1ZK6A

Nmr solution structure of b. subtilis prsa ppiase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
GKIRASHILVADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Foldase protein prsA
publication title NMR solution structure and characterization of substrate binding site of the PPIase domain of PrsA protein from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zk6A00
3UQIA 3O5EA 3O5QA 4LAXA 2K8IA 2Y78A 2ZR5A 5HWBA 2PPOA 3O5IA 2XP6A 3KCEA 4ODLA 2F21A 2XP3A 5DIVA 4ODOA 1N1AA 3KABA 1KT0A 4DZ2A 3UQAA 4MSPA 1EYMA 5HW6A 5HW7A 2FAPA 2Q5AA 2ITKA 2XP4A 4QIBA 2RQSA 3NTPA 1ZCNA 4IQCA 3TCZA 3UI4A 2DG3A 3PRDA 4DRQA 1ZK6A 2KFWA 2MLXA 2PBCA 4DZ3A 4LAYA 4W9OA 1W26A 4DRKA 2IF4A 1B6CA 4W9PA 2KGJA 4U86A 4TX0A 4DRHA 1PBKA 2KI3A 2AWGA 1NSGA 4W9QA 4LAVA 4ODRA 1ROUA 3O5LA 5DITA 2MLYA 1QZ2A 1C9HA 4ODMA 2DG9A 1BL4A 3JXVA 1FAPA 3O5PA 3FAPA 2F2DA 4JFMA 1J4RA 2MPHA 4JYSA 1U79A 2LKNA 1D6OA 2XP7A 1R9HA 3KADA 4MGVA 4TYOA 4DROA 4U85A 4DT4A 1FJDA 3CGMA 1Q6HA 4TW7A 4GGQA 3UF8A 3O5KA 4J4OA 3UI5A 2PV3A 3UI6A 1ROTA 2ZQSA 2M1IA 1D7HA 1FKTA 3IHZA 3PRBA 4G2PA 3O5JA 3O5FA 3TC5A 2N87A 2ZQVA 5GPGA 3GPKA 3WH0A 4DRJA 2MLZA 1KT1A 3CGNA 1FKJA 2VCDA 4JFIA 1FKLA 2XPAA 1HXVA 2PPPA 3KACA 4U84A 2KO7A 4ODPA 2PV1A 1FKBA 2PV2A 1P5QA 4DRMA 2OFNA 4TNSA 3IKDA 4FN2A 3LUOA 3RFWA 3TDBA 5HT1A 3PA7A 4GIVA 1FKHA 4JFKA 3EY6A 3NI6A 4DH0A 1A7XA 2MF9A 1Q1CA 2ZR4A 3KAHA 3KZ7A 2KR7A 4TW6A 2D9FA 2ZQTA 4ODNA 2JZVA 4BF8A 3IKGA 4ODQA 1F40A 2VN1A 4J4NA 2RUCA 3KAIA 1Q6IA 4TW8A 4ITZA 1FKGA 1QPFA 1JNSA 1M5YA 2MNTA 3OOBA 4C02B 5J6EA 2LGOA 4DRPA 3O5DA 2M2AA 1FKSA 4N19A 1D7JA 3O5GA 1BKFA 1FD9A 2L2SA 3JYMA 4JFJA 5HWCA 2M08A 4R0XA 1FKDA 3MDYB 3O5MA 3RGCA 5B8IC 5HTGA 1Q6UA 5HKGA 5HUAA 3VAWA 1EQ3A 1J4HA 4O2TA 4FAPA 3ODKA 2UZ5A 4DIPA 2F4EA 2KE0A 4ODKA 1J4IA 1T11A 2FKEA 1FKIA 1JNTA 2XP9A 3I6CA 5HW8A 1YW5A 1FKRA 4G50A 1NMWA 2RSEA 5D75A 4NNRA 2ZR6A 1NMVA 1JVWA 1YATA 2DG4A 4QT3A 3O5OA 4IPXA 1FKFA 1FKKA 2XP5A 4DRNA 1D7IA 3O5RA 2PPNA 1J6YA 2LJ4A 5BXJA 3UQBA 1F8AB 1L1PA 3B7XA 4JFLA 3KAFA 2XP8A 2RUDA 5I98A 3NRKA 2ZQUA 4DRIA 3H9RB 1PINA 4QT2A 5DIUA 4LAWA 1TCOC 3KAGA 1Y0OA 1QPLA 2RUQA 2LPVA 2RURA 3IK8A 3JYJA 4IQ2A 2XPBA
chains in the Genus database with same CATH superfamily
1XHGA 1LG2A 3O5QA 2G8ZA 3O5IA 3KCEA 4DZ2A 1KFWA 2FAPA 4QIBA 2DT1A 4Z2KA 2PBCA 2A3BA 3ARRA 1HKKA 1HKIA 1NSGA 4WIWA 4ODRA 5DITA 3CZ8A 2FDMA 3CHCA 3CHDA 1HKJA 3JXVA 1UR8A 1NWUA 3FAPA 3O5PA 4JYSA 1TFVA 1ZBKA 3AS1A 1D6OA 1R9HA 1JNDA 4TYOA 4U85A 1Q6HA 4GGQA 2ZQSA 3GU0A 1X6NA 1D7HA 1E44A 5GPGA 2MLZA 1KT1A 3ARSA 4JFIA 3W4RA 2XPAA 1HXVA 1E6NA 3KACA 3IKDA 4FN2A 4DWSD 2YBUA 4MTVA 5HT1A 4JFKA 3QOKA 1GUVA 1D2KA 1Q1CA 3KZ7A 3WKZA 5HBFA 2D9FA 4ODNA 2DSVA 4ODQA 2VN1A 5DEZA 1OGGA 4J4NA 1Q6IA 1QPFA 1JNSA 1M5YA 5J6EA 1SYTA 2M2AA 3O5GA 4UDMA 1OWQA 1BKFA 2M08A 4R0XA 3MDYB 5HTGA 5HKGA 1J4HA 4FAPA 1W1YA 4DIPA 1ZBWA 3BXWA 1JCHB 1E9LA 2KE0A 1T11A 2EULA 3I6CA 1NMWA 2RSEA 3RM9A 4NNRA 1NMVA 2DG4A 4DWSC 4P8VA 5DF0A 4Z2IA 4S3KA 2PPNA 4WK9A 2DT2A 1E6ZA 4S3JA 1L1PA 4URIA 3KAFA 1W1TA 4LAWA 2DT3A 1Y0OA 2RUQA 2PI6A 2XPBA 4LAXA 3WQVA 2PPOA 3EIPA 3KABA 3RM8A 1H0IA 4MAVA 1JNEA 2ITKA 2XP4A 4IQCA 1ZL1A 3G6LA 1E15A 4DRQA 4DRKA 3G6MA 4P8XA 3FY1A 2KI3A 3WD2A 4LAVA 3O5LA 1C9HA 1LL4A 3AS3A 1BL4A 3AS0A 2A3AA 2LKNA 4XAKA 4TW7A 4Z2GA 3UI6A 4L3NA 3WIJA 4DWSB 2M1IA 3IHZA 4WKAA 3O5FA 3WH0A 3CGNA 3WD3A 1E6RA 5DO2A 1HJWA 3BMBA 4DRMA 3PA7A 1FKHA 1LG1A 3NI6A 1A7XA 1H0GA 3KAHA 4QZVB 4WKFA 2P4VA 1FKGA 2MNTA 3GTYX 3O5DA 1FKSA 3FXYA 5GQBA 2AOSA 2B5UB 3VAWA 3AQUA 1NWSA 1ZBCA 1J4IA 1FKIA 1JNTA 2XP9A 1E6PA 3WL0A 4G50A 5D75A 2ESCA 2ZR6A 1JVWA 4ZS6A 4MNLA 1K9TA 5JH8A 4IPXA 1FKKA 2XP5A 4DRNA 1D7IA 1J6YA 2LJ4A 3ARUA 2O9OA 3B7XA 4JFLA 2DSWA 2RUDA 4ZPWR 1IX5A 1TCOC 3IK8A 3ARQA 4ZPVR 3UQIA 1XRVA 3O5EA 2K8IA 5HWBA 3B8SA 2XP6A 4ODLA 1FFQA 1KT0A 2YBTA 3WD4A 1VF8A 2IUZA 2RQSA 1ZCNA 3UI4A 4Z2HA 2DG3A 3PRDA 1ZK6A 4IT4A 2MLXA 4W9OA 1W26A 2DPEA 2KGJA 4U86A 4WJXA 4TX0A 1PBKA 4W9QA 3B9EA 1FFRA 2DSZA 2MLYA 1QZ2A 4ODMA 4JFMA 1LQ0A 1LL7A 4MNMA 1W1PA 2XP7A 3KADA 5GPRA 4MGVA 4DT4A 1FJDA 3CGMA 3O5KA 3ALFA 3ARZA 1ROTA 1FKTA 3CHFA 3PRBA 4G2PA 3O5JA 3GPKA 4DRJA 1X6LA 4HBOA 4U84A 4ODPA 2PV1A 1FKBA 4Q22A 2OFNA 1EHNA 3LUOA 3TDBA 4GIVA 4P8WA 2ETNA 3EY6A 3B9AA 4TW6A 1LL6A 2WLYA 2ZQTA 2JZVA 1F40A 4NZCA 2RUCA 1ZB5A 2WK2A 2LGOA 4DRPA 4Z2LA 1D7JA 2L2SA 3JYMA 1CTNA 1FKDA 3O5MA 5B8IC 1Q6UA 5HUAA 1EQ3A 1OGBA 1W9PA 4ODKA 2FKEA 5HW8A 1YATA 4QT3A 3PRAA 2A3EA 2DSUA 1EIBA 3O5OA 2QF8A 1FKFA 4ML4A 4HARA 1GOIA 5BXJA 3UQBA 2XP8A 1WNOA 3NRKA 3CHEA 4Q7NA 3H9RB 1PINA 3ARPA 3AS2A 4LGXA 2G41A 5DIUA 3KAGA 3JYJA 2LPVA 2RURA 3CH9A 4IQ2A 1NWTA 2Y78A 2ZR5A 2F21A 2XP3A 5DIVA 4ODOA 1N1AA 3WQWA 3UQAA 4MSPA 1EYMA 5HW6A 5HW7A 2PN0A 2Q5AA 3WD1A 3NTPA 3TCZA 1WB0A 2KFWA 1W9VA 4DZ3A 4LAYA 1EDQA 2IF4A 1B6CA 4W9PA 4DRHA 3RM4A 2AWGA 1W1VA 1ROUA 3RMEA 2DG9A 3ARWA 1FAPA 2F2DA 1J4RA 2MPHA 4P8UA 1U79A 3AROA 4NSBA 4DROA 4MNJA 3UI5A 3UF8A 4J4OA 2PV3A 1ZU8A 1LJYA 4ZPTR 3TC5A 2N87A 2ZQVA 3ARVA 1HKMA 1FKJA 2VCDA 3B9DA 1FKLA 2B31A 2PPPA 2F23A 2KO7A 4HBEA 2PV2A 1P5QA 1HJXA 4TNSA 3RFWA 1NWRA 3ARYA 4W5UA 4DH0A 1NH6A 2MF9A 2WM0A 4IT6A 2ZR4A 2KR7A 4BF8A 3IKGA 3KAIA 4TW8A 3ALGA 4ITZA 2A3CA 2O92A 3OOBA 4C02B 1ZBVA 4R5EA 4N19A 4AY1A 1FD9A 4JFJA 4WKHA 5HWCA 3RGCA 3PR9A 4O2TA 3ODKA 2UZ5A 1WAWA 2F4EA 4MNKA 2OLHA 1HJVA 3OA5A 1FKRA 1YW5A 2DT0A 1SR0A 1GRJA 4MPKA 4PTMA 1GPFA 1O6IA 3ARXA 4DWSA 3O5RA 1ITXA 2WLZA 1UR9A 1F8AB 4L72B 3WD0A 3ARTA 5I98A 4DRIA 2ZQUA 4KQZA 1RD6A 4Z2JA 3WL1A 4QT2A 1QPLA 4KR0B 1W9UA
chains in the Genus database with same CATH topology
1XHGA 1LG2A 3O5QA 2G8ZA 3O5IA 3KCEA 4DZ2A 1KFWA 2FAPA 4QIBA 2DT1A 4Z2KA 2PBCA 2A3BA 3ARRA 1HKKA 1HKIA 1NSGA 4WIWA 4ODRA 5DITA 3CZ8A 2FDMA 3CHCA 3CHDA 1HKJA 3JXVA 1UR8A 1NWUA 3O5PA 3FAPA 4JYSA 1TFVA 1ZBKA 3AS1A 1D6OA 1R9HA 1JNDA 4TYOA 4U85A 1Q6HA 4GGQA 2ZQSA 1X6NA 1D7HA 5GPGA 2MLZA 1KT1A 3ARSA 4JFIA 3W4RA 2XPAA 1HXVA 1E6NA 3KACA 3IKDA 4FN2A 4DWSD 2YBUA 4MTVA 5HT1A 4JFKA 3QOKA 1GUVA 1D2KA 1Q1CA 3KZ7A 3WKZA 5HBFA 2D9FA 4ODNA 2DSVA 4ODQA 2VN1A 5DEZA 1OGGA 4J4NA 1Q6IA 1QPFA 1JNSA 1M5YA 5J6EA 1SYTA 2M2AA 3O5GA 1OWQA 1BKFA 2M08A 4R0XA 3MDYB 5HTGA 5HKGA 1J4HA 4FAPA 1W1YA 4DIPA 1ZBWA 3BXWA 1E9LA 2KE0A 1T11A 3I6CA 1NMWA 2RSEA 3RM9A 4NNRA 1NMVA 2DG4A 4DWSC 4P8VA 5DF0A 4Z2IA 4S3KA 2PPNA 4WK9A 2DT2A 1E6ZA 4S3JA 1L1PA 4URIA 3KAFA 1W1TA 4LAWA 2DT3A 1Y0OA 2RUQA 2PI6A 2XPBA 4LAXA 3WQVA 2PPOA 3KABA 3RM8A 1H0IA 4MAVA 1JNEA 2ITKA 2XP4A 4IQCA 1ZL1A 3G6LA 1E15A 4DRQA 4DRKA 3G6MA 4P8XA 3FY1A 2KI3A 3WD2A 4LAVA 3O5LA 1C9HA 1LL4A 3AS3A 1BL4A 3AS0A 2A3AA 2LKNA 4XAKA 4TW7A 4Z2GA 3UI6A 4L3NA 3WIJA 4DWSB 2M1IA 3IHZA 4WKAA 3O5FA 3WH0A 3CGNA 3WD3A 1E6RA 5DO2A 1HJWA 4DRMA 3PA7A 1FKHA 1LG1A 3NI6A 1A7XA 1H0GA 3KAHA 4QZVB 4WKFA 1FKGA 2MNTA 3O5DA 1FKSA 3FXYA 5GQBA 2AOSA 3VAWA 3AQUA 1NWSA 1ZBCA 1J4IA 1FKIA 1JNTA 2XP9A 1E6PA 3WL0A 4G50A 5D75A 2ESCA 2ZR6A 1JVWA 4ZS6A 4MNLA 1K9TA 5JH8A 4IPXA 1FKKA 2XP5A 4DRNA 1D7IA 1J6YA 2LJ4A 3ARUA 2O9OA 3B7XA 4JFLA 2DSWA 2RUDA 4ZPWR 1IX5A 1TCOC 3IK8A 3ARQA 4ZPVR 3UQIA 1XRVA 3O5EA 2K8IA 5HWBA 3B8SA 2XP6A 4ODLA 1FFQA 1KT0A 2YBTA 3WD4A 1VF8A 2IUZA 2RQSA 1ZCNA 3UI4A 4Z2HA 2DG3A 3PRDA 1ZK6A 4IT4A 2MLXA 4W9OA 1W26A 2DPEA 2KGJA 4U86A 4WJXA 4TX0A 1PBKA 4W9QA 3B9EA 1FFRA 2DSZA 2MLYA 1QZ2A 4ODMA 4JFMA 1LQ0A 1LL7A 4MNMA 1W1PA 2XP7A 3KADA 5GPRA 4MGVA 4DT4A 1FJDA 3CGMA 3O5KA 3ALFA 3ARZA 1ROTA 1FKTA 3CHFA 3PRBA 4G2PA 3O5JA 3GPKA 4DRJA 1X6LA 4HBOA 4U84A 4ODPA 2PV1A 1FKBA 4Q22A 2OFNA 1EHNA 3LUOA 3TDBA 4GIVA 4P8WA 3EY6A 3B9AA 4TW6A 1LL6A 2WLYA 2ZQTA 2JZVA 1F40A 4NZCA 2RUCA 1ZB5A 2WK2A 2LGOA 4DRPA 4Z2LA 1D7JA 2L2SA 3JYMA 1CTNA 1FKDA 3O5MA 5B8IC 1Q6UA 5HUAA 1EQ3A 1OGBA 1W9PA 4ODKA 2FKEA 5HW8A 1YATA 4QT3A 3PRAA 2A3EA 2DSUA 1EIBA 3O5OA 2QF8A 1FKFA 4ML4A 4HARA 1GOIA 5BXJA 3UQBA 2XP8A 1WNOA 3NRKA 3CHEA 4Q7NA 3H9RB 1PINA 3ARPA 3AS2A 4LGXA 2G41A 5DIUA 3KAGA 3JYJA 2LPVA 2RURA 3CH9A 4IQ2A 1NWTA 2Y78A 2ZR5A 2F21A 2XP3A 5DIVA 4ODOA 1N1AA 3WQWA 3UQAA 4MSPA 1EYMA 5HW6A 5HW7A 2Q5AA 3WD1A 3NTPA 3TCZA 1WB0A 2KFWA 1W9VA 4DZ3A 4LAYA 1EDQA 2IF4A 1B6CA 4W9PA 4DRHA 3RM4A 2AWGA 1W1VA 1ROUA 3RMEA 2DG9A 3ARWA 1FAPA 2F2DA 1J4RA 2MPHA 4P8UA 1U79A 3AROA 4NSBA 4DROA 4MNJA 3UI5A 3UF8A 4J4OA 2PV3A 1ZU8A 1LJYA 4ZPTR 3TC5A 2N87A 2ZQVA 3ARVA 1HKMA 1FKJA 2VCDA 3B9DA 1FKLA 2B31A 2PPPA 2KO7A 4HBEA 2PV2A 1P5QA 1HJXA 4TNSA 3RFWA 1NWRA 3ARYA 4W5UA 4DH0A 1NH6A 2MF9A 2WM0A 4IT6A 2ZR4A 2KR7A 4BF8A 3IKGA 3KAIA 4TW8A 3ALGA 4ITZA 2A3CA 2O92A 3OOBA 4C02B 1ZBVA 4R5EA 4N19A 4AY1A 1FD9A 4JFJA 4WKHA 5HWCA 3RGCA 3PR9A 4O2TA 3ODKA 2UZ5A 1WAWA 2F4EA 4MNKA 2OLHA 1HJVA 3OA5A 1FKRA 1YW5A 2DT0A 1SR0A 4PTMA 4MPKA 1GPFA 1O6IA 3ARXA 4DWSA 3O5RA 1ITXA 2WLZA 1UR9A 1F8AB 4L72B 3WD0A 3ARTA 5I98A 4DRIA 2ZQUA 4KQZA 1RD6A 4Z2JA 3WL1A 4QT2A 1QPLA 4KR0B 1W9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQI A;  3O5E A;  3O5Q A;  4LAX A;  2K8I A;  2Y78 A;  2ZR5 A;  5HWB A;  2PPO A;  3O5I A;  2XP6 A;  3KCE A;  4ODL A;  2F21 A;  2XP3 A;  5DIV A;  4ODO A;  1N1A A;  3KAB A;  1KT0 A;  4DZ2 A;  3UQA A;  4MSP A;  1EYM A;  5HW6 A;  5HW7 A;  2FAP A;  2Q5A A;  2ITK A;  2XP4 A;  4QIB A;  2RQS A;  3NTP A;  1ZCN A;  4IQC A;  3TCZ A;  3UI4 A;  2DG3 A;  3PRD A;  4DRQ A;  1ZK6 A;  2KFW A;  2MLX A;  2PBC A;  4DZ3 A;  4LAY A;  4W9O A;  1W26 A;  4DRK A;  2IF4 A;  1B6C A;  4W9P A;  2KGJ A;  4U86 A;  4TX0 A;  4DRH A;  1PBK A;  2KI3 A;  2AWG A;  1NSG A;  4W9Q A;  4LAV A;  4ODR A;  1ROU A;  3O5L A;  5DIT A;  2MLY A;  1QZ2 A;  1C9H A;  4ODM A;  2DG9 A;  1BL4 A;  3JXV A;  1FAP A;  3O5P A;  3FAP A;  2F2D A;  4JFM A;  1J4R A;  2MPH A;  4JYS A;  1U79 A;  2LKN A;  1D6O A;  2XP7 A;  1R9H A;  3KAD A;  4MGV A;  4TYO A;  4DRO A;  4U85 A;  4DT4 A;  1FJD A;  3CGM A;  1Q6H A;  4TW7 A;  4GGQ A;  3UF8 A;  3O5K A;  4J4O A;  3UI5 A;  2PV3 A;  3UI6 A;  1ROT A;  2ZQS A;  2M1I A;  1D7H A;  1FKT A;  3IHZ A;  3PRB A;  4G2P A;  3O5J A;  3O5F A;  3TC5 A;  2N87 A;  2ZQV A;  5GPG A;  3GPK A;  3WH0 A;  4DRJ A;  2MLZ A;  1KT1 A;  3CGN A;  1FKJ A;  2VCD A;  4JFI A;  1FKL A;  2XPA A;  1HXV A;  2PPP A;  3KAC A;  4U84 A;  2KO7 A;  4ODP A;  2PV1 A;  1FKB A;  2PV2 A;  1P5Q A;  4DRM A;  2OFN A;  4TNS A;  3IKD A;  4FN2 A;  3LUO A;  3RFW A;  3TDB A;  5HT1 A;  3PA7 A;  4GIV A;  1FKH A;  4JFK A;  3EY6 A;  3NI6 A;  4DH0 A;  1A7X A;  2MF9 A;  1Q1C A;  2ZR4 A;  3KAH A;  3KZ7 A;  2KR7 A;  4TW6 A;  2D9F A;  2ZQT A;  4ODN A;  2JZV A;  4BF8 A;  3IKG A;  4ODQ A;  1F40 A;  2VN1 A;  4J4N A;  2RUC A;  3KAI A;  1Q6I A;  4TW8 A;  4ITZ A;  1FKG A;  1QPF A;  1JNS A;  1M5Y A;  2MNT A;  3OOB A;  4C02 B;  5J6E A;  2LGO A;  4DRP A;  3O5D A;  2M2A A;  1FKS A;  4N19 A;  1D7J A;  3O5G A;  1BKF A;  1FD9 A;  2L2S A;  3JYM A;  4JFJ A;  5HWC A;  2M08 A;  4R0X A;  1FKD A;  3MDY B;  3O5M A;  3RGC A;  5B8I C;  5HTG A;  1Q6U A;  5HKG A;  5HUA A;  3VAW A;  1EQ3 A;  1J4H A;  4O2T A;  4FAP A;  3ODK A;  2UZ5 A;  4DIP A;  2F4E A;  2KE0 A;  4ODK A;  1J4I A;  1T11 A;  2FKE A;  1FKI A;  1JNT A;  2XP9 A;  3I6C A;  5HW8 A;  1YW5 A;  1FKR A;  4G50 A;  1NMW A;  2RSE A;  5D75 A;  4NNR A;  2ZR6 A;  1NMV A;  1JVW A;  1YAT A;  2DG4 A;  4QT3 A;  3O5O A;  4IPX A;  1FKF A;  1FKK A;  2XP5 A;  4DRN A;  1D7I A;  3O5R A;  2PPN A;  1J6Y A;  2LJ4 A;  5BXJ A;  3UQB A;  1F8A B;  1L1P A;  3B7X A;  4JFL A;  3KAF A;  2XP8 A;  2RUD A;  5I98 A;  3NRK A;  2ZQU A;  4DRI A;  3H9R B;  1PIN A;  4QT2 A;  5DIU A;  4LAW A;  1TCO C;  3KAG A;  1Y0O A;  1QPL A;  2RUQ A;  2LPV A;  2RUR A;  3IK8 A;  3JYJ A;  4IQ2 A;  2XPB A; 
#chains in the Genus database with same CATH topology
 1XHG A;  1LG2 A;  3O5Q A;  2G8Z A;  3O5I A;  3KCE A;  4DZ2 A;  1KFW A;  2FAP A;  4QIB A;  2DT1 A;  4Z2K A;  2PBC A;  2A3B A;  3ARR A;  1HKK A;  1HKI A;  1NSG A;  4WIW A;  4ODR A;  5DIT A;  3CZ8 A;  2FDM A;  3CHC A;  3CHD A;  1HKJ A;  3JXV A;  1UR8 A;  1NWU A;  3FAP A;  3O5P A;  4JYS A;  1TFV A;  1ZBK A;  3AS1 A;  1D6O A;  1R9H A;  1JND A;  4TYO A;  4U85 A;  1Q6H A;  4GGQ A;  2ZQS A;  3GU0 A;  1X6N A;  1D7H A;  1E44 A;  5GPG A;  2MLZ A;  1KT1 A;  3ARS A;  4JFI A;  3W4R A;  2XPA A;  1HXV A;  1E6N A;  3KAC A;  3IKD A;  4FN2 A;  4DWS D;  2YBU A;  4MTV A;  5HT1 A;  4JFK A;  3QOK A;  1GUV A;  1D2K A;  1Q1C A;  3KZ7 A;  3WKZ A;  5HBF A;  2D9F A;  4ODN A;  2DSV A;  4ODQ A;  2VN1 A;  5DEZ A;  1OGG A;  4J4N A;  1Q6I A;  1QPF A;  1JNS A;  1M5Y A;  5J6E A;  1SYT A;  2M2A A;  3O5G A;  4UDM A;  1OWQ A;  1BKF A;  2M08 A;  4R0X A;  3MDY B;  5HTG A;  5HKG A;  1J4H A;  4FAP A;  1W1Y A;  4DIP A;  1ZBW A;  3BXW A;  1JCH B;  1E9L A;  2KE0 A;  1T11 A;  2EUL A;  3I6C A;  1NMW A;  2RSE A;  3RM9 A;  4NNR A;  1NMV A;  2DG4 A;  4DWS C;  4P8V A;  5DF0 A;  4Z2I A;  4S3K A;  2PPN A;  4WK9 A;  2DT2 A;  1E6Z A;  4S3J A;  1L1P A;  4URI A;  3KAF A;  1W1T A;  4LAW A;  2DT3 A;  1Y0O A;  2RUQ A;  2PI6 A;  2XPB A;  4LAX A;  3WQV A;  2PPO A;  3EIP A;  3KAB A;  3RM8 A;  1H0I A;  4MAV A;  1JNE A;  2ITK A;  2XP4 A;  4IQC A;  1ZL1 A;  3G6L A;  1E15 A;  4DRQ A;  4DRK A;  3G6M A;  4P8X A;  3FY1 A;  2KI3 A;  3WD2 A;  4LAV A;  3O5L A;  1C9H A;  1LL4 A;  3AS3 A;  1BL4 A;  3AS0 A;  2A3A A;  2LKN A;  4XAK A;  4TW7 A;  4Z2G A;  3UI6 A;  4L3N A;  3WIJ A;  4DWS B;  2M1I A;  3IHZ A;  4WKA A;  3O5F A;  3WH0 A;  3CGN A;  3WD3 A;  1E6R A;  5DO2 A;  1HJW A;  3BMB A;  4DRM A;  3PA7 A;  1FKH A;  1LG1 A;  3NI6 A;  1A7X A;  1H0G A;  3KAH A;  4QZV B;  4WKF A;  2P4V A;  1FKG A;  2MNT A;  3GTY X;  3O5D A;  1FKS A;  3FXY A;  5GQB A;  2AOS A;  2B5U B;  3VAW A;  3AQU A;  1NWS A;  1ZBC A;  1J4I A;  1FKI A;  1JNT A;  2XP9 A;  1E6P A;  3WL0 A;  4G50 A;  5D75 A;  2ESC A;  2ZR6 A;  1JVW A;  4ZS6 A;  4MNL A;  1K9T A;  5JH8 A;  4IPX A;  1FKK A;  2XP5 A;  4DRN A;  1D7I A;  1J6Y A;  2LJ4 A;  3ARU A;  2O9O A;  3B7X A;  4JFL A;  2DSW A;  2RUD A;  4ZPW R;  1IX5 A;  1TCO C;  3IK8 A;  3ARQ A;  4ZPV R;  3UQI A;  1XRV A;  3O5E A;  2K8I A;  5HWB A;  3B8S A;  2XP6 A;  4ODL A;  1FFQ A;  1KT0 A;  2YBT A;  3WD4 A;  1VF8 A;  2IUZ A;  2RQS A;  1ZCN A;  3UI4 A;  4Z2H A;  2DG3 A;  3PRD A;  1ZK6 A;  4IT4 A;  2MLX A;  4W9O A;  1W26 A;  2DPE A;  2KGJ A;  4U86 A;  4WJX A;  4TX0 A;  1PBK A;  4W9Q A;  3B9E A;  1FFR A;  2DSZ A;  2MLY A;  1QZ2 A;  4ODM A;  4JFM A;  1LQ0 A;  1LL7 A;  4MNM A;  1W1P A;  2XP7 A;  3KAD A;  5GPR A;  4MGV A;  4DT4 A;  1FJD A;  3CGM A;  3O5K A;  3ALF A;  3ARZ A;  1ROT A;  1FKT A;  3CHF A;  3PRB A;  4G2P A;  3O5J A;  3GPK A;  4DRJ A;  1X6L A;  4HBO A;  4U84 A;  4ODP A;  2PV1 A;  1FKB A;  4Q22 A;  2OFN A;  1EHN A;  3LUO A;  3TDB A;  4GIV A;  4P8W A;  2ETN A;  3EY6 A;  3B9A A;  4TW6 A;  1LL6 A;  2WLY A;  2ZQT A;  2JZV A;  1F40 A;  4NZC A;  2RUC A;  1ZB5 A;  2WK2 A;  2LGO A;  4DRP A;  4Z2L A;  1D7J A;  2L2S A;  3JYM A;  1CTN A;  1FKD A;  3O5M A;  5B8I C;  1Q6U A;  5HUA A;  1EQ3 A;  1OGB A;  1W9P A;  4ODK A;  2FKE A;  5HW8 A;  1YAT A;  4QT3 A;  3PRA A;  2A3E A;  2DSU A;  1EIB A;  3O5O A;  2QF8 A;  1FKF A;  4ML4 A;  4HAR A;  1GOI A;  5BXJ A;  3UQB A;  2XP8 A;  1WNO A;  3NRK A;  3CHE A;  4Q7N A;  3H9R B;  1PIN A;  3ARP A;  3AS2 A;  4LGX A;  2G41 A;  5DIU A;  3KAG A;  3JYJ A;  2LPV A;  2RUR A;  3CH9 A;  4IQ2 A;  1NWT A;  2Y78 A;  2ZR5 A;  2F21 A;  2XP3 A;  5DIV A;  4ODO A;  1N1A A;  3WQW A;  3UQA A;  4MSP A;  1EYM A;  5HW6 A;  5HW7 A;  2PN0 A;  2Q5A A;  3WD1 A;  3NTP A;  3TCZ A;  1WB0 A;  2KFW A;  1W9V A;  4DZ3 A;  4LAY A;  1EDQ A;  2IF4 A;  1B6C A;  4W9P A;  4DRH A;  3RM4 A;  2AWG A;  1W1V A;  1ROU A;  3RME A;  2DG9 A;  3ARW A;  1FAP A;  2F2D A;  1J4R A;  2MPH A;  4P8U A;  1U79 A;  3ARO A;  4NSB A;  4DRO A;  4MNJ A;  3UI5 A;  3UF8 A;  4J4O A;  2PV3 A;  1ZU8 A;  1LJY A;  4ZPT R;  3TC5 A;  2N87 A;  2ZQV A;  3ARV A;  1HKM A;  1FKJ A;  2VCD A;  3B9D A;  1FKL A;  2B31 A;  2PPP A;  2F23 A;  2KO7 A;  4HBE A;  2PV2 A;  1P5Q A;  1HJX A;  4TNS A;  3RFW A;  1NWR A;  3ARY A;  4W5U A;  4DH0 A;  1NH6 A;  2MF9 A;  2WM0 A;  4IT6 A;  2ZR4 A;  2KR7 A;  4BF8 A;  3IKG A;  3KAI A;  4TW8 A;  3ALG A;  4ITZ A;  2A3C A;  2O92 A;  3OOB A;  4C02 B;  1ZBV A;  4R5E A;  4N19 A;  4AY1 A;  1FD9 A;  4JFJ A;  4WKH A;  5HWC A;  3RGC A;  3PR9 A;  4O2T A;  3ODK A;  2UZ5 A;  1WAW A;  2F4E A;  4MNK A;  2OLH A;  1HJV A;  3OA5 A;  1FKR A;  1YW5 A;  2DT0 A;  1SR0 A;  1GRJ A;  4MPK A;  4PTM A;  1GPF A;  1O6I A;  3ARX A;  4DWS A;  3O5R A;  1ITX A;  2WLZ A;  1UR9 A;  1F8A B;  4L72 B;  3WD0 A;  3ART A;  5I98 A;  4DRI A;  2ZQU A;  4KQZ A;  1RD6 A;  4Z2J A;  3WL1 A;  4QT2 A;  1QPL A;  4KR0 B;  1W9U A; 
#chains in the Genus database with same CATH homology
 1XHG A;  1LG2 A;  3O5Q A;  2G8Z A;  3O5I A;  3KCE A;  4DZ2 A;  1KFW A;  2FAP A;  4QIB A;  2DT1 A;  4Z2K A;  2PBC A;  2A3B A;  3ARR A;  1HKK A;  1HKI A;  1NSG A;  4WIW A;  4ODR A;  5DIT A;  3CZ8 A;  2FDM A;  3CHC A;  3CHD A;  1HKJ A;  3JXV A;  1UR8 A;  1NWU A;  3O5P A;  3FAP A;  4JYS A;  1TFV A;  1ZBK A;  3AS1 A;  1D6O A;  1R9H A;  1JND A;  4TYO A;  4U85 A;  1Q6H A;  4GGQ A;  2ZQS A;  1X6N A;  1D7H A;  5GPG A;  2MLZ A;  1KT1 A;  3ARS A;  4JFI A;  3W4R A;  2XPA A;  1HXV A;  1E6N A;  3KAC A;  3IKD A;  4FN2 A;  4DWS D;  2YBU A;  4MTV A;  5HT1 A;  4JFK A;  3QOK A;  1GUV A;  1D2K A;  1Q1C A;  3KZ7 A;  3WKZ A;  5HBF A;  2D9F A;  4ODN A;  2DSV A;  4ODQ A;  2VN1 A;  5DEZ A;  1OGG A;  4J4N A;  1Q6I A;  1QPF A;  1JNS A;  1M5Y A;  5J6E A;  1SYT A;  2M2A A;  3O5G A;  1OWQ A;  1BKF A;  2M08 A;  4R0X A;  3MDY B;  5HTG A;  5HKG A;  1J4H A;  4FAP A;  1W1Y A;  4DIP A;  1ZBW A;  3BXW A;  1E9L A;  2KE0 A;  1T11 A;  3I6C A;  1NMW A;  2RSE A;  3RM9 A;  4NNR A;  1NMV A;  2DG4 A;  4DWS C;  4P8V A;  5DF0 A;  4Z2I A;  4S3K A;  2PPN A;  4WK9 A;  2DT2 A;  1E6Z A;  4S3J A;  1L1P A;  4URI A;  3KAF A;  1W1T A;  4LAW A;  2DT3 A;  1Y0O A;  2RUQ A;  2PI6 A;  2XPB A;  4LAX A;  3WQV A;  2PPO A;  3KAB A;  3RM8 A;  1H0I A;  4MAV A;  1JNE A;  2ITK A;  2XP4 A;  4IQC A;  1ZL1 A;  3G6L A;  1E15 A;  4DRQ A;  4DRK A;  3G6M A;  4P8X A;  3FY1 A;  2KI3 A;  3WD2 A;  4LAV A;  3O5L A;  1C9H A;  1LL4 A;  3AS3 A;  1BL4 A;  3AS0 A;  2A3A A;  2LKN A;  4XAK A;  4TW7 A;  4Z2G A;  3UI6 A;  4L3N A;  3WIJ A;  4DWS B;  2M1I A;  3IHZ A;  4WKA A;  3O5F A;  3WH0 A;  3CGN A;  3WD3 A;  1E6R A;  5DO2 A;  1HJW A;  4DRM A;  3PA7 A;  1FKH A;  1LG1 A;  3NI6 A;  1A7X A;  1H0G A;  3KAH A;  4QZV B;  4WKF A;  1FKG A;  2MNT A;  3O5D A;  1FKS A;  3FXY A;  5GQB A;  2AOS A;  3VAW A;  3AQU A;  1NWS A;  1ZBC A;  1J4I A;  1FKI A;  1JNT A;  2XP9 A;  1E6P A;  3WL0 A;  4G50 A;  5D75 A;  2ESC A;  2ZR6 A;  1JVW A;  4ZS6 A;  4MNL A;  1K9T A;  5JH8 A;  4IPX A;  1FKK A;  2XP5 A;  4DRN A;  1D7I A;  1J6Y A;  2LJ4 A;  3ARU A;  2O9O A;  3B7X A;  4JFL A;  2DSW A;  2RUD A;  4ZPW R;  1IX5 A;  1TCO C;  3IK8 A;  3ARQ A;  4ZPV R;  3UQI A;  1XRV A;  3O5E A;  2K8I A;  5HWB A;  3B8S A;  2XP6 A;  4ODL A;  1FFQ A;  1KT0 A;  2YBT A;  3WD4 A;  1VF8 A;  2IUZ A;  2RQS A;  1ZCN A;  3UI4 A;  4Z2H A;  2DG3 A;  3PRD A;  1ZK6 A;  4IT4 A;  2MLX A;  4W9O A;  1W26 A;  2DPE A;  2KGJ A;  4U86 A;  4WJX A;  4TX0 A;  1PBK A;  4W9Q A;  3B9E A;  1FFR A;  2DSZ A;  2MLY A;  1QZ2 A;  4ODM A;  4JFM A;  1LQ0 A;  1LL7 A;  4MNM A;  1W1P A;  2XP7 A;  3KAD A;  5GPR A;  4MGV A;  4DT4 A;  1FJD A;  3CGM A;  3O5K A;  3ALF A;  3ARZ A;  1ROT A;  1FKT A;  3CHF A;  3PRB A;  4G2P A;  3O5J A;  3GPK A;  4DRJ A;  1X6L A;  4HBO A;  4U84 A;  4ODP A;  2PV1 A;  1FKB A;  4Q22 A;  2OFN A;  1EHN A;  3LUO A;  3TDB A;  4GIV A;  4P8W A;  3EY6 A;  3B9A A;  4TW6 A;  1LL6 A;  2WLY A;  2ZQT A;  2JZV A;  1F40 A;  4NZC A;  2RUC A;  1ZB5 A;  2WK2 A;  2LGO A;  4DRP A;  4Z2L A;  1D7J A;  2L2S A;  3JYM A;  1CTN A;  1FKD A;  3O5M A;  5B8I C;  1Q6U A;  5HUA A;  1EQ3 A;  1OGB A;  1W9P A;  4ODK A;  2FKE A;  5HW8 A;  1YAT A;  4QT3 A;  3PRA A;  2A3E A;  2DSU A;  1EIB A;  3O5O A;  2QF8 A;  1FKF A;  4ML4 A;  4HAR A;  1GOI A;  5BXJ A;  3UQB A;  2XP8 A;  1WNO A;  3NRK A;  3CHE A;  4Q7N A;  3H9R B;  1PIN A;  3ARP A;  3AS2 A;  4LGX A;  2G41 A;  5DIU A;  3KAG A;  3JYJ A;  2LPV A;  2RUR A;  3CH9 A;  4IQ2 A;  1NWT A;  2Y78 A;  2ZR5 A;  2F21 A;  2XP3 A;  5DIV A;  4ODO A;  1N1A A;  3WQW A;  3UQA A;  4MSP A;  1EYM A;  5HW6 A;  5HW7 A;  2Q5A A;  3WD1 A;  3NTP A;  3TCZ A;  1WB0 A;  2KFW A;  1W9V A;  4DZ3 A;  4LAY A;  1EDQ A;  2IF4 A;  1B6C A;  4W9P A;  4DRH A;  3RM4 A;  2AWG A;  1W1V A;  1ROU A;  3RME A;  2DG9 A;  3ARW A;  1FAP A;  2F2D A;  1J4R A;  2MPH A;  4P8U A;  1U79 A;  3ARO A;  4NSB A;  4DRO A;  4MNJ A;  3UI5 A;  3UF8 A;  4J4O A;  2PV3 A;  1ZU8 A;  1LJY A;  4ZPT R;  3TC5 A;  2N87 A;  2ZQV A;  3ARV A;  1HKM A;  1FKJ A;  2VCD A;  3B9D A;  1FKL A;  2B31 A;  2PPP A;  2KO7 A;  4HBE A;  2PV2 A;  1P5Q A;  1HJX A;  4TNS A;  3RFW A;  1NWR A;  3ARY A;  4W5U A;  4DH0 A;  1NH6 A;  2MF9 A;  2WM0 A;  4IT6 A;  2ZR4 A;  2KR7 A;  4BF8 A;  3IKG A;  3KAI A;  4TW8 A;  3ALG A;  4ITZ A;  2A3C A;  2O92 A;  3OOB A;  4C02 B;  1ZBV A;  4R5E A;  4N19 A;  4AY1 A;  1FD9 A;  4JFJ A;  4WKH A;  5HWC A;  3RGC A;  3PR9 A;  4O2T A;  3ODK A;  2UZ5 A;  1WAW A;  2F4E A;  4MNK A;  2OLH A;  1HJV A;  3OA5 A;  1FKR A;  1YW5 A;  2DT0 A;  1SR0 A;  4PTM A;  4MPK A;  1GPF A;  1O6I A;  3ARX A;  4DWS A;  3O5R A;  1ITX A;  2WLZ A;  1UR9 A;  1F8A B;  4L72 B;  3WD0 A;  3ART A;  5I98 A;  4DRI A;  2ZQU A;  4KQZ A;  1RD6 A;  4Z2J A;  3WL1 A;  4QT2 A;  1QPL A;  4KR0 B;  1W9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...