2M1IA

High resolution structure and dynamics of cspina parvulin at physiological temperature
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvulin-like peptidyl-prolyl isomerase
publication title High resolution structure and dynamics of CsPinA parvulin at physiological temperature
rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
total genus 29
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2m1iA00
2KI3A 2ZQUA 4QT3A 2KE0A 3O5PA 3O5FA 4U86A 1TCOC 1W26A 4W9OA 1Y0OA 4IQCA 2IF4A 3KZ7A 3O5EA 1FKIA 1B6CA 1ROUA 1YW5A 5HWBA 4FN2A 4JFMA 4N19A 1M5YA 1NMVA 3O5MA 4JYSA 4TW6A 3KADA 2AWGA 1HXVA 3KAHA 1QPFA 3TCZA 1QZ2A 1JNSA 2XP9A 2KFWA 3O5OA 2DG9A 5I98A 2ZQSA 3KACA 1FJDA 2KO7A 2MPHA 2RUDA 1FKHA 4BF8A 3RFWA 1C9HA 3UI5A 2XP7A 1FD9A 2F4EA 2MNTA 2LJ4A 5HW8A 2M08A 4JFKA 1A7XA 3FAPA 2LPVA 3KAIA 2KGJA 4U84A 4ODKA 3WH0A 3KAGA 4QIBA 1FKJA 3PA7A 3GPKA 3IHZA 2Q5AA 1ZCNA 4FAPA 2M1IA 4ODQA 1P5QA 4JFIA 1FKBA 5DIUA 2OFNA 1D7HA 4O2TA 2FKEA 4C02B 3OOBA 5HUAA 2F2DA 2PBCA 3I6CA 1D7IA 4R0XA 3UI6A 4DRQA 3O5RA 3UQIA 3IKDA 4DZ2A 2FAPA 3CGNA 4ODRA 5HTGA 4G2PA 4MGVA 4JFJA 3RGCA 2L2SA 1F8AB 1FKFA 5B8IC 2PV1A 1JVWA 2UZ5A 3JXVA 3UF8A 1J6YA 2ZQVA 1L1PA 3NI6A 5J6EA 4LAVA 4DZ3A 4DRHA 1FKDA 4J4NA 3UQBA 5HWCA 1ROTA 3O5IA 1N1AA 2DG4A 1T11A 3O5JA 2VN1A 3O5LA 2ITKA 1FAPA 1JNTA 4IQ2A 2K8IA 3O5QA 4J4OA 4LAWA 4ITZA 4NNRA 1J4IA 2PV3A 5HKGA 1BKFA 3TDBA 2XP3A 2PV2A 4DRPA 3O5KA 5HT1A 2Y78A 2ZR4A 3TC5A 4DH0A 1PBKA 1FKLA 2MLZA 4DRNA 2LGOA 3VAWA 4DIPA 3CGMA 2ZR6A 3H9RB 2PPOA 1Q1CA 1Q6UA 3PRBA 3KAFA 4IPXA 4MSPA 3ODKA 4TX0A 4DRIA 4DT4A 1U79A 2ZQTA 2MLXA 1Q6IA 4U85A 3JYMA 4LAYA 1R9HA 1D6OA 2ZR5A 1J4RA 2MLYA 3UI4A 2JZVA 5D75A 4DRMA 3B7XA 4W9PA 1KT0A 2XP6A 4ODPA 1NSGA 4G50A 3JYJA 4ODOA 5DIVA 1EYMA 5GPGA 4DROA 1KT1A 2RUCA 4GGQA 4TYOA 2PPNA 3UQAA 1F40A 1FKKA 1QPLA 4DRJA 5HW6A 2XPAA 1NMWA 1ZK6A 2N87A 1FKRA 3O5DA 2LKNA 2KR7A 3KCEA 4TW8A 2RQSA 2RURA 4LAXA 2MF9A 2RSEA 1Q6HA 1J4HA 1FKTA 4QT2A 3NTPA 4TW7A 5DITA 2VCDA 5HW7A 2M2AA 1PINA 3NRKA 1YATA 2PPPA 4TNSA 1FKGA 4GIVA 2XPBA 3IK8A 3IKGA 1FKSA 2XP8A 3PRDA 4ODNA 3KABA 3O5GA 1BL4A 4ODMA 1D7JA 2XP4A 3MDYB 3LUOA 4JFLA 2F21A 2RUQA 4DRKA 5BXJA 4ODLA 4W9QA 2D9FA 1EQ3A 2XP5A 3EY6A 2DG3A
chains in the Genus database with same CATH superfamily
1FFQA 1W26A 4ZS6A 3FY1A 1FKIA 4WJXA 1ROUA 5HWBA 4FN2A 1M5YA 1XHGA 2XP9A 3O5OA 2ETNA 3QOKA 4P8VA 1FJDA 2MPHA 1FKHA 3UI5A 3B9EA 2F4EA 5HW8A 1A7XA 3FAPA 2LPVA 4ODKA 2WM0A 3PA7A 2A3EA 3GPKA 3ARYA 4JFIA 1X6LA 5DIUA 2F2DA 4MNKA 4DRQA 3O5RA 3WIJA 3CGNA 2L2SA 3RM9A 5B8IC 1J6YA 5GQBA 1L1PA 5J6EA 4LAVA 4DRHA 4J4NA 3RM8A 3O5QA 1W1PA 1EQ3A 1J4IA 3AS1A 1NWSA 2O92A 2XP3A 4DRPA 3GTYX 2Y78A 1E44A 4DH0A 3CGMA 2ZR6A 3AQUA 1Q6UA 4DRIA 1WNOA 2ZQTA 3G6LA 1Q6IA 1D6OA 4MNJA 1J4RA 2MLYA 3CZ8A 3UI4A 5D75A 3B7XA 2DT2A 4ZPVR 1NSGA 1HKJA 3FXYA 1KT1A 1F40A 4MAVA 2IUZA 1J4HA 1FKTA 4ZPWR 5DITA 1ZBCA 2EULA 3ARWA 2DSZA 2O9OA 1ZL1A 1W1TA 1LQ0A 2XPBA 4ZPTR 1X6NA 2XP8A 3PRAA 4ODNA 3KABA 4HBEA 4DRKA 4ODLA 2D9FA 3UF8A 4IT4A 1GUVA 1E6NA 2ZQUA 3O5FA 5DO2A 4IQCA 2IF4A 3KZ7A 3O5EA 3ARQA 4JYSA 4TW6A 3KADA 2AWGA 2WLZA 1QPFA 1QZ2A 2YBTA 3BMBA 3PR9A 1W9UA 1W1VA 3ARZA 2KO7A 4BF8A 2AOSA 2G8ZA 1GPFA 1C9HA 4KQZA 3WL0A 1FD9A 4QZVB 1UR9A 1CTNA 5DEZA 1E15A 4JFKA 1W9VA 3BXWA 3KAIA 3WQWA 2Q5AA 4LGXA 1HKMA 3ARPA 4ODQA 1P5QA 2OFNA 3ALGA 4O2TA 2WLYA 3CHCA 3OOBA 5HUAA 3G6MA 3I6CA 4R0XA 3UQIA 2FAPA 4Z2LA 4G2PA 4MGVA 5HTGA 4JFJA 1E6PA 1FKFA 3WD2A 2DSWA 2YBUA 3B9DA 3NI6A 4MTVA 1W9PA 5HWCA 1EHNA 3O5IA 2DG4A 3O5JA 3O5LA 4Z2GA 3CH9A 4NNRA 2PV3A 1JNEA 1HKKA 4DWSC 2PV2A 3O5KA 1HJXA 1UR8A 1VF8A 1FKLA 4MNMA 4DIPA 1LG1A 2PPOA 3AS2A 3PRBA 4DT4A 4IPXA 4TX0A 3ODKA 2ZR5A 1XRVA 1NH6A 4W9PA 2XP6A 1ZB5A 2PN0A 5GPGA 4GGQA 2RUCA 3WD1A 3O5DA 2B31A 2KR7A 4TW8A 2RSEA 2P4VA 3NTPA 2VCDA 5HW7A 3NRKA 3WD3A 1YATA 2DT0A 2G41A 1E6ZA 3RM4A 1BL4A 4ODMA 2XP4A 4ML4A 2FDMA 1E6RA 4UDMA 1NWRA 2XP5A 1LL7A 2KI3A 3WD4A 3WL1A 1WAWA 2KE0A 4U86A 1TCOC 4L72B 1Y0OA 1LJYA 4HBOA 1NMVA 3AS3A 2ESCA 3KAHA 1NWUA 1JNSA 2A3AA 1ZU8A 2DG9A 2ZQSA 3KACA 4WK9A 3WKZA 5JH8A 3RFWA 1TFVA 1KFWA 1HKIA 2F23A 3W4RA 2LJ4A 4AY1A 4WKHA 3AROA 4DWSD 2KGJA 4U84A 3WH0A 4DWSA 4QIBA 3OA5A 4P8UA 1ZCNA 1LL4A 4Z2IA 2M1IA 3CHFA 1NWTA 4C02B 2PBCA 1D7IA 4ODRA 2PV1A 1JVWA 3B9AA 3JXVA 1ITXA 2ZQVA 3ARRA 4DZ3A 1FKDA 1D2KA 3UQBA 3ARVA 1ROTA 1N1AA 1T11A 1FAPA 1JNTA 1ZBVA 5HKGA 4Z2KA 3TDBA 1OGGA 4DRNA 2LGOA 3VAWA 3H9RB 3KAFA 5GPRA 4LAYA 1R9HA 4P8WA 2B5UB 3ARSA 3ARTA 1KT0A 1SR0A 4G50A 3JYJA 4ODOA 1EYMA 4DROA 1FFRA 4TYOA 3UQAA 3RMEA 1FKKA 1QPLA 5HW6A 1W1YA 2XPAA 4S3KA 2A3CA 1SYTA 4WIWA 4XAKA 3ALFA 3KCEA 1Q6HA 2DSUA 2M2AA 1PINA 2DT1A 2PPPA 1FKGA 4GIVA 3IK8A 3IKGA 1FKSA 3PRDA 4WKAA 1E9LA 1ZBKA 3MDYB 4MPKA 4W5UA 4JFLA 4HARA 3GU0A 5BXJA 4W9QA 3EIPA 3EY6A 4QT3A 3O5PA 3ARUA 3CHEA 4W9OA 1H0IA 1OGBA 1B6CA 1GOIA 1YW5A 4JFMA 4N19A 5DF0A 3O5MA 1HXVA 3TCZA 1OWQA 2KFWA 4Q7NA 5I98A 3AS0A 1H0GA 1ZBWA 2RUDA 4R5EA 1EDQA 2XP7A 1EIBA 1LL6A 2MNTA 1HJWA 4NSBA 2M08A 2DT3A 1RD6A 1O6IA 3KAGA 1FKJA 5HBFA 1GRJA 4Z2HA 3IHZA 4FAPA 1FKBA 1D7HA 1HJVA 2FKEA 1K9TA 4WKFA 3UI6A 3WD0A 2PI6A 3IKDA 4DZ2A 2A3BA 3WQVA 2DPEA 3RGCA 1F8AB 2UZ5A 1WB0A 4Q22A 4MNLA 2VN1A 2ITKA 4IQ2A 2K8IA 4J4OA 2QF8A 4LAWA 4ITZA 3CHDA 1BKFA 4P8XA 5HT1A 2ZR4A 3TC5A 1PBKA 2MLZA 4URIA 1Q1CA 4MSPA 1U79A 2MLXA 4U85A 3JYMA 3B8SA 4Z2JA 2JZVA 4DWSB 4DRMA 1LG2A 4ODPA 4KR0B 1JCHB 4NZCA 5DIVA 4DRJA 1NMWA 1ZK6A 2N87A 1FKRA 2LKNA 2RQSA 2OLHA 2RURA 4LAXA 1JNDA 2MF9A 4QT2A 2WK2A 4TW7A 4TNSA 3O5GA 1D7JA 4IT6A 3LUOA 1IX5A 2F21A 2RUQA 4S3JA 4PTMA 4L3NA 3ARXA 2PPNA 2DSVA 2DG3A
chains in the Genus database with same CATH topology
1FFQA 1W26A 4ZS6A 3FY1A 1FKIA 4WJXA 1ROUA 5HWBA 4FN2A 1M5YA 1XHGA 2XP9A 3O5OA 3QOKA 4P8VA 1FJDA 2MPHA 1FKHA 3UI5A 3B9EA 2F4EA 5HW8A 1A7XA 3FAPA 2LPVA 4ODKA 2WM0A 3PA7A 2A3EA 3GPKA 3ARYA 4JFIA 1X6LA 5DIUA 2F2DA 4MNKA 4DRQA 3O5RA 3WIJA 3CGNA 2L2SA 3RM9A 5B8IC 1J6YA 5GQBA 1L1PA 5J6EA 4LAVA 4DRHA 4J4NA 3RM8A 3O5QA 1W1PA 1EQ3A 1J4IA 3AS1A 1NWSA 2O92A 2XP3A 4DRPA 2Y78A 4DH0A 3CGMA 2ZR6A 3AQUA 1Q6UA 4DRIA 1WNOA 2ZQTA 3G6LA 1Q6IA 1D6OA 4MNJA 1J4RA 2MLYA 3CZ8A 3UI4A 5D75A 3B7XA 2DT2A 4ZPVR 1NSGA 1HKJA 3FXYA 1KT1A 1F40A 4MAVA 2IUZA 1J4HA 1FKTA 4ZPWR 5DITA 1ZBCA 3ARWA 2DSZA 2O9OA 1ZL1A 1W1TA 1LQ0A 2XPBA 4ZPTR 1X6NA 2XP8A 3PRAA 4ODNA 3KABA 4HBEA 4DRKA 4ODLA 2D9FA 3UF8A 4IT4A 1E6NA 1GUVA 2ZQUA 3O5FA 5DO2A 4IQCA 2IF4A 3KZ7A 3O5EA 3ARQA 4JYSA 4TW6A 3KADA 2AWGA 2WLZA 1QPFA 1QZ2A 2YBTA 3PR9A 1W9UA 1W1VA 3ARZA 2KO7A 4BF8A 2AOSA 2G8ZA 1GPFA 1C9HA 4KQZA 3WL0A 1FD9A 4QZVB 1UR9A 1CTNA 5DEZA 1E15A 4JFKA 1W9VA 3BXWA 3KAIA 3WQWA 2Q5AA 4LGXA 1HKMA 3ARPA 4ODQA 1P5QA 2OFNA 3ALGA 4O2TA 2WLYA 3CHCA 3OOBA 5HUAA 3G6MA 3I6CA 4R0XA 3UQIA 2FAPA 4Z2LA 4G2PA 4MGVA 5HTGA 4JFJA 1E6PA 1FKFA 3WD2A 2DSWA 2YBUA 3B9DA 3NI6A 4MTVA 1W9PA 5HWCA 1EHNA 3O5IA 2DG4A 3O5JA 3O5LA 4Z2GA 3CH9A 4NNRA 2PV3A 1JNEA 1HKKA 4DWSC 2PV2A 3O5KA 1HJXA 1UR8A 1VF8A 1FKLA 4MNMA 4DIPA 1LG1A 2PPOA 3AS2A 3PRBA 4DT4A 4IPXA 4TX0A 3ODKA 2ZR5A 1XRVA 1NH6A 4W9PA 2XP6A 1ZB5A 5GPGA 4GGQA 2RUCA 3WD1A 3O5DA 2B31A 2KR7A 4TW8A 2RSEA 3NTPA 2VCDA 5HW7A 3NRKA 3WD3A 1YATA 2DT0A 2G41A 1E6ZA 3RM4A 1BL4A 4ODMA 2XP4A 4ML4A 2FDMA 1E6RA 1NWRA 2XP5A 1LL7A 2KI3A 3WD4A 3WL1A 1WAWA 2KE0A 4U86A 1TCOC 4L72B 1Y0OA 1LJYA 4HBOA 1NMVA 3AS3A 2ESCA 3KAHA 1NWUA 1JNSA 2A3AA 1ZU8A 2DG9A 2ZQSA 3KACA 4WK9A 3WKZA 5JH8A 3RFWA 1TFVA 1KFWA 1HKIA 3W4RA 2LJ4A 4AY1A 4WKHA 3AROA 4DWSD 2KGJA 4U84A 3WH0A 4DWSA 4QIBA 3OA5A 4P8UA 1ZCNA 1LL4A 4Z2IA 2M1IA 3CHFA 1NWTA 4C02B 2PBCA 1D7IA 4ODRA 2PV1A 1JVWA 3B9AA 3JXVA 1ITXA 2ZQVA 3ARRA 4DZ3A 1FKDA 1D2KA 3UQBA 3ARVA 1ROTA 1N1AA 1T11A 1FAPA 1JNTA 1ZBVA 5HKGA 4Z2KA 3TDBA 1OGGA 4DRNA 2LGOA 3VAWA 3H9RB 3KAFA 5GPRA 4LAYA 1R9HA 4P8WA 3ARSA 3ARTA 1KT0A 1SR0A 4G50A 3JYJA 4ODOA 1EYMA 4DROA 1FFRA 4TYOA 3UQAA 3RMEA 1FKKA 1QPLA 5HW6A 1W1YA 2XPAA 4S3KA 2A3CA 1SYTA 4WIWA 4XAKA 3ALFA 3KCEA 1Q6HA 2DSUA 2M2AA 1PINA 2DT1A 2PPPA 1FKGA 4GIVA 3IK8A 3IKGA 1FKSA 3PRDA 4WKAA 1E9LA 1ZBKA 3MDYB 4MPKA 4W5UA 4JFLA 4HARA 5BXJA 4W9QA 3EY6A 4QT3A 3O5PA 3ARUA 3CHEA 4W9OA 1H0IA 1OGBA 1B6CA 1GOIA 1YW5A 4JFMA 4N19A 5DF0A 3O5MA 1HXVA 3TCZA 1OWQA 2KFWA 4Q7NA 5I98A 3AS0A 1H0GA 1ZBWA 2RUDA 4R5EA 1EDQA 2XP7A 1EIBA 1LL6A 2MNTA 1HJWA 4NSBA 2M08A 2DT3A 1RD6A 1O6IA 3KAGA 1FKJA 5HBFA 4Z2HA 3IHZA 4FAPA 1FKBA 1D7HA 1HJVA 2FKEA 1K9TA 4WKFA 3UI6A 3WD0A 2PI6A 3IKDA 4DZ2A 2A3BA 3WQVA 2DPEA 3RGCA 1F8AB 2UZ5A 1WB0A 4Q22A 4MNLA 2VN1A 2ITKA 4IQ2A 2K8IA 4J4OA 2QF8A 4LAWA 4ITZA 3CHDA 1BKFA 4P8XA 5HT1A 2ZR4A 3TC5A 1PBKA 2MLZA 4URIA 1Q1CA 4MSPA 1U79A 2MLXA 4U85A 3JYMA 3B8SA 4Z2JA 2JZVA 4DWSB 4DRMA 1LG2A 4ODPA 4KR0B 4NZCA 5DIVA 4DRJA 1NMWA 1ZK6A 2N87A 1FKRA 2LKNA 2RQSA 2OLHA 2RURA 4LAXA 1JNDA 2MF9A 4QT2A 2WK2A 4TW7A 4TNSA 3O5GA 1D7JA 4IT6A 3LUOA 1IX5A 2F21A 2RUQA 4S3JA 4PTMA 4L3NA 3ARXA 2PPNA 2DSVA 2DG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI3 A;  2ZQU A;  4QT3 A;  2KE0 A;  3O5P A;  3O5F A;  4U86 A;  1TCO C;  1W26 A;  4W9O A;  1Y0O A;  4IQC A;  2IF4 A;  3KZ7 A;  3O5E A;  1FKI A;  1B6C A;  1ROU A;  1YW5 A;  5HWB A;  4FN2 A;  4JFM A;  4N19 A;  1M5Y A;  1NMV A;  3O5M A;  4JYS A;  4TW6 A;  3KAD A;  2AWG A;  1HXV A;  3KAH A;  1QPF A;  3TCZ A;  1QZ2 A;  1JNS A;  2XP9 A;  2KFW A;  3O5O A;  2DG9 A;  5I98 A;  2ZQS A;  3KAC A;  1FJD A;  2KO7 A;  2MPH A;  2RUD A;  1FKH A;  4BF8 A;  3RFW A;  1C9H A;  3UI5 A;  2XP7 A;  1FD9 A;  2F4E A;  2MNT A;  2LJ4 A;  5HW8 A;  2M08 A;  4JFK A;  1A7X A;  3FAP A;  2LPV A;  3KAI A;  2KGJ A;  4U84 A;  4ODK A;  3WH0 A;  3KAG A;  4QIB A;  1FKJ A;  3PA7 A;  3GPK A;  3IHZ A;  2Q5A A;  1ZCN A;  4FAP A;  2M1I A;  4ODQ A;  1P5Q A;  4JFI A;  1FKB A;  5DIU A;  2OFN A;  1D7H A;  4O2T A;  2FKE A;  4C02 B;  3OOB A;  5HUA A;  2F2D A;  2PBC A;  3I6C A;  1D7I A;  4R0X A;  3UI6 A;  4DRQ A;  3O5R A;  3UQI A;  3IKD A;  4DZ2 A;  2FAP A;  3CGN A;  4ODR A;  5HTG A;  4G2P A;  4MGV A;  4JFJ A;  3RGC A;  2L2S A;  1F8A B;  1FKF A;  5B8I C;  2PV1 A;  1JVW A;  2UZ5 A;  3JXV A;  3UF8 A;  1J6Y A;  2ZQV A;  1L1P A;  3NI6 A;  5J6E A;  4LAV A;  4DZ3 A;  4DRH A;  1FKD A;  4J4N A;  3UQB A;  5HWC A;  1ROT A;  3O5I A;  1N1A A;  2DG4 A;  1T11 A;  3O5J A;  2VN1 A;  3O5L A;  2ITK A;  1FAP A;  1JNT A;  4IQ2 A;  2K8I A;  3O5Q A;  4J4O A;  4LAW A;  4ITZ A;  4NNR A;  1J4I A;  2PV3 A;  5HKG A;  1BKF A;  3TDB A;  2XP3 A;  2PV2 A;  4DRP A;  3O5K A;  5HT1 A;  2Y78 A;  2ZR4 A;  3TC5 A;  4DH0 A;  1PBK A;  1FKL A;  2MLZ A;  4DRN A;  2LGO A;  3VAW A;  4DIP A;  3CGM A;  2ZR6 A;  3H9R B;  2PPO A;  1Q1C A;  1Q6U A;  3PRB A;  3KAF A;  4IPX A;  4MSP A;  3ODK A;  4TX0 A;  4DRI A;  4DT4 A;  1U79 A;  2ZQT A;  2MLX A;  1Q6I A;  4U85 A;  3JYM A;  4LAY A;  1R9H A;  1D6O A;  2ZR5 A;  1J4R A;  2MLY A;  3UI4 A;  2JZV A;  5D75 A;  4DRM A;  3B7X A;  4W9P A;  1KT0 A;  2XP6 A;  4ODP A;  1NSG A;  4G50 A;  3JYJ A;  4ODO A;  5DIV A;  1EYM A;  5GPG A;  4DRO A;  1KT1 A;  2RUC A;  4GGQ A;  4TYO A;  2PPN A;  3UQA A;  1F40 A;  1FKK A;  1QPL A;  4DRJ A;  5HW6 A;  2XPA A;  1NMW A;  1ZK6 A;  2N87 A;  1FKR A;  3O5D A;  2LKN A;  2KR7 A;  3KCE A;  4TW8 A;  2RQS A;  2RUR A;  4LAX A;  2MF9 A;  2RSE A;  1Q6H A;  1J4H A;  1FKT A;  4QT2 A;  3NTP A;  4TW7 A;  5DIT A;  2VCD A;  5HW7 A;  2M2A A;  1PIN A;  3NRK A;  1YAT A;  2PPP A;  4TNS A;  1FKG A;  4GIV A;  2XPB A;  3IK8 A;  3IKG A;  1FKS A;  2XP8 A;  3PRD A;  4ODN A;  3KAB A;  3O5G A;  1BL4 A;  4ODM A;  1D7J A;  2XP4 A;  3MDY B;  3LUO A;  4JFL A;  2F21 A;  2RUQ A;  4DRK A;  5BXJ A;  4ODL A;  4W9Q A;  2D9F A;  1EQ3 A;  2XP5 A;  3EY6 A;  2DG3 A; 
#chains in the Genus database with same CATH topology
 1FFQ A;  1W26 A;  4ZS6 A;  3FY1 A;  1FKI A;  4WJX A;  1ROU A;  5HWB A;  4FN2 A;  1M5Y A;  1XHG A;  2XP9 A;  3O5O A;  2ETN A;  3QOK A;  4P8V A;  1FJD A;  2MPH A;  1FKH A;  3UI5 A;  3B9E A;  2F4E A;  5HW8 A;  1A7X A;  3FAP A;  2LPV A;  4ODK A;  2WM0 A;  3PA7 A;  2A3E A;  3GPK A;  3ARY A;  4JFI A;  1X6L A;  5DIU A;  2F2D A;  4MNK A;  4DRQ A;  3O5R A;  3WIJ A;  3CGN A;  2L2S A;  3RM9 A;  5B8I C;  1J6Y A;  5GQB A;  1L1P A;  5J6E A;  4LAV A;  4DRH A;  4J4N A;  3RM8 A;  3O5Q A;  1W1P A;  1EQ3 A;  1J4I A;  3AS1 A;  1NWS A;  2O92 A;  2XP3 A;  4DRP A;  3GTY X;  2Y78 A;  1E44 A;  4DH0 A;  3CGM A;  2ZR6 A;  3AQU A;  1Q6U A;  4DRI A;  1WNO A;  2ZQT A;  3G6L A;  1Q6I A;  1D6O A;  4MNJ A;  1J4R A;  2MLY A;  3CZ8 A;  3UI4 A;  5D75 A;  3B7X A;  2DT2 A;  4ZPV R;  1NSG A;  1HKJ A;  3FXY A;  1KT1 A;  1F40 A;  4MAV A;  2IUZ A;  1J4H A;  1FKT A;  4ZPW R;  5DIT A;  1ZBC A;  2EUL A;  3ARW A;  2DSZ A;  2O9O A;  1ZL1 A;  1W1T A;  1LQ0 A;  2XPB A;  4ZPT R;  1X6N A;  2XP8 A;  3PRA A;  4ODN A;  3KAB A;  4HBE A;  4DRK A;  4ODL A;  2D9F A;  3UF8 A;  4IT4 A;  1GUV A;  1E6N A;  2ZQU A;  3O5F A;  5DO2 A;  4IQC A;  2IF4 A;  3KZ7 A;  3O5E A;  3ARQ A;  4JYS A;  4TW6 A;  3KAD A;  2AWG A;  2WLZ A;  1QPF A;  1QZ2 A;  2YBT A;  3BMB A;  3PR9 A;  1W9U A;  1W1V A;  3ARZ A;  2KO7 A;  4BF8 A;  2AOS A;  2G8Z A;  1GPF A;  1C9H A;  4KQZ A;  3WL0 A;  1FD9 A;  4QZV B;  1UR9 A;  1CTN A;  5DEZ A;  1E15 A;  4JFK A;  1W9V A;  3BXW A;  3KAI A;  3WQW A;  2Q5A A;  4LGX A;  1HKM A;  3ARP A;  4ODQ A;  1P5Q A;  2OFN A;  3ALG A;  4O2T A;  2WLY A;  3CHC A;  3OOB A;  5HUA A;  3G6M A;  3I6C A;  4R0X A;  3UQI A;  2FAP A;  4Z2L A;  4G2P A;  4MGV A;  5HTG A;  4JFJ A;  1E6P A;  1FKF A;  3WD2 A;  2DSW A;  2YBU A;  3B9D A;  3NI6 A;  4MTV A;  1W9P A;  5HWC A;  1EHN A;  3O5I A;  2DG4 A;  3O5J A;  3O5L A;  4Z2G A;  3CH9 A;  4NNR A;  2PV3 A;  1JNE A;  1HKK A;  4DWS C;  2PV2 A;  3O5K A;  1HJX A;  1UR8 A;  1VF8 A;  1FKL A;  4MNM A;  4DIP A;  1LG1 A;  2PPO A;  3AS2 A;  3PRB A;  4DT4 A;  4IPX A;  4TX0 A;  3ODK A;  2ZR5 A;  1XRV A;  1NH6 A;  4W9P A;  2XP6 A;  1ZB5 A;  2PN0 A;  5GPG A;  4GGQ A;  2RUC A;  3WD1 A;  3O5D A;  2B31 A;  2KR7 A;  4TW8 A;  2RSE A;  2P4V A;  3NTP A;  2VCD A;  5HW7 A;  3NRK A;  3WD3 A;  1YAT A;  2DT0 A;  2G41 A;  1E6Z A;  3RM4 A;  1BL4 A;  4ODM A;  2XP4 A;  4ML4 A;  2FDM A;  1E6R A;  4UDM A;  1NWR A;  2XP5 A;  1LL7 A;  2KI3 A;  3WD4 A;  3WL1 A;  1WAW A;  2KE0 A;  4U86 A;  1TCO C;  4L72 B;  1Y0O A;  1LJY A;  4HBO A;  1NMV A;  3AS3 A;  2ESC A;  3KAH A;  1NWU A;  1JNS A;  2A3A A;  1ZU8 A;  2DG9 A;  2ZQS A;  3KAC A;  4WK9 A;  3WKZ A;  5JH8 A;  3RFW A;  1TFV A;  1KFW A;  1HKI A;  2F23 A;  3W4R A;  2LJ4 A;  4AY1 A;  4WKH A;  3ARO A;  4DWS D;  2KGJ A;  4U84 A;  3WH0 A;  4DWS A;  4QIB A;  3OA5 A;  4P8U A;  1ZCN A;  1LL4 A;  4Z2I A;  2M1I A;  3CHF A;  1NWT A;  4C02 B;  2PBC A;  1D7I A;  4ODR A;  2PV1 A;  1JVW A;  3B9A A;  3JXV A;  1ITX A;  2ZQV A;  3ARR A;  4DZ3 A;  1FKD A;  1D2K A;  3UQB A;  3ARV A;  1ROT A;  1N1A A;  1T11 A;  1FAP A;  1JNT A;  1ZBV A;  5HKG A;  4Z2K A;  3TDB A;  1OGG A;  4DRN A;  2LGO A;  3VAW A;  3H9R B;  3KAF A;  5GPR A;  4LAY A;  1R9H A;  4P8W A;  2B5U B;  3ARS A;  3ART A;  1KT0 A;  1SR0 A;  4G50 A;  3JYJ A;  4ODO A;  1EYM A;  4DRO A;  1FFR A;  4TYO A;  3UQA A;  3RME A;  1FKK A;  1QPL A;  5HW6 A;  1W1Y A;  2XPA A;  4S3K A;  2A3C A;  1SYT A;  4WIW A;  4XAK A;  3ALF A;  3KCE A;  1Q6H A;  2DSU A;  2M2A A;  1PIN A;  2DT1 A;  2PPP A;  1FKG A;  4GIV A;  3IK8 A;  3IKG A;  1FKS A;  3PRD A;  4WKA A;  1E9L A;  1ZBK A;  3MDY B;  4MPK A;  4W5U A;  4JFL A;  4HAR A;  3GU0 A;  5BXJ A;  4W9Q A;  3EIP A;  3EY6 A;  4QT3 A;  3O5P A;  3ARU A;  3CHE A;  4W9O A;  1H0I A;  1OGB A;  1B6C A;  1GOI A;  1YW5 A;  4JFM A;  4N19 A;  5DF0 A;  3O5M A;  1HXV A;  3TCZ A;  1OWQ A;  2KFW A;  4Q7N A;  5I98 A;  3AS0 A;  1H0G A;  1ZBW A;  2RUD A;  4R5E A;  1EDQ A;  2XP7 A;  1EIB A;  1LL6 A;  2MNT A;  1HJW A;  4NSB A;  2M08 A;  2DT3 A;  1RD6 A;  1O6I A;  3KAG A;  1FKJ A;  5HBF A;  1GRJ A;  4Z2H A;  3IHZ A;  4FAP A;  1FKB A;  1D7H A;  1HJV A;  2FKE A;  1K9T A;  4WKF A;  3UI6 A;  3WD0 A;  2PI6 A;  3IKD A;  4DZ2 A;  2A3B A;  3WQV A;  2DPE A;  3RGC A;  1F8A B;  2UZ5 A;  1WB0 A;  4Q22 A;  4MNL A;  2VN1 A;  2ITK A;  4IQ2 A;  2K8I A;  4J4O A;  2QF8 A;  4LAW A;  4ITZ A;  3CHD A;  1BKF A;  4P8X A;  5HT1 A;  2ZR4 A;  3TC5 A;  1PBK A;  2MLZ A;  4URI A;  1Q1C A;  4MSP A;  1U79 A;  2MLX A;  4U85 A;  3JYM A;  3B8S A;  4Z2J A;  2JZV A;  4DWS B;  4DRM A;  1LG2 A;  4ODP A;  4KR0 B;  1JCH B;  4NZC A;  5DIV A;  4DRJ A;  1NMW A;  1ZK6 A;  2N87 A;  1FKR A;  2LKN A;  2RQS A;  2OLH A;  2RUR A;  4LAX A;  1JND A;  2MF9 A;  4QT2 A;  2WK2 A;  4TW7 A;  4TNS A;  3O5G A;  1D7J A;  4IT6 A;  3LUO A;  1IX5 A;  2F21 A;  2RUQ A;  4S3J A;  4PTM A;  4L3N A;  3ARX A;  2PPN A;  2DSV A;  2DG3 A; 
#chains in the Genus database with same CATH homology
 1FFQ A;  1W26 A;  4ZS6 A;  3FY1 A;  1FKI A;  4WJX A;  1ROU A;  5HWB A;  4FN2 A;  1M5Y A;  1XHG A;  2XP9 A;  3O5O A;  3QOK A;  4P8V A;  1FJD A;  2MPH A;  1FKH A;  3UI5 A;  3B9E A;  2F4E A;  5HW8 A;  1A7X A;  3FAP A;  2LPV A;  4ODK A;  2WM0 A;  3PA7 A;  2A3E A;  3GPK A;  3ARY A;  4JFI A;  1X6L A;  5DIU A;  2F2D A;  4MNK A;  4DRQ A;  3O5R A;  3WIJ A;  3CGN A;  2L2S A;  3RM9 A;  5B8I C;  1J6Y A;  5GQB A;  1L1P A;  5J6E A;  4LAV A;  4DRH A;  4J4N A;  3RM8 A;  3O5Q A;  1W1P A;  1EQ3 A;  1J4I A;  3AS1 A;  1NWS A;  2O92 A;  2XP3 A;  4DRP A;  2Y78 A;  4DH0 A;  3CGM A;  2ZR6 A;  3AQU A;  1Q6U A;  4DRI A;  1WNO A;  2ZQT A;  3G6L A;  1Q6I A;  1D6O A;  4MNJ A;  1J4R A;  2MLY A;  3CZ8 A;  3UI4 A;  5D75 A;  3B7X A;  2DT2 A;  4ZPV R;  1NSG A;  1HKJ A;  3FXY A;  1KT1 A;  1F40 A;  4MAV A;  2IUZ A;  1J4H A;  1FKT A;  4ZPW R;  5DIT A;  1ZBC A;  3ARW A;  2DSZ A;  2O9O A;  1ZL1 A;  1W1T A;  1LQ0 A;  2XPB A;  4ZPT R;  1X6N A;  2XP8 A;  3PRA A;  4ODN A;  3KAB A;  4HBE A;  4DRK A;  4ODL A;  2D9F A;  3UF8 A;  4IT4 A;  1E6N A;  1GUV A;  2ZQU A;  3O5F A;  5DO2 A;  4IQC A;  2IF4 A;  3KZ7 A;  3O5E A;  3ARQ A;  4JYS A;  4TW6 A;  3KAD A;  2AWG A;  2WLZ A;  1QPF A;  1QZ2 A;  2YBT A;  3PR9 A;  1W9U A;  1W1V A;  3ARZ A;  2KO7 A;  4BF8 A;  2AOS A;  2G8Z A;  1GPF A;  1C9H A;  4KQZ A;  3WL0 A;  1FD9 A;  4QZV B;  1UR9 A;  1CTN A;  5DEZ A;  1E15 A;  4JFK A;  1W9V A;  3BXW A;  3KAI A;  3WQW A;  2Q5A A;  4LGX A;  1HKM A;  3ARP A;  4ODQ A;  1P5Q A;  2OFN A;  3ALG A;  4O2T A;  2WLY A;  3CHC A;  3OOB A;  5HUA A;  3G6M A;  3I6C A;  4R0X A;  3UQI A;  2FAP A;  4Z2L A;  4G2P A;  4MGV A;  5HTG A;  4JFJ A;  1E6P A;  1FKF A;  3WD2 A;  2DSW A;  2YBU A;  3B9D A;  3NI6 A;  4MTV A;  1W9P A;  5HWC A;  1EHN A;  3O5I A;  2DG4 A;  3O5J A;  3O5L A;  4Z2G A;  3CH9 A;  4NNR A;  2PV3 A;  1JNE A;  1HKK A;  4DWS C;  2PV2 A;  3O5K A;  1HJX A;  1UR8 A;  1VF8 A;  1FKL A;  4MNM A;  4DIP A;  1LG1 A;  2PPO A;  3AS2 A;  3PRB A;  4DT4 A;  4IPX A;  4TX0 A;  3ODK A;  2ZR5 A;  1XRV A;  1NH6 A;  4W9P A;  2XP6 A;  1ZB5 A;  5GPG A;  4GGQ A;  2RUC A;  3WD1 A;  3O5D A;  2B31 A;  2KR7 A;  4TW8 A;  2RSE A;  3NTP A;  2VCD A;  5HW7 A;  3NRK A;  3WD3 A;  1YAT A;  2DT0 A;  2G41 A;  1E6Z A;  3RM4 A;  1BL4 A;  4ODM A;  2XP4 A;  4ML4 A;  2FDM A;  1E6R A;  1NWR A;  2XP5 A;  1LL7 A;  2KI3 A;  3WD4 A;  3WL1 A;  1WAW A;  2KE0 A;  4U86 A;  1TCO C;  4L72 B;  1Y0O A;  1LJY A;  4HBO A;  1NMV A;  3AS3 A;  2ESC A;  3KAH A;  1NWU A;  1JNS A;  2A3A A;  1ZU8 A;  2DG9 A;  2ZQS A;  3KAC A;  4WK9 A;  3WKZ A;  5JH8 A;  3RFW A;  1TFV A;  1KFW A;  1HKI A;  3W4R A;  2LJ4 A;  4AY1 A;  4WKH A;  3ARO A;  4DWS D;  2KGJ A;  4U84 A;  3WH0 A;  4DWS A;  4QIB A;  3OA5 A;  4P8U A;  1ZCN A;  1LL4 A;  4Z2I A;  2M1I A;  3CHF A;  1NWT A;  4C02 B;  2PBC A;  1D7I A;  4ODR A;  2PV1 A;  1JVW A;  3B9A A;  3JXV A;  1ITX A;  2ZQV A;  3ARR A;  4DZ3 A;  1FKD A;  1D2K A;  3UQB A;  3ARV A;  1ROT A;  1N1A A;  1T11 A;  1FAP A;  1JNT A;  1ZBV A;  5HKG A;  4Z2K A;  3TDB A;  1OGG A;  4DRN A;  2LGO A;  3VAW A;  3H9R B;  3KAF A;  5GPR A;  4LAY A;  1R9H A;  4P8W A;  3ARS A;  3ART A;  1KT0 A;  1SR0 A;  4G50 A;  3JYJ A;  4ODO A;  1EYM A;  4DRO A;  1FFR A;  4TYO A;  3UQA A;  3RME A;  1FKK A;  1QPL A;  5HW6 A;  1W1Y A;  2XPA A;  4S3K A;  2A3C A;  1SYT A;  4WIW A;  4XAK A;  3ALF A;  3KCE A;  1Q6H A;  2DSU A;  2M2A A;  1PIN A;  2DT1 A;  2PPP A;  1FKG A;  4GIV A;  3IK8 A;  3IKG A;  1FKS A;  3PRD A;  4WKA A;  1E9L A;  1ZBK A;  3MDY B;  4MPK A;  4W5U A;  4JFL A;  4HAR A;  5BXJ A;  4W9Q A;  3EY6 A;  4QT3 A;  3O5P A;  3ARU A;  3CHE A;  4W9O A;  1H0I A;  1OGB A;  1B6C A;  1GOI A;  1YW5 A;  4JFM A;  4N19 A;  5DF0 A;  3O5M A;  1HXV A;  3TCZ A;  1OWQ A;  2KFW A;  4Q7N A;  5I98 A;  3AS0 A;  1H0G A;  1ZBW A;  2RUD A;  4R5E A;  1EDQ A;  2XP7 A;  1EIB A;  1LL6 A;  2MNT A;  1HJW A;  4NSB A;  2M08 A;  2DT3 A;  1RD6 A;  1O6I A;  3KAG A;  1FKJ A;  5HBF A;  4Z2H A;  3IHZ A;  4FAP A;  1FKB A;  1D7H A;  1HJV A;  2FKE A;  1K9T A;  4WKF A;  3UI6 A;  3WD0 A;  2PI6 A;  3IKD A;  4DZ2 A;  2A3B A;  3WQV A;  2DPE A;  3RGC A;  1F8A B;  2UZ5 A;  1WB0 A;  4Q22 A;  4MNL A;  2VN1 A;  2ITK A;  4IQ2 A;  2K8I A;  4J4O A;  2QF8 A;  4LAW A;  4ITZ A;  3CHD A;  1BKF A;  4P8X A;  5HT1 A;  2ZR4 A;  3TC5 A;  1PBK A;  2MLZ A;  4URI A;  1Q1C A;  4MSP A;  1U79 A;  2MLX A;  4U85 A;  3JYM A;  3B8S A;  4Z2J A;  2JZV A;  4DWS B;  4DRM A;  1LG2 A;  4ODP A;  4KR0 B;  4NZC A;  5DIV A;  4DRJ A;  1NMW A;  1ZK6 A;  2N87 A;  1FKR A;  2LKN A;  2RQS A;  2OLH A;  2RUR A;  4LAX A;  1JND A;  2MF9 A;  4QT2 A;  2WK2 A;  4TW7 A;  4TNS A;  3O5G A;  1D7J A;  4IT6 A;  3LUO A;  1IX5 A;  2F21 A;  2RUQ A;  4S3J A;  4PTM A;  4L3N A;  3ARX A;  2PPN A;  2DSV A;  2DG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...