1KT0A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
380
structure length
357
Chain Sequence
VLKIVTPMIGDKVYVHYKGKLFDSPFVFSLGKGQVIKAWDIGVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNERDRRIYANM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 51 KDA FK506-BINDING PROTEIN
publication title Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 357
sequence length 380
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt0A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A02
1JNSA 1ZK6A 4JYSA 4YVOA 3QWVA 1W3BA 3JYSA 3UQ3A 5BXJA 4DRQA 2RUCA 3KD7A 4NRHB 5CHEE 5DBKA 1JNTA 5A7DB 2DG3A 2LSVA 2MPHA 4YVQC 4ODRA 4JFIA 2UWJG 4ODNA 3S7FA 3MDYB 3IK8A 2ZQTA 2PQNA 3LCAA 5G05J 3RU0A 1M5YA 2UZ5A 3JXVA 4DRKA 4GZ5A 4JL0A 2PV1A 2HR2A 2R5SA 1N1AA 1XNFA 5G05C 3QWWA 2FBNA 1P5QA 2L6JA 3K9IA 4N19A 2XPBA 4KBQA 5JJ6A 1Q1CA 4N3BA 5HKGA 4GA0A 4DH0A 2ZQUA 4O2TA 4G23A 2HO1A 4LAXA 4J8DA 3WXXA 4NNRA 1IYGA 4WNEA 4DRNA 2PZIA 3RO3A 5KJMA 2JZVA 2VSNA 1YA0A 4W9OA 3OOBA 2Y4TA 5HW6A 5BT1A 5I98A 3O5KA 4R0XA 3TDBA 1Q6IA 2AWGA 3PE4A 3Q5MA 3EY6A 2VQ2A 5CCLA 1NZNA 3SZ7A 1JVWA 3Q15A 4GYWA 5GPGA 3ASGA 2KCKA 1FD9A 5A6CA 5FZSA 3O5QA 4JFKA 3O5OA 2C0LA 2Q7FA 4ODOA 2YHCA 4RG6A 4JFLA 3KAGA 3MV3B 5HTGA 3CV0A 3UQAA 4U86A 5AYWD 1WAO1 3KZ7A 1TCOC 4U07A 3O5GA 3FFLA 3JYMA 4W9PA 3O5EA 4QIBA 1FKGA 3CK9A 3RO2A 2RSEA 2FO7A 4F3VA 2PV2A 3O48A 4GCNA 2M2AA 3GZ1A 3CVPA 2VCDA 4JFJA 5D0QD 3ZHEA 2RURA 1HH8A 2P58C 2XP6A 4WNDA 2E2EA 5JJTA 2PPOA 2XP7A 3S7BA 3Q49B 3OXFA 3NRKA 4HOQA 2KI3A 4G2PA 3WH0A 4U0ZA 3QKYA 2LSUA 4HOTA 4J8FA 3KAHA 4ODKA 4B94A 3AS5A 4A1SA 1D7HA 3UI4A 3NTPA 2LNIA 4GYYA 2VN1A 5C1DA 5HWCA 3FP3A 3LYAA 3UUXA 2M08A 1J4RA 2RUDA 4ODMA 3VTXA 2KATA 2K8IA 1J4HA 1NMVA 3I6CA 1Q6HA 4UI9K 4TNSA 4G26A 4N3CA 5KJKA 2FKEA 3CEQA 1U79A 3CGNA 3CVNA 4J0UA 4XI9A 2C0MA 4DROA 4KYOB 1FKRA 5FT9A 2XP9A 1Q6UA 5KJLA 4EQFA 2KR7A 3FAPA 3KACA 5EX3A 1HXVA 4ODQA 4DRPA 2XP3A 5BNWA 3ZN3A 3U3WA 2DG9A 4BTBA 1EYMA 1ELWA 4TW6A 4DT4A 2MLXA 4HOSA 1PC2A 5JJ7A 3ULQA 3O5PA 3BEEA 5D0OD 2J9QA 2XGOA 1D6OA 1TJCA 2PQRA 4H7XA 2L2SA 4DRMA 2DG4A 4GIVA 2VSYA 2KCVA 1PBKA 3H9RB 1KT0A 5FZRA 2RUQA 4AM9A 3ZGQA 3LKUA 4G50A 4ABNA 3Q4AB 5M72A 1ZU2A 1F40A 5LCWJ 4BWRA 3ASDA 4U0SA 4DRHA 1NMWA 3GW4A 5DIVA 2N87A 4DRJA 2MLZA 4MSPA 2VGXB 5HI7A 4ME2A 4GPKA 3FWVA 1A17A 4N3AA 3OXLA 3MV2B 3VTYA 2XCBA 2ZR5A 3PRBA 4XIFA 4G24A 2BUGA 4U84A 3TGOA 1FKJA 1Y8MA 2XEVA 4UQXA 2ZQVA 1KT1A 4GA2A 2I6HA 5HT1A 4FAPA 3CKBA 1FKTA 1L1PA 3PE3A 4JFMA 1F8AB 3AS8A 4G2VA 2MLYA 1FKLA 2Y4UA 2ONDA 4MGVA 1FKKA 3CVQA 3O5DA 2XGMA 4AY6A 4TW7A 4IQ2A 3NI6A 4BF8A 2C2LA 2KC7A 4LAYA 2M1IA 2LJ4A 3PRDA 1Y0OA 4J8EA 5FTPA 2PL2A 4BT8A 3S7DA 2HYZA 2LGOA 2PBCA 1A7XA 1KLXA 3LY8A 4XI0A 1NSGA 1NA3A 4U04A 4GYOA 1OUVA 1E96B 1FJDA 3QWPA 3ZFWA 3KCEA 1J6YA 2PPPA 3UI6A 4G25A 4I1AA 4AY5A 5ARGA 4WNGA 3NF1A 4I2WA 3MKRA 4C02B 3O5FA 1FKSA 2NC9A 3JYJA 2OOEA 5EKQD 1C9HA 1FKIA 1D7IA 4CDRA 3U4TA 2ITKA 4RG9A 1BL4A 2MHKA 3KAFA 4LEUA 4N5CA 3B7XA 3O5JA 2MNTA 5G04J 1D7JA 3ZPJA 3ODKA 5HW8A 4UQYA 4JA9A 4LAWA 1QPFA 1B6CA 3KAEA 1NA0A 4IPXA 5G04C 3QOUA 3IKGA 4U0UA 4GCOA 2PV3A 2XPAA 1ZCNA 2JLBA 4WNFA 2PPNA 5DITA 1B89A 4KXKB 3OXGA 2XGSA 5HUAA 3UQBA 3CK8A 3LY9A 4GZ6A 3O5IA 3CK7A 4FN2A 3ESKA 5D75A 2VGXA 5CCMA 4Y6WA 3IKDA 4APOA 4QT2A 4CGVA 1BKFA 2QFCA 2WQHA 4BT9A 5B8IC 2KE0A 3GZ2A 4UI9J 4W9RA 3O5LA 4G1TA 1QQEA 3GYZA 4UQZA 4GZ3A 3LPZA 4UI9C 2D9FA 2UY1B 1HZ4A 2KO7A 4N39A 4WUYA 3TC5A 5HQ8A 3PA7A 2FF4A 5FZQA 5J6EA 1W26A 4NQ0A 5LCWC 4HORA 2F21A 3SF4A 4DZ3A 2IF4A 4DRIA 4H7YA 4TX0A 5DIUA 3ASHA 3LUOA 3IHZA 3UF8A 2LKNA 4QT3A 2Y78A 1ELRA 3VAWA 5BW8C 3UI5A 2XP8A 3TG5A 3UPVA 2ZR6A 1YW5A 4IQCA 3O5RA 3TCZA 3IEGA 4J4OA 4AIFA 3TG4A 3AS4A 2ZR4A 5DIZA 4W9QA 2F2DA 1YATA 3KADA 1HXIA 3KABA 1J4IA 3KS2A 2IFUA 4LAVA 5FJYA 4I9CA 2KCLA 2YQ8A 1PINA 2AVPA 3RKVA 3ASFA 1QZ2A 3URZA 4ITZA 5HWBA 3O5MA 1FKFA 2FEZA 3KAIA 4ODPA 3CGMA 2WPVA 4YNDA 3CKCA 2KFWA 1FAPA 2FAPA 4O6FA 1T11A 3CVLA 4JHRA 2VYIA 5ARFA 2FI7A 3QDNA 4GA1A 2DBAA 4Y6CA 1QPLA 2XPIA 4HOUA 4BTAA 3Q47B 1FKDA 4IN3B 4TW8A 1FCHA 4N2SA 4TYOA 2XP4A 1EQ3A 4I2ZA 5KJNA 3R9AB 4GGQA 5EX0A 2RQSA 3LY7A 2VGYA 4N2QA 2LPVA 4I17A 4DIPA 2ZQSA 3RIBA 2F4EA 5HW7A 4U85A 4JA7A 1FKHA 3RFWA 3GPKA 3PDNA 3TAXA 2V5FA 1R9HA 1FKBA 2Q5AA 3S7JA 4DZ2A 3HYMB 2OFNA 2XP5A 3E4BA 3ZHEB 4ODLA 4CGWA 4J4NA 4I9EA 3MA5A 3N71A 3UQIA 2KGJA 1IHGA 3MEKA 3EDTB 1ZBPA 1WM5A 3RJVA 2XCCA 2MF9A 2GW1A 1ROUA 1ROTA 3RGCA 2UY1A
chains in the Genus database with same CATH superfamily
4KQZA 4JYSA 1OGBA 3UQ3A 1N0RA 5BXJA 4DRQA 3KD7A 5CHEE 5DBKA 1JNTA 5A7DB 2JABA 2LSVA 2MPHA 4YVQC 4DX5D 4ODNA 3MDYB 4ZFHA 2KZTA 4XE0A 2H6IA 4C48B 1WY6A 3UINC 4O60A 2P4VA 4GZ5A 3JXIA 5G05C 3QWWA 1P5QA 2L6JA 3K9IA 4AOFA 1Q1CA 4LNBA 1E90A 5T8IA 4DX6D 3FUHA 2ZQUA 1VDYA 4O2TA 4G23A 1H2TC 2HO1A 1SA4A 3UKRG 4NNRA 4F6RD 3J5QB 4KVOA 1IYGA 3IHYA 2RKKA 5KJMA 5I98A 2BTDA 2OVBA 4PTMA 3X2QE 3U9WA 5CCLA 4E85A 4F7AA 3FUEA 2A3EA 1JVWA 5GPGA 2MOWA 5FZSA 2EULA 2YBUA 4JFKA 4DX1A 3O5OA 2ETAA 2YHCA 4ZPWR 3I4GA 4JFLA 5KBAA 3QNKA 3UQAA 4U86A 3D9PA 2XHEA 1XHGA 5AYWD 4CDMA 1WAO1 2DSUA 4C9BB 2I1KA 3O5EA 5EYLA 2RSEA 3L6AA 2FO7A 4GCNA 2M2AA 3CVPA 3C3OA 4MAVA 3S2AA 4BERA 2P58C 3CLJA 2PPOA 4BX9A 3U64A 3W9GA 3UT8A 1JPLA 3OXFA 1E7UA 3EJNA 3CVYA 3KEZA 3WH0A 3FUMA 1ZBKA 1D7HA 3AS5A 1D2KA 1H0AA 5CEDB 4WJXA 4GAAA 4G8LA 3FP3A 2M08A 4I6JA 3ZXPA 4EBAA 4URKA 4ODMA 3JUEA 2BF0X 2RFMA 5ENNA 1J4HA 3I6CA 3CHSA 1Q6HA 4UI9K 4TNSA 3DRAA 4G26A 3HXFA 5KJKA 3L13A 4L2YA 3ALFA 3CGNA 3EIPA 4PDXA 2ILRA 4DPRA 1OCCE 3DPYA 4NIKA 3L82A 1LG1A 4Q7NA 4TW6A 4DT4A 3DSUA 2MLXA 4GMLA 1D6OA 4U8HA 3FXYA 4WAFA 2EILE 1S63A 3H9RB 4RVBA 3E37A 3DSWA 2F37A 2RUQA 4A3TA 3ZYLA 2ZU6B 4ABNA 3ASDA 2XEEA 4LSZE 4V3IA 1NMWA 4FC8A 2ZGGA 3GW4A 2VGXB 1FFQA 1NH6A 1A17A 1V55E 2CHWA 3EHNA 4N3AA 3CSFA 2PM7A 3R9MA 3CVUA 4KT6B 3VTYA 3NB2A 1O6IA 4G24A 4A3VA 1N4RA 4UQXA 1JWFA 1O1TA 4OVVA 2OVFA 1FFRA 3PNTB 1N4QA 3CGHA 4U8VD 1GW6A 3MZLB 3PE3A 1YYHA 1F8AB 2J4BA 3AS8A 3IXEA 3TWSA 1FKLA 3B13A 4HARA 3TJPA 1FKKA 3CVQA 5CERB 4YDWA 2QC9A 4FULA 1SVXA 3WKZA 4AY6A 2XPYA 3L54A 4IQ2A 4L2LA 2C2LA 3NZSA 4DRXE 2KC7A 4LAYA 4L3NA 2JEKA 1Y0OA 3G2TA 3ISMC 2PBCA 2L6BA 1DVPA 3LY8A 4XI0A 1NA3A 3DPDA 1BLXB 4U04A 5AQBA 3C98A 1OUVA 3G2UA 1JCQA 2WXNA 2PPPA 1G3NB 4G25A 4I1AA 4FHJA 5A23A 5ARGA 3SGHA 3NF1A 1X81A 1FKSA 4MNKA 1FKIA 4DK5A 1D7IA 1N4PA 1YCSB 2DT0A 3AQUA 3ARYA 4HFGA 1N0QA 4RG9A 2MHKA 1LTXA 3KAFA 1NFIE 1D7JA 3ODKA 1JWGA 1D9SA 4UQYA 4P8WA 4JA9A 4LAWA 1QPFA 1KZOA 2F8XK 1Q2ZA 4U0UA 3WD2A 5HBFA 2PPNA 3SFYA 5CRVA 2ETBA 3PRAA 4DI3A 3UQBA 3CK8A 1DC2A 3O5IA 3CK7A 4FN2A 4LG6A 5CBNA 1BI8B 3ESKA 4OAUC 1D8EA 2VGXA 2P9NG 3SHFA 4IT6A 4QT2A 4CGVA 2WQHA 3FU6A 4BT9A 3FUKA 4ZPVR 5LFAA 4OYSA 4G1TA 5LOZA 3Q79A 4UI9C 2D9FA 2KO7A 1UR8A 2RD0A 3Q9NC 4FP7A 1NWUA 5FZQA 5J6EA 3B9EA 1GOIA 4Q22A 1O5MA 5HRYA 5LCWC 4HORA 2F21A 4RQIA 4DRIA 3G2SA 4S3JA 2WVIA 2DZNA 3C72A 4ANUA 3IHZA 4OAVB 4QT3A 1ELRA 4HBEA 2X6HA 3UI5A 2P9LG 3NAWA 3UM2A 3ARUA 3TCZA 3TG4A 4B93B 2AWIA 3SFZA 1YATA 3AG2E 1OT8A 4L7TA 3KADA 3ML9A 2X6IA 1D8DA 5HS0A 2IFUA 1JCRA 2DSWA 2XS1A 2KCLA 2YQ8A 3V2OA 4B8AA 2R02A 2LUHA 1PINA 3RKVA 5BPPA 2PN0A 1QZ2A 3B9AA 4ITZA 2WLYA 3ULEG 5J90A 2PI6A 5DF0A 4DWSD 1E8WA 2FEZA 3KAIA 4HS2A 2CHZA 2FAPA 3RAUA 4O6FA 3FH7A 3T8MA 1T11A 4JHRA 3CHEA 4CT4A 3QDNA 3QK0A 1QPLA 4HOUA 4XKCA 3I4RB 2Y69E 3NBNB 4GTQA 3U66A 1WDYA 4CCAA 2XP4A 3DWLG 4LGXA 2ETCA 4DX7D 2L0IA 5J08A 2RQSA 2VGYA 5ENTD 2Y3AA 3RIBA 4Q94A 3RFWA 1OCOE 3PDNA 2H6FA 1H6KA 2OFNA 4ODLA 5KWDA 4I9EA 3MA5A 3N71A 3QARA 3RM4A 3EDTB 1ZBPA 1WM5A 3RJVA 1MZCA 2XCCA 3SQVA 4F1SA 4JXTA 2O92A 1ROUA 1ROTA 4FLBA 2IOSA 2YNQA 1ZK6A 5JMND 3APCA 3D9OA 1TN8A 4BX8A 2DG3A 4WKHA 4G8KA 4ODRA 1KPSB 4YDYA 4C0MA 4QFVA 3FH8A 4WWNA 3RU0A 1M5YA 1Z3XA 1HKKA 4IT4A 4DRKA 3EU9A 2WMNA 1MYOA 2HR2A 1XNFA 2XRYA 2EIME 3FTZA 3RMEA 3PNLB 3HXEA 2DCPA 3KEAA 1TNBA 1LD7A 2DSVA 3DSSA 3FEXA 4JC8A 5ENQD 1UN8A 2WLZA 3LJNA 3TWRA 4UWLA 1UR9A 4W9OA 3PEUB 2Y4TA 5BT1A 1W9PA 1IKND 4MNJA 3T5VA 4JB8P 1Q6IA 4LNUD 3UM3A 1HKJA 3PREA 2DVWA 2VJ8A 2YHEA 3V79K 3EY6A 2VQ2A 3ESLA 2XZTG 5IY5E 4MBGA 1FD9A 3WQWA 3FU3A 3O5QA 2C0LA 1HG2A 4A63B 4ML4A 2WK2A 1TR4A 2ZISA 3KAGA 5KNHD 2DSZA 3PUJA 1OWMA 3DEPA 5CRUA 3FFLA 5EILA 4DJAA 2GRNB 4QIBA 4PS7A 2PV2A 2KXPC 4F3VA 3Q7FA 1S0PA 1N11A 4ANVA 2BKKB 2VCDA 2WXFA 1TNYA 1HX8A 5BXOA 1IQUA 1AWCB 3CSTA 5JJTA 2OEWA 2XP7A 4GMJA 1WNOA 2KM4A 1W1TA 2WM9A 3NRKA 2KI3A 4GTOA 4JZYA 4DUIA 4HOTA 4J8FA 4ODKA 3HIZA 2B0OE 3NTPA 2DYSE 2LNIA 4GYYA 2VN1A 5ENSD 3LYAA 4RSYA 3UUXA 1DCQA 3L22A 2RUDA 3MX3A 2H6HA 3T9KA 3VTXA 3JQ1A 2K8IA 3FDHA 3UM1A 1X6NA 3JUIA 4B89A 1LL7A 4JHKA 1E8ZA 1Y6IA 3CVWA 5FQ4A 2IJGX 4XI9A 4DROA 4KYOB 1FKRA 3AAAC 5FT9A 1NWTA 3V31A 3FTSA 2XP9A 1MX2A 1Q6UA 2KR7A 1HXVA 3KACA 4DRPA 3TWUA 2XP3A 3L17A 4NSBA 4BTBA 3EIQC 3FU5A 2VSXE 1H0IA 3ARQA 3QJZA 3ZEFA 1X5BA 2I9CA 2KBXA 3G2VA 5JJ7A 3O5PA 2XGOA 3SY2A 1EHNA 5BV0A 2L2SA 4GIVA 5G2NA 3ARWA 1PBKA 4AM9A 3ZGQA 2A3CA 4G50A 3DSVA 3Q4AB 3AG3E 3ZU7B 1F40A 4WIWA 3CIAA 2MYOA 2PM6A 4NZCA 5FWQA 5DIVA 2N87A 4MSPA 5H7PA 3ZVVA 4ME2A 3WD1A 3MJWA 2XS8A 1E6PA 4KMOA 4R5EA 3WD0A 4GTTA 2EQXA 1HO8A 3D9HA 4XIFA 3EHQA 3RSEG 1LG2A 2XEVA 1OWLA 2DWZA 4GA2A 1ZBCA 1NP7A 1N52A 1TNOA 3C3RA 1H0GA 3ZUVB 3ZKJA 3QB2A 1LL6A 5CEAA 4G2VA 1HKIA 1INZA 3LS8A 1JUQA 4EHMA 3ABLE 1U3CA 2AOSA 2YBTA 3NI6A 4JPSA 2AXVA 3CVXA 3UT4A 2M1IA 5FTPA 2I1JA 2PL2A 4LERA 1NWSA 3D9JA 3TWXA 3P1UA 4EBAG 5T3RA 4WKAA 3QWPA 3OTNA 4KZCA 3WL1A 3HHMA 3UI6A 3UM0A 4AY5A 1MJ0A 4UWFA 2ZIRA 1SA5A 2WQ7A 3O5FA 5JHAA 2OOEA 5EKQD 4U95D 3ZYKA 2GGFA 5ANLA 4CDRA 3AS0A 3U4TA 2FDMA 4HB5A 1OWPA 3BU8A 4R7LA 3AS2A 3ZPJA 2LO6A 1H6PA 3V30A 4LCTA 2NXPA 1S70B 1NA0A 3QOUA 3UI2A 4IRUA 3MGBA 4GCOA 2CFZA 3G6MA 3B8SA 4KXKB 4Z2HA 4AY1A 3DSXA 3LY9A 3BXWA 4XKBA 3J5PA 4PS3A 1O1RA 3T8KA 3IKDA 3ABKE 4APOA 3NZUA 4GB9A 5AARA 3TWTA 5EYPF 2O9OA 3AU4A 3O5LA 1HFAA 4KR0B 2A5UA 4UQZA 3AJIA 3CQGB 3SI5A 4CT0A 4WUYA 3MKQA 4S3KA 3DBSA 4NURA 3RK6A 4ATGA 2XPZA 3SF4A 4AP2A 3LVQE 4X8QA 4K03A 1GUVA 1WG0A 4H7YA 1OCZE 5DIUA 4G11A 3ASHA 3LUOA 5AQ7A 3ZYQA 2LKNA 4ILGA 2Y78A 5BW8C 2XP8A 3UPVA 1TEZA 3O5RA 3FHEA 3IEGA 4BEPA 2V8SE 3TXNA 4WK9A 3Q73A 3ARRA 2EIKE 4YDOA 1FVFA 3CHRA 4MNMA 4TXPA 1HE8A 2LAIA 3WD3A 4MTVA 4LAVA 2X3MA 4FU3A 3HXDA 3WL0A 1FKFA 2QYJA 3V2XA 3ALGA 1LQ0A 4ODPA 1LF8A 2GRPB 2IO3C 3CKCA 1FAPA 4U7EB 4GPMA 5BV1A 4JW1A 3RRNB 3SBTB 5GPRA 2M63A 4GTMA 2DBAA 5EDSA 3Q47B 3FEYA 3LXUX 2B31A 4IN3B 3VLEA 1EDUA 4TW8A 1FCHA 2B6CA 5ENPD 3FY4A 3FULA 2DT3A 3PUKA 1EQ3A 2X38A 3CHDA 4N2QA 2FULA 3B7RL 5FQ8A 2J07A 5HW7A 4U85A 4IYPA 3GPKA 3ML8A 5AN8A 2V5FA 2IEJA 1FKBA 1K1BA 2Q5AA 1FVHA 2XP5A 4J4NA 3G2WA 3MEKA 3WIJA 3E30A 4O1OA 5T4YA 3W9FA 2MF9A 2GW1A 4FHKA 2F0YA 3ONKA 3RGCA 3GU0A 2IONA 3FH5A 1JNSA 1FT1A 4ZPTR 4TUMA 1WB0A 4K5CA 3L9TA 1L5JA 4JFIA 2UWJG 3CHOA 3IK8A 2ZQTA 1OWQA 2PQNA 4MPKA 2GROB 3LCAA 1HF8A 1HJWA 3MCXA 2UZ5A 2P2CP 1EIBA 1E7VA 4DX2A 2V4HC 2PV1A 1N94A 1N1AA 4C0EA 4LNGA 2FBNA 4N19A 4KBQA 5JJ6A 2J09A 5HKGA 4GA0A 4DWSC 1W9UA 1H2UA 4LAXA 3WXXA 2AXZA 3HG0D 2X6JA 4JEUA 3ARSA 3CVVA 3FUFA 2PZIA 2Y1LE 3RO3A 4CZ2D 1YA0A 1SZAA 1TNUA 3KSLA 3OOBA 3SD5A 3ONLA 3ASNE 3BUAA 4U8YD 4R0XA 4PH4B 3TDBA 1E6NA 2AWGA 1MHQA 3ULYA 2FO1E 3Q5MA 1N9AA 3D3MA 4GYWA 4DLQA 5A6CA 4ODOA 2Q7FA 1H6OA 2J4DA 4RG6A 5HTGA 3FUNA 3O4ZA 5AQAA 3PS6A 4QZVB 1TCOC 4U07A 3O5GA 4M3OA 1H19A 1FKGA 3CK9A 3B7SA 3TXMA 4HLLA 3PEVB 3O48A 2P9UG 3GZ1A 3ASOE 2WM0A 1IXVA 1EDQA 4JFJA 5D0QD 2A3AA 3PR9A 2L9BA 2RURA 2XP6A 2CHXA 4WNDA 2E2EA 4B8CB 3S7BA 1RW2A 5LP0A 2IUZA 4HI8A 3VLFA 3Q49B 2L0TB 5AJLA 4G2PA 4EZJA 3DEOA 1JNEA 2LSUA 3EU5A 2QYUA 4B94A 4P8VA 3UI4A 3CHPA 5CMYA 5C1DA 5HWCA 2AJAA 3DXKG 4JHJA 1J4RA 1NMVA 3BMBA 4GZCA 1S64A 2OCCE 4N3CA 3HXCA 2FKEA 3I3NA 3CEQA 1U79A 4J0UA 1K9TA 1MX6A 1NL4A 4N5QA 3SFXA 3WG7E 4LRZA 4ILIA 3QAQA 4EQFA 5GQBA 5EX3A 5BNWA 4JEHA 3ZN3A 3U3WA 1EYMA 2XENA 3Q7AA 3FY1A 1RZ4A 4I43A 4HOSA 4D10C 3BEEA 5D0OD 1TJCA 4H7XA 4BSXA 2WXOA 2DG4A 3DSTA 3IV0A 4EECA 2VSYA 1KT0A 2VSOE 3PVLA 2WMOA 2P9PG 5M72A 4J8SA 1QYMA 5LCWJ 4TRQA 2WXPA 4URIA 4DRJA 3F6QA 4J6IA 4QQIA 4F1PA 4AXHA 4Q96A 3OXLA 2XQ0A 3MV2B 1GRJA 2P9SG 3PRBA 2XEHA 2BUGA 4BETA 4U84A 1Y8MA 1AP7A 4UDMA 1KT1A 1U2VG 1X6LA 3CKBA 4FAPA 4ZS6A 2V0PA 1FKTA 3FTXA 1UJJA 2IU1A 3CR3A 4JFMA 2DIWA 2ONDA 3JXJA 3PZ3A 4MGVA 4CYMD 5AAOA 5JA4D 3FTYA 2H6GA 4HBOA 4F53A 5KNGA 3CHFA 4WKFA 2LXMA 3PRDA 3E34A 4GTVA 1PY1A 2LGOA 2DZOA 1A7XA 4P29A 3TWQA 1KLXA 3B7BA 1NSGA 2DT2A 4GYOA 2A3BA 3ARTA 1ELKA 3Q75A 1E96B 3ARXA 1FJDA 5JH8A 3ZFWA 4ZHBA 3KCEA 3FU0A 2LAHA 4EZLA 5B1AE 2QY7A 4FA6A 1JNDA 4EZKA 4I2WA 5AENA 3MKRA 2GRQB 4C02B 1W1PA 3JYJA 1C9HA 4K0RA 4BSZB 2WXHA 4PS8A 1OXJA 4UWGA 4ACLA 2ZGDA 3UIPC 4DLOA 1LL4A 4ACKA 4Z2LA 4Z2GA 4LEUA 4N5CA 3B7XA 3D9IA 2MNTA 5G04J 5HW8A 1BI7B 1OGGA 3B95A 1B6CA 4CEMA 3D9LA 3KAEA 1E8YA 2JLBA 4WNFA 5DITA 1B89A 2RFAA 3OXGA 3ZIMA 3EIJA 1ZL1A 3GTYX 1E6ZA 5CCMA 4HRLA 4UWKA 3EHRA 3NOCD 1HJXA 2KE0A 3CQCB 1QQEA 3GYZA 4I1MA 1MQSA 4Z2IA 5FIOA 3LPZA 1N95A 1QNFA 1V54E 1HZ4A 5CMWA 3FTUA 5HQ8A 3PA7A 4PUCA 2FF4A 3ZNGA 1W26A 3ZRHA 1ITXA 4DZ3A 4HXIA 4J7WA 4TX0A 3RRUA 4AEZC 4AJWA 3JCKC 3UF8A 5D2MC 2NSZA 3UTMA 2IO2C 3UMVA 3ABME 1LD8A 3VAWA 4CRWA 3TG5A 2ZR6A 2NYJA 3SBSA 4IQCA 4A55A 4J4OA 3MKQB 3AG4E 4UUCA 3B7TA 3LEWA 3NQPA 1HXIA 1O1SA 4HBDA 3Q9UC 1TYQG 4JD2G 3KS2A 3CHCA 4ILHB 5FJYA 4GTSA 2AVPA 1H2VC 4GZDA 3URZA 3PRZA 5LX8A 5HWBA 1OWNA 3B7UX 4FADA 3CGMA 2WPVA 4YNDA 3HVEB 3UKUG 4E6HA 3CVLA 2QF8A 1W9VA 5AIJA 3EUVA 2VTBB 2FI7A 4GA1A 1UOHA 4Y6CA 3AG1E 1SR0A 4WWPA 3FUDA 5KCMA 3IKOB 4APFA 4N2SA 4TYOA 4DWSB 1U3DA 3CHQA 4I2ZA 5KJNA 4Z68A 5EX0A 4EPZA 5HKPA 3VLDA 3HXBA 4I6EA 2B5UB 4XZ4A 4DIPA 4TUUA 3GZSA 4TXRA 1KZPA 3HYMB 2XRZA 5BUZA 2E0IA 3E4BA 3ZHEB 4CGWA 2P9KG 1IHGA 2WXJA 4GTPA 1TFVA 2R2LA 5BXUA 3WQVA 4OVUA 1SYTA 4YVOA 3QWVA 3L08A 1W3BA 3TWWA 3JYSA 1DCEA 4XX5A 2RUCA 2YINA 4NRHB 4MS6A 4ANWA 3S7FA 5E75A 5G05J 3JXVA 4RLYA 4JL0A 5CECB 5EIDA 3LVRE 2R5SA 1W1YA 2XPBA 3WD4A 3SNXA 2XZDG 3HRAA 1PAQA 4WWOA 4N3BA 3T5XA 2A5EA 4DH0A 2I2OA 4BESA 4J8DA 4DI4A 4WNEA 1E44A 4TXQA 4DRNA 2JZVA 3PZDA 2VSNA 2WB2A 5HW6A 1HG5A 3O5KA 3HVEA 4GMRA 3PE4A 2HM8A 3ZXSA 1NZNA 2WXLA 2X6FA 3CHMA 2VTBA 3SZ7A 3Q15A 3ASGA 2KCKA 3L16A 4DWSA 2R59A 3R7RA 2MRIA 1NI1A 3FTVA 3MV3B 2P9IG 1BPOA 3CV0A 4FJYA 1WAWA 3PZ2A 3KZ7A 2AXUA 1TNZA 3JYMA 4W9PA 3RO2A 3JQ0A 1HJVA 1JCSA 4KZ0A 3ZHEA 1ZB1A 1HH8A 3APFA 4XEIG 1SZ9A 4P8XA 3AROA 4HOQA 1FT2A 4U0ZA 3ZW3A 3QKYA 4MKTA 4B0ZA 4XAKA 1IHBA 3KAHA 4A1SA 4HQDA 1BD8A 4BY6A 2LXLA 3QOKA 4FLHA 5ANRA 2V5QC 3FTWA 5FINA 1SQMA 4HNAD 5ITZF 2KATA 4ATZD 2AW6A 3AU5A 4GTRA 4I1OB 2ZXWE 1HKMA 3ENEA 3CVNA 2C0MA 3Q78A 5ENOD 3R7QA 1QBQA 5KJLA 3FAPA 4L1BA 1VF8A 4ODQA 3BG1B 3MYVA 4L23A 2DG9A 3G6LA 3LJ3A 1ELWA 4K5AB 1TJFA 3BG0B 1BU9A 3PH0C 1PC2A 4Q69A 3ULQA 3P2BA 1UJKA 2J9QA 2PQRA 4DRMA 2KCVA 5FZRA 3C3QA 3HDXA 3LKUA 1MX4A 1ZU2A 3UX4A 4BWRA 2G8ZA 3CZ8A 4U0SA 4DRHA 3NOGD 2MLZA 5HI7A 4YDEA 4GPKA 3FWVA 2OEVA 1JCHB 2WXRA 2CG2A 2XCBA 2ESCA 2ZR5A 4HRMB 2R05A 3TGOA 1TN6A 1FKJA 3UXGA 2R17C 2ZQVA 5HT1A 2I6HA 3TL5A 2OV8A 2QZAA 2IY0C 2GRRB 3DXMG 3E32A 1L1PA 2DPEA 4BFRA 2MLYA 5ENRD 2Y4UA 3O5DA 2HE0A 2ETNA 2XGMA 1K8KG 2WXIA 4HVBA 4TW7A 2PNNA 5E76A 4BF8A 4Z2KA 2LJ4A 3TWVA 4J8EA 1NWRA 4MNLA 4LUNU 4BT8A 3S7DA 4O1PA 2G41A 2HYZA 2J8SD 3OAWA 2EIJE 1J6YA 2BEDA 3KSQA 1W1VA 2R03A 2CFUA 1EPUA 4L9PA 2A4ZA 3BQOA 2WXGA 3PZ1A 4WNGA 1HU3A 3UT7A 5FQ6A 2NC9A 2DYRE 3OA5A 1KFWA 1LJYA 2WXKA 2X6KA 1ZB5A 2ITKA 1BL4A 1RD6A 2V4LA 5DO2A 1E6RA 3D9NA 5CBOA 3O5JA 3FUIA 2F23A 4Z2JA 2IOLA 4IPXA 2GRLA 3ZYMA 5G04C 3IKGA 1OCRE 2XPAA 2PV3A 3B9DA 1ZCNA 3EHMA 4J8YA 4K5BA 2XGSA 4A1GA 5HUAA 4I6GA 4GZ6A 3D9KA 5D75A 4Y6WA 3E33A 4KVMA 3W4RA 2VGEA 1BKFA 4MLPA 2QFCA 3RRMB 5B8IC 1IQRA 3GZ2A 4UI9J 4W9RA 3FUJA 1OWOA 1E8XA 5DEZA 3PZ4A 3RM8A 4GZ3A 4TV3A 3QC1A 1XRVA 2UY1B 4N39A 4U63A 3TC5A 2CG3A 1ZU8A 1Z3YA 3SO8A 4NQ0A 1ZBVA 5D66A 1EF1C 2IF4A 1TN7A 4L72B 1E9LA 4AV7A 4JVSA 4HI9A 2KZTB 2OLHA 2WXQA 3ARPA 2J08A 4AVXA 1YW5A 1GPFA 1ZBWA 1E15A 4AIFA 3AS4A 2ZR4A 5DIZA 3RM9A 4W9QA 2F2DA 1UG3A 3IHVA 1UN9A 3ARVA 3KABA 4U96D 4ANXA 1J4IA 2DT1A 1K1AA 2J49A 1CTNA 1XGWA 3ARZA 4I9CA 4M7CA 3CH9A 1FPPA 3ASFA 4NACA 4CDNA 2F8YA 1DNPA 3O5MA 2WXMA 3I5PA 1EYHA 2KFWA 5AQ9A 4UWHA 3LDZA 4IULA 4FJZA 2VYIA 2IQCA 5ARFA 5EIBE 1K3ZD 1N54A 2XPIA 4BTAA 3UIOC 2WQ6A 1FKDA 1N4SA 5JHBA 4GU5A 2Y0BG 3D9MA 3R9AB 4GGQA 1HS6A 3APDA 5EN5D 1A5EA 3LY7A 5G55A 3IBEA 4HLEA 2LPVA 2EINE 2BKGA 4MRUA 4I17A 2ZQSA 1SW6A 4P8UA 2F4EA 4JA7A 1FKHA 3TAXA 5B3SE 1OY3D 1R9HA 3AS3A 1YMPA 2RG8A 3S7JA 4DZ2A 1UW4B 3AS1A 4W5UA 1IX5A 5C2YA 3UQIA 2KGJA 4HRNA 3C5RA 5FQ7A 5AJDA 1Z5SC 1Z6TA 2UY1A 5B1BE 2GRMA
chains in the Genus database with same CATH topology
4KQZA 4JYSA 1OGBA 3UQ3A 5BXJA 4DRQA 3KD7A 5CHEE 5DBKA 1JNTA 5A7DB 2LSVA 2MPHA 4YVQC 4ODNA 3MDYB 2KZTA 4XE0A 1WY6A 4GZ5A 5G05C 3QWWA 1P5QA 2L6JA 3K9IA 4AOFA 1Q1CA 1E90A 5T8IA 3FUHA 2ZQUA 1VDYA 4O2TA 4G23A 1H2TC 2HO1A 4NNRA 1IYGA 4KVOA 3IHYA 5KJMA 5I98A 2BTDA 2OVBA 4PTMA 3U9WA 5CCLA 4E85A 4F7AA 3FUEA 2A3EA 1JVWA 5GPGA 2MOWA 5FZSA 2YBUA 4JFKA 3O5OA 2YHCA 4ZPWR 3I4GA 4JFLA 3QNKA 3UQAA 4U86A 3D9PA 2XHEA 1XHGA 5AYWD 4CDMA 1WAO1 2DSUA 4C9BB 2I1KA 3O5EA 2RSEA 3L6AA 2FO7A 4GCNA 2M2AA 3CVPA 4MAVA 3S2AA 2P58C 3CLJA 2PPOA 4BX9A 3U64A 3UT8A 1JPLA 3OXFA 1E7UA 3EJNA 3CVYA 3KEZA 3WH0A 3FUMA 1ZBKA 1D7HA 3AS5A 1D2KA 1H0AA 4WJXA 4GAAA 3FP3A 2M08A 4I6JA 4EBAA 4URKA 4ODMA 2BF0X 5ENNA 1J4HA 3I6CA 3CHSA 1Q6HA 4UI9K 4TNSA 4G26A 5KJKA 3L13A 4L2YA 3ALFA 3CGNA 4PDXA 2ILRA 4DPRA 1LG1A 4Q7NA 4TW6A 4DT4A 2MLXA 4GMLA 1D6OA 4U8HA 3FXYA 4WAFA 3H9RB 4RVBA 2RUQA 4A3TA 3ZYLA 2ZU6B 4ABNA 3ASDA 4V3IA 1NMWA 4FC8A 3GW4A 2VGXB 1FFQA 1NH6A 1A17A 2CHWA 3EHNA 4N3AA 3CSFA 2PM7A 3CVUA 4KT6B 3VTYA 1O6IA 4G24A 4A3VA 4UQXA 1JWFA 4OVVA 2OVFA 1FFRA 3PNTB 3CGHA 1GW6A 3MZLB 3PE3A 1F8AB 2J4BA 3AS8A 1FKLA 3B13A 4HARA 3TJPA 1FKKA 3CVQA 4FULA 3WKZA 4AY6A 2XPYA 3L54A 4IQ2A 4L2LA 2C2LA 3NZSA 2KC7A 4LAYA 4L3NA 2JEKA 1Y0OA 3G2TA 2PBCA 1DVPA 3LY8A 4XI0A 1NA3A 3DPDA 4U04A 3C98A 1OUVA 3G2UA 2WXNA 2PPPA 4G25A 4I1AA 4FHJA 5A23A 5ARGA 3SGHA 3NF1A 1FKSA 4MNKA 1FKIA 4DK5A 1D7IA 2DT0A 3AQUA 3ARYA 4HFGA 4RG9A 2MHKA 3KAFA 1D7JA 3ODKA 1JWGA 4UQYA 4P8WA 4JA9A 4LAWA 1QPFA 4U0UA 3WD2A 5HBFA 2PPNA 3PRAA 4DI3A 3UQBA 3CK8A 3O5IA 3CK7A 4FN2A 3ESKA 2VGXA 4IT6A 3SHFA 4QT2A 4CGVA 2WQHA 3FU6A 4BT9A 3FUKA 4ZPVR 5LFAA 4OYSA 4G1TA 5LOZA 4UI9C 2D9FA 2KO7A 1UR8A 2RD0A 4FP7A 1NWUA 5FZQA 5J6EA 3B9EA 1GOIA 4Q22A 5LCWC 4HORA 2F21A 4DRIA 3G2SA 4S3JA 2WVIA 4ANUA 3IHZA 4QT3A 1ELRA 4HBEA 2X6HA 3UI5A 3TCZA 3ARUA 3TG4A 2AWIA 3SFZA 1YATA 4L7TA 3KADA 3ML9A 2X6IA 2IFUA 2DSWA 2KCLA 2YQ8A 4B8AA 1PINA 3RKVA 5BPPA 1QZ2A 3B9AA 4ITZA 2WLYA 5J90A 2PI6A 5DF0A 4DWSD 1E8WA 2FEZA 3KAIA 4HS2A 2CHZA 2FAPA 4O6FA 3FH7A 3T8MA 1T11A 4JHRA 3CHEA 4CT4A 3QDNA 3QK0A 1QPLA 4HOUA 4XKCA 3I4RB 3U66A 4CCAA 2XP4A 4LGXA 2L0IA 5J08A 2RQSA 2VGYA 2Y3AA 3RIBA 4Q94A 3RFWA 3PDNA 1H6KA 2OFNA 4ODLA 4I9EA 3MA5A 3N71A 3QARA 3RM4A 3EDTB 1ZBPA 1WM5A 3RJVA 2XCCA 4F1SA 4JXTA 2O92A 1ROUA 1ROTA 4FLBA 2IOSA 2YNQA 1ZK6A 3APCA 3D9OA 4BX8A 2DG3A 4WKHA 4ODRA 4C0MA 4QFVA 3FH8A 4WWNA 3RU0A 1M5YA 1Z3XA 1HKKA 4IT4A 4DRKA 2WMNA 2HR2A 1XNFA 2XRYA 3FTZA 3RMEA 3PNLB 2DCPA 2DSVA 3FEXA 4JC8A 1UN8A 2WLZA 4UWLA 1UR9A 4W9OA 3PEUB 2Y4TA 5BT1A 1W9PA 4MNJA 3T5VA 1Q6IA 1HKJA 3PREA 2VJ8A 2YHEA 3EY6A 2VQ2A 3ESLA 1FD9A 3WQWA 3FU3A 3O5QA 2C0LA 1HG2A 4ML4A 2WK2A 3KAGA 2DSZA 3PUJA 1OWMA 3FFLA 4DJAA 4QIBA 4PS7A 2PV2A 4F3VA 1S0PA 4ANVA 2VCDA 2WXFA 1HX8A 1IQUA 3CSTA 5JJTA 2XP7A 4GMJA 1WNOA 2KM4A 1W1TA 2WM9A 3NRKA 2KI3A 4JZYA 4HOTA 4J8FA 4ODKA 3HIZA 3NTPA 2LNIA 4GYYA 2VN1A 3LYAA 4RSYA 3UUXA 3L22A 2RUDA 3MX3A 3VTXA 3JQ1A 2K8IA 3FDHA 1X6NA 3JUIA 4B89A 1LL7A 4JHKA 1E8ZA 1Y6IA 3CVWA 5FQ4A 2IJGX 4XI9A 4DROA 4KYOB 1FKRA 5FT9A 1NWTA 3FTSA 2XP9A 1Q6UA 2KR7A 1HXVA 3KACA 4DRPA 2XP3A 3L17A 4NSBA 4BTBA 3EIQC 3FU5A 2VSXE 1H0IA 3ARQA 3QJZA 3ZEFA 1X5BA 2I9CA 3G2VA 5JJ7A 3O5PA 2XGOA 1EHNA 5BV0A 2L2SA 4GIVA 5G2NA 3ARWA 1PBKA 4AM9A 3ZGQA 2A3CA 4G50A 3Q4AB 1F40A 4WIWA 3CIAA 2PM6A 4NZCA 5FWQA 5DIVA 2N87A 4MSPA 3ZVVA 4ME2A 3WD1A 3MJWA 1E6PA 4KMOA 4R5EA 3WD0A 2EQXA 1HO8A 4XIFA 1LG2A 2XEVA 1OWLA 4GA2A 1ZBCA 1NP7A 1N52A 1H0GA 3QB2A 1LL6A 4G2VA 1HKIA 1INZA 3LS8A 1JUQA 1U3CA 2AOSA 2YBTA 3NI6A 4JPSA 2AXVA 3CVXA 3UT4A 2M1IA 5FTPA 2I1JA 2PL2A 4LERA 1NWSA 3D9JA 3P1UA 4EBAG 5T3RA 4WKAA 3QWPA 3OTNA 4KZCA 3WL1A 3HHMA 3UI6A 4AY5A 4UWFA 2WQ7A 3O5FA 5JHAA 2OOEA 5EKQD 3ZYKA 2GGFA 5ANLA 4CDRA 3AS0A 3U4TA 2FDMA 1OWPA 4R7LA 3AS2A 3ZPJA 2LO6A 4LCTA 2NXPA 1NA0A 3QOUA 4IRUA 3MGBA 4GCOA 2CFZA 3G6MA 3B8SA 4KXKB 4Z2HA 4AY1A 3LY9A 3BXWA 4XKBA 4PS3A 3IKDA 3NZUA 4APOA 4GB9A 2O9OA 3AU4A 3O5LA 1HFAA 4KR0B 2A5UA 4UQZA 3CQGB 3SI5A 4CT0A 4WUYA 3MKQA 4S3KA 3DBSA 4NURA 3RK6A 4ATGA 2XPZA 3SF4A 4AP2A 3LVQE 4K03A 1GUVA 4H7YA 5DIUA 4G11A 3ASHA 3LUOA 3ZYQA 2LKNA 4ILGA 2Y78A 5BW8C 2XP8A 3UPVA 1TEZA 3O5RA 3FHEA 3IEGA 2V8SE 3TXNA 4WK9A 3ARRA 1FVFA 3CHRA 4MNMA 1HE8A 2LAIA 3WD3A 4MTVA 4LAVA 2X3MA 4FU3A 3WL0A 1FKFA 3ALGA 1LQ0A 4ODPA 1LF8A 3CKCA 1FAPA 5BV1A 4JW1A 3RRNB 3SBTB 5GPRA 2M63A 2DBAA 5EDSA 3Q47B 3FEYA 3LXUX 2B31A 4IN3B 3VLEA 1EDUA 4TW8A 1FCHA 3FY4A 3FULA 2DT3A 3PUKA 1EQ3A 2X38A 3CHDA 4N2QA 2FULA 3B7RL 5FQ8A 2J07A 5HW7A 4U85A 4IYPA 3GPKA 3ML8A 2V5FA 1FKBA 2Q5AA 1FVHA 2XP5A 4J4NA 3G2WA 3MEKA 3WIJA 5T4YA 2MF9A 2GW1A 4FHKA 3ONKA 3RGCA 2IONA 3FH5A 1JNSA 4ZPTR 1WB0A 1L5JA 4JFIA 2UWJG 3CHOA 3IK8A 2ZQTA 1OWQA 2PQNA 4MPKA 3LCAA 1HF8A 1HJWA 3MCXA 2UZ5A 1EIBA 1E7VA 2PV1A 1N1AA 4C0EA 2FBNA 4N19A 4KBQA 5JJ6A 2J09A 5HKGA 4GA0A 4DWSC 1W9UA 1H2UA 4LAXA 3WXXA 2AXZA 2X6JA 4JEUA 3ARSA 3CVVA 3FUFA 2PZIA 3RO3A 1YA0A 1SZAA 3OOBA 3SD5A 3ONLA 4R0XA 4PH4B 3TDBA 1E6NA 2AWGA 1MHQA 3Q5MA 3D3MA 4GYWA 4DLQA 5A6CA 4ODOA 2Q7FA 2J4DA 4RG6A 5HTGA 3FUNA 3O4ZA 3PS6A 4QZVB 1TCOC 4U07A 3O5GA 4M3OA 1H19A 1FKGA 3CK9A 3B7SA 3TXMA 3PEVB 3O48A 3GZ1A 2WM0A 1EDQA 4JFJA 5D0QD 2A3AA 3PR9A 2L9BA 2RURA 2XP6A 2CHXA 4WNDA 2E2EA 4B8CB 3S7BA 5LP0A 2IUZA 3VLFA 3Q49B 2L0TB 5AJLA 4G2PA 4EZJA 1JNEA 2LSUA 4B94A 4P8VA 3UI4A 3CHPA 5CMYA 5C1DA 5HWCA 4JHJA 1J4RA 1NMVA 4GZCA 4N3CA 2FKEA 3I3NA 3CEQA 1U79A 4J0UA 1K9TA 4LRZA 4ILIA 3QAQA 4EQFA 5GQBA 5EX3A 5BNWA 4JEHA 3ZN3A 3U3WA 1EYMA 3FY1A 4I43A 4HOSA 4D10C 3BEEA 5D0OD 1TJCA 4H7XA 4BSXA 2WXOA 2DG4A 3IV0A 4EECA 2VSYA 1KT0A 2VSOE 3PVLA 2WMOA 5M72A 4J8SA 5LCWJ 4TRQA 2WXPA 4URIA 4DRJA 4J6IA 4AXHA 4Q96A 3OXLA 2XQ0A 3MV2B 3PRBA 2BUGA 4U84A 1Y8MA 1KT1A 1X6LA 3CKBA 4FAPA 4ZS6A 2V0PA 1FKTA 3FTXA 1UJJA 2IU1A 3CR3A 4JFMA 2DIWA 2ONDA 4MGVA 3FTYA 4HBOA 4F53A 3CHFA 4WKFA 3PRDA 1PY1A 2LGOA 1A7XA 4P29A 1KLXA 1NSGA 2DT2A 4GYOA 2A3BA 3ARTA 1ELKA 1E96B 3ARXA 1FJDA 5JH8A 3ZFWA 3KCEA 3FU0A 2LAHA 4EZLA 2QY7A 4FA6A 1JNDA 4EZKA 4I2WA 5AENA 3MKRA 4C02B 1W1PA 3JYJA 1C9HA 4K0RA 2WXHA 4PS8A 4UWGA 4ACLA 4DLOA 1LL4A 4ACKA 4Z2LA 4Z2GA 4LEUA 4N5CA 3B7XA 3D9IA 2MNTA 5G04J 5HW8A 1OGGA 1B6CA 4CEMA 3D9LA 3KAEA 1E8YA 2JLBA 4WNFA 5DITA 1B89A 3OXGA 3ZIMA 3EIJA 1ZL1A 1E6ZA 5CCMA 4UWKA 1HJXA 2KE0A 3CQCB 1QQEA 3GYZA 4I1MA 1MQSA 4Z2IA 3LPZA 1QNFA 1HZ4A 5CMWA 3FTUA 5HQ8A 3PA7A 4PUCA 2FF4A 1W26A 3ZRHA 1ITXA 4DZ3A 4HXIA 4TX0A 3RRUA 4AEZC 4AJWA 3JCKC 3UF8A 2NSZA 3UMVA 3VAWA 4CRWA 3TG5A 2ZR6A 3SBSA 4IQCA 4A55A 4J4OA 3MKQB 3B7TA 3LEWA 3NQPA 1HXIA 3KS2A 3CHCA 4ILHB 5FJYA 2AVPA 1H2VC 4GZDA 3URZA 3PRZA 5LX8A 5HWBA 1OWNA 3B7UX 4FADA 3CGMA 2WPVA 4YNDA 3HVEB 4E6HA 3CVLA 2QF8A 1W9VA 5AIJA 2VTBB 2FI7A 4GA1A 4Y6CA 1SR0A 4WWPA 3FUDA 5KCMA 3IKOB 4APFA 4N2SA 4TYOA 4DWSB 1U3DA 3CHQA 4I2ZA 5KJNA 5EX0A 4EPZA 3VLDA 4I6EA 4XZ4A 4DIPA 4TUUA 3GZSA 3HYMB 2XRZA 5BUZA 2E0IA 3E4BA 3ZHEB 4CGWA 1IHGA 2WXJA 1TFVA 3WQVA 4OVUA 1SYTA 4YVOA 3QWVA 3L08A 1W3BA 3JYSA 4XX5A 2RUCA 2YINA 4NRHB 4MS6A 4ANWA 3S7FA 5E75A 5G05J 3JXVA 4JL0A 3LVRE 2R5SA 1W1YA 2XPBA 3WD4A 3SNXA 1PAQA 4WWOA 4N3BA 3T5XA 4DH0A 2I2OA 4J8DA 4DI4A 4WNEA 4DRNA 2JZVA 3PZDA 2VSNA 2WB2A 5HW6A 1HG5A 3O5KA 3HVEA 3PE4A 2HM8A 3ZXSA 1NZNA 2WXLA 2X6FA 3CHMA 2VTBA 3SZ7A 3Q15A 3ASGA 2KCKA 3L16A 4DWSA 2R59A 3R7RA 2MRIA 3FTVA 3MV3B 4FJYA 1BPOA 3CV0A 1WAWA 3KZ7A 2AXUA 3JYMA 4W9PA 3RO2A 3JQ0A 1HJVA 4KZ0A 3ZHEA 1HH8A 3APFA 1SZ9A 4P8XA 3AROA 4HOQA 4U0ZA 3ZW3A 3QKYA 4MKTA 4B0ZA 4XAKA 3KAHA 4A1SA 4BY6A 3QOKA 4FLHA 5ANRA 3FTWA 1SQMA 2KATA 2AW6A 3AU5A 4I1OB 1HKMA 3ENEA 3CVNA 2C0MA 3R7QA 5KJLA 3FAPA 4L1BA 1VF8A 4ODQA 3BG1B 3MYVA 4L23A 2DG9A 3G6LA 3LJ3A 1ELWA 1TJFA 3BG0B 3PH0C 1PC2A 4Q69A 3ULQA 3P2BA 1UJKA 2J9QA 2PQRA 4DRMA 2KCVA 5FZRA 3HDXA 3LKUA 1ZU2A 3UX4A 4BWRA 2G8ZA 3CZ8A 4U0SA 4DRHA 2MLZA 5HI7A 4GPKA 3FWVA 2WXRA 2CG2A 2XCBA 2ESCA 2ZR5A 3TGOA 1FKJA 2R17C 2ZQVA 5HT1A 2I6HA 3TL5A 2OV8A 1L1PA 2DPEA 4BFRA 2MLYA 2Y4UA 3O5DA 2XGMA 2WXIA 4HVBA 4TW7A 5E76A 4BF8A 4Z2KA 2LJ4A 4J8EA 1NWRA 4MNLA 4LUNU 4BT8A 3S7DA 2G41A 2HYZA 3OAWA 1J6YA 1W1VA 2CFUA 1EPUA 2A4ZA 2WXGA 4WNGA 1HU3A 3UT7A 5FQ6A 2NC9A 3OA5A 1KFWA 1LJYA 2WXKA 2X6KA 1ZB5A 2ITKA 1BL4A 1RD6A 2V4LA 5DO2A 1E6RA 3D9NA 3O5JA 3FUIA 4Z2JA 2IOLA 4IPXA 2GRLA 3ZYMA 5G04C 3IKGA 2XPAA 2PV3A 3B9DA 1ZCNA 3EHMA 2XGSA 4A1GA 5HUAA 4I6GA 4GZ6A 3D9KA 5D75A 4Y6WA 4KVMA 3W4RA 1BKFA 4MLPA 2QFCA 3RRMB 5B8IC 1IQRA 3GZ2A 4UI9J 4W9RA 3FUJA 1OWOA 1E8XA 5DEZA 3RM8A 4GZ3A 4TV3A 3QC1A 1XRVA 2UY1B 4N39A 4U63A 3TC5A 2CG3A 1ZU8A 1Z3YA 4NQ0A 1ZBVA 1EF1C 2IF4A 4L72B 1E9LA 4AV7A 4JVSA 2KZTB 2OLHA 2WXQA 3ARPA 2J08A 4AVXA 1YW5A 1GPFA 1ZBWA 1E15A 4AIFA 3AS4A 2ZR4A 5DIZA 3RM9A 4W9QA 2F2DA 1UG3A 3IHVA 1UN9A 3ARVA 3KABA 4ANXA 1J4IA 2DT1A 2J49A 1CTNA 1XGWA 3ARZA 4I9CA 3CH9A 3ASFA 4NACA 4CDNA 1DNPA 3O5MA 2WXMA 3I5PA 1EYHA 2KFWA 4UWHA 3LDZA 4IULA 4FJZA 2VYIA 2IQCA 5ARFA 1N54A 2XPIA 4BTAA 2WQ6A 1FKDA 5JHBA 4GU5A 3D9MA 3R9AB 4GGQA 1HS6A 3APDA 3LY7A 5G55A 3IBEA 4HLEA 2LPVA 4MRUA 4I17A 2ZQSA 4P8UA 2F4EA 4JA7A 1FKHA 3TAXA 1R9HA 3AS3A 2RG8A 3S7JA 4DZ2A 1UW4B 3AS1A 4W5UA 1IX5A 5C2YA 3UQIA 2KGJA 5FQ7A 5AJDA 1Z6TA 2UY1A 2GRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNS A;  1ZK6 A;  4JYS A;  4YVO A;  3QWV A;  1W3B A;  3JYS A;  3UQ3 A;  5BXJ A;  4DRQ A;  2RUC A;  3KD7 A;  4NRH B;  5CHE E;  5DBK A;  1JNT A;  5A7D B;  2DG3 A;  2LSV A;  2MPH A;  4YVQ C;  4ODR A;  4JFI A;  2UWJ G;  4ODN A;  3S7F A;  3MDY B;  3IK8 A;  2ZQT A;  2PQN A;  3LCA A;  5G05 J;  3RU0 A;  1M5Y A;  2UZ5 A;  3JXV A;  4DRK A;  4GZ5 A;  4JL0 A;  2PV1 A;  2HR2 A;  2R5S A;  1N1A A;  1XNF A;  5G05 C;  3QWW A;  2FBN A;  1P5Q A;  2L6J A;  3K9I A;  4N19 A;  2XPB A;  4KBQ A;  5JJ6 A;  1Q1C A;  4N3B A;  5HKG A;  4GA0 A;  4DH0 A;  2ZQU A;  4O2T A;  4G23 A;  2HO1 A;  4LAX A;  4J8D A;  3WXX A;  4NNR A;  1IYG A;  4WNE A;  4DRN A;  2PZI A;  3RO3 A;  5KJM A;  2JZV A;  2VSN A;  1YA0 A;  4W9O A;  3OOB A;  2Y4T A;  5HW6 A;  5BT1 A;  5I98 A;  3O5K A;  4R0X A;  3TDB A;  1Q6I A;  2AWG A;  3PE4 A;  3Q5M A;  3EY6 A;  2VQ2 A;  5CCL A;  1NZN A;  3SZ7 A;  1JVW A;  3Q15 A;  4GYW A;  5GPG A;  3ASG A;  2KCK A;  1FD9 A;  5A6C A;  5FZS A;  3O5Q A;  4JFK A;  3O5O A;  2C0L A;  2Q7F A;  4ODO A;  2YHC A;  4RG6 A;  4JFL A;  3KAG A;  3MV3 B;  5HTG A;  3CV0 A;  3UQA A;  4U86 A;  5AYW D;  1WAO 1;  3KZ7 A;  1TCO C;  4U07 A;  3O5G A;  3FFL A;  3JYM A;  4W9P A;  3O5E A;  4QIB A;  1FKG A;  3CK9 A;  3RO2 A;  2RSE A;  2FO7 A;  4F3V A;  2PV2 A;  3O48 A;  4GCN A;  2M2A A;  3GZ1 A;  3CVP A;  2VCD A;  4JFJ A;  5D0Q D;  3ZHE A;  2RUR A;  1HH8 A;  2P58 C;  2XP6 A;  4WND A;  2E2E A;  5JJT A;  2PPO A;  2XP7 A;  3S7B A;  3Q49 B;  3OXF A;  3NRK A;  4HOQ A;  2KI3 A;  4G2P A;  3WH0 A;  4U0Z A;  3QKY A;  2LSU A;  4HOT A;  4J8F A;  3KAH A;  4ODK A;  4B94 A;  3AS5 A;  4A1S A;  1D7H A;  3UI4 A;  3NTP A;  2LNI A;  4GYY A;  2VN1 A;  5C1D A;  5HWC A;  3FP3 A;  3LYA A;  3UUX A;  2M08 A;  1J4R A;  2RUD A;  4ODM A;  3VTX A;  2KAT A;  2K8I A;  1J4H A;  1NMV A;  3I6C A;  1Q6H A;  4UI9 K;  4TNS A;  4G26 A;  4N3C A;  5KJK A;  2FKE A;  3CEQ A;  1U79 A;  3CGN A;  3CVN A;  4J0U A;  4XI9 A;  2C0M A;  4DRO A;  4KYO B;  1FKR A;  5FT9 A;  2XP9 A;  1Q6U A;  5KJL A;  4EQF A;  2KR7 A;  3FAP A;  3KAC A;  5EX3 A;  1HXV A;  4ODQ A;  4DRP A;  2XP3 A;  5BNW A;  3ZN3 A;  3U3W A;  2DG9 A;  4BTB A;  1EYM A;  1ELW A;  4TW6 A;  4DT4 A;  2MLX A;  4HOS A;  1PC2 A;  5JJ7 A;  3ULQ A;  3O5P A;  3BEE A;  5D0O D;  2J9Q A;  2XGO A;  1D6O A;  1TJC A;  2PQR A;  4H7X A;  2L2S A;  4DRM A;  2DG4 A;  4GIV A;  2VSY A;  2KCV A;  1PBK A;  3H9R B;  1KT0 A;  5FZR A;  2RUQ A;  4AM9 A;  3ZGQ A;  3LKU A;  4G50 A;  4ABN A;  3Q4A B;  5M72 A;  1ZU2 A;  1F40 A;  5LCW J;  4BWR A;  3ASD A;  4U0S A;  4DRH A;  1NMW A;  3GW4 A;  5DIV A;  2N87 A;  4DRJ A;  2MLZ A;  4MSP A;  2VGX B;  5HI7 A;  4ME2 A;  4GPK A;  3FWV A;  1A17 A;  4N3A A;  3OXL A;  3MV2 B;  3VTY A;  2XCB A;  2ZR5 A;  3PRB A;  4XIF A;  4G24 A;  2BUG A;  4U84 A;  3TGO A;  1FKJ A;  1Y8M A;  2XEV A;  4UQX A;  2ZQV A;  1KT1 A;  4GA2 A;  2I6H A;  5HT1 A;  4FAP A;  3CKB A;  1FKT A;  1L1P A;  3PE3 A;  4JFM A;  1F8A B;  3AS8 A;  4G2V A;  2MLY A;  1FKL A;  2Y4U A;  2OND A;  4MGV A;  1FKK A;  3CVQ A;  3O5D A;  2XGM A;  4AY6 A;  4TW7 A;  4IQ2 A;  3NI6 A;  4BF8 A;  2C2L A;  2KC7 A;  4LAY A;  2M1I A;  2LJ4 A;  3PRD A;  1Y0O A;  4J8E A;  5FTP A;  2PL2 A;  4BT8 A;  3S7D A;  2HYZ A;  2LGO A;  2PBC A;  1A7X A;  1KLX A;  3LY8 A;  4XI0 A;  1NSG A;  1NA3 A;  4U04 A;  4GYO A;  1OUV A;  1E96 B;  1FJD A;  3QWP A;  3ZFW A;  3KCE A;  1J6Y A;  2PPP A;  3UI6 A;  4G25 A;  4I1A A;  4AY5 A;  5ARG A;  4WNG A;  3NF1 A;  4I2W A;  3MKR A;  4C02 B;  3O5F A;  1FKS A;  2NC9 A;  3JYJ A;  2OOE A;  5EKQ D;  1C9H A;  1FKI A;  1D7I A;  4CDR A;  3U4T A;  2ITK A;  4RG9 A;  1BL4 A;  2MHK A;  3KAF A;  4LEU A;  4N5C A;  3B7X A;  3O5J A;  2MNT A;  5G04 J;  1D7J A;  3ZPJ A;  3ODK A;  5HW8 A;  4UQY A;  4JA9 A;  4LAW A;  1QPF A;  1B6C A;  3KAE A;  1NA0 A;  4IPX A;  5G04 C;  3QOU A;  3IKG A;  4U0U A;  4GCO A;  2PV3 A;  2XPA A;  1ZCN A;  2JLB A;  4WNF A;  2PPN A;  5DIT A;  1B89 A;  4KXK B;  3OXG A;  2XGS A;  5HUA A;  3UQB A;  3CK8 A;  3LY9 A;  4GZ6 A;  3O5I A;  3CK7 A;  4FN2 A;  3ESK A;  5D75 A;  2VGX A;  5CCM A;  4Y6W A;  3IKD A;  4APO A;  4QT2 A;  4CGV A;  1BKF A;  2QFC A;  2WQH A;  4BT9 A;  5B8I C;  2KE0 A;  3GZ2 A;  4UI9 J;  4W9R A;  3O5L A;  4G1T A;  1QQE A;  3GYZ A;  4UQZ A;  4GZ3 A;  3LPZ A;  4UI9 C;  2D9F A;  2UY1 B;  1HZ4 A;  2KO7 A;  4N39 A;  4WUY A;  3TC5 A;  5HQ8 A;  3PA7 A;  2FF4 A;  5FZQ A;  5J6E A;  1W26 A;  4NQ0 A;  5LCW C;  4HOR A;  2F21 A;  3SF4 A;  4DZ3 A;  2IF4 A;  4DRI A;  4H7Y A;  4TX0 A;  5DIU A;  3ASH A;  3LUO A;  3IHZ A;  3UF8 A;  2LKN A;  4QT3 A;  2Y78 A;  1ELR A;  3VAW A;  5BW8 C;  3UI5 A;  2XP8 A;  3TG5 A;  3UPV A;  2ZR6 A;  1YW5 A;  4IQC A;  3O5R A;  3TCZ A;  3IEG A;  4J4O A;  4AIF A;  3TG4 A;  3AS4 A;  2ZR4 A;  5DIZ A;  4W9Q A;  2F2D A;  1YAT A;  3KAD A;  1HXI A;  3KAB A;  1J4I A;  3KS2 A;  2IFU A;  4LAV A;  5FJY A;  4I9C A;  2KCL A;  2YQ8 A;  1PIN A;  2AVP A;  3RKV A;  3ASF A;  1QZ2 A;  3URZ A;  4ITZ A;  5HWB A;  3O5M A;  1FKF A;  2FEZ A;  3KAI A;  4ODP A;  3CGM A;  2WPV A;  4YND A;  3CKC A;  2KFW A;  1FAP A;  2FAP A;  4O6F A;  1T11 A;  3CVL A;  4JHR A;  2VYI A;  5ARF A;  2FI7 A;  3QDN A;  4GA1 A;  2DBA A;  4Y6C A;  1QPL A;  2XPI A;  4HOU A;  4BTA A;  3Q47 B;  1FKD A;  4IN3 B;  4TW8 A;  1FCH A;  4N2S A;  4TYO A;  2XP4 A;  1EQ3 A;  4I2Z A;  5KJN A;  3R9A B;  4GGQ A;  5EX0 A;  2RQS A;  3LY7 A;  2VGY A;  4N2Q A;  2LPV A;  4I17 A;  4DIP A;  2ZQS A;  3RIB A;  2F4E A;  5HW7 A;  4U85 A;  4JA7 A;  1FKH A;  3RFW A;  3GPK A;  3PDN A;  3TAX A;  2V5F A;  1R9H A;  1FKB A;  2Q5A A;  3S7J A;  4DZ2 A;  3HYM B;  2OFN A;  2XP5 A;  3E4B A;  3ZHE B;  4ODL A;  4CGW A;  4J4N A;  4I9E A;  3MA5 A;  3N71 A;  3UQI A;  2KGJ A;  1IHG A;  3MEK A;  3EDT B;  1ZBP A;  1WM5 A;  3RJV A;  2XCC A;  2MF9 A;  2GW1 A;  1ROU A;  1ROT A;  3RGC A;  2UY1 A; 
#chains in the Genus database with same CATH topology
 4KQZ A;  4JYS A;  1OGB A;  3UQ3 A;  1N0R A;  5BXJ A;  4DRQ A;  3KD7 A;  5CHE E;  5DBK A;  1JNT A;  5A7D B;  2JAB A;  2LSV A;  2MPH A;  4YVQ C;  4DX5 D;  4ODN A;  3MDY B;  4ZFH A;  2KZT A;  4XE0 A;  2H6I A;  4C48 B;  1WY6 A;  3UIN C;  4O60 A;  2P4V A;  4GZ5 A;  3JXI A;  5G05 C;  3QWW A;  1P5Q A;  2L6J A;  3K9I A;  4AOF A;  1Q1C A;  4LNB A;  1E90 A;  5T8I A;  4DX6 D;  3FUH A;  2ZQU A;  1VDY A;  4O2T A;  4G23 A;  1H2T C;  2HO1 A;  1SA4 A;  3UKR G;  4NNR A;  4F6R D;  3J5Q B;  4KVO A;  1IYG A;  3IHY A;  2RKK A;  5KJM A;  5I98 A;  2BTD A;  2OVB A;  4PTM A;  3X2Q E;  3U9W A;  5CCL A;  4E85 A;  4F7A A;  3FUE A;  2A3E A;  1JVW A;  5GPG A;  2MOW A;  5FZS A;  2EUL A;  2YBU A;  4JFK A;  4DX1 A;  3O5O A;  2ETA A;  2YHC A;  4ZPW R;  3I4G A;  4JFL A;  5KBA A;  3QNK A;  3UQA A;  4U86 A;  3D9P A;  2XHE A;  1XHG A;  5AYW D;  4CDM A;  1WAO 1;  2DSU A;  4C9B B;  2I1K A;  3O5E A;  5EYL A;  2RSE A;  3L6A A;  2FO7 A;  4GCN A;  2M2A A;  3CVP A;  3C3O A;  4MAV A;  3S2A A;  4BER A;  2P58 C;  3CLJ A;  2PPO A;  4BX9 A;  3U64 A;  3W9G A;  3UT8 A;  1JPL A;  3OXF A;  1E7U A;  3EJN A;  3CVY A;  3KEZ A;  3WH0 A;  3FUM A;  1ZBK A;  1D7H A;  3AS5 A;  1D2K A;  1H0A A;  5CED B;  4WJX A;  4GAA A;  4G8L A;  3FP3 A;  2M08 A;  4I6J A;  3ZXP A;  4EBA A;  4URK A;  4ODM A;  3JUE A;  2BF0 X;  2RFM A;  5ENN A;  1J4H A;  3I6C A;  3CHS A;  1Q6H A;  4UI9 K;  4TNS A;  3DRA A;  4G26 A;  3HXF A;  5KJK A;  3L13 A;  4L2Y A;  3ALF A;  3CGN A;  3EIP A;  4PDX A;  2ILR A;  4DPR A;  1OCC E;  3DPY A;  4NIK A;  3L82 A;  1LG1 A;  4Q7N A;  4TW6 A;  4DT4 A;  3DSU A;  2MLX A;  4GML A;  1D6O A;  4U8H A;  3FXY A;  4WAF A;  2EIL E;  1S63 A;  3H9R B;  4RVB A;  3E37 A;  3DSW A;  2F37 A;  2RUQ A;  4A3T A;  3ZYL A;  2ZU6 B;  4ABN A;  3ASD A;  2XEE A;  4LSZ E;  4V3I A;  1NMW A;  4FC8 A;  2ZGG A;  3GW4 A;  2VGX B;  1FFQ A;  1NH6 A;  1A17 A;  1V55 E;  2CHW A;  3EHN A;  4N3A A;  3CSF A;  2PM7 A;  3R9M A;  3CVU A;  4KT6 B;  3VTY A;  3NB2 A;  1O6I A;  4G24 A;  4A3V A;  1N4R A;  4UQX A;  1JWF A;  1O1T A;  4OVV A;  2OVF A;  1FFR A;  3PNT B;  1N4Q A;  3CGH A;  4U8V D;  1GW6 A;  3MZL B;  3PE3 A;  1YYH A;  1F8A B;  2J4B A;  3AS8 A;  3IXE A;  3TWS A;  1FKL A;  3B13 A;  4HAR A;  3TJP A;  1FKK A;  3CVQ A;  5CER B;  4YDW A;  2QC9 A;  4FUL A;  1SVX A;  3WKZ A;  4AY6 A;  2XPY A;  3L54 A;  4IQ2 A;  4L2L A;  2C2L A;  3NZS A;  4DRX E;  2KC7 A;  4LAY A;  4L3N A;  2JEK A;  1Y0O A;  3G2T A;  3ISM C;  2PBC A;  2L6B A;  1DVP A;  3LY8 A;  4XI0 A;  1NA3 A;  3DPD A;  1BLX B;  4U04 A;  5AQB A;  3C98 A;  1OUV A;  3G2U A;  1JCQ A;  2WXN A;  2PPP A;  1G3N B;  4G25 A;  4I1A A;  4FHJ A;  5A23 A;  5ARG A;  3SGH A;  3NF1 A;  1X81 A;  1FKS A;  4MNK A;  1FKI A;  4DK5 A;  1D7I A;  1N4P A;  1YCS B;  2DT0 A;  3AQU A;  3ARY A;  4HFG A;  1N0Q A;  4RG9 A;  2MHK A;  1LTX A;  3KAF A;  1NFI E;  1D7J A;  3ODK A;  1JWG A;  1D9S A;  4UQY A;  4P8W A;  4JA9 A;  4LAW A;  1QPF A;  1KZO A;  2F8X K;  1Q2Z A;  4U0U A;  3WD2 A;  5HBF A;  2PPN A;  3SFY A;  5CRV A;  2ETB A;  3PRA A;  4DI3 A;  3UQB A;  3CK8 A;  1DC2 A;  3O5I A;  3CK7 A;  4FN2 A;  4LG6 A;  5CBN A;  1BI8 B;  3ESK A;  4OAU C;  1D8E A;  2VGX A;  2P9N G;  3SHF A;  4IT6 A;  4QT2 A;  4CGV A;  2WQH A;  3FU6 A;  4BT9 A;  3FUK A;  4ZPV R;  5LFA A;  4OYS A;  4G1T A;  5LOZ A;  3Q79 A;  4UI9 C;  2D9F A;  2KO7 A;  1UR8 A;  2RD0 A;  3Q9N C;  4FP7 A;  1NWU A;  5FZQ A;  5J6E A;  3B9E A;  1GOI A;  4Q22 A;  1O5M A;  5HRY A;  5LCW C;  4HOR A;  2F21 A;  4RQI A;  4DRI A;  3G2S A;  4S3J A;  2WVI A;  2DZN A;  3C72 A;  4ANU A;  3IHZ A;  4OAV B;  4QT3 A;  1ELR A;  4HBE A;  2X6H A;  3UI5 A;  2P9L G;  3NAW A;  3UM2 A;  3ARU A;  3TCZ A;  3TG4 A;  4B93 B;  2AWI A;  3SFZ A;  1YAT A;  3AG2 E;  1OT8 A;  4L7T A;  3KAD A;  3ML9 A;  2X6I A;  1D8D A;  5HS0 A;  2IFU A;  1JCR A;  2DSW A;  2XS1 A;  2KCL A;  2YQ8 A;  3V2O A;  4B8A A;  2R02 A;  2LUH A;  1PIN A;  3RKV A;  5BPP A;  2PN0 A;  1QZ2 A;  3B9A A;  4ITZ A;  2WLY A;  3ULE G;  5J90 A;  2PI6 A;  5DF0 A;  4DWS D;  1E8W A;  2FEZ A;  3KAI A;  4HS2 A;  2CHZ A;  2FAP A;  3RAU A;  4O6F A;  3FH7 A;  3T8M A;  1T11 A;  4JHR A;  3CHE A;  4CT4 A;  3QDN A;  3QK0 A;  1QPL A;  4HOU A;  4XKC A;  3I4R B;  2Y69 E;  3NBN B;  4GTQ A;  3U66 A;  1WDY A;  4CCA A;  2XP4 A;  3DWL G;  4LGX A;  2ETC A;  4DX7 D;  2L0I A;  5J08 A;  2RQS A;  2VGY A;  5ENT D;  2Y3A A;  3RIB A;  4Q94 A;  3RFW A;  1OCO E;  3PDN A;  2H6F A;  1H6K A;  2OFN A;  4ODL A;  5KWD A;  4I9E A;  3MA5 A;  3N71 A;  3QAR A;  3RM4 A;  3EDT B;  1ZBP A;  1WM5 A;  3RJV A;  1MZC A;  2XCC A;  3SQV A;  4F1S A;  4JXT A;  2O92 A;  1ROU A;  1ROT A;  4FLB A;  2IOS A;  2YNQ A;  1ZK6 A;  5JMN D;  3APC A;  3D9O A;  1TN8 A;  4BX8 A;  2DG3 A;  4WKH A;  4G8K A;  4ODR A;  1KPS B;  4YDY A;  4C0M A;  4QFV A;  3FH8 A;  4WWN A;  3RU0 A;  1M5Y A;  1Z3X A;  1HKK A;  4IT4 A;  4DRK A;  3EU9 A;  2WMN A;  1MYO A;  2HR2 A;  1XNF A;  2XRY A;  2EIM E;  3FTZ A;  3RME A;  3PNL B;  3HXE A;  2DCP A;  3KEA A;  1TNB A;  1LD7 A;  2DSV A;  3DSS A;  3FEX A;  4JC8 A;  5ENQ D;  1UN8 A;  2WLZ A;  3LJN A;  3TWR A;  4UWL A;  1UR9 A;  4W9O A;  3PEU B;  2Y4T A;  5BT1 A;  1W9P A;  1IKN D;  4MNJ A;  3T5V A;  4JB8 P;  1Q6I A;  4LNU D;  3UM3 A;  1HKJ A;  3PRE A;  2DVW A;  2VJ8 A;  2YHE A;  3V79 K;  3EY6 A;  2VQ2 A;  3ESL A;  2XZT G;  5IY5 E;  4MBG A;  1FD9 A;  3WQW A;  3FU3 A;  3O5Q A;  2C0L A;  1HG2 A;  4A63 B;  4ML4 A;  2WK2 A;  1TR4 A;  2ZIS A;  3KAG A;  5KNH D;  2DSZ A;  3PUJ A;  1OWM A;  3DEP A;  5CRU A;  3FFL A;  5EIL A;  4DJA A;  2GRN B;  4QIB A;  4PS7 A;  2PV2 A;  2KXP C;  4F3V A;  3Q7F A;  1S0P A;  1N11 A;  4ANV A;  2BKK B;  2VCD A;  2WXF A;  1TNY A;  1HX8 A;  5BXO A;  1IQU A;  1AWC B;  3CST A;  5JJT A;  2OEW A;  2XP7 A;  4GMJ A;  1WNO A;  2KM4 A;  1W1T A;  2WM9 A;  3NRK A;  2KI3 A;  4GTO A;  4JZY A;  4DUI A;  4HOT A;  4J8F A;  4ODK A;  3HIZ A;  2B0O E;  3NTP A;  2DYS E;  2LNI A;  4GYY A;  2VN1 A;  5ENS D;  3LYA A;  4RSY A;  3UUX A;  1DCQ A;  3L22 A;  2RUD A;  3MX3 A;  2H6H A;  3T9K A;  3VTX A;  3JQ1 A;  2K8I A;  3FDH A;  3UM1 A;  1X6N A;  3JUI A;  4B89 A;  1LL7 A;  4JHK A;  1E8Z A;  1Y6I A;  3CVW A;  5FQ4 A;  2IJG X;  4XI9 A;  4DRO A;  4KYO B;  1FKR A;  3AAA C;  5FT9 A;  1NWT A;  3V31 A;  3FTS A;  2XP9 A;  1MX2 A;  1Q6U A;  2KR7 A;  1HXV A;  3KAC A;  4DRP A;  3TWU A;  2XP3 A;  3L17 A;  4NSB A;  4BTB A;  3EIQ C;  3FU5 A;  2VSX E;  1H0I A;  3ARQ A;  3QJZ A;  3ZEF A;  1X5B A;  2I9C A;  2KBX A;  3G2V A;  5JJ7 A;  3O5P A;  2XGO A;  3SY2 A;  1EHN A;  5BV0 A;  2L2S A;  4GIV A;  5G2N A;  3ARW A;  1PBK A;  4AM9 A;  3ZGQ A;  2A3C A;  4G50 A;  3DSV A;  3Q4A B;  3AG3 E;  3ZU7 B;  1F40 A;  4WIW A;  3CIA A;  2MYO A;  2PM6 A;  4NZC A;  5FWQ A;  5DIV A;  2N87 A;  4MSP A;  5H7P A;  3ZVV A;  4ME2 A;  3WD1 A;  3MJW A;  2XS8 A;  1E6P A;  4KMO A;  4R5E A;  3WD0 A;  4GTT A;  2EQX A;  1HO8 A;  3D9H A;  4XIF A;  3EHQ A;  3RSE G;  1LG2 A;  2XEV A;  1OWL A;  2DWZ A;  4GA2 A;  1ZBC A;  1NP7 A;  1N52 A;  1TNO A;  3C3R A;  1H0G A;  3ZUV B;  3ZKJ A;  3QB2 A;  1LL6 A;  5CEA A;  4G2V A;  1HKI A;  1INZ A;  3LS8 A;  1JUQ A;  4EHM A;  3ABL E;  1U3C A;  2AOS A;  2YBT A;  3NI6 A;  4JPS A;  2AXV A;  3CVX A;  3UT4 A;  2M1I A;  5FTP A;  2I1J A;  2PL2 A;  4LER A;  1NWS A;  3D9J A;  3TWX A;  3P1U A;  4EBA G;  5T3R A;  4WKA A;  3QWP A;  3OTN A;  4KZC A;  3WL1 A;  3HHM A;  3UI6 A;  3UM0 A;  4AY5 A;  1MJ0 A;  4UWF A;  2ZIR A;  1SA5 A;  2WQ7 A;  3O5F A;  5JHA A;  2OOE A;  5EKQ D;  4U95 D;  3ZYK A;  2GGF A;  5ANL A;  4CDR A;  3AS0 A;  3U4T A;  2FDM A;  4HB5 A;  1OWP A;  3BU8 A;  4R7L A;  3AS2 A;  3ZPJ A;  2LO6 A;  1H6P A;  3V30 A;  4LCT A;  2NXP A;  1S70 B;  1NA0 A;  3QOU A;  3UI2 A;  4IRU A;  3MGB A;  4GCO A;  2CFZ A;  3G6M A;  3B8S A;  4KXK B;  4Z2H A;  4AY1 A;  3DSX A;  3LY9 A;  3BXW A;  4XKB A;  3J5P A;  4PS3 A;  1O1R A;  3T8K A;  3IKD A;  3ABK E;  4APO A;  3NZU A;  4GB9 A;  5AAR A;  3TWT A;  5EYP F;  2O9O A;  3AU4 A;  3O5L A;  1HFA A;  4KR0 B;  2A5U A;  4UQZ A;  3AJI A;  3CQG B;  3SI5 A;  4CT0 A;  4WUY A;  3MKQ A;  4S3K A;  3DBS A;  4NUR A;  3RK6 A;  4ATG A;  2XPZ A;  3SF4 A;  4AP2 A;  3LVQ E;  4X8Q A;  4K03 A;  1GUV A;  1WG0 A;  4H7Y A;  1OCZ E;  5DIU A;  4G11 A;  3ASH A;  3LUO A;  5AQ7 A;  3ZYQ A;  2LKN A;  4ILG A;  2Y78 A;  5BW8 C;  2XP8 A;  3UPV A;  1TEZ A;  3O5R A;  3FHE A;  3IEG A;  4BEP A;  2V8S E;  3TXN A;  4WK9 A;  3Q73 A;  3ARR A;  2EIK E;  4YDO A;  1FVF A;  3CHR A;  4MNM A;  4TXP A;  1HE8 A;  2LAI A;  3WD3 A;  4MTV A;  4LAV A;  2X3M A;  4FU3 A;  3HXD A;  3WL0 A;  1FKF A;  2QYJ A;  3V2X A;  3ALG A;  1LQ0 A;  4ODP A;  1LF8 A;  2GRP B;  2IO3 C;  3CKC A;  1FAP A;  4U7E B;  4GPM A;  5BV1 A;  4JW1 A;  3RRN B;  3SBT B;  5GPR A;  2M63 A;  4GTM A;  2DBA A;  5EDS A;  3Q47 B;  3FEY A;  3LXU X;  2B31 A;  4IN3 B;  3VLE A;  1EDU A;  4TW8 A;  1FCH A;  2B6C A;  5ENP D;  3FY4 A;  3FUL A;  2DT3 A;  3PUK A;  1EQ3 A;  2X38 A;  3CHD A;  4N2Q A;  2FUL A;  3B7R L;  5FQ8 A;  2J07 A;  5HW7 A;  4U85 A;  4IYP A;  3GPK A;  3ML8 A;  5AN8 A;  2V5F A;  2IEJ A;  1FKB A;  1K1B A;  2Q5A A;  1FVH A;  2XP5 A;  4J4N A;  3G2W A;  3MEK A;  3WIJ A;  3E30 A;  4O1O A;  5T4Y A;  3W9F A;  2MF9 A;  2GW1 A;  4FHK A;  2F0Y A;  3ONK A;  3RGC A;  3GU0 A;  2ION A;  3FH5 A;  1JNS A;  1FT1 A;  4ZPT R;  4TUM A;  1WB0 A;  4K5C A;  3L9T A;  1L5J A;  4JFI A;  2UWJ G;  3CHO A;  3IK8 A;  2ZQT A;  1OWQ A;  2PQN A;  4MPK A;  2GRO B;  3LCA A;  1HF8 A;  1HJW A;  3MCX A;  2UZ5 A;  2P2C P;  1EIB A;  1E7V A;  4DX2 A;  2V4H C;  2PV1 A;  1N94 A;  1N1A A;  4C0E A;  4LNG A;  2FBN A;  4N19 A;  4KBQ A;  5JJ6 A;  2J09 A;  5HKG A;  4GA0 A;  4DWS C;  1W9U A;  1H2U A;  4LAX A;  3WXX A;  2AXZ A;  3HG0 D;  2X6J A;  4JEU A;  3ARS A;  3CVV A;  3FUF A;  2PZI A;  2Y1L E;  3RO3 A;  4CZ2 D;  1YA0 A;  1SZA A;  1TNU A;  3KSL A;  3OOB A;  3SD5 A;  3ONL A;  3ASN E;  3BUA A;  4U8Y D;  4R0X A;  4PH4 B;  3TDB A;  1E6N A;  2AWG A;  1MHQ A;  3ULY A;  2FO1 E;  3Q5M A;  1N9A A;  3D3M A;  4GYW A;  4DLQ A;  5A6C A;  4ODO A;  2Q7F A;  1H6O A;  2J4D A;  4RG6 A;  5HTG A;  3FUN A;  3O4Z A;  5AQA A;  3PS6 A;  4QZV B;  1TCO C;  4U07 A;  3O5G A;  4M3O A;  1H19 A;  1FKG A;  3CK9 A;  3B7S A;  3TXM A;  4HLL A;  3PEV B;  3O48 A;  2P9U G;  3GZ1 A;  3ASO E;  2WM0 A;  1IXV A;  1EDQ A;  4JFJ A;  5D0Q D;  2A3A A;  3PR9 A;  2L9B A;  2RUR A;  2XP6 A;  2CHX A;  4WND A;  2E2E A;  4B8C B;  3S7B A;  1RW2 A;  5LP0 A;  2IUZ A;  4HI8 A;  3VLF A;  3Q49 B;  2L0T B;  5AJL A;  4G2P A;  4EZJ A;  3DEO A;  1JNE A;  2LSU A;  3EU5 A;  2QYU A;  4B94 A;  4P8V A;  3UI4 A;  3CHP A;  5CMY A;  5C1D A;  5HWC A;  2AJA A;  3DXK G;  4JHJ A;  1J4R A;  1NMV A;  3BMB A;  4GZC A;  1S64 A;  2OCC E;  4N3C A;  3HXC A;  2FKE A;  3I3N A;  3CEQ A;  1U79 A;  4J0U A;  1K9T A;  1MX6 A;  1NL4 A;  4N5Q A;  3SFX A;  3WG7 E;  4LRZ A;  4ILI A;  3QAQ A;  4EQF A;  5GQB A;  5EX3 A;  5BNW A;  4JEH A;  3ZN3 A;  3U3W A;  1EYM A;  2XEN A;  3Q7A A;  3FY1 A;  1RZ4 A;  4I43 A;  4HOS A;  4D10 C;  3BEE A;  5D0O D;  1TJC A;  4H7X A;  4BSX A;  2WXO A;  2DG4 A;  3DST A;  3IV0 A;  4EEC A;  2VSY A;  1KT0 A;  2VSO E;  3PVL A;  2WMO A;  2P9P G;  5M72 A;  4J8S A;  1QYM A;  5LCW J;  4TRQ A;  2WXP A;  4URI A;  4DRJ A;  3F6Q A;  4J6I A;  4QQI A;  4F1P A;  4AXH A;  4Q96 A;  3OXL A;  2XQ0 A;  3MV2 B;  1GRJ A;  2P9S G;  3PRB A;  2XEH A;  2BUG A;  4BET A;  4U84 A;  1Y8M A;  1AP7 A;  4UDM A;  1KT1 A;  1U2V G;  1X6L A;  3CKB A;  4FAP A;  4ZS6 A;  2V0P A;  1FKT A;  3FTX A;  1UJJ A;  2IU1 A;  3CR3 A;  4JFM A;  2DIW A;  2OND A;  3JXJ A;  3PZ3 A;  4MGV A;  4CYM D;  5AAO A;  5JA4 D;  3FTY A;  2H6G A;  4HBO A;  4F53 A;  5KNG A;  3CHF A;  4WKF A;  2LXM A;  3PRD A;  3E34 A;  4GTV A;  1PY1 A;  2LGO A;  2DZO A;  1A7X A;  4P29 A;  3TWQ A;  1KLX A;  3B7B A;  1NSG A;  2DT2 A;  4GYO A;  2A3B A;  3ART A;  1ELK A;  3Q75 A;  1E96 B;  3ARX A;  1FJD A;  5JH8 A;  3ZFW A;  4ZHB A;  3KCE A;  3FU0 A;  2LAH A;  4EZL A;  5B1A E;  2QY7 A;  4FA6 A;  1JND A;  4EZK A;  4I2W A;  5AEN A;  3MKR A;  2GRQ B;  4C02 B;  1W1P A;  3JYJ A;  1C9H A;  4K0R A;  4BSZ B;  2WXH A;  4PS8 A;  1OXJ A;  4UWG A;  4ACL A;  2ZGD A;  3UIP C;  4DLO A;  1LL4 A;  4ACK A;  4Z2L A;  4Z2G A;  4LEU A;  4N5C A;  3B7X A;  3D9I A;  2MNT A;  5G04 J;  5HW8 A;  1BI7 B;  1OGG A;  3B95 A;  1B6C A;  4CEM A;  3D9L A;  3KAE A;  1E8Y A;  2JLB A;  4WNF A;  5DIT A;  1B89 A;  2RFA A;  3OXG A;  3ZIM A;  3EIJ A;  1ZL1 A;  3GTY X;  1E6Z A;  5CCM A;  4HRL A;  4UWK A;  3EHR A;  3NOC D;  1HJX A;  2KE0 A;  3CQC B;  1QQE A;  3GYZ A;  4I1M A;  1MQS A;  4Z2I A;  5FIO A;  3LPZ A;  1N95 A;  1QNF A;  1V54 E;  1HZ4 A;  5CMW A;  3FTU A;  5HQ8 A;  3PA7 A;  4PUC A;  2FF4 A;  3ZNG A;  1W26 A;  3ZRH A;  1ITX A;  4DZ3 A;  4HXI A;  4J7W A;  4TX0 A;  3RRU A;  4AEZ C;  4AJW A;  3JCK C;  3UF8 A;  5D2M C;  2NSZ A;  3UTM A;  2IO2 C;  3UMV A;  3ABM E;  1LD8 A;  3VAW A;  4CRW A;  3TG5 A;  2ZR6 A;  2NYJ A;  3SBS A;  4IQC A;  4A55 A;  4J4O A;  3MKQ B;  3AG4 E;  4UUC A;  3B7T A;  3LEW A;  3NQP A;  1HXI A;  1O1S A;  4HBD A;  3Q9U C;  1TYQ G;  4JD2 G;  3KS2 A;  3CHC A;  4ILH B;  5FJY A;  4GTS A;  2AVP A;  1H2V C;  4GZD A;  3URZ A;  3PRZ A;  5LX8 A;  5HWB A;  1OWN A;  3B7U X;  4FAD A;  3CGM A;  2WPV A;  4YND A;  3HVE B;  3UKU G;  4E6H A;  3CVL A;  2QF8 A;  1W9V A;  5AIJ A;  3EUV A;  2VTB B;  2FI7 A;  4GA1 A;  1UOH A;  4Y6C A;  3AG1 E;  1SR0 A;  4WWP A;  3FUD A;  5KCM A;  3IKO B;  4APF A;  4N2S A;  4TYO A;  4DWS B;  1U3D A;  3CHQ A;  4I2Z A;  5KJN A;  4Z68 A;  5EX0 A;  4EPZ A;  5HKP A;  3VLD A;  3HXB A;  4I6E A;  2B5U B;  4XZ4 A;  4DIP A;  4TUU A;  3GZS A;  4TXR A;  1KZP A;  3HYM B;  2XRZ A;  5BUZ A;  2E0I A;  3E4B A;  3ZHE B;  4CGW A;  2P9K G;  1IHG A;  2WXJ A;  4GTP A;  1TFV A;  2R2L A;  5BXU A;  3WQV A;  4OVU A;  1SYT A;  4YVO A;  3QWV A;  3L08 A;  1W3B A;  3TWW A;  3JYS A;  1DCE A;  4XX5 A;  2RUC A;  2YIN A;  4NRH B;  4MS6 A;  4ANW A;  3S7F A;  5E75 A;  5G05 J;  3JXV A;  4RLY A;  4JL0 A;  5CEC B;  5EID A;  3LVR E;  2R5S A;  1W1Y A;  2XPB A;  3WD4 A;  3SNX A;  2XZD G;  3HRA A;  1PAQ A;  4WWO A;  4N3B A;  3T5X A;  2A5E A;  4DH0 A;  2I2O A;  4BES A;  4J8D A;  4DI4 A;  4WNE A;  1E44 A;  4TXQ A;  4DRN A;  2JZV A;  3PZD A;  2VSN A;  2WB2 A;  5HW6 A;  1HG5 A;  3O5K A;  3HVE A;  4GMR A;  3PE4 A;  2HM8 A;  3ZXS A;  1NZN A;  2WXL A;  2X6F A;  3CHM A;  2VTB A;  3SZ7 A;  3Q15 A;  3ASG A;  2KCK A;  3L16 A;  4DWS A;  2R59 A;  3R7R A;  2MRI A;  1NI1 A;  3FTV A;  3MV3 B;  2P9I G;  1BPO A;  3CV0 A;  4FJY A;  1WAW A;  3PZ2 A;  3KZ7 A;  2AXU A;  1TNZ A;  3JYM A;  4W9P A;  3RO2 A;  3JQ0 A;  1HJV A;  1JCS A;  4KZ0 A;  3ZHE A;  1ZB1 A;  1HH8 A;  3APF A;  4XEI G;  1SZ9 A;  4P8X A;  3ARO A;  4HOQ A;  1FT2 A;  4U0Z A;  3ZW3 A;  3QKY A;  4MKT A;  4B0Z A;  4XAK A;  1IHB A;  3KAH A;  4A1S A;  4HQD A;  1BD8 A;  4BY6 A;  2LXL A;  3QOK A;  4FLH A;  5ANR A;  2V5Q C;  3FTW A;  5FIN A;  1SQM A;  4HNA D;  5ITZ F;  2KAT A;  4ATZ D;  2AW6 A;  3AU5 A;  4GTR A;  4I1O B;  2ZXW E;  1HKM A;  3ENE A;  3CVN A;  2C0M A;  3Q78 A;  5ENO D;  3R7Q A;  1QBQ A;  5KJL A;  3FAP A;  4L1B A;  1VF8 A;  4ODQ A;  3BG1 B;  3MYV A;  4L23 A;  2DG9 A;  3G6L A;  3LJ3 A;  1ELW A;  4K5A B;  1TJF A;  3BG0 B;  1BU9 A;  3PH0 C;  1PC2 A;  4Q69 A;  3ULQ A;  3P2B A;  1UJK A;  2J9Q A;  2PQR A;  4DRM A;  2KCV A;  5FZR A;  3C3Q A;  3HDX A;  3LKU A;  1MX4 A;  1ZU2 A;  3UX4 A;  4BWR A;  2G8Z A;  3CZ8 A;  4U0S A;  4DRH A;  3NOG D;  2MLZ A;  5HI7 A;  4YDE A;  4GPK A;  3FWV A;  2OEV A;  1JCH B;  2WXR A;  2CG2 A;  2XCB A;  2ESC A;  2ZR5 A;  4HRM B;  2R05 A;  3TGO A;  1TN6 A;  1FKJ A;  3UXG A;  2R17 C;  2ZQV A;  5HT1 A;  2I6H A;  3TL5 A;  2OV8 A;  2QZA A;  2IY0 C;  2GRR B;  3DXM G;  3E32 A;  1L1P A;  2DPE A;  4BFR A;  2MLY A;  5ENR D;  2Y4U A;  3O5D A;  2HE0 A;  2ETN A;  2XGM A;  1K8K G;  2WXI A;  4HVB A;  4TW7 A;  2PNN A;  5E76 A;  4BF8 A;  4Z2K A;  2LJ4 A;  3TWV A;  4J8E A;  1NWR A;  4MNL A;  4LUN U;  4BT8 A;  3S7D A;  4O1P A;  2G41 A;  2HYZ A;  2J8S D;  3OAW A;  2EIJ E;  1J6Y A;  2BED A;  3KSQ A;  1W1V A;  2R03 A;  2CFU A;  1EPU A;  4L9P A;  2A4Z A;  3BQO A;  2WXG A;  3PZ1 A;  4WNG A;  1HU3 A;  3UT7 A;  5FQ6 A;  2NC9 A;  2DYR E;  3OA5 A;  1KFW A;  1LJY A;  2WXK A;  2X6K A;  1ZB5 A;  2ITK A;  1BL4 A;  1RD6 A;  2V4L A;  5DO2 A;  1E6R A;  3D9N A;  5CBO A;  3O5J A;  3FUI A;  2F23 A;  4Z2J A;  2IOL A;  4IPX A;  2GRL A;  3ZYM A;  5G04 C;  3IKG A;  1OCR E;  2XPA A;  2PV3 A;  3B9D A;  1ZCN A;  3EHM A;  4J8Y A;  4K5B A;  2XGS A;  4A1G A;  5HUA A;  4I6G A;  4GZ6 A;  3D9K A;  5D75 A;  4Y6W A;  3E33 A;  4KVM A;  3W4R A;  2VGE A;  1BKF A;  4MLP A;  2QFC A;  3RRM B;  5B8I C;  1IQR A;  3GZ2 A;  4UI9 J;  4W9R A;  3FUJ A;  1OWO A;  1E8X A;  5DEZ A;  3PZ4 A;  3RM8 A;  4GZ3 A;  4TV3 A;  3QC1 A;  1XRV A;  2UY1 B;  4N39 A;  4U63 A;  3TC5 A;  2CG3 A;  1ZU8 A;  1Z3Y A;  3SO8 A;  4NQ0 A;  1ZBV A;  5D66 A;  1EF1 C;  2IF4 A;  1TN7 A;  4L72 B;  1E9L A;  4AV7 A;  4JVS A;  4HI9 A;  2KZT B;  2OLH A;  2WXQ A;  3ARP A;  2J08 A;  4AVX A;  1YW5 A;  1GPF A;  1ZBW A;  1E15 A;  4AIF A;  3AS4 A;  2ZR4 A;  5DIZ A;  3RM9 A;  4W9Q A;  2F2D A;  1UG3 A;  3IHV A;  1UN9 A;  3ARV A;  3KAB A;  4U96 D;  4ANX A;  1J4I A;  2DT1 A;  1K1A A;  2J49 A;  1CTN A;  1XGW A;  3ARZ A;  4I9C A;  4M7C A;  3CH9 A;  1FPP A;  3ASF A;  4NAC A;  4CDN A;  2F8Y A;  1DNP A;  3O5M A;  2WXM A;  3I5P A;  1EYH A;  2KFW A;  5AQ9 A;  4UWH A;  3LDZ A;  4IUL A;  4FJZ A;  2VYI A;  2IQC A;  5ARF A;  5EIB E;  1K3Z D;  1N54 A;  2XPI A;  4BTA A;  3UIO C;  2WQ6 A;  1FKD A;  1N4S A;  5JHB A;  4GU5 A;  2Y0B G;  3D9M A;  3R9A B;  4GGQ A;  1HS6 A;  3APD A;  5EN5 D;  1A5E A;  3LY7 A;  5G55 A;  3IBE A;  4HLE A;  2LPV A;  2EIN E;  2BKG A;  4MRU A;  4I17 A;  2ZQS A;  1SW6 A;  4P8U A;  2F4E A;  4JA7 A;  1FKH A;  3TAX A;  5B3S E;  1OY3 D;  1R9H A;  3AS3 A;  1YMP A;  2RG8 A;  3S7J A;  4DZ2 A;  1UW4 B;  3AS1 A;  4W5U A;  1IX5 A;  5C2Y A;  3UQI A;  2KGJ A;  4HRN A;  3C5R A;  5FQ7 A;  5AJD A;  1Z5S C;  1Z6T A;  2UY1 A;  5B1B E;  2GRM A; 
#chains in the Genus database with same CATH homology
 4KQZ A;  4JYS A;  1OGB A;  3UQ3 A;  5BXJ A;  4DRQ A;  3KD7 A;  5CHE E;  5DBK A;  1JNT A;  5A7D B;  2LSV A;  2MPH A;  4YVQ C;  4ODN A;  3MDY B;  2KZT A;  4XE0 A;  1WY6 A;  4GZ5 A;  5G05 C;  3QWW A;  1P5Q A;  2L6J A;  3K9I A;  4AOF A;  1Q1C A;  1E90 A;  5T8I A;  3FUH A;  2ZQU A;  1VDY A;  4O2T A;  4G23 A;  1H2T C;  2HO1 A;  4NNR A;  1IYG A;  4KVO A;  3IHY A;  5KJM A;  5I98 A;  2BTD A;  2OVB A;  4PTM A;  3U9W A;  5CCL A;  4E85 A;  4F7A A;  3FUE A;  2A3E A;  1JVW A;  5GPG A;  2MOW A;  5FZS A;  2YBU A;  4JFK A;  3O5O A;  2YHC A;  4ZPW R;  3I4G A;  4JFL A;  3QNK A;  3UQA A;  4U86 A;  3D9P A;  2XHE A;  1XHG A;  5AYW D;  4CDM A;  1WAO 1;  2DSU A;  4C9B B;  2I1K A;  3O5E A;  2RSE A;  3L6A A;  2FO7 A;  4GCN A;  2M2A A;  3CVP A;  4MAV A;  3S2A A;  2P58 C;  3CLJ A;  2PPO A;  4BX9 A;  3U64 A;  3UT8 A;  1JPL A;  3OXF A;  1E7U A;  3EJN A;  3CVY A;  3KEZ A;  3WH0 A;  3FUM A;  1ZBK A;  1D7H A;  3AS5 A;  1D2K A;  1H0A A;  4WJX A;  4GAA A;  3FP3 A;  2M08 A;  4I6J A;  4EBA A;  4URK A;  4ODM A;  2BF0 X;  5ENN A;  1J4H A;  3I6C A;  3CHS A;  1Q6H A;  4UI9 K;  4TNS A;  4G26 A;  5KJK A;  3L13 A;  4L2Y A;  3ALF A;  3CGN A;  4PDX A;  2ILR A;  4DPR A;  1LG1 A;  4Q7N A;  4TW6 A;  4DT4 A;  2MLX A;  4GML A;  1D6O A;  4U8H A;  3FXY A;  4WAF A;  3H9R B;  4RVB A;  2RUQ A;  4A3T A;  3ZYL A;  2ZU6 B;  4ABN A;  3ASD A;  4V3I A;  1NMW A;  4FC8 A;  3GW4 A;  2VGX B;  1FFQ A;  1NH6 A;  1A17 A;  2CHW A;  3EHN A;  4N3A A;  3CSF A;  2PM7 A;  3CVU A;  4KT6 B;  3VTY A;  1O6I A;  4G24 A;  4A3V A;  4UQX A;  1JWF A;  4OVV A;  2OVF A;  1FFR A;  3PNT B;  3CGH A;  1GW6 A;  3MZL B;  3PE3 A;  1F8A B;  2J4B A;  3AS8 A;  1FKL A;  3B13 A;  4HAR A;  3TJP A;  1FKK A;  3CVQ A;  4FUL A;  3WKZ A;  4AY6 A;  2XPY A;  3L54 A;  4IQ2 A;  4L2L A;  2C2L A;  3NZS A;  2KC7 A;  4LAY A;  4L3N A;  2JEK A;  1Y0O A;  3G2T A;  2PBC A;  1DVP A;  3LY8 A;  4XI0 A;  1NA3 A;  3DPD A;  4U04 A;  3C98 A;  1OUV A;  3G2U A;  2WXN A;  2PPP A;  4G25 A;  4I1A A;  4FHJ A;  5A23 A;  5ARG A;  3SGH A;  3NF1 A;  1FKS A;  4MNK A;  1FKI A;  4DK5 A;  1D7I A;  2DT0 A;  3AQU A;  3ARY A;  4HFG A;  4RG9 A;  2MHK A;  3KAF A;  1D7J A;  3ODK A;  1JWG A;  4UQY A;  4P8W A;  4JA9 A;  4LAW A;  1QPF A;  4U0U A;  3WD2 A;  5HBF A;  2PPN A;  3PRA A;  4DI3 A;  3UQB A;  3CK8 A;  3O5I A;  3CK7 A;  4FN2 A;  3ESK A;  2VGX A;  4IT6 A;  3SHF A;  4QT2 A;  4CGV A;  2WQH A;  3FU6 A;  4BT9 A;  3FUK A;  4ZPV R;  5LFA A;  4OYS A;  4G1T A;  5LOZ A;  4UI9 C;  2D9F A;  2KO7 A;  1UR8 A;  2RD0 A;  4FP7 A;  1NWU A;  5FZQ A;  5J6E A;  3B9E A;  1GOI A;  4Q22 A;  5LCW C;  4HOR A;  2F21 A;  4DRI A;  3G2S A;  4S3J A;  2WVI A;  4ANU A;  3IHZ A;  4QT3 A;  1ELR A;  4HBE A;  2X6H A;  3UI5 A;  3TCZ A;  3ARU A;  3TG4 A;  2AWI A;  3SFZ A;  1YAT A;  4L7T A;  3KAD A;  3ML9 A;  2X6I A;  2IFU A;  2DSW A;  2KCL A;  2YQ8 A;  4B8A A;  1PIN A;  3RKV A;  5BPP A;  1QZ2 A;  3B9A A;  4ITZ A;  2WLY A;  5J90 A;  2PI6 A;  5DF0 A;  4DWS D;  1E8W A;  2FEZ A;  3KAI A;  4HS2 A;  2CHZ A;  2FAP A;  4O6F A;  3FH7 A;  3T8M A;  1T11 A;  4JHR A;  3CHE A;  4CT4 A;  3QDN A;  3QK0 A;  1QPL A;  4HOU A;  4XKC A;  3I4R B;  3U66 A;  4CCA A;  2XP4 A;  4LGX A;  2L0I A;  5J08 A;  2RQS A;  2VGY A;  2Y3A A;  3RIB A;  4Q94 A;  3RFW A;  3PDN A;  1H6K A;  2OFN A;  4ODL A;  4I9E A;  3MA5 A;  3N71 A;  3QAR A;  3RM4 A;  3EDT B;  1ZBP A;  1WM5 A;  3RJV A;  2XCC A;  4F1S A;  4JXT A;  2O92 A;  1ROU A;  1ROT A;  4FLB A;  2IOS A;  2YNQ A;  1ZK6 A;  3APC A;  3D9O A;  4BX8 A;  2DG3 A;  4WKH A;  4ODR A;  4C0M A;  4QFV A;  3FH8 A;  4WWN A;  3RU0 A;  1M5Y A;  1Z3X A;  1HKK A;  4IT4 A;  4DRK A;  2WMN A;  2HR2 A;  1XNF A;  2XRY A;  3FTZ A;  3RME A;  3PNL B;  2DCP A;  2DSV A;  3FEX A;  4JC8 A;  1UN8 A;  2WLZ A;  4UWL A;  1UR9 A;  4W9O A;  3PEU B;  2Y4T A;  5BT1 A;  1W9P A;  4MNJ A;  3T5V A;  1Q6I A;  1HKJ A;  3PRE A;  2VJ8 A;  2YHE A;  3EY6 A;  2VQ2 A;  3ESL A;  1FD9 A;  3WQW A;  3FU3 A;  3O5Q A;  2C0L A;  1HG2 A;  4ML4 A;  2WK2 A;  3KAG A;  2DSZ A;  3PUJ A;  1OWM A;  3FFL A;  4DJA A;  4QIB A;  4PS7 A;  2PV2 A;  4F3V A;  1S0P A;  4ANV A;  2VCD A;  2WXF A;  1HX8 A;  1IQU A;  3CST A;  5JJT A;  2XP7 A;  4GMJ A;  1WNO A;  2KM4 A;  1W1T A;  2WM9 A;  3NRK A;  2KI3 A;  4JZY A;  4HOT A;  4J8F A;  4ODK A;  3HIZ A;  3NTP A;  2LNI A;  4GYY A;  2VN1 A;  3LYA A;  4RSY A;  3UUX A;  3L22 A;  2RUD A;  3MX3 A;  3VTX A;  3JQ1 A;  2K8I A;  3FDH A;  1X6N A;  3JUI A;  4B89 A;  1LL7 A;  4JHK A;  1E8Z A;  1Y6I A;  3CVW A;  5FQ4 A;  2IJG X;  4XI9 A;  4DRO A;  4KYO B;  1FKR A;  5FT9 A;  1NWT A;  3FTS A;  2XP9 A;  1Q6U A;  2KR7 A;  1HXV A;  3KAC A;  4DRP A;  2XP3 A;  3L17 A;  4NSB A;  4BTB A;  3EIQ C;  3FU5 A;  2VSX E;  1H0I A;  3ARQ A;  3QJZ A;  3ZEF A;  1X5B A;  2I9C A;  3G2V A;  5JJ7 A;  3O5P A;  2XGO A;  1EHN A;  5BV0 A;  2L2S A;  4GIV A;  5G2N A;  3ARW A;  1PBK A;  4AM9 A;  3ZGQ A;  2A3C A;  4G50 A;  3Q4A B;  1F40 A;  4WIW A;  3CIA A;  2PM6 A;  4NZC A;  5FWQ A;  5DIV A;  2N87 A;  4MSP A;  3ZVV A;  4ME2 A;  3WD1 A;  3MJW A;  1E6P A;  4KMO A;  4R5E A;  3WD0 A;  2EQX A;  1HO8 A;  4XIF A;  1LG2 A;  2XEV A;  1OWL A;  4GA2 A;  1ZBC A;  1NP7 A;  1N52 A;  1H0G A;  3QB2 A;  1LL6 A;  4G2V A;  1HKI A;  1INZ A;  3LS8 A;  1JUQ A;  1U3C A;  2AOS A;  2YBT A;  3NI6 A;  4JPS A;  2AXV A;  3CVX A;  3UT4 A;  2M1I A;  5FTP A;  2I1J A;  2PL2 A;  4LER A;  1NWS A;  3D9J A;  3P1U A;  4EBA G;  5T3R A;  4WKA A;  3QWP A;  3OTN A;  4KZC A;  3WL1 A;  3HHM A;  3UI6 A;  4AY5 A;  4UWF A;  2WQ7 A;  3O5F A;  5JHA A;  2OOE A;  5EKQ D;  3ZYK A;  2GGF A;  5ANL A;  4CDR A;  3AS0 A;  3U4T A;  2FDM A;  1OWP A;  4R7L A;  3AS2 A;  3ZPJ A;  2LO6 A;  4LCT A;  2NXP A;  1NA0 A;  3QOU A;  4IRU A;  3MGB A;  4GCO A;  2CFZ A;  3G6M A;  3B8S A;  4KXK B;  4Z2H A;  4AY1 A;  3LY9 A;  3BXW A;  4XKB A;  4PS3 A;  3IKD A;  3NZU A;  4APO A;  4GB9 A;  2O9O A;  3AU4 A;  3O5L A;  1HFA A;  4KR0 B;  2A5U A;  4UQZ A;  3CQG B;  3SI5 A;  4CT0 A;  4WUY A;  3MKQ A;  4S3K A;  3DBS A;  4NUR A;  3RK6 A;  4ATG A;  2XPZ A;  3SF4 A;  4AP2 A;  3LVQ E;  4K03 A;  1GUV A;  4H7Y A;  5DIU A;  4G11 A;  3ASH A;  3LUO A;  3ZYQ A;  2LKN A;  4ILG A;  2Y78 A;  5BW8 C;  2XP8 A;  3UPV A;  1TEZ A;  3O5R A;  3FHE A;  3IEG A;  2V8S E;  3TXN A;  4WK9 A;  3ARR A;  1FVF A;  3CHR A;  4MNM A;  1HE8 A;  2LAI A;  3WD3 A;  4MTV A;  4LAV A;  2X3M A;  4FU3 A;  3WL0 A;  1FKF A;  3ALG A;  1LQ0 A;  4ODP A;  1LF8 A;  3CKC A;  1FAP A;  5BV1 A;  4JW1 A;  3RRN B;  3SBT B;  5GPR A;  2M63 A;  2DBA A;  5EDS A;  3Q47 B;  3FEY A;  3LXU X;  2B31 A;  4IN3 B;  3VLE A;  1EDU A;  4TW8 A;  1FCH A;  3FY4 A;  3FUL A;  2DT3 A;  3PUK A;  1EQ3 A;  2X38 A;  3CHD A;  4N2Q A;  2FUL A;  3B7R L;  5FQ8 A;  2J07 A;  5HW7 A;  4U85 A;  4IYP A;  3GPK A;  3ML8 A;  2V5F A;  1FKB A;  2Q5A A;  1FVH A;  2XP5 A;  4J4N A;  3G2W A;  3MEK A;  3WIJ A;  5T4Y A;  2MF9 A;  2GW1 A;  4FHK A;  3ONK A;  3RGC A;  2ION A;  3FH5 A;  1JNS A;  4ZPT R;  1WB0 A;  1L5J A;  4JFI A;  2UWJ G;  3CHO A;  3IK8 A;  2ZQT A;  1OWQ A;  2PQN A;  4MPK A;  3LCA A;  1HF8 A;  1HJW A;  3MCX A;  2UZ5 A;  1EIB A;  1E7V A;  2PV1 A;  1N1A A;  4C0E A;  2FBN A;  4N19 A;  4KBQ A;  5JJ6 A;  2J09 A;  5HKG A;  4GA0 A;  4DWS C;  1W9U A;  1H2U A;  4LAX A;  3WXX A;  2AXZ A;  2X6J A;  4JEU A;  3ARS A;  3CVV A;  3FUF A;  2PZI A;  3RO3 A;  1YA0 A;  1SZA A;  3OOB A;  3SD5 A;  3ONL A;  4R0X A;  4PH4 B;  3TDB A;  1E6N A;  2AWG A;  1MHQ A;  3Q5M A;  3D3M A;  4GYW A;  4DLQ A;  5A6C A;  4ODO A;  2Q7F A;  2J4D A;  4RG6 A;  5HTG A;  3FUN A;  3O4Z A;  3PS6 A;  4QZV B;  1TCO C;  4U07 A;  3O5G A;  4M3O A;  1H19 A;  1FKG A;  3CK9 A;  3B7S A;  3TXM A;  3PEV B;  3O48 A;  3GZ1 A;  2WM0 A;  1EDQ A;  4JFJ A;  5D0Q D;  2A3A A;  3PR9 A;  2L9B A;  2RUR A;  2XP6 A;  2CHX A;  4WND A;  2E2E A;  4B8C B;  3S7B A;  5LP0 A;  2IUZ A;  3VLF A;  3Q49 B;  2L0T B;  5AJL A;  4G2P A;  4EZJ A;  1JNE A;  2LSU A;  4B94 A;  4P8V A;  3UI4 A;  3CHP A;  5CMY A;  5C1D A;  5HWC A;  4JHJ A;  1J4R A;  1NMV A;  4GZC A;  4N3C A;  2FKE A;  3I3N A;  3CEQ A;  1U79 A;  4J0U A;  1K9T A;  4LRZ A;  4ILI A;  3QAQ A;  4EQF A;  5GQB A;  5EX3 A;  5BNW A;  4JEH A;  3ZN3 A;  3U3W A;  1EYM A;  3FY1 A;  4I43 A;  4HOS A;  4D10 C;  3BEE A;  5D0O D;  1TJC A;  4H7X A;  4BSX A;  2WXO A;  2DG4 A;  3IV0 A;  4EEC A;  2VSY A;  1KT0 A;  2VSO E;  3PVL A;  2WMO A;  5M72 A;  4J8S A;  5LCW J;  4TRQ A;  2WXP A;  4URI A;  4DRJ A;  4J6I A;  4AXH A;  4Q96 A;  3OXL A;  2XQ0 A;  3MV2 B;  3PRB A;  2BUG A;  4U84 A;  1Y8M A;  1KT1 A;  1X6L A;  3CKB A;  4FAP A;  4ZS6 A;  2V0P A;  1FKT A;  3FTX A;  1UJJ A;  2IU1 A;  3CR3 A;  4JFM A;  2DIW A;  2OND A;  4MGV A;  3FTY A;  4HBO A;  4F53 A;  3CHF A;  4WKF A;  3PRD A;  1PY1 A;  2LGO A;  1A7X A;  4P29 A;  1KLX A;  1NSG A;  2DT2 A;  4GYO A;  2A3B A;  3ART A;  1ELK A;  1E96 B;  3ARX A;  1FJD A;  5JH8 A;  3ZFW A;  3KCE A;  3FU0 A;  2LAH A;  4EZL A;  2QY7 A;  4FA6 A;  1JND A;  4EZK A;  4I2W A;  5AEN A;  3MKR A;  4C02 B;  1W1P A;  3JYJ A;  1C9H A;  4K0R A;  2WXH A;  4PS8 A;  4UWG A;  4ACL A;  4DLO A;  1LL4 A;  4ACK A;  4Z2L A;  4Z2G A;  4LEU A;  4N5C A;  3B7X A;  3D9I A;  2MNT A;  5G04 J;  5HW8 A;  1OGG A;  1B6C A;  4CEM A;  3D9L A;  3KAE A;  1E8Y A;  2JLB A;  4WNF A;  5DIT A;  1B89 A;  3OXG A;  3ZIM A;  3EIJ A;  1ZL1 A;  1E6Z A;  5CCM A;  4UWK A;  1HJX A;  2KE0 A;  3CQC B;  1QQE A;  3GYZ A;  4I1M A;  1MQS A;  4Z2I A;  3LPZ A;  1QNF A;  1HZ4 A;  5CMW A;  3FTU A;  5HQ8 A;  3PA7 A;  4PUC A;  2FF4 A;  1W26 A;  3ZRH A;  1ITX A;  4DZ3 A;  4HXI A;  4TX0 A;  3RRU A;  4AEZ C;  4AJW A;  3JCK C;  3UF8 A;  2NSZ A;  3UMV A;  3VAW A;  4CRW A;  3TG5 A;  2ZR6 A;  3SBS A;  4IQC A;  4A55 A;  4J4O A;  3MKQ B;  3B7T A;  3LEW A;  3NQP A;  1HXI A;  3KS2 A;  3CHC A;  4ILH B;  5FJY A;  2AVP A;  1H2V C;  4GZD A;  3URZ A;  3PRZ A;  5LX8 A;  5HWB A;  1OWN A;  3B7U X;  4FAD A;  3CGM A;  2WPV A;  4YND A;  3HVE B;  4E6H A;  3CVL A;  2QF8 A;  1W9V A;  5AIJ A;  2VTB B;  2FI7 A;  4GA1 A;  4Y6C A;  1SR0 A;  4WWP A;  3FUD A;  5KCM A;  3IKO B;  4APF A;  4N2S A;  4TYO A;  4DWS B;  1U3D A;  3CHQ A;  4I2Z A;  5KJN A;  5EX0 A;  4EPZ A;  3VLD A;  4I6E A;  4XZ4 A;  4DIP A;  4TUU A;  3GZS A;  3HYM B;  2XRZ A;  5BUZ A;  2E0I A;  3E4B A;  3ZHE B;  4CGW A;  1IHG A;  2WXJ A;  1TFV A;  3WQV A;  4OVU A;  1SYT A;  4YVO A;  3QWV A;  3L08 A;  1W3B A;  3JYS A;  4XX5 A;  2RUC A;  2YIN A;  4NRH B;  4MS6 A;  4ANW A;  3S7F A;  5E75 A;  5G05 J;  3JXV A;  4JL0 A;  3LVR E;  2R5S A;  1W1Y A;  2XPB A;  3WD4 A;  3SNX A;  1PAQ A;  4WWO A;  4N3B A;  3T5X A;  4DH0 A;  2I2O A;  4J8D A;  4DI4 A;  4WNE A;  4DRN A;  2JZV A;  3PZD A;  2VSN A;  2WB2 A;  5HW6 A;  1HG5 A;  3O5K A;  3HVE A;  3PE4 A;  2HM8 A;  3ZXS A;  1NZN A;  2WXL A;  2X6F A;  3CHM A;  2VTB A;  3SZ7 A;  3Q15 A;  3ASG A;  2KCK A;  3L16 A;  4DWS A;  2R59 A;  3R7R A;  2MRI A;  3FTV A;  3MV3 B;  4FJY A;  1BPO A;  3CV0 A;  1WAW A;  3KZ7 A;  2AXU A;  3JYM A;  4W9P A;  3RO2 A;  3JQ0 A;  1HJV A;  4KZ0 A;  3ZHE A;  1HH8 A;  3APF A;  1SZ9 A;  4P8X A;  3ARO A;  4HOQ A;  4U0Z A;  3ZW3 A;  3QKY A;  4MKT A;  4B0Z A;  4XAK A;  3KAH A;  4A1S A;  4BY6 A;  3QOK A;  4FLH A;  5ANR A;  3FTW A;  1SQM A;  2KAT A;  2AW6 A;  3AU5 A;  4I1O B;  1HKM A;  3ENE A;  3CVN A;  2C0M A;  3R7Q A;  5KJL A;  3FAP A;  4L1B A;  1VF8 A;  4ODQ A;  3BG1 B;  3MYV A;  4L23 A;  2DG9 A;  3G6L A;  3LJ3 A;  1ELW A;  1TJF A;  3BG0 B;  3PH0 C;  1PC2 A;  4Q69 A;  3ULQ A;  3P2B A;  1UJK A;  2J9Q A;  2PQR A;  4DRM A;  2KCV A;  5FZR A;  3HDX A;  3LKU A;  1ZU2 A;  3UX4 A;  4BWR A;  2G8Z A;  3CZ8 A;  4U0S A;  4DRH A;  2MLZ A;  5HI7 A;  4GPK A;  3FWV A;  2WXR A;  2CG2 A;  2XCB A;  2ESC A;  2ZR5 A;  3TGO A;  1FKJ A;  2R17 C;  2ZQV A;  5HT1 A;  2I6H A;  3TL5 A;  2OV8 A;  1L1P A;  2DPE A;  4BFR A;  2MLY A;  2Y4U A;  3O5D A;  2XGM A;  2WXI A;  4HVB A;  4TW7 A;  5E76 A;  4BF8 A;  4Z2K A;  2LJ4 A;  4J8E A;  1NWR A;  4MNL A;  4LUN U;  4BT8 A;  3S7D A;  2G41 A;  2HYZ A;  3OAW A;  1J6Y A;  1W1V A;  2CFU A;  1EPU A;  2A4Z A;  2WXG A;  4WNG A;  1HU3 A;  3UT7 A;  5FQ6 A;  2NC9 A;  3OA5 A;  1KFW A;  1LJY A;  2WXK A;  2X6K A;  1ZB5 A;  2ITK A;  1BL4 A;  1RD6 A;  2V4L A;  5DO2 A;  1E6R A;  3D9N A;  3O5J A;  3FUI A;  4Z2J A;  2IOL A;  4IPX A;  2GRL A;  3ZYM A;  5G04 C;  3IKG A;  2XPA A;  2PV3 A;  3B9D A;  1ZCN A;  3EHM A;  2XGS A;  4A1G A;  5HUA A;  4I6G A;  4GZ6 A;  3D9K A;  5D75 A;  4Y6W A;  4KVM A;  3W4R A;  1BKF A;  4MLP A;  2QFC A;  3RRM B;  5B8I C;  1IQR A;  3GZ2 A;  4UI9 J;  4W9R A;  3FUJ A;  1OWO A;  1E8X A;  5DEZ A;  3RM8 A;  4GZ3 A;  4TV3 A;  3QC1 A;  1XRV A;  2UY1 B;  4N39 A;  4U63 A;  3TC5 A;  2CG3 A;  1ZU8 A;  1Z3Y A;  4NQ0 A;  1ZBV A;  1EF1 C;  2IF4 A;  4L72 B;  1E9L A;  4AV7 A;  4JVS A;  2KZT B;  2OLH A;  2WXQ A;  3ARP A;  2J08 A;  4AVX A;  1YW5 A;  1GPF A;  1ZBW A;  1E15 A;  4AIF A;  3AS4 A;  2ZR4 A;  5DIZ A;  3RM9 A;  4W9Q A;  2F2D A;  1UG3 A;  3IHV A;  1UN9 A;  3ARV A;  3KAB A;  4ANX A;  1J4I A;  2DT1 A;  2J49 A;  1CTN A;  1XGW A;  3ARZ A;  4I9C A;  3CH9 A;  3ASF A;  4NAC A;  4CDN A;  1DNP A;  3O5M A;  2WXM A;  3I5P A;  1EYH A;  2KFW A;  4UWH A;  3LDZ A;  4IUL A;  4FJZ A;  2VYI A;  2IQC A;  5ARF A;  1N54 A;  2XPI A;  4BTA A;  2WQ6 A;  1FKD A;  5JHB A;  4GU5 A;  3D9M A;  3R9A B;  4GGQ A;  1HS6 A;  3APD A;  3LY7 A;  5G55 A;  3IBE A;  4HLE A;  2LPV A;  4MRU A;  4I17 A;  2ZQS A;  4P8U A;  2F4E A;  4JA7 A;  1FKH A;  3TAX A;  1R9H A;  3AS3 A;  2RG8 A;  3S7J A;  4DZ2 A;  1UW4 B;  3AS1 A;  4W5U A;  1IX5 A;  5C2Y A;  3UQI A;  2KGJ A;  5FQ7 A;  5AJD A;  1Z6T A;  2UY1 A;  2GRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...