4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
1A7XA 3IHZA 2Y78A 1FKSA 4ODPA 3CGMA 4ODOA 1QPFA 1FKDA 4GIVA 2IF4A 3O5RA 3O5QA 1FKLA 4ODNA 4DRMA 1EQ3A 1ROTA 2M08A 5HW6A 3O5LA 5I98A 3O5FA 3VAWA 5J6EA 3OOBA 4N19A 2KGJA 2LJ4A 2KR7A 3TDBA 1Y0OA 2LPVA 5DIUA 3RFWA 2PPNA 1PBKA 2D9FA 2Q5AA 3NRKA 2RUQA 3PA7A 3NTPA 4ODLA 3IKGA 4DRJA 4DZ2A 4TW7A 5HWBA 1JVWA 1FKTA 2OFNA 3TCZA 2DG3A 1FAPA 3UI6A 2MLZA 1QZ2A 1C9HA 2MLYA 2ZR5A 2MF9A 2JZVA 1FKGA 2ZQUA 3KAFA 3NI6A 4LAVA 4QT2A 5D75A 3GPKA 2VCDA 2FAPA 2MPHA 4FN2A 4JFJA 4W9PA 2K8IA 4JFKA 1N1AA 1F8AB 1NMVA 2KO7A 2XP8A 5B8IC 3O5KA 1ZCNA 4ODQA 1D7JA 2RURA 1U79A 2N87A 1KT0A 4R0XA 1BKFA 1Q6HA 2FKEA 3H9RB 2PV2A 3O5MA 1FKRA 3KAHA 1FKHA 1P5QA 2ZQTA 3LUOA 3PRDA 3RGCA 5BXJA 3I6CA 1JNSA 1Q6UA 2XPBA 2KFWA 1T11A 2XP4A 2M2AA 2ZR4A 2LKNA 2PBCA 5DIVA 3KACA 1FKJA 3O5OA 4DIPA 2L2SA 3O5DA 4J4OA 4G50A 4GGQA 3O5JA 4U85A 4DRNA 4DRPA 2XP6A 1R9HA 4U84A 3KABA 1Q1CA 3MDYB 2DG9A 4ODRA 1M5YA 3O5IA 2KI3A 4LAYA 1J6YA 3PRBA 2AWGA 4LAWA 4TW8A 1JNTA 3UQBA 2XP7A 4JFIA 4ODKA 2KE0A 3O5GA 4DRIA 1FKFA 4QIBA 4FAPA 3O5EA 4TNSA 3UI5A 5HKGA 2VN1A 3EY6A 2DG4A 4IQCA 3TC5A 2RUDA 5HTGA 4DH0A 4MGVA 2PV3A 2ITKA 3JYJA 4DT4A 4G2PA 4QT3A 1YATA 2PPOA 3UI4A 2F4EA 1PINA 1D6OA 1NSGA 3B7XA 3KADA 4JFLA 2UZ5A 4BF8A 1YW5A 1J4IA 4NNRA 2PPPA 1FKBA 1TCOC 2F21A 2LGOA 4ITZA 3UQAA 3UF8A 1D7HA 1FKKA 2ZQVA 1FD9A 3JYMA 4ODMA 3KCEA 4DRQA 2RQSA 1W26A 1D7IA 4J4NA 4DZ3A 1FJDA 4TYOA 4C02B 3UQIA 2ZQSA 1NMWA 2XP9A 3O5PA 1FKIA 1B6CA 4TX0A 1QPLA 5DITA 1HXVA 2RUCA 3JXVA 2PV1A 4MSPA 4O2TA 4IQ2A 3WH0A 1ZK6A 1ROUA 5HWCA 5HUAA 5GPGA 2MLXA 4JFMA 3FAPA 4U86A 1BL4A 1L1PA 4DRHA 2F2DA 2RSEA 1Q6IA 1F40A 1EYMA 2ZR6A 4W9QA 3CGNA 3IK8A 4LAXA 4JYSA 4DRKA 5HT1A 1J4HA 5HW8A 2M1IA 4W9OA 4TW6A 3KZ7A 4IPXA 5HW7A 1KT1A 2XP3A 2XPAA 3IKDA 1J4RA 3KAIA 3KAGA 3ODKA 2MNTA 4DROA 2XP5A
chains in the Genus database with same CATH superfamily
1LQ0A 4ODOA 3W4RA 3O5RA 3O5QA 4ODNA 1ROTA 1GUVA 4WK9A 2M08A 3O5FA 1H0GA 4N19A 4URIA 5DIUA 2FDMA 1E9LA 2Q5AA 1ZBKA 2RUQA 3IKGA 1W1TA 1FKTA 2A3BA 4S3KA 3B9AA 4W9OA 2AOSA 2MF9A 4IT6A 1NH6A 3ARYA 2FAPA 4FN2A 1N1AA 4WKHA 1W1VA 3O5KA 1SR0A 1D7JA 4Z2GA 1GOIA 2RURA 1VF8A 4HBOA 1KT0A 4R0XA 3H9RB 2PV2A 3O5MA 2DT1A 3KAHA 2A3EA 4Z2HA 3I6CA 1TFVA 2XPBA 2KFWA 1IX5A 2ZR4A 2OLHA 3ARQA 3WQVA 4QZVB 1HKJA 4J4OA 3QOKA 4MAVA 1WNOA 2KI3A 3PRBA 4TW8A 2XP7A 2KE0A 2YBUA 2DPEA 1ZL1A 4IQCA 3TC5A 4MGVA 2WK2A 4DT4A 4QT3A 1EHNA 1YATA 4ML4A 4MPKA 3B7XA 4JFLA 4BF8A 2PPPA 2F21A 2P4VA 1D7HA 3B9EA 3ALFA 1XRVA 1HXVA 2B31A 2DT3A 2RUCA 4O2TA 1HKIA 3ARTA 4WKFA 4JFMA 4U86A 3BXWA 1L1PA 2F2DA 1F40A 1ZU8A 1EYMA 4JYSA 1ZBVA 3PRAA 2M1IA 5HW7A 1E6RA 1UR9A 4MTVA 2XP3A 4DROA 2XP4A 2MNTA 3B8SA 1FKSA 1QPFA 1RD6A 1FKDA 4GIVA 3CHCA 1EQ3A 5I98A 5HW6A 4MNLA 2F23A 3VAWA 5J6EA 3OOBA 2EULA 2PPNA 1PBKA 1D2KA 1XHGA 4DRJA 3ARWA 3TCZA 2DG3A 3OA5A 1FAPA 2B5UB 3UI6A 4LAVA 1HJWA 2MLYA 2ZR5A 2JZVA 4XAKA 3NI6A 4HARA 5D75A 2VCDA 1W9UA 2MPHA 4W9PA 1OWQA 4JFKA 1E44A 2A3CA 1EIBA 2N87A 1BKFA 4ZPWR 3RGCA 3PRDA 1T11A 2M2AA 3WD3A 3CHEA 2LKNA 4DWSD 1X6NA 5DIVA 1LL4A 1FKJA 3KACA 3O5DA 1JNEA 3FY1A 4G50A 4U85A 3AQUA 2XP6A 3MDYB 1J6YA 4LAWA 3UQBA 1W9VA 3WQWA 2IUZA 1FKFA 4FAPA 2A3AA 3RM8A 3WIJA 2PV3A 5JH8A 2O92A 2PN0A 1PINA 4DWSA 3KADA 1NSGA 3ARVA 1J4IA 1FKBA 1TCOC 4ITZA 5GQBA 2WLZA 4ODMA 3KCEA 1ZB5A 4J4NA 4DZ3A 1EDQA 1FJDA 4C02B 2XP9A 1FKIA 5DITA 1QPLA 4MSPA 2PV1A 4IQ2A 3AS2A 1ROUA 1WB0A 1E6NA 5GPGA 3FAPA 4P8VA 3AS3A 1Q6IA 2ZR6A 3IK8A 2DSZA 5GPRA 1KT1A 1NWTA 3KAIA 3KAGA 3JYMA 3NRKA 3PR9A 4Q7NA 3BMBA 3IHZA 2Y78A 1NWUA 1ITXA 3CHDA 1OGGA 2IF4A 1KFWA 1E15A 3O5LA 2DSWA 4WIWA 3TDBA 2LPVA 3WD0A 3G6LA 5HWBA 1JVWA 4KR0B 2WM0A 1O6IA 2DT0A 1C9HA 2ZQUA 1FKGA 3KAFA 4DWSB 2G8ZA 3RM9A 2K8IA 1NMVA 5B8IC 1HKMA 1OGBA 1ZCNA 4L72B 4ODQA 4PTMA 1HJXA 4MNMA 1FKRA 1P5QA 2ZQTA 5BXJA 1E6ZA 3ARRA 4P8WA 1Q6UA 5HBFA 4LGXA 2PBCA 3O5OA 4DIPA 2L2SA 3WD2A 4WJXA 4GGQA 4DRNA 1HKKA 1E6PA 2DG9A 1M5YA 3O5IA 4LAYA 1FFRA 1JNTA 3WD4A 1SYTA 4ODKA 4DRIA 4QIBA 4Z2KA 2RUDA 4HBEA 4IT4A 3JYJA 1J4RA 1ZBCA 4G2PA 3UI4A 1GPFA 1WAWA 3B9DA 2UZ5A 1JNDA 1CTNA 4UDMA 2LGOA 3GU0A 3UQAA 3UF8A 1FKKA 2ZQVA 3CHFA 4DRQA 1FFQA 3G6MA 2WLYA 2RQSA 1W1YA 4TYOA 3UQIA 2ZQSA 1NMWA 1X6LA 3O5PA 4TX0A 3JXVA 4ZPVR 3WH0A 1GRJA 2DSVA 3WL1A 3EIPA 5HUAA 4R5EA 1BL4A 3AS0A 4DRHA 4DRKA 3FXYA 3WKZA 4P8UA 5HW8A 4IPXA 1LL6A 2XPAA 3ODKA 2XP5A 1A7XA 4ODPA 3CGMA 1LG1A 1FKLA 3WD1A 4DRMA 1JCHB 2QF8A 1NWRA 2KGJA 2LJ4A 2KR7A 1Y0OA 3RFWA 2D9FA 4DZ2A 3PA7A 3NTPA 4ODLA 1LJYA 4TW7A 3ARXA 3WL0A 1W9PA 2OFNA 4NZCA 4Q22A 2MLZA 1HJVA 1QZ2A 1ZBWA 1NWSA 3AROA 3GTYX 4QT2A 3GPKA 3RMEA 4JFJA 2DSUA 2KO7A 1F8AB 2XP8A 4ZS6A 4Z2IA 4Z2LA 2DT2A 3CH9A 2ETNA 4L3NA 1U79A 1Q6HA 2FKEA 3ALGA 1FKHA 1JNSA 5DF0A 1H0IA 4MNKA 1LL7A 3ARZA 4DRPA 3O5JA 1R9HA 4U84A 3KABA 2G41A 1Q1CA 4ODRA 4W5UA 2AWGA 2YBTA 1UR8A 4JFIA 1K9TA 2ESCA 3CZ8A 4ZPTR 3O5GA 4NSBA 3O5EA 4TNSA 3UI5A 5HKGA 2VN1A 3EY6A 2DG4A 4KQZA 5HTGA 4S3JA 4DH0A 4P8XA 2ITKA 3ARPA 2PPOA 2F4EA 1D6OA 3ARUA 1YW5A 4DWSC 4NNRA 4Z2JA 1FD9A 2O9OA 1W26A 1D7IA 5DO2A 1B6CA 5DEZA 3RM4A 3ARSA 1W1PA 1ZK6A 5HWCA 4MNJA 2MLXA 4AY1A 2RSEA 1LG2A 2PI6A 4W9QA 3CGNA 4LAXA 3AS1A 5HT1A 1J4HA 4TW6A 3KZ7A 4WKAA 3IKDA 3LUOA
chains in the Genus database with same CATH topology
1LQ0A 4ODOA 3W4RA 3O5RA 3O5QA 4ODNA 1ROTA 1GUVA 4WK9A 2M08A 3O5FA 1H0GA 4N19A 4URIA 5DIUA 2FDMA 1E9LA 2Q5AA 1ZBKA 2RUQA 3IKGA 1W1TA 1FKTA 2A3BA 4S3KA 3B9AA 4W9OA 2AOSA 2MF9A 4IT6A 1NH6A 3ARYA 2FAPA 4FN2A 1N1AA 4WKHA 1W1VA 3O5KA 1SR0A 1D7JA 4Z2GA 1GOIA 2RURA 1VF8A 4HBOA 1KT0A 4R0XA 3H9RB 2PV2A 3O5MA 2DT1A 3KAHA 2A3EA 4Z2HA 3I6CA 1TFVA 2XPBA 2KFWA 1IX5A 2ZR4A 2OLHA 3ARQA 3WQVA 4QZVB 1HKJA 4J4OA 3QOKA 4MAVA 1WNOA 2KI3A 3PRBA 4TW8A 2XP7A 2KE0A 2YBUA 2DPEA 1ZL1A 4IQCA 3TC5A 4MGVA 2WK2A 4DT4A 4QT3A 1EHNA 1YATA 4ML4A 4MPKA 3B7XA 4JFLA 4BF8A 2PPPA 2F21A 1D7HA 3B9EA 3ALFA 1XRVA 1HXVA 2B31A 2DT3A 2RUCA 4O2TA 1HKIA 3ARTA 4WKFA 4JFMA 4U86A 3BXWA 1L1PA 2F2DA 1F40A 1ZU8A 1EYMA 4JYSA 1ZBVA 3PRAA 2M1IA 5HW7A 1E6RA 1UR9A 4MTVA 2XP3A 4DROA 2XP4A 2MNTA 3B8SA 1FKSA 1QPFA 1RD6A 1FKDA 4GIVA 3CHCA 1EQ3A 5I98A 5HW6A 4MNLA 3VAWA 5J6EA 3OOBA 2PPNA 1PBKA 1D2KA 1XHGA 4DRJA 3ARWA 3TCZA 2DG3A 3OA5A 1FAPA 3UI6A 4LAVA 1HJWA 2MLYA 2ZR5A 2JZVA 4XAKA 3NI6A 4HARA 5D75A 2VCDA 1W9UA 2MPHA 4W9PA 1OWQA 4JFKA 2A3CA 1EIBA 2N87A 1BKFA 4ZPWR 3RGCA 3PRDA 1T11A 2M2AA 3WD3A 3CHEA 2LKNA 4DWSD 1X6NA 5DIVA 1LL4A 1FKJA 3KACA 3O5DA 1JNEA 3FY1A 4G50A 4U85A 3AQUA 2XP6A 3MDYB 1J6YA 4LAWA 3UQBA 1W9VA 3WQWA 2IUZA 1FKFA 4FAPA 2A3AA 3RM8A 3WIJA 2PV3A 5JH8A 2O92A 1PINA 4DWSA 3KADA 1NSGA 3ARVA 1J4IA 1FKBA 1TCOC 4ITZA 5GQBA 2WLZA 4ODMA 3KCEA 1ZB5A 4J4NA 4DZ3A 1EDQA 1FJDA 4C02B 2XP9A 1FKIA 5DITA 1QPLA 4MSPA 2PV1A 4IQ2A 3AS2A 1ROUA 1WB0A 1E6NA 5GPGA 3FAPA 4P8VA 3AS3A 1Q6IA 2ZR6A 3IK8A 2DSZA 5GPRA 1KT1A 1NWTA 3KAIA 3KAGA 3NRKA 3JYMA 3PR9A 4Q7NA 3IHZA 2Y78A 1NWUA 1ITXA 3CHDA 1OGGA 2IF4A 1KFWA 1E15A 3O5LA 2DSWA 4WIWA 3TDBA 2LPVA 3WD0A 3G6LA 5HWBA 1JVWA 4KR0B 2WM0A 1O6IA 2DT0A 1C9HA 2ZQUA 1FKGA 3KAFA 4DWSB 2G8ZA 3RM9A 2K8IA 1NMVA 5B8IC 1HKMA 1OGBA 1ZCNA 4L72B 4ODQA 4PTMA 1HJXA 4MNMA 1FKRA 1P5QA 2ZQTA 5BXJA 1E6ZA 3ARRA 4P8WA 1Q6UA 5HBFA 4LGXA 2PBCA 3O5OA 4DIPA 2L2SA 3WD2A 4WJXA 4GGQA 4DRNA 1HKKA 1E6PA 2DG9A 1M5YA 3O5IA 4LAYA 1FFRA 1JNTA 3WD4A 1SYTA 4ODKA 4DRIA 4QIBA 4Z2KA 2RUDA 4HBEA 4IT4A 3JYJA 1J4RA 1ZBCA 4G2PA 3UI4A 1GPFA 1WAWA 3B9DA 2UZ5A 1JNDA 1CTNA 2LGOA 3UQAA 3UF8A 1FKKA 2ZQVA 3CHFA 4DRQA 1FFQA 3G6MA 2WLYA 2RQSA 1W1YA 4TYOA 3UQIA 2ZQSA 1NMWA 3O5PA 1X6LA 4TX0A 3JXVA 4ZPVR 3WH0A 2DSVA 3WL1A 5HUAA 4R5EA 1BL4A 3AS0A 4DRHA 4DRKA 3FXYA 3WKZA 4P8UA 5HW8A 4IPXA 1LL6A 2XPAA 3ODKA 2XP5A 1A7XA 4ODPA 3CGMA 1LG1A 1FKLA 3WD1A 4DRMA 2QF8A 1NWRA 2KGJA 2LJ4A 2KR7A 1Y0OA 3RFWA 2D9FA 4DZ2A 3PA7A 3NTPA 4ODLA 1LJYA 4TW7A 3ARXA 3WL0A 1W9PA 2OFNA 4NZCA 4Q22A 2MLZA 1HJVA 1QZ2A 1ZBWA 1NWSA 3AROA 4QT2A 3GPKA 3RMEA 4JFJA 2DSUA 2KO7A 1F8AB 2XP8A 4ZS6A 4Z2IA 4Z2LA 2DT2A 3CH9A 4L3NA 1U79A 1Q6HA 2FKEA 3ALGA 1FKHA 1JNSA 5DF0A 1H0IA 4MNKA 1LL7A 3ARZA 4DRPA 3O5JA 1R9HA 4U84A 3KABA 2G41A 1Q1CA 4ODRA 4W5UA 2AWGA 2YBTA 1UR8A 4JFIA 1K9TA 2ESCA 3CZ8A 4ZPTR 3O5GA 4NSBA 3O5EA 4TNSA 3UI5A 5HKGA 2VN1A 3EY6A 2DG4A 4KQZA 5HTGA 4S3JA 4DH0A 4P8XA 2ITKA 3ARPA 2PPOA 2F4EA 1D6OA 3ARUA 1YW5A 4DWSC 4NNRA 4Z2JA 1FD9A 2O9OA 1W26A 1D7IA 5DO2A 1B6CA 5DEZA 3RM4A 3ARSA 1W1PA 1ZK6A 5HWCA 4MNJA 2MLXA 4AY1A 2RSEA 1LG2A 2PI6A 4W9QA 3CGNA 4LAXA 3AS1A 5HT1A 1J4HA 4TW6A 3KZ7A 4WKAA 3IKDA 3LUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  3IHZ A;  2Y78 A;  1FKS A;  4ODP A;  3CGM A;  4ODO A;  1QPF A;  1FKD A;  4GIV A;  2IF4 A;  3O5R A;  3O5Q A;  1FKL A;  4ODN A;  4DRM A;  1EQ3 A;  1ROT A;  2M08 A;  5HW6 A;  3O5L A;  5I98 A;  3O5F A;  3VAW A;  5J6E A;  3OOB A;  4N19 A;  2KGJ A;  2LJ4 A;  2KR7 A;  3TDB A;  1Y0O A;  2LPV A;  5DIU A;  3RFW A;  2PPN A;  1PBK A;  2D9F A;  2Q5A A;  3NRK A;  2RUQ A;  3PA7 A;  3NTP A;  4ODL A;  3IKG A;  4DRJ A;  4DZ2 A;  4TW7 A;  5HWB A;  1JVW A;  1FKT A;  2OFN A;  3TCZ A;  2DG3 A;  1FAP A;  3UI6 A;  2MLZ A;  1QZ2 A;  1C9H A;  2MLY A;  2ZR5 A;  2MF9 A;  2JZV A;  1FKG A;  2ZQU A;  3KAF A;  3NI6 A;  4LAV A;  4QT2 A;  5D75 A;  3GPK A;  2VCD A;  2FAP A;  2MPH A;  4FN2 A;  4JFJ A;  4W9P A;  2K8I A;  4JFK A;  1N1A A;  1F8A B;  1NMV A;  2KO7 A;  2XP8 A;  5B8I C;  3O5K A;  1ZCN A;  4ODQ A;  1D7J A;  2RUR A;  1U79 A;  2N87 A;  1KT0 A;  4R0X A;  1BKF A;  1Q6H A;  2FKE A;  3H9R B;  2PV2 A;  3O5M A;  1FKR A;  3KAH A;  1FKH A;  1P5Q A;  2ZQT A;  3LUO A;  3PRD A;  3RGC A;  5BXJ A;  3I6C A;  1JNS A;  1Q6U A;  2XPB A;  2KFW A;  1T11 A;  2XP4 A;  2M2A A;  2ZR4 A;  2LKN A;  2PBC A;  5DIV A;  3KAC A;  1FKJ A;  3O5O A;  4DIP A;  2L2S A;  3O5D A;  4J4O A;  4G50 A;  4GGQ A;  3O5J A;  4U85 A;  4DRN A;  4DRP A;  2XP6 A;  1R9H A;  4U84 A;  3KAB A;  1Q1C A;  3MDY B;  2DG9 A;  4ODR A;  1M5Y A;  3O5I A;  2KI3 A;  4LAY A;  1J6Y A;  3PRB A;  2AWG A;  4LAW A;  4TW8 A;  1JNT A;  3UQB A;  2XP7 A;  4JFI A;  4ODK A;  2KE0 A;  3O5G A;  4DRI A;  1FKF A;  4QIB A;  4FAP A;  3O5E A;  4TNS A;  3UI5 A;  5HKG A;  2VN1 A;  3EY6 A;  2DG4 A;  4IQC A;  3TC5 A;  2RUD A;  5HTG A;  4DH0 A;  4MGV A;  2PV3 A;  2ITK A;  3JYJ A;  4DT4 A;  4G2P A;  4QT3 A;  1YAT A;  2PPO A;  3UI4 A;  2F4E A;  1PIN A;  1D6O A;  1NSG A;  3B7X A;  3KAD A;  4JFL A;  2UZ5 A;  4BF8 A;  1YW5 A;  1J4I A;  4NNR A;  2PPP A;  1FKB A;  1TCO C;  2F21 A;  2LGO A;  4ITZ A;  3UQA A;  3UF8 A;  1D7H A;  1FKK A;  2ZQV A;  1FD9 A;  3JYM A;  4ODM A;  3KCE A;  4DRQ A;  2RQS A;  1W26 A;  1D7I A;  4J4N A;  4DZ3 A;  1FJD A;  4TYO A;  4C02 B;  3UQI A;  2ZQS A;  1NMW A;  2XP9 A;  3O5P A;  1FKI A;  1B6C A;  4TX0 A;  1QPL A;  5DIT A;  1HXV A;  2RUC A;  3JXV A;  2PV1 A;  4MSP A;  4O2T A;  4IQ2 A;  3WH0 A;  1ZK6 A;  1ROU A;  5HWC A;  5HUA A;  5GPG A;  2MLX A;  4JFM A;  3FAP A;  4U86 A;  1BL4 A;  1L1P A;  4DRH A;  2F2D A;  2RSE A;  1Q6I A;  1F40 A;  1EYM A;  2ZR6 A;  4W9Q A;  3CGN A;  3IK8 A;  4LAX A;  4JYS A;  4DRK A;  5HT1 A;  1J4H A;  5HW8 A;  2M1I A;  4W9O A;  4TW6 A;  3KZ7 A;  4IPX A;  5HW7 A;  1KT1 A;  2XP3 A;  2XPA A;  3IKD A;  1J4R A;  3KAI A;  3KAG A;  3ODK A;  2MNT A;  4DRO A;  2XP5 A; 
#chains in the Genus database with same CATH topology
 1LQ0 A;  4ODO A;  3W4R A;  3O5R A;  3O5Q A;  4ODN A;  1ROT A;  1GUV A;  4WK9 A;  2M08 A;  3O5F A;  1H0G A;  4N19 A;  4URI A;  5DIU A;  2FDM A;  1E9L A;  2Q5A A;  1ZBK A;  2RUQ A;  3IKG A;  1W1T A;  1FKT A;  2A3B A;  4S3K A;  3B9A A;  4W9O A;  2AOS A;  2MF9 A;  4IT6 A;  1NH6 A;  3ARY A;  2FAP A;  4FN2 A;  1N1A A;  4WKH A;  1W1V A;  3O5K A;  1SR0 A;  1D7J A;  4Z2G A;  1GOI A;  2RUR A;  1VF8 A;  4HBO A;  1KT0 A;  4R0X A;  3H9R B;  2PV2 A;  3O5M A;  2DT1 A;  3KAH A;  2A3E A;  4Z2H A;  3I6C A;  1TFV A;  2XPB A;  2KFW A;  1IX5 A;  2ZR4 A;  2OLH A;  3ARQ A;  3WQV A;  4QZV B;  1HKJ A;  4J4O A;  3QOK A;  4MAV A;  1WNO A;  2KI3 A;  3PRB A;  4TW8 A;  2XP7 A;  2KE0 A;  2YBU A;  2DPE A;  1ZL1 A;  4IQC A;  3TC5 A;  4MGV A;  2WK2 A;  4DT4 A;  4QT3 A;  1EHN A;  1YAT A;  4ML4 A;  4MPK A;  3B7X A;  4JFL A;  4BF8 A;  2PPP A;  2F21 A;  2P4V A;  1D7H A;  3B9E A;  3ALF A;  1XRV A;  1HXV A;  2B31 A;  2DT3 A;  2RUC A;  4O2T A;  1HKI A;  3ART A;  4WKF A;  4JFM A;  4U86 A;  3BXW A;  1L1P A;  2F2D A;  1F40 A;  1ZU8 A;  1EYM A;  4JYS A;  1ZBV A;  3PRA A;  2M1I A;  5HW7 A;  1E6R A;  1UR9 A;  4MTV A;  2XP3 A;  4DRO A;  2XP4 A;  2MNT A;  3B8S A;  1FKS A;  1QPF A;  1RD6 A;  1FKD A;  4GIV A;  3CHC A;  1EQ3 A;  5I98 A;  5HW6 A;  4MNL A;  2F23 A;  3VAW A;  5J6E A;  3OOB A;  2EUL A;  2PPN A;  1PBK A;  1D2K A;  1XHG A;  4DRJ A;  3ARW A;  3TCZ A;  2DG3 A;  3OA5 A;  1FAP A;  2B5U B;  3UI6 A;  4LAV A;  1HJW A;  2MLY A;  2ZR5 A;  2JZV A;  4XAK A;  3NI6 A;  4HAR A;  5D75 A;  2VCD A;  1W9U A;  2MPH A;  4W9P A;  1OWQ A;  4JFK A;  1E44 A;  2A3C A;  1EIB A;  2N87 A;  1BKF A;  4ZPW R;  3RGC A;  3PRD A;  1T11 A;  2M2A A;  3WD3 A;  3CHE A;  2LKN A;  4DWS D;  1X6N A;  5DIV A;  1LL4 A;  1FKJ A;  3KAC A;  3O5D A;  1JNE A;  3FY1 A;  4G50 A;  4U85 A;  3AQU A;  2XP6 A;  3MDY B;  1J6Y A;  4LAW A;  3UQB A;  1W9V A;  3WQW A;  2IUZ A;  1FKF A;  4FAP A;  2A3A A;  3RM8 A;  3WIJ A;  2PV3 A;  5JH8 A;  2O92 A;  2PN0 A;  1PIN A;  4DWS A;  3KAD A;  1NSG A;  3ARV A;  1J4I A;  1FKB A;  1TCO C;  4ITZ A;  5GQB A;  2WLZ A;  4ODM A;  3KCE A;  1ZB5 A;  4J4N A;  4DZ3 A;  1EDQ A;  1FJD A;  4C02 B;  2XP9 A;  1FKI A;  5DIT A;  1QPL A;  4MSP A;  2PV1 A;  4IQ2 A;  3AS2 A;  1ROU A;  1WB0 A;  1E6N A;  5GPG A;  3FAP A;  4P8V A;  3AS3 A;  1Q6I A;  2ZR6 A;  3IK8 A;  2DSZ A;  5GPR A;  1KT1 A;  1NWT A;  3KAI A;  3KAG A;  3JYM A;  3NRK A;  3PR9 A;  4Q7N A;  3BMB A;  3IHZ A;  2Y78 A;  1NWU A;  1ITX A;  3CHD A;  1OGG A;  2IF4 A;  1KFW A;  1E15 A;  3O5L A;  2DSW A;  4WIW A;  3TDB A;  2LPV A;  3WD0 A;  3G6L A;  5HWB A;  1JVW A;  4KR0 B;  2WM0 A;  1O6I A;  2DT0 A;  1C9H A;  2ZQU A;  1FKG A;  3KAF A;  4DWS B;  2G8Z A;  3RM9 A;  2K8I A;  1NMV A;  5B8I C;  1HKM A;  1OGB A;  1ZCN A;  4L72 B;  4ODQ A;  4PTM A;  1HJX A;  4MNM A;  1FKR A;  1P5Q A;  2ZQT A;  5BXJ A;  1E6Z A;  3ARR A;  4P8W A;  1Q6U A;  5HBF A;  4LGX A;  2PBC A;  3O5O A;  4DIP A;  2L2S A;  3WD2 A;  4WJX A;  4GGQ A;  4DRN A;  1HKK A;  1E6P A;  2DG9 A;  1M5Y A;  3O5I A;  4LAY A;  1FFR A;  1JNT A;  3WD4 A;  1SYT A;  4ODK A;  4DRI A;  4QIB A;  4Z2K A;  2RUD A;  4HBE A;  4IT4 A;  3JYJ A;  1J4R A;  1ZBC A;  4G2P A;  3UI4 A;  1GPF A;  1WAW A;  3B9D A;  2UZ5 A;  1JND A;  1CTN A;  4UDM A;  2LGO A;  3GU0 A;  3UQA A;  3UF8 A;  1FKK A;  2ZQV A;  3CHF A;  4DRQ A;  1FFQ A;  3G6M A;  2WLY A;  2RQS A;  1W1Y A;  4TYO A;  3UQI A;  2ZQS A;  1NMW A;  1X6L A;  3O5P A;  4TX0 A;  3JXV A;  4ZPV R;  3WH0 A;  1GRJ A;  2DSV A;  3WL1 A;  3EIP A;  5HUA A;  4R5E A;  1BL4 A;  3AS0 A;  4DRH A;  4DRK A;  3FXY A;  3WKZ A;  4P8U A;  5HW8 A;  4IPX A;  1LL6 A;  2XPA A;  3ODK A;  2XP5 A;  1A7X A;  4ODP A;  3CGM A;  1LG1 A;  1FKL A;  3WD1 A;  4DRM A;  1JCH B;  2QF8 A;  1NWR A;  2KGJ A;  2LJ4 A;  2KR7 A;  1Y0O A;  3RFW A;  2D9F A;  4DZ2 A;  3PA7 A;  3NTP A;  4ODL A;  1LJY A;  4TW7 A;  3ARX A;  3WL0 A;  1W9P A;  2OFN A;  4NZC A;  4Q22 A;  2MLZ A;  1HJV A;  1QZ2 A;  1ZBW A;  1NWS A;  3ARO A;  3GTY X;  4QT2 A;  3GPK A;  3RME A;  4JFJ A;  2DSU A;  2KO7 A;  1F8A B;  2XP8 A;  4ZS6 A;  4Z2I A;  4Z2L A;  2DT2 A;  3CH9 A;  2ETN A;  4L3N A;  1U79 A;  1Q6H A;  2FKE A;  3ALG A;  1FKH A;  1JNS A;  5DF0 A;  1H0I A;  4MNK A;  1LL7 A;  3ARZ A;  4DRP A;  3O5J A;  1R9H A;  4U84 A;  3KAB A;  2G41 A;  1Q1C A;  4ODR A;  4W5U A;  2AWG A;  2YBT A;  1UR8 A;  4JFI A;  1K9T A;  2ESC A;  3CZ8 A;  4ZPT R;  3O5G A;  4NSB A;  3O5E A;  4TNS A;  3UI5 A;  5HKG A;  2VN1 A;  3EY6 A;  2DG4 A;  4KQZ A;  5HTG A;  4S3J A;  4DH0 A;  4P8X A;  2ITK A;  3ARP A;  2PPO A;  2F4E A;  1D6O A;  3ARU A;  1YW5 A;  4DWS C;  4NNR A;  4Z2J A;  1FD9 A;  2O9O A;  1W26 A;  1D7I A;  5DO2 A;  1B6C A;  5DEZ A;  3RM4 A;  3ARS A;  1W1P A;  1ZK6 A;  5HWC A;  4MNJ A;  2MLX A;  4AY1 A;  2RSE A;  1LG2 A;  2PI6 A;  4W9Q A;  3CGN A;  4LAX A;  3AS1 A;  5HT1 A;  1J4H A;  4TW6 A;  3KZ7 A;  4WKA A;  3IKD A;  3LUO A; 
#chains in the Genus database with same CATH homology
 1LQ0 A;  4ODO A;  3W4R A;  3O5R A;  3O5Q A;  4ODN A;  1ROT A;  1GUV A;  4WK9 A;  2M08 A;  3O5F A;  1H0G A;  4N19 A;  4URI A;  5DIU A;  2FDM A;  1E9L A;  2Q5A A;  1ZBK A;  2RUQ A;  3IKG A;  1W1T A;  1FKT A;  2A3B A;  4S3K A;  3B9A A;  4W9O A;  2AOS A;  2MF9 A;  4IT6 A;  1NH6 A;  3ARY A;  2FAP A;  4FN2 A;  1N1A A;  4WKH A;  1W1V A;  3O5K A;  1SR0 A;  1D7J A;  4Z2G A;  1GOI A;  2RUR A;  1VF8 A;  4HBO A;  1KT0 A;  4R0X A;  3H9R B;  2PV2 A;  3O5M A;  2DT1 A;  3KAH A;  2A3E A;  4Z2H A;  3I6C A;  1TFV A;  2XPB A;  2KFW A;  1IX5 A;  2ZR4 A;  2OLH A;  3ARQ A;  3WQV A;  4QZV B;  1HKJ A;  4J4O A;  3QOK A;  4MAV A;  1WNO A;  2KI3 A;  3PRB A;  4TW8 A;  2XP7 A;  2KE0 A;  2YBU A;  2DPE A;  1ZL1 A;  4IQC A;  3TC5 A;  4MGV A;  2WK2 A;  4DT4 A;  4QT3 A;  1EHN A;  1YAT A;  4ML4 A;  4MPK A;  3B7X A;  4JFL A;  4BF8 A;  2PPP A;  2F21 A;  1D7H A;  3B9E A;  3ALF A;  1XRV A;  1HXV A;  2B31 A;  2DT3 A;  2RUC A;  4O2T A;  1HKI A;  3ART A;  4WKF A;  4JFM A;  4U86 A;  3BXW A;  1L1P A;  2F2D A;  1F40 A;  1ZU8 A;  1EYM A;  4JYS A;  1ZBV A;  3PRA A;  2M1I A;  5HW7 A;  1E6R A;  1UR9 A;  4MTV A;  2XP3 A;  4DRO A;  2XP4 A;  2MNT A;  3B8S A;  1FKS A;  1QPF A;  1RD6 A;  1FKD A;  4GIV A;  3CHC A;  1EQ3 A;  5I98 A;  5HW6 A;  4MNL A;  3VAW A;  5J6E A;  3OOB A;  2PPN A;  1PBK A;  1D2K A;  1XHG A;  4DRJ A;  3ARW A;  3TCZ A;  2DG3 A;  3OA5 A;  1FAP A;  3UI6 A;  4LAV A;  1HJW A;  2MLY A;  2ZR5 A;  2JZV A;  4XAK A;  3NI6 A;  4HAR A;  5D75 A;  2VCD A;  1W9U A;  2MPH A;  4W9P A;  1OWQ A;  4JFK A;  2A3C A;  1EIB A;  2N87 A;  1BKF A;  4ZPW R;  3RGC A;  3PRD A;  1T11 A;  2M2A A;  3WD3 A;  3CHE A;  2LKN A;  4DWS D;  1X6N A;  5DIV A;  1LL4 A;  1FKJ A;  3KAC A;  3O5D A;  1JNE A;  3FY1 A;  4G50 A;  4U85 A;  3AQU A;  2XP6 A;  3MDY B;  1J6Y A;  4LAW A;  3UQB A;  1W9V A;  3WQW A;  2IUZ A;  1FKF A;  4FAP A;  2A3A A;  3RM8 A;  3WIJ A;  2PV3 A;  5JH8 A;  2O92 A;  1PIN A;  4DWS A;  3KAD A;  1NSG A;  3ARV A;  1J4I A;  1FKB A;  1TCO C;  4ITZ A;  5GQB A;  2WLZ A;  4ODM A;  3KCE A;  1ZB5 A;  4J4N A;  4DZ3 A;  1EDQ A;  1FJD A;  4C02 B;  2XP9 A;  1FKI A;  5DIT A;  1QPL A;  4MSP A;  2PV1 A;  4IQ2 A;  3AS2 A;  1ROU A;  1WB0 A;  1E6N A;  5GPG A;  3FAP A;  4P8V A;  3AS3 A;  1Q6I A;  2ZR6 A;  3IK8 A;  2DSZ A;  5GPR A;  1KT1 A;  1NWT A;  3KAI A;  3KAG A;  3NRK A;  3JYM A;  3PR9 A;  4Q7N A;  3IHZ A;  2Y78 A;  1NWU A;  1ITX A;  3CHD A;  1OGG A;  2IF4 A;  1KFW A;  1E15 A;  3O5L A;  2DSW A;  4WIW A;  3TDB A;  2LPV A;  3WD0 A;  3G6L A;  5HWB A;  1JVW A;  4KR0 B;  2WM0 A;  1O6I A;  2DT0 A;  1C9H A;  2ZQU A;  1FKG A;  3KAF A;  4DWS B;  2G8Z A;  3RM9 A;  2K8I A;  1NMV A;  5B8I C;  1HKM A;  1OGB A;  1ZCN A;  4L72 B;  4ODQ A;  4PTM A;  1HJX A;  4MNM A;  1FKR A;  1P5Q A;  2ZQT A;  5BXJ A;  1E6Z A;  3ARR A;  4P8W A;  1Q6U A;  5HBF A;  4LGX A;  2PBC A;  3O5O A;  4DIP A;  2L2S A;  3WD2 A;  4WJX A;  4GGQ A;  4DRN A;  1HKK A;  1E6P A;  2DG9 A;  1M5Y A;  3O5I A;  4LAY A;  1FFR A;  1JNT A;  3WD4 A;  1SYT A;  4ODK A;  4DRI A;  4QIB A;  4Z2K A;  2RUD A;  4HBE A;  4IT4 A;  3JYJ A;  1J4R A;  1ZBC A;  4G2P A;  3UI4 A;  1GPF A;  1WAW A;  3B9D A;  2UZ5 A;  1JND A;  1CTN A;  2LGO A;  3UQA A;  3UF8 A;  1FKK A;  2ZQV A;  3CHF A;  4DRQ A;  1FFQ A;  3G6M A;  2WLY A;  2RQS A;  1W1Y A;  4TYO A;  3UQI A;  2ZQS A;  1NMW A;  3O5P A;  1X6L A;  4TX0 A;  3JXV A;  4ZPV R;  3WH0 A;  2DSV A;  3WL1 A;  5HUA A;  4R5E A;  1BL4 A;  3AS0 A;  4DRH A;  4DRK A;  3FXY A;  3WKZ A;  4P8U A;  5HW8 A;  4IPX A;  1LL6 A;  2XPA A;  3ODK A;  2XP5 A;  1A7X A;  4ODP A;  3CGM A;  1LG1 A;  1FKL A;  3WD1 A;  4DRM A;  2QF8 A;  1NWR A;  2KGJ A;  2LJ4 A;  2KR7 A;  1Y0O A;  3RFW A;  2D9F A;  4DZ2 A;  3PA7 A;  3NTP A;  4ODL A;  1LJY A;  4TW7 A;  3ARX A;  3WL0 A;  1W9P A;  2OFN A;  4NZC A;  4Q22 A;  2MLZ A;  1HJV A;  1QZ2 A;  1ZBW A;  1NWS A;  3ARO A;  4QT2 A;  3GPK A;  3RME A;  4JFJ A;  2DSU A;  2KO7 A;  1F8A B;  2XP8 A;  4ZS6 A;  4Z2I A;  4Z2L A;  2DT2 A;  3CH9 A;  4L3N A;  1U79 A;  1Q6H A;  2FKE A;  3ALG A;  1FKH A;  1JNS A;  5DF0 A;  1H0I A;  4MNK A;  1LL7 A;  3ARZ A;  4DRP A;  3O5J A;  1R9H A;  4U84 A;  3KAB A;  2G41 A;  1Q1C A;  4ODR A;  4W5U A;  2AWG A;  2YBT A;  1UR8 A;  4JFI A;  1K9T A;  2ESC A;  3CZ8 A;  4ZPT R;  3O5G A;  4NSB A;  3O5E A;  4TNS A;  3UI5 A;  5HKG A;  2VN1 A;  3EY6 A;  2DG4 A;  4KQZ A;  5HTG A;  4S3J A;  4DH0 A;  4P8X A;  2ITK A;  3ARP A;  2PPO A;  2F4E A;  1D6O A;  3ARU A;  1YW5 A;  4DWS C;  4NNR A;  4Z2J A;  1FD9 A;  2O9O A;  1W26 A;  1D7I A;  5DO2 A;  1B6C A;  5DEZ A;  3RM4 A;  3ARS A;  1W1P A;  1ZK6 A;  5HWC A;  4MNJ A;  2MLX A;  4AY1 A;  2RSE A;  1LG2 A;  2PI6 A;  4W9Q A;  3CGN A;  4LAX A;  3AS1 A;  5HT1 A;  1J4H A;  4TW6 A;  3KZ7 A;  4WKA A;  3IKD A;  3LUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...