4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
3KABA 1JNSA 3KCEA 2ZR6A 3TDBA 4DRMA 3JXVA 2OFNA 3UF8A 3UI5A 1YW5A 3RFWA 5HW6A 3O5KA 3FAPA 3IKDA 2VN1A 3O5RA 4MGVA 2ZR5A 4DRHA 1U79A 4TNSA 2RSEA 5HUAA 3KAGA 4GGQA 3UQBA 2ZQTA 4GIVA 4BF8A 2LGOA 2PBCA 2N87A 2LJ4A 4U85A 1B6CA 2DG9A 4ODQA 3O5EA 2KI3A 2PPPA 2XP7A 1FKRA 4FAPA 2D9FA 1Q1CA 1KT0A 2PPOA 3TC5A 4C02B 1F40A 4TW6A 1BL4A 2ZQSA 2DG3A 3VAWA 2FAPA 1A7XA 2PV2A 2MNTA 2RUDA 2XP4A 4LAWA 4LAYA 5J6EA 1N1AA 2UZ5A 1P5QA 2L2SA 1JNTA 1FKSA 2KO7A 4IPXA 4ODLA 4TW7A 1FD9A 3TCZA 2KR7A 1Y0OA 2JZVA 4ITZA 3KADA 2KFWA 2RUCA 4DZ2A 2M2AA 1FKBA 3PRBA 1D7JA 1FKKA 2F21A 1J4HA 2ZR4A 4DZ3A 1QZ2A 4JFKA 2KGJA 5D75A 4W9QA 1D7IA 5GPGA 3H9RB 4FN2A 2XP5A 3O5GA 4TX0A 3JYJA 5DIUA 1FJDA 2IF4A 3KAFA 3O5LA 2XP9A 3UQIA 1NSGA 4R0XA 4LAXA 2LKNA 4DRQA 1FAPA 5B8IC 5HWBA 3LUOA 3IK8A 3I6CA 1FKGA 1ZCNA 2MLYA 3B7XA 3EY6A 4JYSA 2XPAA 1FKLA 1D6OA 2ZQVA 1T11A 3OOBA 4TYOA 4J4NA 2PV1A 2AWGA 4O2TA 4ODPA 4TW8A 3UI4A 5HTGA 2Q5AA 3CGNA 4QT2A 2RQSA 3GPKA 3O5DA 1FKJA 1QPLA 4DIPA 1J6YA 4DRNA 4NNRA 2MLXA 4JFLA 4LAVA 5HW7A 4DROA 2ITKA 3O5FA 1NMWA 1TCOC 2VCDA 3O5OA 5BXJA 2XPBA 4JFMA 4QIBA 3WH0A 1D7HA 1PINA 1ROTA 3IHZA 3KAHA 3MDYB 1Q6HA 4IQ2A 1C9HA 1BKFA 2M1IA 4ODNA 2FKEA 5DIVA 3RGCA 5HWCA 4U84A 3IKGA 1FKHA 1J4IA 3UI6A 3UQAA 2XP8A 3O5PA 4ODMA 5HW8A 1F8AB 2ZQUA 1HXVA 1J4RA 4DRJA 1EYMA 2XP6A 3KACA 5HKGA 1JVWA 4DRPA 1Q6UA 3PA7A 1FKFA 4QT3A 2MF9A 1EQ3A 1FKTA 1M5YA 1Q6IA 4ODKA 3NTPA 3JYMA 5DITA 1L1PA 1R9HA 4G2PA 5I98A 1FKDA 2PPNA 3PRDA 3CGMA 3KAIA 2M08A 2LPVA 4IQCA 1KT1A 2DG4A 3O5IA 2MPHA 1YATA 2RURA 2KE0A 2MLZA 3ODKA 4J4OA 4DT4A 3O5JA 4W9PA 4MSPA 4DH0A 1ROUA 3KZ7A 1W26A 2RUQA 2F4EA 2Y78A 2PV3A 4ODOA 4DRKA 3O5MA 2K8IA 3O5QA 3NRKA 1FKIA 1PBKA 4W9OA 4JFJA 4DRIA 2XP3A 4G50A 4JFIA 5HT1A 4N19A 4U86A 3NI6A 1QPFA 2F2DA 1ZK6A 1NMVA 4ODRA
chains in the Genus database with same CATH superfamily
1E44A 4Z2GA 1JNSA 2ZR6A 4HBEA 2G41A 1HJXA 2OFNA 3UF8A 3UI5A 3FAPA 3O5RA 1U79A 4TNSA 2RSEA 1OWQA 4BF8A 2LGOA 2PBCA 4U85A 2DG9A 4ODQA 1GUVA 2KI3A 1E6ZA 5DEZA 1FKRA 2PPOA 1BL4A 4NSBA 1HJVA 4P8UA 3CHEA 1LL4A 3VAWA 4IT6A 1N1AA 2L2SA 4IPXA 4ODLA 2DT1A 2DSUA 2JZVA 3OA5A 1ZU8A 1NWSA 2KFWA 2RUCA 3PRBA 4MNMA 4JFKA 4KR0B 3JYJA 2IF4A 3O5LA 1TFVA 4LAXA 4LGXA 1FAPA 5HWBA 1JNEA 3IK8A 4QZVB 2DT3A 1HKMA 2XPAA 2EULA 3OOBA 4TYOA 3CHFA 4O2TA 2AWGA 4ODPA 2WK2A 4WKAA 1J6YA 2MLXA 4L72B 3AQUA 4UDMA 5HW7A 2ITKA 4MAVA 3ARVA 1NMWA 1OGGA 2VCDA 2XPBA 4JFMA 1D7HA 2DSVA 1ROTA 3ARSA 1W1TA 3IHZA 4ODNA 1C9HA 1W9VA 5DIVA 2XP8A 1SYTA 2ZQUA 1CTNA 5GQBA 4P8VA 5HKGA 4DWSB 5DO2A 3ARTA 4QT3A 2P4VA 2FDMA 1LL6A 5HBFA 1E9LA 3CGMA 3KAIA 2OLHA 1ZL1A 3AROA 1EIBA 2DG4A 1E6NA 3O5JA 4W9PA 4MSPA 1ZB5A 2PV3A 4URIA 3O5QA 1XRVA 4JFIA 3WIJA 1QPFA 2F2DA 2G8ZA 3G6MA 2QF8A 3KABA 3FXYA 3KCEA 3G6LA 3RFWA 5HW6A 3O5KA 1ITXA 3IKDA 1NH6A 2VN1A 2ZR5A 3UQBA 1H0GA 1H0IA 3KAGA 4GGQA 2PPPA 1Q1CA 3ALFA 4C02B 4P8WA 3WD0A 2FAPA 1A7XA 2RUDA 2XP4A 3B9EA 3AS3A 5GPRA 2DSZA 1XHGA 3AS1A 4TW7A 2KO7A 3QOKA 4ZPWR 2KR7A 3ARRA 4ITZA 1W9PA 3PRAA 1HKJA 2M2AA 1E15A 1D7JA 1J4HA 3FY1A 3ARZA 1QZ2A 2KGJA 3H9RB 3CHDA 4FN2A 2XP5A 4ML4A 3ARPA 1NSGA 2LKNA 4DRQA 4DWSC 5B8IC 1K9TA 3I6CA 2MLYA 3EY6A 3GTYX 1SR0A 1RD6A 3W4RA 1WAWA 1FKJA 1W9UA 4HBOA 4DIPA 1ZBVA 4LAVA 1TCOC 3B9AA 5BXJA 4QIBA 4DRIA 3RGCA 3IKGA 3O5PA 2A3EA 1F8AB 3CZ8A 1HXVA 4DRJA 1EYMA 3KACA 1W1PA 3WD3A 1FKFA 1EQ3A 2DSWA 1FKTA 1Q6IA 3JYMA 2A3AA 5DF0A 1FKDA 1UR9A 2DT2A 3O5IA 1YATA 1GPFA 3EIPA 3ODKA 4J4OA 4DT4A 1IX5A 4DH0A 3KZ7A 1W26A 2Y78A 4AY1A 3O5MA 2K8IA 1FKIA 1PBKA 1FFRA 1NWRA 4N19A 3NI6A 5JH8A 2AOSA 1HKIA 3ARUA 3ARYA 4DRMA 4KQZA 4DRHA 4GIVA 1EHNA 4S3KA 2LJ4A 4PTMA 3O5EA 1OGBA 4FAPA 2D9FA 4MTVA 1X6NA 3TC5A 1F40A 2ZQSA 2DG3A 2B31A 3ARWA 4LAYA 5J6EA 1EDQA 1P5QA 1JNTA 3WD4A 1FD9A 3TCZA 4ZS6A 3AS0A 2A3BA 3KADA 4DZ2A 3RM4A 1FKKA 2ZR4A 5D75A 1D7IA 4Q22A 5GPGA 2DPEA 3O5GA 1D2KA 4WK9A 3KAFA 4R0XA 4WKFA 2F23A 3LUOA 2YBUA 3BXWA 1ZCNA 4JYSA 4J4NA 1WB0A 5HTGA 2Q5AA 3CGNA 1X6LA 1W1VA 3WQWA 1GOIA 1QPLA 4NNRA 1ZBCA 2A3CA 1PINA 3MDYB 1Q6HA 4IQ2A 2M1IA 2FKEA 1O6IA 3WQVA 3UI6A 3UQAA 4ODMA 4Z2HA 1JVWA 3CH9A 4DRPA 4XAKA 3PA7A 3ARXA 2WM0A 4ODKA 2PI6A 3NTPA 5I98A 3PRDA 4DWSD 2M08A 1KT1A 2B5UB 3RMEA 1ROUA 2RUQA 4ODOA 4DRKA 3ARQA 4DWSA 3NRKA 4P8XA 4JFJA 3WD1A 1UR8A 2XP3A 4G50A 2O9OA 1W1YA 5HT1A 1ZK6A 1NMVA 4ODRA 3BMBA 3TDBA 3JXVA 4W5UA 1VF8A 1E6PA 1HJWA 1YW5A 4MGVA 1NWTA 1KFWA 5HUAA 2ZQTA 4R5EA 2N87A 1B6CA 1LG1A 2WLZA 2XP7A 1KT0A 1E6RA 4TW6A 4ZPVR 1JNDA 2PV2A 2MNTA 4LAWA 4Z2LA 1LQ0A 4HARA 4MPKA 2UZ5A 1FKSA 2WLYA 1Y0OA 1FKBA 1LG2A 2F21A 4DZ3A 4WJXA 4W9QA 2PN0A 3WL0A 4Q7NA 4TX0A 4Z2IA 2IUZA 5DIUA 1FJDA 2XP9A 2ESCA 3B9DA 3UQIA 4Z2KA 4WKHA 1FKGA 3B7XA 4MNJA 2O92A 3PR9A 1FKLA 1D6OA 2ZQVA 1HKKA 1T11A 3RM9A 4IT4A 1ZBKA 2PV1A 1FFQA 1ZBWA 2YBTA 4TW8A 3UI4A 4QT2A 2RQSA 3GPKA 3O5DA 3B8SA 4NZCA 4DRNA 4JFLA 1WNOA 3RM8A 4DROA 3O5FA 3O5OA 3WH0A 1JCHB 3GU0A 3KAHA 1BKFA 4MNLA 5HWCA 4U84A 1FKHA 1J4IA 1LJYA 5HW8A 4L3NA 1J4RA 3WKZA 2XP6A 3ALGA 1Q6UA 4MNKA 2MF9A 3WL1A 1M5YA 5DITA 4ZPTR 1L1PA 1R9HA 4G2PA 1LL7A 4S3JA 2PPNA 2LPVA 4IQCA 4WIWA 2MPHA 2RURA 2ETNA 2KE0A 2MLZA 3WD2A 2DT0A 2F4EA 3AS2A 4W9OA 1GRJA 4Z2JA 4U86A 1NWUA 3CHCA
chains in the Genus database with same CATH topology
4Z2GA 1JNSA 2ZR6A 4HBEA 2G41A 1HJXA 2OFNA 3UF8A 3UI5A 3FAPA 3O5RA 1U79A 4TNSA 2RSEA 1OWQA 4BF8A 2LGOA 2PBCA 4U85A 2DG9A 4ODQA 1GUVA 2KI3A 1E6ZA 5DEZA 1FKRA 2PPOA 1BL4A 4NSBA 1HJVA 4P8UA 3CHEA 1LL4A 3VAWA 4IT6A 1N1AA 2L2SA 4IPXA 4ODLA 2DT1A 2DSUA 2JZVA 3OA5A 1ZU8A 1NWSA 2KFWA 2RUCA 3PRBA 4MNMA 4JFKA 4KR0B 3JYJA 2IF4A 3O5LA 1TFVA 4LAXA 4LGXA 1FAPA 5HWBA 1JNEA 3IK8A 4QZVB 2DT3A 1HKMA 2XPAA 3OOBA 4TYOA 3CHFA 4O2TA 2AWGA 4ODPA 2WK2A 4WKAA 1J6YA 2MLXA 4L72B 3AQUA 5HW7A 2ITKA 4MAVA 3ARVA 1NMWA 1OGGA 2VCDA 2XPBA 4JFMA 1D7HA 2DSVA 1ROTA 3ARSA 1W1TA 3IHZA 4ODNA 1C9HA 1W9VA 5DIVA 2XP8A 1SYTA 2ZQUA 1CTNA 5GQBA 4P8VA 5HKGA 4DWSB 5DO2A 3ARTA 4QT3A 2FDMA 1LL6A 5HBFA 1E9LA 3CGMA 3KAIA 2OLHA 1ZL1A 3AROA 1EIBA 2DG4A 1E6NA 3O5JA 4W9PA 4MSPA 1ZB5A 2PV3A 4URIA 3O5QA 1XRVA 4JFIA 3WIJA 1QPFA 2F2DA 2G8ZA 3G6MA 2QF8A 3KABA 3FXYA 3KCEA 3G6LA 3RFWA 5HW6A 3O5KA 1ITXA 3IKDA 1NH6A 2VN1A 2ZR5A 3UQBA 1H0GA 1H0IA 3KAGA 4GGQA 2PPPA 1Q1CA 3ALFA 4C02B 4P8WA 3WD0A 2FAPA 1A7XA 2RUDA 2XP4A 3B9EA 3AS3A 5GPRA 2DSZA 1XHGA 3AS1A 4TW7A 2KO7A 3QOKA 4ZPWR 2KR7A 3ARRA 4ITZA 1W9PA 3PRAA 1HKJA 2M2AA 1E15A 1D7JA 1J4HA 3FY1A 3ARZA 1QZ2A 2KGJA 3H9RB 3CHDA 4FN2A 2XP5A 4ML4A 3ARPA 1NSGA 2LKNA 4DRQA 4DWSC 5B8IC 1K9TA 3I6CA 2MLYA 3EY6A 1SR0A 1RD6A 3W4RA 1WAWA 1FKJA 1W9UA 4HBOA 4DIPA 1ZBVA 4LAVA 1TCOC 3B9AA 5BXJA 4QIBA 4DRIA 3RGCA 3IKGA 3O5PA 2A3EA 1F8AB 3CZ8A 1HXVA 4DRJA 1EYMA 3KACA 1W1PA 3WD3A 1FKFA 1EQ3A 2DSWA 1FKTA 1Q6IA 3JYMA 2A3AA 5DF0A 1FKDA 1UR9A 2DT2A 3O5IA 1YATA 1GPFA 3ODKA 4J4OA 4DT4A 1IX5A 4DH0A 3KZ7A 1W26A 2Y78A 4AY1A 3O5MA 2K8IA 1FKIA 1PBKA 1FFRA 1NWRA 4N19A 3NI6A 5JH8A 2AOSA 1HKIA 3ARUA 3ARYA 4DRMA 4KQZA 4DRHA 4GIVA 1EHNA 4S3KA 2LJ4A 4PTMA 3O5EA 1OGBA 4FAPA 2D9FA 4MTVA 1X6NA 3TC5A 1F40A 2ZQSA 2DG3A 2B31A 3ARWA 4LAYA 5J6EA 1EDQA 1P5QA 1JNTA 3WD4A 1FD9A 3TCZA 4ZS6A 3AS0A 2A3BA 3KADA 4DZ2A 3RM4A 1FKKA 2ZR4A 5D75A 1D7IA 4Q22A 5GPGA 2DPEA 3O5GA 1D2KA 4WK9A 3KAFA 4R0XA 4WKFA 3LUOA 2YBUA 3BXWA 1ZCNA 4JYSA 4J4NA 1WB0A 5HTGA 2Q5AA 3CGNA 1X6LA 1W1VA 3WQWA 1GOIA 1QPLA 4NNRA 1ZBCA 2A3CA 1PINA 3MDYB 1Q6HA 4IQ2A 2M1IA 2FKEA 1O6IA 3WQVA 3UI6A 3UQAA 4ODMA 4Z2HA 1JVWA 3CH9A 4DRPA 4XAKA 3PA7A 3ARXA 2WM0A 4ODKA 2PI6A 3NTPA 5I98A 3PRDA 4DWSD 2M08A 1KT1A 3RMEA 1ROUA 2RUQA 4ODOA 4DRKA 3ARQA 4DWSA 3NRKA 4P8XA 4JFJA 3WD1A 1UR8A 2XP3A 4G50A 2O9OA 1W1YA 5HT1A 1ZK6A 1NMVA 4ODRA 3TDBA 3JXVA 4W5UA 1VF8A 1E6PA 1HJWA 1YW5A 4MGVA 1NWTA 1KFWA 5HUAA 2ZQTA 4R5EA 2N87A 1B6CA 1LG1A 2WLZA 2XP7A 1KT0A 1E6RA 4TW6A 4ZPVR 1JNDA 2PV2A 2MNTA 4LAWA 4Z2LA 1LQ0A 4HARA 4MPKA 2UZ5A 1FKSA 2WLYA 1Y0OA 1FKBA 1LG2A 2F21A 4DZ3A 4WJXA 4W9QA 3WL0A 4Q7NA 4TX0A 4Z2IA 2IUZA 5DIUA 1FJDA 2XP9A 2ESCA 3B9DA 3UQIA 4Z2KA 4WKHA 1FKGA 3B7XA 4MNJA 2O92A 3PR9A 1FKLA 1D6OA 2ZQVA 1HKKA 1T11A 3RM9A 4IT4A 1ZBKA 2PV1A 1FFQA 1ZBWA 2YBTA 4TW8A 3UI4A 4QT2A 2RQSA 3GPKA 3O5DA 3B8SA 4NZCA 4DRNA 4JFLA 1WNOA 3RM8A 4DROA 3O5FA 3O5OA 3WH0A 3KAHA 1BKFA 4MNLA 5HWCA 4U84A 1FKHA 1J4IA 1LJYA 5HW8A 4L3NA 1J4RA 3WKZA 2XP6A 3ALGA 1Q6UA 4MNKA 2MF9A 3WL1A 1M5YA 5DITA 4ZPTR 1L1PA 1R9HA 4G2PA 1LL7A 4S3JA 2PPNA 2LPVA 4IQCA 4WIWA 2MPHA 2RURA 2KE0A 2MLZA 3WD2A 2DT0A 2F4EA 3AS2A 4W9OA 4Z2JA 4U86A 1NWUA 3CHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAB A;  1JNS A;  3KCE A;  2ZR6 A;  3TDB A;  4DRM A;  3JXV A;  2OFN A;  3UF8 A;  3UI5 A;  1YW5 A;  3RFW A;  5HW6 A;  3O5K A;  3FAP A;  3IKD A;  2VN1 A;  3O5R A;  4MGV A;  2ZR5 A;  4DRH A;  1U79 A;  4TNS A;  2RSE A;  5HUA A;  3KAG A;  4GGQ A;  3UQB A;  2ZQT A;  4GIV A;  4BF8 A;  2LGO A;  2PBC A;  2N87 A;  2LJ4 A;  4U85 A;  1B6C A;  2DG9 A;  4ODQ A;  3O5E A;  2KI3 A;  2PPP A;  2XP7 A;  1FKR A;  4FAP A;  2D9F A;  1Q1C A;  1KT0 A;  2PPO A;  3TC5 A;  4C02 B;  1F40 A;  4TW6 A;  1BL4 A;  2ZQS A;  2DG3 A;  3VAW A;  2FAP A;  1A7X A;  2PV2 A;  2MNT A;  2RUD A;  2XP4 A;  4LAW A;  4LAY A;  5J6E A;  1N1A A;  2UZ5 A;  1P5Q A;  2L2S A;  1JNT A;  1FKS A;  2KO7 A;  4IPX A;  4ODL A;  4TW7 A;  1FD9 A;  3TCZ A;  2KR7 A;  1Y0O A;  2JZV A;  4ITZ A;  3KAD A;  2KFW A;  2RUC A;  4DZ2 A;  2M2A A;  1FKB A;  3PRB A;  1D7J A;  1FKK A;  2F21 A;  1J4H A;  2ZR4 A;  4DZ3 A;  1QZ2 A;  4JFK A;  2KGJ A;  5D75 A;  4W9Q A;  1D7I A;  5GPG A;  3H9R B;  4FN2 A;  2XP5 A;  3O5G A;  4TX0 A;  3JYJ A;  5DIU A;  1FJD A;  2IF4 A;  3KAF A;  3O5L A;  2XP9 A;  3UQI A;  1NSG A;  4R0X A;  4LAX A;  2LKN A;  4DRQ A;  1FAP A;  5B8I C;  5HWB A;  3LUO A;  3IK8 A;  3I6C A;  1FKG A;  1ZCN A;  2MLY A;  3B7X A;  3EY6 A;  4JYS A;  2XPA A;  1FKL A;  1D6O A;  2ZQV A;  1T11 A;  3OOB A;  4TYO A;  4J4N A;  2PV1 A;  2AWG A;  4O2T A;  4ODP A;  4TW8 A;  3UI4 A;  5HTG A;  2Q5A A;  3CGN A;  4QT2 A;  2RQS A;  3GPK A;  3O5D A;  1FKJ A;  1QPL A;  4DIP A;  1J6Y A;  4DRN A;  4NNR A;  2MLX A;  4JFL A;  4LAV A;  5HW7 A;  4DRO A;  2ITK A;  3O5F A;  1NMW A;  1TCO C;  2VCD A;  3O5O A;  5BXJ A;  2XPB A;  4JFM A;  4QIB A;  3WH0 A;  1D7H A;  1PIN A;  1ROT A;  3IHZ A;  3KAH A;  3MDY B;  1Q6H A;  4IQ2 A;  1C9H A;  1BKF A;  2M1I A;  4ODN A;  2FKE A;  5DIV A;  3RGC A;  5HWC A;  4U84 A;  3IKG A;  1FKH A;  1J4I A;  3UI6 A;  3UQA A;  2XP8 A;  3O5P A;  4ODM A;  5HW8 A;  1F8A B;  2ZQU A;  1HXV A;  1J4R A;  4DRJ A;  1EYM A;  2XP6 A;  3KAC A;  5HKG A;  1JVW A;  4DRP A;  1Q6U A;  3PA7 A;  1FKF A;  4QT3 A;  2MF9 A;  1EQ3 A;  1FKT A;  1M5Y A;  1Q6I A;  4ODK A;  3NTP A;  3JYM A;  5DIT A;  1L1P A;  1R9H A;  4G2P A;  5I98 A;  1FKD A;  2PPN A;  3PRD A;  3CGM A;  3KAI A;  2M08 A;  2LPV A;  4IQC A;  1KT1 A;  2DG4 A;  3O5I A;  2MPH A;  1YAT A;  2RUR A;  2KE0 A;  2MLZ A;  3ODK A;  4J4O A;  4DT4 A;  3O5J A;  4W9P A;  4MSP A;  4DH0 A;  1ROU A;  3KZ7 A;  1W26 A;  2RUQ A;  2F4E A;  2Y78 A;  2PV3 A;  4ODO A;  4DRK A;  3O5M A;  2K8I A;  3O5Q A;  3NRK A;  1FKI A;  1PBK A;  4W9O A;  4JFJ A;  4DRI A;  2XP3 A;  4G50 A;  4JFI A;  5HT1 A;  4N19 A;  4U86 A;  3NI6 A;  1QPF A;  2F2D A;  1ZK6 A;  1NMV A;  4ODR A; 
#chains in the Genus database with same CATH topology
 1E44 A;  4Z2G A;  1JNS A;  2ZR6 A;  4HBE A;  2G41 A;  1HJX A;  2OFN A;  3UF8 A;  3UI5 A;  3FAP A;  3O5R A;  1U79 A;  4TNS A;  2RSE A;  1OWQ A;  4BF8 A;  2LGO A;  2PBC A;  4U85 A;  2DG9 A;  4ODQ A;  1GUV A;  2KI3 A;  1E6Z A;  5DEZ A;  1FKR A;  2PPO A;  1BL4 A;  4NSB A;  1HJV A;  4P8U A;  3CHE A;  1LL4 A;  3VAW A;  4IT6 A;  1N1A A;  2L2S A;  4IPX A;  4ODL A;  2DT1 A;  2DSU A;  2JZV A;  3OA5 A;  1ZU8 A;  1NWS A;  2KFW A;  2RUC A;  3PRB A;  4MNM A;  4JFK A;  4KR0 B;  3JYJ A;  2IF4 A;  3O5L A;  1TFV A;  4LAX A;  4LGX A;  1FAP A;  5HWB A;  1JNE A;  3IK8 A;  4QZV B;  2DT3 A;  1HKM A;  2XPA A;  2EUL A;  3OOB A;  4TYO A;  3CHF A;  4O2T A;  2AWG A;  4ODP A;  2WK2 A;  4WKA A;  1J6Y A;  2MLX A;  4L72 B;  3AQU A;  4UDM A;  5HW7 A;  2ITK A;  4MAV A;  3ARV A;  1NMW A;  1OGG A;  2VCD A;  2XPB A;  4JFM A;  1D7H A;  2DSV A;  1ROT A;  3ARS A;  1W1T A;  3IHZ A;  4ODN A;  1C9H A;  1W9V A;  5DIV A;  2XP8 A;  1SYT A;  2ZQU A;  1CTN A;  5GQB A;  4P8V A;  5HKG A;  4DWS B;  5DO2 A;  3ART A;  4QT3 A;  2P4V A;  2FDM A;  1LL6 A;  5HBF A;  1E9L A;  3CGM A;  3KAI A;  2OLH A;  1ZL1 A;  3ARO A;  1EIB A;  2DG4 A;  1E6N A;  3O5J A;  4W9P A;  4MSP A;  1ZB5 A;  2PV3 A;  4URI A;  3O5Q A;  1XRV A;  4JFI A;  3WIJ A;  1QPF A;  2F2D A;  2G8Z A;  3G6M A;  2QF8 A;  3KAB A;  3FXY A;  3KCE A;  3G6L A;  3RFW A;  5HW6 A;  3O5K A;  1ITX A;  3IKD A;  1NH6 A;  2VN1 A;  2ZR5 A;  3UQB A;  1H0G A;  1H0I A;  3KAG A;  4GGQ A;  2PPP A;  1Q1C A;  3ALF A;  4C02 B;  4P8W A;  3WD0 A;  2FAP A;  1A7X A;  2RUD A;  2XP4 A;  3B9E A;  3AS3 A;  5GPR A;  2DSZ A;  1XHG A;  3AS1 A;  4TW7 A;  2KO7 A;  3QOK A;  4ZPW R;  2KR7 A;  3ARR A;  4ITZ A;  1W9P A;  3PRA A;  1HKJ A;  2M2A A;  1E15 A;  1D7J A;  1J4H A;  3FY1 A;  3ARZ A;  1QZ2 A;  2KGJ A;  3H9R B;  3CHD A;  4FN2 A;  2XP5 A;  4ML4 A;  3ARP A;  1NSG A;  2LKN A;  4DRQ A;  4DWS C;  5B8I C;  1K9T A;  3I6C A;  2MLY A;  3EY6 A;  3GTY X;  1SR0 A;  1RD6 A;  3W4R A;  1WAW A;  1FKJ A;  1W9U A;  4HBO A;  4DIP A;  1ZBV A;  4LAV A;  1TCO C;  3B9A A;  5BXJ A;  4QIB A;  4DRI A;  3RGC A;  3IKG A;  3O5P A;  2A3E A;  1F8A B;  3CZ8 A;  1HXV A;  4DRJ A;  1EYM A;  3KAC A;  1W1P A;  3WD3 A;  1FKF A;  1EQ3 A;  2DSW A;  1FKT A;  1Q6I A;  3JYM A;  2A3A A;  5DF0 A;  1FKD A;  1UR9 A;  2DT2 A;  3O5I A;  1YAT A;  1GPF A;  3EIP A;  3ODK A;  4J4O A;  4DT4 A;  1IX5 A;  4DH0 A;  3KZ7 A;  1W26 A;  2Y78 A;  4AY1 A;  3O5M A;  2K8I A;  1FKI A;  1PBK A;  1FFR A;  1NWR A;  4N19 A;  3NI6 A;  5JH8 A;  2AOS A;  1HKI A;  3ARU A;  3ARY A;  4DRM A;  4KQZ A;  4DRH A;  4GIV A;  1EHN A;  4S3K A;  2LJ4 A;  4PTM A;  3O5E A;  1OGB A;  4FAP A;  2D9F A;  4MTV A;  1X6N A;  3TC5 A;  1F40 A;  2ZQS A;  2DG3 A;  2B31 A;  3ARW A;  4LAY A;  5J6E A;  1EDQ A;  1P5Q A;  1JNT A;  3WD4 A;  1FD9 A;  3TCZ A;  4ZS6 A;  3AS0 A;  2A3B A;  3KAD A;  4DZ2 A;  3RM4 A;  1FKK A;  2ZR4 A;  5D75 A;  1D7I A;  4Q22 A;  5GPG A;  2DPE A;  3O5G A;  1D2K A;  4WK9 A;  3KAF A;  4R0X A;  4WKF A;  2F23 A;  3LUO A;  2YBU A;  3BXW A;  1ZCN A;  4JYS A;  4J4N A;  1WB0 A;  5HTG A;  2Q5A A;  3CGN A;  1X6L A;  1W1V A;  3WQW A;  1GOI A;  1QPL A;  4NNR A;  1ZBC A;  2A3C A;  1PIN A;  3MDY B;  1Q6H A;  4IQ2 A;  2M1I A;  2FKE A;  1O6I A;  3WQV A;  3UI6 A;  3UQA A;  4ODM A;  4Z2H A;  1JVW A;  3CH9 A;  4DRP A;  4XAK A;  3PA7 A;  3ARX A;  2WM0 A;  4ODK A;  2PI6 A;  3NTP A;  5I98 A;  3PRD A;  4DWS D;  2M08 A;  1KT1 A;  2B5U B;  3RME A;  1ROU A;  2RUQ A;  4ODO A;  4DRK A;  3ARQ A;  4DWS A;  3NRK A;  4P8X A;  4JFJ A;  3WD1 A;  1UR8 A;  2XP3 A;  4G50 A;  2O9O A;  1W1Y A;  5HT1 A;  1ZK6 A;  1NMV A;  4ODR A;  3BMB A;  3TDB A;  3JXV A;  4W5U A;  1VF8 A;  1E6P A;  1HJW A;  1YW5 A;  4MGV A;  1NWT A;  1KFW A;  5HUA A;  2ZQT A;  4R5E A;  2N87 A;  1B6C A;  1LG1 A;  2WLZ A;  2XP7 A;  1KT0 A;  1E6R A;  4TW6 A;  4ZPV R;  1JND A;  2PV2 A;  2MNT A;  4LAW A;  4Z2L A;  1LQ0 A;  4HAR A;  4MPK A;  2UZ5 A;  1FKS A;  2WLY A;  1Y0O A;  1FKB A;  1LG2 A;  2F21 A;  4DZ3 A;  4WJX A;  4W9Q A;  2PN0 A;  3WL0 A;  4Q7N A;  4TX0 A;  4Z2I A;  2IUZ A;  5DIU A;  1FJD A;  2XP9 A;  2ESC A;  3B9D A;  3UQI A;  4Z2K A;  4WKH A;  1FKG A;  3B7X A;  4MNJ A;  2O92 A;  3PR9 A;  1FKL A;  1D6O A;  2ZQV A;  1HKK A;  1T11 A;  3RM9 A;  4IT4 A;  1ZBK A;  2PV1 A;  1FFQ A;  1ZBW A;  2YBT A;  4TW8 A;  3UI4 A;  4QT2 A;  2RQS A;  3GPK A;  3O5D A;  3B8S A;  4NZC A;  4DRN A;  4JFL A;  1WNO A;  3RM8 A;  4DRO A;  3O5F A;  3O5O A;  3WH0 A;  1JCH B;  3GU0 A;  3KAH A;  1BKF A;  4MNL A;  5HWC A;  4U84 A;  1FKH A;  1J4I A;  1LJY A;  5HW8 A;  4L3N A;  1J4R A;  3WKZ A;  2XP6 A;  3ALG A;  1Q6U A;  4MNK A;  2MF9 A;  3WL1 A;  1M5Y A;  5DIT A;  4ZPT R;  1L1P A;  1R9H A;  4G2P A;  1LL7 A;  4S3J A;  2PPN A;  2LPV A;  4IQC A;  4WIW A;  2MPH A;  2RUR A;  2ETN A;  2KE0 A;  2MLZ A;  3WD2 A;  2DT0 A;  2F4E A;  3AS2 A;  4W9O A;  1GRJ A;  4Z2J A;  4U86 A;  1NWU A;  3CHC A; 
#chains in the Genus database with same CATH homology
 4Z2G A;  1JNS A;  2ZR6 A;  4HBE A;  2G41 A;  1HJX A;  2OFN A;  3UF8 A;  3UI5 A;  3FAP A;  3O5R A;  1U79 A;  4TNS A;  2RSE A;  1OWQ A;  4BF8 A;  2LGO A;  2PBC A;  4U85 A;  2DG9 A;  4ODQ A;  1GUV A;  2KI3 A;  1E6Z A;  5DEZ A;  1FKR A;  2PPO A;  1BL4 A;  4NSB A;  1HJV A;  4P8U A;  3CHE A;  1LL4 A;  3VAW A;  4IT6 A;  1N1A A;  2L2S A;  4IPX A;  4ODL A;  2DT1 A;  2DSU A;  2JZV A;  3OA5 A;  1ZU8 A;  1NWS A;  2KFW A;  2RUC A;  3PRB A;  4MNM A;  4JFK A;  4KR0 B;  3JYJ A;  2IF4 A;  3O5L A;  1TFV A;  4LAX A;  4LGX A;  1FAP A;  5HWB A;  1JNE A;  3IK8 A;  4QZV B;  2DT3 A;  1HKM A;  2XPA A;  3OOB A;  4TYO A;  3CHF A;  4O2T A;  2AWG A;  4ODP A;  2WK2 A;  4WKA A;  1J6Y A;  2MLX A;  4L72 B;  3AQU A;  5HW7 A;  2ITK A;  4MAV A;  3ARV A;  1NMW A;  1OGG A;  2VCD A;  2XPB A;  4JFM A;  1D7H A;  2DSV A;  1ROT A;  3ARS A;  1W1T A;  3IHZ A;  4ODN A;  1C9H A;  1W9V A;  5DIV A;  2XP8 A;  1SYT A;  2ZQU A;  1CTN A;  5GQB A;  4P8V A;  5HKG A;  4DWS B;  5DO2 A;  3ART A;  4QT3 A;  2FDM A;  1LL6 A;  5HBF A;  1E9L A;  3CGM A;  3KAI A;  2OLH A;  1ZL1 A;  3ARO A;  1EIB A;  2DG4 A;  1E6N A;  3O5J A;  4W9P A;  4MSP A;  1ZB5 A;  2PV3 A;  4URI A;  3O5Q A;  1XRV A;  4JFI A;  3WIJ A;  1QPF A;  2F2D A;  2G8Z A;  3G6M A;  2QF8 A;  3KAB A;  3FXY A;  3KCE A;  3G6L A;  3RFW A;  5HW6 A;  3O5K A;  1ITX A;  3IKD A;  1NH6 A;  2VN1 A;  2ZR5 A;  3UQB A;  1H0G A;  1H0I A;  3KAG A;  4GGQ A;  2PPP A;  1Q1C A;  3ALF A;  4C02 B;  4P8W A;  3WD0 A;  2FAP A;  1A7X A;  2RUD A;  2XP4 A;  3B9E A;  3AS3 A;  5GPR A;  2DSZ A;  1XHG A;  3AS1 A;  4TW7 A;  2KO7 A;  3QOK A;  4ZPW R;  2KR7 A;  3ARR A;  4ITZ A;  1W9P A;  3PRA A;  1HKJ A;  2M2A A;  1E15 A;  1D7J A;  1J4H A;  3FY1 A;  3ARZ A;  1QZ2 A;  2KGJ A;  3H9R B;  3CHD A;  4FN2 A;  2XP5 A;  4ML4 A;  3ARP A;  1NSG A;  2LKN A;  4DRQ A;  4DWS C;  5B8I C;  1K9T A;  3I6C A;  2MLY A;  3EY6 A;  1SR0 A;  1RD6 A;  3W4R A;  1WAW A;  1FKJ A;  1W9U A;  4HBO A;  4DIP A;  1ZBV A;  4LAV A;  1TCO C;  3B9A A;  5BXJ A;  4QIB A;  4DRI A;  3RGC A;  3IKG A;  3O5P A;  2A3E A;  1F8A B;  3CZ8 A;  1HXV A;  4DRJ A;  1EYM A;  3KAC A;  1W1P A;  3WD3 A;  1FKF A;  1EQ3 A;  2DSW A;  1FKT A;  1Q6I A;  3JYM A;  2A3A A;  5DF0 A;  1FKD A;  1UR9 A;  2DT2 A;  3O5I A;  1YAT A;  1GPF A;  3ODK A;  4J4O A;  4DT4 A;  1IX5 A;  4DH0 A;  3KZ7 A;  1W26 A;  2Y78 A;  4AY1 A;  3O5M A;  2K8I A;  1FKI A;  1PBK A;  1FFR A;  1NWR A;  4N19 A;  3NI6 A;  5JH8 A;  2AOS A;  1HKI A;  3ARU A;  3ARY A;  4DRM A;  4KQZ A;  4DRH A;  4GIV A;  1EHN A;  4S3K A;  2LJ4 A;  4PTM A;  3O5E A;  1OGB A;  4FAP A;  2D9F A;  4MTV A;  1X6N A;  3TC5 A;  1F40 A;  2ZQS A;  2DG3 A;  2B31 A;  3ARW A;  4LAY A;  5J6E A;  1EDQ A;  1P5Q A;  1JNT A;  3WD4 A;  1FD9 A;  3TCZ A;  4ZS6 A;  3AS0 A;  2A3B A;  3KAD A;  4DZ2 A;  3RM4 A;  1FKK A;  2ZR4 A;  5D75 A;  1D7I A;  4Q22 A;  5GPG A;  2DPE A;  3O5G A;  1D2K A;  4WK9 A;  3KAF A;  4R0X A;  4WKF A;  3LUO A;  2YBU A;  3BXW A;  1ZCN A;  4JYS A;  4J4N A;  1WB0 A;  5HTG A;  2Q5A A;  3CGN A;  1X6L A;  1W1V A;  3WQW A;  1GOI A;  1QPL A;  4NNR A;  1ZBC A;  2A3C A;  1PIN A;  3MDY B;  1Q6H A;  4IQ2 A;  2M1I A;  2FKE A;  1O6I A;  3WQV A;  3UI6 A;  3UQA A;  4ODM A;  4Z2H A;  1JVW A;  3CH9 A;  4DRP A;  4XAK A;  3PA7 A;  3ARX A;  2WM0 A;  4ODK A;  2PI6 A;  3NTP A;  5I98 A;  3PRD A;  4DWS D;  2M08 A;  1KT1 A;  3RME A;  1ROU A;  2RUQ A;  4ODO A;  4DRK A;  3ARQ A;  4DWS A;  3NRK A;  4P8X A;  4JFJ A;  3WD1 A;  1UR8 A;  2XP3 A;  4G50 A;  2O9O A;  1W1Y A;  5HT1 A;  1ZK6 A;  1NMV A;  4ODR A;  3TDB A;  3JXV A;  4W5U A;  1VF8 A;  1E6P A;  1HJW A;  1YW5 A;  4MGV A;  1NWT A;  1KFW A;  5HUA A;  2ZQT A;  4R5E A;  2N87 A;  1B6C A;  1LG1 A;  2WLZ A;  2XP7 A;  1KT0 A;  1E6R A;  4TW6 A;  4ZPV R;  1JND A;  2PV2 A;  2MNT A;  4LAW A;  4Z2L A;  1LQ0 A;  4HAR A;  4MPK A;  2UZ5 A;  1FKS A;  2WLY A;  1Y0O A;  1FKB A;  1LG2 A;  2F21 A;  4DZ3 A;  4WJX A;  4W9Q A;  3WL0 A;  4Q7N A;  4TX0 A;  4Z2I A;  2IUZ A;  5DIU A;  1FJD A;  2XP9 A;  2ESC A;  3B9D A;  3UQI A;  4Z2K A;  4WKH A;  1FKG A;  3B7X A;  4MNJ A;  2O92 A;  3PR9 A;  1FKL A;  1D6O A;  2ZQV A;  1HKK A;  1T11 A;  3RM9 A;  4IT4 A;  1ZBK A;  2PV1 A;  1FFQ A;  1ZBW A;  2YBT A;  4TW8 A;  3UI4 A;  4QT2 A;  2RQS A;  3GPK A;  3O5D A;  3B8S A;  4NZC A;  4DRN A;  4JFL A;  1WNO A;  3RM8 A;  4DRO A;  3O5F A;  3O5O A;  3WH0 A;  3KAH A;  1BKF A;  4MNL A;  5HWC A;  4U84 A;  1FKH A;  1J4I A;  1LJY A;  5HW8 A;  4L3N A;  1J4R A;  3WKZ A;  2XP6 A;  3ALG A;  1Q6U A;  4MNK A;  2MF9 A;  3WL1 A;  1M5Y A;  5DIT A;  4ZPT R;  1L1P A;  1R9H A;  4G2P A;  1LL7 A;  4S3J A;  2PPN A;  2LPV A;  4IQC A;  4WIW A;  2MPH A;  2RUR A;  2KE0 A;  2MLZ A;  3WD2 A;  2DT0 A;  2F4E A;  3AS2 A;  4W9O A;  4Z2J A;  4U86 A;  1NWU A;  3CHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...