2M1IA

High resolution structure and dynamics of cspina parvulin at physiological temperature
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
GPMGSMADKIKCSHILVKKQGEALAVQERLKAGEKFGKLAKELSIDGGSAKRDGSLGYFGRGKMVKPFEDAAFRLQVGEVSEPVKSEFGYHVIKRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structure and dynamics of CsPinA parvulin at physiological temperature
rcsb
source organism Cenarchaeum symbiosum
molecule tags Isomerase
molecule keywords Parvulin-like peptidyl-prolyl isomerase
total genus 29
structure length 97
sequence length 97
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2m1iA00
3TC5A 1QZ2A 4W9PA 4G50A 1PBKA 3O5OA 2Q5AA 3PRBA 2MPHA 4TW7A 2LPVA 2K8IA 2ITKA 1BL4A 4J4OA 1FJDA 4ODKA 1A7XA 2LKNA 3NI6A 4ODMA 1D7JA 1TCOC 3I6CA 1QPLA 3O5PA 1FAPA 3KAFA 1N1AA 1FKTA 2DG9A 3UI5A 4ODNA 1JNSA 1FKBA 2JZVA 3O5FA 3RFWA 2XP8A 3KCEA 4ODOA 3NTPA 3H9RB 4MGVA 2PPOA 4IQ2A 4LAXA 3UQIA 1F8AB 2KGJA 2ZQTA 2ZQVA 3PA7A 2PV3A 2M08A 1ZCNA 4N19A 2MLXA 4GIVA 4DRIA 3RGCA 2M2AA 5DIVA 1W26A 4U86A 2ZQUA 4ODRA 3O5QA 2ZR4A 4W9QA 5I98A 1EYMA 5B8IC 2DG4A 2XP4A 4U84A 3KACA 3UQBA 2VN1A 3O5MA 4DRMA 1D6OA 4DZ2A 1F40A 2KR7A 1HXVA 2IF4A 3O5IA 4DZ3A 2RUQA 3VAWA 1L1PA 4C02B 3O5LA 3PRDA 2RUDA 5HW6A 1Q6UA 4JFJA 3TDBA 3UI6A 5HWCA 3GPKA 4JFIA 1FKDA 4QIBA 4QT3A 2PBCA 1Q6IA 2M1IA 3EY6A 3JYMA 2MNTA 3KAIA 4LAWA 4DH0A 4TW8A 3O5RA 4O2TA 1QPFA 1FKIA 2L2SA 2OFNA 2XP9A 5HW7A 3IHZA 2XPAA 4DRKA 1J4IA 1J6YA 1NMVA 4JFMA 1D7HA 4QT2A 2MLYA 4FAPA 3UQAA 1J4HA 1Y0OA 2DG3A 1FKHA 4ODLA 4LAVA 2F4EA 3JXVA 4DRPA 2F2DA 2PPNA 2XP3A 2KE0A 1FKKA 4U85A 4TYOA 3JYJA 4DRNA 3O5EA 1YW5A 1JNTA 1FKRA 1R9HA 4DRQA 5HKGA 1M5YA 2N87A 1ROUA 2PV1A 2AWGA 3O5KA 3KZ7A 5GPGA 1T11A 2KI3A 3O5GA 2VCDA 2LJ4A 2MF9A 3CGMA 4JYSA 3TCZA 3B7XA 1P5QA 2RURA 2RSEA 1FKJA 2ZQSA 3O5JA 4IQCA 4JFKA 1Q1CA 5D75A 4R0XA 3KAGA 4TW6A 4J4NA 2ZR5A 3IK8A 2D9FA 5HUAA 4ODPA 2XPBA 2ZR6A 2MLZA 2XP7A 4TNSA 2PV2A 2UZ5A 5HTGA 2XP5A 5DIUA 1ROTA 2KFWA 1ZK6A 1KT1A 2FKEA 1J4RA 4LAYA 3UI4A 5HWBA 1EQ3A 4IPXA 1U79A 1NMWA 1NSGA 1KT0A 3IKGA 3UF8A 3ODKA 2KO7A 1PINA 2PPPA 5BXJA 5J6EA 5HT1A 1JVWA 2FAPA 3FAPA 2RUCA 3NRKA 2F21A 3CGNA 4DRJA 2XP6A 2LGOA 3O5DA 1C9HA 1YATA 4JFLA 4ODQA 1D7IA 1FKFA 3KABA 4BF8A 1B6CA 2RQSA 4FN2A 4DROA 1BKFA 2Y78A 4DIPA 1FKSA 1Q6HA 4NNRA 5DITA 4W9OA 4ITZA 4G2PA 3KAHA 4MSPA 3OOBA 4TX0A 3MDYB 3WH0A 1FKLA 4DT4A 1FD9A 3LUOA 5HW8A 3KADA 3IKDA 4DRHA 4GGQA 1FKGA
chains in the Genus database with same CATH superfamily
3PRBA 1W1YA 2MPHA 1BL4A 4J4OA 4KR0B 1D7JA 3ARZA 1HKMA 1FAPA 1N1AA 2PI6A 4ODNA 2XP8A 3KCEA 4ODOA 4DWSB 3H9RB 4LGXA 2A3BA 2PPOA 4LAXA 3ARXA 4URIA 2ZQTA 2G8ZA 1X6NA 2M08A 4DRIA 2O9OA 2PN0A 3RGCA 1E44A 4KQZA 1NWRA 2ZQUA 4W9QA 2A3CA 5B8IC 4U84A 4L72B 3B8SA 3O5MA 1EDQA 2KR7A 4C02B 5HW6A 4AY1A 1E6PA 2PBCA 3EY6A 3JYMA 4DWSD 3KAIA 3O5RA 5DO2A 1E6NA 3AQUA 3IHZA 4UDMA 4ZPWR 4Z2LA 4FAPA 3UQAA 1D7HA 4QT2A 2MLYA 1GPFA 1J4HA 1Y0OA 2DG3A 4R5EA 5GPRA 2F4EA 2F2DA 2XP3A 2KE0A 1FFRA 3ARQA 4DRNA 1JNTA 1HJWA 4HARA 1R9HA 2DT1A 1ROUA 2PV1A 3WKZA 1E6RA 2LJ4A 2MF9A 3B7XA 1P5QA 3O5JA 5D75A 2ZR5A 2XP7A 4TNSA 2DPEA 2XP5A 3G6LA 2KFWA 1OWQA 1ZK6A 1J4RA 4LAYA 5HWBA 1NSGA 1KT0A 2KO7A 2FAPA 2F21A 2LGOA 3O5DA 4JFLA 1D7IA 1FKFA 4MNLA 4DROA 1GOIA 3AS2A 2Y78A 4G2PA 3KAHA 3WH0A 1FKLA 1WB0A 4WKFA 3KADA 4DWSA 3IKDA 1ZU8A 1FKGA 1QZ2A 4S3JA 4G50A 3FY1A 2DT2A 1ZBVA 4TW7A 1FJDA 4ODMA 1IX5A 3I6CA 3O5PA 3KAFA 3WD2A 4P8UA 2DG9A 3UI5A 1JNSA 1SR0A 2B5UB 3NTPA 2QF8A 4IQ2A 1UR9A 2KGJA 1E6ZA 1ZCNA 4N19A 1HKJA 5DIVA 4ZPVR 4U86A 4ODRA 4MAVA 4DWSC 3WL0A 3KACA 2VN1A 3ARTA 3WIJA 2B31A 1HXVA 2IF4A 1E9LA 4DZ3A 3VAWA 1K9TA 1VF8A 2RUDA 1W9PA 4JFJA 3UI6A 3GPKA 4QT3A 1FKDA 3WD4A 3ARYA 3ARUA 1W1PA 1QPFA 5HW7A 2XP9A 2XPAA 4DRKA 1NMVA 4JFMA 4WJXA 3CZ8A 4LAVA 3JXVA 4HBOA 2PPNA 1XRVA 1FKKA 3JYJA 1ZL1A 1M5YA 2N87A 3O5KA 4MNJA 2ESCA 3KZ7A 4P8VA 2KI3A 3TCZA 2RURA 2ZQSA 1O6IA 4P8WA 4JFKA 1Q1CA 1ZBKA 1EIBA 3ALFA 4TW6A 3IK8A 1GRJA 3ARVA 5HUAA 1HJXA 1W1TA 4MTVA 2OLHA 1JCHB 1W9VA 5HTGA 5DIUA 5HBFA 1KT1A 3UI4A 2FKEA 4WKAA 2G41A 1EQ3A 1U79A 1NMWA 2FDMA 3ODKA 3CHFA 2PPPA 5BXJA 5J6EA 5HT1A 2RUCA 3NRKA 4DRJA 3RM4A 3WD0A 1NH6A 2WLYA 4ODQA 3ARSA 3KABA 2RQSA 3BXWA 1Q6HA 4HBEA 4W9OA 3CHEA 1W9UA 1FD9A 3AS1A 1LQ0A 3PRDA 3TC5A 3EIPA 1NWUA 3G6MA 2ITKA 1A7XA 3NI6A 4IT4A 1TCOC 3AROA 1QPLA 4ZS6A 3B9AA 3RM9A 4PTMA 2YBUA 1WNOA 2JZVA 3O5FA 3RFWA 4IT6A 3ARPA 4MGVA 4P8XA 3UQIA 1ITXA 1F8AB 1XHGA 2ZQVA 3PA7A 1RD6A 3WD3A 2DSWA 2MLXA 2M2AA 2DSUA 1W26A 4WK9A 3O5QA 2ZR4A 5I98A 2DG4A 1SYTA 1HJVA 2XP4A 4DRMA 1D6OA 3WQVA 4DZ2A 5GQBA 1LG2A 3O5IA 3O5LA 2ETNA 1Q6UA 5HWCA 4JFIA 3GTYX 4LAWA 3PR9A 4NSBA 4O2TA 2L2SA 2DSVA 1J4IA 1EHNA 2YBTA 4ODLA 4DRPA 2IUZA 4Z2GA 1YW5A 2WM0A 4Q7NA 1FKRA 4Q22A 5HKGA 4MNMA 2AWGA 1T11A 3O5GA 2VCDA 3WD1A 4XAKA 4IQCA 1JNEA 1HKIA 3CHDA 3WL1A 4Z2IA 2D9FA 4ODPA 2XPBA 2ZR6A 4QZVB 1KFWA 1NWTA 2UZ5A 3W4RA 2P4VA 4MPKA 4WKHA 3IKGA 3UF8A 1H0GA 2WK2A 1PINA 1JVWA 3FAPA 3ARWA 1ZBCA 1C9HA 1YATA 2AOSA 4BF8A 1B6CA 4FN2A 1BKFA 4DIPA 1WAWA 1W1VA 1FKSA 1OGGA 4WIWA 4ITZA 1GUVA 4MSPA 5DEZA 3OOBA 3MDYB 1TFVA 4W5UA 1LG1A 4DRHA 1E15A 4W9PA 1PBKA 3O5OA 2Q5AA 3PRAA 2LPVA 2K8IA 4ODKA 2LKNA 1H0IA 1NWSA 1ZB5A 1OGBA 1FKTA 1FKBA 3AS0A 2PV3A 3AS3A 4GIVA 1LL4A 2DT3A 1JNDA 4MNKA 3CHCA 1EYMA 4ML4A 3FXYA 5JH8A 3UQBA 3B9DA 1F40A 2RUQA 1L1PA 3QOKA 3TDBA 4QIBA 3RMEA 1Q6IA 2M1IA 4DH0A 2MNTA 1FKIA 2OFNA 2A3EA 3ALGA 1J6YA 2DSZA 3OA5A 1FKHA 4U85A 4TYOA 3GU0A 3O5EA 2EULA 4DRQA 1ZBWA 5GPGA 2O92A 4JYSA 3CGMA 1UR8A 2RSEA 1FKJA 4L3NA 4R0XA 1CTNA 3KAGA 4J4NA 3BMBA 2A3AA 5DF0A 2MLZA 1X6LA 2PV2A 3ARRA 1ROTA 2DT0A 4S3KA 1LJYA 4IPXA 4Z2KA 3CGNA 4Z2HA 3WQWA 2XP6A 3B9EA 4ZPTR 2F23A 4Z2JA 3RM8A 4NNRA 5DITA 1HKKA 4NZCA 1FFQA 1D2KA 3CH9A 4TX0A 2WLZA 4DT4A 5HW8A 3LUOA 1LL7A 1LL6A 4TW8A 4GGQA
chains in the Genus database with same CATH topology
3PRBA 1W1YA 2MPHA 1BL4A 4J4OA 4KR0B 1D7JA 3ARZA 1HKMA 1FAPA 1N1AA 2PI6A 4ODNA 2XP8A 3KCEA 4ODOA 4DWSB 3H9RB 4LGXA 2A3BA 2PPOA 4LAXA 3ARXA 4URIA 2ZQTA 2G8ZA 1X6NA 2M08A 4DRIA 2O9OA 3RGCA 1NWRA 2ZQUA 4W9QA 2A3CA 5B8IC 4U84A 4L72B 3B8SA 3O5MA 1EDQA 2KR7A 4C02B 5HW6A 4AY1A 1E6PA 2PBCA 3EY6A 3JYMA 4DWSD 3KAIA 3O5RA 5DO2A 1E6NA 3AQUA 3IHZA 4ZPWR 4Z2LA 4FAPA 3UQAA 1D7HA 4QT2A 2MLYA 1GPFA 1J4HA 1Y0OA 2DG3A 4R5EA 5GPRA 2F4EA 2F2DA 2XP3A 2KE0A 1FFRA 3ARQA 4DRNA 1JNTA 1HJWA 4HARA 1R9HA 2DT1A 1ROUA 2PV1A 3WKZA 1E6RA 2LJ4A 2MF9A 3B7XA 1P5QA 3O5JA 5D75A 2ZR5A 2XP7A 4TNSA 2DPEA 2XP5A 3G6LA 2KFWA 1OWQA 1ZK6A 1J4RA 4LAYA 5HWBA 1NSGA 1KT0A 2KO7A 2FAPA 2F21A 2LGOA 3O5DA 4JFLA 1D7IA 1FKFA 4MNLA 4DROA 1GOIA 3AS2A 2Y78A 4G2PA 3KAHA 3WH0A 1FKLA 1WB0A 4WKFA 3KADA 4DWSA 3IKDA 1ZU8A 1FKGA 1QZ2A 4S3JA 4G50A 3FY1A 2DT2A 1ZBVA 4TW7A 1FJDA 4ODMA 1IX5A 3I6CA 3O5PA 3KAFA 3WD2A 4P8UA 2DG9A 3UI5A 1JNSA 1SR0A 3NTPA 2QF8A 4IQ2A 1UR9A 2KGJA 1E6ZA 1ZCNA 4N19A 1HKJA 5DIVA 4ZPVR 4U86A 4ODRA 4MAVA 4DWSC 3WL0A 3KACA 2VN1A 3ARTA 3WIJA 2B31A 1HXVA 2IF4A 1E9LA 4DZ3A 3VAWA 1K9TA 1VF8A 2RUDA 1W9PA 4JFJA 3UI6A 3GPKA 4QT3A 1FKDA 3WD4A 3ARYA 3ARUA 1W1PA 1QPFA 5HW7A 2XP9A 2XPAA 4DRKA 1NMVA 4JFMA 4WJXA 3CZ8A 4LAVA 3JXVA 4HBOA 2PPNA 1XRVA 1FKKA 3JYJA 1ZL1A 1M5YA 2N87A 3O5KA 4MNJA 2ESCA 3KZ7A 4P8VA 2KI3A 3TCZA 2RURA 2ZQSA 1O6IA 4P8WA 4JFKA 1Q1CA 1ZBKA 1EIBA 3ALFA 4TW6A 3IK8A 3ARVA 5HUAA 1HJXA 1W1TA 4MTVA 2OLHA 1W9VA 5HTGA 5DIUA 5HBFA 1KT1A 3UI4A 2FKEA 4WKAA 2G41A 1EQ3A 1U79A 1NMWA 2FDMA 3ODKA 3CHFA 2PPPA 5BXJA 5J6EA 5HT1A 2RUCA 3NRKA 4DRJA 3RM4A 3WD0A 1NH6A 2WLYA 4ODQA 3ARSA 3KABA 2RQSA 3BXWA 1Q6HA 4HBEA 4W9OA 3CHEA 1W9UA 1FD9A 3AS1A 1LQ0A 3PRDA 3TC5A 1NWUA 3G6MA 2ITKA 1A7XA 3NI6A 4IT4A 1TCOC 3AROA 1QPLA 4ZS6A 3B9AA 3RM9A 4PTMA 2YBUA 1WNOA 2JZVA 3O5FA 3RFWA 4IT6A 3ARPA 4MGVA 4P8XA 3UQIA 1ITXA 1F8AB 1XHGA 2ZQVA 3PA7A 1RD6A 3WD3A 2DSWA 2MLXA 2M2AA 2DSUA 1W26A 4WK9A 3O5QA 2ZR4A 5I98A 2DG4A 1SYTA 1HJVA 2XP4A 4DRMA 1D6OA 3WQVA 4DZ2A 5GQBA 1LG2A 3O5IA 3O5LA 1Q6UA 5HWCA 4JFIA 4LAWA 3PR9A 4NSBA 4O2TA 2L2SA 2DSVA 1J4IA 1EHNA 2YBTA 4ODLA 4DRPA 2IUZA 4Z2GA 1YW5A 2WM0A 4Q7NA 1FKRA 4Q22A 5HKGA 4MNMA 2AWGA 1T11A 3O5GA 2VCDA 3WD1A 4XAKA 4IQCA 1JNEA 1HKIA 3CHDA 3WL1A 4Z2IA 2D9FA 4ODPA 2XPBA 2ZR6A 4QZVB 1KFWA 1NWTA 2UZ5A 3W4RA 4MPKA 4WKHA 3IKGA 3UF8A 1H0GA 2WK2A 1PINA 1JVWA 3FAPA 3ARWA 1ZBCA 1C9HA 1YATA 2AOSA 4BF8A 1B6CA 4FN2A 1BKFA 4DIPA 1WAWA 1W1VA 1FKSA 1OGGA 4WIWA 4ITZA 1GUVA 4MSPA 5DEZA 3OOBA 3MDYB 1TFVA 4W5UA 1LG1A 4DRHA 1E15A 4W9PA 1PBKA 3O5OA 2Q5AA 3PRAA 2LPVA 2K8IA 4ODKA 2LKNA 1H0IA 1NWSA 1ZB5A 1OGBA 1FKTA 1FKBA 3AS0A 2PV3A 3AS3A 4GIVA 1LL4A 2DT3A 1JNDA 4MNKA 4GGQA 3CHCA 1EYMA 4ML4A 3FXYA 5JH8A 3UQBA 3B9DA 1F40A 2RUQA 1L1PA 3QOKA 3TDBA 4QIBA 3RMEA 1Q6IA 2M1IA 4DH0A 2MNTA 1FKIA 2OFNA 2A3EA 3ALGA 1J6YA 2DSZA 3OA5A 1FKHA 4U85A 4TYOA 3O5EA 4DRQA 1ZBWA 5GPGA 2O92A 4JYSA 3CGMA 1UR8A 2RSEA 1FKJA 4L3NA 4R0XA 1CTNA 3KAGA 4J4NA 2A3AA 5DF0A 2MLZA 1X6LA 2PV2A 3ARRA 1ROTA 2DT0A 4S3KA 1LJYA 4IPXA 4Z2KA 3CGNA 4Z2HA 3WQWA 2XP6A 3B9EA 4ZPTR 4Z2JA 3RM8A 4NNRA 5DITA 1HKKA 4NZCA 1FFQA 1D2KA 3CH9A 4TX0A 2WLZA 4DT4A 5HW8A 3LUOA 1LL7A 1LL6A 4TW8A 4KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC5 A;  1QZ2 A;  4W9P A;  4G50 A;  1PBK A;  3O5O A;  2Q5A A;  3PRB A;  2MPH A;  4TW7 A;  2LPV A;  2K8I A;  2ITK A;  1BL4 A;  4J4O A;  1FJD A;  4ODK A;  1A7X A;  2LKN A;  3NI6 A;  4ODM A;  1D7J A;  1TCO C;  3I6C A;  1QPL A;  3O5P A;  1FAP A;  3KAF A;  1N1A A;  1FKT A;  2DG9 A;  3UI5 A;  4ODN A;  1JNS A;  1FKB A;  2JZV A;  3O5F A;  3RFW A;  2XP8 A;  3KCE A;  4ODO A;  3NTP A;  3H9R B;  4MGV A;  2PPO A;  4IQ2 A;  4LAX A;  3UQI A;  1F8A B;  2KGJ A;  2ZQT A;  2ZQV A;  3PA7 A;  2PV3 A;  2M08 A;  1ZCN A;  4N19 A;  2MLX A;  4GIV A;  4DRI A;  3RGC A;  2M2A A;  5DIV A;  1W26 A;  4U86 A;  2ZQU A;  4ODR A;  3O5Q A;  2ZR4 A;  4W9Q A;  5I98 A;  1EYM A;  5B8I C;  2DG4 A;  2XP4 A;  4U84 A;  3KAC A;  3UQB A;  2VN1 A;  3O5M A;  4DRM A;  1D6O A;  4DZ2 A;  1F40 A;  2KR7 A;  1HXV A;  2IF4 A;  3O5I A;  4DZ3 A;  2RUQ A;  3VAW A;  1L1P A;  4C02 B;  3O5L A;  3PRD A;  2RUD A;  5HW6 A;  1Q6U A;  4JFJ A;  3TDB A;  3UI6 A;  5HWC A;  3GPK A;  4JFI A;  1FKD A;  4QIB A;  4QT3 A;  2PBC A;  1Q6I A;  2M1I A;  3EY6 A;  3JYM A;  2MNT A;  3KAI A;  4LAW A;  4DH0 A;  4TW8 A;  3O5R A;  4O2T A;  1QPF A;  1FKI A;  2L2S A;  2OFN A;  2XP9 A;  5HW7 A;  3IHZ A;  2XPA A;  4DRK A;  1J4I A;  1J6Y A;  1NMV A;  4JFM A;  1D7H A;  4QT2 A;  2MLY A;  4FAP A;  3UQA A;  1J4H A;  1Y0O A;  2DG3 A;  1FKH A;  4ODL A;  4LAV A;  2F4E A;  3JXV A;  4DRP A;  2F2D A;  2PPN A;  2XP3 A;  2KE0 A;  1FKK A;  4U85 A;  4TYO A;  3JYJ A;  4DRN A;  3O5E A;  1YW5 A;  1JNT A;  1FKR A;  1R9H A;  4DRQ A;  5HKG A;  1M5Y A;  2N87 A;  1ROU A;  2PV1 A;  2AWG A;  3O5K A;  3KZ7 A;  5GPG A;  1T11 A;  2KI3 A;  3O5G A;  2VCD A;  2LJ4 A;  2MF9 A;  3CGM A;  4JYS A;  3TCZ A;  3B7X A;  1P5Q A;  2RUR A;  2RSE A;  1FKJ A;  2ZQS A;  3O5J A;  4IQC A;  4JFK A;  1Q1C A;  5D75 A;  4R0X A;  3KAG A;  4TW6 A;  4J4N A;  2ZR5 A;  3IK8 A;  2D9F A;  5HUA A;  4ODP A;  2XPB A;  2ZR6 A;  2MLZ A;  2XP7 A;  4TNS A;  2PV2 A;  2UZ5 A;  5HTG A;  2XP5 A;  5DIU A;  1ROT A;  2KFW A;  1ZK6 A;  1KT1 A;  2FKE A;  1J4R A;  4LAY A;  3UI4 A;  5HWB A;  1EQ3 A;  4IPX A;  1U79 A;  1NMW A;  1NSG A;  1KT0 A;  3IKG A;  3UF8 A;  3ODK A;  2KO7 A;  1PIN A;  2PPP A;  5BXJ A;  5J6E A;  5HT1 A;  1JVW A;  2FAP A;  3FAP A;  2RUC A;  3NRK A;  2F21 A;  3CGN A;  4DRJ A;  2XP6 A;  2LGO A;  3O5D A;  1C9H A;  1YAT A;  4JFL A;  4ODQ A;  1D7I A;  1FKF A;  3KAB A;  4BF8 A;  1B6C A;  2RQS A;  4FN2 A;  4DRO A;  1BKF A;  2Y78 A;  4DIP A;  1FKS A;  1Q6H A;  4NNR A;  5DIT A;  4W9O A;  4ITZ A;  4G2P A;  3KAH A;  4MSP A;  3OOB A;  4TX0 A;  3MDY B;  3WH0 A;  1FKL A;  4DT4 A;  1FD9 A;  3LUO A;  5HW8 A;  3KAD A;  3IKD A;  4DRH A;  4GGQ A;  1FKG A; 
#chains in the Genus database with same CATH topology
 3PRB A;  1W1Y A;  2MPH A;  1BL4 A;  4J4O A;  4KR0 B;  1D7J A;  3ARZ A;  1HKM A;  1FAP A;  1N1A A;  2PI6 A;  4ODN A;  2XP8 A;  3KCE A;  4ODO A;  4DWS B;  3H9R B;  4LGX A;  2A3B A;  2PPO A;  4LAX A;  3ARX A;  4URI A;  2ZQT A;  2G8Z A;  1X6N A;  2M08 A;  4DRI A;  2O9O A;  2PN0 A;  3RGC A;  1E44 A;  4KQZ A;  1NWR A;  2ZQU A;  4W9Q A;  2A3C A;  5B8I C;  4U84 A;  4L72 B;  3B8S A;  3O5M A;  1EDQ A;  2KR7 A;  4C02 B;  5HW6 A;  4AY1 A;  1E6P A;  2PBC A;  3EY6 A;  3JYM A;  4DWS D;  3KAI A;  3O5R A;  5DO2 A;  1E6N A;  3AQU A;  3IHZ A;  4UDM A;  4ZPW R;  4Z2L A;  4FAP A;  3UQA A;  1D7H A;  4QT2 A;  2MLY A;  1GPF A;  1J4H A;  1Y0O A;  2DG3 A;  4R5E A;  5GPR A;  2F4E A;  2F2D A;  2XP3 A;  2KE0 A;  1FFR A;  3ARQ A;  4DRN A;  1JNT A;  1HJW A;  4HAR A;  1R9H A;  2DT1 A;  1ROU A;  2PV1 A;  3WKZ A;  1E6R A;  2LJ4 A;  2MF9 A;  3B7X A;  1P5Q A;  3O5J A;  5D75 A;  2ZR5 A;  2XP7 A;  4TNS A;  2DPE A;  2XP5 A;  3G6L A;  2KFW A;  1OWQ A;  1ZK6 A;  1J4R A;  4LAY A;  5HWB A;  1NSG A;  1KT0 A;  2KO7 A;  2FAP A;  2F21 A;  2LGO A;  3O5D A;  4JFL A;  1D7I A;  1FKF A;  4MNL A;  4DRO A;  1GOI A;  3AS2 A;  2Y78 A;  4G2P A;  3KAH A;  3WH0 A;  1FKL A;  1WB0 A;  4WKF A;  3KAD A;  4DWS A;  3IKD A;  1ZU8 A;  1FKG A;  1QZ2 A;  4S3J A;  4G50 A;  3FY1 A;  2DT2 A;  1ZBV A;  4TW7 A;  1FJD A;  4ODM A;  1IX5 A;  3I6C A;  3O5P A;  3KAF A;  3WD2 A;  4P8U A;  2DG9 A;  3UI5 A;  1JNS A;  1SR0 A;  2B5U B;  3NTP A;  2QF8 A;  4IQ2 A;  1UR9 A;  2KGJ A;  1E6Z A;  1ZCN A;  4N19 A;  1HKJ A;  5DIV A;  4ZPV R;  4U86 A;  4ODR A;  4MAV A;  4DWS C;  3WL0 A;  3KAC A;  2VN1 A;  3ART A;  3WIJ A;  2B31 A;  1HXV A;  2IF4 A;  1E9L A;  4DZ3 A;  3VAW A;  1K9T A;  1VF8 A;  2RUD A;  1W9P A;  4JFJ A;  3UI6 A;  3GPK A;  4QT3 A;  1FKD A;  3WD4 A;  3ARY A;  3ARU A;  1W1P A;  1QPF A;  5HW7 A;  2XP9 A;  2XPA A;  4DRK A;  1NMV A;  4JFM A;  4WJX A;  3CZ8 A;  4LAV A;  3JXV A;  4HBO A;  2PPN A;  1XRV A;  1FKK A;  3JYJ A;  1ZL1 A;  1M5Y A;  2N87 A;  3O5K A;  4MNJ A;  2ESC A;  3KZ7 A;  4P8V A;  2KI3 A;  3TCZ A;  2RUR A;  2ZQS A;  1O6I A;  4P8W A;  4JFK A;  1Q1C A;  1ZBK A;  1EIB A;  3ALF A;  4TW6 A;  3IK8 A;  1GRJ A;  3ARV A;  5HUA A;  1HJX A;  1W1T A;  4MTV A;  2OLH A;  1JCH B;  1W9V A;  5HTG A;  5DIU A;  5HBF A;  1KT1 A;  3UI4 A;  2FKE A;  4WKA A;  2G41 A;  1EQ3 A;  1U79 A;  1NMW A;  2FDM A;  3ODK A;  3CHF A;  2PPP A;  5BXJ A;  5J6E A;  5HT1 A;  2RUC A;  3NRK A;  4DRJ A;  3RM4 A;  3WD0 A;  1NH6 A;  2WLY A;  4ODQ A;  3ARS A;  3KAB A;  2RQS A;  3BXW A;  1Q6H A;  4HBE A;  4W9O A;  3CHE A;  1W9U A;  1FD9 A;  3AS1 A;  1LQ0 A;  3PRD A;  3TC5 A;  3EIP A;  1NWU A;  3G6M A;  2ITK A;  1A7X A;  3NI6 A;  4IT4 A;  1TCO C;  3ARO A;  1QPL A;  4ZS6 A;  3B9A A;  3RM9 A;  4PTM A;  2YBU A;  1WNO A;  2JZV A;  3O5F A;  3RFW A;  4IT6 A;  3ARP A;  4MGV A;  4P8X A;  3UQI A;  1ITX A;  1F8A B;  1XHG A;  2ZQV A;  3PA7 A;  1RD6 A;  3WD3 A;  2DSW A;  2MLX A;  2M2A A;  2DSU A;  1W26 A;  4WK9 A;  3O5Q A;  2ZR4 A;  5I98 A;  2DG4 A;  1SYT A;  1HJV A;  2XP4 A;  4DRM A;  1D6O A;  3WQV A;  4DZ2 A;  5GQB A;  1LG2 A;  3O5I A;  3O5L A;  2ETN A;  1Q6U A;  5HWC A;  4JFI A;  3GTY X;  4LAW A;  3PR9 A;  4NSB A;  4O2T A;  2L2S A;  2DSV A;  1J4I A;  1EHN A;  2YBT A;  4ODL A;  4DRP A;  2IUZ A;  4Z2G A;  1YW5 A;  2WM0 A;  4Q7N A;  1FKR A;  4Q22 A;  5HKG A;  4MNM A;  2AWG A;  1T11 A;  3O5G A;  2VCD A;  3WD1 A;  4XAK A;  4IQC A;  1JNE A;  1HKI A;  3CHD A;  3WL1 A;  4Z2I A;  2D9F A;  4ODP A;  2XPB A;  2ZR6 A;  4QZV B;  1KFW A;  1NWT A;  2UZ5 A;  3W4R A;  2P4V A;  4MPK A;  4WKH A;  3IKG A;  3UF8 A;  1H0G A;  2WK2 A;  1PIN A;  1JVW A;  3FAP A;  3ARW A;  1ZBC A;  1C9H A;  1YAT A;  2AOS A;  4BF8 A;  1B6C A;  4FN2 A;  1BKF A;  4DIP A;  1WAW A;  1W1V A;  1FKS A;  1OGG A;  4WIW A;  4ITZ A;  1GUV A;  4MSP A;  5DEZ A;  3OOB A;  3MDY B;  1TFV A;  4W5U A;  1LG1 A;  4DRH A;  1E15 A;  4W9P A;  1PBK A;  3O5O A;  2Q5A A;  3PRA A;  2LPV A;  2K8I A;  4ODK A;  2LKN A;  1H0I A;  1NWS A;  1ZB5 A;  1OGB A;  1FKT A;  1FKB A;  3AS0 A;  2PV3 A;  3AS3 A;  4GIV A;  1LL4 A;  2DT3 A;  1JND A;  4MNK A;  3CHC A;  1EYM A;  4ML4 A;  3FXY A;  5JH8 A;  3UQB A;  3B9D A;  1F40 A;  2RUQ A;  1L1P A;  3QOK A;  3TDB A;  4QIB A;  3RME A;  1Q6I A;  2M1I A;  4DH0 A;  2MNT A;  1FKI A;  2OFN A;  2A3E A;  3ALG A;  1J6Y A;  2DSZ A;  3OA5 A;  1FKH A;  4U85 A;  4TYO A;  3GU0 A;  3O5E A;  2EUL A;  4DRQ A;  1ZBW A;  5GPG A;  2O92 A;  4JYS A;  3CGM A;  1UR8 A;  2RSE A;  1FKJ A;  4L3N A;  4R0X A;  1CTN A;  3KAG A;  4J4N A;  3BMB A;  2A3A A;  5DF0 A;  2MLZ A;  1X6L A;  2PV2 A;  3ARR A;  1ROT A;  2DT0 A;  4S3K A;  1LJY A;  4IPX A;  4Z2K A;  3CGN A;  4Z2H A;  3WQW A;  2XP6 A;  3B9E A;  4ZPT R;  2F23 A;  4Z2J A;  3RM8 A;  4NNR A;  5DIT A;  1HKK A;  4NZC A;  1FFQ A;  1D2K A;  3CH9 A;  4TX0 A;  2WLZ A;  4DT4 A;  5HW8 A;  3LUO A;  1LL7 A;  1LL6 A;  4TW8 A;  4GGQ A; 
#chains in the Genus database with same CATH homology
 3PRB A;  1W1Y A;  2MPH A;  1BL4 A;  4J4O A;  4KR0 B;  1D7J A;  3ARZ A;  1HKM A;  1FAP A;  1N1A A;  2PI6 A;  4ODN A;  2XP8 A;  3KCE A;  4ODO A;  4DWS B;  3H9R B;  4LGX A;  2A3B A;  2PPO A;  4LAX A;  3ARX A;  4URI A;  2ZQT A;  2G8Z A;  1X6N A;  2M08 A;  4DRI A;  2O9O A;  3RGC A;  1NWR A;  2ZQU A;  4W9Q A;  2A3C A;  5B8I C;  4U84 A;  4L72 B;  3B8S A;  3O5M A;  1EDQ A;  2KR7 A;  4C02 B;  5HW6 A;  4AY1 A;  1E6P A;  2PBC A;  3EY6 A;  3JYM A;  4DWS D;  3KAI A;  3O5R A;  5DO2 A;  1E6N A;  3AQU A;  3IHZ A;  4ZPW R;  4Z2L A;  4FAP A;  3UQA A;  1D7H A;  4QT2 A;  2MLY A;  1GPF A;  1J4H A;  1Y0O A;  2DG3 A;  4R5E A;  5GPR A;  2F4E A;  2F2D A;  2XP3 A;  2KE0 A;  1FFR A;  3ARQ A;  4DRN A;  1JNT A;  1HJW A;  4HAR A;  1R9H A;  2DT1 A;  1ROU A;  2PV1 A;  3WKZ A;  1E6R A;  2LJ4 A;  2MF9 A;  3B7X A;  1P5Q A;  3O5J A;  5D75 A;  2ZR5 A;  2XP7 A;  4TNS A;  2DPE A;  2XP5 A;  3G6L A;  2KFW A;  1OWQ A;  1ZK6 A;  1J4R A;  4LAY A;  5HWB A;  1NSG A;  1KT0 A;  2KO7 A;  2FAP A;  2F21 A;  2LGO A;  3O5D A;  4JFL A;  1D7I A;  1FKF A;  4MNL A;  4DRO A;  1GOI A;  3AS2 A;  2Y78 A;  4G2P A;  3KAH A;  3WH0 A;  1FKL A;  1WB0 A;  4WKF A;  3KAD A;  4DWS A;  3IKD A;  1ZU8 A;  1FKG A;  1QZ2 A;  4S3J A;  4G50 A;  3FY1 A;  2DT2 A;  1ZBV A;  4TW7 A;  1FJD A;  4ODM A;  1IX5 A;  3I6C A;  3O5P A;  3KAF A;  3WD2 A;  4P8U A;  2DG9 A;  3UI5 A;  1JNS A;  1SR0 A;  3NTP A;  2QF8 A;  4IQ2 A;  1UR9 A;  2KGJ A;  1E6Z A;  1ZCN A;  4N19 A;  1HKJ A;  5DIV A;  4ZPV R;  4U86 A;  4ODR A;  4MAV A;  4DWS C;  3WL0 A;  3KAC A;  2VN1 A;  3ART A;  3WIJ A;  2B31 A;  1HXV A;  2IF4 A;  1E9L A;  4DZ3 A;  3VAW A;  1K9T A;  1VF8 A;  2RUD A;  1W9P A;  4JFJ A;  3UI6 A;  3GPK A;  4QT3 A;  1FKD A;  3WD4 A;  3ARY A;  3ARU A;  1W1P A;  1QPF A;  5HW7 A;  2XP9 A;  2XPA A;  4DRK A;  1NMV A;  4JFM A;  4WJX A;  3CZ8 A;  4LAV A;  3JXV A;  4HBO A;  2PPN A;  1XRV A;  1FKK A;  3JYJ A;  1ZL1 A;  1M5Y A;  2N87 A;  3O5K A;  4MNJ A;  2ESC A;  3KZ7 A;  4P8V A;  2KI3 A;  3TCZ A;  2RUR A;  2ZQS A;  1O6I A;  4P8W A;  4JFK A;  1Q1C A;  1ZBK A;  1EIB A;  3ALF A;  4TW6 A;  3IK8 A;  3ARV A;  5HUA A;  1HJX A;  1W1T A;  4MTV A;  2OLH A;  1W9V A;  5HTG A;  5DIU A;  5HBF A;  1KT1 A;  3UI4 A;  2FKE A;  4WKA A;  2G41 A;  1EQ3 A;  1U79 A;  1NMW A;  2FDM A;  3ODK A;  3CHF A;  2PPP A;  5BXJ A;  5J6E A;  5HT1 A;  2RUC A;  3NRK A;  4DRJ A;  3RM4 A;  3WD0 A;  1NH6 A;  2WLY A;  4ODQ A;  3ARS A;  3KAB A;  2RQS A;  3BXW A;  1Q6H A;  4HBE A;  4W9O A;  3CHE A;  1W9U A;  1FD9 A;  3AS1 A;  1LQ0 A;  3PRD A;  3TC5 A;  1NWU A;  3G6M A;  2ITK A;  1A7X A;  3NI6 A;  4IT4 A;  1TCO C;  3ARO A;  1QPL A;  4ZS6 A;  3B9A A;  3RM9 A;  4PTM A;  2YBU A;  1WNO A;  2JZV A;  3O5F A;  3RFW A;  4IT6 A;  3ARP A;  4MGV A;  4P8X A;  3UQI A;  1ITX A;  1F8A B;  1XHG A;  2ZQV A;  3PA7 A;  1RD6 A;  3WD3 A;  2DSW A;  2MLX A;  2M2A A;  2DSU A;  1W26 A;  4WK9 A;  3O5Q A;  2ZR4 A;  5I98 A;  2DG4 A;  1SYT A;  1HJV A;  2XP4 A;  4DRM A;  1D6O A;  3WQV A;  4DZ2 A;  5GQB A;  1LG2 A;  3O5I A;  3O5L A;  1Q6U A;  5HWC A;  4JFI A;  4LAW A;  3PR9 A;  4NSB A;  4O2T A;  2L2S A;  2DSV A;  1J4I A;  1EHN A;  2YBT A;  4ODL A;  4DRP A;  2IUZ A;  4Z2G A;  1YW5 A;  2WM0 A;  4Q7N A;  1FKR A;  4Q22 A;  5HKG A;  4MNM A;  2AWG A;  1T11 A;  3O5G A;  2VCD A;  3WD1 A;  4XAK A;  4IQC A;  1JNE A;  1HKI A;  3CHD A;  3WL1 A;  4Z2I A;  2D9F A;  4ODP A;  2XPB A;  2ZR6 A;  4QZV B;  1KFW A;  1NWT A;  2UZ5 A;  3W4R A;  4MPK A;  4WKH A;  3IKG A;  3UF8 A;  1H0G A;  2WK2 A;  1PIN A;  1JVW A;  3FAP A;  3ARW A;  1ZBC A;  1C9H A;  1YAT A;  2AOS A;  4BF8 A;  1B6C A;  4FN2 A;  1BKF A;  4DIP A;  1WAW A;  1W1V A;  1FKS A;  1OGG A;  4WIW A;  4ITZ A;  1GUV A;  4MSP A;  5DEZ A;  3OOB A;  3MDY B;  1TFV A;  4W5U A;  1LG1 A;  4DRH A;  1E15 A;  4W9P A;  1PBK A;  3O5O A;  2Q5A A;  3PRA A;  2LPV A;  2K8I A;  4ODK A;  2LKN A;  1H0I A;  1NWS A;  1ZB5 A;  1OGB A;  1FKT A;  1FKB A;  3AS0 A;  2PV3 A;  3AS3 A;  4GIV A;  1LL4 A;  2DT3 A;  1JND A;  4MNK A;  4GGQ A;  3CHC A;  1EYM A;  4ML4 A;  3FXY A;  5JH8 A;  3UQB A;  3B9D A;  1F40 A;  2RUQ A;  1L1P A;  3QOK A;  3TDB A;  4QIB A;  3RME A;  1Q6I A;  2M1I A;  4DH0 A;  2MNT A;  1FKI A;  2OFN A;  2A3E A;  3ALG A;  1J6Y A;  2DSZ A;  3OA5 A;  1FKH A;  4U85 A;  4TYO A;  3O5E A;  4DRQ A;  1ZBW A;  5GPG A;  2O92 A;  4JYS A;  3CGM A;  1UR8 A;  2RSE A;  1FKJ A;  4L3N A;  4R0X A;  1CTN A;  3KAG A;  4J4N A;  2A3A A;  5DF0 A;  2MLZ A;  1X6L A;  2PV2 A;  3ARR A;  1ROT A;  2DT0 A;  4S3K A;  1LJY A;  4IPX A;  4Z2K A;  3CGN A;  4Z2H A;  3WQW A;  2XP6 A;  3B9E A;  4ZPT R;  4Z2J A;  3RM8 A;  4NNR A;  5DIT A;  1HKK A;  4NZC A;  1FFQ A;  1D2K A;  3CH9 A;  4TX0 A;  2WLZ A;  4DT4 A;  5HW8 A;  3LUO A;  1LL7 A;  1LL6 A;  4TW8 A;  4KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...