2M1IA

High resolution structure and dynamics of cspina parvulin at physiological temperature
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvulin-like peptidyl-prolyl isomerase
publication title High resolution structure and dynamics of CsPinA parvulin at physiological temperature
rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
total genus 29
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2m1iA00
2ZQSA 2Q5AA 4DH0A 2LJ4A 3KADA 1YATA 1FKRA 2PPNA 2ZR6A 2M1IA 2L2SA 3RFWA 1D7JA 3JXVA 4TNSA 5DITA 1N1AA 1P5QA 3O5PA 5BXJA 1JNSA 2PBCA 3FAPA 1B6CA 4LAVA 2RURA 4TW8A 1J4HA 3EY6A 3O5MA 1PINA 4ODNA 1M5YA 3B7XA 2D9FA 2ZQUA 2F21A 4U86A 1Y0OA 2AWGA 3O5FA 2XP9A 4FN2A 4DIPA 2MLYA 1D7IA 1JNTA 1QPLA 3KZ7A 3PA7A 4U84A 4DT4A 1FKGA 2PV3A 3UQAA 5HUAA 2KI3A 5HTGA 4GIVA 4JFIA 2RQSA 4ODOA 3UI4A 4DRQA 1A7XA 3IKDA 3O5DA 3NTPA 1ROTA 5GPGA 1FKIA 4BF8A 5B8IC 2K8IA 3O5KA 4ODMA 3JYMA 3PRBA 4DRKA 4LAWA 2VN1A 2F4EA 2MF9A 3KAFA 2XPBA 5D75A 4DRHA 2OFNA 3O5QA 3IK8A 3O5LA 4JYSA 4ODKA 1FKBA 4ODRA 4DZ3A 4QT3A 3TDBA 2PPOA 2N87A 1PBKA 1ZK6A 2ZQTA 4N19A 1D7HA 2PPPA 2MLXA 3KAGA 3RGCA 5HW8A 5I98A 4MGVA 1KT0A 3MDYB 3O5EA 5HKGA 1J4IA 2XP7A 1FD9A 4IQ2A 5HW6A 3OOBA 4ODPA 4TW6A 4TW7A 2DG3A 3KACA 1NMVA 2Y78A 4ITZA 3VAWA 4DRIA 4G2PA 2LKNA 3ODKA 2KFWA 2FAPA 3IKGA 1FKHA 4J4NA 2DG9A 1U79A 3TCZA 4W9PA 1FKFA 3I6CA 4LAYA 4DRNA 2RUCA 2XP3A 3TC5A 1Q6HA 1F40A 4MSPA 5HWBA 3O5OA 1J6YA 2ZQVA 4J4OA 3CGNA 2KO7A 5DIUA 3WH0A 3UI5A 1T11A 3PRDA 5HWCA 1ZCNA 4DRMA 1FAPA 3KAHA 4TYOA 3O5GA 1FKTA 2KE0A 4TX0A 4QT2A 2PV2A 4G50A 4W9OA 5HT1A 2FKEA 3NI6A 1YW5A 1Q6IA 2VCDA 3IHZA 1ROUA 1TCOC 2XP5A 3GPKA 3UQIA 3CGMA 1R9HA 1L1PA 2ITKA 4JFLA 2DG4A 2RUDA 1Q6UA 2LGOA 2XP4A 3O5IA 4R0XA 4FAPA 3O5RA 3LUOA 4W9QA 4DZ2A 1EQ3A 3H9RB 1W26A 1D6OA 1NMWA 1EYMA 2XPAA 1J4RA 4LAXA 4NNRA 1FJDA 4DROA 2MPHA 2UZ5A 2XP6A 1BKFA 2M2AA 4O2TA 3UI6A 1FKJA 4IQCA 1FKLA 1KT1A 3O5JA 1FKKA 2MLZA 1FKDA 1F8AB 4JFKA 4ODLA 1Q1CA 4U85A 2RSEA 2KR7A 2PV1A 1C9HA 4IPXA 2RUQA 4C02B 3UF8A 3NRKA 2M08A 3KAIA 2JZVA 4QIBA 3UQBA 1QZ2A 1QPFA 4GGQA 2XP8A 4JFJA 1FKSA 2LPVA 3KCEA 1BL4A 2MNTA 2ZR4A 4DRPA 5DIVA 2IF4A 2F2DA 2ZR5A 5HW7A 1JVWA 3KABA 4JFMA 4ODQA 5J6EA 3JYJA 1HXVA 2KGJA 4DRJA 1NSGA
chains in the Genus database with same CATH superfamily
2Q5AA 1GPFA 1YATA 1FKRA 3ARQA 4P8VA 2ZR6A 2WM0A 3O5PA 1JNSA 1B6CA 1E6RA 3EY6A 1PINA 2G41A 1Y0OA 4P8UA 2XP9A 4FN2A 4KQZA 4U84A 4MNJA 3B9DA 2KI3A 4GIVA 4ODOA 3CHFA 4DWSB 3AS2A 3IKDA 4BF8A 1H0GA 4LAWA 3ARYA 2VN1A 2F4EA 2A3CA 5D75A 1EHNA 4JYSA 1FKBA 4DZ3A 3OA5A 4QT3A 2PPOA 1D7HA 3KAGA 5HW8A 4MGVA 3BXWA 3MDYB 1J4IA 1FD9A 3OOBA 4MNMA 1K9TA 3KACA 4DRIA 4HBOA 1FKHA 2DG9A 1UR9A 1E15A 3G6MA 1F40A 1HKMA 3O5OA 1J6YA 2ZQVA 4J4OA 2KO7A 1ZCNA 3KAHA 3CZ8A 4W9OA 4NZCA 1YW5A 2DSWA 1E6NA 2WK2A 1LQ0A 4Q7NA 3LUOA 4W9QA 4DZ2A 1EQ3A 3H9RB 4LAXA 4NNRA 4DROA 2XP6A 1BKFA 2M2AA 4O2TA 4FAPA 1F8AB 4ODLA 1Q1CA 4U85A 2RSEA 2KR7A 3ARWA 3NRKA 2M08A 4QIBA 2JZVA 1QZ2A 1ZBCA 1RD6A 2DT3A 3AROA 4JFJA 1FKSA 1ZBVA 1ZBWA 1W1TA 5HBFA 5DEZA 4S3KA 2ZR5A 4ODQA 1HXVA 1FFRA 1NSGA 4DH0A 1SR0A 4ML4A 1D7JA 1LG1A 3ARUA 1KFWA 5JH8A 5DITA 4ZPTR 1ZL1A 4WK9A 1E6PA 1P5QA 3WQWA 3PR9A 3BMBA 4NSBA 4AY1A 3B7XA 2D9FA 2ZQUA 2AWGA 3AS1A 4XAKA 3WL1A 1ZU8A 4DRQA 1A7XA 2WLYA 4PTMA 3O5DA 3NTPA 5B8IC 2O92A 3B9AA 4ODMA 3PRBA 2MF9A 4DRHA 2OFNA 3IK8A 3O5LA 3RMEA 1O6IA 2DSVA 1ZK6A 2DPEA 4MTVA 1E9LA 1E6ZA 1HKJA 3PRAA 3O5EA 5HKGA 2YBUA 2Y78A 3VAWA 2KFWA 3IKGA 4J4NA 4P8WA 4DRNA 2RUCA 2XP3A 3ARPA 5DIUA 3WH0A 1XRVA 3UI5A 3GTYX 1LG2A 1T11A 4DRMA 4LGXA 3EIPA 3WKZA 2PV2A 5HT1A 4WKHA 1NWUA 2VCDA 3IHZA 3WQVA 2XP5A 3CGMA 1L1PA 2ITKA 2XP4A 1Q6UA 2LGOA 1OGGA 1LL6A 1TFVA 1W9UA 4ZPWR 1EYMA 4ZPVR 4DWSA 1FJDA 3WIJA 1GRJA 2MLZA 4JFKA 1HJWA 2PV1A 1C9HA 1X6NA 4IPXA 3UF8A 3CHDA 4GGQA 2A3BA 2MNTA 2ZR4A 4DRPA 5DIVA 5GQBA 1JVWA 4WKAA 5J6EA 1WAWA 2DT1A 2ZQSA 2LJ4A 1EDQA 2YBTA 3KADA 3WL0A 2M1IA 2L2SA 3RFWA 3WD3A 1WB0A 2DT2A 5BXJA 2PBCA 3FAPA 2RURA 1J4HA 3AS3A 4ODNA 1M5YA 2F21A 1FFQA 3CHEA 4DIPA 3B9EA 4L72B 3KZ7A 2WLZA 1QPLA 1FKGA 2PV3A 3RM4A 5HUAA 2RQSA 1E44A 3CH9A 3AQUA 3RM8A 1FKIA 2K8IA 3KAFA 2B5UB 2DSUA 2AOSA 4DWSC 4MPKA 2A3EA 4ODKA 4ODRA 3TDBA 2N87A 4N19A 1HJVA 3ARSA 2PPPA 2OLHA 1KT0A 4QZVB 1LL4A 5HW6A 4Q22A 1WNOA 3ALFA 2DG3A 4ITZA 1NMVA 4W5UA 2P4VA 3ODKA 2FAPA 4Z2JA 1U79A 5DO2A 3WD1A 3ARTA 3I6CA 4LAYA 1NWTA 4MSPA 4L3NA 5HWBA 2A3AA 3CGNA 4UDMA 3B8SA 1HKKA 3ARZA 3RM9A 4Z2HA 4HBEA 1FKTA 2KE0A 4QT2A 4G50A 2FKEA 1ZB5A 1ROUA 3UQIA 4R0XA 2DT0A 4R5EA 1W1PA 3G6LA 4HARA 1HJXA 1W26A 1D6OA 1NMWA 4DWSD 4WIWA 1CTNA 1J4RA 1XHGA 4IT4A 1JNDA 3O5JA 4MNKA 2RUQA 1NWSA 2XP8A 2B31A 4Z2KA 2LPVA 4WJXA 4WKFA 3KABA 4JFMA 3JYJA 4DRJA 2F23A 2O9OA 2PPNA 4MNLA 5GPRA 3JXVA 4TNSA 1W1YA 1N1AA 2FDMA 4LAVA 4TW8A 1OGBA 3O5MA 3AS0A 4U86A 3O5FA 3WD4A 2MLYA 1D7IA 1JNTA 3PA7A 2QF8A 4DT4A 3UQAA 5HTGA 4JFIA 2ESCA 4Z2LA 1IX5A 3UI4A 4KR0B 4IT6A 3WD2A 3WD0A 1SYTA 4Z2GA 1LL7A 1ROTA 5GPGA 1JNEA 3O5KA 2DSZA 3JYMA 4DRKA 4ZS6A 2EULA 4URIA 2XPBA 3CHCA 3O5QA 1W9PA 3GU0A 1PBKA 2ZQTA 5DF0A 2MLXA 3RGCA 5I98A 3ARXA 2XP7A 4IQ2A 4ODPA 4TW6A 4TW7A 1W9VA 4G2PA 2LKNA 3TCZA 4W9PA 1EIBA 1FKFA 1OWQA 3TC5A 1Q6HA 3FXYA 4P8XA 2IUZA 1ZBKA 3ARRA 1NH6A 4MAVA 1ITXA 3PRDA 5HWCA 1FAPA 4TYOA 3O5GA 2PN0A 4TX0A 1H0IA 4S3JA 3NI6A 1Q6IA 1NWRA 1VF8A 2ETNA 1TCOC 3GPKA 1R9HA 1X6LA 4JFLA 2DG4A 2RUDA 2G8ZA 2PI6A 3O5IA 1LJYA 1D2KA 3QOKA 3O5RA 3W4RA 4Z2IA 2XPAA 1JCHB 2MPHA 2UZ5A 3UI6A 1FKJA 4IQCA 1FKLA 1KT1A 1FKKA 1FKDA 4C02B 3KAIA 3UQBA 1HKIA 1QPFA 1UR8A 1GUVA 3ARVA 3KCEA 1GOIA 1BL4A 3FY1A 2IF4A 2F2DA 5HW7A 3ALGA 1W1VA 2KGJA
chains in the Genus database with same CATH topology
2Q5AA 1GPFA 1YATA 1FKRA 3ARQA 4P8VA 2ZR6A 2WM0A 3O5PA 1JNSA 1B6CA 1E6RA 3EY6A 1PINA 2G41A 1Y0OA 4P8UA 2XP9A 4FN2A 4KQZA 4U84A 4MNJA 3B9DA 2KI3A 4GIVA 4ODOA 3CHFA 4DWSB 3AS2A 3IKDA 4BF8A 1H0GA 4LAWA 3ARYA 2VN1A 2F4EA 2A3CA 5D75A 1EHNA 4JYSA 1FKBA 4DZ3A 3OA5A 4QT3A 2PPOA 1D7HA 3KAGA 5HW8A 4MGVA 3BXWA 3MDYB 1J4IA 1FD9A 3OOBA 4MNMA 1K9TA 3KACA 4DRIA 4HBOA 1FKHA 2DG9A 1UR9A 1E15A 3G6MA 1F40A 1HKMA 3O5OA 1J6YA 2ZQVA 4J4OA 2KO7A 1ZCNA 3KAHA 3CZ8A 4W9OA 4NZCA 1YW5A 2DSWA 1E6NA 2WK2A 1LQ0A 4Q7NA 3LUOA 4W9QA 4DZ2A 1EQ3A 3H9RB 4LAXA 4NNRA 4DROA 2XP6A 1BKFA 2M2AA 4O2TA 4FAPA 1F8AB 4ODLA 1Q1CA 4U85A 2RSEA 2KR7A 3ARWA 3NRKA 2M08A 4QIBA 2JZVA 1QZ2A 1ZBCA 1RD6A 2DT3A 3AROA 4JFJA 1FKSA 1ZBVA 1ZBWA 1W1TA 5HBFA 5DEZA 4S3KA 2ZR5A 4ODQA 1HXVA 1FFRA 1NSGA 4DH0A 1SR0A 4ML4A 1D7JA 1LG1A 3ARUA 1KFWA 5JH8A 5DITA 4ZPTR 1ZL1A 4WK9A 1E6PA 1P5QA 3WQWA 3PR9A 4NSBA 4AY1A 3B7XA 2D9FA 2ZQUA 2AWGA 3AS1A 4XAKA 3WL1A 1ZU8A 4DRQA 1A7XA 2WLYA 4PTMA 3O5DA 3NTPA 5B8IC 2O92A 3B9AA 4ODMA 3PRBA 2MF9A 4DRHA 2OFNA 3IK8A 3O5LA 3RMEA 1O6IA 2DSVA 1ZK6A 2DPEA 4MTVA 1E9LA 1E6ZA 1HKJA 3PRAA 3O5EA 5HKGA 2YBUA 2Y78A 3VAWA 2KFWA 3IKGA 4J4NA 4P8WA 4DRNA 2RUCA 2XP3A 3ARPA 5DIUA 3WH0A 1XRVA 3UI5A 1LG2A 1T11A 4DRMA 4LGXA 3WKZA 2PV2A 5HT1A 4WKHA 1NWUA 2VCDA 3IHZA 3WQVA 2XP5A 3CGMA 1L1PA 2ITKA 2XP4A 1Q6UA 2LGOA 1OGGA 1LL6A 1TFVA 1W9UA 4ZPWR 1EYMA 4ZPVR 4DWSA 1FJDA 3WIJA 2MLZA 4JFKA 1HJWA 2PV1A 1C9HA 1X6NA 4IPXA 3UF8A 3CHDA 4GGQA 2A3BA 2MNTA 2ZR4A 4DRPA 5DIVA 5GQBA 1JVWA 4WKAA 5J6EA 1WAWA 2DT1A 2ZQSA 2LJ4A 1EDQA 2YBTA 3KADA 3WL0A 2M1IA 2L2SA 3RFWA 3WD3A 1WB0A 2DT2A 5BXJA 2PBCA 3FAPA 2RURA 1J4HA 3AS3A 4ODNA 1M5YA 2F21A 1FFQA 3CHEA 4DIPA 3B9EA 4L72B 3KZ7A 2WLZA 1QPLA 1FKGA 2PV3A 3RM4A 5HUAA 2RQSA 3CH9A 3AQUA 3RM8A 1FKIA 2K8IA 3KAFA 4DWSC 2DSUA 2AOSA 4MPKA 2A3EA 4ODKA 4ODRA 3TDBA 2N87A 4N19A 1HJVA 3ARSA 2PPPA 2OLHA 1KT0A 4QZVB 1LL4A 5HW6A 4Q22A 1WNOA 3ALFA 2DG3A 4ITZA 1NMVA 4W5UA 3ODKA 2FAPA 4Z2JA 1U79A 5DO2A 3WD1A 3ARTA 3I6CA 4LAYA 1NWTA 4MSPA 4L3NA 5HWBA 2A3AA 3CGNA 3B8SA 1HKKA 3ARZA 3RM9A 4Z2HA 4HBEA 1FKTA 2KE0A 4QT2A 4G50A 2FKEA 1ZB5A 1ROUA 3UQIA 4R0XA 2DT0A 4R5EA 1W1PA 3G6LA 4HARA 1HJXA 1W26A 1D6OA 1NMWA 4DWSD 4WIWA 1CTNA 1J4RA 1XHGA 4IT4A 1JNDA 3O5JA 4MNKA 2RUQA 1NWSA 2XP8A 2B31A 4Z2KA 2LPVA 4WJXA 4WKFA 3KABA 4JFMA 3JYJA 4DRJA 2O9OA 2PPNA 4MNLA 5GPRA 3JXVA 4TNSA 1W1YA 1N1AA 2FDMA 4LAVA 4TW8A 1OGBA 3O5MA 3AS0A 4U86A 3O5FA 3WD4A 2MLYA 1D7IA 1JNTA 3PA7A 2QF8A 4DT4A 3UQAA 5HTGA 4JFIA 2ESCA 4Z2LA 1IX5A 3UI4A 4KR0B 4IT6A 3WD2A 3WD0A 1SYTA 4Z2GA 1LL7A 1ROTA 5GPGA 1JNEA 3O5KA 2DSZA 3JYMA 4DRKA 4ZS6A 4URIA 2XPBA 3CHCA 3O5QA 1W9PA 1PBKA 2ZQTA 5DF0A 2MLXA 3RGCA 5I98A 3ARXA 2XP7A 4IQ2A 4ODPA 4TW6A 4TW7A 1W9VA 4G2PA 2LKNA 3TCZA 4W9PA 1EIBA 1FKFA 1OWQA 3TC5A 1Q6HA 3FXYA 4P8XA 2IUZA 1ZBKA 3ARRA 1NH6A 4MAVA 1ITXA 3PRDA 5HWCA 1FAPA 4TYOA 3O5GA 4TX0A 1H0IA 4S3JA 3NI6A 1Q6IA 1NWRA 1VF8A 1TCOC 3GPKA 1R9HA 1X6LA 4JFLA 2DG4A 2RUDA 2G8ZA 2PI6A 3O5IA 1LJYA 1D2KA 3QOKA 3O5RA 3W4RA 4Z2IA 2XPAA 2MPHA 2UZ5A 3UI6A 1FKJA 4IQCA 1FKLA 1KT1A 1FKKA 1FKDA 4C02B 3KAIA 3UQBA 1HKIA 1QPFA 1UR8A 1GUVA 3ARVA 3KCEA 1GOIA 1BL4A 3FY1A 2IF4A 2F2DA 5HW7A 3ALGA 1W1VA 2KGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQS A;  2Q5A A;  4DH0 A;  2LJ4 A;  3KAD A;  1YAT A;  1FKR A;  2PPN A;  2ZR6 A;  2M1I A;  2L2S A;  3RFW A;  1D7J A;  3JXV A;  4TNS A;  5DIT A;  1N1A A;  1P5Q A;  3O5P A;  5BXJ A;  1JNS A;  2PBC A;  3FAP A;  1B6C A;  4LAV A;  2RUR A;  4TW8 A;  1J4H A;  3EY6 A;  3O5M A;  1PIN A;  4ODN A;  1M5Y A;  3B7X A;  2D9F A;  2ZQU A;  2F21 A;  4U86 A;  1Y0O A;  2AWG A;  3O5F A;  2XP9 A;  4FN2 A;  4DIP A;  2MLY A;  1D7I A;  1JNT A;  1QPL A;  3KZ7 A;  3PA7 A;  4U84 A;  4DT4 A;  1FKG A;  2PV3 A;  3UQA A;  5HUA A;  2KI3 A;  5HTG A;  4GIV A;  4JFI A;  2RQS A;  4ODO A;  3UI4 A;  4DRQ A;  1A7X A;  3IKD A;  3O5D A;  3NTP A;  1ROT A;  5GPG A;  1FKI A;  4BF8 A;  5B8I C;  2K8I A;  3O5K A;  4ODM A;  3JYM A;  3PRB A;  4DRK A;  4LAW A;  2VN1 A;  2F4E A;  2MF9 A;  3KAF A;  2XPB A;  5D75 A;  4DRH A;  2OFN A;  3O5Q A;  3IK8 A;  3O5L A;  4JYS A;  4ODK A;  1FKB A;  4ODR A;  4DZ3 A;  4QT3 A;  3TDB A;  2PPO A;  2N87 A;  1PBK A;  1ZK6 A;  2ZQT A;  4N19 A;  1D7H A;  2PPP A;  2MLX A;  3KAG A;  3RGC A;  5HW8 A;  5I98 A;  4MGV A;  1KT0 A;  3MDY B;  3O5E A;  5HKG A;  1J4I A;  2XP7 A;  1FD9 A;  4IQ2 A;  5HW6 A;  3OOB A;  4ODP A;  4TW6 A;  4TW7 A;  2DG3 A;  3KAC A;  1NMV A;  2Y78 A;  4ITZ A;  3VAW A;  4DRI A;  4G2P A;  2LKN A;  3ODK A;  2KFW A;  2FAP A;  3IKG A;  1FKH A;  4J4N A;  2DG9 A;  1U79 A;  3TCZ A;  4W9P A;  1FKF A;  3I6C A;  4LAY A;  4DRN A;  2RUC A;  2XP3 A;  3TC5 A;  1Q6H A;  1F40 A;  4MSP A;  5HWB A;  3O5O A;  1J6Y A;  2ZQV A;  4J4O A;  3CGN A;  2KO7 A;  5DIU A;  3WH0 A;  3UI5 A;  1T11 A;  3PRD A;  5HWC A;  1ZCN A;  4DRM A;  1FAP A;  3KAH A;  4TYO A;  3O5G A;  1FKT A;  2KE0 A;  4TX0 A;  4QT2 A;  2PV2 A;  4G50 A;  4W9O A;  5HT1 A;  2FKE A;  3NI6 A;  1YW5 A;  1Q6I A;  2VCD A;  3IHZ A;  1ROU A;  1TCO C;  2XP5 A;  3GPK A;  3UQI A;  3CGM A;  1R9H A;  1L1P A;  2ITK A;  4JFL A;  2DG4 A;  2RUD A;  1Q6U A;  2LGO A;  2XP4 A;  3O5I A;  4R0X A;  4FAP A;  3O5R A;  3LUO A;  4W9Q A;  4DZ2 A;  1EQ3 A;  3H9R B;  1W26 A;  1D6O A;  1NMW A;  1EYM A;  2XPA A;  1J4R A;  4LAX A;  4NNR A;  1FJD A;  4DRO A;  2MPH A;  2UZ5 A;  2XP6 A;  1BKF A;  2M2A A;  4O2T A;  3UI6 A;  1FKJ A;  4IQC A;  1FKL A;  1KT1 A;  3O5J A;  1FKK A;  2MLZ A;  1FKD A;  1F8A B;  4JFK A;  4ODL A;  1Q1C A;  4U85 A;  2RSE A;  2KR7 A;  2PV1 A;  1C9H A;  4IPX A;  2RUQ A;  4C02 B;  3UF8 A;  3NRK A;  2M08 A;  3KAI A;  2JZV A;  4QIB A;  3UQB A;  1QZ2 A;  1QPF A;  4GGQ A;  2XP8 A;  4JFJ A;  1FKS A;  2LPV A;  3KCE A;  1BL4 A;  2MNT A;  2ZR4 A;  4DRP A;  5DIV A;  2IF4 A;  2F2D A;  2ZR5 A;  5HW7 A;  1JVW A;  3KAB A;  4JFM A;  4ODQ A;  5J6E A;  3JYJ A;  1HXV A;  2KGJ A;  4DRJ A;  1NSG A; 
#chains in the Genus database with same CATH topology
 2Q5A A;  1GPF A;  1YAT A;  1FKR A;  3ARQ A;  4P8V A;  2ZR6 A;  2WM0 A;  3O5P A;  1JNS A;  1B6C A;  1E6R A;  3EY6 A;  1PIN A;  2G41 A;  1Y0O A;  4P8U A;  2XP9 A;  4FN2 A;  4KQZ A;  4U84 A;  4MNJ A;  3B9D A;  2KI3 A;  4GIV A;  4ODO A;  3CHF A;  4DWS B;  3AS2 A;  3IKD A;  4BF8 A;  1H0G A;  4LAW A;  3ARY A;  2VN1 A;  2F4E A;  2A3C A;  5D75 A;  1EHN A;  4JYS A;  1FKB A;  4DZ3 A;  3OA5 A;  4QT3 A;  2PPO A;  1D7H A;  3KAG A;  5HW8 A;  4MGV A;  3BXW A;  3MDY B;  1J4I A;  1FD9 A;  3OOB A;  4MNM A;  1K9T A;  3KAC A;  4DRI A;  4HBO A;  1FKH A;  2DG9 A;  1UR9 A;  1E15 A;  3G6M A;  1F40 A;  1HKM A;  3O5O A;  1J6Y A;  2ZQV A;  4J4O A;  2KO7 A;  1ZCN A;  3KAH A;  3CZ8 A;  4W9O A;  4NZC A;  1YW5 A;  2DSW A;  1E6N A;  2WK2 A;  1LQ0 A;  4Q7N A;  3LUO A;  4W9Q A;  4DZ2 A;  1EQ3 A;  3H9R B;  4LAX A;  4NNR A;  4DRO A;  2XP6 A;  1BKF A;  2M2A A;  4O2T A;  4FAP A;  1F8A B;  4ODL A;  1Q1C A;  4U85 A;  2RSE A;  2KR7 A;  3ARW A;  3NRK A;  2M08 A;  4QIB A;  2JZV A;  1QZ2 A;  1ZBC A;  1RD6 A;  2DT3 A;  3ARO A;  4JFJ A;  1FKS A;  1ZBV A;  1ZBW A;  1W1T A;  5HBF A;  5DEZ A;  4S3K A;  2ZR5 A;  4ODQ A;  1HXV A;  1FFR A;  1NSG A;  4DH0 A;  1SR0 A;  4ML4 A;  1D7J A;  1LG1 A;  3ARU A;  1KFW A;  5JH8 A;  5DIT A;  4ZPT R;  1ZL1 A;  4WK9 A;  1E6P A;  1P5Q A;  3WQW A;  3PR9 A;  3BMB A;  4NSB A;  4AY1 A;  3B7X A;  2D9F A;  2ZQU A;  2AWG A;  3AS1 A;  4XAK A;  3WL1 A;  1ZU8 A;  4DRQ A;  1A7X A;  2WLY A;  4PTM A;  3O5D A;  3NTP A;  5B8I C;  2O92 A;  3B9A A;  4ODM A;  3PRB A;  2MF9 A;  4DRH A;  2OFN A;  3IK8 A;  3O5L A;  3RME A;  1O6I A;  2DSV A;  1ZK6 A;  2DPE A;  4MTV A;  1E9L A;  1E6Z A;  1HKJ A;  3PRA A;  3O5E A;  5HKG A;  2YBU A;  2Y78 A;  3VAW A;  2KFW A;  3IKG A;  4J4N A;  4P8W A;  4DRN A;  2RUC A;  2XP3 A;  3ARP A;  5DIU A;  3WH0 A;  1XRV A;  3UI5 A;  3GTY X;  1LG2 A;  1T11 A;  4DRM A;  4LGX A;  3EIP A;  3WKZ A;  2PV2 A;  5HT1 A;  4WKH A;  1NWU A;  2VCD A;  3IHZ A;  3WQV A;  2XP5 A;  3CGM A;  1L1P A;  2ITK A;  2XP4 A;  1Q6U A;  2LGO A;  1OGG A;  1LL6 A;  1TFV A;  1W9U A;  4ZPW R;  1EYM A;  4ZPV R;  4DWS A;  1FJD A;  3WIJ A;  1GRJ A;  2MLZ A;  4JFK A;  1HJW A;  2PV1 A;  1C9H A;  1X6N A;  4IPX A;  3UF8 A;  3CHD A;  4GGQ A;  2A3B A;  2MNT A;  2ZR4 A;  4DRP A;  5DIV A;  5GQB A;  1JVW A;  4WKA A;  5J6E A;  1WAW A;  2DT1 A;  2ZQS A;  2LJ4 A;  1EDQ A;  2YBT A;  3KAD A;  3WL0 A;  2M1I A;  2L2S A;  3RFW A;  3WD3 A;  1WB0 A;  2DT2 A;  5BXJ A;  2PBC A;  3FAP A;  2RUR A;  1J4H A;  3AS3 A;  4ODN A;  1M5Y A;  2F21 A;  1FFQ A;  3CHE A;  4DIP A;  3B9E A;  4L72 B;  3KZ7 A;  2WLZ A;  1QPL A;  1FKG A;  2PV3 A;  3RM4 A;  5HUA A;  2RQS A;  1E44 A;  3CH9 A;  3AQU A;  3RM8 A;  1FKI A;  2K8I A;  3KAF A;  2B5U B;  2DSU A;  2AOS A;  4DWS C;  4MPK A;  2A3E A;  4ODK A;  4ODR A;  3TDB A;  2N87 A;  4N19 A;  1HJV A;  3ARS A;  2PPP A;  2OLH A;  1KT0 A;  4QZV B;  1LL4 A;  5HW6 A;  4Q22 A;  1WNO A;  3ALF A;  2DG3 A;  4ITZ A;  1NMV A;  4W5U A;  2P4V A;  3ODK A;  2FAP A;  4Z2J A;  1U79 A;  5DO2 A;  3WD1 A;  3ART A;  3I6C A;  4LAY A;  1NWT A;  4MSP A;  4L3N A;  5HWB A;  2A3A A;  3CGN A;  4UDM A;  3B8S A;  1HKK A;  3ARZ A;  3RM9 A;  4Z2H A;  4HBE A;  1FKT A;  2KE0 A;  4QT2 A;  4G50 A;  2FKE A;  1ZB5 A;  1ROU A;  3UQI A;  4R0X A;  2DT0 A;  4R5E A;  1W1P A;  3G6L A;  4HAR A;  1HJX A;  1W26 A;  1D6O A;  1NMW A;  4DWS D;  4WIW A;  1CTN A;  1J4R A;  1XHG A;  4IT4 A;  1JND A;  3O5J A;  4MNK A;  2RUQ A;  1NWS A;  2XP8 A;  2B31 A;  4Z2K A;  2LPV A;  4WJX A;  4WKF A;  3KAB A;  4JFM A;  3JYJ A;  4DRJ A;  2F23 A;  2O9O A;  2PPN A;  4MNL A;  5GPR A;  3JXV A;  4TNS A;  1W1Y A;  1N1A A;  2FDM A;  4LAV A;  4TW8 A;  1OGB A;  3O5M A;  3AS0 A;  4U86 A;  3O5F A;  3WD4 A;  2MLY A;  1D7I A;  1JNT A;  3PA7 A;  2QF8 A;  4DT4 A;  3UQA A;  5HTG A;  4JFI A;  2ESC A;  4Z2L A;  1IX5 A;  3UI4 A;  4KR0 B;  4IT6 A;  3WD2 A;  3WD0 A;  1SYT A;  4Z2G A;  1LL7 A;  1ROT A;  5GPG A;  1JNE A;  3O5K A;  2DSZ A;  3JYM A;  4DRK A;  4ZS6 A;  2EUL A;  4URI A;  2XPB A;  3CHC A;  3O5Q A;  1W9P A;  3GU0 A;  1PBK A;  2ZQT A;  5DF0 A;  2MLX A;  3RGC A;  5I98 A;  3ARX A;  2XP7 A;  4IQ2 A;  4ODP A;  4TW6 A;  4TW7 A;  1W9V A;  4G2P A;  2LKN A;  3TCZ A;  4W9P A;  1EIB A;  1FKF A;  1OWQ A;  3TC5 A;  1Q6H A;  3FXY A;  4P8X A;  2IUZ A;  1ZBK A;  3ARR A;  1NH6 A;  4MAV A;  1ITX A;  3PRD A;  5HWC A;  1FAP A;  4TYO A;  3O5G A;  2PN0 A;  4TX0 A;  1H0I A;  4S3J A;  3NI6 A;  1Q6I A;  1NWR A;  1VF8 A;  2ETN A;  1TCO C;  3GPK A;  1R9H A;  1X6L A;  4JFL A;  2DG4 A;  2RUD A;  2G8Z A;  2PI6 A;  3O5I A;  1LJY A;  1D2K A;  3QOK A;  3O5R A;  3W4R A;  4Z2I A;  2XPA A;  1JCH B;  2MPH A;  2UZ5 A;  3UI6 A;  1FKJ A;  4IQC A;  1FKL A;  1KT1 A;  1FKK A;  1FKD A;  4C02 B;  3KAI A;  3UQB A;  1HKI A;  1QPF A;  1UR8 A;  1GUV A;  3ARV A;  3KCE A;  1GOI A;  1BL4 A;  3FY1 A;  2IF4 A;  2F2D A;  5HW7 A;  3ALG A;  1W1V A;  2KGJ A; 
#chains in the Genus database with same CATH homology
 2Q5A A;  1GPF A;  1YAT A;  1FKR A;  3ARQ A;  4P8V A;  2ZR6 A;  2WM0 A;  3O5P A;  1JNS A;  1B6C A;  1E6R A;  3EY6 A;  1PIN A;  2G41 A;  1Y0O A;  4P8U A;  2XP9 A;  4FN2 A;  4KQZ A;  4U84 A;  4MNJ A;  3B9D A;  2KI3 A;  4GIV A;  4ODO A;  3CHF A;  4DWS B;  3AS2 A;  3IKD A;  4BF8 A;  1H0G A;  4LAW A;  3ARY A;  2VN1 A;  2F4E A;  2A3C A;  5D75 A;  1EHN A;  4JYS A;  1FKB A;  4DZ3 A;  3OA5 A;  4QT3 A;  2PPO A;  1D7H A;  3KAG A;  5HW8 A;  4MGV A;  3BXW A;  3MDY B;  1J4I A;  1FD9 A;  3OOB A;  4MNM A;  1K9T A;  3KAC A;  4DRI A;  4HBO A;  1FKH A;  2DG9 A;  1UR9 A;  1E15 A;  3G6M A;  1F40 A;  1HKM A;  3O5O A;  1J6Y A;  2ZQV A;  4J4O A;  2KO7 A;  1ZCN A;  3KAH A;  3CZ8 A;  4W9O A;  4NZC A;  1YW5 A;  2DSW A;  1E6N A;  2WK2 A;  1LQ0 A;  4Q7N A;  3LUO A;  4W9Q A;  4DZ2 A;  1EQ3 A;  3H9R B;  4LAX A;  4NNR A;  4DRO A;  2XP6 A;  1BKF A;  2M2A A;  4O2T A;  4FAP A;  1F8A B;  4ODL A;  1Q1C A;  4U85 A;  2RSE A;  2KR7 A;  3ARW A;  3NRK A;  2M08 A;  4QIB A;  2JZV A;  1QZ2 A;  1ZBC A;  1RD6 A;  2DT3 A;  3ARO A;  4JFJ A;  1FKS A;  1ZBV A;  1ZBW A;  1W1T A;  5HBF A;  5DEZ A;  4S3K A;  2ZR5 A;  4ODQ A;  1HXV A;  1FFR A;  1NSG A;  4DH0 A;  1SR0 A;  4ML4 A;  1D7J A;  1LG1 A;  3ARU A;  1KFW A;  5JH8 A;  5DIT A;  4ZPT R;  1ZL1 A;  4WK9 A;  1E6P A;  1P5Q A;  3WQW A;  3PR9 A;  4NSB A;  4AY1 A;  3B7X A;  2D9F A;  2ZQU A;  2AWG A;  3AS1 A;  4XAK A;  3WL1 A;  1ZU8 A;  4DRQ A;  1A7X A;  2WLY A;  4PTM A;  3O5D A;  3NTP A;  5B8I C;  2O92 A;  3B9A A;  4ODM A;  3PRB A;  2MF9 A;  4DRH A;  2OFN A;  3IK8 A;  3O5L A;  3RME A;  1O6I A;  2DSV A;  1ZK6 A;  2DPE A;  4MTV A;  1E9L A;  1E6Z A;  1HKJ A;  3PRA A;  3O5E A;  5HKG A;  2YBU A;  2Y78 A;  3VAW A;  2KFW A;  3IKG A;  4J4N A;  4P8W A;  4DRN A;  2RUC A;  2XP3 A;  3ARP A;  5DIU A;  3WH0 A;  1XRV A;  3UI5 A;  1LG2 A;  1T11 A;  4DRM A;  4LGX A;  3WKZ A;  2PV2 A;  5HT1 A;  4WKH A;  1NWU A;  2VCD A;  3IHZ A;  3WQV A;  2XP5 A;  3CGM A;  1L1P A;  2ITK A;  2XP4 A;  1Q6U A;  2LGO A;  1OGG A;  1LL6 A;  1TFV A;  1W9U A;  4ZPW R;  1EYM A;  4ZPV R;  4DWS A;  1FJD A;  3WIJ A;  2MLZ A;  4JFK A;  1HJW A;  2PV1 A;  1C9H A;  1X6N A;  4IPX A;  3UF8 A;  3CHD A;  4GGQ A;  2A3B A;  2MNT A;  2ZR4 A;  4DRP A;  5DIV A;  5GQB A;  1JVW A;  4WKA A;  5J6E A;  1WAW A;  2DT1 A;  2ZQS A;  2LJ4 A;  1EDQ A;  2YBT A;  3KAD A;  3WL0 A;  2M1I A;  2L2S A;  3RFW A;  3WD3 A;  1WB0 A;  2DT2 A;  5BXJ A;  2PBC A;  3FAP A;  2RUR A;  1J4H A;  3AS3 A;  4ODN A;  1M5Y A;  2F21 A;  1FFQ A;  3CHE A;  4DIP A;  3B9E A;  4L72 B;  3KZ7 A;  2WLZ A;  1QPL A;  1FKG A;  2PV3 A;  3RM4 A;  5HUA A;  2RQS A;  3CH9 A;  3AQU A;  3RM8 A;  1FKI A;  2K8I A;  3KAF A;  4DWS C;  2DSU A;  2AOS A;  4MPK A;  2A3E A;  4ODK A;  4ODR A;  3TDB A;  2N87 A;  4N19 A;  1HJV A;  3ARS A;  2PPP A;  2OLH A;  1KT0 A;  4QZV B;  1LL4 A;  5HW6 A;  4Q22 A;  1WNO A;  3ALF A;  2DG3 A;  4ITZ A;  1NMV A;  4W5U A;  3ODK A;  2FAP A;  4Z2J A;  1U79 A;  5DO2 A;  3WD1 A;  3ART A;  3I6C A;  4LAY A;  1NWT A;  4MSP A;  4L3N A;  5HWB A;  2A3A A;  3CGN A;  3B8S A;  1HKK A;  3ARZ A;  3RM9 A;  4Z2H A;  4HBE A;  1FKT A;  2KE0 A;  4QT2 A;  4G50 A;  2FKE A;  1ZB5 A;  1ROU A;  3UQI A;  4R0X A;  2DT0 A;  4R5E A;  1W1P A;  3G6L A;  4HAR A;  1HJX A;  1W26 A;  1D6O A;  1NMW A;  4DWS D;  4WIW A;  1CTN A;  1J4R A;  1XHG A;  4IT4 A;  1JND A;  3O5J A;  4MNK A;  2RUQ A;  1NWS A;  2XP8 A;  2B31 A;  4Z2K A;  2LPV A;  4WJX A;  4WKF A;  3KAB A;  4JFM A;  3JYJ A;  4DRJ A;  2O9O A;  2PPN A;  4MNL A;  5GPR A;  3JXV A;  4TNS A;  1W1Y A;  1N1A A;  2FDM A;  4LAV A;  4TW8 A;  1OGB A;  3O5M A;  3AS0 A;  4U86 A;  3O5F A;  3WD4 A;  2MLY A;  1D7I A;  1JNT A;  3PA7 A;  2QF8 A;  4DT4 A;  3UQA A;  5HTG A;  4JFI A;  2ESC A;  4Z2L A;  1IX5 A;  3UI4 A;  4KR0 B;  4IT6 A;  3WD2 A;  3WD0 A;  1SYT A;  4Z2G A;  1LL7 A;  1ROT A;  5GPG A;  1JNE A;  3O5K A;  2DSZ A;  3JYM A;  4DRK A;  4ZS6 A;  4URI A;  2XPB A;  3CHC A;  3O5Q A;  1W9P A;  1PBK A;  2ZQT A;  5DF0 A;  2MLX A;  3RGC A;  5I98 A;  3ARX A;  2XP7 A;  4IQ2 A;  4ODP A;  4TW6 A;  4TW7 A;  1W9V A;  4G2P A;  2LKN A;  3TCZ A;  4W9P A;  1EIB A;  1FKF A;  1OWQ A;  3TC5 A;  1Q6H A;  3FXY A;  4P8X A;  2IUZ A;  1ZBK A;  3ARR A;  1NH6 A;  4MAV A;  1ITX A;  3PRD A;  5HWC A;  1FAP A;  4TYO A;  3O5G A;  4TX0 A;  1H0I A;  4S3J A;  3NI6 A;  1Q6I A;  1NWR A;  1VF8 A;  1TCO C;  3GPK A;  1R9H A;  1X6L A;  4JFL A;  2DG4 A;  2RUD A;  2G8Z A;  2PI6 A;  3O5I A;  1LJY A;  1D2K A;  3QOK A;  3O5R A;  3W4R A;  4Z2I A;  2XPA A;  2MPH A;  2UZ5 A;  3UI6 A;  1FKJ A;  4IQC A;  1FKL A;  1KT1 A;  1FKK A;  1FKD A;  4C02 B;  3KAI A;  3UQB A;  1HKI A;  1QPF A;  1UR8 A;  1GUV A;  3ARV A;  3KCE A;  1GOI A;  1BL4 A;  3FY1 A;  2IF4 A;  2F2D A;  5HW7 A;  3ALG A;  1W1V A;  2KGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...