1ZK6A

Nmr solution structure of b. subtilis prsa ppiase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
GKIRASHILVADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Foldase protein prsA
publication title NMR solution structure and characterization of substrate binding site of the PPIase domain of PrsA protein from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zk6A00
4DH0A 1Q6UA 1C9HA 1BL4A 4W9QA 4U86A 2ITKA 1D7HA 4TW6A 4DRMA 2M08A 3O5EA 2PV3A 1J6YA 1JVWA 4N19A 4ODPA 1R9HA 3CGMA 4LAXA 4ODMA 1TCOC 2MF9A 3NI6A 2Y78A 3O5QA 4TW7A 3RGCA 4R0XA 4ITZA 2ZR5A 3RFWA 1ZK6A 4IQCA 1N1AA 1D7JA 2IF4A 2MLXA 2XP3A 4ODLA 3IK8A 4C02B 4BF8A 1Q6HA 4DZ3A 1J4RA 1J4HA 2KI3A 2KR7A 1D6OA 2ZQVA 3O5RA 4LAWA 3UI4A 1EYMA 2ZR4A 4G50A 2LPVA 1FJDA 3UQAA 4JFMA 1YATA 1NSGA 4JYSA 3O5FA 4TYOA 2LJ4A 3EY6A 2XPAA 2RUDA 3JXVA 2F4EA 4IQ2A 4JFIA 4DRNA 2RQSA 1ROTA 4JFJA 2RUQA 5HT1A 1M5YA 2PPOA 3TDBA 4FAPA 1B6CA 3O5PA 4TNSA 4GIVA 3UI6A 4DRHA 1U79A 2L2SA 1ROUA 1FKKA 2MLZA 4JFKA 4DRQA 3KAFA 1FKIA 1FKHA 3KAGA 3UQIA 1BKFA 2MLYA 4DRJA 1W26A 2PV1A 3H9RB 2PV2A 2VCDA 2KGJA 3IHZA 3KAIA 2D9FA 1QPLA 3ODKA 2FKEA 2DG3A 4DRIA 1Q6IA 1FKSA 2F21A 5HWBA 1KT0A 4DIPA 1FAPA 2RURA 3TCZA 4DZ2A 1F40A 3NTPA 3TC5A 4U84A 1FKLA 3KZ7A 3PRBA 3PA7A 4ODKA 4QT3A 2MNTA 4DRPA 4DROA 5HWCA 4QIBA 1KT1A 3MDYB 2N87A 1Y0OA 2ZQUA 2LKNA 3O5JA 3O5LA 3O5GA 2PBCA 2DG9A 3CGNA 5B8IC 5HUAA 3GPKA 5J6EA 1JNSA 1FKFA 3JYMA 3WH0A 5HW7A 1ZCNA 2KO7A 3IKDA 2PPPA 3PRDA 2M2AA 2UZ5A 2XPBA 5HW8A 5HW6A 2VN1A 4DT4A 1FKJA 3OOBA 1FKRA 4W9PA 1NMWA 4DRKA 1L1PA 2FAPA 4IPXA 5DITA 1FKDA 4JFLA 4J4OA 2OFNA 2RSEA 3KABA 4LAYA 3KCEA 1A7XA 2Q5AA 2XP5A 3JYJA 3O5DA 1FKGA 1PINA 2MPHA 2JZVA 2ZR6A 1D7IA 4J4NA 5GPGA 2PPNA 1EQ3A 1NMVA 2XP4A 3LUOA 4MSPA 1P5QA 2ZQTA 4ODRA 4ODNA 2XP8A 3KACA 5HTGA 3UQBA 1YW5A 3FAPA 4GGQA 2K8IA 3O5KA 4O2TA 2F2DA 1FKBA 1T11A 2AWGA 3O5MA 4W9OA 1FD9A 3B7XA 5DIVA 3UI5A 5HKGA 3NRKA 2XP7A 3O5OA 4G2PA 1PBKA 2M1IA 2ZQSA 4NNRA 3UF8A 5DIUA 3IKGA 1J4IA 3O5IA 2KE0A 4QT2A 5D75A 2RUCA 1Q1CA 1QPFA 4ODQA 3KAHA 2DG4A 4U85A 5BXJA 1FKTA 4FN2A 2LGOA 1QZ2A 1F8AB 2XP9A 3I6CA 4MGVA 2KFWA 2XP6A 4ODOA 5I98A 4TX0A 1HXVA 4TW8A 3VAWA 3KADA 1JNTA 4LAVA
chains in the Genus database with same CATH superfamily
1C9HA 4W9QA 2ITKA 4DRMA 1JVWA 4ODPA 1R9HA 1XHGA 5DEZA 2YBTA 4KR0B 3CZ8A 3RFWA 1ZK6A 5DF0A 1D7JA 1ZU8A 2IF4A 2XP3A 4ODLA 4C02B 1J4RA 1J4HA 1W9PA 2KR7A 2DSZA 1EYMA 1VF8A 1OGGA 4G50A 3WKZA 4JYSA 1NSGA 4ML4A 3WIJA 1LL7A 3AS1A 2XPAA 2RUDA 3JXVA 2F4EA 4JFJA 5HT1A 2RUQA 1WNOA 2PPOA 3TDBA 4FAPA 4TNSA 3ARRA 4Z2GA 1ROUA 2AOSA 2FDMA 3G6LA 4DRQA 3RMEA 1FKIA 3KAGA 3QOKA 4DRJA 1LQ0A 2VCDA 3IHZA 3CHCA 1GPFA 4R5EA 3ARPA 3AS2A 2PI6A 1GOIA 4DRIA 5HWBA 4DIPA 1FAPA 2RURA 1E6RA 3AS0A 3TCZA 4DWSA 3PRBA 4ODKA 1FFQA 3EIPA 1NH6A 2N87A 2ZQUA 1JNSA 3GU0A 2KO7A 4MNJA 3CH9A 4PTMA 4WJXA 4MAVA 4DT4A 1E44A 4J4OA 4LAYA 4DWSD 2QF8A 2XP5A 3JYJA 1JCHB 2JZVA 2ZR6A 4J4NA 4ZPVR 1EQ3A 2A3CA 3RM4A 1SYTA 1NMVA 4MSPA 3WD0A 1P5QA 3B9AA 3ARWA 5HTGA 1YW5A 1H0GA 3ARUA 4O2TA 1FKBA 1T11A 2AWGA 3O5MA 4W9OA 3NRKA 4IT6A 4P8XA 1J4IA 4QT2A 2RUCA 1QPFA 1E6NA 1D2KA 1F8AB 2XP9A 1GRJA 4WIWA 1W1VA 2A3EA 4TW8A 3WD2A 1Q6UA 1D7HA 4N19A 1NWTA 2DPEA 1W1PA 3CGMA 4ODMA 3BXWA 3NI6A 2Y78A 3O5QA 4TW7A 4XAKA 4R0XA 4ITZA 4IQCA 4DWSB 3IK8A 4P8UA 4BF8A 1LL4A 2ZQVA 1D6OA 2ZR4A 1FJDA 3UQAA 1OGBA 1YATA 1E6ZA 4JFMA 3O5FA 2DSWA 3ALFA 1W9UA 1ROTA 1E6PA 3ALGA 5GPRA 1W1YA 4URIA 4DRHA 2L2SA 4KQZA 1EHNA 3OA5A 2PN0A 1FKHA 3UQIA 1BKFA 2MLYA 2OLHA 2FKEA 2DSVA 3CHDA 3WL1A 3TC5A 1ZBWA 4QT3A 2O9OA 3MDYB 3O5JA 2LKNA 3ARQA 5HUAA 3AROA 2DG9A 5J6EA 1FKFA 3WH0A 1ZCNA 1W9VA 4UDMA 2UZ5A 5HW8A 2WLYA 3WD4A 2A3BA 1FKRA 4W9PA 1ITXA 1NMWA 4DRKA 2FAPA 4IPXA 2DT2A 3RM9A 3KABA 3KCEA 4HARA 2G8ZA 4WKFA 1D7IA 1NWRA 5GPGA 2WK2A 2ZQTA 4ODNA 2K8IA 3O5KA 2F2DA 4Z2IA 4MTVA 2XP7A 3BMBA 1PBKA 2M1IA 3UF8A 4ODQA 3KAHA 1JNEA 1HKIA 1FKTA 4FN2A 2LGOA 1QZ2A 3ARYA 1EIBA 4DWSC 2ESCA 2KFWA 2XP6A 1ZBVA 4TX0A 4ZS6A 2B31A 3KADA 4P8WA 4L3NA 2WLZA 3RM8A 4TW6A 1J6YA 1ZL1A 2PV3A 3O5EA 3WQWA 1CTNA 3RGCA 1UR8A 4MNKA 3FY1A 3ARTA 4ZPWR 2DT3A 2A3AA 4DZ3A 3UI4A 4MNMA 3WQVA 4TYOA 1IX5A 4IQ2A 1JNDA 4IT4A 1M5YA 1B6CA 3O5PA 4GIVA 4Z2KA 1FKKA 5JH8A 4Z2HA 2MLZA 4JFKA 3KAFA 3PRAA 2KGJA 4L72B 3ARXA 1QPLA 3AQUA 2DG3A 1Q6IA 1FKSA 2DSUA 4AY1A 4WKAA 1WB0A 2MNTA 1NWSA 4WK9A 3G6MA 5HWCA 1KT1A 3O5GA 1Y0OA 5B8IC 2IUZA 3CGNA 1E9LA 3GPKA 5DO2A 5HW7A 3PRDA 3OOBA 1L1PA 1FKDA 1FKGA 1PINA 3LUOA 2EULA 2G41A 4P8VA 2ETNA 2XP8A 3KACA 3CHFA 1ZBKA 4ZPTR 5HKGA 3B7XA 4G2PA 2ZQSA 4NNRA 4W5UA 4NZCA 4NSBA 2P4VA 1GUVA 5BXJA 2F23A 4MGVA 1X6NA 1HJWA 1HXVA 3VAWA 3AS3A 1LL6A 2PBCA 4LAVA 4DH0A 1HKKA 1BL4A 4U86A 2M08A 3WL0A 3B8SA 1TCOC 2MF9A 3WD3A 2WM0A 2ZR5A 3ARSA 1N1AA 1E15A 2MLXA 4Z2LA 1Q6HA 2KI3A 2YBUA 4LAWA 3O5RA 1LG1A 2LPVA 1LJYA 2LJ4A 3EY6A 4JFIA 1F40A 3B9DA 4DRNA 1LG2A 2RQSA 4QZVB 4Q7NA 3PR9A 4HBOA 3UI6A 5HBFA 1U79A 5GQBA 3GTYX 4S3KA 1W26A 2PV1A 1OWQA 3H9RB 2PV2A 3KAIA 2D9FA 3ODKA 4LGXA 1W1TA 4MNLA 2F21A 1KT0A 4DZ2A 3NTPA 1RD6A 3ARZA 4U84A 1FKLA 3KZ7A 1XRVA 3PA7A 1ZBCA 4DRPA 4MPKA 4DROA 3B9EA 4QIBA 1FFRA 3O5LA 4LAXA 1H0IA 2B5UB 3JYMA 1SR0A 3IKDA 2PPPA 2M2AA 2XPBA 5HW6A 2VN1A 1FKJA 1HKJA 1KFWA 3WD1A 5DITA 4JFLA 1HKMA 2OFNA 2RSEA 3CHEA 1A7XA 2Q5AA 4Q22A 3O5DA 1ZB5A 1X6LA 2MPHA 3ARVA 2PPNA 4WKHA 2XP4A 1HJXA 4ODRA 3FXYA 3UQBA 1K9TA 1TFVA 2O92A 3FAPA 4GGQA 3UI5A 2DT1A 1FD9A 5DIVA 1EDQA 3O5OA 4S3JA 4HBEA 5DIUA 2DT0A 3IKGA 3W4RA 3O5IA 2KE0A 5D75A 1HJVA 1Q1CA 4Z2JA 1O6IA 4U85A 2DG4A 1WAWA 3I6CA 4ODOA 5I98A 1NWUA 1UR9A 1JNTA
chains in the Genus database with same CATH topology
1C9HA 4W9QA 2ITKA 4DRMA 1JVWA 4ODPA 1R9HA 1XHGA 5DEZA 2YBTA 4KR0B 3CZ8A 3RFWA 1ZK6A 5DF0A 1D7JA 1ZU8A 2IF4A 2XP3A 4ODLA 4C02B 1J4RA 1J4HA 1W9PA 2KR7A 2DSZA 1EYMA 1VF8A 1OGGA 4G50A 3WKZA 4JYSA 1NSGA 4ML4A 3WIJA 1LL7A 3AS1A 2XPAA 2RUDA 3JXVA 2F4EA 4JFJA 5HT1A 2RUQA 1WNOA 2PPOA 3TDBA 4FAPA 4TNSA 3ARRA 4Z2GA 1ROUA 2AOSA 2FDMA 3G6LA 4DRQA 3RMEA 1FKIA 3KAGA 3QOKA 4DRJA 1LQ0A 2VCDA 3IHZA 3CHCA 1GPFA 4R5EA 3ARPA 3AS2A 2PI6A 1GOIA 4DRIA 5HWBA 4DIPA 1FAPA 2RURA 1E6RA 3AS0A 3TCZA 4DWSA 3PRBA 4ODKA 1FFQA 1NH6A 2N87A 2ZQUA 1JNSA 2KO7A 4MNJA 3CH9A 4PTMA 4WJXA 4MAVA 4DT4A 4J4OA 4LAYA 4DWSD 2QF8A 2XP5A 3JYJA 2JZVA 2ZR6A 4J4NA 4ZPVR 1EQ3A 2A3CA 3RM4A 1SYTA 1NMVA 4MSPA 3WD0A 1P5QA 3B9AA 3ARWA 5HTGA 1YW5A 1H0GA 3ARUA 4O2TA 1FKBA 1T11A 2AWGA 3O5MA 4W9OA 3NRKA 4IT6A 4P8XA 1J4IA 4QT2A 2RUCA 1QPFA 1E6NA 1D2KA 1F8AB 2XP9A 4WIWA 1W1VA 2A3EA 4TW8A 3WD2A 1Q6UA 1D7HA 4N19A 1NWTA 2DPEA 1W1PA 3CGMA 4ODMA 3BXWA 3NI6A 2Y78A 3O5QA 4TW7A 4XAKA 4R0XA 4ITZA 4IQCA 4DWSB 3IK8A 4P8UA 4BF8A 1LL4A 2ZQVA 1D6OA 2ZR4A 1FJDA 3UQAA 1OGBA 1YATA 1E6ZA 4JFMA 3O5FA 2DSWA 3ALFA 1W9UA 1ROTA 1E6PA 3ALGA 5GPRA 1W1YA 4URIA 4DRHA 2L2SA 4KQZA 1EHNA 3OA5A 1FKHA 3UQIA 1BKFA 2MLYA 2OLHA 2FKEA 2DSVA 3CHDA 3WL1A 3TC5A 1ZBWA 4QT3A 2O9OA 3MDYB 3O5JA 2LKNA 3ARQA 5HUAA 3AROA 2DG9A 5J6EA 1FKFA 3WH0A 1ZCNA 1W9VA 2UZ5A 5HW8A 2WLYA 3WD4A 2A3BA 1FKRA 4W9PA 1ITXA 1NMWA 4DRKA 2FAPA 4IPXA 2DT2A 3RM9A 3KABA 3KCEA 4HARA 2G8ZA 4WKFA 1D7IA 1NWRA 5GPGA 2WK2A 2ZQTA 4ODNA 2K8IA 3O5KA 2F2DA 4Z2IA 4MTVA 2XP7A 1PBKA 2M1IA 3UF8A 4ODQA 3KAHA 1JNEA 1HKIA 1FKTA 4FN2A 2LGOA 1QZ2A 3ARYA 1EIBA 4DWSC 2ESCA 2KFWA 2XP6A 1ZBVA 4TX0A 4ZS6A 2B31A 3KADA 4P8WA 4L3NA 2WLZA 3RM8A 4TW6A 1J6YA 1ZL1A 2PV3A 3O5EA 3WQWA 1CTNA 3RGCA 1UR8A 4MNKA 3FY1A 3ARTA 4ZPWR 2DT3A 2A3AA 4DZ3A 3UI4A 4MNMA 3WQVA 4TYOA 1IX5A 4IQ2A 1JNDA 4IT4A 1M5YA 1B6CA 3O5PA 4GIVA 4Z2KA 1FKKA 5JH8A 4Z2HA 2MLZA 4JFKA 3KAFA 3PRAA 2KGJA 4L72B 3ARXA 1QPLA 3AQUA 2DG3A 1Q6IA 1FKSA 2DSUA 4AY1A 4WKAA 1WB0A 2MNTA 1NWSA 4WK9A 3G6MA 5HWCA 1KT1A 3O5GA 1Y0OA 5B8IC 2IUZA 3CGNA 1E9LA 3GPKA 5DO2A 5HW7A 3PRDA 3OOBA 1L1PA 1FKDA 1FKGA 1PINA 3LUOA 2G41A 4P8VA 2XP8A 3KACA 3CHFA 1ZBKA 4ZPTR 5HKGA 3B7XA 4G2PA 2ZQSA 4NNRA 4W5UA 4NZCA 4NSBA 1GUVA 5BXJA 4MGVA 1X6NA 1HJWA 1HXVA 3VAWA 3AS3A 1LL6A 2PBCA 4LAVA 4DH0A 1HKKA 1BL4A 4U86A 2M08A 3WL0A 3B8SA 1TCOC 2MF9A 3WD3A 2WM0A 2ZR5A 3ARSA 1N1AA 1E15A 2MLXA 4Z2LA 1Q6HA 2KI3A 2YBUA 4LAWA 3O5RA 1LG1A 2LPVA 1LJYA 2LJ4A 3EY6A 4JFIA 1F40A 3B9DA 4DRNA 1LG2A 2RQSA 4QZVB 4Q7NA 3PR9A 4HBOA 3UI6A 5HBFA 1U79A 5GQBA 4S3KA 1W26A 2PV1A 1OWQA 3H9RB 2PV2A 3KAIA 2D9FA 3ODKA 4LGXA 1W1TA 4MNLA 2F21A 1KT0A 4DZ2A 3NTPA 1RD6A 3ARZA 4U84A 1FKLA 3KZ7A 1XRVA 3PA7A 1ZBCA 4DRPA 4MPKA 4DROA 3B9EA 4QIBA 3O5LA 1FFRA 4LAXA 1H0IA 3JYMA 1SR0A 3IKDA 2PPPA 2M2AA 2XPBA 5HW6A 2VN1A 1FKJA 1HKJA 1KFWA 3WD1A 5DITA 4JFLA 1HKMA 2OFNA 2RSEA 3CHEA 1A7XA 2Q5AA 4Q22A 3O5DA 1ZB5A 1X6LA 2MPHA 3ARVA 2PPNA 4WKHA 2XP4A 1HJXA 4ODRA 3FXYA 3UQBA 1K9TA 1TFVA 2O92A 3FAPA 4GGQA 3UI5A 2DT1A 1FD9A 5DIVA 1EDQA 3O5OA 4S3JA 4HBEA 5DIUA 2DT0A 3IKGA 3W4RA 3O5IA 2KE0A 5D75A 1HJVA 1Q1CA 4Z2JA 1O6IA 4U85A 2DG4A 1WAWA 3I6CA 4ODOA 5I98A 1NWUA 1UR9A 1JNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DH0 A;  1Q6U A;  1C9H A;  1BL4 A;  4W9Q A;  4U86 A;  2ITK A;  1D7H A;  4TW6 A;  4DRM A;  2M08 A;  3O5E A;  2PV3 A;  1J6Y A;  1JVW A;  4N19 A;  4ODP A;  1R9H A;  3CGM A;  4LAX A;  4ODM A;  1TCO C;  2MF9 A;  3NI6 A;  2Y78 A;  3O5Q A;  4TW7 A;  3RGC A;  4R0X A;  4ITZ A;  2ZR5 A;  3RFW A;  1ZK6 A;  4IQC A;  1N1A A;  1D7J A;  2IF4 A;  2MLX A;  2XP3 A;  4ODL A;  3IK8 A;  4C02 B;  4BF8 A;  1Q6H A;  4DZ3 A;  1J4R A;  1J4H A;  2KI3 A;  2KR7 A;  1D6O A;  2ZQV A;  3O5R A;  4LAW A;  3UI4 A;  1EYM A;  2ZR4 A;  4G50 A;  2LPV A;  1FJD A;  3UQA A;  4JFM A;  1YAT A;  1NSG A;  4JYS A;  3O5F A;  4TYO A;  2LJ4 A;  3EY6 A;  2XPA A;  2RUD A;  3JXV A;  2F4E A;  4IQ2 A;  4JFI A;  4DRN A;  2RQS A;  1ROT A;  4JFJ A;  2RUQ A;  5HT1 A;  1M5Y A;  2PPO A;  3TDB A;  4FAP A;  1B6C A;  3O5P A;  4TNS A;  4GIV A;  3UI6 A;  4DRH A;  1U79 A;  2L2S A;  1ROU A;  1FKK A;  2MLZ A;  4JFK A;  4DRQ A;  3KAF A;  1FKI A;  1FKH A;  3KAG A;  3UQI A;  1BKF A;  2MLY A;  4DRJ A;  1W26 A;  2PV1 A;  3H9R B;  2PV2 A;  2VCD A;  2KGJ A;  3IHZ A;  3KAI A;  2D9F A;  1QPL A;  3ODK A;  2FKE A;  2DG3 A;  4DRI A;  1Q6I A;  1FKS A;  2F21 A;  5HWB A;  1KT0 A;  4DIP A;  1FAP A;  2RUR A;  3TCZ A;  4DZ2 A;  1F40 A;  3NTP A;  3TC5 A;  4U84 A;  1FKL A;  3KZ7 A;  3PRB A;  3PA7 A;  4ODK A;  4QT3 A;  2MNT A;  4DRP A;  4DRO A;  5HWC A;  4QIB A;  1KT1 A;  3MDY B;  2N87 A;  1Y0O A;  2ZQU A;  2LKN A;  3O5J A;  3O5L A;  3O5G A;  2PBC A;  2DG9 A;  3CGN A;  5B8I C;  5HUA A;  3GPK A;  5J6E A;  1JNS A;  1FKF A;  3JYM A;  3WH0 A;  5HW7 A;  1ZCN A;  2KO7 A;  3IKD A;  2PPP A;  3PRD A;  2M2A A;  2UZ5 A;  2XPB A;  5HW8 A;  5HW6 A;  2VN1 A;  4DT4 A;  1FKJ A;  3OOB A;  1FKR A;  4W9P A;  1NMW A;  4DRK A;  1L1P A;  2FAP A;  4IPX A;  5DIT A;  1FKD A;  4JFL A;  4J4O A;  2OFN A;  2RSE A;  3KAB A;  4LAY A;  3KCE A;  1A7X A;  2Q5A A;  2XP5 A;  3JYJ A;  3O5D A;  1FKG A;  1PIN A;  2MPH A;  2JZV A;  2ZR6 A;  1D7I A;  4J4N A;  5GPG A;  2PPN A;  1EQ3 A;  1NMV A;  2XP4 A;  3LUO A;  4MSP A;  1P5Q A;  2ZQT A;  4ODR A;  4ODN A;  2XP8 A;  3KAC A;  5HTG A;  3UQB A;  1YW5 A;  3FAP A;  4GGQ A;  2K8I A;  3O5K A;  4O2T A;  2F2D A;  1FKB A;  1T11 A;  2AWG A;  3O5M A;  4W9O A;  1FD9 A;  3B7X A;  5DIV A;  3UI5 A;  5HKG A;  3NRK A;  2XP7 A;  3O5O A;  4G2P A;  1PBK A;  2M1I A;  2ZQS A;  4NNR A;  3UF8 A;  5DIU A;  3IKG A;  1J4I A;  3O5I A;  2KE0 A;  4QT2 A;  5D75 A;  2RUC A;  1Q1C A;  1QPF A;  4ODQ A;  3KAH A;  2DG4 A;  4U85 A;  5BXJ A;  1FKT A;  4FN2 A;  2LGO A;  1QZ2 A;  1F8A B;  2XP9 A;  3I6C A;  4MGV A;  2KFW A;  2XP6 A;  4ODO A;  5I98 A;  4TX0 A;  1HXV A;  4TW8 A;  3VAW A;  3KAD A;  1JNT A;  4LAV A; 
#chains in the Genus database with same CATH topology
 1C9H A;  4W9Q A;  2ITK A;  4DRM A;  1JVW A;  4ODP A;  1R9H A;  1XHG A;  5DEZ A;  2YBT A;  4KR0 B;  3CZ8 A;  3RFW A;  1ZK6 A;  5DF0 A;  1D7J A;  1ZU8 A;  2IF4 A;  2XP3 A;  4ODL A;  4C02 B;  1J4R A;  1J4H A;  1W9P A;  2KR7 A;  2DSZ A;  1EYM A;  1VF8 A;  1OGG A;  4G50 A;  3WKZ A;  4JYS A;  1NSG A;  4ML4 A;  3WIJ A;  1LL7 A;  3AS1 A;  2XPA A;  2RUD A;  3JXV A;  2F4E A;  4JFJ A;  5HT1 A;  2RUQ A;  1WNO A;  2PPO A;  3TDB A;  4FAP A;  4TNS A;  3ARR A;  4Z2G A;  1ROU A;  2AOS A;  2FDM A;  3G6L A;  4DRQ A;  3RME A;  1FKI A;  3KAG A;  3QOK A;  4DRJ A;  1LQ0 A;  2VCD A;  3IHZ A;  3CHC A;  1GPF A;  4R5E A;  3ARP A;  3AS2 A;  2PI6 A;  1GOI A;  4DRI A;  5HWB A;  4DIP A;  1FAP A;  2RUR A;  1E6R A;  3AS0 A;  3TCZ A;  4DWS A;  3PRB A;  4ODK A;  1FFQ A;  3EIP A;  1NH6 A;  2N87 A;  2ZQU A;  1JNS A;  3GU0 A;  2KO7 A;  4MNJ A;  3CH9 A;  4PTM A;  4WJX A;  4MAV A;  4DT4 A;  1E44 A;  4J4O A;  4LAY A;  4DWS D;  2QF8 A;  2XP5 A;  3JYJ A;  1JCH B;  2JZV A;  2ZR6 A;  4J4N A;  4ZPV R;  1EQ3 A;  2A3C A;  3RM4 A;  1SYT A;  1NMV A;  4MSP A;  3WD0 A;  1P5Q A;  3B9A A;  3ARW A;  5HTG A;  1YW5 A;  1H0G A;  3ARU A;  4O2T A;  1FKB A;  1T11 A;  2AWG A;  3O5M A;  4W9O A;  3NRK A;  4IT6 A;  4P8X A;  1J4I A;  4QT2 A;  2RUC A;  1QPF A;  1E6N A;  1D2K A;  1F8A B;  2XP9 A;  1GRJ A;  4WIW A;  1W1V A;  2A3E A;  4TW8 A;  3WD2 A;  1Q6U A;  1D7H A;  4N19 A;  1NWT A;  2DPE A;  1W1P A;  3CGM A;  4ODM A;  3BXW A;  3NI6 A;  2Y78 A;  3O5Q A;  4TW7 A;  4XAK A;  4R0X A;  4ITZ A;  4IQC A;  4DWS B;  3IK8 A;  4P8U A;  4BF8 A;  1LL4 A;  2ZQV A;  1D6O A;  2ZR4 A;  1FJD A;  3UQA A;  1OGB A;  1YAT A;  1E6Z A;  4JFM A;  3O5F A;  2DSW A;  3ALF A;  1W9U A;  1ROT A;  1E6P A;  3ALG A;  5GPR A;  1W1Y A;  4URI A;  4DRH A;  2L2S A;  4KQZ A;  1EHN A;  3OA5 A;  2PN0 A;  1FKH A;  3UQI A;  1BKF A;  2MLY A;  2OLH A;  2FKE A;  2DSV A;  3CHD A;  3WL1 A;  3TC5 A;  1ZBW A;  4QT3 A;  2O9O A;  3MDY B;  3O5J A;  2LKN A;  3ARQ A;  5HUA A;  3ARO A;  2DG9 A;  5J6E A;  1FKF A;  3WH0 A;  1ZCN A;  1W9V A;  4UDM A;  2UZ5 A;  5HW8 A;  2WLY A;  3WD4 A;  2A3B A;  1FKR A;  4W9P A;  1ITX A;  1NMW A;  4DRK A;  2FAP A;  4IPX A;  2DT2 A;  3RM9 A;  3KAB A;  3KCE A;  4HAR A;  2G8Z A;  4WKF A;  1D7I A;  1NWR A;  5GPG A;  2WK2 A;  2ZQT A;  4ODN A;  2K8I A;  3O5K A;  2F2D A;  4Z2I A;  4MTV A;  2XP7 A;  3BMB A;  1PBK A;  2M1I A;  3UF8 A;  4ODQ A;  3KAH A;  1JNE A;  1HKI A;  1FKT A;  4FN2 A;  2LGO A;  1QZ2 A;  3ARY A;  1EIB A;  4DWS C;  2ESC A;  2KFW A;  2XP6 A;  1ZBV A;  4TX0 A;  4ZS6 A;  2B31 A;  3KAD A;  4P8W A;  4L3N A;  2WLZ A;  3RM8 A;  4TW6 A;  1J6Y A;  1ZL1 A;  2PV3 A;  3O5E A;  3WQW A;  1CTN A;  3RGC A;  1UR8 A;  4MNK A;  3FY1 A;  3ART A;  4ZPW R;  2DT3 A;  2A3A A;  4DZ3 A;  3UI4 A;  4MNM A;  3WQV A;  4TYO A;  1IX5 A;  4IQ2 A;  1JND A;  4IT4 A;  1M5Y A;  1B6C A;  3O5P A;  4GIV A;  4Z2K A;  1FKK A;  5JH8 A;  4Z2H A;  2MLZ A;  4JFK A;  3KAF A;  3PRA A;  2KGJ A;  4L72 B;  3ARX A;  1QPL A;  3AQU A;  2DG3 A;  1Q6I A;  1FKS A;  2DSU A;  4AY1 A;  4WKA A;  1WB0 A;  2MNT A;  1NWS A;  4WK9 A;  3G6M A;  5HWC A;  1KT1 A;  3O5G A;  1Y0O A;  5B8I C;  2IUZ A;  3CGN A;  1E9L A;  3GPK A;  5DO2 A;  5HW7 A;  3PRD A;  3OOB A;  1L1P A;  1FKD A;  1FKG A;  1PIN A;  3LUO A;  2EUL A;  2G41 A;  4P8V A;  2ETN A;  2XP8 A;  3KAC A;  3CHF A;  1ZBK A;  4ZPT R;  5HKG A;  3B7X A;  4G2P A;  2ZQS A;  4NNR A;  4W5U A;  4NZC A;  4NSB A;  2P4V A;  1GUV A;  5BXJ A;  2F23 A;  4MGV A;  1X6N A;  1HJW A;  1HXV A;  3VAW A;  3AS3 A;  1LL6 A;  2PBC A;  4LAV A;  4DH0 A;  1HKK A;  1BL4 A;  4U86 A;  2M08 A;  3WL0 A;  3B8S A;  1TCO C;  2MF9 A;  3WD3 A;  2WM0 A;  2ZR5 A;  3ARS A;  1N1A A;  1E15 A;  2MLX A;  4Z2L A;  1Q6H A;  2KI3 A;  2YBU A;  4LAW A;  3O5R A;  1LG1 A;  2LPV A;  1LJY A;  2LJ4 A;  3EY6 A;  4JFI A;  1F40 A;  3B9D A;  4DRN A;  1LG2 A;  2RQS A;  4QZV B;  4Q7N A;  3PR9 A;  4HBO A;  3UI6 A;  5HBF A;  1U79 A;  5GQB A;  3GTY X;  4S3K A;  1W26 A;  2PV1 A;  1OWQ A;  3H9R B;  2PV2 A;  3KAI A;  2D9F A;  3ODK A;  4LGX A;  1W1T A;  4MNL A;  2F21 A;  1KT0 A;  4DZ2 A;  3NTP A;  1RD6 A;  3ARZ A;  4U84 A;  1FKL A;  3KZ7 A;  1XRV A;  3PA7 A;  1ZBC A;  4DRP A;  4MPK A;  4DRO A;  3B9E A;  4QIB A;  1FFR A;  3O5L A;  4LAX A;  1H0I A;  2B5U B;  3JYM A;  1SR0 A;  3IKD A;  2PPP A;  2M2A A;  2XPB A;  5HW6 A;  2VN1 A;  1FKJ A;  1HKJ A;  1KFW A;  3WD1 A;  5DIT A;  4JFL A;  1HKM A;  2OFN A;  2RSE A;  3CHE A;  1A7X A;  2Q5A A;  4Q22 A;  3O5D A;  1ZB5 A;  1X6L A;  2MPH A;  3ARV A;  2PPN A;  4WKH A;  2XP4 A;  1HJX A;  4ODR A;  3FXY A;  3UQB A;  1K9T A;  1TFV A;  2O92 A;  3FAP A;  4GGQ A;  3UI5 A;  2DT1 A;  1FD9 A;  5DIV A;  1EDQ A;  3O5O A;  4S3J A;  4HBE A;  5DIU A;  2DT0 A;  3IKG A;  3W4R A;  3O5I A;  2KE0 A;  5D75 A;  1HJV A;  1Q1C A;  4Z2J A;  1O6I A;  4U85 A;  2DG4 A;  1WAW A;  3I6C A;  4ODO A;  5I98 A;  1NWU A;  1UR9 A;  1JNT A; 
#chains in the Genus database with same CATH homology
 1C9H A;  4W9Q A;  2ITK A;  4DRM A;  1JVW A;  4ODP A;  1R9H A;  1XHG A;  5DEZ A;  2YBT A;  4KR0 B;  3CZ8 A;  3RFW A;  1ZK6 A;  5DF0 A;  1D7J A;  1ZU8 A;  2IF4 A;  2XP3 A;  4ODL A;  4C02 B;  1J4R A;  1J4H A;  1W9P A;  2KR7 A;  2DSZ A;  1EYM A;  1VF8 A;  1OGG A;  4G50 A;  3WKZ A;  4JYS A;  1NSG A;  4ML4 A;  3WIJ A;  1LL7 A;  3AS1 A;  2XPA A;  2RUD A;  3JXV A;  2F4E A;  4JFJ A;  5HT1 A;  2RUQ A;  1WNO A;  2PPO A;  3TDB A;  4FAP A;  4TNS A;  3ARR A;  4Z2G A;  1ROU A;  2AOS A;  2FDM A;  3G6L A;  4DRQ A;  3RME A;  1FKI A;  3KAG A;  3QOK A;  4DRJ A;  1LQ0 A;  2VCD A;  3IHZ A;  3CHC A;  1GPF A;  4R5E A;  3ARP A;  3AS2 A;  2PI6 A;  1GOI A;  4DRI A;  5HWB A;  4DIP A;  1FAP A;  2RUR A;  1E6R A;  3AS0 A;  3TCZ A;  4DWS A;  3PRB A;  4ODK A;  1FFQ A;  1NH6 A;  2N87 A;  2ZQU A;  1JNS A;  2KO7 A;  4MNJ A;  3CH9 A;  4PTM A;  4WJX A;  4MAV A;  4DT4 A;  4J4O A;  4LAY A;  4DWS D;  2QF8 A;  2XP5 A;  3JYJ A;  2JZV A;  2ZR6 A;  4J4N A;  4ZPV R;  1EQ3 A;  2A3C A;  3RM4 A;  1SYT A;  1NMV A;  4MSP A;  3WD0 A;  1P5Q A;  3B9A A;  3ARW A;  5HTG A;  1YW5 A;  1H0G A;  3ARU A;  4O2T A;  1FKB A;  1T11 A;  2AWG A;  3O5M A;  4W9O A;  3NRK A;  4IT6 A;  4P8X A;  1J4I A;  4QT2 A;  2RUC A;  1QPF A;  1E6N A;  1D2K A;  1F8A B;  2XP9 A;  4WIW A;  1W1V A;  2A3E A;  4TW8 A;  3WD2 A;  1Q6U A;  1D7H A;  4N19 A;  1NWT A;  2DPE A;  1W1P A;  3CGM A;  4ODM A;  3BXW A;  3NI6 A;  2Y78 A;  3O5Q A;  4TW7 A;  4XAK A;  4R0X A;  4ITZ A;  4IQC A;  4DWS B;  3IK8 A;  4P8U A;  4BF8 A;  1LL4 A;  2ZQV A;  1D6O A;  2ZR4 A;  1FJD A;  3UQA A;  1OGB A;  1YAT A;  1E6Z A;  4JFM A;  3O5F A;  2DSW A;  3ALF A;  1W9U A;  1ROT A;  1E6P A;  3ALG A;  5GPR A;  1W1Y A;  4URI A;  4DRH A;  2L2S A;  4KQZ A;  1EHN A;  3OA5 A;  1FKH A;  3UQI A;  1BKF A;  2MLY A;  2OLH A;  2FKE A;  2DSV A;  3CHD A;  3WL1 A;  3TC5 A;  1ZBW A;  4QT3 A;  2O9O A;  3MDY B;  3O5J A;  2LKN A;  3ARQ A;  5HUA A;  3ARO A;  2DG9 A;  5J6E A;  1FKF A;  3WH0 A;  1ZCN A;  1W9V A;  2UZ5 A;  5HW8 A;  2WLY A;  3WD4 A;  2A3B A;  1FKR A;  4W9P A;  1ITX A;  1NMW A;  4DRK A;  2FAP A;  4IPX A;  2DT2 A;  3RM9 A;  3KAB A;  3KCE A;  4HAR A;  2G8Z A;  4WKF A;  1D7I A;  1NWR A;  5GPG A;  2WK2 A;  2ZQT A;  4ODN A;  2K8I A;  3O5K A;  2F2D A;  4Z2I A;  4MTV A;  2XP7 A;  1PBK A;  2M1I A;  3UF8 A;  4ODQ A;  3KAH A;  1JNE A;  1HKI A;  1FKT A;  4FN2 A;  2LGO A;  1QZ2 A;  3ARY A;  1EIB A;  4DWS C;  2ESC A;  2KFW A;  2XP6 A;  1ZBV A;  4TX0 A;  4ZS6 A;  2B31 A;  3KAD A;  4P8W A;  4L3N A;  2WLZ A;  3RM8 A;  4TW6 A;  1J6Y A;  1ZL1 A;  2PV3 A;  3O5E A;  3WQW A;  1CTN A;  3RGC A;  1UR8 A;  4MNK A;  3FY1 A;  3ART A;  4ZPW R;  2DT3 A;  2A3A A;  4DZ3 A;  3UI4 A;  4MNM A;  3WQV A;  4TYO A;  1IX5 A;  4IQ2 A;  1JND A;  4IT4 A;  1M5Y A;  1B6C A;  3O5P A;  4GIV A;  4Z2K A;  1FKK A;  5JH8 A;  4Z2H A;  2MLZ A;  4JFK A;  3KAF A;  3PRA A;  2KGJ A;  4L72 B;  3ARX A;  1QPL A;  3AQU A;  2DG3 A;  1Q6I A;  1FKS A;  2DSU A;  4AY1 A;  4WKA A;  1WB0 A;  2MNT A;  1NWS A;  4WK9 A;  3G6M A;  5HWC A;  1KT1 A;  3O5G A;  1Y0O A;  5B8I C;  2IUZ A;  3CGN A;  1E9L A;  3GPK A;  5DO2 A;  5HW7 A;  3PRD A;  3OOB A;  1L1P A;  1FKD A;  1FKG A;  1PIN A;  3LUO A;  2G41 A;  4P8V A;  2XP8 A;  3KAC A;  3CHF A;  1ZBK A;  4ZPT R;  5HKG A;  3B7X A;  4G2P A;  2ZQS A;  4NNR A;  4W5U A;  4NZC A;  4NSB A;  1GUV A;  5BXJ A;  4MGV A;  1X6N A;  1HJW A;  1HXV A;  3VAW A;  3AS3 A;  1LL6 A;  2PBC A;  4LAV A;  4DH0 A;  1HKK A;  1BL4 A;  4U86 A;  2M08 A;  3WL0 A;  3B8S A;  1TCO C;  2MF9 A;  3WD3 A;  2WM0 A;  2ZR5 A;  3ARS A;  1N1A A;  1E15 A;  2MLX A;  4Z2L A;  1Q6H A;  2KI3 A;  2YBU A;  4LAW A;  3O5R A;  1LG1 A;  2LPV A;  1LJY A;  2LJ4 A;  3EY6 A;  4JFI A;  1F40 A;  3B9D A;  4DRN A;  1LG2 A;  2RQS A;  4QZV B;  4Q7N A;  3PR9 A;  4HBO A;  3UI6 A;  5HBF A;  1U79 A;  5GQB A;  4S3K A;  1W26 A;  2PV1 A;  1OWQ A;  3H9R B;  2PV2 A;  3KAI A;  2D9F A;  3ODK A;  4LGX A;  1W1T A;  4MNL A;  2F21 A;  1KT0 A;  4DZ2 A;  3NTP A;  1RD6 A;  3ARZ A;  4U84 A;  1FKL A;  3KZ7 A;  1XRV A;  3PA7 A;  1ZBC A;  4DRP A;  4MPK A;  4DRO A;  3B9E A;  4QIB A;  3O5L A;  1FFR A;  4LAX A;  1H0I A;  3JYM A;  1SR0 A;  3IKD A;  2PPP A;  2M2A A;  2XPB A;  5HW6 A;  2VN1 A;  1FKJ A;  1HKJ A;  1KFW A;  3WD1 A;  5DIT A;  4JFL A;  1HKM A;  2OFN A;  2RSE A;  3CHE A;  1A7X A;  2Q5A A;  4Q22 A;  3O5D A;  1ZB5 A;  1X6L A;  2MPH A;  3ARV A;  2PPN A;  4WKH A;  2XP4 A;  1HJX A;  4ODR A;  3FXY A;  3UQB A;  1K9T A;  1TFV A;  2O92 A;  3FAP A;  4GGQ A;  3UI5 A;  2DT1 A;  1FD9 A;  5DIV A;  1EDQ A;  3O5O A;  4S3J A;  4HBE A;  5DIU A;  2DT0 A;  3IKG A;  3W4R A;  3O5I A;  2KE0 A;  5D75 A;  1HJV A;  1Q1C A;  4Z2J A;  1O6I A;  4U85 A;  2DG4 A;  1WAW A;  3I6C A;  4ODO A;  5I98 A;  1NWU A;  1UR9 A;  1JNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...