1ZK6A

Nmr solution structure of b. subtilis prsa ppiase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
GKIRASHILVADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Foldase protein prsA
publication title NMR solution structure and characterization of substrate binding site of the PPIase domain of PrsA protein from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zk6A00
2XP3A 1KT0A 1BKFA 3NRKA 1EQ3A 4DRKA 2LPVA 1Q1CA 1EYMA 1PINA 2DG9A 2ZQSA 3OOBA 3IKDA 2D9FA 2M1IA 3O5LA 2OFNA 4ODPA 1JNTA 5HKGA 2PBCA 3UQIA 4ODKA 1FJDA 3KCEA 4DIPA 2KE0A 3PA7A 3KAHA 4ODQA 4IQ2A 4ODNA 1Q6HA 1Q6IA 2PPOA 2Q5AA 1R9HA 4QIBA 4W9OA 2XP9A 5HTGA 2ZR5A 2FAPA 2N87A 2MLYA 1U79A 1FAPA 2IF4A 3O5PA 3O5KA 3O5DA 4JYSA 4JFMA 3UI6A 3EY6A 2ZR6A 5DITA 4DROA 2XP6A 4QT3A 5HUAA 2F4EA 2ZR4A 4DRJA 1L1PA 4JFKA 3O5MA 3RGCA 4DZ2A 2ZQVA 3KACA 4ITZA 2MLZA 1FKJA 2XPAA 3PRDA 1FKTA 3UI4A 1FKGA 3I6CA 1NMWA 4DRQA 1J4IA 1JNSA 3CGNA 2PPNA 5D75A 2MF9A 3KABA 3O5RA 4LAWA 1N1AA 3O5GA 1HXVA 4C02B 3GPKA 1B6CA 4G2PA 4JFLA 4W9QA 2RSEA 2XPBA 3UI5A 1ROTA 4N19A 5HWCA 3ODKA 3O5QA 3O5IA 3O5FA 2MNTA 3MDYB 1FKLA 2DG4A 3O5JA 3TCZA 2KI3A 3CGMA 2MPHA 2M2AA 4DRHA 4DRIA 1F40A 3WH0A 3B7XA 3VAWA 4DRMA 1TCOC 4GGQA 1FKBA 4JFIA 2XP8A 4LAXA 4W9PA 4ODRA 4ODLA 4BF8A 5HW6A 1J6YA 4ODOA 5HW7A 1C9HA 5HW8A 2RUCA 4FN2A 2RUDA 2VN1A 3NTPA 1ZCNA 3KADA 2ZQTA 1FKHA 4MSPA 4FAPA 5I98A 1FKIA 1J4HA 4TW8A 4TX0A 4TW7A 1FKKA 1M5YA 2DG3A 2LGOA 5GPGA 2XP7A 1ZK6A 1Q6UA 2PPPA 1Y0OA 4J4NA 4NNRA 4TW6A 1BL4A 1FKRA 1F8AB 4QT2A 2M08A 5B8IC 1FKDA 1FD9A 3RFWA 1QPLA 4U86A 4IPXA 1ROUA 2LJ4A 2FKEA 3PRBA 3TC5A 4GIVA 2KGJA 2ITKA 4DT4A 4J4OA 4ODMA 4U84A 1D7IA 1FKSA 1NMVA 4TNSA 5DIVA 1W26A 1T11A 3KAIA 2L2SA 2KR7A 2XP5A 4JFJA 2Y78A 4MGVA 3O5EA 4IQCA 1J4RA 2PV2A 4LAVA 5HT1A 2UZ5A 3UF8A 4DH0A 2RURA 4O2TA 3KAFA 1FKFA 4U85A 2F2DA 2RQSA 1D6OA 5J6EA 3JYMA 2K8IA 5BXJA 2ZQUA 1QZ2A 1YW5A 4DRNA 1YATA 3TDBA 2RUQA 1D7JA 1KT1A 2PV1A 4DZ3A 2LKNA 3NI6A 4DRPA 1JVWA 3IKGA 1NSGA 2F21A 2XP4A 3O5OA 4LAYA 1D7HA 4R0XA 3FAPA 2MLXA 3JXVA 2VCDA 3KAGA 3LUOA 4G50A 1A7XA 3UQAA 1PBKA 4TYOA 1P5QA 5DIUA 5HWBA 2JZVA 2KO7A 2AWGA 3IHZA 3IK8A 2KFWA 3JYJA 1QPFA 3H9RB 3UQBA 2PV3A 3KZ7A
chains in the Genus database with same CATH superfamily
2XP3A 4DRKA 4L72B 2DG9A 4XAKA 3WD3A 3ALFA 5HKGA 4ODKA 1FJDA 3KCEA 2KE0A 1OGGA 3WD4A 1LG1A 4W9OA 2XP9A 3WD2A 3B9EA 4JYSA 3O5DA 1U79A 3G6LA 3EY6A 4KQZA 5DITA 1XRVA 4URIA 1NWRA 2ZR4A 4DRJA 1WNOA 3W4RA 3PRDA 1FKTA 1E6ZA 5JH8A 3CGNA 1N1AA 1HXVA 1B6CA 2RSEA 4Z2HA 2WLZA 2WM0A 1ROTA 4N19A 4Q22A 4ZPTR 1ZBWA 4MTVA 4Q7NA 3TCZA 2KI3A 3CGMA 2MPHA 4DRHA 4DRIA 4GGQA 2FDMA 4PTMA 1J6YA 3AQUA 5HW7A 2VN1A 3NTPA 1ZCNA 3KADA 2ZQTA 4MSPA 3ARPA 1FKKA 2LGOA 5GPGA 2O92A 2YBTA 4J4NA 1F8AB 3G6MA 5B8IC 1FKDA 3AROA 1QPLA 4U86A 1W9VA 2FKEA 3PRBA 4GIVA 2KGJA 3CHFA 4U84A 1NMVA 1T11A 3WD1A 1KFWA 1W1TA 2RURA 5BXJA 1QZ2A 1W1VA 4HBOA 4MAVA 1YATA 2RUQA 1KT1A 2PV1A 1JNDA 3NI6A 1W1PA 3IKGA 4LAYA 4ML4A 1E6NA 4IT4A 5DIUA 4P8VA 1JNEA 2JZVA 2AWGA 2KFWA 3NRKA 1H0IA 2WK2A 1PINA 4ODPA 2OFNA 4ZPVR 2PBCA 1E44A 1WB0A 1W9PA 4DIPA 5GQBA 3PA7A 1HKIA 4ODQA 3ARSA 4IQ2A 4S3JA 2Q5AA 1R9HA 4QIBA 2G8ZA 2ZR5A 2N87A 3O5PA 2MLYA 1FAPA 2ZR6A 1NWTA 2XP6A 5HUAA 1L1PA 3O5MA 4UDMA 4DZ2A 4ITZA 2XPAA 1EIBA 4KR0B 1NMWA 4DRQA 1JNSA 2PPNA 2MF9A 1OWQA 4LAWA 3GTYX 4MNKA 4JFLA 1E6PA 1GRJA 5HWCA 3O5QA 3O5IA 2DG4A 4MPKA 2M2AA 2WLYA 2A3AA 3WL1A 3VAWA 4DRMA 1TCOC 4JFIA 4LAXA 4W9PA 1IX5A 2F23A 1E9LA 2B5UB 2RUCA 4FN2A 4WIWA 1FKIA 1ZBCA 1J4HA 4TX0A 5DEZA 1SR0A 3PRAA 2DG3A 1K9TA 3FY1A 1BL4A 3RFWA 3AS2A 4IPXA 1ROUA 2DSWA 3BMBA 1D2KA 2ITKA 4ODMA 1D7IA 1FKSA 3RM4A 2L2SA 2Y78A 2DT2A 5HT1A 4IQCA 1J4RA 2PV2A 1LG2A 2UZ5A 3UF8A 4DWSD 3CHEA 2A3EA 3B9AA 2F2DA 4U85A 3JYMA 1FFQA 1NWUA 4WK9A 4P8UA 4W5UA 4Z2GA 1OGBA 1X6NA 1D7JA 4NZCA 2LKNA 4IT6A 3CHDA 5HW6A 1ZU8A 3O5OA 4R0XA 3FAPA 2MLXA 3KAGA 2VCDA 2OLHA 2YBUA 3ARZA 1A7XA 4G50A 5GPRA 1PBKA 3WD0A 3UQAA 3UQBA 1W9UA 3KZ7A 3AS0A 1KT0A 1EQ3A 2LPVA 1TFVA 2ZQSA 3OOBA 3IKDA 2M1IA 1HJWA 3WQVA 2A3CA 3UQIA 4WKFA 2DSVA 4ODNA 1Q6IA 4ZPWR 2PPOA 5HTGA 1NH6A 2IF4A 4Z2IA 4AY1A 4JFMA 1NWSA 1EDQA 2F4EA 4JFKA 3RGCA 2DT3A 2IUZA 2ZQVA 3KACA 4LGXA 2MLZA 3UI4A 1FKGA 3I6CA 2B31A 1J4IA 1H0GA 5D75A 3ARRA 3KABA 3QOKA 3GPKA 4W9QA 2XPBA 3ARWA 3UI5A 1HJXA 1ITXA 1XHGA 1FFRA 2MNTA 1LJYA 3MDYB 3O5JA 1O6IA 3EIPA 1VF8A 4DWSC 1LQ0A 3AS3A 3WH0A 4QZVB 3B7XA 1FKBA 2DSUA 4ODRA 2RUDA 4FAPA 2ESCA 5I98A 1FKHA 4WKAA 2DT1A 2O9OA 4TW8A 2G41A 2ETNA 1HKJA 4MNLA 3WQWA 3ARVA 1HKKA 3GU0A 4TW6A 3OA5A 3ARTA 1FKRA 4QT2A 3RMEA 3RM9A 2LJ4A 2P4VA 3TC5A 4J4OA 4TNSA 5DIVA 2QF8A 1W26A 3RM8A 3KAIA 3ARQA 2XP5A 4JFJA 4MGVA 4LAVA 3ALGA 4DH0A 3KAFA 1FKFA 5J6EA 1HJVA 1D6OA 1CTNA 4Z2LA 2ZQUA 4NSBA 1SYTA 4DRNA 1W1YA 3CH9A 3TDBA 3WKZA 1ZB5A 3AS1A 4DRPA 1NSGA 3B9DA 2XP4A 1E15A 3LUOA 3JXVA 4TYOA 4Z2KA 1P5QA 2KO7A 3JYJA 1GUVA 3PR9A 1LL7A 1BKFA 1Q1CA 1EYMA 1RD6A 2D9FA 3O5LA 1JNTA 3ARYA 2PI6A 4DWSB 1UR9A 3KAHA 1Q6HA 2FAPA 3O5KA 3UI6A 3ARUA 1ZL1A 4DROA 4QT3A 2DT0A 3CZ8A 5HBFA 1FKJA 2PN0A 1GOIA 3ARXA 3O5RA 4P8WA 3O5GA 4C02B 1ZBVA 2EULA 1GPFA 4G2PA 4MNJA 4HARA 1UR8A 3ODKA 3O5FA 1FKLA 2A3BA 1F40A 1E6RA 1ZBKA 2XP8A 3CHCA 4WKHA 4BF8A 4ODLA 3B8SA 4ODOA 1C9HA 5HW8A 4R5EA 2DPEA 4ZS6A 4HBEA 1LL6A 4TW7A 1WAWA 1M5YA 2XP7A 1ZK6A 1Q6UA 2PPPA 1Y0OA 1X6LA 4MNMA 4NNRA 2M08A 1FD9A 4P8XA 4L3NA 4DT4A 1LL4A 3BXWA 2KR7A 5DO2A 1HKMA 3O5EA 4WJXA 4O2TA 2RQSA 2K8IA 1EHNA 2AOSA 1YW5A 4DWSA 3FXYA 4DZ3A 2DSZA 1JVWA 4S3KA 2F21A 1D7HA 3WL0A 4Z2JA 1JCHB 5HWBA 3IHZA 3IK8A 3WIJA 5DF0A 1QPFA 3H9RB 2PV3A
chains in the Genus database with same CATH topology
2XP3A 4DRKA 4L72B 2DG9A 4XAKA 3WD3A 3ALFA 5HKGA 4ODKA 1FJDA 3KCEA 2KE0A 1OGGA 3WD4A 1LG1A 4W9OA 2XP9A 3WD2A 3B9EA 4JYSA 3O5DA 1U79A 3G6LA 3EY6A 4KQZA 5DITA 1XRVA 4URIA 1NWRA 2ZR4A 4DRJA 1WNOA 3W4RA 3PRDA 1FKTA 1E6ZA 5JH8A 3CGNA 1N1AA 1HXVA 1B6CA 2RSEA 4Z2HA 2WLZA 2WM0A 1ROTA 4N19A 4Q22A 4ZPTR 1ZBWA 4MTVA 4Q7NA 3TCZA 2KI3A 3CGMA 2MPHA 4DRHA 4DRIA 4GGQA 2FDMA 4PTMA 1J6YA 3AQUA 5HW7A 2VN1A 3NTPA 1ZCNA 3KADA 2ZQTA 4MSPA 3ARPA 1FKKA 2LGOA 5GPGA 2O92A 2YBTA 4J4NA 1F8AB 3G6MA 5B8IC 1FKDA 3AROA 1QPLA 4U86A 1W9VA 2FKEA 3PRBA 4GIVA 2KGJA 3CHFA 4U84A 1NMVA 1T11A 3WD1A 1KFWA 1W1TA 2RURA 5BXJA 1QZ2A 1W1VA 4HBOA 4MAVA 1YATA 2RUQA 1KT1A 2PV1A 1JNDA 3NI6A 1W1PA 3IKGA 4LAYA 4ML4A 1E6NA 4IT4A 5DIUA 4P8VA 1JNEA 2JZVA 2AWGA 2KFWA 3NRKA 1H0IA 2WK2A 1PINA 4ODPA 2OFNA 4ZPVR 2PBCA 1W9PA 1WB0A 4DIPA 5GQBA 3PA7A 1HKIA 4ODQA 3ARSA 4IQ2A 4S3JA 2Q5AA 1R9HA 4QIBA 2G8ZA 2ZR5A 2N87A 3O5PA 2MLYA 1FAPA 2ZR6A 1NWTA 2XP6A 5HUAA 1L1PA 3O5MA 4DZ2A 4ITZA 2XPAA 1EIBA 4KR0B 1NMWA 4DRQA 1JNSA 2PPNA 2MF9A 1OWQA 4LAWA 4MNKA 4JFLA 1E6PA 5HWCA 3O5QA 3O5IA 2DG4A 4MPKA 2M2AA 2WLYA 2A3AA 3WL1A 3VAWA 4DRMA 1TCOC 4JFIA 4LAXA 4W9PA 1IX5A 1E9LA 4WIWA 2RUCA 4FN2A 1FKIA 1ZBCA 1J4HA 4TX0A 5DEZA 1SR0A 3PRAA 2DG3A 1K9TA 3FY1A 1BL4A 3RFWA 3AS2A 4IPXA 1ROUA 2DSWA 1D2KA 2ITKA 4ODMA 1D7IA 1FKSA 3RM4A 2L2SA 2Y78A 2DT2A 5HT1A 4IQCA 1J4RA 2PV2A 1LG2A 2UZ5A 3UF8A 4DWSD 3CHEA 2A3EA 3B9AA 2F2DA 4U85A 3JYMA 1FFQA 1NWUA 4WK9A 4P8UA 4W5UA 4Z2GA 1OGBA 1X6NA 1D7JA 4NZCA 2LKNA 4IT6A 3CHDA 5HW6A 1ZU8A 3O5OA 4R0XA 3FAPA 2MLXA 3KAGA 2VCDA 2OLHA 2YBUA 3ARZA 1A7XA 4G50A 5GPRA 1PBKA 3WD0A 3UQAA 3UQBA 1W9UA 3KZ7A 3AS0A 1KT0A 1EQ3A 2LPVA 1TFVA 2ZQSA 3OOBA 3IKDA 2M1IA 1HJWA 3WQVA 2A3CA 3UQIA 4WKFA 2DSVA 4ODNA 1Q6IA 4ZPWR 2PPOA 5HTGA 1NH6A 2IF4A 4Z2IA 4AY1A 4JFMA 1NWSA 1EDQA 2F4EA 4JFKA 3RGCA 2DT3A 2IUZA 2ZQVA 3KACA 4LGXA 2MLZA 3UI4A 1FKGA 3I6CA 2B31A 1J4IA 1H0GA 5D75A 3ARRA 3KABA 3QOKA 3GPKA 4W9QA 2XPBA 3ARWA 3UI5A 1HJXA 1ITXA 1XHGA 1FFRA 2MNTA 1LJYA 3MDYB 3O5JA 1O6IA 1VF8A 4DWSC 1LQ0A 3AS3A 3WH0A 4QZVB 3B7XA 1FKBA 2DSUA 4ODRA 2RUDA 4FAPA 2ESCA 5I98A 1FKHA 4WKAA 2DT1A 2O9OA 4TW8A 2G41A 1HKJA 4MNLA 3WQWA 3ARVA 1HKKA 4TW6A 3OA5A 3ARTA 1FKRA 4QT2A 3RMEA 3RM9A 2LJ4A 3TC5A 4J4OA 4TNSA 5DIVA 2QF8A 1W26A 3RM8A 3KAIA 3ARQA 2XP5A 4JFJA 4MGVA 4LAVA 3ALGA 4DH0A 3KAFA 1FKFA 5J6EA 1HJVA 1D6OA 1CTNA 4Z2LA 2ZQUA 4NSBA 1SYTA 4DRNA 1W1YA 3CH9A 3TDBA 3WKZA 1ZB5A 3AS1A 4DRPA 1NSGA 3B9DA 2XP4A 1E15A 3LUOA 3JXVA 4TYOA 4Z2KA 1P5QA 2KO7A 3JYJA 1GUVA 3PR9A 1LL7A 1BKFA 1Q1CA 1EYMA 1RD6A 2D9FA 3O5LA 1JNTA 3ARYA 2PI6A 4DWSB 1UR9A 3KAHA 1Q6HA 2FAPA 3O5KA 3UI6A 3ARUA 1ZL1A 4DROA 4QT3A 2DT0A 3CZ8A 5HBFA 1FKJA 1GOIA 3ARXA 3O5RA 4P8WA 3O5GA 4C02B 1ZBVA 1GPFA 4G2PA 4MNJA 4HARA 1UR8A 3ODKA 3O5FA 1FKLA 2A3BA 1F40A 1E6RA 1ZBKA 2XP8A 3CHCA 4WKHA 4BF8A 4ODLA 3B8SA 4ODOA 1C9HA 5HW8A 4R5EA 2DPEA 4ZS6A 4HBEA 1LL6A 4TW7A 1WAWA 1M5YA 2XP7A 1ZK6A 1Q6UA 2PPPA 1Y0OA 1X6LA 4MNMA 4NNRA 2M08A 1FD9A 4P8XA 4L3NA 4DT4A 1LL4A 3BXWA 2KR7A 5DO2A 1HKMA 3O5EA 4WJXA 4O2TA 2RQSA 2K8IA 1EHNA 2AOSA 1YW5A 4DWSA 3FXYA 4DZ3A 2DSZA 1JVWA 4S3KA 2F21A 1D7HA 3WL0A 4Z2JA 5HWBA 3IHZA 3IK8A 3WIJA 5DF0A 1QPFA 3H9RB 2PV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP3 A;  1KT0 A;  1BKF A;  3NRK A;  1EQ3 A;  4DRK A;  2LPV A;  1Q1C A;  1EYM A;  1PIN A;  2DG9 A;  2ZQS A;  3OOB A;  3IKD A;  2D9F A;  2M1I A;  3O5L A;  2OFN A;  4ODP A;  1JNT A;  5HKG A;  2PBC A;  3UQI A;  4ODK A;  1FJD A;  3KCE A;  4DIP A;  2KE0 A;  3PA7 A;  3KAH A;  4ODQ A;  4IQ2 A;  4ODN A;  1Q6H A;  1Q6I A;  2PPO A;  2Q5A A;  1R9H A;  4QIB A;  4W9O A;  2XP9 A;  5HTG A;  2ZR5 A;  2FAP A;  2N87 A;  2MLY A;  1U79 A;  1FAP A;  2IF4 A;  3O5P A;  3O5K A;  3O5D A;  4JYS A;  4JFM A;  3UI6 A;  3EY6 A;  2ZR6 A;  5DIT A;  4DRO A;  2XP6 A;  4QT3 A;  5HUA A;  2F4E A;  2ZR4 A;  4DRJ A;  1L1P A;  4JFK A;  3O5M A;  3RGC A;  4DZ2 A;  2ZQV A;  3KAC A;  4ITZ A;  2MLZ A;  1FKJ A;  2XPA A;  3PRD A;  1FKT A;  3UI4 A;  1FKG A;  3I6C A;  1NMW A;  4DRQ A;  1J4I A;  1JNS A;  3CGN A;  2PPN A;  5D75 A;  2MF9 A;  3KAB A;  3O5R A;  4LAW A;  1N1A A;  3O5G A;  1HXV A;  4C02 B;  3GPK A;  1B6C A;  4G2P A;  4JFL A;  4W9Q A;  2RSE A;  2XPB A;  3UI5 A;  1ROT A;  4N19 A;  5HWC A;  3ODK A;  3O5Q A;  3O5I A;  3O5F A;  2MNT A;  3MDY B;  1FKL A;  2DG4 A;  3O5J A;  3TCZ A;  2KI3 A;  3CGM A;  2MPH A;  2M2A A;  4DRH A;  4DRI A;  1F40 A;  3WH0 A;  3B7X A;  3VAW A;  4DRM A;  1TCO C;  4GGQ A;  1FKB A;  4JFI A;  2XP8 A;  4LAX A;  4W9P A;  4ODR A;  4ODL A;  4BF8 A;  5HW6 A;  1J6Y A;  4ODO A;  5HW7 A;  1C9H A;  5HW8 A;  2RUC A;  4FN2 A;  2RUD A;  2VN1 A;  3NTP A;  1ZCN A;  3KAD A;  2ZQT A;  1FKH A;  4MSP A;  4FAP A;  5I98 A;  1FKI A;  1J4H A;  4TW8 A;  4TX0 A;  4TW7 A;  1FKK A;  1M5Y A;  2DG3 A;  2LGO A;  5GPG A;  2XP7 A;  1ZK6 A;  1Q6U A;  2PPP A;  1Y0O A;  4J4N A;  4NNR A;  4TW6 A;  1BL4 A;  1FKR A;  1F8A B;  4QT2 A;  2M08 A;  5B8I C;  1FKD A;  1FD9 A;  3RFW A;  1QPL A;  4U86 A;  4IPX A;  1ROU A;  2LJ4 A;  2FKE A;  3PRB A;  3TC5 A;  4GIV A;  2KGJ A;  2ITK A;  4DT4 A;  4J4O A;  4ODM A;  4U84 A;  1D7I A;  1FKS A;  1NMV A;  4TNS A;  5DIV A;  1W26 A;  1T11 A;  3KAI A;  2L2S A;  2KR7 A;  2XP5 A;  4JFJ A;  2Y78 A;  4MGV A;  3O5E A;  4IQC A;  1J4R A;  2PV2 A;  4LAV A;  5HT1 A;  2UZ5 A;  3UF8 A;  4DH0 A;  2RUR A;  4O2T A;  3KAF A;  1FKF A;  4U85 A;  2F2D A;  2RQS A;  1D6O A;  5J6E A;  3JYM A;  2K8I A;  5BXJ A;  2ZQU A;  1QZ2 A;  1YW5 A;  4DRN A;  1YAT A;  3TDB A;  2RUQ A;  1D7J A;  1KT1 A;  2PV1 A;  4DZ3 A;  2LKN A;  3NI6 A;  4DRP A;  1JVW A;  3IKG A;  1NSG A;  2F21 A;  2XP4 A;  3O5O A;  4LAY A;  1D7H A;  4R0X A;  3FAP A;  2MLX A;  3JXV A;  2VCD A;  3KAG A;  3LUO A;  4G50 A;  1A7X A;  3UQA A;  1PBK A;  4TYO A;  1P5Q A;  5DIU A;  5HWB A;  2JZV A;  2KO7 A;  2AWG A;  3IHZ A;  3IK8 A;  2KFW A;  3JYJ A;  1QPF A;  3H9R B;  3UQB A;  2PV3 A;  3KZ7 A; 
#chains in the Genus database with same CATH topology
 2XP3 A;  4DRK A;  4L72 B;  2DG9 A;  4XAK A;  3WD3 A;  3ALF A;  5HKG A;  4ODK A;  1FJD A;  3KCE A;  2KE0 A;  1OGG A;  3WD4 A;  1LG1 A;  4W9O A;  2XP9 A;  3WD2 A;  3B9E A;  4JYS A;  3O5D A;  1U79 A;  3G6L A;  3EY6 A;  4KQZ A;  5DIT A;  1XRV A;  4URI A;  1NWR A;  2ZR4 A;  4DRJ A;  1WNO A;  3W4R A;  3PRD A;  1FKT A;  1E6Z A;  5JH8 A;  3CGN A;  1N1A A;  1HXV A;  1B6C A;  2RSE A;  4Z2H A;  2WLZ A;  2WM0 A;  1ROT A;  4N19 A;  4Q22 A;  4ZPT R;  1ZBW A;  4MTV A;  4Q7N A;  3TCZ A;  2KI3 A;  3CGM A;  2MPH A;  4DRH A;  4DRI A;  4GGQ A;  2FDM A;  4PTM A;  1J6Y A;  3AQU A;  5HW7 A;  2VN1 A;  3NTP A;  1ZCN A;  3KAD A;  2ZQT A;  4MSP A;  3ARP A;  1FKK A;  2LGO A;  5GPG A;  2O92 A;  2YBT A;  4J4N A;  1F8A B;  3G6M A;  5B8I C;  1FKD A;  3ARO A;  1QPL A;  4U86 A;  1W9V A;  2FKE A;  3PRB A;  4GIV A;  2KGJ A;  3CHF A;  4U84 A;  1NMV A;  1T11 A;  3WD1 A;  1KFW A;  1W1T A;  2RUR A;  5BXJ A;  1QZ2 A;  1W1V A;  4HBO A;  4MAV A;  1YAT A;  2RUQ A;  1KT1 A;  2PV1 A;  1JND A;  3NI6 A;  1W1P A;  3IKG A;  4LAY A;  4ML4 A;  1E6N A;  4IT4 A;  5DIU A;  4P8V A;  1JNE A;  2JZV A;  2AWG A;  2KFW A;  3NRK A;  1H0I A;  2WK2 A;  1PIN A;  4ODP A;  2OFN A;  4ZPV R;  2PBC A;  1E44 A;  1WB0 A;  1W9P A;  4DIP A;  5GQB A;  3PA7 A;  1HKI A;  4ODQ A;  3ARS A;  4IQ2 A;  4S3J A;  2Q5A A;  1R9H A;  4QIB A;  2G8Z A;  2ZR5 A;  2N87 A;  3O5P A;  2MLY A;  1FAP A;  2ZR6 A;  1NWT A;  2XP6 A;  5HUA A;  1L1P A;  3O5M A;  4UDM A;  4DZ2 A;  4ITZ A;  2XPA A;  1EIB A;  4KR0 B;  1NMW A;  4DRQ A;  1JNS A;  2PPN A;  2MF9 A;  1OWQ A;  4LAW A;  3GTY X;  4MNK A;  4JFL A;  1E6P A;  1GRJ A;  5HWC A;  3O5Q A;  3O5I A;  2DG4 A;  4MPK A;  2M2A A;  2WLY A;  2A3A A;  3WL1 A;  3VAW A;  4DRM A;  1TCO C;  4JFI A;  4LAX A;  4W9P A;  1IX5 A;  2F23 A;  1E9L A;  2B5U B;  2RUC A;  4FN2 A;  4WIW A;  1FKI A;  1ZBC A;  1J4H A;  4TX0 A;  5DEZ A;  1SR0 A;  3PRA A;  2DG3 A;  1K9T A;  3FY1 A;  1BL4 A;  3RFW A;  3AS2 A;  4IPX A;  1ROU A;  2DSW A;  3BMB A;  1D2K A;  2ITK A;  4ODM A;  1D7I A;  1FKS A;  3RM4 A;  2L2S A;  2Y78 A;  2DT2 A;  5HT1 A;  4IQC A;  1J4R A;  2PV2 A;  1LG2 A;  2UZ5 A;  3UF8 A;  4DWS D;  3CHE A;  2A3E A;  3B9A A;  2F2D A;  4U85 A;  3JYM A;  1FFQ A;  1NWU A;  4WK9 A;  4P8U A;  4W5U A;  4Z2G A;  1OGB A;  1X6N A;  1D7J A;  4NZC A;  2LKN A;  4IT6 A;  3CHD A;  5HW6 A;  1ZU8 A;  3O5O A;  4R0X A;  3FAP A;  2MLX A;  3KAG A;  2VCD A;  2OLH A;  2YBU A;  3ARZ A;  1A7X A;  4G50 A;  5GPR A;  1PBK A;  3WD0 A;  3UQA A;  3UQB A;  1W9U A;  3KZ7 A;  3AS0 A;  1KT0 A;  1EQ3 A;  2LPV A;  1TFV A;  2ZQS A;  3OOB A;  3IKD A;  2M1I A;  1HJW A;  3WQV A;  2A3C A;  3UQI A;  4WKF A;  2DSV A;  4ODN A;  1Q6I A;  4ZPW R;  2PPO A;  5HTG A;  1NH6 A;  2IF4 A;  4Z2I A;  4AY1 A;  4JFM A;  1NWS A;  1EDQ A;  2F4E A;  4JFK A;  3RGC A;  2DT3 A;  2IUZ A;  2ZQV A;  3KAC A;  4LGX A;  2MLZ A;  3UI4 A;  1FKG A;  3I6C A;  2B31 A;  1J4I A;  1H0G A;  5D75 A;  3ARR A;  3KAB A;  3QOK A;  3GPK A;  4W9Q A;  2XPB A;  3ARW A;  3UI5 A;  1HJX A;  1ITX A;  1XHG A;  1FFR A;  2MNT A;  1LJY A;  3MDY B;  3O5J A;  1O6I A;  3EIP A;  1VF8 A;  4DWS C;  1LQ0 A;  3AS3 A;  3WH0 A;  4QZV B;  3B7X A;  1FKB A;  2DSU A;  4ODR A;  2RUD A;  4FAP A;  2ESC A;  5I98 A;  1FKH A;  4WKA A;  2DT1 A;  2O9O A;  4TW8 A;  2G41 A;  2ETN A;  1HKJ A;  4MNL A;  3WQW A;  3ARV A;  1HKK A;  3GU0 A;  4TW6 A;  3OA5 A;  3ART A;  1FKR A;  4QT2 A;  3RME A;  3RM9 A;  2LJ4 A;  2P4V A;  3TC5 A;  4J4O A;  4TNS A;  5DIV A;  2QF8 A;  1W26 A;  3RM8 A;  3KAI A;  3ARQ A;  2XP5 A;  4JFJ A;  4MGV A;  4LAV A;  3ALG A;  4DH0 A;  3KAF A;  1FKF A;  5J6E A;  1HJV A;  1D6O A;  1CTN A;  4Z2L A;  2ZQU A;  4NSB A;  1SYT A;  4DRN A;  1W1Y A;  3CH9 A;  3TDB A;  3WKZ A;  1ZB5 A;  3AS1 A;  4DRP A;  1NSG A;  3B9D A;  2XP4 A;  1E15 A;  3LUO A;  3JXV A;  4TYO A;  4Z2K A;  1P5Q A;  2KO7 A;  3JYJ A;  1GUV A;  3PR9 A;  1LL7 A;  1BKF A;  1Q1C A;  1EYM A;  1RD6 A;  2D9F A;  3O5L A;  1JNT A;  3ARY A;  2PI6 A;  4DWS B;  1UR9 A;  3KAH A;  1Q6H A;  2FAP A;  3O5K A;  3UI6 A;  3ARU A;  1ZL1 A;  4DRO A;  4QT3 A;  2DT0 A;  3CZ8 A;  5HBF A;  1FKJ A;  2PN0 A;  1GOI A;  3ARX A;  3O5R A;  4P8W A;  3O5G A;  4C02 B;  1ZBV A;  2EUL A;  1GPF A;  4G2P A;  4MNJ A;  4HAR A;  1UR8 A;  3ODK A;  3O5F A;  1FKL A;  2A3B A;  1F40 A;  1E6R A;  1ZBK A;  2XP8 A;  3CHC A;  4WKH A;  4BF8 A;  4ODL A;  3B8S A;  4ODO A;  1C9H A;  5HW8 A;  4R5E A;  2DPE A;  4ZS6 A;  4HBE A;  1LL6 A;  4TW7 A;  1WAW A;  1M5Y A;  2XP7 A;  1ZK6 A;  1Q6U A;  2PPP A;  1Y0O A;  1X6L A;  4MNM A;  4NNR A;  2M08 A;  1FD9 A;  4P8X A;  4L3N A;  4DT4 A;  1LL4 A;  3BXW A;  2KR7 A;  5DO2 A;  1HKM A;  3O5E A;  4WJX A;  4O2T A;  2RQS A;  2K8I A;  1EHN A;  2AOS A;  1YW5 A;  4DWS A;  3FXY A;  4DZ3 A;  2DSZ A;  1JVW A;  4S3K A;  2F21 A;  1D7H A;  3WL0 A;  4Z2J A;  1JCH B;  5HWB A;  3IHZ A;  3IK8 A;  3WIJ A;  5DF0 A;  1QPF A;  3H9R B;  2PV3 A; 
#chains in the Genus database with same CATH homology
 2XP3 A;  4DRK A;  4L72 B;  2DG9 A;  4XAK A;  3WD3 A;  3ALF A;  5HKG A;  4ODK A;  1FJD A;  3KCE A;  2KE0 A;  1OGG A;  3WD4 A;  1LG1 A;  4W9O A;  2XP9 A;  3WD2 A;  3B9E A;  4JYS A;  3O5D A;  1U79 A;  3G6L A;  3EY6 A;  4KQZ A;  5DIT A;  1XRV A;  4URI A;  1NWR A;  2ZR4 A;  4DRJ A;  1WNO A;  3W4R A;  3PRD A;  1FKT A;  1E6Z A;  5JH8 A;  3CGN A;  1N1A A;  1HXV A;  1B6C A;  2RSE A;  4Z2H A;  2WLZ A;  2WM0 A;  1ROT A;  4N19 A;  4Q22 A;  4ZPT R;  1ZBW A;  4MTV A;  4Q7N A;  3TCZ A;  2KI3 A;  3CGM A;  2MPH A;  4DRH A;  4DRI A;  4GGQ A;  2FDM A;  4PTM A;  1J6Y A;  3AQU A;  5HW7 A;  2VN1 A;  3NTP A;  1ZCN A;  3KAD A;  2ZQT A;  4MSP A;  3ARP A;  1FKK A;  2LGO A;  5GPG A;  2O92 A;  2YBT A;  4J4N A;  1F8A B;  3G6M A;  5B8I C;  1FKD A;  3ARO A;  1QPL A;  4U86 A;  1W9V A;  2FKE A;  3PRB A;  4GIV A;  2KGJ A;  3CHF A;  4U84 A;  1NMV A;  1T11 A;  3WD1 A;  1KFW A;  1W1T A;  2RUR A;  5BXJ A;  1QZ2 A;  1W1V A;  4HBO A;  4MAV A;  1YAT A;  2RUQ A;  1KT1 A;  2PV1 A;  1JND A;  3NI6 A;  1W1P A;  3IKG A;  4LAY A;  4ML4 A;  1E6N A;  4IT4 A;  5DIU A;  4P8V A;  1JNE A;  2JZV A;  2AWG A;  2KFW A;  3NRK A;  1H0I A;  2WK2 A;  1PIN A;  4ODP A;  2OFN A;  4ZPV R;  2PBC A;  1W9P A;  1WB0 A;  4DIP A;  5GQB A;  3PA7 A;  1HKI A;  4ODQ A;  3ARS A;  4IQ2 A;  4S3J A;  2Q5A A;  1R9H A;  4QIB A;  2G8Z A;  2ZR5 A;  2N87 A;  3O5P A;  2MLY A;  1FAP A;  2ZR6 A;  1NWT A;  2XP6 A;  5HUA A;  1L1P A;  3O5M A;  4DZ2 A;  4ITZ A;  2XPA A;  1EIB A;  4KR0 B;  1NMW A;  4DRQ A;  1JNS A;  2PPN A;  2MF9 A;  1OWQ A;  4LAW A;  4MNK A;  4JFL A;  1E6P A;  5HWC A;  3O5Q A;  3O5I A;  2DG4 A;  4MPK A;  2M2A A;  2WLY A;  2A3A A;  3WL1 A;  3VAW A;  4DRM A;  1TCO C;  4JFI A;  4LAX A;  4W9P A;  1IX5 A;  1E9L A;  4WIW A;  2RUC A;  4FN2 A;  1FKI A;  1ZBC A;  1J4H A;  4TX0 A;  5DEZ A;  1SR0 A;  3PRA A;  2DG3 A;  1K9T A;  3FY1 A;  1BL4 A;  3RFW A;  3AS2 A;  4IPX A;  1ROU A;  2DSW A;  1D2K A;  2ITK A;  4ODM A;  1D7I A;  1FKS A;  3RM4 A;  2L2S A;  2Y78 A;  2DT2 A;  5HT1 A;  4IQC A;  1J4R A;  2PV2 A;  1LG2 A;  2UZ5 A;  3UF8 A;  4DWS D;  3CHE A;  2A3E A;  3B9A A;  2F2D A;  4U85 A;  3JYM A;  1FFQ A;  1NWU A;  4WK9 A;  4P8U A;  4W5U A;  4Z2G A;  1OGB A;  1X6N A;  1D7J A;  4NZC A;  2LKN A;  4IT6 A;  3CHD A;  5HW6 A;  1ZU8 A;  3O5O A;  4R0X A;  3FAP A;  2MLX A;  3KAG A;  2VCD A;  2OLH A;  2YBU A;  3ARZ A;  1A7X A;  4G50 A;  5GPR A;  1PBK A;  3WD0 A;  3UQA A;  3UQB A;  1W9U A;  3KZ7 A;  3AS0 A;  1KT0 A;  1EQ3 A;  2LPV A;  1TFV A;  2ZQS A;  3OOB A;  3IKD A;  2M1I A;  1HJW A;  3WQV A;  2A3C A;  3UQI A;  4WKF A;  2DSV A;  4ODN A;  1Q6I A;  4ZPW R;  2PPO A;  5HTG A;  1NH6 A;  2IF4 A;  4Z2I A;  4AY1 A;  4JFM A;  1NWS A;  1EDQ A;  2F4E A;  4JFK A;  3RGC A;  2DT3 A;  2IUZ A;  2ZQV A;  3KAC A;  4LGX A;  2MLZ A;  3UI4 A;  1FKG A;  3I6C A;  2B31 A;  1J4I A;  1H0G A;  5D75 A;  3ARR A;  3KAB A;  3QOK A;  3GPK A;  4W9Q A;  2XPB A;  3ARW A;  3UI5 A;  1HJX A;  1ITX A;  1XHG A;  1FFR A;  2MNT A;  1LJY A;  3MDY B;  3O5J A;  1O6I A;  1VF8 A;  4DWS C;  1LQ0 A;  3AS3 A;  3WH0 A;  4QZV B;  3B7X A;  1FKB A;  2DSU A;  4ODR A;  2RUD A;  4FAP A;  2ESC A;  5I98 A;  1FKH A;  4WKA A;  2DT1 A;  2O9O A;  4TW8 A;  2G41 A;  1HKJ A;  4MNL A;  3WQW A;  3ARV A;  1HKK A;  4TW6 A;  3OA5 A;  3ART A;  1FKR A;  4QT2 A;  3RME A;  3RM9 A;  2LJ4 A;  3TC5 A;  4J4O A;  4TNS A;  5DIV A;  2QF8 A;  1W26 A;  3RM8 A;  3KAI A;  3ARQ A;  2XP5 A;  4JFJ A;  4MGV A;  4LAV A;  3ALG A;  4DH0 A;  3KAF A;  1FKF A;  5J6E A;  1HJV A;  1D6O A;  1CTN A;  4Z2L A;  2ZQU A;  4NSB A;  1SYT A;  4DRN A;  1W1Y A;  3CH9 A;  3TDB A;  3WKZ A;  1ZB5 A;  3AS1 A;  4DRP A;  1NSG A;  3B9D A;  2XP4 A;  1E15 A;  3LUO A;  3JXV A;  4TYO A;  4Z2K A;  1P5Q A;  2KO7 A;  3JYJ A;  1GUV A;  3PR9 A;  1LL7 A;  1BKF A;  1Q1C A;  1EYM A;  1RD6 A;  2D9F A;  3O5L A;  1JNT A;  3ARY A;  2PI6 A;  4DWS B;  1UR9 A;  3KAH A;  1Q6H A;  2FAP A;  3O5K A;  3UI6 A;  3ARU A;  1ZL1 A;  4DRO A;  4QT3 A;  2DT0 A;  3CZ8 A;  5HBF A;  1FKJ A;  1GOI A;  3ARX A;  3O5R A;  4P8W A;  3O5G A;  4C02 B;  1ZBV A;  1GPF A;  4G2P A;  4MNJ A;  4HAR A;  1UR8 A;  3ODK A;  3O5F A;  1FKL A;  2A3B A;  1F40 A;  1E6R A;  1ZBK A;  2XP8 A;  3CHC A;  4WKH A;  4BF8 A;  4ODL A;  3B8S A;  4ODO A;  1C9H A;  5HW8 A;  4R5E A;  2DPE A;  4ZS6 A;  4HBE A;  1LL6 A;  4TW7 A;  1WAW A;  1M5Y A;  2XP7 A;  1ZK6 A;  1Q6U A;  2PPP A;  1Y0O A;  1X6L A;  4MNM A;  4NNR A;  2M08 A;  1FD9 A;  4P8X A;  4L3N A;  4DT4 A;  1LL4 A;  3BXW A;  2KR7 A;  5DO2 A;  1HKM A;  3O5E A;  4WJX A;  4O2T A;  2RQS A;  2K8I A;  1EHN A;  2AOS A;  1YW5 A;  4DWS A;  3FXY A;  4DZ3 A;  2DSZ A;  1JVW A;  4S3K A;  2F21 A;  1D7H A;  3WL0 A;  4Z2J A;  5HWB A;  3IHZ A;  3IK8 A;  3WIJ A;  5DF0 A;  1QPF A;  3H9R B;  2PV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...