4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
3OOBA 3O5PA 4MGVA 1FKLA 4DRNA 2PV3A 3UI5A 2XP6A 2PPNA 2UZ5A 4IPXA 1Q6IA 4GGQA 4QIBA 2RUQA 4QT3A 3IHZA 1D7HA 3O5JA 2PBCA 4JFIA 1FKJA 2K8IA 3RGCA 3CGNA 2IF4A 1J4HA 4DH0A 1FD9A 3KAIA 1FKGA 2F21A 1J4IA 1JVWA 4DRKA 2LGOA 5HW6A 2PPOA 3CGMA 3JYMA 2JZVA 1F40A 1TCOC 5HWBA 2VN1A 2ZR6A 2XPBA 1FKDA 5DIVA 2N87A 2XP3A 3KAFA 3IK8A 2XP7A 1C9HA 3NTPA 1YW5A 1D7JA 4ODNA 1KT0A 3B7XA 4DRMA 4J4OA 1B6CA 5DITA 4IQ2A 1NMVA 2FKEA 1FJDA 3KADA 5D75A 2Q5AA 3RFWA 1T11A 1JNSA 2OFNA 3JYJA 2ZR5A 2MNTA 3KAGA 3KABA 4JFKA 1J6YA 4TW7A 3O5OA 3NI6A 3PRDA 5BXJA 4JFMA 3TCZA 4LAXA 4TW8A 4NNRA 2MF9A 1KT1A 3KCEA 1EYMA 3O5EA 1L1PA 4GIVA 1P5QA 2MLZA 4U86A 4TYOA 5HT1A 1R9HA 2RUDA 1NMWA 3IKGA 4W9OA 2XPAA 2VCDA 4DT4A 1W26A 1BL4A 4N19A 2PPPA 3O5IA 2M2AA 1F8AB 3PA7A 3UI6A 2KGJA 1QPFA 1U79A 3NRKA 4J4NA 1A7XA 1ZK6A 2XP9A 2ZQTA 3TDBA 1NSGA 4DZ3A 2XP8A 5HKGA 3I6CA 2XP4A 4DZ2A 4FN2A 1ROUA 3O5GA 2DG9A 4FAPA 4W9PA 4LAVA 1Q6HA 4U85A 4DRQA 5B8IC 2MLXA 1YATA 1FKKA 2AWGA 2PV1A 4DRIA 1FKRA 2RSEA 4DRHA 2ITKA 4U84A 4DRPA 1N1AA 5HW7A 2Y78A 2KR7A 1PINA 3MDYB 1ROTA 2DG3A 5HUAA 1JNTA 4DRJA 4TW6A 1M5YA 2MPHA 4ODOA 3TC5A 4ODQA 4QT2A 4TNSA 4ODPA 1FKFA 5HTGA 2ZQUA 3O5FA 3O5RA 1Q6UA 3O5MA 5GPGA 2KO7A 1QPLA 2DG4A 4LAYA 4TX0A 4ODRA 4JFJA 2KFWA 2LPVA 3KZ7A 2L2SA 3KACA 5I98A 2F2DA 3H9RB 2MLYA 1J4RA 2XP5A 4MSPA 3VAWA 2RURA 5HW8A 3UQBA 4O2TA 3GPKA 3UQIA 2D9FA 1FAPA 3IKDA 3O5LA 4JFLA 4BF8A 2KE0A 4G50A 2RQSA 2RUCA 4JYSA 4R0XA 4W9QA 4C02B 3O5QA 4ITZA 4DROA 5J6EA 1FKIA 2LKNA 3O5DA 4IQCA 3EY6A 1FKTA 1FKBA 2KI3A 2ZQSA 4ODMA 2F4EA 3ODKA 1FKHA 1HXVA 2ZQVA 1D7IA 2FAPA 4LAWA 3UQAA 3PRBA 3FAPA 1Y0OA 1PBKA 3JXVA 5DIUA 1D6OA 1BKFA 4ODLA 2M08A 4DIPA 1EQ3A 3UF8A 1FKSA 2LJ4A 1Q1CA 3O5KA 2ZR4A 3LUOA 3UI4A 2PV2A 5HWCA 1ZCNA 4ODKA 3KAHA 1QZ2A 3WH0A 4G2PA 2M1IA
chains in the Genus database with same CATH superfamily
1FKLA 4DRNA 3UI5A 2XP6A 1X6LA 4IPXA 4QT3A 2RUQA 4WK9A 1D7HA 2PBCA 4JFIA 2K8IA 1J4HA 2DT2A 1JVWA 3OA5A 3JYMA 3GTYX 1WB0A 5HWBA 2XPBA 1JCHB 1FKDA 1NWSA 2N87A 1SR0A 1KT0A 4DRMA 5DITA 2Q5AA 1JNSA 3ALGA 4MPKA 3KABA 4TW7A 3O5OA 3G6MA 4L72B 4LAXA 4TW8A 1FFRA 2MF9A 5DF0A 1KT1A 1EYMA 5DEZA 2MLZA 1LQ0A 1R9HA 2RUDA 3WQVA 4XAKA 4DWSC 1W26A 3WL1A 3UI6A 3NRKA 1A7XA 1H0IA 4HARA 5HKGA 1HKJA 2XP4A 3RM8A 4FN2A 4LAVA 1Q6HA 5B8IC 4UDMA 1E6NA 4DRIA 3QOKA 4S3JA 2ITKA 5HUAA 1W9UA 1H0GA 4TW6A 4QT2A 5HTGA 4ODPA 2DSZA 5GPGA 1QPLA 4TX0A 4WKFA 1NWRA 1HKIA 2L2SA 4MSPA 2MLYA 4O2TA 3UQIA 4JFLA 1NH6A 2B31A 4C02B 2DT3A 1ZU8A 2B5UB 3O5QA 1LL6A 3AQUA 3PRAA 1FKTA 1HJVA 3ODKA 1HXVA 1D7IA 3PRBA 3WD1A 4ML4A 4L3NA 3UF8A 4ZPVR 4DWSD 3UI4A 5HWCA 1ZCNA 4ODKA 1D2KA 2M1IA 1W1YA 4PTMA 1ZBWA 2P4VA 2UZ5A 1Q6IA 4QIBA 1FKJA 3RGCA 3CGNA 2IF4A 4DH0A 3KAIA 1FKGA 2JZVA 2ZR6A 1HJXA 5DIVA 2XP3A 3WKZA 4P8WA 1YW5A 1D7JA 1RD6A 4WIWA 1B6CA 4IQ2A 1CTNA 1FJDA 2ZR5A 4Q22A 3FY1A 2A3CA 3NI6A 4JFMA 3AS1A 2OLHA 1ZBKA 3EIPA 4R5EA 4S3KA 4GIVA 1P5QA 1WAWA 3ARTA 3G6LA 3ARVA 1UR9A 2VCDA 4DT4A 1BL4A 4AY1A 3O5IA 1EIBA 1JNEA 4DWSB 1F8AB 2KGJA 2DPEA 4WJXA 2YBUA 2ZQTA 2XP9A 4J4NA 3TDBA 1NSGA 4DZ3A 3I6CA 4Z2LA 1ROUA 2WLYA 2DSVA 4W9PA 4FAPA 1YATA 3FXYA 2AWGA 1FKRA 4DRHA 2WM0A 1N1AA 5HW7A 2Y78A 2KR7A 4DWSA 4Z2GA 1ROTA 2DG3A 4DRJA 1M5YA 1W1TA 4ZPWR 1FKFA 2ETNA 3B9DA 3O5FA 4LAYA 3CH9A 4JFJA 1XRVA 3KACA 5I98A 1ZBVA 5HW8A 2XP5A 2RURA 3GPKA 3ARSA 4BF8A 2KE0A 2RQSA 4JYSA 1TFVA 1OWQA 2LKNA 3O5DA 3EY6A 2G41A 1SYTA 1ZBCA 1UR8A 1FKHA 1ZL1A 1W9PA 3UQAA 4Z2HA 1Y0OA 2A3BA 4MNLA 4WKAA 1FKSA 4P8UA 3LUOA 3ARQA 2PV2A 3WH0A 1EDQA 4NZCA 3OOBA 4MNMA 4MGVA 2PV3A 1E6ZA 1EHNA 3B8SA 4MTVA 2PPNA 4GGQA 3IHZA 3ARWA 3O5JA 3CHEA 3B9AA 1X6NA 2F21A 4DRKA 2DT0A 1W1VA 2PPOA 3CGMA 1TCOC 2VN1A 3KAFA 1E6RA 4ODNA 2FKEA 3KADA 5D75A 3WD4A 4MNJA 3JYJA 2MNTA 4JFKA 1LL4A 3ALFA 3PRDA 3ARUA 2WK2A 2PN0A 3O5EA 4TYOA 3ARZA 1K9TA 3IKGA 4W9OA 2ESCA 2XPAA 2A3AA 3RM4A 3ARRA 1W9VA 2G8ZA 2PPPA 3PA7A 1HJWA 1U79A 1E9LA 1NWTA 1ZK6A 1NWUA 4DZ2A 4MAVA 1LG1A 2DG9A 4ZS6A 3CHDA 1OGGA 2MLXA 1FKKA 2PV1A 2A3EA 2RSEA 1GOIA 4U84A 2DT1A 2AOSA 4NSBA 1JNTA 4ODOA 4ODQA 1LJYA 1OGBA 1E44A 3O5RA 1Q6UA 3O5MA 2KO7A 3ARPA 2DG4A 4ZPTR 4ODRA 2KFWA 2F2DA 3H9RB 3VAWA 4IT6A 1FAPA 3IKDA 1ITXA 2RUCA 4W9QA 5J6EA 1E15A 1FKBA 2KI3A 2ZQSA 2F4EA 2ZQVA 4Z2JA 2O9OA 2FAPA 2DSWA 3FAPA 1JNDA 3RM9A 4HBOA 4KQZA 5JH8A 1BKFA 4WKHA 4ODLA 3WD3A 2M08A 4DIPA 1EQ3A 1Q1CA 3O5KA 2ZR4A 1XHGA 2FDMA 1E6PA 1QZ2A 3CHFA 4NNRA 3O5PA 4Z2KA 3WD0A 3CHCA 2F23A 2PI6A 2YBTA 4LGXA 3B9EA 2EULA 5GQBA 4Q7NA 1FD9A 1J4IA 2LGOA 5HW6A 3ARYA 1W1PA 1F40A 1LG2A 3IK8A 2XP7A 1C9HA 3NTPA 3B7XA 3ARXA 4J4OA 1NMVA 3RFWA 1T11A 2OFNA 1LL7A 3KAGA 1J6YA 3AS2A 5BXJA 3TCZA 4HBEA 1ZB5A 3KCEA 1L1PA 5GPRA 4U86A 5HT1A 5DO2A 1HKMA 2WLZA 3WQWA 4P8XA 1NMWA 3WD2A 4N19A 2M2AA 1QPFA 1WNOA 3BXWA 4MNKA 2XP8A 3AS0A 4W5UA 3O5GA 2O92A 4DRQA 4U85A 4DRPA 4URIA 1PINA 3MDYB 1VF8A 1O6IA 1FFQA 1KFWA 1GUVA 4P8VA 2MPHA 3TC5A 4TNSA 2DSUA 2ZQUA 3WIJA 1IX5A 3W4RA 2LPVA 3KZ7A 1J4RA 3UQBA 4QZVB 2D9FA 3O5LA 3AROA 4G50A 4R0XA 4ITZA 4DROA 1FKIA 4IQCA 3RMEA 4Z2IA 4ODMA 5HBFA 4LAWA 3AS3A 1GPFA 1PBKA 3JXVA 2QF8A 5DIUA 1D6OA 3PR9A 4KR0B 4IT4A 2LJ4A 3CZ8A 3GU0A 3WL0A 1GRJA 2IUZA 3BMBA 3KAHA 4G2PA 1HKKA
chains in the Genus database with same CATH topology
1FKLA 4DRNA 3UI5A 2XP6A 1X6LA 4IPXA 4QT3A 2RUQA 4WK9A 1D7HA 2PBCA 4JFIA 2K8IA 1J4HA 2DT2A 1JVWA 3OA5A 3JYMA 1WB0A 5HWBA 2XPBA 1NWSA 1FKDA 2N87A 1SR0A 1KT0A 4DRMA 5DITA 2Q5AA 1JNSA 3ALGA 4MPKA 3KABA 4TW7A 3O5OA 3G6MA 4L72B 4LAXA 4TW8A 1FFRA 2MF9A 5DF0A 1KT1A 1EYMA 5DEZA 2MLZA 1LQ0A 1R9HA 2RUDA 3WQVA 4XAKA 4DWSC 1W26A 3WL1A 3UI6A 3NRKA 1A7XA 1H0IA 4HARA 5HKGA 1HKJA 2XP4A 3RM8A 4FN2A 4LAVA 1Q6HA 5B8IC 1E6NA 4DRIA 3QOKA 4S3JA 2ITKA 5HUAA 1W9UA 1H0GA 4TW6A 4QT2A 5HTGA 4ODPA 2DSZA 5GPGA 1QPLA 4TX0A 4WKFA 1NWRA 1HKIA 2L2SA 4MSPA 2MLYA 4O2TA 3UQIA 4JFLA 1NH6A 2B31A 4C02B 2DT3A 1ZU8A 3O5QA 1LL6A 3AQUA 3PRAA 1FKTA 1HJVA 3ODKA 1HXVA 1D7IA 3PRBA 3WD1A 4ML4A 4L3NA 3UF8A 4ZPVR 4DWSD 3UI4A 5HWCA 1ZCNA 4ODKA 1D2KA 2M1IA 1W1YA 4PTMA 1ZBWA 2UZ5A 1Q6IA 4QIBA 1FKJA 3RGCA 3CGNA 2IF4A 4DH0A 3KAIA 1FKGA 2JZVA 2ZR6A 1HJXA 5DIVA 2XP3A 3WKZA 4P8WA 1YW5A 1D7JA 1RD6A 4WIWA 1B6CA 4IQ2A 1CTNA 1FJDA 2ZR5A 4Q22A 3FY1A 2A3CA 3NI6A 4JFMA 3AS1A 2OLHA 1ZBKA 4R5EA 4S3KA 4GIVA 1P5QA 1WAWA 3ARTA 3G6LA 3ARVA 1UR9A 2VCDA 4DT4A 1BL4A 4AY1A 3O5IA 1EIBA 1JNEA 4DWSB 1F8AB 2KGJA 2DPEA 4WJXA 2YBUA 2ZQTA 2XP9A 4J4NA 3TDBA 1NSGA 4DZ3A 3I6CA 4Z2LA 1ROUA 2WLYA 2DSVA 4W9PA 4FAPA 1YATA 3FXYA 2AWGA 1FKRA 4DRHA 2WM0A 1N1AA 5HW7A 2Y78A 2KR7A 4DWSA 4Z2GA 1ROTA 2DG3A 4DRJA 1M5YA 1W1TA 4ZPWR 1FKFA 3B9DA 3O5FA 4LAYA 3CH9A 4JFJA 1XRVA 3KACA 5I98A 1ZBVA 5HW8A 2XP5A 2RURA 3GPKA 3ARSA 4BF8A 2KE0A 2RQSA 4JYSA 1TFVA 1OWQA 2LKNA 3O5DA 3EY6A 2G41A 1SYTA 1ZBCA 1UR8A 1FKHA 1ZL1A 1W9PA 3UQAA 4Z2HA 1Y0OA 2A3BA 4MNLA 4WKAA 1FKSA 4P8UA 3LUOA 3ARQA 2PV2A 3WH0A 1EDQA 4NZCA 3OOBA 4MNMA 4MGVA 2PV3A 1E6ZA 1EHNA 3B8SA 4MTVA 2PPNA 4GGQA 3IHZA 3ARWA 3O5JA 3CHEA 3B9AA 1X6NA 2F21A 4DRKA 2DT0A 1W1VA 2PPOA 3CGMA 1TCOC 2VN1A 3KAFA 1E6RA 4ODNA 2FKEA 3KADA 5D75A 3WD4A 4MNJA 3JYJA 2MNTA 4JFKA 1LL4A 3ALFA 3PRDA 3ARUA 2WK2A 3O5EA 4TYOA 3ARZA 1K9TA 3IKGA 4W9OA 2ESCA 2XPAA 2A3AA 3RM4A 3ARRA 1W9VA 2G8ZA 2PPPA 3PA7A 1HJWA 1U79A 1E9LA 1NWTA 1ZK6A 1NWUA 4DZ2A 4MAVA 1LG1A 2DG9A 4ZS6A 3CHDA 1OGGA 2MLXA 1FKKA 2PV1A 2A3EA 2RSEA 1GOIA 4U84A 2DT1A 2AOSA 4NSBA 1JNTA 4ODOA 4ODQA 1LJYA 1OGBA 3O5RA 1Q6UA 3O5MA 2KO7A 3ARPA 2DG4A 4ZPTR 4ODRA 2KFWA 2F2DA 3H9RB 3VAWA 4IT6A 1FAPA 3IKDA 1ITXA 2RUCA 4W9QA 5J6EA 1E15A 1FKBA 2KI3A 2ZQSA 2F4EA 2ZQVA 4Z2JA 2O9OA 2FAPA 2DSWA 3FAPA 1JNDA 3RM9A 4HBOA 4KQZA 5JH8A 1BKFA 4WKHA 4ODLA 3WD3A 2M08A 4DIPA 1EQ3A 1Q1CA 3O5KA 2ZR4A 1XHGA 2FDMA 1E6PA 1QZ2A 3CHFA 4NNRA 3O5PA 4Z2KA 3WD0A 3CHCA 2PI6A 2YBTA 4LGXA 3B9EA 5GQBA 4Q7NA 1FD9A 1J4IA 2LGOA 5HW6A 3ARYA 1W1PA 1F40A 1LG2A 3IK8A 2XP7A 1C9HA 3NTPA 3B7XA 3ARXA 4J4OA 1NMVA 3RFWA 1T11A 2OFNA 1LL7A 3KAGA 1J6YA 3AS2A 5BXJA 3TCZA 4HBEA 1ZB5A 3KCEA 1L1PA 5GPRA 4U86A 5HT1A 5DO2A 1HKMA 2WLZA 3WQWA 4P8XA 1NMWA 3WD2A 4N19A 2M2AA 1QPFA 1WNOA 3BXWA 4MNKA 2XP8A 3AS0A 4W5UA 3O5GA 2O92A 4DRQA 4U85A 4DRPA 4URIA 1PINA 3MDYB 1VF8A 1O6IA 1FFQA 1KFWA 1GUVA 4P8VA 2MPHA 3TC5A 4TNSA 2DSUA 2ZQUA 3WIJA 1IX5A 3W4RA 2LPVA 3KZ7A 1J4RA 3UQBA 4QZVB 2D9FA 3O5LA 3AROA 4G50A 4R0XA 4ITZA 4DROA 1FKIA 4IQCA 3RMEA 4Z2IA 4ODMA 5HBFA 4LAWA 3AS3A 1GPFA 1PBKA 3JXVA 2QF8A 5DIUA 1D6OA 3PR9A 4KR0B 4IT4A 2LJ4A 3CZ8A 3WL0A 2IUZA 3KAHA 4G2PA 1HKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOB A;  3O5P A;  4MGV A;  1FKL A;  4DRN A;  2PV3 A;  3UI5 A;  2XP6 A;  2PPN A;  2UZ5 A;  4IPX A;  1Q6I A;  4GGQ A;  4QIB A;  2RUQ A;  4QT3 A;  3IHZ A;  1D7H A;  3O5J A;  2PBC A;  4JFI A;  1FKJ A;  2K8I A;  3RGC A;  3CGN A;  2IF4 A;  1J4H A;  4DH0 A;  1FD9 A;  3KAI A;  1FKG A;  2F21 A;  1J4I A;  1JVW A;  4DRK A;  2LGO A;  5HW6 A;  2PPO A;  3CGM A;  3JYM A;  2JZV A;  1F40 A;  1TCO C;  5HWB A;  2VN1 A;  2ZR6 A;  2XPB A;  1FKD A;  5DIV A;  2N87 A;  2XP3 A;  3KAF A;  3IK8 A;  2XP7 A;  1C9H A;  3NTP A;  1YW5 A;  1D7J A;  4ODN A;  1KT0 A;  3B7X A;  4DRM A;  4J4O A;  1B6C A;  5DIT A;  4IQ2 A;  1NMV A;  2FKE A;  1FJD A;  3KAD A;  5D75 A;  2Q5A A;  3RFW A;  1T11 A;  1JNS A;  2OFN A;  3JYJ A;  2ZR5 A;  2MNT A;  3KAG A;  3KAB A;  4JFK A;  1J6Y A;  4TW7 A;  3O5O A;  3NI6 A;  3PRD A;  5BXJ A;  4JFM A;  3TCZ A;  4LAX A;  4TW8 A;  4NNR A;  2MF9 A;  1KT1 A;  3KCE A;  1EYM A;  3O5E A;  1L1P A;  4GIV A;  1P5Q A;  2MLZ A;  4U86 A;  4TYO A;  5HT1 A;  1R9H A;  2RUD A;  1NMW A;  3IKG A;  4W9O A;  2XPA A;  2VCD A;  4DT4 A;  1W26 A;  1BL4 A;  4N19 A;  2PPP A;  3O5I A;  2M2A A;  1F8A B;  3PA7 A;  3UI6 A;  2KGJ A;  1QPF A;  1U79 A;  3NRK A;  4J4N A;  1A7X A;  1ZK6 A;  2XP9 A;  2ZQT A;  3TDB A;  1NSG A;  4DZ3 A;  2XP8 A;  5HKG A;  3I6C A;  2XP4 A;  4DZ2 A;  4FN2 A;  1ROU A;  3O5G A;  2DG9 A;  4FAP A;  4W9P A;  4LAV A;  1Q6H A;  4U85 A;  4DRQ A;  5B8I C;  2MLX A;  1YAT A;  1FKK A;  2AWG A;  2PV1 A;  4DRI A;  1FKR A;  2RSE A;  4DRH A;  2ITK A;  4U84 A;  4DRP A;  1N1A A;  5HW7 A;  2Y78 A;  2KR7 A;  1PIN A;  3MDY B;  1ROT A;  2DG3 A;  5HUA A;  1JNT A;  4DRJ A;  4TW6 A;  1M5Y A;  2MPH A;  4ODO A;  3TC5 A;  4ODQ A;  4QT2 A;  4TNS A;  4ODP A;  1FKF A;  5HTG A;  2ZQU A;  3O5F A;  3O5R A;  1Q6U A;  3O5M A;  5GPG A;  2KO7 A;  1QPL A;  2DG4 A;  4LAY A;  4TX0 A;  4ODR A;  4JFJ A;  2KFW A;  2LPV A;  3KZ7 A;  2L2S A;  3KAC A;  5I98 A;  2F2D A;  3H9R B;  2MLY A;  1J4R A;  2XP5 A;  4MSP A;  3VAW A;  2RUR A;  5HW8 A;  3UQB A;  4O2T A;  3GPK A;  3UQI A;  2D9F A;  1FAP A;  3IKD A;  3O5L A;  4JFL A;  4BF8 A;  2KE0 A;  4G50 A;  2RQS A;  2RUC A;  4JYS A;  4R0X A;  4W9Q A;  4C02 B;  3O5Q A;  4ITZ A;  4DRO A;  5J6E A;  1FKI A;  2LKN A;  3O5D A;  4IQC A;  3EY6 A;  1FKT A;  1FKB A;  2KI3 A;  2ZQS A;  4ODM A;  2F4E A;  3ODK A;  1FKH A;  1HXV A;  2ZQV A;  1D7I A;  2FAP A;  4LAW A;  3UQA A;  3PRB A;  3FAP A;  1Y0O A;  1PBK A;  3JXV A;  5DIU A;  1D6O A;  1BKF A;  4ODL A;  2M08 A;  4DIP A;  1EQ3 A;  3UF8 A;  1FKS A;  2LJ4 A;  1Q1C A;  3O5K A;  2ZR4 A;  3LUO A;  3UI4 A;  2PV2 A;  5HWC A;  1ZCN A;  4ODK A;  3KAH A;  1QZ2 A;  3WH0 A;  4G2P A;  2M1I A; 
#chains in the Genus database with same CATH topology
 1FKL A;  4DRN A;  3UI5 A;  2XP6 A;  1X6L A;  4IPX A;  4QT3 A;  2RUQ A;  4WK9 A;  1D7H A;  2PBC A;  4JFI A;  2K8I A;  1J4H A;  2DT2 A;  1JVW A;  3OA5 A;  3JYM A;  3GTY X;  1WB0 A;  5HWB A;  2XPB A;  1JCH B;  1FKD A;  1NWS A;  2N87 A;  1SR0 A;  1KT0 A;  4DRM A;  5DIT A;  2Q5A A;  1JNS A;  3ALG A;  4MPK A;  3KAB A;  4TW7 A;  3O5O A;  3G6M A;  4L72 B;  4LAX A;  4TW8 A;  1FFR A;  2MF9 A;  5DF0 A;  1KT1 A;  1EYM A;  5DEZ A;  2MLZ A;  1LQ0 A;  1R9H A;  2RUD A;  3WQV A;  4XAK A;  4DWS C;  1W26 A;  3WL1 A;  3UI6 A;  3NRK A;  1A7X A;  1H0I A;  4HAR A;  5HKG A;  1HKJ A;  2XP4 A;  3RM8 A;  4FN2 A;  4LAV A;  1Q6H A;  5B8I C;  4UDM A;  1E6N A;  4DRI A;  3QOK A;  4S3J A;  2ITK A;  5HUA A;  1W9U A;  1H0G A;  4TW6 A;  4QT2 A;  5HTG A;  4ODP A;  2DSZ A;  5GPG A;  1QPL A;  4TX0 A;  4WKF A;  1NWR A;  1HKI A;  2L2S A;  4MSP A;  2MLY A;  4O2T A;  3UQI A;  4JFL A;  1NH6 A;  2B31 A;  4C02 B;  2DT3 A;  1ZU8 A;  2B5U B;  3O5Q A;  1LL6 A;  3AQU A;  3PRA A;  1FKT A;  1HJV A;  3ODK A;  1HXV A;  1D7I A;  3PRB A;  3WD1 A;  4ML4 A;  4L3N A;  3UF8 A;  4ZPV R;  4DWS D;  3UI4 A;  5HWC A;  1ZCN A;  4ODK A;  1D2K A;  2M1I A;  1W1Y A;  4PTM A;  1ZBW A;  2P4V A;  2UZ5 A;  1Q6I A;  4QIB A;  1FKJ A;  3RGC A;  3CGN A;  2IF4 A;  4DH0 A;  3KAI A;  1FKG A;  2JZV A;  2ZR6 A;  1HJX A;  5DIV A;  2XP3 A;  3WKZ A;  4P8W A;  1YW5 A;  1D7J A;  1RD6 A;  4WIW A;  1B6C A;  4IQ2 A;  1CTN A;  1FJD A;  2ZR5 A;  4Q22 A;  3FY1 A;  2A3C A;  3NI6 A;  4JFM A;  3AS1 A;  2OLH A;  1ZBK A;  3EIP A;  4R5E A;  4S3K A;  4GIV A;  1P5Q A;  1WAW A;  3ART A;  3G6L A;  3ARV A;  1UR9 A;  2VCD A;  4DT4 A;  1BL4 A;  4AY1 A;  3O5I A;  1EIB A;  1JNE A;  4DWS B;  1F8A B;  2KGJ A;  2DPE A;  4WJX A;  2YBU A;  2ZQT A;  2XP9 A;  4J4N A;  3TDB A;  1NSG A;  4DZ3 A;  3I6C A;  4Z2L A;  1ROU A;  2WLY A;  2DSV A;  4W9P A;  4FAP A;  1YAT A;  3FXY A;  2AWG A;  1FKR A;  4DRH A;  2WM0 A;  1N1A A;  5HW7 A;  2Y78 A;  2KR7 A;  4DWS A;  4Z2G A;  1ROT A;  2DG3 A;  4DRJ A;  1M5Y A;  1W1T A;  4ZPW R;  1FKF A;  2ETN A;  3B9D A;  3O5F A;  4LAY A;  3CH9 A;  4JFJ A;  1XRV A;  3KAC A;  5I98 A;  1ZBV A;  5HW8 A;  2XP5 A;  2RUR A;  3GPK A;  3ARS A;  4BF8 A;  2KE0 A;  2RQS A;  4JYS A;  1TFV A;  1OWQ A;  2LKN A;  3O5D A;  3EY6 A;  2G41 A;  1SYT A;  1ZBC A;  1UR8 A;  1FKH A;  1ZL1 A;  1W9P A;  3UQA A;  4Z2H A;  1Y0O A;  2A3B A;  4MNL A;  4WKA A;  1FKS A;  4P8U A;  3LUO A;  3ARQ A;  2PV2 A;  3WH0 A;  1EDQ A;  4NZC A;  3OOB A;  4MNM A;  4MGV A;  2PV3 A;  1E6Z A;  1EHN A;  3B8S A;  4MTV A;  2PPN A;  4GGQ A;  3IHZ A;  3ARW A;  3O5J A;  3CHE A;  3B9A A;  1X6N A;  2F21 A;  4DRK A;  2DT0 A;  1W1V A;  2PPO A;  3CGM A;  1TCO C;  2VN1 A;  3KAF A;  1E6R A;  4ODN A;  2FKE A;  3KAD A;  5D75 A;  3WD4 A;  4MNJ A;  3JYJ A;  2MNT A;  4JFK A;  1LL4 A;  3ALF A;  3PRD A;  3ARU A;  2WK2 A;  2PN0 A;  3O5E A;  4TYO A;  3ARZ A;  1K9T A;  3IKG A;  4W9O A;  2ESC A;  2XPA A;  2A3A A;  3RM4 A;  3ARR A;  1W9V A;  2G8Z A;  2PPP A;  3PA7 A;  1HJW A;  1U79 A;  1E9L A;  1NWT A;  1ZK6 A;  1NWU A;  4DZ2 A;  4MAV A;  1LG1 A;  2DG9 A;  4ZS6 A;  3CHD A;  1OGG A;  2MLX A;  1FKK A;  2PV1 A;  2A3E A;  2RSE A;  1GOI A;  4U84 A;  2DT1 A;  2AOS A;  4NSB A;  1JNT A;  4ODO A;  4ODQ A;  1LJY A;  1OGB A;  1E44 A;  3O5R A;  1Q6U A;  3O5M A;  2KO7 A;  3ARP A;  2DG4 A;  4ZPT R;  4ODR A;  2KFW A;  2F2D A;  3H9R B;  3VAW A;  4IT6 A;  1FAP A;  3IKD A;  1ITX A;  2RUC A;  4W9Q A;  5J6E A;  1E15 A;  1FKB A;  2KI3 A;  2ZQS A;  2F4E A;  2ZQV A;  4Z2J A;  2O9O A;  2FAP A;  2DSW A;  3FAP A;  1JND A;  3RM9 A;  4HBO A;  4KQZ A;  5JH8 A;  1BKF A;  4WKH A;  4ODL A;  3WD3 A;  2M08 A;  4DIP A;  1EQ3 A;  1Q1C A;  3O5K A;  2ZR4 A;  1XHG A;  2FDM A;  1E6P A;  1QZ2 A;  3CHF A;  4NNR A;  3O5P A;  4Z2K A;  3WD0 A;  3CHC A;  2F23 A;  2PI6 A;  2YBT A;  4LGX A;  3B9E A;  2EUL A;  5GQB A;  4Q7N A;  1FD9 A;  1J4I A;  2LGO A;  5HW6 A;  3ARY A;  1W1P A;  1F40 A;  1LG2 A;  3IK8 A;  2XP7 A;  1C9H A;  3NTP A;  3B7X A;  3ARX A;  4J4O A;  1NMV A;  3RFW A;  1T11 A;  2OFN A;  1LL7 A;  3KAG A;  1J6Y A;  3AS2 A;  5BXJ A;  3TCZ A;  4HBE A;  1ZB5 A;  3KCE A;  1L1P A;  5GPR A;  4U86 A;  5HT1 A;  5DO2 A;  1HKM A;  2WLZ A;  3WQW A;  4P8X A;  1NMW A;  3WD2 A;  4N19 A;  2M2A A;  1QPF A;  1WNO A;  3BXW A;  4MNK A;  2XP8 A;  3AS0 A;  4W5U A;  3O5G A;  2O92 A;  4DRQ A;  4U85 A;  4DRP A;  4URI A;  1PIN A;  3MDY B;  1VF8 A;  1O6I A;  1FFQ A;  1KFW A;  1GUV A;  4P8V A;  2MPH A;  3TC5 A;  4TNS A;  2DSU A;  2ZQU A;  3WIJ A;  1IX5 A;  3W4R A;  2LPV A;  3KZ7 A;  1J4R A;  3UQB A;  4QZV B;  2D9F A;  3O5L A;  3ARO A;  4G50 A;  4R0X A;  4ITZ A;  4DRO A;  1FKI A;  4IQC A;  3RME A;  4Z2I A;  4ODM A;  5HBF A;  4LAW A;  3AS3 A;  1GPF A;  1PBK A;  3JXV A;  2QF8 A;  5DIU A;  1D6O A;  3PR9 A;  4KR0 B;  4IT4 A;  2LJ4 A;  3CZ8 A;  3GU0 A;  3WL0 A;  1GRJ A;  2IUZ A;  3BMB A;  3KAH A;  4G2P A;  1HKK A; 
#chains in the Genus database with same CATH homology
 1FKL A;  4DRN A;  3UI5 A;  2XP6 A;  1X6L A;  4IPX A;  4QT3 A;  2RUQ A;  4WK9 A;  1D7H A;  2PBC A;  4JFI A;  2K8I A;  1J4H A;  2DT2 A;  1JVW A;  3OA5 A;  3JYM A;  1WB0 A;  5HWB A;  2XPB A;  1NWS A;  1FKD A;  2N87 A;  1SR0 A;  1KT0 A;  4DRM A;  5DIT A;  2Q5A A;  1JNS A;  3ALG A;  4MPK A;  3KAB A;  4TW7 A;  3O5O A;  3G6M A;  4L72 B;  4LAX A;  4TW8 A;  1FFR A;  2MF9 A;  5DF0 A;  1KT1 A;  1EYM A;  5DEZ A;  2MLZ A;  1LQ0 A;  1R9H A;  2RUD A;  3WQV A;  4XAK A;  4DWS C;  1W26 A;  3WL1 A;  3UI6 A;  3NRK A;  1A7X A;  1H0I A;  4HAR A;  5HKG A;  1HKJ A;  2XP4 A;  3RM8 A;  4FN2 A;  4LAV A;  1Q6H A;  5B8I C;  1E6N A;  4DRI A;  3QOK A;  4S3J A;  2ITK A;  5HUA A;  1W9U A;  1H0G A;  4TW6 A;  4QT2 A;  5HTG A;  4ODP A;  2DSZ A;  5GPG A;  1QPL A;  4TX0 A;  4WKF A;  1NWR A;  1HKI A;  2L2S A;  4MSP A;  2MLY A;  4O2T A;  3UQI A;  4JFL A;  1NH6 A;  2B31 A;  4C02 B;  2DT3 A;  1ZU8 A;  3O5Q A;  1LL6 A;  3AQU A;  3PRA A;  1FKT A;  1HJV A;  3ODK A;  1HXV A;  1D7I A;  3PRB A;  3WD1 A;  4ML4 A;  4L3N A;  3UF8 A;  4ZPV R;  4DWS D;  3UI4 A;  5HWC A;  1ZCN A;  4ODK A;  1D2K A;  2M1I A;  1W1Y A;  4PTM A;  1ZBW A;  2UZ5 A;  1Q6I A;  4QIB A;  1FKJ A;  3RGC A;  3CGN A;  2IF4 A;  4DH0 A;  3KAI A;  1FKG A;  2JZV A;  2ZR6 A;  1HJX A;  5DIV A;  2XP3 A;  3WKZ A;  4P8W A;  1YW5 A;  1D7J A;  1RD6 A;  4WIW A;  1B6C A;  4IQ2 A;  1CTN A;  1FJD A;  2ZR5 A;  4Q22 A;  3FY1 A;  2A3C A;  3NI6 A;  4JFM A;  3AS1 A;  2OLH A;  1ZBK A;  4R5E A;  4S3K A;  4GIV A;  1P5Q A;  1WAW A;  3ART A;  3G6L A;  3ARV A;  1UR9 A;  2VCD A;  4DT4 A;  1BL4 A;  4AY1 A;  3O5I A;  1EIB A;  1JNE A;  4DWS B;  1F8A B;  2KGJ A;  2DPE A;  4WJX A;  2YBU A;  2ZQT A;  2XP9 A;  4J4N A;  3TDB A;  1NSG A;  4DZ3 A;  3I6C A;  4Z2L A;  1ROU A;  2WLY A;  2DSV A;  4W9P A;  4FAP A;  1YAT A;  3FXY A;  2AWG A;  1FKR A;  4DRH A;  2WM0 A;  1N1A A;  5HW7 A;  2Y78 A;  2KR7 A;  4DWS A;  4Z2G A;  1ROT A;  2DG3 A;  4DRJ A;  1M5Y A;  1W1T A;  4ZPW R;  1FKF A;  3B9D A;  3O5F A;  4LAY A;  3CH9 A;  4JFJ A;  1XRV A;  3KAC A;  5I98 A;  1ZBV A;  5HW8 A;  2XP5 A;  2RUR A;  3GPK A;  3ARS A;  4BF8 A;  2KE0 A;  2RQS A;  4JYS A;  1TFV A;  1OWQ A;  2LKN A;  3O5D A;  3EY6 A;  2G41 A;  1SYT A;  1ZBC A;  1UR8 A;  1FKH A;  1ZL1 A;  1W9P A;  3UQA A;  4Z2H A;  1Y0O A;  2A3B A;  4MNL A;  4WKA A;  1FKS A;  4P8U A;  3LUO A;  3ARQ A;  2PV2 A;  3WH0 A;  1EDQ A;  4NZC A;  3OOB A;  4MNM A;  4MGV A;  2PV3 A;  1E6Z A;  1EHN A;  3B8S A;  4MTV A;  2PPN A;  4GGQ A;  3IHZ A;  3ARW A;  3O5J A;  3CHE A;  3B9A A;  1X6N A;  2F21 A;  4DRK A;  2DT0 A;  1W1V A;  2PPO A;  3CGM A;  1TCO C;  2VN1 A;  3KAF A;  1E6R A;  4ODN A;  2FKE A;  3KAD A;  5D75 A;  3WD4 A;  4MNJ A;  3JYJ A;  2MNT A;  4JFK A;  1LL4 A;  3ALF A;  3PRD A;  3ARU A;  2WK2 A;  3O5E A;  4TYO A;  3ARZ A;  1K9T A;  3IKG A;  4W9O A;  2ESC A;  2XPA A;  2A3A A;  3RM4 A;  3ARR A;  1W9V A;  2G8Z A;  2PPP A;  3PA7 A;  1HJW A;  1U79 A;  1E9L A;  1NWT A;  1ZK6 A;  1NWU A;  4DZ2 A;  4MAV A;  1LG1 A;  2DG9 A;  4ZS6 A;  3CHD A;  1OGG A;  2MLX A;  1FKK A;  2PV1 A;  2A3E A;  2RSE A;  1GOI A;  4U84 A;  2DT1 A;  2AOS A;  4NSB A;  1JNT A;  4ODO A;  4ODQ A;  1LJY A;  1OGB A;  3O5R A;  1Q6U A;  3O5M A;  2KO7 A;  3ARP A;  2DG4 A;  4ZPT R;  4ODR A;  2KFW A;  2F2D A;  3H9R B;  3VAW A;  4IT6 A;  1FAP A;  3IKD A;  1ITX A;  2RUC A;  4W9Q A;  5J6E A;  1E15 A;  1FKB A;  2KI3 A;  2ZQS A;  2F4E A;  2ZQV A;  4Z2J A;  2O9O A;  2FAP A;  2DSW A;  3FAP A;  1JND A;  3RM9 A;  4HBO A;  4KQZ A;  5JH8 A;  1BKF A;  4WKH A;  4ODL A;  3WD3 A;  2M08 A;  4DIP A;  1EQ3 A;  1Q1C A;  3O5K A;  2ZR4 A;  1XHG A;  2FDM A;  1E6P A;  1QZ2 A;  3CHF A;  4NNR A;  3O5P A;  4Z2K A;  3WD0 A;  3CHC A;  2PI6 A;  2YBT A;  4LGX A;  3B9E A;  5GQB A;  4Q7N A;  1FD9 A;  1J4I A;  2LGO A;  5HW6 A;  3ARY A;  1W1P A;  1F40 A;  1LG2 A;  3IK8 A;  2XP7 A;  1C9H A;  3NTP A;  3B7X A;  3ARX A;  4J4O A;  1NMV A;  3RFW A;  1T11 A;  2OFN A;  1LL7 A;  3KAG A;  1J6Y A;  3AS2 A;  5BXJ A;  3TCZ A;  4HBE A;  1ZB5 A;  3KCE A;  1L1P A;  5GPR A;  4U86 A;  5HT1 A;  5DO2 A;  1HKM A;  2WLZ A;  3WQW A;  4P8X A;  1NMW A;  3WD2 A;  4N19 A;  2M2A A;  1QPF A;  1WNO A;  3BXW A;  4MNK A;  2XP8 A;  3AS0 A;  4W5U A;  3O5G A;  2O92 A;  4DRQ A;  4U85 A;  4DRP A;  4URI A;  1PIN A;  3MDY B;  1VF8 A;  1O6I A;  1FFQ A;  1KFW A;  1GUV A;  4P8V A;  2MPH A;  3TC5 A;  4TNS A;  2DSU A;  2ZQU A;  3WIJ A;  1IX5 A;  3W4R A;  2LPV A;  3KZ7 A;  1J4R A;  3UQB A;  4QZV B;  2D9F A;  3O5L A;  3ARO A;  4G50 A;  4R0X A;  4ITZ A;  4DRO A;  1FKI A;  4IQC A;  3RME A;  4Z2I A;  4ODM A;  5HBF A;  4LAW A;  3AS3 A;  1GPF A;  1PBK A;  3JXV A;  2QF8 A;  5DIU A;  1D6O A;  3PR9 A;  4KR0 B;  4IT4 A;  2LJ4 A;  3CZ8 A;  3WL0 A;  2IUZ A;  3KAH A;  4G2P A;  1HKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...