4DRPA

Evaluation of synthetic fk506 analogs as ligands for the fk506-binding proteins 51 and 52: complex of fkbp51 with 2-(3-((r)-3-(3,4-dimethoxyphenyl)-1-((s)-1-(2-((1r,2s)-2-ethyl-1-hydroxy-cyclohexyl)-2-oxoacetyl)piperidine-2-carbonyloxy)propyl)phenoxy)acetic acid from cocrystallization
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Evaluation of Synthetic FK506 Analogues as Ligands for the FK506-Binding Proteins 51 and 52.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drpA00
4ODLA 5DIVA 4NNRA 2FAPA 3O5KA 3O5PA 1QZ2A 2XP9A 4JFKA 2PV2A 2ZQUA 4FN2A 3O5LA 4JYSA 4FAPA 1Q1CA 1FKRA 3UI5A 5J6EA 4DRKA 2LPVA 1FD9A 4J4NA 4ODPA 2XP8A 4DRNA 4DRPA 4DH0A 3UI4A 2F2DA 1FKGA 2F21A 4LAYA 2VN1A 4TX0A 4W9QA 1EQ3A 2RUCA 3O5GA 2XP4A 1B6CA 1JNTA 2ITKA 4ODMA 4W9OA 3PRBA 4ODOA 2F4EA 2K8IA 3IHZA 2PV1A 3OOBA 2PPPA 1J4IA 4QT2A 5D75A 2M1IA 3NRKA 5DITA 3O5OA 4DZ2A 1Q6IA 2DG4A 3KCEA 4LAXA 2XP7A 1PINA 2LKNA 3CGNA 2PPNA 2MNTA 2LJ4A 1D7JA 4LAWA 1U79A 1FKLA 3KADA 5BXJA 2UZ5A 4IPXA 4TYOA 2KO7A 4LAVA 2AWGA 3B7XA 4JFIA 4O2TA 5I98A 2M08A 1J4RA 1FKHA 2KE0A 1Y0OA 1F40A 1A7XA 4W9PA 3LUOA 2KR7A 1M5YA 3RGCA 5HKGA 2RSEA 1W26A 2M2AA 3UQAA 1ZK6A 3NI6A 5HUAA 1QPFA 2ZR6A 3CGMA 1NSGA 5HW6A 4IQCA 3I6CA 1ROTA 2KFWA 4ITZA 1BL4A 2RUQA 3PA7A 1D7IA 1BKFA 2Y78A 1J4HA 2LGOA 3TDBA 1FKSA 3KABA 2L2SA 3KAGA 4J4OA 2PBCA 1QPLA 3O5EA 4TW6A 4G50A 5B8IC 2MPHA 3FAPA 1YATA 3UQBA 1JNSA 5GPGA 2MLZA 4U85A 3TCZA 3UI6A 3KAHA 1JVWA 5HWBA 1HXVA 2XP3A 4MSPA 1T11A 1TCOC 3NTPA 4DRIA 1ROUA 2MLYA 1NMVA 2XPBA 3KZ7A 1D7HA 1FJDA 4G2PA 4ODKA 2KI3A 2D9FA 1FAPA 3UQIA 4C02B 2ZQTA 2ZQSA 3MDYB 1EYMA 1YW5A 1KT0A 3IKDA 5DIUA 4DIPA 5HT1A 2KGJA 1N1AA 4N19A 4R0XA 4ODRA 5HWCA 1R9HA 2N87A 2OFNA 2RURA 3O5FA 1Q6HA 2PPOA 4TW8A 2ZR4A 1L1PA 1FKDA 4IQ2A 2ZQVA 2MF9A 4GGQA 3H9RB 3IKGA 1J6YA 1P5QA 1FKFA 4QIBA 4DROA 3JYJA 4DRHA 3UF8A 3JYMA 2PV3A 3ODKA 4JFJA 4ODNA 4U86A 4TNSA 1F8AB 4JFLA 2RQSA 3PRDA 3KAFA 4GIVA 3TC5A 4DZ3A 1Q6UA 1C9HA 2RUDA 3O5DA 4DT4A 1D6OA 2XP5A 1FKTA 2XPAA 1NMWA 1PBKA 3O5IA 1FKKA 3KAIA 1KT1A 3VAWA 2Q5AA 3O5QA 2VCDA 4JFMA 1FKIA 3EY6A 3KACA 2DG3A 3JXVA 4DRQA 2XP6A 3IK8A 4ODQA 1FKJA 3O5MA 4BF8A 3GPKA 4MGVA 4DRJA 2JZVA 4U84A 1FKBA 3RFWA 2ZR5A 2MLXA 4DRMA 5HTGA 1ZCNA 2FKEA 5HW7A 4QT3A 2DG9A 4TW7A 2IF4A 3WH0A 3O5JA 3O5RA 5HW8A
chains in the Genus database with same CATH superfamily
3CHDA 5DIVA 1GUVA 2PV2A 4FN2A 4JFKA 2AOSA 2DT0A 1HKMA 4W5UA 3UI5A 4DRKA 2EULA 4J4NA 2XP8A 1NWUA 1FKGA 2F21A 4LAYA 4TX0A 2RUCA 2XP4A 1B6CA 2ITKA 4ODOA 1HJVA 2G8ZA 2K8IA 3ARUA 3OOBA 5DITA 1Q6IA 4WK9A 1ZBKA 1PINA 3CGNA 4MNMA 4LAWA 2LJ4A 1E15A 1VF8A 4URIA 2KO7A 4LAVA 4HBEA 1NWTA 1Y0OA 1A7XA 4MPKA 3RM4A 3UQAA 3RMEA 1QPFA 4HARA 2KFWA 3PA7A 4HBOA 3KABA 3O5EA 4G50A 1YATA 3RM9A 3AS2A 3UI6A 5HWBA 4Z2JA 4MSPA 3AS3A 1O6IA 3GTYX 1D2KA 3WD1A 2KI3A 3OA5A 2ZQTA 1E9LA 3WQVA 3IKDA 1KT0A 3CHEA 5DIUA 5HT1A 3BMBA 5HWCA 2N87A 2PPOA 2ZR4A 4IQ2A 3ARQA 2MF9A 4GGQA 3IKGA 1ZBVA 1IX5A 3WD0A 3PRAA 3JYJA 4DRHA 4NSBA 3UF8A 3JYMA 2O92A 1OWQA 2QF8A 1W9UA 1GOIA 1Q6UA 1FKTA 1NMWA 1FKKA 2Q5AA 2VCDA 1FKIA 3CHCA 3IK8A 4IT4A 1FKJA 4L3NA 1EHNA 3GPKA 4DRJA 4DRMA 1E44A 2IF4A 1JNDA 3O5JA 4MNLA 4ODLA 2XP9A 4FAPA 4ML4A 1FD9A 4ODPA 3WL0A 1W1PA 3UI4A 2VN1A 1FFQA 1EQ3A 2ETNA 1ZBCA 5DEZA 3BXWA 1J4IA 3WD4A 4DZ2A 3NRKA 2MNTA 4QZVB 4R5EA 3KADA 4IPXA 4TYOA 4O2TA 3GU0A 2WM0A 2KR7A 5GQBA 2RSEA 4WJXA 2M2AA 3NI6A 1E6NA 2ZR6A 5HW6A 3I6CA 1ROTA 4LGXA 1BL4A 2DSVA 2RUQA 1D7IA 1X6LA 3RM8A 1J4HA 3TDBA 2L2SA 4J4OA 2PBCA 2MPHA 3FAPA 5GPGA 4U85A 3TCZA 1GRJA 5DO2A 1WNOA 1TFVA 1TCOC 1NMVA 5DF0A 2XPBA 4Z2GA 4G2PA 2G41A 1X6NA 3AROA 1N1AA 2WLYA 4PTMA 1R9HA 3O5FA 1Q6HA 4Z2KA 1FKDA 2A3BA 3H9RB 1P5QA 4QIBA 3AS1A 3ARZA 1E6RA 4DWSC 4TNSA 1EDQA 4JFLA 1XHGA 2RQSA 3ARVA 3KAFA 3PRDA 4GIVA 1C9HA 3O5DA 1D6OA 4MNJA 1PBKA 3O5IA 3KAIA 4JFMA 3EY6A 3JXVA 4NZCA 3CHFA 4WIWA 1LJYA 1LL6A 4MGVA 2JZVA 1EIBA 4U84A 2ZR5A 1W9VA 4ZPTR 2DT2A 5GPRA 2DG9A 1OGGA 2DT1A 3WH0A 1NWRA 3O5RA 1ZBWA 4NNRA 2FAPA 3O5KA 1UR8A 2ZQUA 3FXYA 4DWSA 4JYSA 3CH9A 1FKRA 1SR0A 2LPVA 3ARWA 4DRPA 4DH0A 4ZPWR 3WIJA 3O5GA 4W9OA 2F4EA 3B9DA 2PPPA 1E6PA 4DWSB 5D75A 2M1IA 2DG4A 3KCEA 4LAXA 3WKZA 1LG2A 1U79A 1FKLA 5BXJA 2YBTA 2UZ5A 2AWGA 3B7XA 5I98A 2OLHA 1J4RA 1FKHA 1HKKA 1GPFA 1F40A 4W9PA 3LUOA 1M5YA 5HKGA 1W26A 2PI6A 1NWSA 4Q22A 1LL7A 1ZB5A 5HUAA 3CGMA 4IQCA 4ITZA 2FDMA 1BKFA 1FKSA 3KAGA 1QPLA 3ARRA 4WKFA 4P8XA 3CZ8A 1ROUA 3KZ7A 1FJDA 2YBUA 4ODKA 2D9FA 1FAPA 3UQIA 3ARYA 1ZU8A 4IT6A 1JNEA 2KGJA 3ARXA 4R0XA 4S3JA 3W4RA 3B9AA 1UR9A 4TW8A 1L1PA 1CTNA 2ZQVA 1HJWA 3ALGA 4Z2IA 2B31A 3B9EA 1W1VA 1SYTA 3AS0A 2PV3A 3ODKA 2WLZA 4ODNA 1F8AB 2PN0A 3TC5A 4DZ3A 4L72B 3WQWA 4MNKA 3ARTA 3O5QA 2IUZA 3WD2A 2F23A 2DG3A 2DT3A 2XP6A 3AQUA 4ODQA 3O5MA 3ARPA 4P8VA 1LL4A 1FKBA 4AY1A 5HTGA 1ZCNA 2FKEA 4WKHA 1HKJA 1W9PA 2P4VA 4UDMA 1JCHB 3O5PA 1QZ2A 1FFRA 3O5LA 2DSWA 1Q1CA 1KFWA 5J6EA 3B8SA 4DRNA 2F2DA 4W9QA 1W1YA 4ODMA 1JNTA 3PRBA 4WKAA 4XAKA 3IHZA 1LQ0A 1WB0A 2PV1A 4P8UA 4MTVA 4QT2A 3O5OA 2XP7A 2LKNA 1RD6A 2PPNA 1D7JA 4P8WA 4KQZA 4JFIA 1HKIA 2DSUA 2M08A 4Z2HA 2DPEA 4KR0B 2KE0A 2O9OA 3RGCA 1ZK6A 1HJXA 4Q7NA 1NSGA 1LG1A 2Y78A 2LGOA 2ESCA 1W1TA 4TW6A 5B8IC 1JNSA 1K9TA 3UQBA 2MLZA 3ARSA 3KAHA 1JVWA 1HXVA 2XP3A 4MAVA 4DRIA 1T11A 3NTPA 4Z2LA 2MLYA 3QOKA 1D7HA 1XRVA 2A3EA 1H0GA 4C02B 2ZQSA 3MDYB 1EYMA 1YW5A 4DIPA 3WL1A 3EIPA 5JH8A 4N19A 4ODRA 2OFNA 2RURA 1H0IA 4DWSD 1WAWA 3ALFA 3G6LA 1J6YA 1FKFA 4DROA 1ITXA 3WD3A 2B5UB 4JFJA 4U86A 2A3AA 2A3CA 3G6MA 4DT4A 2RUDA 2XP5A 2XPAA 3VAWA 2WK2A 1KT1A 3KACA 4DRQA 4ZPVR 4S3KA 1E6ZA 1NH6A 4BF8A 4ZS6A 3RFWA 2DSZA 2MLXA 5HBFA 3PR9A 3FY1A 5HW7A 4QT3A 4TW7A 1OGBA 1ZL1A 5HW8A
chains in the Genus database with same CATH topology
3CHDA 5DIVA 1GUVA 2PV2A 4FN2A 4JFKA 2AOSA 2DT0A 1HKMA 4W5UA 3UI5A 4DRKA 4J4NA 2XP8A 1NWUA 1FKGA 2F21A 4LAYA 4TX0A 2RUCA 2XP4A 1B6CA 2ITKA 4ODOA 1HJVA 2G8ZA 2K8IA 3ARUA 3OOBA 5DITA 1Q6IA 4WK9A 1ZBKA 1PINA 3CGNA 4MNMA 4LAWA 2LJ4A 1E15A 1VF8A 4URIA 2KO7A 4LAVA 4HBEA 1NWTA 1Y0OA 1A7XA 4MPKA 3RM4A 3UQAA 3RMEA 1QPFA 4HARA 2KFWA 3PA7A 4HBOA 3KABA 3O5EA 4G50A 1YATA 3RM9A 3AS2A 3UI6A 5HWBA 4Z2JA 4MSPA 3AS3A 1O6IA 1D2KA 3WD1A 2KI3A 3OA5A 2ZQTA 1E9LA 3WQVA 3IKDA 1KT0A 3CHEA 5DIUA 5HT1A 5HWCA 2N87A 2PPOA 2ZR4A 4IQ2A 3ARQA 2MF9A 4GGQA 3IKGA 1ZBVA 1IX5A 3WD0A 3PRAA 3JYJA 4DRHA 4NSBA 3UF8A 3JYMA 2O92A 1OWQA 2QF8A 1W9UA 1GOIA 1Q6UA 1FKTA 1NMWA 1FKKA 2Q5AA 2VCDA 1FKIA 3CHCA 3IK8A 4IT4A 1FKJA 4L3NA 1EHNA 3GPKA 4DRJA 4DRMA 2IF4A 1JNDA 3O5JA 4MNLA 4ODLA 2XP9A 4FAPA 4ML4A 1FD9A 4ODPA 3WL0A 1W1PA 3UI4A 2VN1A 1FFQA 1EQ3A 1ZBCA 5DEZA 3BXWA 1J4IA 3WD4A 4DZ2A 3NRKA 2MNTA 4QZVB 4R5EA 3KADA 4IPXA 4TYOA 4O2TA 2WM0A 2KR7A 5GQBA 2RSEA 4WJXA 2M2AA 3NI6A 1E6NA 2ZR6A 5HW6A 3I6CA 1ROTA 4LGXA 1BL4A 2DSVA 2RUQA 1D7IA 1X6LA 3RM8A 1J4HA 3TDBA 2L2SA 4J4OA 2PBCA 2MPHA 3FAPA 5GPGA 4U85A 3TCZA 5DO2A 1WNOA 1TFVA 1TCOC 1NMVA 5DF0A 2XPBA 4Z2GA 4G2PA 2G41A 1X6NA 3AROA 1N1AA 2WLYA 4PTMA 1R9HA 3O5FA 1Q6HA 4Z2KA 1FKDA 2A3BA 3H9RB 1P5QA 4QIBA 3AS1A 3ARZA 1E6RA 4DWSC 4TNSA 1EDQA 4JFLA 1XHGA 2RQSA 3ARVA 3KAFA 3PRDA 4GIVA 1C9HA 3O5DA 1D6OA 4MNJA 1PBKA 3O5IA 3KAIA 4JFMA 3EY6A 3JXVA 4NZCA 3CHFA 4WIWA 1LJYA 1LL6A 4MGVA 2JZVA 1EIBA 4U84A 2ZR5A 1W9VA 4ZPTR 2DT2A 5GPRA 2DG9A 1OGGA 2DT1A 3WH0A 1NWRA 3O5RA 1ZBWA 4NNRA 2FAPA 3O5KA 1UR8A 2ZQUA 3FXYA 4DWSA 4JYSA 3CH9A 1FKRA 1SR0A 2LPVA 3ARWA 4DRPA 4DH0A 4ZPWR 3WIJA 3O5GA 4W9OA 2F4EA 3B9DA 2PPPA 1E6PA 4DWSB 5D75A 2M1IA 2DG4A 3KCEA 4LAXA 3WKZA 1LG2A 1U79A 1FKLA 5BXJA 2YBTA 2UZ5A 2AWGA 3B7XA 5I98A 2OLHA 1J4RA 1FKHA 1HKKA 1GPFA 1F40A 4W9PA 3LUOA 1M5YA 5HKGA 1W26A 2PI6A 1NWSA 4Q22A 1LL7A 1ZB5A 5HUAA 3CGMA 4IQCA 4ITZA 2FDMA 1BKFA 1FKSA 3KAGA 1QPLA 3ARRA 4WKFA 4P8XA 3CZ8A 1ROUA 3KZ7A 1FJDA 2YBUA 4ODKA 2D9FA 1FAPA 3UQIA 3ARYA 1ZU8A 4IT6A 1JNEA 2KGJA 3ARXA 4R0XA 4S3JA 3W4RA 3B9AA 1UR9A 4TW8A 1L1PA 1CTNA 2ZQVA 1HJWA 3ALGA 4Z2IA 2B31A 3B9EA 1W1VA 1SYTA 3AS0A 2PV3A 3ODKA 2WLZA 4ODNA 1F8AB 3TC5A 4DZ3A 4L72B 3WQWA 4MNKA 3ARTA 3O5QA 2IUZA 3WD2A 2DG3A 2DT3A 2XP6A 3AQUA 4ODQA 3O5MA 3ARPA 4P8VA 1LL4A 1FKBA 4AY1A 5HTGA 1ZCNA 2FKEA 4WKHA 1HKJA 1W9PA 3O5PA 1QZ2A 1FFRA 3O5LA 2DSWA 1Q1CA 1KFWA 5J6EA 3B8SA 4DRNA 2F2DA 4W9QA 1W1YA 4ODMA 1JNTA 3PRBA 4WKAA 4XAKA 3IHZA 1LQ0A 1WB0A 2PV1A 4P8UA 4MTVA 4QT2A 3O5OA 2XP7A 2LKNA 1RD6A 2PPNA 1D7JA 4P8WA 4KQZA 4JFIA 1HKIA 2DSUA 2M08A 4Z2HA 2DPEA 4KR0B 2KE0A 2O9OA 3RGCA 1ZK6A 1HJXA 4Q7NA 1NSGA 1LG1A 2Y78A 2LGOA 2ESCA 1W1TA 4TW6A 5B8IC 1JNSA 1K9TA 3UQBA 2MLZA 3ARSA 3KAHA 1JVWA 1HXVA 2XP3A 4MAVA 4DRIA 1T11A 3NTPA 4Z2LA 2MLYA 3QOKA 1D7HA 1XRVA 2A3EA 1H0GA 4C02B 2ZQSA 3MDYB 1EYMA 1YW5A 4DIPA 3WL1A 5JH8A 4N19A 4ODRA 2OFNA 2RURA 1H0IA 4DWSD 1WAWA 3ALFA 3G6LA 1J6YA 1FKFA 4DROA 1ITXA 3WD3A 4JFJA 4U86A 2A3AA 2A3CA 3G6MA 4DT4A 2RUDA 2XP5A 2XPAA 3VAWA 2WK2A 1KT1A 3KACA 4DRQA 4ZPVR 4S3KA 1E6ZA 1NH6A 4BF8A 4ZS6A 3RFWA 2DSZA 2MLXA 5HBFA 3PR9A 3FY1A 5HW7A 4QT3A 4TW7A 1OGBA 1ZL1A 5HW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODL A;  5DIV A;  4NNR A;  2FAP A;  3O5K A;  3O5P A;  1QZ2 A;  2XP9 A;  4JFK A;  2PV2 A;  2ZQU A;  4FN2 A;  3O5L A;  4JYS A;  4FAP A;  1Q1C A;  1FKR A;  3UI5 A;  5J6E A;  4DRK A;  2LPV A;  1FD9 A;  4J4N A;  4ODP A;  2XP8 A;  4DRN A;  4DRP A;  4DH0 A;  3UI4 A;  2F2D A;  1FKG A;  2F21 A;  4LAY A;  2VN1 A;  4TX0 A;  4W9Q A;  1EQ3 A;  2RUC A;  3O5G A;  2XP4 A;  1B6C A;  1JNT A;  2ITK A;  4ODM A;  4W9O A;  3PRB A;  4ODO A;  2F4E A;  2K8I A;  3IHZ A;  2PV1 A;  3OOB A;  2PPP A;  1J4I A;  4QT2 A;  5D75 A;  2M1I A;  3NRK A;  5DIT A;  3O5O A;  4DZ2 A;  1Q6I A;  2DG4 A;  3KCE A;  4LAX A;  2XP7 A;  1PIN A;  2LKN A;  3CGN A;  2PPN A;  2MNT A;  2LJ4 A;  1D7J A;  4LAW A;  1U79 A;  1FKL A;  3KAD A;  5BXJ A;  2UZ5 A;  4IPX A;  4TYO A;  2KO7 A;  4LAV A;  2AWG A;  3B7X A;  4JFI A;  4O2T A;  5I98 A;  2M08 A;  1J4R A;  1FKH A;  2KE0 A;  1Y0O A;  1F40 A;  1A7X A;  4W9P A;  3LUO A;  2KR7 A;  1M5Y A;  3RGC A;  5HKG A;  2RSE A;  1W26 A;  2M2A A;  3UQA A;  1ZK6 A;  3NI6 A;  5HUA A;  1QPF A;  2ZR6 A;  3CGM A;  1NSG A;  5HW6 A;  4IQC A;  3I6C A;  1ROT A;  2KFW A;  4ITZ A;  1BL4 A;  2RUQ A;  3PA7 A;  1D7I A;  1BKF A;  2Y78 A;  1J4H A;  2LGO A;  3TDB A;  1FKS A;  3KAB A;  2L2S A;  3KAG A;  4J4O A;  2PBC A;  1QPL A;  3O5E A;  4TW6 A;  4G50 A;  5B8I C;  2MPH A;  3FAP A;  1YAT A;  3UQB A;  1JNS A;  5GPG A;  2MLZ A;  4U85 A;  3TCZ A;  3UI6 A;  3KAH A;  1JVW A;  5HWB A;  1HXV A;  2XP3 A;  4MSP A;  1T11 A;  1TCO C;  3NTP A;  4DRI A;  1ROU A;  2MLY A;  1NMV A;  2XPB A;  3KZ7 A;  1D7H A;  1FJD A;  4G2P A;  4ODK A;  2KI3 A;  2D9F A;  1FAP A;  3UQI A;  4C02 B;  2ZQT A;  2ZQS A;  3MDY B;  1EYM A;  1YW5 A;  1KT0 A;  3IKD A;  5DIU A;  4DIP A;  5HT1 A;  2KGJ A;  1N1A A;  4N19 A;  4R0X A;  4ODR A;  5HWC A;  1R9H A;  2N87 A;  2OFN A;  2RUR A;  3O5F A;  1Q6H A;  2PPO A;  4TW8 A;  2ZR4 A;  1L1P A;  1FKD A;  4IQ2 A;  2ZQV A;  2MF9 A;  4GGQ A;  3H9R B;  3IKG A;  1J6Y A;  1P5Q A;  1FKF A;  4QIB A;  4DRO A;  3JYJ A;  4DRH A;  3UF8 A;  3JYM A;  2PV3 A;  3ODK A;  4JFJ A;  4ODN A;  4U86 A;  4TNS A;  1F8A B;  4JFL A;  2RQS A;  3PRD A;  3KAF A;  4GIV A;  3TC5 A;  4DZ3 A;  1Q6U A;  1C9H A;  2RUD A;  3O5D A;  4DT4 A;  1D6O A;  2XP5 A;  1FKT A;  2XPA A;  1NMW A;  1PBK A;  3O5I A;  1FKK A;  3KAI A;  1KT1 A;  3VAW A;  2Q5A A;  3O5Q A;  2VCD A;  4JFM A;  1FKI A;  3EY6 A;  3KAC A;  2DG3 A;  3JXV A;  4DRQ A;  2XP6 A;  3IK8 A;  4ODQ A;  1FKJ A;  3O5M A;  4BF8 A;  3GPK A;  4MGV A;  4DRJ A;  2JZV A;  4U84 A;  1FKB A;  3RFW A;  2ZR5 A;  2MLX A;  4DRM A;  5HTG A;  1ZCN A;  2FKE A;  5HW7 A;  4QT3 A;  2DG9 A;  4TW7 A;  2IF4 A;  3WH0 A;  3O5J A;  3O5R A;  5HW8 A; 
#chains in the Genus database with same CATH topology
 3CHD A;  5DIV A;  1GUV A;  2PV2 A;  4FN2 A;  4JFK A;  2AOS A;  2DT0 A;  1HKM A;  4W5U A;  3UI5 A;  4DRK A;  2EUL A;  4J4N A;  2XP8 A;  1NWU A;  1FKG A;  2F21 A;  4LAY A;  4TX0 A;  2RUC A;  2XP4 A;  1B6C A;  2ITK A;  4ODO A;  1HJV A;  2G8Z A;  2K8I A;  3ARU A;  3OOB A;  5DIT A;  1Q6I A;  4WK9 A;  1ZBK A;  1PIN A;  3CGN A;  4MNM A;  4LAW A;  2LJ4 A;  1E15 A;  1VF8 A;  4URI A;  2KO7 A;  4LAV A;  4HBE A;  1NWT A;  1Y0O A;  1A7X A;  4MPK A;  3RM4 A;  3UQA A;  3RME A;  1QPF A;  4HAR A;  2KFW A;  3PA7 A;  4HBO A;  3KAB A;  3O5E A;  4G50 A;  1YAT A;  3RM9 A;  3AS2 A;  3UI6 A;  5HWB A;  4Z2J A;  4MSP A;  3AS3 A;  1O6I A;  3GTY X;  1D2K A;  3WD1 A;  2KI3 A;  3OA5 A;  2ZQT A;  1E9L A;  3WQV A;  3IKD A;  1KT0 A;  3CHE A;  5DIU A;  5HT1 A;  3BMB A;  5HWC A;  2N87 A;  2PPO A;  2ZR4 A;  4IQ2 A;  3ARQ A;  2MF9 A;  4GGQ A;  3IKG A;  1ZBV A;  1IX5 A;  3WD0 A;  3PRA A;  3JYJ A;  4DRH A;  4NSB A;  3UF8 A;  3JYM A;  2O92 A;  1OWQ A;  2QF8 A;  1W9U A;  1GOI A;  1Q6U A;  1FKT A;  1NMW A;  1FKK A;  2Q5A A;  2VCD A;  1FKI A;  3CHC A;  3IK8 A;  4IT4 A;  1FKJ A;  4L3N A;  1EHN A;  3GPK A;  4DRJ A;  4DRM A;  1E44 A;  2IF4 A;  1JND A;  3O5J A;  4MNL A;  4ODL A;  2XP9 A;  4FAP A;  4ML4 A;  1FD9 A;  4ODP A;  3WL0 A;  1W1P A;  3UI4 A;  2VN1 A;  1FFQ A;  1EQ3 A;  2ETN A;  1ZBC A;  5DEZ A;  3BXW A;  1J4I A;  3WD4 A;  4DZ2 A;  3NRK A;  2MNT A;  4QZV B;  4R5E A;  3KAD A;  4IPX A;  4TYO A;  4O2T A;  3GU0 A;  2WM0 A;  2KR7 A;  5GQB A;  2RSE A;  4WJX A;  2M2A A;  3NI6 A;  1E6N A;  2ZR6 A;  5HW6 A;  3I6C A;  1ROT A;  4LGX A;  1BL4 A;  2DSV A;  2RUQ A;  1D7I A;  1X6L A;  3RM8 A;  1J4H A;  3TDB A;  2L2S A;  4J4O A;  2PBC A;  2MPH A;  3FAP A;  5GPG A;  4U85 A;  3TCZ A;  1GRJ A;  5DO2 A;  1WNO A;  1TFV A;  1TCO C;  1NMV A;  5DF0 A;  2XPB A;  4Z2G A;  4G2P A;  2G41 A;  1X6N A;  3ARO A;  1N1A A;  2WLY A;  4PTM A;  1R9H A;  3O5F A;  1Q6H A;  4Z2K A;  1FKD A;  2A3B A;  3H9R B;  1P5Q A;  4QIB A;  3AS1 A;  3ARZ A;  1E6R A;  4DWS C;  4TNS A;  1EDQ A;  4JFL A;  1XHG A;  2RQS A;  3ARV A;  3KAF A;  3PRD A;  4GIV A;  1C9H A;  3O5D A;  1D6O A;  4MNJ A;  1PBK A;  3O5I A;  3KAI A;  4JFM A;  3EY6 A;  3JXV A;  4NZC A;  3CHF A;  4WIW A;  1LJY A;  1LL6 A;  4MGV A;  2JZV A;  1EIB A;  4U84 A;  2ZR5 A;  1W9V A;  4ZPT R;  2DT2 A;  5GPR A;  2DG9 A;  1OGG A;  2DT1 A;  3WH0 A;  1NWR A;  3O5R A;  1ZBW A;  4NNR A;  2FAP A;  3O5K A;  1UR8 A;  2ZQU A;  3FXY A;  4DWS A;  4JYS A;  3CH9 A;  1FKR A;  1SR0 A;  2LPV A;  3ARW A;  4DRP A;  4DH0 A;  4ZPW R;  3WIJ A;  3O5G A;  4W9O A;  2F4E A;  3B9D A;  2PPP A;  1E6P A;  4DWS B;  5D75 A;  2M1I A;  2DG4 A;  3KCE A;  4LAX A;  3WKZ A;  1LG2 A;  1U79 A;  1FKL A;  5BXJ A;  2YBT A;  2UZ5 A;  2AWG A;  3B7X A;  5I98 A;  2OLH A;  1J4R A;  1FKH A;  1HKK A;  1GPF A;  1F40 A;  4W9P A;  3LUO A;  1M5Y A;  5HKG A;  1W26 A;  2PI6 A;  1NWS A;  4Q22 A;  1LL7 A;  1ZB5 A;  5HUA A;  3CGM A;  4IQC A;  4ITZ A;  2FDM A;  1BKF A;  1FKS A;  3KAG A;  1QPL A;  3ARR A;  4WKF A;  4P8X A;  3CZ8 A;  1ROU A;  3KZ7 A;  1FJD A;  2YBU A;  4ODK A;  2D9F A;  1FAP A;  3UQI A;  3ARY A;  1ZU8 A;  4IT6 A;  1JNE A;  2KGJ A;  3ARX A;  4R0X A;  4S3J A;  3W4R A;  3B9A A;  1UR9 A;  4TW8 A;  1L1P A;  1CTN A;  2ZQV A;  1HJW A;  3ALG A;  4Z2I A;  2B31 A;  3B9E A;  1W1V A;  1SYT A;  3AS0 A;  2PV3 A;  3ODK A;  2WLZ A;  4ODN A;  1F8A B;  2PN0 A;  3TC5 A;  4DZ3 A;  4L72 B;  3WQW A;  4MNK A;  3ART A;  3O5Q A;  2IUZ A;  3WD2 A;  2F23 A;  2DG3 A;  2DT3 A;  2XP6 A;  3AQU A;  4ODQ A;  3O5M A;  3ARP A;  4P8V A;  1LL4 A;  1FKB A;  4AY1 A;  5HTG A;  1ZCN A;  2FKE A;  4WKH A;  1HKJ A;  1W9P A;  2P4V A;  4UDM A;  1JCH B;  3O5P A;  1QZ2 A;  1FFR A;  3O5L A;  2DSW A;  1Q1C A;  1KFW A;  5J6E A;  3B8S A;  4DRN A;  2F2D A;  4W9Q A;  1W1Y A;  4ODM A;  1JNT A;  3PRB A;  4WKA A;  4XAK A;  3IHZ A;  1LQ0 A;  1WB0 A;  2PV1 A;  4P8U A;  4MTV A;  4QT2 A;  3O5O A;  2XP7 A;  2LKN A;  1RD6 A;  2PPN A;  1D7J A;  4P8W A;  4KQZ A;  4JFI A;  1HKI A;  2DSU A;  2M08 A;  4Z2H A;  2DPE A;  4KR0 B;  2KE0 A;  2O9O A;  3RGC A;  1ZK6 A;  1HJX A;  4Q7N A;  1NSG A;  1LG1 A;  2Y78 A;  2LGO A;  2ESC A;  1W1T A;  4TW6 A;  5B8I C;  1JNS A;  1K9T A;  3UQB A;  2MLZ A;  3ARS A;  3KAH A;  1JVW A;  1HXV A;  2XP3 A;  4MAV A;  4DRI A;  1T11 A;  3NTP A;  4Z2L A;  2MLY A;  3QOK A;  1D7H A;  1XRV A;  2A3E A;  1H0G A;  4C02 B;  2ZQS A;  3MDY B;  1EYM A;  1YW5 A;  4DIP A;  3WL1 A;  3EIP A;  5JH8 A;  4N19 A;  4ODR A;  2OFN A;  2RUR A;  1H0I A;  4DWS D;  1WAW A;  3ALF A;  3G6L A;  1J6Y A;  1FKF A;  4DRO A;  1ITX A;  3WD3 A;  2B5U B;  4JFJ A;  4U86 A;  2A3A A;  2A3C A;  3G6M A;  4DT4 A;  2RUD A;  2XP5 A;  2XPA A;  3VAW A;  2WK2 A;  1KT1 A;  3KAC A;  4DRQ A;  4ZPV R;  4S3K A;  1E6Z A;  1NH6 A;  4BF8 A;  4ZS6 A;  3RFW A;  2DSZ A;  2MLX A;  5HBF A;  3PR9 A;  3FY1 A;  5HW7 A;  4QT3 A;  4TW7 A;  1OGB A;  1ZL1 A;  5HW8 A; 
#chains in the Genus database with same CATH homology
 3CHD A;  5DIV A;  1GUV A;  2PV2 A;  4FN2 A;  4JFK A;  2AOS A;  2DT0 A;  1HKM A;  4W5U A;  3UI5 A;  4DRK A;  4J4N A;  2XP8 A;  1NWU A;  1FKG A;  2F21 A;  4LAY A;  4TX0 A;  2RUC A;  2XP4 A;  1B6C A;  2ITK A;  4ODO A;  1HJV A;  2G8Z A;  2K8I A;  3ARU A;  3OOB A;  5DIT A;  1Q6I A;  4WK9 A;  1ZBK A;  1PIN A;  3CGN A;  4MNM A;  4LAW A;  2LJ4 A;  1E15 A;  1VF8 A;  4URI A;  2KO7 A;  4LAV A;  4HBE A;  1NWT A;  1Y0O A;  1A7X A;  4MPK A;  3RM4 A;  3UQA A;  3RME A;  1QPF A;  4HAR A;  2KFW A;  3PA7 A;  4HBO A;  3KAB A;  3O5E A;  4G50 A;  1YAT A;  3RM9 A;  3AS2 A;  3UI6 A;  5HWB A;  4Z2J A;  4MSP A;  3AS3 A;  1O6I A;  1D2K A;  3WD1 A;  2KI3 A;  3OA5 A;  2ZQT A;  1E9L A;  3WQV A;  3IKD A;  1KT0 A;  3CHE A;  5DIU A;  5HT1 A;  5HWC A;  2N87 A;  2PPO A;  2ZR4 A;  4IQ2 A;  3ARQ A;  2MF9 A;  4GGQ A;  3IKG A;  1ZBV A;  1IX5 A;  3WD0 A;  3PRA A;  3JYJ A;  4DRH A;  4NSB A;  3UF8 A;  3JYM A;  2O92 A;  1OWQ A;  2QF8 A;  1W9U A;  1GOI A;  1Q6U A;  1FKT A;  1NMW A;  1FKK A;  2Q5A A;  2VCD A;  1FKI A;  3CHC A;  3IK8 A;  4IT4 A;  1FKJ A;  4L3N A;  1EHN A;  3GPK A;  4DRJ A;  4DRM A;  2IF4 A;  1JND A;  3O5J A;  4MNL A;  4ODL A;  2XP9 A;  4FAP A;  4ML4 A;  1FD9 A;  4ODP A;  3WL0 A;  1W1P A;  3UI4 A;  2VN1 A;  1FFQ A;  1EQ3 A;  1ZBC A;  5DEZ A;  3BXW A;  1J4I A;  3WD4 A;  4DZ2 A;  3NRK A;  2MNT A;  4QZV B;  4R5E A;  3KAD A;  4IPX A;  4TYO A;  4O2T A;  2WM0 A;  2KR7 A;  5GQB A;  2RSE A;  4WJX A;  2M2A A;  3NI6 A;  1E6N A;  2ZR6 A;  5HW6 A;  3I6C A;  1ROT A;  4LGX A;  1BL4 A;  2DSV A;  2RUQ A;  1D7I A;  1X6L A;  3RM8 A;  1J4H A;  3TDB A;  2L2S A;  4J4O A;  2PBC A;  2MPH A;  3FAP A;  5GPG A;  4U85 A;  3TCZ A;  5DO2 A;  1WNO A;  1TFV A;  1TCO C;  1NMV A;  5DF0 A;  2XPB A;  4Z2G A;  4G2P A;  2G41 A;  1X6N A;  3ARO A;  1N1A A;  2WLY A;  4PTM A;  1R9H A;  3O5F A;  1Q6H A;  4Z2K A;  1FKD A;  2A3B A;  3H9R B;  1P5Q A;  4QIB A;  3AS1 A;  3ARZ A;  1E6R A;  4DWS C;  4TNS A;  1EDQ A;  4JFL A;  1XHG A;  2RQS A;  3ARV A;  3KAF A;  3PRD A;  4GIV A;  1C9H A;  3O5D A;  1D6O A;  4MNJ A;  1PBK A;  3O5I A;  3KAI A;  4JFM A;  3EY6 A;  3JXV A;  4NZC A;  3CHF A;  4WIW A;  1LJY A;  1LL6 A;  4MGV A;  2JZV A;  1EIB A;  4U84 A;  2ZR5 A;  1W9V A;  4ZPT R;  2DT2 A;  5GPR A;  2DG9 A;  1OGG A;  2DT1 A;  3WH0 A;  1NWR A;  3O5R A;  1ZBW A;  4NNR A;  2FAP A;  3O5K A;  1UR8 A;  2ZQU A;  3FXY A;  4DWS A;  4JYS A;  3CH9 A;  1FKR A;  1SR0 A;  2LPV A;  3ARW A;  4DRP A;  4DH0 A;  4ZPW R;  3WIJ A;  3O5G A;  4W9O A;  2F4E A;  3B9D A;  2PPP A;  1E6P A;  4DWS B;  5D75 A;  2M1I A;  2DG4 A;  3KCE A;  4LAX A;  3WKZ A;  1LG2 A;  1U79 A;  1FKL A;  5BXJ A;  2YBT A;  2UZ5 A;  2AWG A;  3B7X A;  5I98 A;  2OLH A;  1J4R A;  1FKH A;  1HKK A;  1GPF A;  1F40 A;  4W9P A;  3LUO A;  1M5Y A;  5HKG A;  1W26 A;  2PI6 A;  1NWS A;  4Q22 A;  1LL7 A;  1ZB5 A;  5HUA A;  3CGM A;  4IQC A;  4ITZ A;  2FDM A;  1BKF A;  1FKS A;  3KAG A;  1QPL A;  3ARR A;  4WKF A;  4P8X A;  3CZ8 A;  1ROU A;  3KZ7 A;  1FJD A;  2YBU A;  4ODK A;  2D9F A;  1FAP A;  3UQI A;  3ARY A;  1ZU8 A;  4IT6 A;  1JNE A;  2KGJ A;  3ARX A;  4R0X A;  4S3J A;  3W4R A;  3B9A A;  1UR9 A;  4TW8 A;  1L1P A;  1CTN A;  2ZQV A;  1HJW A;  3ALG A;  4Z2I A;  2B31 A;  3B9E A;  1W1V A;  1SYT A;  3AS0 A;  2PV3 A;  3ODK A;  2WLZ A;  4ODN A;  1F8A B;  3TC5 A;  4DZ3 A;  4L72 B;  3WQW A;  4MNK A;  3ART A;  3O5Q A;  2IUZ A;  3WD2 A;  2DG3 A;  2DT3 A;  2XP6 A;  3AQU A;  4ODQ A;  3O5M A;  3ARP A;  4P8V A;  1LL4 A;  1FKB A;  4AY1 A;  5HTG A;  1ZCN A;  2FKE A;  4WKH A;  1HKJ A;  1W9P A;  3O5P A;  1QZ2 A;  1FFR A;  3O5L A;  2DSW A;  1Q1C A;  1KFW A;  5J6E A;  3B8S A;  4DRN A;  2F2D A;  4W9Q A;  1W1Y A;  4ODM A;  1JNT A;  3PRB A;  4WKA A;  4XAK A;  3IHZ A;  1LQ0 A;  1WB0 A;  2PV1 A;  4P8U A;  4MTV A;  4QT2 A;  3O5O A;  2XP7 A;  2LKN A;  1RD6 A;  2PPN A;  1D7J A;  4P8W A;  4KQZ A;  4JFI A;  1HKI A;  2DSU A;  2M08 A;  4Z2H A;  2DPE A;  4KR0 B;  2KE0 A;  2O9O A;  3RGC A;  1ZK6 A;  1HJX A;  4Q7N A;  1NSG A;  1LG1 A;  2Y78 A;  2LGO A;  2ESC A;  1W1T A;  4TW6 A;  5B8I C;  1JNS A;  1K9T A;  3UQB A;  2MLZ A;  3ARS A;  3KAH A;  1JVW A;  1HXV A;  2XP3 A;  4MAV A;  4DRI A;  1T11 A;  3NTP A;  4Z2L A;  2MLY A;  3QOK A;  1D7H A;  1XRV A;  2A3E A;  1H0G A;  4C02 B;  2ZQS A;  3MDY B;  1EYM A;  1YW5 A;  4DIP A;  3WL1 A;  5JH8 A;  4N19 A;  4ODR A;  2OFN A;  2RUR A;  1H0I A;  4DWS D;  1WAW A;  3ALF A;  3G6L A;  1J6Y A;  1FKF A;  4DRO A;  1ITX A;  3WD3 A;  4JFJ A;  4U86 A;  2A3A A;  2A3C A;  3G6M A;  4DT4 A;  2RUD A;  2XP5 A;  2XPA A;  3VAW A;  2WK2 A;  1KT1 A;  3KAC A;  4DRQ A;  4ZPV R;  4S3K A;  1E6Z A;  1NH6 A;  4BF8 A;  4ZS6 A;  3RFW A;  2DSZ A;  2MLX A;  5HBF A;  3PR9 A;  3FY1 A;  5HW7 A;  4QT3 A;  4TW7 A;  1OGB A;  1ZL1 A;  5HW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...