4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
1JNTA 4ODPA 2XP4A 4TW6A 1FAPA 4G50A 3PRDA 4DRNA 1D7HA 1U79A 3O5GA 4DRQA 2JZVA 3B7XA 2ITKA 3KZ7A 2ZR5A 1D7JA 3O5PA 4GGQA 4IPXA 1J4RA 3NI6A 4IQ2A 5D75A 1C9HA 4N19A 1EQ3A 3CGNA 2ZQSA 4MGVA 4TX0A 5HW8A 2F21A 4LAYA 4JYSA 3NRKA 5DIUA 2DG3A 2PPPA 3TC5A 3KAIA 4LAWA 2LPVA 3JYJA 4QT3A 1NMWA 1QPFA 2MLYA 1YATA 2N87A 4QIBA 1PBKA 2KE0A 3KADA 4ODOA 4DZ2A 2KI3A 3O5QA 3O5DA 2ZR6A 1FKFA 2XPAA 3OOBA 3FAPA 1N1AA 3IKDA 3JXVA 1QZ2A 2XP5A 1L1PA 2ZQVA 3NTPA 3JYMA 4ODRA 5HWBA 1ZCNA 1Q6HA 4LAVA 3RGCA 4DIPA 2MF9A 4R0XA 4DRMA 4DRHA 2XP3A 4JFMA 3VAWA 1F8AB 2VCDA 1B6CA 3PRBA 1KT0A 4DRPA 4FAPA 3UI5A 1FKBA 1FD9A 3CGMA 2Y78A 3RFWA 3TDBA 2MLXA 2RUDA 2XP9A 5HTGA 2UZ5A 2LKNA 3O5FA 4TW8A 1FKIA 2VN1A 3O5KA 5HW7A 1FKRA 4JFKA 1P5QA 2XP8A 2Q5AA 4W9OA 3PA7A 4NNRA 4C02B 2K8IA 1FKHA 4DRKA 4DRIA 2RUCA 2PV2A 3H9RB 4ODNA 4ODLA 2MLZA 2ZR4A 2XPBA 4TNSA 5B8IC 5HWCA 5HW6A 1ZK6A 1ROTA 1FJDA 4DT4A 5I98A 3KCEA 1FKJA 1BKFA 3LUOA 3WH0A 2FKEA 2ZQTA 4U85A 3O5EA 2RSEA 1D6OA 1T11A 1ROUA 1EYMA 3UI4A 2KO7A 1JNSA 2PPNA 2AWGA 2RUQA 2LGOA 3KACA 1HXVA 5HT1A 1KT1A 1FKDA 3ODKA 4JFJA 3UQAA 4O2TA 2MPHA 3IHZA 3O5JA 4DZ3A 3UI6A 3UF8A 2ZQUA 2L2SA 4U84A 4JFLA 3GPKA 1FKLA 1NMVA 2M2AA 2XP7A 3IKGA 4IQCA 5GPGA 4DRJA 4TYOA 5HUAA 2RQSA 4J4OA 3I6CA 2MNTA 2FAPA 1FKTA 2RURA 1Q1CA 1Q6UA 3UQIA 4W9PA 4U86A 4ODKA 1QPLA 1PINA 1JVWA 1J4IA 1FKKA 3KABA 4ODMA 2DG9A 4QT2A 4BF8A 5HKGA 1Q6IA 2DG4A 2PV1A 1J6YA 3TCZA 1FKSA 1BL4A 2F2DA 3O5RA 3O5LA 3IK8A 3KAHA 3O5IA 2PBCA 3KAFA 4MSPA 1A7XA 1J4HA 4TW7A 1F40A 4G2PA 2PPOA 3KAGA 4DROA 1M5YA 1D7IA 2KR7A 5BXJA 2PV3A 5DITA 5J6EA 1W26A 4DH0A 2LJ4A 1Y0OA 3EY6A 2KFWA 4FN2A 4JFIA 4LAXA 2OFNA 3O5MA 1YW5A 3O5OA 3MDYB 2KGJA 4W9QA 2D9FA 1NSGA 1TCOC 4J4NA 2IF4A 3UQBA 2F4EA 2M08A 2M1IA 1R9HA 2XP6A 4GIVA 5DIVA 4ODQA 4ITZA 1FKGA
chains in the Genus database with same CATH superfamily
3PRDA 1SR0A 2EULA 3ARWA 4IQ2A 3NI6A 1VF8A 1C9HA 4QZVB 1EQ3A 1D2KA 2ZQSA 5HW8A 2F21A 3WD0A 4JYSA 5DIUA 2AOSA 4LAWA 1NMWA 1QPFA 4ODOA 2KE0A 3O5DA 3FY1A 3CHDA 3FAPA 1N1AA 3IKDA 4L3NA 4R5EA 2XP5A 2ZQVA 3JYMA 4DRHA 3AS0A 4Z2HA 3CGMA 5HTGA 2RUDA 4TW8A 1CTNA 4MAVA 2XP8A 1WNOA 4UDMA 3CHEA 2PI6A 4C02B 1FKHA 2PV2A 3H9RB 4ODLA 3AQUA 3OA5A 4TNSA 5HWCA 4ZPTR 4MNLA 1O6IA 2FKEA 3O5EA 1D6OA 1T11A 1UR8A 3ALGA 2RUQA 2LGOA 3KACA 3BXWA 5HT1A 4O2TA 2MPHA 3UF8A 3CH9A 1FKLA 1ZBWA 2M2AA 2P4VA 1HJVA 2RQSA 4DWSB 4P8XA 2ESCA 1JCHB 3UQIA 4HARA 4U86A 1QPLA 1NWUA 1FKKA 4WKFA 4WIWA 4BF8A 5HKGA 5JH8A 1J6YA 1W9UA 1BL4A 2F2DA 4S3JA 1NWRA 3PRAA 3WQWA 3IK8A 4TW7A 4MSPA 2QF8A 4ZPWR 2PPOA 4KQZA 3WKZA 2KR7A 2PV3A 4DH0A 1E9LA 2OFNA 4MPKA 1NWSA 2KGJA 1NSGA 4J4NA 2DT0A 2F4EA 3ARRA 4MTVA 5DIVA 2DT3A 4ITZA 1JNTA 1FAPA 4DRNA 3WIJA 1K9TA 2JZVA 3B7XA 2ITKA 4IPXA 1D7JA 2DPEA 3CHFA 4Z2JA 3CGNA 4MGVA 4TX0A 1ITXA 3NRKA 1HKJA 3B8SA 3JYJA 2A3AA 4QT3A 1YATA 4P8VA 4Z2IA 1PBKA 3KADA 2YBTA 3WD3A 3ARSA 3OOBA 3JXVA 5DO2A 3WD2A 5HWBA 1W9VA 1ZCNA 3RGCA 4JFMA 1FD9A 3RFWA 3WD4A 3O5FA 5HW7A 3O5KA 4ML4A 1XRVA 4W9OA 4NNRA 5GPRA 2K8IA 2WM0A 4ODNA 2MLZA 5B8IC 3ARTA 1ZK6A 1X6LA 1FFRA 4DT4A 1GPFA 3LUOA 1GRJA 3ARUA 2RSEA 1ROUA 1EYMA 1NH6A 1X6NA 1E6ZA 1LQ0A 1JNSA 4MNKA 1KT1A 3ODKA 3EIPA 4L72B 3O5JA 1OGBA 2B31A 1EDQA 4IQCA 5HUAA 4TYOA 3I6CA 2B5UB 1ZBKA 1KFWA 4ODKA 1PINA 3B9AA 3KABA 1J4IA 1FKRA 2DT2A 3ARYA 2DG4A 2PV1A 3B9DA 3TCZA 1FKSA 3W4RA 2A3CA 2PN0A 3O5LA 4W5UA 3KAHA 3WL0A 4G2PA 4DROA 2DSWA 1D7IA 1RD6A 1WB0A 5DITA 5J6EA 5DEZA 4DWSA 4JFIA 4FN2A 4LAXA 4WKHA 3ARPA 4DWSD 4Q7NA 4NZCA 3UQBA 3BMBA 2M1IA 3AS2A 4IT4A 4ODPA 2XP4A 4DRQA 2WLZA 4P8UA 3KZ7A 4GGQA 1J4RA 3ARZA 4N19A 3QOKA 2F23A 3TC5A 2PPPA 4Z2LA 4AY1A 2LPVA 2DT1A 2DSVA 2ETNA 2N87A 2KI3A 2XPAA 3ALFA 2G8ZA 1L1PA 3NTPA 3ARXA 4ODRA 4DRMA 4R0XA 2A3EA 2XP3A 3PRBA 4DRPA 1FKBA 4MNJA 3TDBA 2Y78A 1EHNA 2XP9A 2UZ5A 2VN1A 4JFKA 1P5QA 2Q5AA 1LL4A 2O9OA 4DRKA 2RUCA 4ZPVR 1LL7A 2ZR4A 2DSZA 1E6RA 1OGGA 2FDMA 4XAKA 1LJYA 1ROTA 5I98A 3KCEA 1LG1A 1FKJA 1E6NA 4WK9A 3WH0A 1JNEA 4Q22A 2ZQTA 1IX5A 4P8WA 3UI4A 2KO7A 3GU0A 1W1VA 2PPNA 1WAWA 1HXVA 1FKDA 2YBUA 1XHGA 4JFLA 4DRJA 2XP7A 2RURA 1Q1CA 1Q6UA 3RM8A 4W9PA 1JVWA 4ODMA 4QT2A 2DG9A 3O5RA 4NSBA 3O5IA 2PBCA 3B9EA 1A7XA 3KAGA 1NWTA 5BXJA 1E44A 4PTMA 1Y0OA 3EY6A 2KFWA 1YW5A 3O5OA 3MDYB 4W9QA 2D9FA 1GOIA 4WJXA 2IF4A 2M08A 1LL6A 1R9HA 4DWSC 2WLYA 4TW6A 3RM4A 4G50A 1D7HA 1U79A 3O5GA 3O5PA 2ZR5A 1FFQA 4LGXA 5D75A 2OLHA 4LAYA 2DG3A 4ZS6A 3KAIA 2MLYA 4QIBA 3G6LA 4DZ2A 3O5QA 2ZR6A 1FKFA 4HBOA 1HKMA 1LG2A 1QZ2A 3CHCA 4HBEA 1Q6HA 4LAVA 4DIPA 2MF9A 5DF0A 1F8AB 1UR9A 2VCDA 1ZBCA 1B6CA 3VAWA 5HBFA 1KT0A 4FAPA 3UI5A 1OWQA 2MLXA 1ZBVA 3G6MA 2LKNA 1HJXA 1FKIA 4IT6A 1W1PA 1HKIA 4URIA 2WK2A 3PA7A 4DRIA 3FXYA 3GTYX 4WKAA 2XPBA 1HJWA 5HW6A 1H0IA 3CZ8A 3ARVA 1FJDA 1BKFA 1W1TA 4U85A 4Z2KA 1W1YA 3WL1A 3RMEA 4KR0B 2AWGA 3AROA 4MNMA 4JFJA 3UQAA 1H0GA 3IHZA 4DZ3A 3UI6A 2ZQUA 2L2SA 4U84A 1ZB5A 3GPKA 1NMVA 3IKGA 5GPGA 1SYTA 4J4OA 2MNTA 2FAPA 3AS1A 1FKTA 2A3BA 1ZU8A 1Q6IA 2G41A 2O92A 1TFVA 3WQVA 3KAFA 1F40A 1J4HA 2IUZA 1W9PA 4S3KA 3PR9A 1GUVA 1M5YA 1ZL1A 1W26A 2LJ4A 3AS3A 1E6PA 3WD1A 1E15A 1JNDA 3O5MA 1EIBA 1HKKA 3ARQA 3RM9A 1TCOC 2XP6A 2DSUA 4GIVA 4Z2GA 4ODQA 5GQBA 1FKGA
chains in the Genus database with same CATH topology
3PRDA 1SR0A 3ARWA 4IQ2A 3NI6A 1VF8A 1C9HA 4QZVB 1EQ3A 1D2KA 2ZQSA 5HW8A 2F21A 3WD0A 4JYSA 5DIUA 2AOSA 4LAWA 1NMWA 1QPFA 4ODOA 2KE0A 3O5DA 3FY1A 3CHDA 3FAPA 1N1AA 3IKDA 4L3NA 4R5EA 2XP5A 2ZQVA 3JYMA 4DRHA 3AS0A 4Z2HA 3CGMA 5HTGA 2RUDA 4TW8A 1CTNA 4MAVA 2XP8A 1WNOA 3CHEA 2PI6A 4C02B 1FKHA 2PV2A 3H9RB 4ODLA 3AQUA 3OA5A 4TNSA 5HWCA 4ZPTR 4MNLA 1O6IA 2FKEA 3O5EA 1D6OA 1T11A 1UR8A 3ALGA 2RUQA 2LGOA 3KACA 3BXWA 5HT1A 4O2TA 2MPHA 3UF8A 3CH9A 1FKLA 1ZBWA 2M2AA 1HJVA 2RQSA 4DWSB 4P8XA 2ESCA 3UQIA 4HARA 4U86A 1QPLA 1NWUA 1FKKA 4WKFA 4WIWA 4BF8A 5HKGA 5JH8A 1J6YA 1W9UA 1BL4A 2F2DA 4S3JA 1NWRA 3PRAA 3WQWA 3IK8A 4TW7A 4MSPA 2QF8A 4ZPWR 2PPOA 4KQZA 3WKZA 2KR7A 2PV3A 4DH0A 1E9LA 2OFNA 4MPKA 1NWSA 2KGJA 1NSGA 4J4NA 2DT0A 2F4EA 3ARRA 4MTVA 5DIVA 2DT3A 4ITZA 1JNTA 1FAPA 4DRNA 3WIJA 1K9TA 2JZVA 3B7XA 2ITKA 4IPXA 1D7JA 2DPEA 3CHFA 4Z2JA 3CGNA 4MGVA 4TX0A 1ITXA 3NRKA 1HKJA 3B8SA 3JYJA 2A3AA 4QT3A 1YATA 4P8VA 4Z2IA 1PBKA 3KADA 2YBTA 3WD3A 3ARSA 3OOBA 3JXVA 5DO2A 3WD2A 5HWBA 1W9VA 1ZCNA 3RGCA 4JFMA 1FD9A 3RFWA 3WD4A 3O5FA 5HW7A 3O5KA 4ML4A 1XRVA 4W9OA 4NNRA 5GPRA 2K8IA 2WM0A 4ODNA 2MLZA 5B8IC 3ARTA 1ZK6A 1X6LA 1FFRA 4DT4A 1GPFA 3LUOA 3ARUA 2RSEA 1ROUA 1EYMA 1NH6A 1X6NA 1E6ZA 1LQ0A 1JNSA 4MNKA 1KT1A 3ODKA 4L72B 3O5JA 1OGBA 2B31A 1EDQA 4IQCA 5HUAA 4TYOA 3I6CA 1ZBKA 1KFWA 4ODKA 1PINA 3B9AA 3KABA 1J4IA 1FKRA 2DT2A 3ARYA 2DG4A 2PV1A 3B9DA 3TCZA 1FKSA 3W4RA 2A3CA 3O5LA 4W5UA 3KAHA 3WL0A 4G2PA 4DROA 2DSWA 1D7IA 1RD6A 1WB0A 5DITA 5J6EA 5DEZA 4DWSA 4JFIA 4FN2A 4LAXA 4WKHA 3ARPA 4DWSD 4Q7NA 4NZCA 3UQBA 2M1IA 3AS2A 4IT4A 4ODPA 2XP4A 4DRQA 2WLZA 4P8UA 3KZ7A 4GGQA 1J4RA 3ARZA 4N19A 3QOKA 3TC5A 2PPPA 4Z2LA 4AY1A 2LPVA 2DT1A 2DSVA 2N87A 2KI3A 2XPAA 3ALFA 2G8ZA 1L1PA 3NTPA 3ARXA 4ODRA 4DRMA 4R0XA 2A3EA 2XP3A 3PRBA 4DRPA 1FKBA 4MNJA 3TDBA 2Y78A 1EHNA 2XP9A 2UZ5A 2VN1A 4JFKA 1P5QA 2Q5AA 1LL4A 2O9OA 4DRKA 2RUCA 4ZPVR 1LL7A 2ZR4A 2DSZA 1E6RA 1OGGA 2FDMA 4XAKA 1LJYA 1ROTA 5I98A 3KCEA 1LG1A 1FKJA 1E6NA 4WK9A 3WH0A 1JNEA 4Q22A 2ZQTA 1IX5A 4P8WA 3UI4A 2KO7A 1W1VA 2PPNA 1WAWA 1HXVA 1FKDA 2YBUA 1XHGA 4JFLA 4DRJA 2XP7A 2RURA 1Q1CA 1Q6UA 3RM8A 4W9PA 1JVWA 4ODMA 4QT2A 2DG9A 3O5RA 4NSBA 3O5IA 2PBCA 3B9EA 1A7XA 3KAGA 1NWTA 5BXJA 4PTMA 1Y0OA 3EY6A 2KFWA 1YW5A 3O5OA 3MDYB 4W9QA 2D9FA 1GOIA 4WJXA 2IF4A 2M08A 1LL6A 1R9HA 4DWSC 2WLYA 4TW6A 3RM4A 4G50A 1D7HA 1U79A 3O5GA 3O5PA 2ZR5A 1FFQA 4LGXA 5D75A 2OLHA 4LAYA 2DG3A 4ZS6A 3KAIA 2MLYA 4QIBA 3G6LA 4DZ2A 3O5QA 2ZR6A 1FKFA 4HBOA 1HKMA 1LG2A 1QZ2A 3CHCA 4HBEA 1Q6HA 4LAVA 4DIPA 2MF9A 5DF0A 1F8AB 1UR9A 2VCDA 1ZBCA 1B6CA 3VAWA 5HBFA 1KT0A 4FAPA 3UI5A 1OWQA 2MLXA 1ZBVA 3G6MA 2LKNA 1HJXA 1FKIA 4IT6A 1W1PA 1HKIA 4URIA 2WK2A 3PA7A 4DRIA 3FXYA 4WKAA 2XPBA 1HJWA 5HW6A 1H0IA 3CZ8A 3ARVA 1FJDA 1BKFA 1W1TA 4U85A 4Z2KA 1W1YA 3WL1A 3RMEA 4KR0B 2AWGA 3AROA 4MNMA 4JFJA 3UQAA 1H0GA 3IHZA 4DZ3A 3UI6A 2ZQUA 2L2SA 4U84A 1ZB5A 3GPKA 1NMVA 3IKGA 5GPGA 1SYTA 4J4OA 2MNTA 2FAPA 3AS1A 1FKTA 2A3BA 1ZU8A 1Q6IA 2G41A 2O92A 1TFVA 3WQVA 3KAFA 1F40A 1J4HA 2IUZA 1W9PA 4S3KA 3PR9A 1GUVA 1M5YA 1ZL1A 1W26A 2LJ4A 3AS3A 1E6PA 3WD1A 1E15A 1JNDA 3O5MA 1EIBA 1HKKA 3ARQA 3RM9A 1TCOC 2XP6A 2DSUA 4GIVA 4Z2GA 4ODQA 5GQBA 1FKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNT A;  4ODP A;  2XP4 A;  4TW6 A;  1FAP A;  4G50 A;  3PRD A;  4DRN A;  1D7H A;  1U79 A;  3O5G A;  4DRQ A;  2JZV A;  3B7X A;  2ITK A;  3KZ7 A;  2ZR5 A;  1D7J A;  3O5P A;  4GGQ A;  4IPX A;  1J4R A;  3NI6 A;  4IQ2 A;  5D75 A;  1C9H A;  4N19 A;  1EQ3 A;  3CGN A;  2ZQS A;  4MGV A;  4TX0 A;  5HW8 A;  2F21 A;  4LAY A;  4JYS A;  3NRK A;  5DIU A;  2DG3 A;  2PPP A;  3TC5 A;  3KAI A;  4LAW A;  2LPV A;  3JYJ A;  4QT3 A;  1NMW A;  1QPF A;  2MLY A;  1YAT A;  2N87 A;  4QIB A;  1PBK A;  2KE0 A;  3KAD A;  4ODO A;  4DZ2 A;  2KI3 A;  3O5Q A;  3O5D A;  2ZR6 A;  1FKF A;  2XPA A;  3OOB A;  3FAP A;  1N1A A;  3IKD A;  3JXV A;  1QZ2 A;  2XP5 A;  1L1P A;  2ZQV A;  3NTP A;  3JYM A;  4ODR A;  5HWB A;  1ZCN A;  1Q6H A;  4LAV A;  3RGC A;  4DIP A;  2MF9 A;  4R0X A;  4DRM A;  4DRH A;  2XP3 A;  4JFM A;  3VAW A;  1F8A B;  2VCD A;  1B6C A;  3PRB A;  1KT0 A;  4DRP A;  4FAP A;  3UI5 A;  1FKB A;  1FD9 A;  3CGM A;  2Y78 A;  3RFW A;  3TDB A;  2MLX A;  2RUD A;  2XP9 A;  5HTG A;  2UZ5 A;  2LKN A;  3O5F A;  4TW8 A;  1FKI A;  2VN1 A;  3O5K A;  5HW7 A;  1FKR A;  4JFK A;  1P5Q A;  2XP8 A;  2Q5A A;  4W9O A;  3PA7 A;  4NNR A;  4C02 B;  2K8I A;  1FKH A;  4DRK A;  4DRI A;  2RUC A;  2PV2 A;  3H9R B;  4ODN A;  4ODL A;  2MLZ A;  2ZR4 A;  2XPB A;  4TNS A;  5B8I C;  5HWC A;  5HW6 A;  1ZK6 A;  1ROT A;  1FJD A;  4DT4 A;  5I98 A;  3KCE A;  1FKJ A;  1BKF A;  3LUO A;  3WH0 A;  2FKE A;  2ZQT A;  4U85 A;  3O5E A;  2RSE A;  1D6O A;  1T11 A;  1ROU A;  1EYM A;  3UI4 A;  2KO7 A;  1JNS A;  2PPN A;  2AWG A;  2RUQ A;  2LGO A;  3KAC A;  1HXV A;  5HT1 A;  1KT1 A;  1FKD A;  3ODK A;  4JFJ A;  3UQA A;  4O2T A;  2MPH A;  3IHZ A;  3O5J A;  4DZ3 A;  3UI6 A;  3UF8 A;  2ZQU A;  2L2S A;  4U84 A;  4JFL A;  3GPK A;  1FKL A;  1NMV A;  2M2A A;  2XP7 A;  3IKG A;  4IQC A;  5GPG A;  4DRJ A;  4TYO A;  5HUA A;  2RQS A;  4J4O A;  3I6C A;  2MNT A;  2FAP A;  1FKT A;  2RUR A;  1Q1C A;  1Q6U A;  3UQI A;  4W9P A;  4U86 A;  4ODK A;  1QPL A;  1PIN A;  1JVW A;  1J4I A;  1FKK A;  3KAB A;  4ODM A;  2DG9 A;  4QT2 A;  4BF8 A;  5HKG A;  1Q6I A;  2DG4 A;  2PV1 A;  1J6Y A;  3TCZ A;  1FKS A;  1BL4 A;  2F2D A;  3O5R A;  3O5L A;  3IK8 A;  3KAH A;  3O5I A;  2PBC A;  3KAF A;  4MSP A;  1A7X A;  1J4H A;  4TW7 A;  1F40 A;  4G2P A;  2PPO A;  3KAG A;  4DRO A;  1M5Y A;  1D7I A;  2KR7 A;  5BXJ A;  2PV3 A;  5DIT A;  5J6E A;  1W26 A;  4DH0 A;  2LJ4 A;  1Y0O A;  3EY6 A;  2KFW A;  4FN2 A;  4JFI A;  4LAX A;  2OFN A;  3O5M A;  1YW5 A;  3O5O A;  3MDY B;  2KGJ A;  4W9Q A;  2D9F A;  1NSG A;  1TCO C;  4J4N A;  2IF4 A;  3UQB A;  2F4E A;  2M08 A;  2M1I A;  1R9H A;  2XP6 A;  4GIV A;  5DIV A;  4ODQ A;  4ITZ A;  1FKG A; 
#chains in the Genus database with same CATH topology
 3PRD A;  1SR0 A;  2EUL A;  3ARW A;  4IQ2 A;  3NI6 A;  1VF8 A;  1C9H A;  4QZV B;  1EQ3 A;  1D2K A;  2ZQS A;  5HW8 A;  2F21 A;  3WD0 A;  4JYS A;  5DIU A;  2AOS A;  4LAW A;  1NMW A;  1QPF A;  4ODO A;  2KE0 A;  3O5D A;  3FY1 A;  3CHD A;  3FAP A;  1N1A A;  3IKD A;  4L3N A;  4R5E A;  2XP5 A;  2ZQV A;  3JYM A;  4DRH A;  3AS0 A;  4Z2H A;  3CGM A;  5HTG A;  2RUD A;  4TW8 A;  1CTN A;  4MAV A;  2XP8 A;  1WNO A;  4UDM A;  3CHE A;  2PI6 A;  4C02 B;  1FKH A;  2PV2 A;  3H9R B;  4ODL A;  3AQU A;  3OA5 A;  4TNS A;  5HWC A;  4ZPT R;  4MNL A;  1O6I A;  2FKE A;  3O5E A;  1D6O A;  1T11 A;  1UR8 A;  3ALG A;  2RUQ A;  2LGO A;  3KAC A;  3BXW A;  5HT1 A;  4O2T A;  2MPH A;  3UF8 A;  3CH9 A;  1FKL A;  1ZBW A;  2M2A A;  2P4V A;  1HJV A;  2RQS A;  4DWS B;  4P8X A;  2ESC A;  1JCH B;  3UQI A;  4HAR A;  4U86 A;  1QPL A;  1NWU A;  1FKK A;  4WKF A;  4WIW A;  4BF8 A;  5HKG A;  5JH8 A;  1J6Y A;  1W9U A;  1BL4 A;  2F2D A;  4S3J A;  1NWR A;  3PRA A;  3WQW A;  3IK8 A;  4TW7 A;  4MSP A;  2QF8 A;  4ZPW R;  2PPO A;  4KQZ A;  3WKZ A;  2KR7 A;  2PV3 A;  4DH0 A;  1E9L A;  2OFN A;  4MPK A;  1NWS A;  2KGJ A;  1NSG A;  4J4N A;  2DT0 A;  2F4E A;  3ARR A;  4MTV A;  5DIV A;  2DT3 A;  4ITZ A;  1JNT A;  1FAP A;  4DRN A;  3WIJ A;  1K9T A;  2JZV A;  3B7X A;  2ITK A;  4IPX A;  1D7J A;  2DPE A;  3CHF A;  4Z2J A;  3CGN A;  4MGV A;  4TX0 A;  1ITX A;  3NRK A;  1HKJ A;  3B8S A;  3JYJ A;  2A3A A;  4QT3 A;  1YAT A;  4P8V A;  4Z2I A;  1PBK A;  3KAD A;  2YBT A;  3WD3 A;  3ARS A;  3OOB A;  3JXV A;  5DO2 A;  3WD2 A;  5HWB A;  1W9V A;  1ZCN A;  3RGC A;  4JFM A;  1FD9 A;  3RFW A;  3WD4 A;  3O5F A;  5HW7 A;  3O5K A;  4ML4 A;  1XRV A;  4W9O A;  4NNR A;  5GPR A;  2K8I A;  2WM0 A;  4ODN A;  2MLZ A;  5B8I C;  3ART A;  1ZK6 A;  1X6L A;  1FFR A;  4DT4 A;  1GPF A;  3LUO A;  1GRJ A;  3ARU A;  2RSE A;  1ROU A;  1EYM A;  1NH6 A;  1X6N A;  1E6Z A;  1LQ0 A;  1JNS A;  4MNK A;  1KT1 A;  3ODK A;  3EIP A;  4L72 B;  3O5J A;  1OGB A;  2B31 A;  1EDQ A;  4IQC A;  5HUA A;  4TYO A;  3I6C A;  2B5U B;  1ZBK A;  1KFW A;  4ODK A;  1PIN A;  3B9A A;  3KAB A;  1J4I A;  1FKR A;  2DT2 A;  3ARY A;  2DG4 A;  2PV1 A;  3B9D A;  3TCZ A;  1FKS A;  3W4R A;  2A3C A;  2PN0 A;  3O5L A;  4W5U A;  3KAH A;  3WL0 A;  4G2P A;  4DRO A;  2DSW A;  1D7I A;  1RD6 A;  1WB0 A;  5DIT A;  5J6E A;  5DEZ A;  4DWS A;  4JFI A;  4FN2 A;  4LAX A;  4WKH A;  3ARP A;  4DWS D;  4Q7N A;  4NZC A;  3UQB A;  3BMB A;  2M1I A;  3AS2 A;  4IT4 A;  4ODP A;  2XP4 A;  4DRQ A;  2WLZ A;  4P8U A;  3KZ7 A;  4GGQ A;  1J4R A;  3ARZ A;  4N19 A;  3QOK A;  2F23 A;  3TC5 A;  2PPP A;  4Z2L A;  4AY1 A;  2LPV A;  2DT1 A;  2DSV A;  2ETN A;  2N87 A;  2KI3 A;  2XPA A;  3ALF A;  2G8Z A;  1L1P A;  3NTP A;  3ARX A;  4ODR A;  4DRM A;  4R0X A;  2A3E A;  2XP3 A;  3PRB A;  4DRP A;  1FKB A;  4MNJ A;  3TDB A;  2Y78 A;  1EHN A;  2XP9 A;  2UZ5 A;  2VN1 A;  4JFK A;  1P5Q A;  2Q5A A;  1LL4 A;  2O9O A;  4DRK A;  2RUC A;  4ZPV R;  1LL7 A;  2ZR4 A;  2DSZ A;  1E6R A;  1OGG A;  2FDM A;  4XAK A;  1LJY A;  1ROT A;  5I98 A;  3KCE A;  1LG1 A;  1FKJ A;  1E6N A;  4WK9 A;  3WH0 A;  1JNE A;  4Q22 A;  2ZQT A;  1IX5 A;  4P8W A;  3UI4 A;  2KO7 A;  3GU0 A;  1W1V A;  2PPN A;  1WAW A;  1HXV A;  1FKD A;  2YBU A;  1XHG A;  4JFL A;  4DRJ A;  2XP7 A;  2RUR A;  1Q1C A;  1Q6U A;  3RM8 A;  4W9P A;  1JVW A;  4ODM A;  4QT2 A;  2DG9 A;  3O5R A;  4NSB A;  3O5I A;  2PBC A;  3B9E A;  1A7X A;  3KAG A;  1NWT A;  5BXJ A;  1E44 A;  4PTM A;  1Y0O A;  3EY6 A;  2KFW A;  1YW5 A;  3O5O A;  3MDY B;  4W9Q A;  2D9F A;  1GOI A;  4WJX A;  2IF4 A;  2M08 A;  1LL6 A;  1R9H A;  4DWS C;  2WLY A;  4TW6 A;  3RM4 A;  4G50 A;  1D7H A;  1U79 A;  3O5G A;  3O5P A;  2ZR5 A;  1FFQ A;  4LGX A;  5D75 A;  2OLH A;  4LAY A;  2DG3 A;  4ZS6 A;  3KAI A;  2MLY A;  4QIB A;  3G6L A;  4DZ2 A;  3O5Q A;  2ZR6 A;  1FKF A;  4HBO A;  1HKM A;  1LG2 A;  1QZ2 A;  3CHC A;  4HBE A;  1Q6H A;  4LAV A;  4DIP A;  2MF9 A;  5DF0 A;  1F8A B;  1UR9 A;  2VCD A;  1ZBC A;  1B6C A;  3VAW A;  5HBF A;  1KT0 A;  4FAP A;  3UI5 A;  1OWQ A;  2MLX A;  1ZBV A;  3G6M A;  2LKN A;  1HJX A;  1FKI A;  4IT6 A;  1W1P A;  1HKI A;  4URI A;  2WK2 A;  3PA7 A;  4DRI A;  3FXY A;  3GTY X;  4WKA A;  2XPB A;  1HJW A;  5HW6 A;  1H0I A;  3CZ8 A;  3ARV A;  1FJD A;  1BKF A;  1W1T A;  4U85 A;  4Z2K A;  1W1Y A;  3WL1 A;  3RME A;  4KR0 B;  2AWG A;  3ARO A;  4MNM A;  4JFJ A;  3UQA A;  1H0G A;  3IHZ A;  4DZ3 A;  3UI6 A;  2ZQU A;  2L2S A;  4U84 A;  1ZB5 A;  3GPK A;  1NMV A;  3IKG A;  5GPG A;  1SYT A;  4J4O A;  2MNT A;  2FAP A;  3AS1 A;  1FKT A;  2A3B A;  1ZU8 A;  1Q6I A;  2G41 A;  2O92 A;  1TFV A;  3WQV A;  3KAF A;  1F40 A;  1J4H A;  2IUZ A;  1W9P A;  4S3K A;  3PR9 A;  1GUV A;  1M5Y A;  1ZL1 A;  1W26 A;  2LJ4 A;  3AS3 A;  1E6P A;  3WD1 A;  1E15 A;  1JND A;  3O5M A;  1EIB A;  1HKK A;  3ARQ A;  3RM9 A;  1TCO C;  2XP6 A;  2DSU A;  4GIV A;  4Z2G A;  4ODQ A;  5GQB A;  1FKG A; 
#chains in the Genus database with same CATH homology
 3PRD A;  1SR0 A;  3ARW A;  4IQ2 A;  3NI6 A;  1VF8 A;  1C9H A;  4QZV B;  1EQ3 A;  1D2K A;  2ZQS A;  5HW8 A;  2F21 A;  3WD0 A;  4JYS A;  5DIU A;  2AOS A;  4LAW A;  1NMW A;  1QPF A;  4ODO A;  2KE0 A;  3O5D A;  3FY1 A;  3CHD A;  3FAP A;  1N1A A;  3IKD A;  4L3N A;  4R5E A;  2XP5 A;  2ZQV A;  3JYM A;  4DRH A;  3AS0 A;  4Z2H A;  3CGM A;  5HTG A;  2RUD A;  4TW8 A;  1CTN A;  4MAV A;  2XP8 A;  1WNO A;  3CHE A;  2PI6 A;  4C02 B;  1FKH A;  2PV2 A;  3H9R B;  4ODL A;  3AQU A;  3OA5 A;  4TNS A;  5HWC A;  4ZPT R;  4MNL A;  1O6I A;  2FKE A;  3O5E A;  1D6O A;  1T11 A;  1UR8 A;  3ALG A;  2RUQ A;  2LGO A;  3KAC A;  3BXW A;  5HT1 A;  4O2T A;  2MPH A;  3UF8 A;  3CH9 A;  1FKL A;  1ZBW A;  2M2A A;  1HJV A;  2RQS A;  4DWS B;  4P8X A;  2ESC A;  3UQI A;  4HAR A;  4U86 A;  1QPL A;  1NWU A;  1FKK A;  4WKF A;  4WIW A;  4BF8 A;  5HKG A;  5JH8 A;  1J6Y A;  1W9U A;  1BL4 A;  2F2D A;  4S3J A;  1NWR A;  3PRA A;  3WQW A;  3IK8 A;  4TW7 A;  4MSP A;  2QF8 A;  4ZPW R;  2PPO A;  4KQZ A;  3WKZ A;  2KR7 A;  2PV3 A;  4DH0 A;  1E9L A;  2OFN A;  4MPK A;  1NWS A;  2KGJ A;  1NSG A;  4J4N A;  2DT0 A;  2F4E A;  3ARR A;  4MTV A;  5DIV A;  2DT3 A;  4ITZ A;  1JNT A;  1FAP A;  4DRN A;  3WIJ A;  1K9T A;  2JZV A;  3B7X A;  2ITK A;  4IPX A;  1D7J A;  2DPE A;  3CHF A;  4Z2J A;  3CGN A;  4MGV A;  4TX0 A;  1ITX A;  3NRK A;  1HKJ A;  3B8S A;  3JYJ A;  2A3A A;  4QT3 A;  1YAT A;  4P8V A;  4Z2I A;  1PBK A;  3KAD A;  2YBT A;  3WD3 A;  3ARS A;  3OOB A;  3JXV A;  5DO2 A;  3WD2 A;  5HWB A;  1W9V A;  1ZCN A;  3RGC A;  4JFM A;  1FD9 A;  3RFW A;  3WD4 A;  3O5F A;  5HW7 A;  3O5K A;  4ML4 A;  1XRV A;  4W9O A;  4NNR A;  5GPR A;  2K8I A;  2WM0 A;  4ODN A;  2MLZ A;  5B8I C;  3ART A;  1ZK6 A;  1X6L A;  1FFR A;  4DT4 A;  1GPF A;  3LUO A;  3ARU A;  2RSE A;  1ROU A;  1EYM A;  1NH6 A;  1X6N A;  1E6Z A;  1LQ0 A;  1JNS A;  4MNK A;  1KT1 A;  3ODK A;  4L72 B;  3O5J A;  1OGB A;  2B31 A;  1EDQ A;  4IQC A;  5HUA A;  4TYO A;  3I6C A;  1ZBK A;  1KFW A;  4ODK A;  1PIN A;  3B9A A;  3KAB A;  1J4I A;  1FKR A;  2DT2 A;  3ARY A;  2DG4 A;  2PV1 A;  3B9D A;  3TCZ A;  1FKS A;  3W4R A;  2A3C A;  3O5L A;  4W5U A;  3KAH A;  3WL0 A;  4G2P A;  4DRO A;  2DSW A;  1D7I A;  1RD6 A;  1WB0 A;  5DIT A;  5J6E A;  5DEZ A;  4DWS A;  4JFI A;  4FN2 A;  4LAX A;  4WKH A;  3ARP A;  4DWS D;  4Q7N A;  4NZC A;  3UQB A;  2M1I A;  3AS2 A;  4IT4 A;  4ODP A;  2XP4 A;  4DRQ A;  2WLZ A;  4P8U A;  3KZ7 A;  4GGQ A;  1J4R A;  3ARZ A;  4N19 A;  3QOK A;  3TC5 A;  2PPP A;  4Z2L A;  4AY1 A;  2LPV A;  2DT1 A;  2DSV A;  2N87 A;  2KI3 A;  2XPA A;  3ALF A;  2G8Z A;  1L1P A;  3NTP A;  3ARX A;  4ODR A;  4DRM A;  4R0X A;  2A3E A;  2XP3 A;  3PRB A;  4DRP A;  1FKB A;  4MNJ A;  3TDB A;  2Y78 A;  1EHN A;  2XP9 A;  2UZ5 A;  2VN1 A;  4JFK A;  1P5Q A;  2Q5A A;  1LL4 A;  2O9O A;  4DRK A;  2RUC A;  4ZPV R;  1LL7 A;  2ZR4 A;  2DSZ A;  1E6R A;  1OGG A;  2FDM A;  4XAK A;  1LJY A;  1ROT A;  5I98 A;  3KCE A;  1LG1 A;  1FKJ A;  1E6N A;  4WK9 A;  3WH0 A;  1JNE A;  4Q22 A;  2ZQT A;  1IX5 A;  4P8W A;  3UI4 A;  2KO7 A;  1W1V A;  2PPN A;  1WAW A;  1HXV A;  1FKD A;  2YBU A;  1XHG A;  4JFL A;  4DRJ A;  2XP7 A;  2RUR A;  1Q1C A;  1Q6U A;  3RM8 A;  4W9P A;  1JVW A;  4ODM A;  4QT2 A;  2DG9 A;  3O5R A;  4NSB A;  3O5I A;  2PBC A;  3B9E A;  1A7X A;  3KAG A;  1NWT A;  5BXJ A;  4PTM A;  1Y0O A;  3EY6 A;  2KFW A;  1YW5 A;  3O5O A;  3MDY B;  4W9Q A;  2D9F A;  1GOI A;  4WJX A;  2IF4 A;  2M08 A;  1LL6 A;  1R9H A;  4DWS C;  2WLY A;  4TW6 A;  3RM4 A;  4G50 A;  1D7H A;  1U79 A;  3O5G A;  3O5P A;  2ZR5 A;  1FFQ A;  4LGX A;  5D75 A;  2OLH A;  4LAY A;  2DG3 A;  4ZS6 A;  3KAI A;  2MLY A;  4QIB A;  3G6L A;  4DZ2 A;  3O5Q A;  2ZR6 A;  1FKF A;  4HBO A;  1HKM A;  1LG2 A;  1QZ2 A;  3CHC A;  4HBE A;  1Q6H A;  4LAV A;  4DIP A;  2MF9 A;  5DF0 A;  1F8A B;  1UR9 A;  2VCD A;  1ZBC A;  1B6C A;  3VAW A;  5HBF A;  1KT0 A;  4FAP A;  3UI5 A;  1OWQ A;  2MLX A;  1ZBV A;  3G6M A;  2LKN A;  1HJX A;  1FKI A;  4IT6 A;  1W1P A;  1HKI A;  4URI A;  2WK2 A;  3PA7 A;  4DRI A;  3FXY A;  4WKA A;  2XPB A;  1HJW A;  5HW6 A;  1H0I A;  3CZ8 A;  3ARV A;  1FJD A;  1BKF A;  1W1T A;  4U85 A;  4Z2K A;  1W1Y A;  3WL1 A;  3RME A;  4KR0 B;  2AWG A;  3ARO A;  4MNM A;  4JFJ A;  3UQA A;  1H0G A;  3IHZ A;  4DZ3 A;  3UI6 A;  2ZQU A;  2L2S A;  4U84 A;  1ZB5 A;  3GPK A;  1NMV A;  3IKG A;  5GPG A;  1SYT A;  4J4O A;  2MNT A;  2FAP A;  3AS1 A;  1FKT A;  2A3B A;  1ZU8 A;  1Q6I A;  2G41 A;  2O92 A;  1TFV A;  3WQV A;  3KAF A;  1F40 A;  1J4H A;  2IUZ A;  1W9P A;  4S3K A;  3PR9 A;  1GUV A;  1M5Y A;  1ZL1 A;  1W26 A;  2LJ4 A;  3AS3 A;  1E6P A;  3WD1 A;  1E15 A;  1JND A;  3O5M A;  1EIB A;  1HKK A;  3ARQ A;  3RM9 A;  1TCO C;  2XP6 A;  2DSU A;  4GIV A;  4Z2G A;  4ODQ A;  5GQB A;  1FKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...