2M1IA

High resolution structure and dynamics of cspina parvulin at physiological temperature
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Parvulin-like peptidyl-prolyl isomerase
publication title High resolution structure and dynamics of CsPinA parvulin at physiological temperature
rcsb
source organism Cenarchaeum symbiosum
total genus 29
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2m1iA00
2LKNA 3PRBA 5HT1A 3UI5A 3IKDA 4DRQA 4W9OA 4ODRA 2M08A 5D75A 1D6OA 1D7IA 5HW8A 3IK8A 1BL4A 3MDYB 4GGQA 2XP4A 4IQ2A 4ITZA 1ZCNA 1YW5A 5J6EA 5HKGA 1EQ3A 1L1PA 2PV2A 2LJ4A 3KACA 4J4NA 3KADA 3O5IA 5DIUA 4ODOA 1F40A 4TNSA 1J4IA 1D7JA 1ZK6A 1FD9A 3IKGA 3O5RA 1HXVA 1FKFA 3ODKA 3KAFA 3KCEA 4DRKA 2XP5A 2RUCA 2PV3A 4LAWA 4TW8A 3KZ7A 2MLZA 4JFIA 1BKFA 3H9RB 3IHZA 2MPHA 3UI4A 1ROTA 1FKGA 1ROUA 2KFWA 4LAVA 2RQSA 4DH0A 2PPOA 1FAPA 2VCDA 1B6CA 1J4HA 2XP3A 4G2PA 2LGOA 2ZQSA 1PBKA 3I6CA 4FN2A 1C9HA 2MNTA 2XP7A 4TX0A 3CGNA 4TYOA 4DROA 2XP8A 4DRMA 4W9PA 3O5FA 4ODQA 1QPFA 2KR7A 1Q6UA 3FAPA 3O5PA 3O5QA 5DITA 2MLXA 4ODLA 3OOBA 4R0XA 5BXJA 2ZQUA 4DZ3A 2K8IA 1NMVA 1Q6IA 2ZQTA 5HWBA 5B8IC 1J6YA 3UF8A 3UQIA 3RGCA 3PA7A 3GPKA 3KAIA 5HW6A 4DIPA 3TDBA 5DIVA 1FKSA 4ODNA 1TCOC 2Y78A 4ODPA 2F21A 4O2TA 4JFMA 1KT1A 1R9HA 5HTGA 1FKIA 4JFLA 2OFNA 4LAXA 3EY6A 4QT2A 4JYSA 3CGMA 2XPBA 3O5LA 4QT3A 1M5YA 1U79A 2XPAA 1Q1CA 3VAWA 2MF9A 3B7XA 5HUAA 1FKHA 2DG9A 1FKLA 2N87A 3NTPA 1Y0OA 2RURA 4J4OA 1YATA 2FKEA 2ZR5A 2ZR4A 3TCZA 4DRIA 1N1AA 1QZ2A 5I98A 4FAPA 2KO7A 1W26A 4NNRA 2IF4A 4N19A 3O5MA 2PPPA 2DG4A 3JYJA 4C02B 3UQBA 3KAGA 2PV1A 3O5KA 2M1IA 4IQCA 1FKTA 1JNTA 3LUOA 2RUQA 1EYMA 4DZ2A 4TW7A 1KT0A 4G50A 1FKDA 4JFJA 1FJDA 2ZQVA 4ODKA 4IPXA 1D7HA 1T11A 2DG3A 1JNSA 2XP9A 1FKJA 5HWCA 4MSPA 1A7XA 3RFWA 2LPVA 2JZVA 4TW6A 4ODMA 3KABA 2F4EA 2AWGA 3NRKA 1NSGA 4QIBA 1FKRA 5GPGA 2RSEA 4DRHA 3O5DA 3O5OA 1FKBA 1JVWA 2M2AA 2RUDA 3JXVA 1J4RA 2MLYA 4GIVA 4U86A 4DT4A 4DRPA 4W9QA 2ITKA 4U84A 2VN1A 3WH0A 3UQAA 4MGVA 3JYMA 1NMWA 2UZ5A 4DRJA 3PRDA 2Q5AA 2PPNA 2PBCA 3O5EA 1FKKA 2D9FA 2ZR6A 2FAPA 3O5JA 4LAYA 1P5QA 3UI6A 4DRNA 2L2SA 5HW7A 4JFKA 4BF8A 2KE0A 2KI3A 3KAHA 2F2DA 3TC5A 1PINA 1QPLA 2KGJA 3NI6A 4U85A 1F8AB 3O5GA 2XP6A 1Q6HA
chains in the Genus database with same CATH superfamily
2LKNA 3PRBA 3QOKA 5HT1A 3B9DA 4DRQA 1WNOA 1EIBA 1NWRA 1LG1A 4IQ2A 1L1PA 2LJ4A 3KADA 3O5IA 1F40A 1D7JA 4IT4A 1HXVA 1W9VA 3WIJA 3ODKA 4WK9A 5GQBA 3KAFA 4DRKA 2RUCA 2QF8A 4LAVA 2RQSA 3WKZA 1J4HA 1K9TA 2LGOA 1EHNA 1C9HA 2AOSA 3AS1A 3CGNA 4TX0A 2XP8A 4L72B 5HWBA 5BXJA 2ZQUA 4ZPWR 2K8IA 4DZ3A 3UQIA 3PA7A 1FKSA 4ODNA 2F21A 4O2TA 1E6RA 2OFNA 2XPBA 1W1PA 1M5YA 1U79A 1XRVA 2XPAA 1SYTA 4HARA 4ZS6A 3AS2A 4ML4A 5JH8A 2KO7A 2DSVA 2IF4A 3O5MA 4S3JA 3ARTA 2PV1A 3O5KA 2M1IA 4S3KA 2PI6A 2RUQA 1GPFA 1ZB5A 4DWSD 2ZQVA 4ODKA 3FY1A 1LQ0A 1D7HA 1T11A 1ITXA 3B9EA 4ZPVR 1FKRA 1LJYA 3NRKA 1ZU8A 4HBOA 2RSEA 4GIVA 3AROA 4DRPA 3WL0A 1NH6A 3UQAA 1H0GA 1SR0A 3PRDA 3UI6A 1P5QA 4ZPTR 2P4VA 4NSBA 4Z2JA 2KI3A 3ARWA 2F2DA 3ALGA 3TC5A 4P8UA 2XP6A 3IKDA 1E15A 4ODRA 2M08A 1D6OA 1BL4A 2DT2A 5DF0A 1HKJA 3B8SA 2B31A 3PRAA 1E6ZA 4NZCA 3CHFA 4J4NA 3GU0A 1FD9A 1W1TA 4LGXA 4MNMA 4R5EA 1FKFA 3KCEA 1HJVA 4Z2IA 2XP5A 4TW8A 1RD6A 4Z2LA 3KZ7A 4JFIA 4URIA 2FDMA 2KFWA 2WK2A 3ARXA 2O9OA 2XP7A 4ODQA 2KR7A 3O5QA 4PTMA 3FAPA 4KQZA 1NWSA 4ODLA 3OOBA 2F23A 5B8IC 3KAIA 5HW6A 3ARRA 3TDBA 1LL6A 5DIVA 1TCOC 3WQWA 3WD3A 1OWQA 3EY6A 4JYSA 3CGMA 3O5LA 4IT6A 1Q1CA 1EDQA 2N87A 3NTPA 1YATA 2ZR5A 3TCZA 2ZR4A 1N1AA 5I98A 1JCHB 2EULA 1WB0A 4N19A 3CHDA 1FKTA 1JNTA 3LUOA 1KT0A 3CZ8A 2DG3A 2XP9A 1FKJA 4WJXA 5HWCA 4MSPA 3RFWA 3WL1A 2LPVA 2JZVA 4ODMA 3KABA 2F4EA 4DRHA 3JXVA 1J4RA 2MLYA 4UDMA 4WIWA 2VN1A 3RM8A 4MGVA 3JYMA 1NMWA 4WKFA 1H0IA 2PBCA 2D9FA 3ARQA 4LAYA 1ZBCA 2KE0A 4MTVA 3NI6A 4MNJA 3G6LA 4Z2HA 1X6NA 4W9OA 5D75A 1D7IA 1W1VA 3IK8A 4P8XA 4GGQA 4ITZA 4Q7NA 1YW5A 5HKGA 1EQ3A 3KACA 4MNLA 3CH9A 4ODOA 4TNSA 1J4IA 1ZK6A 3IKGA 4MPKA 3ARVA 2OLHA 2MLZA 3BMBA 3H9RB 2MPHA 1E6NA 1X6LA 2PPOA 1HKMA 3ARSA 1B6CA 2ZQSA 1UR9A 4WKAA 4DRMA 4MAVA 4W9PA 5DEZA 3O5FA 1QPFA 1GRJA 5DITA 1LL7A 4R0XA 3EIPA 2ZQTA 1J6YA 3UF8A 3RGCA 3GPKA 4AY1A 4DIPA 1KFWA 2DSWA 4KR0B 1FFQA 4JFMA 1IX5A 2YBUA 3WD4A 1ZBWA 1R9HA 2DT0A 5HTGA 2A3EA 4QT2A 4L3NA 1D2KA 4QT3A 3FXYA 3AS3A 2MF9A 3B7XA 5HUAA 2DG9A 2ESCA 1HKIA 1Y0OA 4J4OA 4DRIA 3WQVA 1LG2A 4FAPA 2ETNA 4DWSB 4NNRA 3PR9A 1ZL1A 4IQCA 2DSUA 3GTYX 4DZ2A 2PN0A 4G50A 4JFJA 4Z2GA 4HBEA 1ZBKA 2DSZA 1FJDA 3RM9A 1JNSA 3ALFA 4MNKA 5GPGA 3O5DA 5HW8A 1FKBA 2M2AA 2RUDA 2O92A 4U86A 4DT4A 1HJXA 4W9QA 3WH0A 2Q5AA 2PPNA 3O5EA 4DRNA 2ZR6A 2FAPA 4Q22A 1UR8A 2DT3A 3OA5A 4BF8A 3KAHA 4DWSA 1OGBA 2WLZA 4WKHA 3CHEA 1F8AB 3O5GA 4FN2A 1Q6HA 4P8WA 3UI5A 4W5UA 1E9LA 4Z2KA 1HKKA 4DWSC 3MDYB 2XP4A 3ARYA 1ZCNA 2G8ZA 5J6EA 2PV2A 3BXWA 3ARPA 5DIUA 3AQUA 3CHCA 3WD0A 3WD1A 3O5RA 3ARZA 2PV3A 4LAWA 2A3BA 2IUZA 3ARUA 1BKFA 3IHZA 3UI4A 1ROTA 1FKGA 1ROUA 3RMEA 4DH0A 2DT1A 1FAPA 1NWUA 2VCDA 2XP3A 4G2PA 3RM4A 1GUVA 1PBKA 3I6CA 4TYOA 2MNTA 4XAKA 4DROA 1W9PA 2B5UB 1Q6UA 1CTNA 3O5PA 1ZBVA 2MLXA 5HBFA 1NMVA 1Q6IA 1LL4A 1W9UA 1NWTA 5DO2A 1JNDA 3B9AA 3G6MA 1O6IA 1TFVA 2Y78A 4ODPA 1KT1A 4P8VA 1FKIA 4JFLA 3W4RA 2WLYA 4LAXA 1FFRA 3VAWA 1FKHA 1FKLA 2RURA 1E44A 2FKEA 2WM0A 3AS0A 1QZ2A 4QZVB 1W26A 1XHGA 2PPPA 2DG4A 3JYJA 4C02B 3UQBA 3KAGA 1EYMA 2YBTA 4TW7A 1FKDA 1JNEA 4IPXA 2A3AA 1GOIA 1A7XA 2DPEA 1E6PA 2G41A 4TW6A 4QIBA 1OGGA 1HJWA 2AWGA 1NSGA 1WAWA 3O5OA 1JVWA 2ITKA 4U84A 2A3CA 2UZ5A 4DRJA 3O5JA 1FKKA 5GPRA 1VF8A 1W1YA 2L2SA 5HW7A 4JFKA 1PINA 1QPLA 2KGJA 4U85A 3WD2A
chains in the Genus database with same CATH topology
2LKNA 3PRBA 3QOKA 5HT1A 3B9DA 4DRQA 1WNOA 1EIBA 1NWRA 1LG1A 4IQ2A 1L1PA 2LJ4A 3KADA 3O5IA 1F40A 1D7JA 4IT4A 1HXVA 1W9VA 3WIJA 3ODKA 4WK9A 5GQBA 3KAFA 4DRKA 2RUCA 2QF8A 4LAVA 2RQSA 3WKZA 1J4HA 1K9TA 2LGOA 1EHNA 1C9HA 2AOSA 3AS1A 3CGNA 4TX0A 2XP8A 4L72B 5HWBA 5BXJA 2ZQUA 4ZPWR 2K8IA 4DZ3A 3UQIA 3PA7A 1FKSA 4ODNA 2F21A 4O2TA 1E6RA 2OFNA 2XPBA 1W1PA 1M5YA 1U79A 1XRVA 2XPAA 1SYTA 4HARA 4ZS6A 3AS2A 4ML4A 5JH8A 2KO7A 2DSVA 2IF4A 3O5MA 4S3JA 3ARTA 2PV1A 3O5KA 2M1IA 4S3KA 2PI6A 2RUQA 1GPFA 1ZB5A 4DWSD 2ZQVA 4ODKA 3FY1A 1LQ0A 1D7HA 1T11A 1ITXA 3B9EA 4ZPVR 1FKRA 1LJYA 3NRKA 1ZU8A 4HBOA 2RSEA 4GIVA 3AROA 4DRPA 3WL0A 1NH6A 3UQAA 1H0GA 1SR0A 3PRDA 3UI6A 1P5QA 4ZPTR 4NSBA 4Z2JA 2KI3A 3ARWA 2F2DA 3ALGA 3TC5A 4P8UA 2XP6A 3IKDA 1E15A 4ODRA 2M08A 1D6OA 1BL4A 2DT2A 5DF0A 1HKJA 3B8SA 2B31A 3PRAA 1E6ZA 4NZCA 3CHFA 4J4NA 4LGXA 1FD9A 1W1TA 4R5EA 4MNMA 1FKFA 3KCEA 1HJVA 4Z2IA 2XP5A 4TW8A 1RD6A 4Z2LA 3KZ7A 4JFIA 4URIA 2FDMA 2KFWA 2WK2A 3ARXA 2O9OA 2XP7A 4ODQA 2KR7A 3O5QA 4PTMA 3FAPA 4KQZA 1NWSA 4ODLA 3OOBA 5B8IC 3KAIA 5HW6A 3ARRA 3TDBA 1LL6A 5DIVA 1TCOC 3WQWA 3WD3A 1OWQA 3EY6A 4JYSA 3CGMA 3O5LA 4IT6A 1Q1CA 1EDQA 2N87A 3NTPA 1YATA 2ZR5A 3TCZA 2ZR4A 1N1AA 5I98A 1WB0A 4N19A 3CHDA 1FKTA 1JNTA 3LUOA 1KT0A 3CZ8A 2DG3A 2XP9A 1FKJA 4WJXA 5HWCA 4MSPA 3RFWA 3WL1A 2LPVA 2JZVA 4ODMA 3KABA 2F4EA 4DRHA 3JXVA 1J4RA 2MLYA 4WIWA 2VN1A 3RM8A 4MGVA 3JYMA 1NMWA 4WKFA 1H0IA 2PBCA 2D9FA 3ARQA 4LAYA 1ZBCA 2KE0A 4MTVA 3NI6A 4MNJA 3G6LA 4Z2HA 1X6NA 4W9OA 5D75A 1D7IA 1W1VA 3IK8A 4P8XA 4GGQA 4ITZA 4Q7NA 1YW5A 5HKGA 1EQ3A 3KACA 4MNLA 3CH9A 4ODOA 4TNSA 1J4IA 1ZK6A 3IKGA 4MPKA 3ARVA 2OLHA 2MLZA 3H9RB 2MPHA 1E6NA 1X6LA 2PPOA 1HKMA 3ARSA 1B6CA 2ZQSA 1UR9A 4WKAA 4DRMA 4MAVA 4W9PA 5DEZA 3O5FA 1QPFA 5DITA 1LL7A 4R0XA 2ZQTA 1J6YA 3UF8A 3RGCA 3GPKA 4AY1A 4DIPA 1KFWA 2DSWA 4KR0B 1FFQA 4JFMA 1IX5A 2YBUA 3WD4A 1ZBWA 1R9HA 2DT0A 5HTGA 2A3EA 4QT2A 4L3NA 1D2KA 4QT3A 3FXYA 3AS3A 2MF9A 3B7XA 5HUAA 2DG9A 2ESCA 1HKIA 1Y0OA 4J4OA 4DRIA 3WQVA 1LG2A 4FAPA 4DWSB 4NNRA 3PR9A 1ZL1A 4IQCA 2DSUA 4DZ2A 4Z2GA 4G50A 4JFJA 4HBEA 1ZBKA 2DSZA 1FJDA 3RM9A 1JNSA 3ALFA 4MNKA 5GPGA 3O5DA 5HW8A 1FKBA 2M2AA 2RUDA 2O92A 4U86A 4DT4A 1HJXA 4W9QA 3WH0A 2Q5AA 2PPNA 3O5EA 4DRNA 2ZR6A 2FAPA 4Q22A 1UR8A 2DT3A 3OA5A 4BF8A 3KAHA 4DWSA 1OGBA 2WLZA 4WKHA 3CHEA 1F8AB 3O5GA 4FN2A 1Q6HA 4P8WA 3UI5A 4W5UA 1E9LA 4Z2KA 1HKKA 4DWSC 3MDYB 2XP4A 3ARYA 1ZCNA 2G8ZA 5J6EA 2PV2A 3BXWA 3ARPA 5DIUA 3AQUA 3CHCA 3WD0A 3WD1A 3O5RA 3ARZA 2PV3A 4LAWA 2A3BA 2IUZA 3ARUA 1BKFA 3IHZA 3UI4A 1ROTA 1FKGA 1ROUA 3RMEA 4DH0A 2DT1A 1FAPA 1NWUA 2VCDA 2XP3A 4G2PA 3RM4A 1GUVA 1PBKA 3I6CA 4TYOA 2MNTA 4XAKA 4DROA 1W9PA 1Q6UA 1CTNA 3O5PA 1ZBVA 2MLXA 5HBFA 1NMVA 1Q6IA 1LL4A 1W9UA 1NWTA 5DO2A 1JNDA 3B9AA 3G6MA 1O6IA 1TFVA 2Y78A 4ODPA 1KT1A 4P8VA 1FKIA 4JFLA 3W4RA 2WLYA 4LAXA 1FFRA 3VAWA 1FKHA 1FKLA 2RURA 2FKEA 2WM0A 3AS0A 1QZ2A 4QZVB 1W26A 1XHGA 2PPPA 2DG4A 3JYJA 4C02B 3UQBA 3KAGA 1EYMA 2YBTA 4TW7A 1FKDA 1JNEA 4IPXA 2A3AA 1GOIA 1A7XA 2DPEA 1E6PA 2G41A 4TW6A 4QIBA 1OGGA 1HJWA 2AWGA 1NSGA 1WAWA 3O5OA 1JVWA 2ITKA 4U84A 2A3CA 2UZ5A 4DRJA 3O5JA 1FKKA 5GPRA 1VF8A 1W1YA 2L2SA 5HW7A 4JFKA 1PINA 1QPLA 2KGJA 4U85A 3WD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKN A;  3PRB A;  5HT1 A;  3UI5 A;  3IKD A;  4DRQ A;  4W9O A;  4ODR A;  2M08 A;  5D75 A;  1D6O A;  1D7I A;  5HW8 A;  3IK8 A;  1BL4 A;  3MDY B;  4GGQ A;  2XP4 A;  4IQ2 A;  4ITZ A;  1ZCN A;  1YW5 A;  5J6E A;  5HKG A;  1EQ3 A;  1L1P A;  2PV2 A;  2LJ4 A;  3KAC A;  4J4N A;  3KAD A;  3O5I A;  5DIU A;  4ODO A;  1F40 A;  4TNS A;  1J4I A;  1D7J A;  1ZK6 A;  1FD9 A;  3IKG A;  3O5R A;  1HXV A;  1FKF A;  3ODK A;  3KAF A;  3KCE A;  4DRK A;  2XP5 A;  2RUC A;  2PV3 A;  4LAW A;  4TW8 A;  3KZ7 A;  2MLZ A;  4JFI A;  1BKF A;  3H9R B;  3IHZ A;  2MPH A;  3UI4 A;  1ROT A;  1FKG A;  1ROU A;  2KFW A;  4LAV A;  2RQS A;  4DH0 A;  2PPO A;  1FAP A;  2VCD A;  1B6C A;  1J4H A;  2XP3 A;  4G2P A;  2LGO A;  2ZQS A;  1PBK A;  3I6C A;  4FN2 A;  1C9H A;  2MNT A;  2XP7 A;  4TX0 A;  3CGN A;  4TYO A;  4DRO A;  2XP8 A;  4DRM A;  4W9P A;  3O5F A;  4ODQ A;  1QPF A;  2KR7 A;  1Q6U A;  3FAP A;  3O5P A;  3O5Q A;  5DIT A;  2MLX A;  4ODL A;  3OOB A;  4R0X A;  5BXJ A;  2ZQU A;  4DZ3 A;  2K8I A;  1NMV A;  1Q6I A;  2ZQT A;  5HWB A;  5B8I C;  1J6Y A;  3UF8 A;  3UQI A;  3RGC A;  3PA7 A;  3GPK A;  3KAI A;  5HW6 A;  4DIP A;  3TDB A;  5DIV A;  1FKS A;  4ODN A;  1TCO C;  2Y78 A;  4ODP A;  2F21 A;  4O2T A;  4JFM A;  1KT1 A;  1R9H A;  5HTG A;  1FKI A;  4JFL A;  2OFN A;  4LAX A;  3EY6 A;  4QT2 A;  4JYS A;  3CGM A;  2XPB A;  3O5L A;  4QT3 A;  1M5Y A;  1U79 A;  2XPA A;  1Q1C A;  3VAW A;  2MF9 A;  3B7X A;  5HUA A;  1FKH A;  2DG9 A;  1FKL A;  2N87 A;  3NTP A;  1Y0O A;  2RUR A;  4J4O A;  1YAT A;  2FKE A;  2ZR5 A;  2ZR4 A;  3TCZ A;  4DRI A;  1N1A A;  1QZ2 A;  5I98 A;  4FAP A;  2KO7 A;  1W26 A;  4NNR A;  2IF4 A;  4N19 A;  3O5M A;  2PPP A;  2DG4 A;  3JYJ A;  4C02 B;  3UQB A;  3KAG A;  2PV1 A;  3O5K A;  2M1I A;  4IQC A;  1FKT A;  1JNT A;  3LUO A;  2RUQ A;  1EYM A;  4DZ2 A;  4TW7 A;  1KT0 A;  4G50 A;  1FKD A;  4JFJ A;  1FJD A;  2ZQV A;  4ODK A;  4IPX A;  1D7H A;  1T11 A;  2DG3 A;  1JNS A;  2XP9 A;  1FKJ A;  5HWC A;  4MSP A;  1A7X A;  3RFW A;  2LPV A;  2JZV A;  4TW6 A;  4ODM A;  3KAB A;  2F4E A;  2AWG A;  3NRK A;  1NSG A;  4QIB A;  1FKR A;  5GPG A;  2RSE A;  4DRH A;  3O5D A;  3O5O A;  1FKB A;  1JVW A;  2M2A A;  2RUD A;  3JXV A;  1J4R A;  2MLY A;  4GIV A;  4U86 A;  4DT4 A;  4DRP A;  4W9Q A;  2ITK A;  4U84 A;  2VN1 A;  3WH0 A;  3UQA A;  4MGV A;  3JYM A;  1NMW A;  2UZ5 A;  4DRJ A;  3PRD A;  2Q5A A;  2PPN A;  2PBC A;  3O5E A;  1FKK A;  2D9F A;  2ZR6 A;  2FAP A;  3O5J A;  4LAY A;  1P5Q A;  3UI6 A;  4DRN A;  2L2S A;  5HW7 A;  4JFK A;  4BF8 A;  2KE0 A;  2KI3 A;  3KAH A;  2F2D A;  3TC5 A;  1PIN A;  1QPL A;  2KGJ A;  3NI6 A;  4U85 A;  1F8A B;  3O5G A;  2XP6 A;  1Q6H A; 
#chains in the Genus database with same CATH topology
 2LKN A;  3PRB A;  3QOK A;  5HT1 A;  3B9D A;  4DRQ A;  1WNO A;  1EIB A;  1NWR A;  1LG1 A;  4IQ2 A;  1L1P A;  2LJ4 A;  3KAD A;  3O5I A;  1F40 A;  1D7J A;  4IT4 A;  1HXV A;  1W9V A;  3WIJ A;  3ODK A;  4WK9 A;  5GQB A;  3KAF A;  4DRK A;  2RUC A;  2QF8 A;  4LAV A;  2RQS A;  3WKZ A;  1J4H A;  1K9T A;  2LGO A;  1EHN A;  1C9H A;  2AOS A;  3AS1 A;  3CGN A;  4TX0 A;  2XP8 A;  4L72 B;  5HWB A;  5BXJ A;  2ZQU A;  4ZPW R;  2K8I A;  4DZ3 A;  3UQI A;  3PA7 A;  1FKS A;  4ODN A;  2F21 A;  4O2T A;  1E6R A;  2OFN A;  2XPB A;  1W1P A;  1M5Y A;  1U79 A;  1XRV A;  2XPA A;  1SYT A;  4HAR A;  4ZS6 A;  3AS2 A;  4ML4 A;  5JH8 A;  2KO7 A;  2DSV A;  2IF4 A;  3O5M A;  4S3J A;  3ART A;  2PV1 A;  3O5K A;  2M1I A;  4S3K A;  2PI6 A;  2RUQ A;  1GPF A;  1ZB5 A;  4DWS D;  2ZQV A;  4ODK A;  3FY1 A;  1LQ0 A;  1D7H A;  1T11 A;  1ITX A;  3B9E A;  4ZPV R;  1FKR A;  1LJY A;  3NRK A;  1ZU8 A;  4HBO A;  2RSE A;  4GIV A;  3ARO A;  4DRP A;  3WL0 A;  1NH6 A;  3UQA A;  1H0G A;  1SR0 A;  3PRD A;  3UI6 A;  1P5Q A;  4ZPT R;  2P4V A;  4NSB A;  4Z2J A;  2KI3 A;  3ARW A;  2F2D A;  3ALG A;  3TC5 A;  4P8U A;  2XP6 A;  3IKD A;  1E15 A;  4ODR A;  2M08 A;  1D6O A;  1BL4 A;  2DT2 A;  5DF0 A;  1HKJ A;  3B8S A;  2B31 A;  3PRA A;  1E6Z A;  4NZC A;  3CHF A;  4J4N A;  3GU0 A;  1FD9 A;  1W1T A;  4LGX A;  4MNM A;  4R5E A;  1FKF A;  3KCE A;  1HJV A;  4Z2I A;  2XP5 A;  4TW8 A;  1RD6 A;  4Z2L A;  3KZ7 A;  4JFI A;  4URI A;  2FDM A;  2KFW A;  2WK2 A;  3ARX A;  2O9O A;  2XP7 A;  4ODQ A;  2KR7 A;  3O5Q A;  4PTM A;  3FAP A;  4KQZ A;  1NWS A;  4ODL A;  3OOB A;  2F23 A;  5B8I C;  3KAI A;  5HW6 A;  3ARR A;  3TDB A;  1LL6 A;  5DIV A;  1TCO C;  3WQW A;  3WD3 A;  1OWQ A;  3EY6 A;  4JYS A;  3CGM A;  3O5L A;  4IT6 A;  1Q1C A;  1EDQ A;  2N87 A;  3NTP A;  1YAT A;  2ZR5 A;  3TCZ A;  2ZR4 A;  1N1A A;  5I98 A;  1JCH B;  2EUL A;  1WB0 A;  4N19 A;  3CHD A;  1FKT A;  1JNT A;  3LUO A;  1KT0 A;  3CZ8 A;  2DG3 A;  2XP9 A;  1FKJ A;  4WJX A;  5HWC A;  4MSP A;  3RFW A;  3WL1 A;  2LPV A;  2JZV A;  4ODM A;  3KAB A;  2F4E A;  4DRH A;  3JXV A;  1J4R A;  2MLY A;  4UDM A;  4WIW A;  2VN1 A;  3RM8 A;  4MGV A;  3JYM A;  1NMW A;  4WKF A;  1H0I A;  2PBC A;  2D9F A;  3ARQ A;  4LAY A;  1ZBC A;  2KE0 A;  4MTV A;  3NI6 A;  4MNJ A;  3G6L A;  4Z2H A;  1X6N A;  4W9O A;  5D75 A;  1D7I A;  1W1V A;  3IK8 A;  4P8X A;  4GGQ A;  4ITZ A;  4Q7N A;  1YW5 A;  5HKG A;  1EQ3 A;  3KAC A;  4MNL A;  3CH9 A;  4ODO A;  4TNS A;  1J4I A;  1ZK6 A;  3IKG A;  4MPK A;  3ARV A;  2OLH A;  2MLZ A;  3BMB A;  3H9R B;  2MPH A;  1E6N A;  1X6L A;  2PPO A;  1HKM A;  3ARS A;  1B6C A;  2ZQS A;  1UR9 A;  4WKA A;  4DRM A;  4MAV A;  4W9P A;  5DEZ A;  3O5F A;  1QPF A;  1GRJ A;  5DIT A;  1LL7 A;  4R0X A;  3EIP A;  2ZQT A;  1J6Y A;  3UF8 A;  3RGC A;  3GPK A;  4AY1 A;  4DIP A;  1KFW A;  2DSW A;  4KR0 B;  1FFQ A;  4JFM A;  1IX5 A;  2YBU A;  3WD4 A;  1ZBW A;  1R9H A;  2DT0 A;  5HTG A;  2A3E A;  4QT2 A;  4L3N A;  1D2K A;  4QT3 A;  3FXY A;  3AS3 A;  2MF9 A;  3B7X A;  5HUA A;  2DG9 A;  2ESC A;  1HKI A;  1Y0O A;  4J4O A;  4DRI A;  3WQV A;  1LG2 A;  4FAP A;  2ETN A;  4DWS B;  4NNR A;  3PR9 A;  1ZL1 A;  4IQC A;  2DSU A;  3GTY X;  4DZ2 A;  2PN0 A;  4G50 A;  4JFJ A;  4Z2G A;  4HBE A;  1ZBK A;  2DSZ A;  1FJD A;  3RM9 A;  1JNS A;  3ALF A;  4MNK A;  5GPG A;  3O5D A;  5HW8 A;  1FKB A;  2M2A A;  2RUD A;  2O92 A;  4U86 A;  4DT4 A;  1HJX A;  4W9Q A;  3WH0 A;  2Q5A A;  2PPN A;  3O5E A;  4DRN A;  2ZR6 A;  2FAP A;  4Q22 A;  1UR8 A;  2DT3 A;  3OA5 A;  4BF8 A;  3KAH A;  4DWS A;  1OGB A;  2WLZ A;  4WKH A;  3CHE A;  1F8A B;  3O5G A;  4FN2 A;  1Q6H A;  4P8W A;  3UI5 A;  4W5U A;  1E9L A;  4Z2K A;  1HKK A;  4DWS C;  3MDY B;  2XP4 A;  3ARY A;  1ZCN A;  2G8Z A;  5J6E A;  2PV2 A;  3BXW A;  3ARP A;  5DIU A;  3AQU A;  3CHC A;  3WD0 A;  3WD1 A;  3O5R A;  3ARZ A;  2PV3 A;  4LAW A;  2A3B A;  2IUZ A;  3ARU A;  1BKF A;  3IHZ A;  3UI4 A;  1ROT A;  1FKG A;  1ROU A;  3RME A;  4DH0 A;  2DT1 A;  1FAP A;  1NWU A;  2VCD A;  2XP3 A;  4G2P A;  3RM4 A;  1GUV A;  1PBK A;  3I6C A;  4TYO A;  2MNT A;  4XAK A;  4DRO A;  1W9P A;  2B5U B;  1Q6U A;  1CTN A;  3O5P A;  1ZBV A;  2MLX A;  5HBF A;  1NMV A;  1Q6I A;  1LL4 A;  1W9U A;  1NWT A;  5DO2 A;  1JND A;  3B9A A;  3G6M A;  1O6I A;  1TFV A;  2Y78 A;  4ODP A;  1KT1 A;  4P8V A;  1FKI A;  4JFL A;  3W4R A;  2WLY A;  4LAX A;  1FFR A;  3VAW A;  1FKH A;  1FKL A;  2RUR A;  1E44 A;  2FKE A;  2WM0 A;  3AS0 A;  1QZ2 A;  4QZV B;  1W26 A;  1XHG A;  2PPP A;  2DG4 A;  3JYJ A;  4C02 B;  3UQB A;  3KAG A;  1EYM A;  2YBT A;  4TW7 A;  1FKD A;  1JNE A;  4IPX A;  2A3A A;  1GOI A;  1A7X A;  2DPE A;  1E6P A;  2G41 A;  4TW6 A;  4QIB A;  1OGG A;  1HJW A;  2AWG A;  1NSG A;  1WAW A;  3O5O A;  1JVW A;  2ITK A;  4U84 A;  2A3C A;  2UZ5 A;  4DRJ A;  3O5J A;  1FKK A;  5GPR A;  1VF8 A;  1W1Y A;  2L2S A;  5HW7 A;  4JFK A;  1PIN A;  1QPL A;  2KGJ A;  4U85 A;  3WD2 A; 
#chains in the Genus database with same CATH homology
 2LKN A;  3PRB A;  3QOK A;  5HT1 A;  3B9D A;  4DRQ A;  1WNO A;  1EIB A;  1NWR A;  1LG1 A;  4IQ2 A;  1L1P A;  2LJ4 A;  3KAD A;  3O5I A;  1F40 A;  1D7J A;  4IT4 A;  1HXV A;  1W9V A;  3WIJ A;  3ODK A;  4WK9 A;  5GQB A;  3KAF A;  4DRK A;  2RUC A;  2QF8 A;  4LAV A;  2RQS A;  3WKZ A;  1J4H A;  1K9T A;  2LGO A;  1EHN A;  1C9H A;  2AOS A;  3AS1 A;  3CGN A;  4TX0 A;  2XP8 A;  4L72 B;  5HWB A;  5BXJ A;  2ZQU A;  4ZPW R;  2K8I A;  4DZ3 A;  3UQI A;  3PA7 A;  1FKS A;  4ODN A;  2F21 A;  4O2T A;  1E6R A;  2OFN A;  2XPB A;  1W1P A;  1M5Y A;  1U79 A;  1XRV A;  2XPA A;  1SYT A;  4HAR A;  4ZS6 A;  3AS2 A;  4ML4 A;  5JH8 A;  2KO7 A;  2DSV A;  2IF4 A;  3O5M A;  4S3J A;  3ART A;  2PV1 A;  3O5K A;  2M1I A;  4S3K A;  2PI6 A;  2RUQ A;  1GPF A;  1ZB5 A;  4DWS D;  2ZQV A;  4ODK A;  3FY1 A;  1LQ0 A;  1D7H A;  1T11 A;  1ITX A;  3B9E A;  4ZPV R;  1FKR A;  1LJY A;  3NRK A;  1ZU8 A;  4HBO A;  2RSE A;  4GIV A;  3ARO A;  4DRP A;  3WL0 A;  1NH6 A;  3UQA A;  1H0G A;  1SR0 A;  3PRD A;  3UI6 A;  1P5Q A;  4ZPT R;  4NSB A;  4Z2J A;  2KI3 A;  3ARW A;  2F2D A;  3ALG A;  3TC5 A;  4P8U A;  2XP6 A;  3IKD A;  1E15 A;  4ODR A;  2M08 A;  1D6O A;  1BL4 A;  2DT2 A;  5DF0 A;  1HKJ A;  3B8S A;  2B31 A;  3PRA A;  1E6Z A;  4NZC A;  3CHF A;  4J4N A;  4LGX A;  1FD9 A;  1W1T A;  4R5E A;  4MNM A;  1FKF A;  3KCE A;  1HJV A;  4Z2I A;  2XP5 A;  4TW8 A;  1RD6 A;  4Z2L A;  3KZ7 A;  4JFI A;  4URI A;  2FDM A;  2KFW A;  2WK2 A;  3ARX A;  2O9O A;  2XP7 A;  4ODQ A;  2KR7 A;  3O5Q A;  4PTM A;  3FAP A;  4KQZ A;  1NWS A;  4ODL A;  3OOB A;  5B8I C;  3KAI A;  5HW6 A;  3ARR A;  3TDB A;  1LL6 A;  5DIV A;  1TCO C;  3WQW A;  3WD3 A;  1OWQ A;  3EY6 A;  4JYS A;  3CGM A;  3O5L A;  4IT6 A;  1Q1C A;  1EDQ A;  2N87 A;  3NTP A;  1YAT A;  2ZR5 A;  3TCZ A;  2ZR4 A;  1N1A A;  5I98 A;  1WB0 A;  4N19 A;  3CHD A;  1FKT A;  1JNT A;  3LUO A;  1KT0 A;  3CZ8 A;  2DG3 A;  2XP9 A;  1FKJ A;  4WJX A;  5HWC A;  4MSP A;  3RFW A;  3WL1 A;  2LPV A;  2JZV A;  4ODM A;  3KAB A;  2F4E A;  4DRH A;  3JXV A;  1J4R A;  2MLY A;  4WIW A;  2VN1 A;  3RM8 A;  4MGV A;  3JYM A;  1NMW A;  4WKF A;  1H0I A;  2PBC A;  2D9F A;  3ARQ A;  4LAY A;  1ZBC A;  2KE0 A;  4MTV A;  3NI6 A;  4MNJ A;  3G6L A;  4Z2H A;  1X6N A;  4W9O A;  5D75 A;  1D7I A;  1W1V A;  3IK8 A;  4P8X A;  4GGQ A;  4ITZ A;  4Q7N A;  1YW5 A;  5HKG A;  1EQ3 A;  3KAC A;  4MNL A;  3CH9 A;  4ODO A;  4TNS A;  1J4I A;  1ZK6 A;  3IKG A;  4MPK A;  3ARV A;  2OLH A;  2MLZ A;  3H9R B;  2MPH A;  1E6N A;  1X6L A;  2PPO A;  1HKM A;  3ARS A;  1B6C A;  2ZQS A;  1UR9 A;  4WKA A;  4DRM A;  4MAV A;  4W9P A;  5DEZ A;  3O5F A;  1QPF A;  5DIT A;  1LL7 A;  4R0X A;  2ZQT A;  1J6Y A;  3UF8 A;  3RGC A;  3GPK A;  4AY1 A;  4DIP A;  1KFW A;  2DSW A;  4KR0 B;  1FFQ A;  4JFM A;  1IX5 A;  2YBU A;  3WD4 A;  1ZBW A;  1R9H A;  2DT0 A;  5HTG A;  2A3E A;  4QT2 A;  4L3N A;  1D2K A;  4QT3 A;  3FXY A;  3AS3 A;  2MF9 A;  3B7X A;  5HUA A;  2DG9 A;  2ESC A;  1HKI A;  1Y0O A;  4J4O A;  4DRI A;  3WQV A;  1LG2 A;  4FAP A;  4DWS B;  4NNR A;  3PR9 A;  1ZL1 A;  4IQC A;  2DSU A;  4DZ2 A;  4Z2G A;  4G50 A;  4JFJ A;  4HBE A;  1ZBK A;  2DSZ A;  1FJD A;  3RM9 A;  1JNS A;  3ALF A;  4MNK A;  5GPG A;  3O5D A;  5HW8 A;  1FKB A;  2M2A A;  2RUD A;  2O92 A;  4U86 A;  4DT4 A;  1HJX A;  4W9Q A;  3WH0 A;  2Q5A A;  2PPN A;  3O5E A;  4DRN A;  2ZR6 A;  2FAP A;  4Q22 A;  1UR8 A;  2DT3 A;  3OA5 A;  4BF8 A;  3KAH A;  4DWS A;  1OGB A;  2WLZ A;  4WKH A;  3CHE A;  1F8A B;  3O5G A;  4FN2 A;  1Q6H A;  4P8W A;  3UI5 A;  4W5U A;  1E9L A;  4Z2K A;  1HKK A;  4DWS C;  3MDY B;  2XP4 A;  3ARY A;  1ZCN A;  2G8Z A;  5J6E A;  2PV2 A;  3BXW A;  3ARP A;  5DIU A;  3AQU A;  3CHC A;  3WD0 A;  3WD1 A;  3O5R A;  3ARZ A;  2PV3 A;  4LAW A;  2A3B A;  2IUZ A;  3ARU A;  1BKF A;  3IHZ A;  3UI4 A;  1ROT A;  1FKG A;  1ROU A;  3RME A;  4DH0 A;  2DT1 A;  1FAP A;  1NWU A;  2VCD A;  2XP3 A;  4G2P A;  3RM4 A;  1GUV A;  1PBK A;  3I6C A;  4TYO A;  2MNT A;  4XAK A;  4DRO A;  1W9P A;  1Q6U A;  1CTN A;  3O5P A;  1ZBV A;  2MLX A;  5HBF A;  1NMV A;  1Q6I A;  1LL4 A;  1W9U A;  1NWT A;  5DO2 A;  1JND A;  3B9A A;  3G6M A;  1O6I A;  1TFV A;  2Y78 A;  4ODP A;  1KT1 A;  4P8V A;  1FKI A;  4JFL A;  3W4R A;  2WLY A;  4LAX A;  1FFR A;  3VAW A;  1FKH A;  1FKL A;  2RUR A;  2FKE A;  2WM0 A;  3AS0 A;  1QZ2 A;  4QZV B;  1W26 A;  1XHG A;  2PPP A;  2DG4 A;  3JYJ A;  4C02 B;  3UQB A;  3KAG A;  1EYM A;  2YBT A;  4TW7 A;  1FKD A;  1JNE A;  4IPX A;  2A3A A;  1GOI A;  1A7X A;  2DPE A;  1E6P A;  2G41 A;  4TW6 A;  4QIB A;  1OGG A;  1HJW A;  2AWG A;  1NSG A;  1WAW A;  3O5O A;  1JVW A;  2ITK A;  4U84 A;  2A3C A;  2UZ5 A;  4DRJ A;  3O5J A;  1FKK A;  5GPR A;  1VF8 A;  1W1Y A;  2L2S A;  5HW7 A;  4JFK A;  1PIN A;  1QPL A;  2KGJ A;  4U85 A;  3WD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...