4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
3B7XA 3ODKA 1BL4A 3KAFA 4ODNA 1F40A 4ODOA 3IHZA 4DZ2A 2RURA 4LAXA 3JXVA 1NMWA 2PV3A 1FKGA 1B6CA 1FKLA 5BXJA 1KT1A 1Q1CA 4BF8A 2MLZA 2Q5AA 2DG4A 4GGQA 4JFIA 2PV1A 4W9PA 5DIUA 1EQ3A 3KACA 2FAPA 2MF9A 1TCOC 2LJ4A 2M2AA 2XPAA 3NI6A 4MSPA 2ZQTA 4U86A 5DIVA 4ODLA 4C02B 2M1IA 1JVWA 2XP8A 5HUAA 2ZR4A 4R0XA 1FAPA 4DRHA 3O5EA 1PINA 1ZCNA 2KE0A 2MNTA 2UZ5A 3O5FA 1J4IA 4NNRA 1T11A 4JFLA 3O5JA 3PRBA 4FAPA 3O5IA 2RQSA 2F2DA 3I6CA 2PPNA 5HW8A 4QT2A 3O5GA 3NRKA 1C9HA 2DG3A 2ZQUA 3TDBA 1J4RA 5J6EA 3TCZA 2Y78A 2KGJA 1P5QA 5HW7A 3IKGA 2ZR5A 4JFJA 3UQBA 3RGCA 2F21A 3UQIA 1J4HA 5B8IC 1NMVA 1FKKA 1PBKA 3JYJA 5HTGA 1YATA 4JFKA 1W26A 3H9RB 1FD9A 1A7XA 5DITA 1D7JA 1ROTA 3PA7A 3O5MA 5HKGA 5D75A 2RUDA 1JNTA 4N19A 1J6YA 2LKNA 4JYSA 4DRIA 2OFNA 4U85A 5HWCA 4ODMA 1FKJA 2LPVA 3PRDA 2KO7A 2PPPA 2XP7A 1D6OA 3LUOA 2RUQA 3JYMA 3O5DA 4ODRA 4DRPA 1FKBA 4FN2A 4DRQA 2XPBA 1FKRA 1N1AA 2PPOA 3UI6A 2XP3A 4TX0A 2M08A 3UI4A 3CGNA 3KAHA 2AWGA 2MLXA 2ZQSA 2ITKA 3TC5A 4DT4A 4LAVA 5HW6A 3FAPA 3KAGA 1F8AB 5GPGA 4G50A 2LGOA 4U84A 3UI5A 4GIVA 1Q6UA 2XP6A 3GPKA 2XP5A 3CGMA 4IQ2A 4TW7A 1QZ2A 4ODQA 1U79A 2MPHA 2RSEA 3KABA 2KR7A 4DROA 1D7IA 1BKFA 4ITZA 4DRKA 1HXVA 2VN1A 1FKFA 4MGVA 1M5YA 2PV2A 3RFWA 3VAWA 2FKEA 4TW6A 4G2PA 1JNSA 1L1PA 4DZ3A 3KADA 3O5PA 5HWBA 3EY6A 1FJDA 3NTPA 1FKTA 2XP4A 1NSGA 4ODKA 1QPLA 2KFWA 2RUCA 1YW5A 4TYOA 1Q6HA 4IQCA 2D9FA 2PBCA 3IK8A 1Y0OA 4DRNA 3UF8A 4TW8A 1ROUA 4ODPA 2KI3A 4W9QA 2ZR6A 1FKDA 3O5OA 4J4OA 4DRJA 3O5RA 3OOBA 4TNSA 1R9HA 4DH0A 3KAIA 2F4EA 3MDYB 3IKDA 3UQAA 4QIBA 2VCDA 3O5LA 2JZVA 1KT0A 2K8IA 3KCEA 1FKHA 2N87A 2L2SA 2XP9A 1Q6IA 3KZ7A 1D7HA 4IPXA 4JFMA 4QT3A 4DRMA 1FKSA 2MLYA 4LAWA 2ZQVA 3O5KA 4DIPA 4J4NA 4O2TA 4W9OA 2DG9A 3WH0A 5I98A 3O5QA 4LAYA 1FKIA 1QPFA 5HT1A 1ZK6A 1EYMA 2IF4A
chains in the Genus database with same CATH superfamily
3ODKA 1LG1A 5DO2A 3WD4A 2RURA 2F23A 1H0IA 1NWSA 3JXVA 1KT1A 4BF8A 1O6IA 2DG4A 3B9DA 1E6PA 1E44A 1EQ3A 3KACA 3RM9A 2XPAA 4DWSB 4C02B 1NH6A 2XP8A 1JVWA 3ARZA 4L72B 1ZCNA 3O5JA 2F2DA 1C9HA 2DG3A 2Y78A 3FY1A 5HW7A 3IKGA 3ARQA 3RGCA 3UQIA 1J4HA 1GPFA 3W4RA 1JCHB 5GPRA 1FD9A 2EULA 5DF0A 1IX5A 3PA7A 4KQZA 4S3JA 3O5MA 5HKGA 3AQUA 4Z2HA 4Z2JA 1JNTA 1W9PA 1E6RA 4DRIA 4Z2GA 1HKJA 3ALGA 3CHFA 1UR8A 2QF8A 4UDMA 3LUOA 2RUQA 4DRPA 1N1AA 4ML4A 1HKMA 1VF8A 2MLXA 1GOIA 4LAVA 3B9EA 4MNMA 3AS2A 5GPGA 1WNOA 1ZBWA 5DEZA 1W1VA 4MNLA 2XP5A 3CGMA 4IQ2A 4TW7A 4MNJA 2ETNA 4MNKA 4DROA 2KR7A 1D7IA 4DRKA 4P8WA 2VN1A 3VAWA 2FKEA 1HJVA 4TW6A 1EHNA 3CH9A 4HBEA 3ALFA 1ZBVA 3WQWA 2XP4A 1NSGA 1RD6A 3CHCA 4IQCA 1UR9A 1LL7A 4TW8A 1ROUA 1W1YA 4W9QA 3OOBA 4TNSA 3AS3A 2OLHA 3IKDA 2VCDA 2O9OA 1D2KA 3O5LA 1HKIA 3KCEA 3EIPA 1JNEA 2N87A 2L2SA 2MLYA 4LAWA 4O2TA 2DG9A 5I98A 1ZB5A 3O5QA 4LAYA 1FKIA 4DWSC 3JYJA 2IUZA 2DSVA 1EYMA 2DT2A 4P8XA 1F40A 4ODOA 4WKHA 4Q7NA 3WD0A 3CHDA 2A3BA 3WD1A 1NMWA 3WD3A 1FKGA 5BXJA 1Q1CA 2Q5AA 1XRVA 2PV1A 1LL4A 4HARA 1TCOC 4U86A 1HJWA 1FAPA 3WIJA 1PINA 4NNRA 1J4IA 2WLZA 2RQSA 3I6CA 2DT0A 3ARPA 1CTNA 2ZQUA 5J6EA 3TCZA 1H0GA 1ZK6A 2ZR5A 1FKKA 2PN0A 1JNDA 1YATA 4JFKA 3H9RB 1K9TA 4Z2KA 2RUDA 3PRAA 1J6YA 2LKNA 4JYSA 4DWSA 5HWCA 1TFVA 1ZBKA 1FKBA 2PI6A 3UI6A 4TX0A 3KAHA 4Z2LA 2AWGA 2A3EA 1NWTA 2DSZA 3TC5A 5HW6A 3FAPA 1GUVA 1F8AB 4G50A 2DT3A 1Q6UA 1KFWA 3RM8A 2DSWA 4ODQA 1U79A 2RSEA 1W9UA 3RFWA 3OA5A 1JNSA 1L1PA 3CZ8A 3KADA 3O5PA 4IT6A 1FJDA 3NTPA 1FKTA 4ODKA 1QPLA 1LJYA 2KFWA 2RUCA 3FXYA 2PBCA 1E15A 3IK8A 1HJXA 5HBFA 4DRNA 3UF8A 3O5OA 2F4EA 3UQAA 4QIBA 2K8IA 1KT0A 1Q6IA 4IPXA 3WL1A 4MPKA 4NZCA 4AY1A 4W9OA 2FDMA 3WH0A 1QPFA 4HBOA 1LG2A 3B7XA 1BL4A 3IHZA 4ZPVR 3ARTA 1FKLA 4GGQA 4W9PA 5DIUA 4Q22A 4P8UA 2M2AA 5DIVA 4WK9A 2WK2A 4ODLA 1E9LA 5GQBA 2YBUA 3O5EA 1LL6A 3O5FA 2DSUA 5HW8A 4QT2A 3AS0A 4KR0B 1J4RA 4JFJA 2F21A 4URIA 4WKFA 3BMBA 1ROTA 1XHGA 5D75A 1W1TA 2YBTA 4LGXA 3AS1A 4U85A 3ARWA 3PRDA 1E6ZA 3PR9A 2A3CA 2XP7A 3GU0A 4Z2IA 3JYMA 4DRQA 2XPBA 1FKRA 3ARXA 1WAWA 3G6MA 3UI4A 3CGNA 2O92A 4DT4A 3B8SA 3ARRA 4MAVA 2LGOA 4U84A 4GIVA 1EDQA 2XP6A 1QZ2A 3KABA 2G41A 4MGVA 1M5YA 2PV2A 3WL0A 4G2PA 4DZ3A 1SR0A 5HWBA 2G8ZA 1SYTA 2D9FA 4R5EA 1LQ0A 4DWSD 4DRJA 3WD2A 2KI3A 2ZR6A 4ZS6A 1R9HA 4DH0A 3MDYB 3WKZA 3ARVA 2JZVA 3WQVA 2ESCA 3KZ7A 2XP9A 1D7HA 4JFMA 1FKSA 3GTYX 3O5KA 3G6LA 1GRJA 2IF4A 3KAFA 2AOSA 4ODNA 4DZ2A 1WB0A 4LAXA 2PV3A 4WKAA 1ZU8A 1B6CA 4WIWA 2MLZA 4JFIA 3BXWA 2WLYA 3CHEA 2FAPA 2MF9A 2LJ4A 3NI6A 4NSBA 4MSPA 2ZQTA 4L3NA 2M1IA 5HUAA 5JH8A 2ZR4A 1EIBA 4R0XA 4DRHA 1W1PA 2KE0A 2MNTA 4WJXA 1ZL1A 1T11A 4JFLA 3PRBA 4FAPA 4S3KA 2B5UB 3O5IA 2PPNA 3O5GA 4IT4A 2A3AA 3NRKA 3RM4A 3TDBA 3ARYA 2KGJA 3UQBA 3QOKA 5B8IC 4QZVB 1NMVA 1PBKA 2WM0A 5HTGA 1W26A 1A7XA 5DITA 1D7JA 4ZPTR 4N19A 3RMEA 4MTVA 2OFNA 4ODMA 1FKJA 1FFQA 2LPVA 2KO7A 2PPPA 1D6OA 4ODRA 3O5DA 4FN2A 2PPOA 1X6LA 4XAKA 3B9AA 2XP3A 1X6NA 2M08A 1ITXA 1HKKA 2ZQSA 2ITKA 3KAGA 2DPEA 1FFRA 3UI5A 2DT1A 3GPKA 2MPHA 1HXVA 1BKFA 4ITZA 1FKFA 1W9VA 1E6NA 2B31A 3EY6A 4W5UA 3ARUA 1OWQA 4TYOA 1YW5A 1Q6HA 1OGGA 1Y0OA 1OGBA 4ODPA 1FKDA 4J4OA 3ARSA 3O5RA 2P4VA 1NWRA 3KAIA 1NWUA 1FKHA 4DRMA 4QT3A 4P8VA 1ZBCA 2ZQVA 4DIPA 4J4NA 3AROA 4PTMA 4ZPWR 5HT1A 1P5QA 2UZ5A
chains in the Genus database with same CATH topology
3ODKA 1LG1A 5DO2A 3WD4A 2RURA 1H0IA 1NWSA 3JXVA 1KT1A 4BF8A 1O6IA 2DG4A 3B9DA 1E6PA 1EQ3A 3KACA 3RM9A 2XPAA 4DWSB 4C02B 1NH6A 2XP8A 1JVWA 3ARZA 4L72B 1ZCNA 3O5JA 2F2DA 1C9HA 2DG3A 2Y78A 3FY1A 5HW7A 3IKGA 3ARQA 3RGCA 3UQIA 1J4HA 1GPFA 3W4RA 5GPRA 1IX5A 1FD9A 5DF0A 3PA7A 4KQZA 4S3JA 3O5MA 5HKGA 3AQUA 4Z2HA 4Z2JA 1JNTA 1W9PA 1E6RA 4DRIA 4Z2GA 1HKJA 3ALGA 3CHFA 1UR8A 2QF8A 3LUOA 2RUQA 4DRPA 1N1AA 4ML4A 1HKMA 1VF8A 2MLXA 1GOIA 4LAVA 3B9EA 4MNMA 3AS2A 5GPGA 1WNOA 1ZBWA 5DEZA 1W1VA 4MNLA 2XP5A 3CGMA 4IQ2A 4TW7A 4MNJA 4MNKA 4DROA 2KR7A 1D7IA 4DRKA 4P8WA 2VN1A 3VAWA 2FKEA 1HJVA 4TW6A 1EHNA 3CH9A 4HBEA 3ALFA 1ZBVA 3WQWA 2XP4A 1NSGA 1RD6A 3CHCA 4IQCA 1UR9A 1LL7A 4TW8A 1ROUA 1W1YA 4W9QA 3OOBA 4TNSA 3AS3A 2OLHA 3IKDA 2VCDA 2O9OA 1D2KA 3O5LA 1HKIA 3KCEA 1JNEA 2N87A 2L2SA 2MLYA 4LAWA 4O2TA 2DG9A 5I98A 1ZB5A 3O5QA 4LAYA 1FKIA 4DWSC 3JYJA 2IUZA 2DSVA 1EYMA 2DT2A 4P8XA 1F40A 4ODOA 4WKHA 4Q7NA 3WD0A 3CHDA 2A3BA 3WD1A 1NMWA 3WD3A 1FKGA 5BXJA 1Q1CA 2Q5AA 1XRVA 2PV1A 1LL4A 4HARA 1TCOC 4U86A 1HJWA 1FAPA 3WIJA 1PINA 4NNRA 1J4IA 2WLZA 2RQSA 3I6CA 2DT0A 3ARPA 1CTNA 2ZQUA 5J6EA 3TCZA 1H0GA 2ZR5A 1FKKA 1JNDA 1YATA 4JFKA 3H9RB 1K9TA 4Z2KA 2RUDA 3PRAA 1J6YA 2LKNA 4JYSA 4DWSA 5HWCA 1TFVA 1ZBKA 1FKBA 2PI6A 3UI6A 4TX0A 3KAHA 4Z2LA 2AWGA 2A3EA 1NWTA 2DSZA 3TC5A 5HW6A 3FAPA 1GUVA 1F8AB 4G50A 2DT3A 1Q6UA 1KFWA 3RM8A 2DSWA 4ODQA 1U79A 2RSEA 1W9UA 3RFWA 3OA5A 1JNSA 1L1PA 3CZ8A 3KADA 3O5PA 4IT6A 1FJDA 3NTPA 1FKTA 4ODKA 1QPLA 1LJYA 2KFWA 2RUCA 3FXYA 2PBCA 1E15A 3IK8A 1HJXA 5HBFA 4DRNA 3UF8A 3O5OA 2F4EA 3UQAA 4QIBA 2K8IA 1KT0A 1Q6IA 4IPXA 3WL1A 4MPKA 4NZCA 4AY1A 4W9OA 2FDMA 3WH0A 1QPFA 4HBOA 1LG2A 3B7XA 1BL4A 3IHZA 4ZPVR 3ARTA 1FKLA 4GGQA 4W9PA 5DIUA 4Q22A 4P8UA 2M2AA 5DIVA 4WK9A 2WK2A 4ODLA 1E9LA 5GQBA 2YBUA 3O5EA 1LL6A 3O5FA 2DSUA 5HW8A 4QT2A 3AS0A 4KR0B 1J4RA 4JFJA 2F21A 4URIA 4WKFA 1ROTA 1XHGA 5D75A 1W1TA 2YBTA 4LGXA 3AS1A 4U85A 3ARWA 3PRDA 1E6ZA 3PR9A 2A3CA 2XP7A 4Z2IA 3JYMA 4DRQA 2XPBA 1FKRA 3ARXA 1WAWA 3G6MA 3UI4A 3CGNA 2O92A 4DT4A 3B8SA 3ARRA 4MAVA 2LGOA 4U84A 4GIVA 1EDQA 2XP6A 1QZ2A 3KABA 2G41A 4MGVA 1M5YA 2PV2A 3WL0A 4G2PA 4DZ3A 1SR0A 5HWBA 2G8ZA 1SYTA 2D9FA 4R5EA 1LQ0A 4DWSD 4DRJA 3WD2A 2KI3A 2ZR6A 4ZS6A 1R9HA 4DH0A 3MDYB 3WKZA 3ARVA 2JZVA 3WQVA 2ESCA 3KZ7A 2XP9A 1D7HA 4JFMA 1FKSA 3O5KA 3G6LA 2IF4A 3KAFA 2AOSA 4ODNA 4DZ2A 1WB0A 4LAXA 2PV3A 4WKAA 1ZU8A 1B6CA 4WIWA 2MLZA 4JFIA 3BXWA 2WLYA 3CHEA 2FAPA 2MF9A 2LJ4A 3NI6A 4NSBA 4MSPA 2ZQTA 4L3NA 2M1IA 5HUAA 5JH8A 2ZR4A 1EIBA 4R0XA 4DRHA 1W1PA 2KE0A 2MNTA 4WJXA 1ZL1A 1T11A 4JFLA 3PRBA 4FAPA 4S3KA 3O5IA 2PPNA 3O5GA 4IT4A 2A3AA 3NRKA 3RM4A 3TDBA 3ARYA 2KGJA 1P5QA 3UQBA 3QOKA 5B8IC 4QZVB 1NMVA 1PBKA 2WM0A 5HTGA 1W26A 1A7XA 5DITA 1D7JA 4ZPTR 4N19A 3RMEA 4MTVA 2OFNA 4ODMA 1FKJA 1FFQA 2LPVA 2KO7A 2PPPA 1D6OA 4ODRA 3O5DA 4FN2A 2PPOA 1X6LA 4XAKA 3B9AA 2XP3A 1X6NA 2M08A 1ITXA 1HKKA 2ZQSA 2ITKA 3KAGA 2DPEA 1FFRA 3UI5A 2DT1A 3GPKA 2MPHA 1HXVA 1BKFA 4ITZA 1FKFA 1W9VA 1E6NA 2B31A 3EY6A 4W5UA 3ARUA 1OWQA 4TYOA 1YW5A 1Q6HA 1OGGA 1Y0OA 1OGBA 4ODPA 1FKDA 4J4OA 3ARSA 3O5RA 1NWRA 3KAIA 1NWUA 1FKHA 4DRMA 4QT3A 4P8VA 1ZBCA 2ZQVA 4DIPA 4J4NA 3AROA 4PTMA 4ZPWR 5HT1A 1ZK6A 2UZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7X A;  3ODK A;  1BL4 A;  3KAF A;  4ODN A;  1F40 A;  4ODO A;  3IHZ A;  4DZ2 A;  2RUR A;  4LAX A;  3JXV A;  1NMW A;  2PV3 A;  1FKG A;  1B6C A;  1FKL A;  5BXJ A;  1KT1 A;  1Q1C A;  4BF8 A;  2MLZ A;  2Q5A A;  2DG4 A;  4GGQ A;  4JFI A;  2PV1 A;  4W9P A;  5DIU A;  1EQ3 A;  3KAC A;  2FAP A;  2MF9 A;  1TCO C;  2LJ4 A;  2M2A A;  2XPA A;  3NI6 A;  4MSP A;  2ZQT A;  4U86 A;  5DIV A;  4ODL A;  4C02 B;  2M1I A;  1JVW A;  2XP8 A;  5HUA A;  2ZR4 A;  4R0X A;  1FAP A;  4DRH A;  3O5E A;  1PIN A;  1ZCN A;  2KE0 A;  2MNT A;  2UZ5 A;  3O5F A;  1J4I A;  4NNR A;  1T11 A;  4JFL A;  3O5J A;  3PRB A;  4FAP A;  3O5I A;  2RQS A;  2F2D A;  3I6C A;  2PPN A;  5HW8 A;  4QT2 A;  3O5G A;  3NRK A;  1C9H A;  2DG3 A;  2ZQU A;  3TDB A;  1J4R A;  5J6E A;  3TCZ A;  2Y78 A;  2KGJ A;  1P5Q A;  5HW7 A;  3IKG A;  2ZR5 A;  4JFJ A;  3UQB A;  3RGC A;  2F21 A;  3UQI A;  1J4H A;  5B8I C;  1NMV A;  1FKK A;  1PBK A;  3JYJ A;  5HTG A;  1YAT A;  4JFK A;  1W26 A;  3H9R B;  1FD9 A;  1A7X A;  5DIT A;  1D7J A;  1ROT A;  3PA7 A;  3O5M A;  5HKG A;  5D75 A;  2RUD A;  1JNT A;  4N19 A;  1J6Y A;  2LKN A;  4JYS A;  4DRI A;  2OFN A;  4U85 A;  5HWC A;  4ODM A;  1FKJ A;  2LPV A;  3PRD A;  2KO7 A;  2PPP A;  2XP7 A;  1D6O A;  3LUO A;  2RUQ A;  3JYM A;  3O5D A;  4ODR A;  4DRP A;  1FKB A;  4FN2 A;  4DRQ A;  2XPB A;  1FKR A;  1N1A A;  2PPO A;  3UI6 A;  2XP3 A;  4TX0 A;  2M08 A;  3UI4 A;  3CGN A;  3KAH A;  2AWG A;  2MLX A;  2ZQS A;  2ITK A;  3TC5 A;  4DT4 A;  4LAV A;  5HW6 A;  3FAP A;  3KAG A;  1F8A B;  5GPG A;  4G50 A;  2LGO A;  4U84 A;  3UI5 A;  4GIV A;  1Q6U A;  2XP6 A;  3GPK A;  2XP5 A;  3CGM A;  4IQ2 A;  4TW7 A;  1QZ2 A;  4ODQ A;  1U79 A;  2MPH A;  2RSE A;  3KAB A;  2KR7 A;  4DRO A;  1D7I A;  1BKF A;  4ITZ A;  4DRK A;  1HXV A;  2VN1 A;  1FKF A;  4MGV A;  1M5Y A;  2PV2 A;  3RFW A;  3VAW A;  2FKE A;  4TW6 A;  4G2P A;  1JNS A;  1L1P A;  4DZ3 A;  3KAD A;  3O5P A;  5HWB A;  3EY6 A;  1FJD A;  3NTP A;  1FKT A;  2XP4 A;  1NSG A;  4ODK A;  1QPL A;  2KFW A;  2RUC A;  1YW5 A;  4TYO A;  1Q6H A;  4IQC A;  2D9F A;  2PBC A;  3IK8 A;  1Y0O A;  4DRN A;  3UF8 A;  4TW8 A;  1ROU A;  4ODP A;  2KI3 A;  4W9Q A;  2ZR6 A;  1FKD A;  3O5O A;  4J4O A;  4DRJ A;  3O5R A;  3OOB A;  4TNS A;  1R9H A;  4DH0 A;  3KAI A;  2F4E A;  3MDY B;  3IKD A;  3UQA A;  4QIB A;  2VCD A;  3O5L A;  2JZV A;  1KT0 A;  2K8I A;  3KCE A;  1FKH A;  2N87 A;  2L2S A;  2XP9 A;  1Q6I A;  3KZ7 A;  1D7H A;  4IPX A;  4JFM A;  4QT3 A;  4DRM A;  1FKS A;  2MLY A;  4LAW A;  2ZQV A;  3O5K A;  4DIP A;  4J4N A;  4O2T A;  4W9O A;  2DG9 A;  3WH0 A;  5I98 A;  3O5Q A;  4LAY A;  1FKI A;  1QPF A;  5HT1 A;  1ZK6 A;  1EYM A;  2IF4 A; 
#chains in the Genus database with same CATH topology
 3ODK A;  1LG1 A;  5DO2 A;  3WD4 A;  2RUR A;  2F23 A;  1H0I A;  1NWS A;  3JXV A;  1KT1 A;  4BF8 A;  1O6I A;  2DG4 A;  3B9D A;  1E6P A;  1E44 A;  1EQ3 A;  3KAC A;  3RM9 A;  2XPA A;  4DWS B;  4C02 B;  1NH6 A;  2XP8 A;  1JVW A;  3ARZ A;  4L72 B;  1ZCN A;  3O5J A;  2F2D A;  1C9H A;  2DG3 A;  2Y78 A;  3FY1 A;  5HW7 A;  3IKG A;  3ARQ A;  3RGC A;  3UQI A;  1J4H A;  1GPF A;  3W4R A;  1JCH B;  5GPR A;  1FD9 A;  2EUL A;  5DF0 A;  1IX5 A;  3PA7 A;  4KQZ A;  4S3J A;  3O5M A;  5HKG A;  3AQU A;  4Z2H A;  4Z2J A;  1JNT A;  1W9P A;  1E6R A;  4DRI A;  4Z2G A;  1HKJ A;  3ALG A;  3CHF A;  1UR8 A;  2QF8 A;  4UDM A;  3LUO A;  2RUQ A;  4DRP A;  1N1A A;  4ML4 A;  1HKM A;  1VF8 A;  2MLX A;  1GOI A;  4LAV A;  3B9E A;  4MNM A;  3AS2 A;  5GPG A;  1WNO A;  1ZBW A;  5DEZ A;  1W1V A;  4MNL A;  2XP5 A;  3CGM A;  4IQ2 A;  4TW7 A;  4MNJ A;  2ETN A;  4MNK A;  4DRO A;  2KR7 A;  1D7I A;  4DRK A;  4P8W A;  2VN1 A;  3VAW A;  2FKE A;  1HJV A;  4TW6 A;  1EHN A;  3CH9 A;  4HBE A;  3ALF A;  1ZBV A;  3WQW A;  2XP4 A;  1NSG A;  1RD6 A;  3CHC A;  4IQC A;  1UR9 A;  1LL7 A;  4TW8 A;  1ROU A;  1W1Y A;  4W9Q A;  3OOB A;  4TNS A;  3AS3 A;  2OLH A;  3IKD A;  2VCD A;  2O9O A;  1D2K A;  3O5L A;  1HKI A;  3KCE A;  3EIP A;  1JNE A;  2N87 A;  2L2S A;  2MLY A;  4LAW A;  4O2T A;  2DG9 A;  5I98 A;  1ZB5 A;  3O5Q A;  4LAY A;  1FKI A;  4DWS C;  3JYJ A;  2IUZ A;  2DSV A;  1EYM A;  2DT2 A;  4P8X A;  1F40 A;  4ODO A;  4WKH A;  4Q7N A;  3WD0 A;  3CHD A;  2A3B A;  3WD1 A;  1NMW A;  3WD3 A;  1FKG A;  5BXJ A;  1Q1C A;  2Q5A A;  1XRV A;  2PV1 A;  1LL4 A;  4HAR A;  1TCO C;  4U86 A;  1HJW A;  1FAP A;  3WIJ A;  1PIN A;  4NNR A;  1J4I A;  2WLZ A;  2RQS A;  3I6C A;  2DT0 A;  3ARP A;  1CTN A;  2ZQU A;  5J6E A;  3TCZ A;  1H0G A;  1ZK6 A;  2ZR5 A;  1FKK A;  2PN0 A;  1JND A;  1YAT A;  4JFK A;  3H9R B;  1K9T A;  4Z2K A;  2RUD A;  3PRA A;  1J6Y A;  2LKN A;  4JYS A;  4DWS A;  5HWC A;  1TFV A;  1ZBK A;  1FKB A;  2PI6 A;  3UI6 A;  4TX0 A;  3KAH A;  4Z2L A;  2AWG A;  2A3E A;  1NWT A;  2DSZ A;  3TC5 A;  5HW6 A;  3FAP A;  1GUV A;  1F8A B;  4G50 A;  2DT3 A;  1Q6U A;  1KFW A;  3RM8 A;  2DSW A;  4ODQ A;  1U79 A;  2RSE A;  1W9U A;  3RFW A;  3OA5 A;  1JNS A;  1L1P A;  3CZ8 A;  3KAD A;  3O5P A;  4IT6 A;  1FJD A;  3NTP A;  1FKT A;  4ODK A;  1QPL A;  1LJY A;  2KFW A;  2RUC A;  3FXY A;  2PBC A;  1E15 A;  3IK8 A;  1HJX A;  5HBF A;  4DRN A;  3UF8 A;  3O5O A;  2F4E A;  3UQA A;  4QIB A;  2K8I A;  1KT0 A;  1Q6I A;  4IPX A;  3WL1 A;  4MPK A;  4NZC A;  4AY1 A;  4W9O A;  2FDM A;  3WH0 A;  1QPF A;  4HBO A;  1LG2 A;  3B7X A;  1BL4 A;  3IHZ A;  4ZPV R;  3ART A;  1FKL A;  4GGQ A;  4W9P A;  5DIU A;  4Q22 A;  4P8U A;  2M2A A;  5DIV A;  4WK9 A;  2WK2 A;  4ODL A;  1E9L A;  5GQB A;  2YBU A;  3O5E A;  1LL6 A;  3O5F A;  2DSU A;  5HW8 A;  4QT2 A;  3AS0 A;  4KR0 B;  1J4R A;  4JFJ A;  2F21 A;  4URI A;  4WKF A;  3BMB A;  1ROT A;  1XHG A;  5D75 A;  1W1T A;  2YBT A;  4LGX A;  3AS1 A;  4U85 A;  3ARW A;  3PRD A;  1E6Z A;  3PR9 A;  2A3C A;  2XP7 A;  3GU0 A;  4Z2I A;  3JYM A;  4DRQ A;  2XPB A;  1FKR A;  3ARX A;  1WAW A;  3G6M A;  3UI4 A;  3CGN A;  2O92 A;  4DT4 A;  3B8S A;  3ARR A;  4MAV A;  2LGO A;  4U84 A;  4GIV A;  1EDQ A;  2XP6 A;  1QZ2 A;  3KAB A;  2G41 A;  4MGV A;  1M5Y A;  2PV2 A;  3WL0 A;  4G2P A;  4DZ3 A;  1SR0 A;  5HWB A;  2G8Z A;  1SYT A;  2D9F A;  4R5E A;  1LQ0 A;  4DWS D;  4DRJ A;  3WD2 A;  2KI3 A;  2ZR6 A;  4ZS6 A;  1R9H A;  4DH0 A;  3MDY B;  3WKZ A;  3ARV A;  2JZV A;  3WQV A;  2ESC A;  3KZ7 A;  2XP9 A;  1D7H A;  4JFM A;  1FKS A;  3GTY X;  3O5K A;  3G6L A;  1GRJ A;  2IF4 A;  3KAF A;  2AOS A;  4ODN A;  4DZ2 A;  1WB0 A;  4LAX A;  2PV3 A;  4WKA A;  1ZU8 A;  1B6C A;  4WIW A;  2MLZ A;  4JFI A;  3BXW A;  2WLY A;  3CHE A;  2FAP A;  2MF9 A;  2LJ4 A;  3NI6 A;  4NSB A;  4MSP A;  2ZQT A;  4L3N A;  2M1I A;  5HUA A;  5JH8 A;  2ZR4 A;  1EIB A;  4R0X A;  4DRH A;  1W1P A;  2KE0 A;  2MNT A;  4WJX A;  1ZL1 A;  1T11 A;  4JFL A;  3PRB A;  4FAP A;  4S3K A;  2B5U B;  3O5I A;  2PPN A;  3O5G A;  4IT4 A;  2A3A A;  3NRK A;  3RM4 A;  3TDB A;  3ARY A;  2KGJ A;  3UQB A;  3QOK A;  5B8I C;  4QZV B;  1NMV A;  1PBK A;  2WM0 A;  5HTG A;  1W26 A;  1A7X A;  5DIT A;  1D7J A;  4ZPT R;  4N19 A;  3RME A;  4MTV A;  2OFN A;  4ODM A;  1FKJ A;  1FFQ A;  2LPV A;  2KO7 A;  2PPP A;  1D6O A;  4ODR A;  3O5D A;  4FN2 A;  2PPO A;  1X6L A;  4XAK A;  3B9A A;  2XP3 A;  1X6N A;  2M08 A;  1ITX A;  1HKK A;  2ZQS A;  2ITK A;  3KAG A;  2DPE A;  1FFR A;  3UI5 A;  2DT1 A;  3GPK A;  2MPH A;  1HXV A;  1BKF A;  4ITZ A;  1FKF A;  1W9V A;  1E6N A;  2B31 A;  3EY6 A;  4W5U A;  3ARU A;  1OWQ A;  4TYO A;  1YW5 A;  1Q6H A;  1OGG A;  1Y0O A;  1OGB A;  4ODP A;  1FKD A;  4J4O A;  3ARS A;  3O5R A;  2P4V A;  1NWR A;  3KAI A;  1NWU A;  1FKH A;  4DRM A;  4QT3 A;  4P8V A;  1ZBC A;  2ZQV A;  4DIP A;  4J4N A;  3ARO A;  4PTM A;  4ZPW R;  5HT1 A;  1P5Q A;  2UZ5 A; 
#chains in the Genus database with same CATH homology
 3ODK A;  1LG1 A;  5DO2 A;  3WD4 A;  2RUR A;  1H0I A;  1NWS A;  3JXV A;  1KT1 A;  4BF8 A;  1O6I A;  2DG4 A;  3B9D A;  1E6P A;  1EQ3 A;  3KAC A;  3RM9 A;  2XPA A;  4DWS B;  4C02 B;  1NH6 A;  2XP8 A;  1JVW A;  3ARZ A;  4L72 B;  1ZCN A;  3O5J A;  2F2D A;  1C9H A;  2DG3 A;  2Y78 A;  3FY1 A;  5HW7 A;  3IKG A;  3ARQ A;  3RGC A;  3UQI A;  1J4H A;  1GPF A;  3W4R A;  5GPR A;  1IX5 A;  1FD9 A;  5DF0 A;  3PA7 A;  4KQZ A;  4S3J A;  3O5M A;  5HKG A;  3AQU A;  4Z2H A;  4Z2J A;  1JNT A;  1W9P A;  1E6R A;  4DRI A;  4Z2G A;  1HKJ A;  3ALG A;  3CHF A;  1UR8 A;  2QF8 A;  3LUO A;  2RUQ A;  4DRP A;  1N1A A;  4ML4 A;  1HKM A;  1VF8 A;  2MLX A;  1GOI A;  4LAV A;  3B9E A;  4MNM A;  3AS2 A;  5GPG A;  1WNO A;  1ZBW A;  5DEZ A;  1W1V A;  4MNL A;  2XP5 A;  3CGM A;  4IQ2 A;  4TW7 A;  4MNJ A;  4MNK A;  4DRO A;  2KR7 A;  1D7I A;  4DRK A;  4P8W A;  2VN1 A;  3VAW A;  2FKE A;  1HJV A;  4TW6 A;  1EHN A;  3CH9 A;  4HBE A;  3ALF A;  1ZBV A;  3WQW A;  2XP4 A;  1NSG A;  1RD6 A;  3CHC A;  4IQC A;  1UR9 A;  1LL7 A;  4TW8 A;  1ROU A;  1W1Y A;  4W9Q A;  3OOB A;  4TNS A;  3AS3 A;  2OLH A;  3IKD A;  2VCD A;  2O9O A;  1D2K A;  3O5L A;  1HKI A;  3KCE A;  1JNE A;  2N87 A;  2L2S A;  2MLY A;  4LAW A;  4O2T A;  2DG9 A;  5I98 A;  1ZB5 A;  3O5Q A;  4LAY A;  1FKI A;  4DWS C;  3JYJ A;  2IUZ A;  2DSV A;  1EYM A;  2DT2 A;  4P8X A;  1F40 A;  4ODO A;  4WKH A;  4Q7N A;  3WD0 A;  3CHD A;  2A3B A;  3WD1 A;  1NMW A;  3WD3 A;  1FKG A;  5BXJ A;  1Q1C A;  2Q5A A;  1XRV A;  2PV1 A;  1LL4 A;  4HAR A;  1TCO C;  4U86 A;  1HJW A;  1FAP A;  3WIJ A;  1PIN A;  4NNR A;  1J4I A;  2WLZ A;  2RQS A;  3I6C A;  2DT0 A;  3ARP A;  1CTN A;  2ZQU A;  5J6E A;  3TCZ A;  1H0G A;  2ZR5 A;  1FKK A;  1JND A;  1YAT A;  4JFK A;  3H9R B;  1K9T A;  4Z2K A;  2RUD A;  3PRA A;  1J6Y A;  2LKN A;  4JYS A;  4DWS A;  5HWC A;  1TFV A;  1ZBK A;  1FKB A;  2PI6 A;  3UI6 A;  4TX0 A;  3KAH A;  4Z2L A;  2AWG A;  2A3E A;  1NWT A;  2DSZ A;  3TC5 A;  5HW6 A;  3FAP A;  1GUV A;  1F8A B;  4G50 A;  2DT3 A;  1Q6U A;  1KFW A;  3RM8 A;  2DSW A;  4ODQ A;  1U79 A;  2RSE A;  1W9U A;  3RFW A;  3OA5 A;  1JNS A;  1L1P A;  3CZ8 A;  3KAD A;  3O5P A;  4IT6 A;  1FJD A;  3NTP A;  1FKT A;  4ODK A;  1QPL A;  1LJY A;  2KFW A;  2RUC A;  3FXY A;  2PBC A;  1E15 A;  3IK8 A;  1HJX A;  5HBF A;  4DRN A;  3UF8 A;  3O5O A;  2F4E A;  3UQA A;  4QIB A;  2K8I A;  1KT0 A;  1Q6I A;  4IPX A;  3WL1 A;  4MPK A;  4NZC A;  4AY1 A;  4W9O A;  2FDM A;  3WH0 A;  1QPF A;  4HBO A;  1LG2 A;  3B7X A;  1BL4 A;  3IHZ A;  4ZPV R;  3ART A;  1FKL A;  4GGQ A;  4W9P A;  5DIU A;  4Q22 A;  4P8U A;  2M2A A;  5DIV A;  4WK9 A;  2WK2 A;  4ODL A;  1E9L A;  5GQB A;  2YBU A;  3O5E A;  1LL6 A;  3O5F A;  2DSU A;  5HW8 A;  4QT2 A;  3AS0 A;  4KR0 B;  1J4R A;  4JFJ A;  2F21 A;  4URI A;  4WKF A;  1ROT A;  1XHG A;  5D75 A;  1W1T A;  2YBT A;  4LGX A;  3AS1 A;  4U85 A;  3ARW A;  3PRD A;  1E6Z A;  3PR9 A;  2A3C A;  2XP7 A;  4Z2I A;  3JYM A;  4DRQ A;  2XPB A;  1FKR A;  3ARX A;  1WAW A;  3G6M A;  3UI4 A;  3CGN A;  2O92 A;  4DT4 A;  3B8S A;  3ARR A;  4MAV A;  2LGO A;  4U84 A;  4GIV A;  1EDQ A;  2XP6 A;  1QZ2 A;  3KAB A;  2G41 A;  4MGV A;  1M5Y A;  2PV2 A;  3WL0 A;  4G2P A;  4DZ3 A;  1SR0 A;  5HWB A;  2G8Z A;  1SYT A;  2D9F A;  4R5E A;  1LQ0 A;  4DWS D;  4DRJ A;  3WD2 A;  2KI3 A;  2ZR6 A;  4ZS6 A;  1R9H A;  4DH0 A;  3MDY B;  3WKZ A;  3ARV A;  2JZV A;  3WQV A;  2ESC A;  3KZ7 A;  2XP9 A;  1D7H A;  4JFM A;  1FKS A;  3O5K A;  3G6L A;  2IF4 A;  3KAF A;  2AOS A;  4ODN A;  4DZ2 A;  1WB0 A;  4LAX A;  2PV3 A;  4WKA A;  1ZU8 A;  1B6C A;  4WIW A;  2MLZ A;  4JFI A;  3BXW A;  2WLY A;  3CHE A;  2FAP A;  2MF9 A;  2LJ4 A;  3NI6 A;  4NSB A;  4MSP A;  2ZQT A;  4L3N A;  2M1I A;  5HUA A;  5JH8 A;  2ZR4 A;  1EIB A;  4R0X A;  4DRH A;  1W1P A;  2KE0 A;  2MNT A;  4WJX A;  1ZL1 A;  1T11 A;  4JFL A;  3PRB A;  4FAP A;  4S3K A;  3O5I A;  2PPN A;  3O5G A;  4IT4 A;  2A3A A;  3NRK A;  3RM4 A;  3TDB A;  3ARY A;  2KGJ A;  1P5Q A;  3UQB A;  3QOK A;  5B8I C;  4QZV B;  1NMV A;  1PBK A;  2WM0 A;  5HTG A;  1W26 A;  1A7X A;  5DIT A;  1D7J A;  4ZPT R;  4N19 A;  3RME A;  4MTV A;  2OFN A;  4ODM A;  1FKJ A;  1FFQ A;  2LPV A;  2KO7 A;  2PPP A;  1D6O A;  4ODR A;  3O5D A;  4FN2 A;  2PPO A;  1X6L A;  4XAK A;  3B9A A;  2XP3 A;  1X6N A;  2M08 A;  1ITX A;  1HKK A;  2ZQS A;  2ITK A;  3KAG A;  2DPE A;  1FFR A;  3UI5 A;  2DT1 A;  3GPK A;  2MPH A;  1HXV A;  1BKF A;  4ITZ A;  1FKF A;  1W9V A;  1E6N A;  2B31 A;  3EY6 A;  4W5U A;  3ARU A;  1OWQ A;  4TYO A;  1YW5 A;  1Q6H A;  1OGG A;  1Y0O A;  1OGB A;  4ODP A;  1FKD A;  4J4O A;  3ARS A;  3O5R A;  1NWR A;  3KAI A;  1NWU A;  1FKH A;  4DRM A;  4QT3 A;  4P8V A;  1ZBC A;  2ZQV A;  4DIP A;  4J4N A;  3ARO A;  4PTM A;  4ZPW R;  5HT1 A;  1ZK6 A;  2UZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...