q A;  3CHC A;  1J4I A;  1SYT A;  1JNE A;  1C9H A;  2DT2 A;  5DO2 A;  4IT4 A;  3B8S A;  1GUV A;  1XHG A;  1EIB A;  3AS0 A;  2LKN A;  1HXV A;  4IPX A;  2XP9 A;  3WIJ A;  1KT0 A;  3RM8 A;  1E6P A;  1LG1 A;  2OFN A;  1E9L A;  3RM9 A;  5JH8 A;  4L3N A;  3ARU A;  2A3B A;  4ZPT R;  3O5M A;  1W9V A;  4L72 B;  1ZBV A;  1NWT A;  5D75 A;  3WKZ A;  3PRD A;  4U86 A;  1FKL A;  4W9P A;  1KFW A;  2F21 A;  4XAK A;  1X6L A;  1KT1 A;  3UF8 A;  2ESC A;  4DRK A;  5DEZ A;  1D7H A;  2PV3 A;  3ARZ A;  1K9T A;  1NWU A;  5DIT A;  3ARO A;  3UI4 A;  2RUD A;  2JZV A;  1LL4 A;  2MF9 A;  4GGQ A;  2M08 A;  4DRP A;  2ZQU A;  2B31 A;  4QT2 A;  3WH0 A;  1HJV A;  2MLZ A;  4IQC A;  3RGC A;  3O5I A;  1F40 A;  4TW8 A;  2MLY A;  2L2S A;  2WLY A;  3NRK A;  3FAP A;  4DRM A;  3KAB A;  2PPN A;  2M2A A;  2PBC A;  4S3J A;  3JYM A;  1J4R A;  1EHN A;  3I6C A;  4AY1 A;  2DT1 A;  3IK8 A;  5HW6 A;  4JFJ A;  3TCZ A;  2AWG A;  2FDM A;  2ZR4 A;  3AQU A;  5DF0 A;  3AS1 A;  1E44 A;  3VAW A;  2PN0 A;  3IHZ A;  3G6M A;  1P5Q A;  3NTP A;  4ZPW R;  1F8A B;  2YBU A;  4TX0 A;  4UDM A;  5HWC A;  3FXY A;  4LAW A;  1LL7 A;  4DRO A;  1EDQ A;  2DT3 A;  3GPK A;  2WLZ A;  4ODK A;  3ALF A;  2F23 A;  1UR8 A;  2A3E A;  2RUC A;  1TCO C;  3LUO A;  4ODO A;  1ZCN A;  2ITK A;  1E6Z A;  2UZ5 A;  4LAY A;  1JNT A;  2FKE A;  2RUR A;  4DRN A;  3O5D A;  2DSU A;  3O5J A;  4DZ2 A;  1FKI A;  1LJY A;  3ARS A;  4WKA A;  5HBF A;  1FKB A;  4NNR A;  4DRI A;  4HBO A;  3O5P A;  2XP8 A;  4WKF A;  2DG3 A;  1HKJ A;  5GPR A;  2RUQ A;  4MNM A;  1GOI A;  4TNS A;  1ROU A;  1OGG A;  1W26 A;  3AS3 A;  4ODN A;  3O5G A;  1B6C A;  1W9U A;  4R5E A;  1YW5 A;  1W9P A;  3EY6 A;  4NZC A;  3KCE A;  1FKG A;  1JND A;  1FJD A;  1M5Y A;  1E6N A;  2AOS A;  2IF4 A;  3WD2 A;  2A3A A;  1FKH A;  2KFW A;  4W5U A;  4MGV A;  1D7I A;  4NSB A;  2KGJ A;  2XP3 A;  3QOK A;  2ZR6 A;  1U79 A;  4DRQ A;  3UI6 A;  3ART A;  3KAG A;  3CHE A;  4FAP A;  5DIU A;  2O9O A;  3W4R A;  1D2K A;  4QT3 A;  4WJX A;  2G8Z A;  1N1A A;  3WD0 A;  2KO7 A;  3RM4 A;  1ZBC A;  2FAP A;  4JFM A;  2DSW A;  1JCH B;  4DT4 A;  4MAV A;  4HBE A;  3UI5 A;  3B9D A;  2EUL A;  1O6I A;  4J4N A;  4ODL A;  3PA7 A;  1Q6H A;  1GPF A;  1HJX A;  2XP4 A;  5I98 A;  4DZ3 A;  4JYS A;  1Q6U A;  1WAW A;  1BL4 A;  5GPG A;  4U85 A;  2DT0 A;  3OOB A;  4LAX A;  1NMV A;  2LPV A;  1J4H A;  3UQI A;  3ALG A;  2MPH A;  4DWS C;  4Z2I A;  3WD4 A;  1FKR A;  1R9H A;  1ZL1 A;  1FKF A;  4DIP A;  1X6N A;  2ETN A;  2RSE A;  2XP6 A;  3JXV A;  1Q1C A;  1TFV A;  3JYJ A;  3TDB A;  1NWS A;  4KR0 B;  1WNO A;  4DWS B;  3G6L A;  2PV2 A;  3WQW A;  3O5O A;  2PV1 A;  4ZPV R;  5HT1 A;  4ZS6 A;  1HKI A;  4BF8 A;  1EQ3 A;  2DG9 A;  1D7J A;  2N87 A;  4KQZ A;  4ODM A;  5HW8 A;  1FFR A;  2MLX A;  1YAT A;  4GIV A;  5HTG A;  4MNL A;  3O5K A;  3B9E A;  2DSZ A;  3O5R A;  3ARQ A;  3EIP A;  1LQ0 A;  1FKT A;  3BXW A;  4G2P A;  2YBT A;  3PR9 A;  4MNK A;  3KAD A;  1FKD A;  3KAF A;  1NSG A;  1D6O A;  5J6E A;  4MTV A;  3WL1 A;  1QPL A;  4Z2H A;  1HKK A;  3BMB A;  1IX5 A;  3ARX A;  1NWR A;  4Z2L A;  1OWQ A;  1FFQ A;  3GTY X;  3WL0 A;  3RME A;  2KE0 A;  3CGM A;  3PRA A;  2KR7 A;  3TC5 A; 
#chains in the Genus database with same CATH homology
 2VCD A;  2DSV A;  3OA5 A;  1Y0O A;  2O92 A;  2PPP A;  4G50 A;  5HKG A;  2ZR5 A;  4Q22 A;  4WK9 A;  2D9F A;  4QIB A;  4PTM A;  3RFW A;  4DH0 A;  2ZQS A;  1ZB5 A;  4R0X A;  1BKF A;  1FD9 A;  2F4E A;  1ZK6 A;  4MNJ A;  2XP7 A;  4N19 A;  2RQS A;  3IKG A;  2KI3 A;  2XPA A;  3IKD A;  1J6Y A;  1QZ2 A;  3CH9 A;  4JFI A;  1H0I A;  1W1T A;  2Q5A A;  5GQB A;  2K8I A;  2XP5 A;  1L1P A;  1W1Y A;  5HUA A;  4QZV B;  3ARP A;  3ARR A;  4O2T A;  3FY1 A;  4TW7 A;  4C02 B;  4JFK A;  4P8U A;  1JVW A;  3WD1 A;  2VN1 A;  3KZ7 A;  5HW7 A;  2ZQT A;  4ODQ A;  4URI A;  1LG2 A;  1XRV A;  1ROT A;  4ODP A;  1E6R A;  4Q7N A;  4DWS A;  2DPE A;  1E15 A;  1QPF A;  1T11 A;  4DWS D;  4JFL A;  3PRB A;  4MSP A;  2PI6 A;  4WKH A;  1WB0 A;  4ML4 A;  4P8V A;  4IT6 A;  1NMW A;  1PBK A;  2OLH A;  2XPB A;  1OGB A;  2QF8 A;  3UQA A;  1ZBK A;  3CHF A;  4DRH A;  4W9O A;  2DG4 A;  3ARW A;  2WK2 A;  4FN2 A;  4ODR A;  3KAH A;  1HKM A;  2IUZ A;  4P8X A;  1FKS A;  3ODK A;  1HJW A;  4U84 A;  2A3C A;  1H0G A;  1ITX A;  1FAP A;  3O5E A;  3MDY B;  4S3K A;  2MNT A;  3WD3 A;  5B8I C;  2Y78 A;  1UR9 A;  4DRJ A;  1CTN A;  2WM0 A;  1PIN A;  1ZBW A;  4ITZ A;  1W1V A;  3CHD A;  1JNS A;  1NH6 A;  2PPO A;  4Z2K A;  3CGN A;  3WQV A;  1VF8 A;  3H9R B;  4J4O A;  2LJ4 A;  2ZQV A;  3KAC A;  3KAI A;  4P8W A;  3NI6 A;  1RD6 A;  2G41 A;  3B9A A;  1A7X A;  1LL6 A;  5DIV A;  4HAR A;  4Z2J A;  4TW6 A;  3ARY A;  4WIW A;  5BXJ A;  3AS2 A;  4IQ2 A;  1EYM A;  3ARV A;  5HWB A;  3UQB A;  4Z2G A;  3CZ8 A;  3O5F A;  4LGX A;  3O5Q A;  1FKJ A;  1SR0 A;  2F2D A;  2LGO A;  4MPK A;  1ZU8 A;  1W1P A;  1Q6I A;  1FKK A;  3O5L A;  3B7X A;  4LAV A;  2M1I A;  4TYO A;  4W9Q A;  3CHC A;  1J4I A;  1SYT A;  1JNE A;  1C9H A;  2DT2 A;  5DO2 A;  4IT4 A;  3B8S A;  1GUV A;  1XHG A;  1EIB A;  3AS0 A;  2LKN A;  1HXV A;  4IPX A;  2XP9 A;  3WIJ A;  1KT0 A;  3RM8 A;  1E6P A;  1LG1 A;  2OFN A;  1E9L A;  3RM9 A;  5JH8 A;  4L3N A;  3ARU A;  2A3B A;  4ZPT R;  3O5M A;  1W9V A;  4L72 B;  1ZBV A;  1NWT A;  5D75 A;  3WKZ A;  3PRD A;  4U86 A;  1FKL A;  4W9P A;  1KFW A;  2F21 A;  4XAK A;  1X6L A;  1KT1 A;  3UF8 A;  2ESC A;  4DRK A;  5DEZ A;  1D7H A;  2PV3 A;  3ARZ A;  1K9T A;  1NWU A;  5DIT A;  3ARO A;  3UI4 A;  2RUD A;  2JZV A;  1LL4 A;  2MF9 A;  4GGQ A;  2M08 A;  4DRP A;  2ZQU A;  2B31 A;  4QT2 A;  3WH0 A;  1HJV A;  2MLZ A;  4IQC A;  3RGC A;  3O5I A;  1F40 A;  4TW8 A;  2MLY A;  2L2S A;  2WLY A;  3NRK A;  3FAP A;  4DRM A;  3KAB A;  2PPN A;  2M2A A;  2PBC A;  4S3J A;  3JYM A;  1J4R A;  1EHN A;  3I6C A;  4AY1 A;  2DT1 A;  3IK8 A;  5HW6 A;  4JFJ A;  3TCZ A;  2AWG A;  2FDM A;  2ZR4 A;  3AQU A;  5DF0 A;  3AS1 A;  3VAW A;  3IHZ A;  3G6M A;  1P5Q A;  3NTP A;  4ZPW R;  1F8A B;  2YBU A;  4TX0 A;  5HWC A;  3FXY A;  4LAW A;  1LL7 A;  4DRO A;  1EDQ A;  2DT3 A;  3GPK A;  2WLZ A;  4ODK A;  3ALF A;  1UR8 A;  2A3E A;  2RUC A;  1TCO C;  3LUO A;  4ODO A;  1ZCN A;  2ITK A;  1E6Z A;  2UZ5 A;  4LAY A;  1JNT A;  2FKE A;  2RUR A;  4DRN A;  3O5D A;  2DSU A;  3O5J A;  4DZ2 A;  1FKI A;  1LJY A;  3ARS A;  4WKA A;  5HBF A;  1FKB A;  4NNR A;  4DRI A;  4HBO A;  3O5P A;  2XP8 A;  4WKF A;  2DG3 A;  1HKJ A;  5GPR A;  2RUQ A;  4MNM A;  1GOI A;  4TNS A;  1ROU A;  1OGG A;  1W26 A;  3AS3 A;  4ODN A;  3O5G A;  1B6C A;  1W9U A;  4R5E A;  1YW5 A;  1W9P A;  3EY6 A;  4NZC A;  3KCE A;  1FKG A;  1JND A;  1FJD A;  1M5Y A;  1E6N A;  2AOS A;  2IF4 A;  3WD2 A;  2A3A A;  1FKH A;  2KFW A;  4W5U A;  4MGV A;  1D7I A;  4NSB A;  2KGJ A;  2XP3 A;  3QOK A;  2ZR6 A;  1U79 A;  4DRQ A;  3UI6 A;  3ART A;  3KAG A;  3CHE A;  4FAP A;  5DIU A;  2O9O A;  3W4R A;  1D2K A;  4QT3 A;  4WJX A;  2G8Z A;  1N1A A;  3WD0 A;  2KO7 A;  3RM4 A;  1ZBC A;  2FAP A;  4JFM A;  2DSW A;  4DT4 A;  4MAV A;  4HBE A;  3UI5 A;  3B9D A;  1O6I A;  4J4N A;  4ODL A;  3PA7 A;  1Q6H A;  1GPF A;  1HJX A;  2XP4 A;  5I98 A;  4DZ3 A;  4JYS A;  1Q6U A;  1WAW A;  1BL4 A;  5GPG A;  4U85 A;  2DT0 A;  3OOB A;  4LAX A;  1NMV A;  2LPV A;  1J4H A;  3UQI A;  3ALG A;  2MPH A;  4DWS C;  4Z2I A;  3WD4 A;  1FKR A;  1R9H A;  1ZL1 A;  1FKF A;  4DIP A;  1X6N A;  2RSE A;  2XP6 A;  3JXV A;  1Q1C A;  1TFV A;  3JYJ A;  3TDB A;  1NWS A;  4KR0 B;  1WNO A;  4DWS B;  3G6L A;  2PV2 A;  3WQW A;  3O5O A;  2PV1 A;  4ZPV R;  5HT1 A;  4ZS6 A;  1HKI A;  4BF8 A;  1EQ3 A;  2DG9 A;  1D7J A;  2N87 A;  4KQZ A;  4ODM A;  5HW8 A;  1FFR A;  2MLX A;  1YAT A;  4GIV A;  5HTG A;  4MNL A;  3O5K A;  3B9E A;  2DSZ A;  3O5R A;  3ARQ A;  1LQ0 A;  1FKT A;  3BXW A;  4G2P A;  2YBT A;  3PR9 A;  4MNK A;  3KAD A;  1FKD A;  3KAF A;  1NSG A;  1D6O A;  5J6E A;  4MTV A;  3WL1 A;  1QPL A;  4Z2H A;  1HKK A;  1IX5 A;  3ARX A;  1NWR A;  4Z2L A;  1OWQ A;  1FFQ A;  3WL0 A;  3RME A;  2KE0 A;  3CGM A;  3PRA A;  2KR7 A;  3TC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...