1ZK6A

Nmr solution structure of b. subtilis prsa ppiase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'GKIRASHILVADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Foldase protein prsA
molecule tags Isomerase
source organism Bacillus subtilis
publication title NMR solution structure and characterization of substrate binding site of the PPIase domain of PrsA protein from Bacillus subtilis
pubmed doi rcsb
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zk6A00
2LJ4A 1W26A 2ZQSA 2PBCA 4ODQA 4TNSA 3UF8A 4DRPA 1R9HA 2D9FA 4BF8A 3UI6A 3EY6A 4ODRA 3UQAA 1Y0OA 4GGQA 3O5EA 2FKEA 1J4RA 1PBKA 2XP4A 4FN2A 5DIUA 1KT0A 3TC5A 5DITA 2KR7A 2M08A 2PPOA 1JNTA 5HT1A 4DRQA 3NTPA 1QZ2A 3O5MA 5HWCA 2RUCA 3OOBA 4IQ2A 1FKIA 1YW5A 5DIVA 3RGCA 5I98A 4JFIA 1A7XA 2RUDA 2ZQVA 2MLZA 3UI5A 2F2DA 4DRJA 4ODOA 1EYMA 2XPAA 4U86A 1L1PA 1ROUA 2KFWA 3H9RB 4ODPA 4DT4A 1Q1CA 3IKGA 1FKTA 1NSGA 1ZCNA 2OFNA 3O5LA 1J4HA 1FKHA 2AWGA 3NI6A 2DG9A 2PV3A 3O5KA 3O5PA 4JFMA 2Q5AA 4DROA 3VAWA 5HTGA 2ZQUA 1D7HA 1N1AA 2ZR5A 1Q6HA 3KAGA 4W9PA 3FAPA 4LAWA 5BXJA 3WH0A 2XP8A 4IPXA 4DRIA 1FAPA 4U84A 2KO7A 4MGVA 5D75A 5J6EA 2MF9A 1BKFA 4TX0A 1FKGA 4IQCA 3KACA 4JYSA 4QT3A 4TW8A 1BL4A 3PRBA 3O5FA 4LAVA 2ZR6A 4QT2A 4FAPA 3O5GA 2L2SA 1TCOC 4LAYA 1FKJA 3IKDA 3PRDA 3O5JA 4DIPA 3UQBA 3KAHA 2F21A 2PPNA 3O5IA 2DG4A 3KCEA 2LPVA 2XP6A 1M5YA 2F4EA 5HUAA 3TDBA 3KZ7A 4J4OA 1FKKA 5HKGA 1FD9A 2FAPA 4W9OA 2DG3A 4DRHA 2MNTA 3O5RA 2XP5A 1Q6IA 2KE0A 3KADA 2VCDA 4JFKA 3NRKA 4R0XA 1ROTA 1J4IA 3O5QA 1PINA 3RFWA 3KAIA 3I6CA 4JFLA 4ODNA 4TYOA 3TCZA 4ODKA 2PV2A 1YATA 2PPPA 1F8AB 1JVWA 4LAXA 4W9QA 4DH0A 1Q6UA 1QPFA 4ODMA 4DRKA 3UQIA 3MDYB 1U79A 2IF4A 4ITZA 4DRNA 2LKNA 1KT1A 2PV1A 3KAFA 3O5OA 3PA7A 3JYJA 1QPLA 1ZK6A 2M2AA 4G50A 4C02B 2UZ5A 5B8IC 2RURA 1JNSA 4GIVA 3CGNA 2JZVA 2RQSA 4TW6A 1J6YA 2XP7A 4ODLA 2ITKA 2VN1A 4O2TA 2LGOA 3CGMA 1FKBA 1FKLA 2XPBA 3JXVA 1FKRA 4TW7A 1FKFA 1F40A 2Y78A 3GPKA 2KI3A 4DZ3A 1FKDA 3JYMA 1B6CA 1FJDA 2ZQTA 3O5DA 3B7XA 4DZ2A 1T11A 1P5QA 3KABA 4J4NA 3LUOA 4MSPA 1EQ3A 2N87A 5HW7A 5HWBA 4QIBA 1D7JA 2K8IA 1HXVA 1NMVA 1FKSA 2RSEA 1NMWA 2KGJA 5GPGA 1D6OA 2MPHA 3IK8A 2XP3A 1D7IA 1C9HA 2RUQA 4N19A 5HW8A 4U85A 3UI4A 4DRMA 2MLXA 5HW6A 2M1IA 2XP9A 2MLYA 2ZR4A 4NNRA 3ODKA 3IHZA 4JFJA 4G2PA
chains in the Genus database with same CATH superfamily
2ZQSA 1GOIA 4TNSA 3UF8A 4Z2HA 1R9HA 3UI6A 3UQAA 4MNLA 4WKHA 3O5EA 4FN2A 5DIUA 1JNSA 5DEZA 1JNEA 2M08A 2PPOA 1JNTA 4XAKA 4Z2IA 1QZ2A 1VF8A 5HWCA 2RUCA 3OOBA 4IQ2A 1YW5A 1A7XA 1GRJA 1W1YA 3UI5A 5DF0A 4LGXA 4DRJA 2G41A 1EYMA 2KFWA 1E6ZA 4WK9A 2DT3A 3O5LA 3NI6A 1SR0A 3O5PA 5HBFA 4DROA 5HTGA 3KAGA 1Q6HA 4MNJA 3WKZA 3AS0A 4Z2LA 2XP8A 3CHCA 2AOSA 1HKMA 4NZCA 4U84A 4MGVA 5D75A 4TX0A 3G6LA 4IQCA 4L3NA 4JYSA 1XRVA 3PRBA 4QT2A 4FAPA 3ARZA 1EHNA 4MTVA 1E6PA 2L2SA 4PTMA 3B9EA 4LAYA 3IKDA 3PRDA 3O5JA 3UQBA 3KAHA 3O5IA 3KCEA 2LPVA 2XP6A 1M5YA 1WAWA 3PR9A 5HUAA 3KZ7A 5JH8A 1LL4A 2B31A 5GPRA 3WL0A 1LL6A 2DSWA 4DRHA 1WNOA 1X6LA 1NWSA 2DT2A 2MNTA 2XP5A 2KE0A 3KADA 2VCDA 2FDMA 3O5QA 3CHEA 1E44A 3I6CA 4ODNA 3TCZA 1IX5A 1ZU8A 1F8AB 3ARSA 4LAXA 4P8WA 1QPFA 4ODMA 4ZPTR 3UQIA 4ITZA 3AS1A 1E9LA 2LKNA 1KT1A 2PV1A 3G6MA 4C02B 3ARVA 2JZVA 1J6YA 1EDQA 4ODLA 2VN1A 1HJVA 4O2TA 2WLYA 3CGMA 1FKBA 2PI6A 4R5EA 1LG2A 2OLHA 1O6IA 1NWRA 1T11A 3KABA 3ARWA 4MSPA 2N87A 4DWSA 1D7JA 2K8IA 1HXVA 1NMVA 2KGJA 4W5UA 2MPHA 5HW8A 4U85A 4DRMA 2MLXA 2M1IA 2XP9A 4NNRA 3ARTA 1UR8A 4DWSB 1NWUA 2PBCA 2D9FA 3WD2A 4S3KA 2FKEA 1J4RA 1PBKA 4P8UA 3TC5A 5HT1A 2KR7A 3CHDA 4DWSD 2QF8A 5DIVA 4Z2KA 2F2DA 4Z2JA 2XPAA 4U86A 4ODPA 4DT4A 1Q1CA 1ZCNA 3W4RA 1FKHA 3RMEA 3O5KA 4JFMA 1D7HA 2G8ZA 4LAWA 5BXJA 3WH0A 3WQWA 4IPXA 1ITXA 2ESCA 4QT3A 3KACA 4TW8A 1HKKA 3O5GA 2DT1A 4DIPA 4WJXA 2F21A 2O9OA 2DG4A 3WL1A 2F4EA 1LG1A 4J4OA 1FKKA 3AS3A 2A3AA 2DSUA 2WK2A 2FAPA 3NRKA 3WD3A 1J4IA 3ARYA 4ODKA 1YATA 4DH0A 1E6RA 1UR9A 4DRKA 1U79A 2IF4A 4DRNA 2YBTA 3O5OA 3PA7A 4QZVB 1QPLA 2UZ5A 4GIVA 1SYTA 3CGNA 4TW6A 4HBOA 1H0GA 4S3JA 2F23A 2ITKA 3AROA 2LGOA 4ZPWR 1FKRA 4TW7A 1FKFA 1TFVA 2B5UB 2KI3A 1FKDA 3PRAA 4J4NA 2A3EA 5HW7A 1HJXA 1NH6A 1W9VA 1NMWA 1OWQA 1D6OA 2RUQA 1C9HA 4N19A 2A3CA 3UI4A 2YBUA 1HJWA 2DSZA 5HW6A 4KQZA 2LJ4A 1W26A 4ODQA 4DRPA 3WD4A 4BF8A 1OGGA 3BXWA 4ODRA 4HBEA 4GGQA 1K9TA 1KT0A 4DRQA 1OGBA 2EULA 3QOKA 3NTPA 1FKIA 4JFIA 4P8VA 2RUDA 1ZBVA 3FXYA 4ODOA 1L1PA 3GU0A 3H9RB 4WKFA 3RM9A 3IKGA 1FKTA 2OFNA 2AWGA 2DG9A 4NSBA 2ZQUA 4W9PA 3FAPA 1NWTA 1GPFA 2KO7A 1BKFA 1FKGA 1BL4A 1FFQA 3O5FA 2ZR6A 1HKJA 4MAVA 3AQUA 3ARRA 3ARPA 1D2KA 1W1TA 4AY1A 4UDMA 3B9AA 3ARQA 1WB0A 3WIJA 1X6NA 3WD0A 3TDBA 4P8XA 2DPEA 5HKGA 4W9OA 4Z2GA 2DG3A 3O5RA 2WM0A 3CZ8A 2WLZA 4ZPVR 3AS2A 4TYOA 2PPPA 1JVWA 1ZBCA 1LL7A 2M2AA 2RURA 1KFWA 1W9UA 5DO2A 1RD6A 2XPBA 3GTYX 2Y78A 4DZ3A 1FJDA 3B7XA 1XHGA 3LUOA 1EQ3A 3OA5A 4QIBA 1FKSA 2A3BA 2XP3A 4IT4A 4L72B 3ARUA 1JNDA 4Q7NA 3ODKA 4HARA 4IT6A 4G2PA 1W1PA 4MNMA 2ETNA 3EY6A 3ARXA 1Y0OA 3ALGA 2XP4A 5DITA 1ZBWA 3O5MA 3RGCA 3BMBA 5I98A 3ALFA 2ZQVA 2MLZA 4MPKA 1ROUA 1GUVA 3CHFA 1NSGA 1J4HA 2PV3A 2Q5AA 3VAWA 2ZR5A 1N1AA 1FFRA 2O92A 1H0IA 4DRIA 2P4VA 1FAPA 1ZBKA 2PN0A 5J6EA 2MF9A 3FY1A 2DSVA 4WIWA 4LAVA 2DT0A 4ZS6A 1TCOC 1FKJA 3RM4A 3B9DA 2PPNA 4DWSC 1CTNA 1JCHB 2IUZA 1FD9A 3RM8A 3EIPA 3WQVA 1W9PA 1Q6IA 4JFKA 4R0XA 1ROTA 1PINA 3RFWA 3KAIA 4JFLA 2PV2A 4W9QA 4URIA 1Q6UA 3WD1A 3MDYB 1LJYA 1E15A 1EIBA 3KAFA 4G50A 3JYJA 1ZK6A 5B8IC 1HKIA 2RQSA 2XP7A 4KR0B 1W1VA 5GQBA 3JXVA 1FKLA 1F40A 3B8SA 3CH9A 3GPKA 4WKAA 3JYMA 1B6CA 4Q22A 2ZQTA 3O5DA 4DZ2A 1P5QA 4ML4A 5HWBA 1E6NA 1ZL1A 2RSEA 5GPGA 3IK8A 1D7IA 1LQ0A 2MLYA 2ZR4A 4MNKA 3IHZA 1ZB5A 4JFJA
chains in the Genus database with same CATH topology
2ZQSA 1GOIA 4TNSA 3UF8A 4Z2HA 1R9HA 3UI6A 3UQAA 4MNLA 4WKHA 3O5EA 4FN2A 5DIUA 1JNSA 5DEZA 1JNEA 2M08A 2PPOA 1JNTA 4XAKA 4Z2IA 1QZ2A 1VF8A 5HWCA 2RUCA 3OOBA 4IQ2A 1YW5A 1A7XA 1W1YA 3UI5A 5DF0A 4LGXA 4DRJA 2G41A 1EYMA 2KFWA 1E6ZA 4WK9A 2DT3A 3O5LA 3NI6A 1SR0A 3O5PA 5HBFA 4DROA 5HTGA 3KAGA 1Q6HA 4MNJA 3WKZA 3AS0A 4Z2LA 2XP8A 3CHCA 2AOSA 1HKMA 4NZCA 4U84A 4MGVA 5D75A 4TX0A 3G6LA 4IQCA 4L3NA 4JYSA 1XRVA 3PRBA 4QT2A 4FAPA 3ARZA 1EHNA 4MTVA 1E6PA 2L2SA 4PTMA 3B9EA 4LAYA 3IKDA 3PRDA 3O5JA 3UQBA 3KAHA 3O5IA 3KCEA 2LPVA 2XP6A 1M5YA 1WAWA 3PR9A 5HUAA 3KZ7A 5JH8A 1LL4A 2B31A 5GPRA 3WL0A 1LL6A 2DSWA 4DRHA 1WNOA 1X6LA 1NWSA 2DT2A 2MNTA 2XP5A 2KE0A 3KADA 2VCDA 2FDMA 3O5QA 3CHEA 3I6CA 4ODNA 3TCZA 1IX5A 1ZU8A 1F8AB 3ARSA 4LAXA 4P8WA 1QPFA 4ODMA 4ZPTR 3UQIA 4ITZA 3AS1A 1E9LA 2LKNA 1KT1A 2PV1A 3G6MA 4C02B 3ARVA 2JZVA 1J6YA 1EDQA 4ODLA 2VN1A 1HJVA 4O2TA 2WLYA 3CGMA 1FKBA 2PI6A 4R5EA 1LG2A 2OLHA 1O6IA 1NWRA 1T11A 3KABA 3ARWA 4MSPA 2N87A 4DWSA 1D7JA 2K8IA 1HXVA 1NMVA 2KGJA 4W5UA 2MPHA 5HW8A 4U85A 4DRMA 2MLXA 2M1IA 2XP9A 4NNRA 3ARTA 1UR8A 4DWSB 1NWUA 2PBCA 2D9FA 3WD2A 4S3KA 2FKEA 1J4RA 1PBKA 4P8UA 3TC5A 5HT1A 2KR7A 3CHDA 4DWSD 2QF8A 5DIVA 4Z2KA 2F2DA 4Z2JA 2XPAA 4U86A 4ODPA 4DT4A 1Q1CA 1ZCNA 3W4RA 1FKHA 3RMEA 3O5KA 4JFMA 1D7HA 2G8ZA 4LAWA 5BXJA 3WH0A 3WQWA 4IPXA 1ITXA 2ESCA 4QT3A 3KACA 4TW8A 1HKKA 3O5GA 2DT1A 4DIPA 4WJXA 2F21A 2O9OA 2DG4A 3WL1A 2F4EA 1LG1A 4J4OA 1FKKA 3AS3A 2A3AA 2DSUA 2WK2A 2FAPA 3NRKA 3WD3A 1J4IA 3ARYA 4ODKA 1YATA 4DH0A 1E6RA 1UR9A 4DRKA 1U79A 2IF4A 4DRNA 2YBTA 3O5OA 3PA7A 4QZVB 1QPLA 2UZ5A 4GIVA 1SYTA 3CGNA 4TW6A 4HBOA 1H0GA 4S3JA 2ITKA 3AROA 2LGOA 4ZPWR 1FKRA 4TW7A 1FKFA 1TFVA 2KI3A 1FKDA 3PRAA 4J4NA 2A3EA 5HW7A 1HJXA 1NH6A 1W9VA 1NMWA 1OWQA 1D6OA 2RUQA 1C9HA 4N19A 2A3CA 3UI4A 2YBUA 1HJWA 2DSZA 5HW6A 4KQZA 2LJ4A 1W26A 4ODQA 4DRPA 3WD4A 4BF8A 1OGGA 3BXWA 4ODRA 4HBEA 4GGQA 1K9TA 1KT0A 4DRQA 1OGBA 3QOKA 3NTPA 1FKIA 4JFIA 4P8VA 2RUDA 1ZBVA 3FXYA 4ODOA 1L1PA 3H9RB 4WKFA 3RM9A 3IKGA 1FKTA 2OFNA 2AWGA 2DG9A 4NSBA 2ZQUA 4W9PA 3FAPA 1NWTA 1GPFA 2KO7A 1BKFA 1FKGA 1BL4A 1FFQA 3O5FA 2ZR6A 1HKJA 4MAVA 3AQUA 3ARRA 3ARPA 1D2KA 1W1TA 4AY1A 3B9AA 3ARQA 1WB0A 3WIJA 1X6NA 3WD0A 3TDBA 4P8XA 2DPEA 5HKGA 4W9OA 4Z2GA 2DG3A 3O5RA 2WM0A 3CZ8A 2WLZA 4ZPVR 3AS2A 4TYOA 2PPPA 1JVWA 1ZBCA 1LL7A 2M2AA 2RURA 1KFWA 1W9UA 5DO2A 1RD6A 2XPBA 2Y78A 4DZ3A 1FJDA 3B7XA 1XHGA 3LUOA 1EQ3A 3OA5A 4QIBA 1FKSA 2A3BA 2XP3A 4IT4A 4L72B 3ARUA 1JNDA 4Q7NA 3ODKA 4IT6A 4HARA 4G2PA 1W1PA 4MNMA 3EY6A 3ARXA 1Y0OA 3ALGA 2XP4A 5DITA 1ZBWA 3O5MA 3RGCA 5I98A 3ALFA 2ZQVA 2MLZA 4MPKA 1ROUA 1GUVA 3CHFA 1NSGA 1J4HA 2PV3A 2Q5AA 3VAWA 2ZR5A 1N1AA 1FFRA 2O92A 1H0IA 4DRIA 1FAPA 1ZBKA 5J6EA 2MF9A 3FY1A 2DSVA 4WIWA 4LAVA 2DT0A 4ZS6A 1TCOC 1FKJA 3RM4A 3B9DA 2PPNA 4DWSC 1CTNA 2IUZA 1FD9A 3RM8A 3WQVA 1W9PA 1Q6IA 4JFKA 4R0XA 1ROTA 1PINA 3RFWA 3KAIA 4JFLA 2PV2A 4W9QA 4URIA 1Q6UA 3WD1A 3MDYB 1LJYA 1E15A 1EIBA 3KAFA 4G50A 3JYJA 1ZK6A 5B8IC 1HKIA 2RQSA 2XP7A 4KR0B 1W1VA 5GQBA 3JXVA 1FKLA 1F40A 3B8SA 3CH9A 3GPKA 4WKAA 3JYMA 1B6CA 4Q22A 2ZQTA 3O5DA 4DZ2A 1P5QA 4ML4A 5HWBA 1E6NA 1ZL1A 2RSEA 5GPGA 3IK8A 1D7IA 1LQ0A 2MLYA 2ZR4A 4MNKA 3IHZA 1ZB5A 4JFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ4 A;  1W26 A;  2ZQS A;  2PBC A;  4ODQ A;  4TNS A;  3UF8 A;  4DRP A;  1R9H A;  2D9F A;  4BF8 A;  3UI6 A;  3EY6 A;  4ODR A;  3UQA A;  1Y0O A;  4GGQ A;  3O5E A;  2FKE A;  1J4R A;  1PBK A;  2XP4 A;  4FN2 A;  5DIU A;  1KT0 A;  3TC5 A;  5DIT A;  2KR7 A;  2M08 A;  2PPO A;  1JNT A;  5HT1 A;  4DRQ A;  3NTP A;  1QZ2 A;  3O5M A;  5HWC A;  2RUC A;  3OOB A;  4IQ2 A;  1FKI A;  1YW5 A;  5DIV A;  3RGC A;  5I98 A;  4JFI A;  1A7X A;  2RUD A;  2ZQV A;  2MLZ A;  3UI5 A;  2F2D A;  4DRJ A;  4ODO A;  1EYM A;  2XPA A;  4U86 A;  1L1P A;  1ROU A;  2KFW A;  3H9R B;  4ODP A;  4DT4 A;  1Q1C A;  3IKG A;  1FKT A;  1NSG A;  1ZCN A;  2OFN A;  3O5L A;  1J4H A;  1FKH A;  2AWG A;  3NI6 A;  2DG9 A;  2PV3 A;  3O5K A;  3O5P A;  4JFM A;  2Q5A A;  4DRO A;  3VAW A;  5HTG A;  2ZQU A;  1D7H A;  1N1A A;  2ZR5 A;  1Q6H A;  3KAG A;  4W9P A;  3FAP A;  4LAW A;  5BXJ A;  3WH0 A;  2XP8 A;  4IPX A;  4DRI A;  1FAP A;  4U84 A;  2KO7 A;  4MGV A;  5D75 A;  5J6E A;  2MF9 A;  1BKF A;  4TX0 A;  1FKG A;  4IQC A;  3KAC A;  4JYS A;  4QT3 A;  4TW8 A;  1BL4 A;  3PRB A;  3O5F A;  4LAV A;  2ZR6 A;  4QT2 A;  4FAP A;  3O5G A;  2L2S A;  1TCO C;  4LAY A;  1FKJ A;  3IKD A;  3PRD A;  3O5J A;  4DIP A;  3UQB A;  3KAH A;  2F21 A;  2PPN A;  3O5I A;  2DG4 A;  3KCE A;  2LPV A;  2XP6 A;  1M5Y A;  2F4E A;  5HUA A;  3TDB A;  3KZ7 A;  4J4O A;  1FKK A;  5HKG A;  1FD9 A;  2FAP A;  4W9O A;  2DG3 A;  4DRH A;  2MNT A;  3O5R A;  2XP5 A;  1Q6I A;  2KE0 A;  3KAD A;  2VCD A;  4JFK A;  3NRK A;  4R0X A;  1ROT A;  1J4I A;  3O5Q A;  1PIN A;  3RFW A;  3KAI A;  3I6C A;  4JFL A;  4ODN A;  4TYO A;  3TCZ A;  4ODK A;  2PV2 A;  1YAT A;  2PPP A;  1F8A B;  1JVW A;  4LAX A;  4W9Q A;  4DH0 A;  1Q6U A;  1QPF A;  4ODM A;  4DRK A;  3UQI A;  3MDY B;  1U79 A;  2IF4 A;  4ITZ A;  4DRN A;  2LKN A;  1KT1 A;  2PV1 A;  3KAF A;  3O5O A;  3PA7 A;  3JYJ A;  1QPL A;  1ZK6 A;  2M2A A;  4G50 A;  4C02 B;  2UZ5 A;  5B8I C;  2RUR A;  1JNS A;  4GIV A;  3CGN A;  2JZV A;  2RQS A;  4TW6 A;  1J6Y A;  2XP7 A;  4ODL A;  2ITK A;  2VN1 A;  4O2T A;  2LGO A;  3CGM A;  1FKB A;  1FKL A;  2XPB A;  3JXV A;  1FKR A;  4TW7 A;  1FKF A;  1F40 A;  2Y78 A;  3GPK A;  2KI3 A;  4DZ3 A;  1FKD A;  3JYM A;  1B6C A;  1FJD A;  2ZQT A;  3O5D A;  3B7X A;  4DZ2 A;  1T11 A;  1P5Q A;  3KAB A;  4J4N A;  3LUO A;  4MSP A;  1EQ3 A;  2N87 A;  5HW7 A;  5HWB A;  4QIB A;  1D7J A;  2K8I A;  1HXV A;  1NMV A;  1FKS A;  2RSE A;  1NMW A;  2KGJ A;  5GPG A;  1D6O A;  2MPH A;  3IK8 A;  2XP3 A;  1D7I A;  1C9H A;  2RUQ A;  4N19 A;  5HW8 A;  4U85 A;  3UI4 A;  4DRM A;  2MLX A;  5HW6 A;  2M1I A;  2XP9 A;  2MLY A;  2ZR4 A;  4NNR A;  3ODK A;  3IHZ A;  4JFJ A;  4G2P A; 
#chains in the Genus database with same CATH topology
 2ZQS A;  1GOI A;  4TNS A;  3UF8 A;  4Z2H A;  1R9H A;  3UI6 A;  3UQA A;  4MNL A;  4WKH A;  3O5E A;  4FN2 A;  5DIU A;  1JNS A;  5DEZ A;  1JNE A;  2M08 A;  2PPO A;  1JNT A;  4XAK A;  4Z2I A;  1QZ2 A;  1VF8 A;  5HWC A;  2RUC A;  3OOB A;  4IQ2 A;  1YW5 A;  1A7X A;  1GRJ A;  1W1Y A;  3UI5 A;  5DF0 A;  4LGX A;  4DRJ A;  2G41 A;  1EYM A;  2KFW A;  1E6Z A;  4WK9 A;  2DT3 A;  3O5L A;  3NI6 A;  1SR0 A;  3O5P A;  5HBF A;  4DRO A;  5HTG A;  3KAG A;  1Q6H A;  4MNJ A;  3WKZ A;  3AS0 A;  4Z2L A;  2XP8 A;  3CHC A;  2AOS A;  1HKM A;  4NZC A;  4U84 A;  4MGV A;  5D75 A;  4TX0 A;  3G6L A;  4IQC A;  4L3N A;  4JYS A;  1XRV A;  3PRB A;  4QT2 A;  4FAP A;  3ARZ A;  1EHN A;  4MTV A;  1E6P A;  2L2S A;  4PTM A;  3B9E A;  4LAY A;  3IKD A;  3PRD A;  3O5J A;  3UQB A;  3KAH A;  3O5I A;  3KCE A;  2LPV A;  2XP6 A;  1M5Y A;  1WAW A;  3PR9 A;  5HUA A;  3KZ7 A;  5JH8 A;  1LL4 A;  2B31 A;  5GPR A;  3WL0 A;  1LL6 A;  2DSW A;  4DRH A;  1WNO A;  1X6L A;  1NWS A;  2DT2 A;  2MNT A;  2XP5 A;  2KE0 A;  3KAD A;  2VCD A;  2FDM A;  3O5Q A;  3CHE A;  1E44 A;  3I6C A;  4ODN A;  3TCZ A;  1IX5 A;  1ZU8 A;  1F8A B;  3ARS A;  4LAX A;  4P8W A;  1QPF A;  4ODM A;  4ZPT R;  3UQI A;  4ITZ A;  3AS1 A;  1E9L A;  2LKN A;  1KT1 A;  2PV1 A;  3G6M A;  4C02 B;  3ARV A;  2JZV A;  1J6Y A;  1EDQ A;  4ODL A;  2VN1 A;  1HJV A;  4O2T A;  2WLY A;  3CGM A;  1FKB A;  2PI6 A;  4R5E A;  1LG2 A;  2OLH A;  1O6I A;  1NWR A;  1T11 A;  3KAB A;  3ARW A;  4MSP A;  2N87 A;  4DWS A;  1D7J A;  2K8I A;  1HXV A;  1NMV A;  2KGJ A;  4W5U A;  2MPH A;  5HW8 A;  4U85 A;  4DRM A;  2MLX A;  2M1I A;  2XP9 A;  4NNR A;  3ART A;  1UR8 A;  4DWS B;  1NWU A;  2PBC A;  2D9F A;  3WD2 A;  4S3K A;  2FKE A;  1J4R A;  1PBK A;  4P8U A;  3TC5 A;  5HT1 A;  2KR7 A;  3CHD A;  4DWS D;  2QF8 A;  5DIV A;  4Z2K A;  2F2D A;  4Z2J A;  2XPA A;  4U86 A;  4ODP A;  4DT4 A;  1Q1C A;  1ZCN A;  3W4R A;  1FKH A;  3RME A;  3O5K A;  4JFM A;  1D7H A;  2G8Z A;  4LAW A;  5BXJ A;  3WH0 A;  3WQW A;  4IPX A;  1ITX A;  2ESC A;  4QT3 A;  3KAC A;  4TW8 A;  1HKK A;  3O5G A;  2DT1 A;  4DIP A;  4WJX A;  2F21 A;  2O9O A;  2DG4 A;  3WL1 A;  2F4E A;  1LG1 A;  4J4O A;  1FKK A;  3AS3 A;  2A3A A;  2DSU A;  2WK2 A;  2FAP A;  3NRK A;  3WD3 A;  1J4I A;  3ARY A;  4ODK A;  1YAT A;  4DH0 A;  1E6R A;  1UR9 A;  4DRK A;  1U79 A;  2IF4 A;  4DRN A;  2YBT A;  3O5O A;  3PA7 A;  4QZV B;  1QPL A;  2UZ5 A;  4GIV A;  1SYT A;  3CGN A;  4TW6 A;  4HBO A;  1H0G A;  4S3J A;  2F23 A;  2ITK A;  3ARO A;  2LGO A;  4ZPW R;  1FKR A;  4TW7 A;  1FKF A;  1TFV A;  2B5U B;  2KI3 A;  1FKD A;  3PRA A;  4J4N A;  2A3E A;  5HW7 A;  1HJX A;  1NH6 A;  1W9V A;  1NMW A;  1OWQ A;  1D6O A;  2RUQ A;  1C9H A;  4N19 A;  2A3C A;  3UI4 A;  2YBU A;  1HJW A;  2DSZ A;  5HW6 A;  4KQZ A;  2LJ4 A;  1W26 A;  4ODQ A;  4DRP A;  3WD4 A;  4BF8 A;  1OGG A;  3BXW A;  4ODR A;  4HBE A;  4GGQ A;  1K9T A;  1KT0 A;  4DRQ A;  1OGB A;  2EUL A;  3QOK A;  3NTP A;  1FKI A;  4JFI A;  4P8V A;  2RUD A;  1ZBV A;  3FXY A;  4ODO A;  1L1P A;  3GU0 A;  3H9R B;  4WKF A;  3RM9 A;  3IKG A;  1FKT A;  2OFN A;  2AWG A;  2DG9 A;  4NSB A;  2ZQU A;  4W9P A;  3FAP A;  1NWT A;  1GPF A;  2KO7 A;  1BKF A;  1FKG A;  1BL4 A;  1FFQ A;  3O5F A;  2ZR6 A;  1HKJ A;  4MAV A;  3AQU A;  3ARR A;  3ARP A;  1D2K A;  1W1T A;  4AY1 A;  4UDM A;  3B9A A;  3ARQ A;  1WB0 A;  3WIJ A;  1X6N A;  3WD0 A;  3TDB A;  4P8X A;  2DPE A;  5HKG A;  4W9O A;  4Z2G A;  2DG3 A;  3O5R A;  2WM0 A;  3CZ8 A;  2WLZ A;  4ZPV R;  3AS2 A;  4TYO A;  2PPP A;  1JVW A;  1ZBC A;  1LL7 A;  2M2A A;  2RUR A;  1KFW A;  1W9U A;  5DO2 A;  1RD6 A;  2XPB A;  3GTY X;  2Y78 A;  4DZ3 A;  1FJD A;  3B7X A;  1XHG A;  3LUO A;  1EQ3 A;  3OA5 A;  4QIB A;  1FKS A;  2A3B A;  2XP3 A;  4IT4 A;  4L72 B;  3ARU A;  1JND A;  4Q7N A;  3ODK A;  4HAR A;  4IT6 A;  4G2P A;  1W1P A;  4MNM A;  2ETN A;  3EY6 A;  3ARX A;  1Y0O A;  3ALG A;  2XP4 A;  5DIT A;  1ZBW A;  3O5M A;  3RGC A;  3BMB A;  5I98 A;  3ALF A;  2ZQV A;  2MLZ A;  4MPK A;  1ROU A;  1GUV A;  3CHF A;  1NSG A;  1J4H A;  2PV3 A;  2Q5A A;  3VAW A;  2ZR5 A;  1N1A A;  1FFR A;  2O92 A;  1H0I A;  4DRI A;  2P4V A;  1FAP A;  1ZBK A;  2PN0 A;  5J6E A;  2MF9 A;  3FY1 A;  2DSV A;  4WIW A;  4LAV A;  2DT0 A;  4ZS6 A;  1TCO C;  1FKJ A;  3RM4 A;  3B9D A;  2PPN A;  4DWS C;  1CTN A;  1JCH B;  2IUZ A;  1FD9 A;  3RM8 A;  3EIP A;  3WQV A;  1W9P A;  1Q6I A;  4JFK A;  4R0X A;  1ROT A;  1PIN A;  3RFW A;  3KAI A;  4JFL A;  2PV2 A;  4W9Q A;  4URI A;  1Q6U A;  3WD1 A;  3MDY B;  1LJY A;  1E15 A;  1EIB A;  3KAF A;  4G50 A;  3JYJ A;  1ZK6 A;  5B8I C;  1HKI A;  2RQS A;  2XP7 A;  4KR0 B;  1W1V A;  5GQB A;  3JXV A;  1FKL A;  1F40 A;  3B8S A;  3CH9 A;  3GPK A;  4WKA A;  3JYM A;  1B6C A;  4Q22 A;  2ZQT A;  3O5D A;  4DZ2 A;  1P5Q A;  4ML4 A;  5HWB A;  1E6N A;  1ZL1 A;  2RSE A;  5GPG A;  3IK8 A;  1D7I A;  1LQ0 A;  2MLY A;  2ZR4 A;  4MNK A;  3IHZ A;  1ZB5 A;  4JFJ A; 
#chains in the Genus database with same CATH homology
 2ZQS A;  1GOI A;  4TNS A;  3UF8 A;  4Z2H A;  1R9H A;  3UI6 A;  3UQA A;  4MNL A;  4WKH A;  3O5E A;  4FN2 A;  5DIU A;  1JNS A;  5DEZ A;  1JNE A;  2M08 A;  2PPO A;  1JNT A;  4XAK A;  4Z2I A;  1QZ2 A;  1VF8 A;  5HWC A;  2RUC A;  3OOB A;  4IQ2 A;  1YW5 A;  1A7X A;  1W1Y A;  3UI5 A;  5DF0 A;  4LGX A;  4DRJ A;  2G41 A;  1EYM A;  2KFW A;  1E6Z A;  4WK9 A;  2DT3 A;  3O5L A;  3NI6 A;  1SR0 A;  3O5P A;  5HBF A;  4DRO A;  5HTG A;  3KAG A;  1Q6H A;  4MNJ A;  3WKZ A;  3AS0 A;  4Z2L A;  2XP8 A;  3CHC A;  2AOS A;  1HKM A;  4NZC A;  4U84 A;  4MGV A;  5D75 A;  4TX0 A;  3G6L A;  4IQC A;  4L3N A;  4JYS A;  1XRV A;  3PRB A;  4QT2 A;  4FAP A;  3ARZ A;  1EHN A;  4MTV A;  1E6P A;  2L2S A;  4PTM A;  3B9E A;  4LAY A;  3IKD A;  3PRD A;  3O5J A;  3UQB A;  3KAH A;  3O5I A;  3KCE A;  2LPV A;  2XP6 A;  1M5Y A;  1WAW A;  3PR9 A;  5HUA A;  3KZ7 A;  5JH8 A;  1LL4 A;  2B31 A;  5GPR A;  3WL0 A;  1LL6 A;  2DSW A;  4DRH A;  1WNO A;  1X6L A;  1NWS A;  2DT2 A;  2MNT A;  2XP5 A;  2KE0 A;  3KAD A;  2VCD A;  2FDM A;  3O5Q A;  3CHE A;  3I6C A;  4ODN A;  3TCZ A;  1IX5 A;  1ZU8 A;  1F8A B;  3ARS A;  4LAX A;  4P8W A;  1QPF A;  4ODM A;  4ZPT R;  3UQI A;  4ITZ A;  3AS1 A;  1E9L A;  2LKN A;  1KT1 A;  2PV1 A;  3G6M A;  4C02 B;  3ARV A;  2JZV A;  1J6Y A;  1EDQ A;  4ODL A;  2VN1 A;  1HJV A;  4O2T A;  2WLY A;  3CGM A;  1FKB A;  2PI6 A;  4R5E A;  1LG2 A;  2OLH A;  1O6I A;  1NWR A;  1T11 A;  3KAB A;  3ARW A;  4MSP A;  2N87 A;  4DWS A;  1D7J A;  2K8I A;  1HXV A;  1NMV A;  2KGJ A;  4W5U A;  2MPH A;  5HW8 A;  4U85 A;  4DRM A;  2MLX A;  2M1I A;  2XP9 A;  4NNR A;  3ART A;  1UR8 A;  4DWS B;  1NWU A;  2PBC A;  2D9F A;  3WD2 A;  4S3K A;  2FKE A;  1J4R A;  1PBK A;  4P8U A;  3TC5 A;  5HT1 A;  2KR7 A;  3CHD A;  4DWS D;  2QF8 A;  5DIV A;  4Z2K A;  2F2D A;  4Z2J A;  2XPA A;  4U86 A;  4ODP A;  4DT4 A;  1Q1C A;  1ZCN A;  3W4R A;  1FKH A;  3RME A;  3O5K A;  4JFM A;  1D7H A;  2G8Z A;  4LAW A;  5BXJ A;  3WH0 A;  3WQW A;  4IPX A;  1ITX A;  2ESC A;  4QT3 A;  3KAC A;  4TW8 A;  1HKK A;  3O5G A;  2DT1 A;  4DIP A;  4WJX A;  2F21 A;  2O9O A;  2DG4 A;  3WL1 A;  2F4E A;  1LG1 A;  4J4O A;  1FKK A;  3AS3 A;  2A3A A;  2DSU A;  2WK2 A;  2FAP A;  3NRK A;  3WD3 A;  1J4I A;  3ARY A;  4ODK A;  1YAT A;  4DH0 A;  1E6R A;  1UR9 A;  4DRK A;  1U79 A;  2IF4 A;  4DRN A;  2YBT A;  3O5O A;  3PA7 A;  4QZV B;  1QPL A;  2UZ5 A;  4GIV A;  1SYT A;  3CGN A;  4TW6 A;  4HBO A;  1H0G A;  4S3J A;  2ITK A;  3ARO A;  2LGO A;  4ZPW R;  1FKR A;  4TW7 A;  1FKF A;  1TFV A;  2KI3 A;  1FKD A;  3PRA A;  4J4N A;  2A3E A;  5HW7 A;  1HJX A;  1NH6 A;  1W9V A;  1NMW A;  1OWQ A;  1D6O A;  2RUQ A;  1C9H A;  4N19 A;  2A3C A;  3UI4 A;  2YBU A;  1HJW A;  2DSZ A;  5HW6 A;  4KQZ A;  2LJ4 A;  1W26 A;  4ODQ A;  4DRP A;  3WD4 A;  4BF8 A;  1OGG A;  3BXW A;  4ODR A;  4HBE A;  4GGQ A;  1K9T A;  1KT0 A;  4DRQ A;  1OGB A;  3QOK A;  3NTP A;  1FKI A;  4JFI A;  4P8V A;  2RUD A;  1ZBV A;  3FXY A;  4ODO A;  1L1P A;  3H9R B;  4WKF A;  3RM9 A;  3IKG A;  1FKT A;  2OFN A;  2AWG A;  2DG9 A;  4NSB A;  2ZQU A;  4W9P A;  3FAP A;  1NWT A;  1GPF A;  2KO7 A;  1BKF A;  1FKG A;  1BL4 A;  1FFQ A;  3O5F A;  2ZR6 A;  1HKJ A;  4MAV A;  3AQU A;  3ARR A;  3ARP A;  1D2K A;  1W1T A;  4AY1 A;  3B9A A;  3ARQ A;  1WB0 A;  3WIJ A;  1X6N A;  3WD0 A;  3TDB A;  4P8X A;  2DPE A;  5HKG A;  4W9O A;  4Z2G A;  2DG3 A;  3O5R A;  2WM0 A;  3CZ8 A;  2WLZ A;  4ZPV R;  3AS2 A;  4TYO A;  2PPP A;  1JVW A;  1ZBC A;  1LL7 A;  2M2A A;  2RUR A;  1KFW A;  1W9U A;  5DO2 A;  1RD6 A;  2XPB A;  2Y78 A;  4DZ3 A;  1FJD A;  3B7X A;  1XHG A;  3LUO A;  1EQ3 A;  3OA5 A;  4QIB A;  1FKS A;  2A3B A;  2XP3 A;  4IT4 A;  4L72 B;  3ARU A;  1JND A;  4Q7N A;  3ODK A;  4IT6 A;  4HAR A;  4G2P A;  1W1P A;  4MNM A;  3EY6 A;  3ARX A;  1Y0O A;  3ALG A;  2XP4 A;  5DIT A;  1ZBW A;  3O5M A;  3RGC A;  5I98 A;  3ALF A;  2ZQV A;  2MLZ A;  4MPK A;  1ROU A;  1GUV A;  3CHF A;  1NSG A;  1J4H A;  2PV3 A;  2Q5A A;  3VAW A;  2ZR5 A;  1N1A A;  1FFR A;  2O92 A;  1H0I A;  4DRI A;  1FAP A;  1ZBK A;  5J6E A;  2MF9 A;  3FY1 A;  2DSV A;  4WIW A;  4LAV A;  2DT0 A;  4ZS6 A;  1TCO C;  1FKJ A;  3RM4 A;  3B9D A;  2PPN A;  4DWS C;  1CTN A;  2IUZ A;  1FD9 A;  3RM8 A;  3WQV A;  1W9P A;  1Q6I A;  4JFK A;  4R0X A;  1ROT A;  1PIN A;  3RFW A;  3KAI A;  4JFL A;  2PV2 A;  4W9Q A;  4URI A;  1Q6U A;  3WD1 A;  3MDY B;  1LJY A;  1E15 A;  1EIB A;  3KAF A;  4G50 A;  3JYJ A;  1ZK6 A;  5B8I C;  1HKI A;  2RQS A;  2XP7 A;  4KR0 B;  1W1V A;  5GQB A;  3JXV A;  1FKL A;  1F40 A;  3B8S A;  3CH9 A;  3GPK A;  4WKA A;  3JYM A;  1B6C A;  4Q22 A;  2ZQT A;  3O5D A;  4DZ2 A;  1P5Q A;  4ML4 A;  5HWB A;  1E6N A;  1ZL1 A;  2RSE A;  5GPG A;  3IK8 A;  1D7I A;  1LQ0 A;  2MLY A;  2ZR4 A;  4MNK A;  3IHZ A;  1ZB5 A;  4JFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...