1KT0A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
380
structure length
357
Chain Sequence
VLKIVTPMIGDKVYVHYKGKLFDSPFVFSLGKGQVIKAWDIGVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNERDRRIYANM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords 51 KDA FK506-BINDING PROTEIN
total genus 110
structure length 357
sequence length 380
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt0A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A02
4GYYA 3KAFA 2Y78A 4DZ3A 4ODOA 4JL0A 4ODLA 5DITA 3ASGA 4DRJA 4O6FA 4IQ2A 3RKVA 2LSVA 1TJCA 1F40A 1ELRA 2OOEA 5BT1A 2J9QA 1NZNA 1FKBA 4TYOA 2PPOA 3MKRA 1PBKA 1YATA 1QZ2A 3QDNA 2C0LA 3AS8A 2FKEA 2YHCA 2M08A 4G23A 3LPZA 1OUVA 3E4BA 3ZFWA 2PQNA 5ARGA 2KR7A 3KAEA 4U0ZA 2LKNA 3TDBA 4KBQA 2LNIA 1FKKA 4HOQA 4DROA 4AY6A 3KCEA 3O5IA 4R0XA 1EQ3A 2DG3A 4MGVA 2PQRA 5D0OD 2FF4A 2XPIA 2VSNA 4DRQA 4UQXA 1A17A 5CCMA 3UUXA 3O5JA 1D7HA 2RUCA 2PPPA 4XI9A 4IPXA 4HOSA 2VGYA 2L2SA 1KLXA 4BTAA 1FKFA 4TX0A 3JXVA 2M2AA 3AS5A 5FZRA 5HT1A 4GYOA 5A6CA 5KJKA 2PV2A 4WUYA 3GZ2A 3S7BA 2XP4A 2AWGA 3LY8A 4I17A 1YA0A 4ITZA 2MLZA 3FWVA 3UF8A 4BT9A 1JNTA 1ROTA 4ODRA 4ODQA 2XP8A 5DIZA 5AYWD 5KJMA 2RUQA 3KZ7A 1YW5A 4CGWA 4WNDA 4DRIA 2P58C 3CKBA 4DRHA 1B6CA 2R5SA 3MEKA 3B7XA 4B94A 2I6HA 3FP3A 5B8IC 4W9PA 1IYGA 1HZ4A 1A7XA 3O5FA 4TNSA 4NNRA 2KCVA 2XEVA 2LJ4A 1PINA 1Q6IA 3GZ1A 5FJYA 4ODMA 4DRMA 5G04C 3UI6A 2FEZA 3KACA 2LSUA 3NTPA 3UI5A 1T11A 4I9EA 4F3VA 3QKYA 3PE4A 2XGSA 3JYMA 4YVOA 1EYMA 2RURA 3RO3A 2XPAA 3K9IA 4O2TA 2KCKA 2VQ2A 1FD9A 4W9QA 4GA0A 5M72A 2F4EA 3GPKA 1JVWA 4J8EA 5HKGA 1HXIA 1ZBPA 2Y4TA 3KS2A 2PV3A 4G24A 1NMWA 2BUGA 4AM9A 3IKGA 2RUDA 5HW8A 5HUAA 3FAPA 2ITKA 5BW8C 2ONDA 3OXGA 3Q5MA 4UI9K 3ASFA 3NI6A 1ZK6A 2VYIA 4EQFA 3LY9A 3O5GA 3IEGA 5EKQD 2XCBA 3QOUA 2NC9A 2IF4A 2D9FA 3TG5A 5HW7A 3RJVA 1QPLA 4BT8A 3PRDA 1BKFA 3OXFA 3ZGQA 4C02B 3I6CA 5HI7A 1Q1CA 1B89A 4RG9A 4AY5A 4I9CA 2ZR4A 4TW6A 5KJLA 3H9RB 4QIBA 1FKGA 2ZR6A 4G2PA 4NRHB 1KT0A 5HTGA 3CK9A 2GW1A 2XCCA 1QQEA 2FO7A 4H7YA 3GW4A 3BEEA 4Y6WA 2LGOA 2IFUA 2ZR5A 3WXXA 3RO2A 2Q5AA 2KCLA 2KGJA 3CV0A 4G26A 2QFCA 2YQ8A 1J4IA 5JJTA 3O5EA 5HWBA 1XNFA 3CKCA 3TAXA 2XPBA 3Q49B 4KXKB 3UQ3A 1QPFA 3O5OA 2VGXB 4J8DA 4U07A 1ROUA 2MPHA 1FJDA 4DRKA 3MV3B 3WH0A 5FZSA 3NRKA 2FBNA 2UZ5A 3ZN3A 3O5PA 2XP9A 3O5DA 1FKDA 4TW8A 4LEUA 1N1AA 4W9RA 4ODNA 3AS4A 2PZIA 1FKTA 4G2VA 1IHGA 3JYJA 4GIVA 4G25A 2KE0A 1D6OA 1HH8A 3UQAA 3TCZA 3UQIA 3NF1A 3RIBA 5EX3A 1NA0A 4TW7A 4APOA 5J6EA 3O48A 3R9AB 4CDRA 1FKRA 4YNDA 3TG4A 2XGMA 2LPVA 3ASDA 2C0MA 3QWVA 4WNGA 3Q47B 4U0SA 3CVPA 5G04J 4J4OA 3S7DA 4HORA 2FI7A 1BL4A 4JHRA 2KC7A 1ZCNA 1FKHA 1PC2A 1P5QA 1FCHA 2VSYA 4BWRA 1W3BA 5FTPA 1WAO1 4N39A 4JFLA 2UY1B 4I1AA 1U79A 2Q7FA 2DG9A 4J4NA 3MA5A 4GZ6A 4U85A 3SF4A 4GYWA 3MV2B 3RU0A 4YVQC 4J8FA 4BTBA 4JA7A 2DG4A 4U86A 3Q4AB 1F8AB 3ASHA 3OXLA 4HOTA 3HYMB 3QWWA 2MF9A 1HXVA 1W26A 5DIVA 3KD7A 4BF8A 3O5RA 3S7JA 4DZ2A 1FKSA 5D0QD 3KAHA 4W9OA 5G05J 3ODKA 4IN3B 5LCWJ 3QWPA 4XIFA 4QT2A 4GCNA 2KFWA 1L1PA 3CVNA 2UWJG 4JFJA 2V5FA 3O5KA 1WM5A 3Q15A 4UI9C 4JA9A 1ELWA 5JJ6A 2WPVA 2ZQVA 3RFWA 3PDNA 2KI3A 2DBAA 3KAGA 4LAWA 1TCOC 5FT9A 4XI0A 3GYZA 1FKJA 3OOBA 3KABA 4N3BA 4N3CA 5CHEE 4DH0A 2UY1A 1FKIA 2XP5A 3O5LA 3U3WA 2ZQUA 2ZQSA 4N2SA 1Y0OA 2FAPA 1Q6HA 3RGCA 5JJ7A 3EDTB 2WQHA 4ABNA 3ULQA 4N5CA 4U0UA 4DIPA 2AVPA 3O5QA 3UQBA 3CEQA 1C9HA 3N71A 3LYAA 5HQ8A 3ESKA 1D7JA 5D75A 1E96B 4U84A 3ZPJA 4UQZA 2MHKA 4GZ3A 2XP3A 5GPGA 2E2EA 2XGOA 4AIFA 3S7FA 2HYZA 5ARFA 5A7DB 3EY6A 3CK8A 2Y4UA 2HR2A 4ODKA 2OFNA 2MLYA 4ME2A 1Y8MA 3TGOA 4I2WA 4WNEA 4FAPA 4G50A 2VGXA 2KO7A 2L6JA 4N2QA 4GPKA 4UQYA 3PA7A 2PPNA 3O5MA 4GGQA 2PL2A 5DBKA 3URZA 4J0UA 4NQ0A 1M5YA 3CGNA 1R9HA 4JFKA 4DRPA 4ODPA 2C2LA 3MDYB 4LAYA 1KT1A 2M1IA 3KAIA 5CCLA 3IHZA 4GA1A 2K8IA 5HW6A 4CGVA 4WNFA 3VAWA 3CVQA 3UPVA 4HOUA 4RG6A 2JLBA 3LKUA 1D7IA 5I98A 3CK7A 1J6YA 2MNTA 4IQCA 3IKDA 4A1SA 1NA3A 3KADA 3TC5A 4DT4A 3LUOA 1ZU2A 5G05C 2XP7A 4JFMA 5LCWC 3FFLA 2F21A 1NMVA 1J4HA 2HO1A 3VTYA 2PBCA 3ZHEB 4Y6CA 2VN1A 3CGMA 1FAPA 5EX0A 4QT3A 3SZ7A 5C1DA 3PE3A 2F2DA 4G1TA 5FZQA 2RSEA 2ZQTA 4LAVA 4UI9J 4FN2A 3CVLA 1NSGA 3LY7A 3ZHEA 4GZ5A 3VTXA 1J4RA 3JYSA 4U04A 4GA2A 4LAXA 2KATA 3IK8A 3LCAA 4MSPA 5BXJA 5HWCA 5DIUA 4GCOA 5BNWA 4DRNA 2VCDA 3U4TA 3PRBA 4I2ZA 4H7XA 1Q6UA 4N19A 2XP6A 4JFIA 1JNSA 4KYOB 3UI4A 1FKLA 4JYSA 5KJNA 2MLXA 2RQSA 2N87A 2JZVA 2PV1A 4N3AA
chains in the Genus database with same CATH superfamily
4KVOA 3HHMA 4DI4A 1X6LA 4GPMA 2Y78A 1E6NA 4DZ3A 4KZ0A 5DITA 4ML4A 3UTMA 2LSVA 4BETA 4F1SA 4OAUC 2J9QA 1NZNA 2PPOA 3CHOA 1LF8A 1QZ2A 4L2YA 3AS0A 3QDNA 3AS8A 1IX5A 1MZCA 2M08A 4O1OA 1D2KA 3NB2A 2GRNB 2PI6A 1OUVA 3UKRG 3SFZA 3CVXA 3W4RA 4GTTA 4U0ZA 2LNIA 4LNBA 4DROA 4AY6A 1HJXA 1O1TA 4EPZA 3HIZA 2PQRA 5D0OD 2H6FA 1ZB1A 1O5MA 1D7HA 2BKKB 2RUCA 5HRYA 4HOSA 3RM8A 2I2OA 1FKFA 4UDMA 3ONKA 2M2AA 1FFRA 5AQ9A 1EDQA 5HT1A 2P9KG 3LY8A 2XEHA 3Q9UC 3AG3E 2MLZA 1MHQA 1K1BA 3SGHA 4BT9A 2OVFA 1ROTA 4BSXA 5GQBA 2WMNA 2B31A 4WNDA 1WDYA 2ILRA 4HS2A 3FY1A 1MX6A 3D9HA 3AG2E 3G6MA 4ZHBA 5G55A 1HKMA 1D8EA 3ALGA 2YNQA 4FLHA 4U63A 4MS6A 4RVBA 2KZTA 5BXOA 1K9TA 1PINA 1HU3A 3GZ1A 4WWNA 4ODMA 5G04C 4KMOA 3KACA 3NTPA 3UI5A 1OCRE 4LSZE 3Q9NC 3JUIA 4F3VA 1TYQG 3CSTA 3PE4A 2XGSA 3QKYA 1GPFA 4K5CA 1U2VG 3K9IA 4OAVB 2AWIA 5AN8A 1FD9A 4ANWA 3I4RB 3AROA 2Y4TA 2PV3A 1ITXA 1NMWA 2V8SE 3IKGA 1FFQA 1MYOA 3LDZA 1NWUA 2ONDA 3OXGA 4L72B 3IEGA 4HI9A 1K8KG 4E85A 3ARQA 5HW7A 2WXPA 3OXFA 5B1BE 3V2OA 2HE0A 3DSSA 4AY5A 1TN8A 3HXDA 4I9CA 2IONA 2ZR4A 5KJLA 2CFZA 5D2MC 4ZS6A 4ILIA 2R05A 2PN0A 2DSUA 5HTGA 1E8WA 2GW1A 3SO8A 1QQEA 5DF0A 3GW4A 3BEEA 2DT2A 2LGOA 2IFUA 2IO3C 4WAFA 3WXXA 2Q5AA 1J4IA 5FQ8A 5HWBA 3TAXA 2XPBA 2EILE 3UQ3A 5LOZA 5AARA 1QPFA 2A4ZA 2VGXB 3HG0D 4DRKA 2WQ7A 3MV3B 2H6HA 4ZPTR 3PUKA 4PTMA 1NL4A 2XP9A 4JEUA 1H2TC 2GRPB 4LEUA 4A3TA 3J5PA 4W9RA 1EYHA 2WXLA 2ETAA 4FHJA 2DSZA 4GIVA 3RAUA 5EX3A 1NA0A 4TW7A 4APOA 3CSFA 4XAKA 2GRQB 3R9AB 1FKRA 3HRAA 5AAOA 3ASDA 3FUEA 1MX4A 3FU0A 4A63B 4G8KA 4JZYA 5CERB 2PM6A 3T8MA 1BL4A 3MX3A 4Z2JA 2WXRA 3TWUA 4BESA 3ABKE 3ARRA 3DWLG 3LVQE 2XRZA 2VSYA 4BWRA 2R03A 1W3BA 5FTPA 3NOGD 4XZ4A 4JFLA 4ACKA 3ESLA 2YHEA 1YMPA 4GZ6A 3UXGA 1MJ0A 3SF4A 4GYWA 1Z6TA 1LD7A 3L9TA 4TUUA 3EIPA 2DG4A 4AJWA 1F8AB 2EIJE 4LRZA 3Q75A 2KM4A 3QWWA 3T9KA 1HXVA 1W26A 3KD7A 2H6IA 3Q78A 5D0QD 4ATGA 1RW2A 3KAHA 2J07A 4C9BB 4W9OA 3VLFA 5G05J 3B7UX 5ENPD 4KZCA 3B7RL 4QT2A 2WXJA 1V55E 3DSWA 4DX6D 1O1RA 4IT6A 1TNUA 1V54E 3Q15A 1ELWA 3G2TA 2ZQVA 1N0QA 2WMOA 3BQOA 3D9KA 2ZXWE 2KI3A 1TCOC 3FEXA 2F8YA 1FKJA 4YDYA 3ZXSA 4CDMA 3OA5A 4WK9A 4DH0A 3FEYA 4HARA 1FKIA 3O5LA 1NFIE 2ZGDA 2AW6A 3ZUVB 1INZA 2QYJA 3AU4A 5KNGA 4BY6A 2WXMA 4FJZA 2GRMA 4U8VD 3QOKA 1GRJA 1Q6HA 4NSBA 4Q7NA 5FIOA 3DPYA 4HRNA 4U0UA 2IQCA 5ENQD 2XENA 2AVPA 5LP0A 3UT4A 4DUIA 1H2VC 4MPKA 3LYAA 3CQGB 1IHBA 1WAWA 2DT3A 1YCSB 1D7JA 1KFWA 5AQAA 3FTYA 4U84A 3IV0A 2EIKE 2XGOA 3D9LA 3S7FA 1SA5A 3EHQA 3B9EA 2A3AA 2WQ6A 4HFGA 3EY6A 1UR8A 2B0OE 4FADA 4QQIA 1CTNA 2OFNA 4UWLA 1BI8B 4N5QA 4GTRA 2VGXA 1SR0A 3MJWA 2KO7A 1OGGA 2PPNA 3O5MA 2E0IA 2XPZA 3URZA 1LL6A 3DXMG 4NQ0A 3TWSA 3PNTB 3CHRA 1ZU8A 3PVLA 4Q22A 2M1IA 3L16A 3EU5A 5ENSD 2MRIA 5HW6A 4O1PA 5CECB 2CG2A 3B7SA 2WXFA 1D9SA 3UPVA 4RG6A 4CYMD 2JLBA 1D7IA 4FC8A 3KADA 5CBNA 3LUOA 2XP7A 5KCMA 5LCWC 5HS0A 4RLYA 2PBCA 2XZTG 3HXFA 1JCHB 3ASNE 5ENTD 5E75A 4QT3A 3P2BA 3PE3A 5FZQA 2RSEA 1D8DA 4LAVA 4PUCA 2L0TB 1NSGA 3ML8A 2A3CA 3VTXA 4HQDA 3D9JA 1W1PA 4LGXA 3WD4A 2WXQA 2P9SG 4MSPA 4AEZC 1IKND 4L23A 2QYUA 5FINA 3FDHA 2O92A 2YBTA 4EBAG 3WL0A 4L2LA 4HRLA 4HBEA 2KBXA 3DBSA 1FKLA 2WK2A 4GU5A 3PREA 1S70B 3MYVA 3GTYX 1DCEA 3RRMB 4GYYA 4JW1A 3KAFA 4JL0A 3ASGA 3RSEG 3L82A 1OWMA 3RKVA 1F40A 1SZ9A 5D66A 5BT1A 3ZIMA 3UT7A 2JEKA 3APDA 3LVRE 4CRWA 2YHCA 3SFYA 3G2SA 3ML9A 4HBDA 4G23A 3J5QB 4S3KA 3UM2A 4AXHA 1UR9A 3KAEA 2LKNA 1OWNA 2VGEA 3TDBA 1FKKA 4HOQA 2DT1A 3BXWA 3O5IA 4R0XA 5CRUA 1KPSB 2WXOA 1EQ3A 2IOLA 1XRVA 3UUXA 3EHNA 4EZJA 1X5BA 3HXCA 4DWSB 2L2SA 1LG1A 1KLXA 2XPYA 2IUZA 2OLHA 3ZU7B 5FZRA 4U96D 4NIKA 3CHCA 5KJKA 4WUYA 3GZ2A 3S7BA 2AWGA 1YA0A 4ITZA 2EINE 3FWVA 3T5XA 3WD1A 1XGWA 4EECA 3Q7AA 4Q94A 2I1JA 5KJMA 3NOCD 2RUQA 1UN9A 4DRIA 1N4RA 4CCAA 1E15A 4URKA 2WXNA 2P2CP 2R5SA 1OWQA 1FT2A 4D10C 3KSQA 2GRRB 2P4VA 3AQUA 5ANRA 3FP3A 3FTZA 1A5EA 4JPSA 4W9PA 3OAWA 4NNRA 3RMEA 2KCVA 1OXJA 4MBGA 1Q6IA 2AXVA 3HDXA 1E8ZA 3D9MA 1IXVA 4DK5A 2FEZA 4AVXA 3C5RA 4URIA 3G2VA 4YDEA 2RURA 4Q96A 3CVVA 5JHBA 2KCKA 4W9QA 3W9GA 4GTOA 2DWZA 3B8SA 4MNMA 2WLZA 5M72A 1JVWA 4KQZA 5JH8A 3KS2A 4G24A 4AM9A 3CIAA 5HW8A 1UOHA 5BW8C 4UI9K 3O4ZA 2VYIA 4TV3A 5EKQD 3WD0A 2XCBA 4UWKA 4JB8P 3PRDA 2QY7A 1X81A 1EHNA 1DCQA 3I6CA 3LS8A 1HF8A 5JMND 4TW6A 4QIBA 1E6ZA 3TWWA 3CK9A 3D9OA 3UINC 4P29A 4K0RA 3CV0A 2QFCA 4F7AA 5JJTA 3IHYA 1XNFA 3ARYA 1W9VA 4U07A 4J8DA 1ROUA 2MPHA 1FJDA 3NRKA 3UM1A 2FBNA 3L54A 5CEDB 4TW8A 2RG8A 2OVBA 2BKGA 3KEAA 4I1OB 4XKCA 5HKPA 3CHEA 1FKTA 4G2VA 3JYJA 2R2LA 4G25A 2KE0A 3NF1A 2WXGA 3O48A 1N4QA 3I5PA 5AJDA 1NP7A 4A3VA 4HI8A 3Q47B 5EN5D 2P9LG 3TWQA 4J4OA 2FI7A 2KC7A 3KEZA 4DX5D 1HKJA 4Z68A 4C0MA 5BV1A 1FCHA 4BX8A 2PM7A 3APFA 1E8YA 2ETBA 4GTVA 2Q7FA 1JWFA 3MA5A 3EJNA 2F37A 3MGBA 4YVQC 4J8FA 4JA7A 4HOTA 3HYMB 2FULA 2Y69E 3UX4A 4WKHA 4IRUA 4DLQA 4BF8A 3S7JA 3B9AA 2Y1LE 1W1TA 2R59A 5EYPF 3IHVA 2P9NG 3ODKA 3S2AA 3PZ2A 2X38A 4XIFA 2DPEA 4GCNA 2KFWA 1WY6A 3FU3A 3AG4E 3C98A 4L9PA 3ARPA 4BX9A 3TWXA 3TL5A 4UI9C 4JA9A 2X6IA 5JJ6A 1ZBKA 3RFWA 4B8CB 4WIWA 3JQ1A 1GUVA 5CBOA 2UY1A 5ITZF 2XP5A 3U3WA 3G6LA 3CHMA 4N2SA 3CZ8A 2FAPA 3SBSA 1H0GA 3RGCA 5AENA 5JJ7A 4ABNA 4N5CA 2IO2C 3ZYMA 1C9HA 4M7CA 1E96B 2MHKA 4GZ3A 2E2EA 2HYZA 4NURA 1WNOA 4HBOA 3RM4A 3CK8A 4K5BA 2JABA 3FUMA 2HR2A 4HRMB 2CHZA 3EIQC 4ME2A 4JEHA 4FAPA 5LFAA 3PNLB 4E6HA 2J49A 4BERA 1HE8A 3L13A 4GGQA 3FH8A 3ZXPA 2PL2A 3GZSA 3BG0B 3UI2A 4FU3A 1M5YA 4DRPA 3ARWA 4L1BA 1LL4A 1KT1A 4WWPA 1N94A 1RD6A 5CCLA 4JD2G 3DEPA 1LG2A 2K8IA 1S64A 4CGVA 4Z2LA 4CT4A 1HJWA 2B6CA 5BV0A 2MYOA 4CDNA 5ENNA 4I1MA 3LJ3A 3I3NA 3LKUA 1JWGA 5ANLA 3WD2A 4A1SA 4KR0B 3TC5A 4DWSD 3CVWA 1H6PA 1Y6IA 4JFMA 4FLBA 3FFLA 4MAVA 4ZPWR 3VTYA 4CEMA 2A3EA 3CGMA 2L9BA 3SZ7A 5C1DA 1OCZE 2YBUA 2F2DA 3ISMC 2ZQTA 3UM3A 3CVLA 2M63A 3ZHEA 4GZ5A 2NXPA 1RZ4A 4GA2A 1SYTA 2KATA 3IK8A 1HG2A 1LQ0A 5DIUA 2FDMA 3VLDA 1OCOE 4ATZD 3U4TA 3CVYA 3SBTB 4N19A 1N4PA 4EZKA 4JFIA 1JNSA 1SQMA 4KYOB 3UI4A 1YYHA 3WL1A 3B7TA 4JVSA 2G8ZA 2BTDA 4FA6A 2ZISA 3FXYA 4L3NA 2N87A 4DLOA 3EHRA 4U8YD 4ODOA 3ALFA 4QZVB 4YDOA 3HVEB 3ARTA 5KBAA 4IQ2A 3UT8A 1TJCA 1ELRA 1BI7B 3PH0C 3MKRA 2FKEA 4W5UA 1JCQA 3LPZA 2WXHA 5T8IA 1KZOA 3HXEA 3E4BA 3ZFWA 3U9WA 3DSTA 1E9LA 4KBQA 1OY3D 4Z2KA 3KCEA 5AJLA 2DZOA 2DG3A 2FF4A 2XPIA 2VSNA 1E6PA 4UQXA 1A17A 5KNHD 5CCMA 2A5EA 4XI9A 1EDUA 2CG3A 3CHDA 2VGYA 1HJVA 4TX0A 1BU9A 3JXVA 4R5EA 2I9CA 2BF0X 4GYOA 2IU1A 3ARVA 5A6CA 4DJAA 1EIBA 1BLXB 2IOSA 4GAAA 3ZYLA 4FP7A 1U3CA 3UF8A 4DPRA 2XEEA 1JNTA 3ZVVA 4X8QA 4ODQA 3ZNGA 2XP8A 3FH7A 3KZ7A 4JHKA 3U64A 4CGWA 1K3ZD 3MCXA 1ZB5A 3X2QE 5CRVA 2AXUA 2XRYA 4DRHA 5FQ4A 3FULA 4DX2A 1O1SA 2VTBA 3RK6A 4IYPA 4GTPA 1JCRA 2P9IG 4A55A 1WG0A 1NWSA 3TJPA 1HZ4A 1Z3XA 2X6JA 2GGFA 1A7XA 3O5FA 5FWQA 2RD0A 2XEVA 3LJNA 1JNDA 5FJYA 3SFXA 4DRMA 2HM8A 2B5UB 4B93B 5EIDA 3JYMA 4YVOA 2QF8A 3RO3A 2XPAA 1TNYA 5J08A 2VQ2A 4NZCA 1IQUA 2ESCA 4FJYA 4GTSA 2ETNA 1HFAA 2F4EA 3GPKA 5HKGA 2OEVA 1ZBPA 1QNFA 1EPUA 2BUGA 4RQIA 2NYJA 5IY5E 4TXQA 2RUDA 1OWLA 3EIJA 1TJFA 3FAPA 2ITKA 3Q5MA 1ZK6A 4JC8A 4EQFA 2G41A 3LY9A 3BUAA 3QOUA 2NC9A 2IF4A 3JCKC 2X6HA 3RJVA 4BT8A 4PS8A 5HI7A 1Q1CA 2LAIA 3PEVB 4RG9A 3QC1A 4G8LA 3H9RB 3C3OA 4IT4A 4NRHB 1KT0A 1VDYA 2XCCA 4F6RD 2Y3AA 4H7YA 4I6GA 3CGHA 3RO2A 4I6EA 2KCLA 2KGJA 3FTSA 2WB2A 1WB0A 1O6IA 3O5EA 1ZL1A 1MX2A 3E33A 1U3DA 5DO2A 2EULA 4ZPVR 4PH4B 2R02A 2UZ5A 3L6AA 3O5PA 4MNLA 4GMLA 3CLJA 3LEWA 1N1AA 2X6KA 4ODNA 2LXMA 4HNAD 1E90A 2PZIA 1N9AA 4ZFHA 2VTBB 1PY1A 3R7RA 1D6OA 1HH8A 5G2NA 4ANUA 3UQIA 3RIBA 3WQVA 2J08A 3CQCB 1QBQA 3JXJA 3FTWA 4YNDA 3TG4A 2LPVA 1LTXA 2C0MA 2A3BA 4WNGA 3ZRHA 2EQXA 3QARA 3JXIA 3CVPA 3P1UA 2P9PG 5G04J 4B89A 4K5AB 1ZCNA 1FKHA 1PC2A 3E37A 2XS1A 4MNJA 2UY1B 1U79A 3PR9A 4J4NA 4LNGA 4U85A 3L22A 1OCCE 3RU0A 4BTBA 3Q4AB 3ASHA 1EF1C 1X6NA 4HXIA 1PAQA 5HBFA 3FUDA 2MF9A 3O5RA 1W1VA 4LCTA 3E32A 1NWRA 3D3MA 4IN3B 5EIBE 4U7EB 3Q73A 1TEZA 3PZDA 3D9NA 4I43A 3UM0A 4JXTA 5BPPA 3NZUA 4L7TA 2V5FA 4JFJA 3O5KA 1WM5A 3IBEA 1HKIA 2VJ8A 3C3QA 2GROB 3CVUA 2DBAA 3KAGA 4LAWA 5FT9A 4XI0A 3GYZA 3PZ1A 2F23A 3OOBA 4N3BA 3L08A 3ZYQA 1JNEA 4HLLA 4MTVA 1Y0OA 1NWTA 3AU5A 1S0PA 3DSUA 3FY4A 4GZCA 1LL7A 3O5QA 3UQBA 3CEQA 3FUKA 3N71A 3SNXA 3FUNA 5HQ8A 3ESKA 1UJJA 5D75A 1SW6A 4V3IA 4UQZA 2XP3A 3FUIA 3C3RA 2IJGX 4AIFA 3PZ4A 1Z5SC 3FTXA 1N54A 5ARFA 2RFAA 2Y0BG 2IY0C 3B9DA 3FUJA 1E8XA 2GRLA 3AS1A 4G50A 4J7WA 2XHEA 2L6JA 3PZ3A 5DBKA 3QNKA 4MKTA 3PUJA 1R9HA 3CGNA 2F8XK 3C72A 3JQ0A 3BMBA 3MDYB 4Z2GA 3KAIA 3IHZA 3T8KA 2V5QC 4WNFA 3VAWA 4C0EA 1BPOA 1VF8A 3HXBA 4FHKA 3ABLE 4DWSA 2P9UG 3IKDA 4TXRA 1NA3A 4DT4A 3QAQA 5G05C 4QFVA 1N0RA 1N95A 1OT8A 2F21A 1NMVA 2DVWA 2V4HC 2HO1A 3ULEG 3ZHEB 4Y6CA 1HS6A 4J8SA 2VN1A 1FAPA 4XX5A 3L17A 5EX0A 2AJAA 1XHGA 3QK0A 1UW4B 3AAAC 4B8AA 1TNZA 2WM0A 3WD3A 1E44A 3LY7A 4AP2A 4EHMA 3JYSA 4MLPA 3LXUX 1W1YA 3LCAA 4CT0A 2AXZA 2A5UA 5BNWA 4DRNA 5DEZA 3PRBA 4I2ZA 4H7XA 4AOFA 2RFMA 1Q6UA 1E7VA 3TWVA 2LUHA 5ENRD 4JYSA 5GPRA 5KJNA 2H6GA 3SHFA 2RQSA 3SQVA 5AQBA 4BFRA 3Q7FA 3B13A 1AP7A 4EBAA 3PS6A 1SVXA 4ODLA 1G3NB 2DYSE 2ZIRA 4DRJA 1GOIA 4O6FA 2IEJA 2WM9A 3PEUB 2CHWA 2OOEA 4I6JA 3AS3A 4UWFA 1FKBA 4TYOA 1PBKA 1YATA 3R9MA 3RRUA 2C0LA 3WG7E 3WQWA 5KWDA 4Z2IA 1TN6A 2EIME 5LX8A 4XKBA 3ULYA 5C2YA 5B3SE 1TFVA 4NACA 2DIWA 3IKOB 2PQNA 1LJYA 3CHFA 5ARGA 2KR7A 4HVBA 2DZNA 1GW6A 5AQ7A 2RKKA 4MGVA 4DRQA 3O5JA 4YDWA 3KSLA 2XQ0A 4F53A 2PPPA 4WWOA 4IPXA 4G11A 2X3MA 4BTAA 3AS5A 4HB5A 3EHMA 1W9PA 2ZU6B 2PV2A 2CHXA 2XP4A 3FH5A 3CHQA 4I17A 3DPDA 2MOWA 4J6IA 1OGBA 1H0AA 4ODRA 1UN8A 2V0PA 4XE0A 5DIZA 5AYWD 5JA4D 1YW5A 3DXKG 2P58C 3W9FA 5CMWA 2VSOE 3CKBA 3FUHA 3UIOC 2XZDG 5EYLA 1B6CA 1Z3YA 4GTMA 3MEKA 3B7XA 4B94A 1N11A 2BEDA 4MRUA 3FU5A 1UG3A 2I6HA 1S63A 4MNKA 1H6KA 5B8IC 1IYGA 1NH6A 1HX8A 3QJZA 4DRXE 5FQ7A 5JHAA 4TNSA 3SD5A 2LJ4A 4DX7D 2DSWA 3ZKJA 3UI6A 3V2XA 2CFUA 3NAWA 2LSUA 1BD8A 1T11A 3D9IA 1HO8A 4I9EA 5J90A 1HKKA 1OWPA 3V31A 2V4LA 1EYMA 4LG6A 4O2TA 3FHEA 2KXPC 3AS2A 4GA0A 4J8EA 1HXIA 3B7BA 5B1AE 3ZEFA 1W9UA 3UIPC 2J4BA 3AG1E 5BUZA 5HUAA 1FVFA 4GZDA 3ASFA 3NI6A 3O5GA 4UWHA 2D9FA 3TG5A 1QPLA 3MKQB 1BKFA 3ZGQA 4C02B 2OCCE 3TWRA 4GMRA 3ZYKA 5EDSA 1B89A 3RM9A 4GMJA 4P8WA 5AIJA 4WKAA 4TUMA 1FKGA 1L5JA 2ZR6A 3TWTA 4G2PA 4F1PA 3DSXA 1KZPA 2I1KA 2FO7A 3ENEA 2VSXE 2J4DA 4Y6WA 2ZR5A 4LERA 4RSYA 3R7QA 4G26A 1SA4A 2YQ8A 4PS7A 3CKCA 3Q49B 4KXKB 3AJIA 3CH9A 3ARUA 4OVUA 3O5OA 4WKFA 2J09A 3WH0A 3CR3A 5FZSA 3ZN3A 1HG5A 4TRQA 3O5DA 1FKDA 3FTVA 4A1GA 2FO1E 3AS4A 3MKQA 2DSVA 2QZAA 3TXNA 1IHGA 1NI1A 2LXLA 3EUVA 3TXMA 3UQAA 3TCZA 5T4YA 5J6EA 4CDRA 4EZLA 2WLYA 1E7UA 2XGMA 4B0ZA 3DRAA 3QWVA 1MQSA 3Q79A 4IULA 4KT6B 4U0SA 1H6OA 3ZW3A 3S7DA 4HORA 4JHRA 1TNOA 3GU0A 1LD8A 1P5QA 1ZBCA 1H19A 1WAO1 4N39A 4I1AA 3UMVA 4P8XA 2ETCA 2F0YA 2DG9A 1DVPA 3MV2B 4S3JA 3NZSA 4U86A 2O9OA 3MZLB 4KVMA 1ELKA 4GB9A 3OXLA 3UKUG 2DYRE 2OV8A 3ONLA 5DIVA 4DZ2A 2WXIA 3OTNA 1FKSA 4LNUD 5A23A 2ZGGA 3DEOA 3APCA 4Z2HA 3PRZA 5LCWJ 1TN7A 2LO6A 3QWPA 4U8HA 3T5VA 1H2UA 1L1PA 3ARXA 3CVNA 4OVVA 5H7PA 4AY1A 2UWJG 1FPPA 3SY2A 4BSZB 3ARSA 3F6QA 4ACLA 2WPVA 1DC2A 3PDNA 3HVEA 4ILHB 3KABA 1ZBWA 1K1AA 4N3CA 1FVHA 4J8YA 2LAHA 3G2UA 5CHEE 1UJKA 4PS3A 1AWCB 3WIJA 2ZQUA 3EU9A 2ZQSA 3QB2A 4DI3A 3G2WA 2OEWA 3V79K 3EDTB 2WQHA 2WXKA 3ULQA 1ZBVA 1JUQA 4LUNU 3RRNB 4GTQA 3FTUA 4DIPA 4M3OA 4FULA 3PRAA 5FQ6A 1TR4A 4XEIG 5EILA 1QYMA 1SZAA 3ZPJA 4UWGA 5GPGA 1JPLA 4Q69A 2QC9A 4UUCA 5A7DB 1JCSA 3WKZA 2Y4UA 4R7LA 4ODKA 4AV7A 5ENOD 2MLYA 4OYSA 1Y8MA 1OWOA 3TGOA 4I2WA 4WNEA 4DWSC 3CHPA 4N2QA 4GPKA 4UQYA 3PA7A 1E6RA 3U66A 2NSZA 2X6FA 4J0UA 4ANVA 3FUFA 3B95A 3FU6A 4JFKA 1DNPA 4ODPA 2C2LA 4ANXA 1IQRA 4LAYA 3CHSA 3IXEA 3ASOE 1N4SA 2AOSA 1Q2ZA 3SI5A 4GA1A 3BG1B 4JHJA 4C48B 3CVQA 2PNNA 3JUEA 2WVIA 3I4GA 4HOUA 4K03A 2YINA 3DSVA 5I98A 3CK7A 1J6YA 2MNTA 4IQCA 3ABME 4CZ2D 4DX1A 1ZU2A 2J8SD 3BU8A 3V30A 3VLEA 4P8UA 1J4HA 4U95D 2XS8A 3NBNB 5BXUA 2L0IA 4P8VA 4G1TA 4UI9J 4FN2A 1H0IA 4BEPA 1TNBA 1N52A 4APFA 1J4RA 4U04A 3E34A 5E76A 2DT0A 4LAXA 4O60A 5BXJA 5HWCA 4GCOA 2VCDA 3NQPA 5T3RA 4TXPA 4HLEA 2KZTB 2DCPA 2XP6A 4PDXA 2L6BA 4ILGA 5CEAA 2MLXA 5CMYA 3ARZA 4WJXA 3E30A 1FT1A 2JZVA 2PV1A 4N3AA 3D9PA 2R17C
chains in the Genus database with same CATH topology
4KVOA 3HHMA 4DI4A 1X6LA 2Y78A 1E6NA 4DZ3A 4KZ0A 5DITA 4ML4A 2LSVA 4F1SA 2J9QA 1NZNA 2PPOA 3CHOA 1LF8A 1QZ2A 4L2YA 3AS0A 3QDNA 3AS8A 1IX5A 2M08A 1D2KA 2PI6A 1OUVA 3SFZA 3CVXA 3W4RA 4U0ZA 2LNIA 4DROA 4AY6A 1HJXA 4EPZA 3HIZA 2PQRA 5D0OD 1D7HA 2RUCA 4HOSA 3RM8A 2I2OA 1FKFA 3ONKA 2M2AA 1FFRA 5HT1A 1EDQA 3LY8A 2MLZA 1MHQA 3SGHA 4BT9A 2OVFA 1ROTA 4BSXA 5GQBA 2WMNA 2B31A 4WNDA 2ILRA 4HS2A 3FY1A 3G6MA 5G55A 1HKMA 3ALGA 2YNQA 4FLHA 4U63A 4MS6A 4RVBA 2KZTA 1K9TA 1PINA 1HU3A 3GZ1A 4WWNA 4ODMA 5G04C 4KMOA 3KACA 3NTPA 3UI5A 3JUIA 4F3VA 3QKYA 3CSTA 3PE4A 2XGSA 1GPFA 3K9IA 2AWIA 1FD9A 4ANWA 3I4RB 3AROA 2Y4TA 2PV3A 1ITXA 1NMWA 2V8SE 3IKGA 1FFQA 3LDZA 1NWUA 2ONDA 3OXGA 4L72B 3IEGA 4E85A 3ARQA 5HW7A 2WXPA 3OXFA 4AY5A 4I9CA 2IONA 2ZR4A 5KJLA 2CFZA 4ZS6A 4ILIA 2DSUA 5HTGA 1E8WA 2GW1A 1QQEA 5DF0A 3GW4A 3BEEA 2DT2A 2LGOA 2IFUA 4WAFA 3WXXA 2Q5AA 1J4IA 5FQ8A 5HWBA 3TAXA 2XPBA 3UQ3A 5LOZA 1QPFA 2A4ZA 2VGXB 4DRKA 2WQ7A 3MV3B 4ZPTR 4PTMA 3PUKA 2XP9A 4JEUA 1H2TC 4LEUA 4A3TA 4W9RA 1EYHA 2WXLA 4FHJA 2DSZA 4GIVA 5EX3A 1NA0A 4TW7A 4APOA 3CSFA 4XAKA 3R9AB 1FKRA 3ASDA 3FUEA 3FU0A 4JZYA 2PM6A 3T8MA 1BL4A 3MX3A 4Z2JA 2WXRA 3ARRA 2XRZA 3LVQE 2VSYA 4BWRA 1W3BA 5FTPA 4XZ4A 4JFLA 4ACKA 3ESLA 2YHEA 4GZ6A 3SF4A 4GYWA 1Z6TA 4TUUA 2DG4A 4AJWA 1F8AB 4LRZA 2KM4A 3QWWA 1HXVA 1W26A 3KD7A 5D0QD 4ATGA 3KAHA 2J07A 4C9BB 4W9OA 3VLFA 5G05J 3B7UX 4KZCA 3B7RL 4QT2A 2WXJA 4IT6A 3Q15A 1ELWA 3G2TA 2ZQVA 2WMOA 3D9KA 2KI3A 1TCOC 3FEXA 1FKJA 4WK9A 3ZXSA 4CDMA 3OA5A 4DH0A 3FEYA 4HARA 1FKIA 3O5LA 2AW6A 1INZA 3AU4A 4BY6A 2WXMA 3QOKA 4FJZA 2GRMA 1Q6HA 4NSBA 4Q7NA 4U0UA 2IQCA 2AVPA 5LP0A 3UT4A 1H2VC 4MPKA 3LYAA 3CQGB 1WAWA 2DT3A 1D7JA 1KFWA 3FTYA 4U84A 3IV0A 2XGOA 3D9LA 3S7FA 3B9EA 2A3AA 2WQ6A 4HFGA 3EY6A 1UR8A 4FADA 1CTNA 2OFNA 4UWLA 2VGXA 1SR0A 3MJWA 2KO7A 1OGGA 2PPNA 3O5MA 2E0IA 2XPZA 3URZA 1LL6A 4NQ0A 3PNTB 3CHRA 1ZU8A 3PVLA 4Q22A 2M1IA 3L16A 2MRIA 5HW6A 2CG2A 3B7SA 2WXFA 3UPVA 4RG6A 2JLBA 1D7IA 4FC8A 3KADA 3LUOA 2XP7A 5KCMA 5LCWC 2PBCA 5E75A 4QT3A 3P2BA 3PE3A 5FZQA 2RSEA 4LAVA 4PUCA 2L0TB 1NSGA 3ML8A 2A3CA 3VTXA 3D9JA 1W1PA 4LGXA 3WD4A 2WXQA 4MSPA 4AEZC 4L23A 3FDHA 2O92A 2YBTA 4EBAG 3WL0A 4L2LA 4HBEA 3DBSA 1FKLA 2WK2A 4GU5A 3PREA 3MYVA 3RRMB 4GYYA 4JW1A 3KAFA 4JL0A 3ASGA 1OWMA 3RKVA 1F40A 1SZ9A 5BT1A 3ZIMA 3UT7A 2JEKA 3APDA 3LVRE 4CRWA 2YHCA 3G2SA 3ML9A 4G23A 4S3KA 4AXHA 1UR9A 3KAEA 2LKNA 1OWNA 3TDBA 1FKKA 4HOQA 2DT1A 3BXWA 3O5IA 4R0XA 2WXOA 1EQ3A 2IOLA 1XRVA 3UUXA 3EHNA 4EZJA 1X5BA 4DWSB 2L2SA 1LG1A 1KLXA 2XPYA 2IUZA 2OLHA 5FZRA 3CHCA 5KJKA 4WUYA 3GZ2A 3S7BA 2AWGA 1YA0A 4ITZA 3FWVA 3T5XA 3WD1A 1XGWA 4EECA 4Q94A 2I1JA 5KJMA 2RUQA 1UN9A 4DRIA 4CCAA 1E15A 4URKA 2WXNA 2R5SA 1OWQA 4D10C 3AQUA 5ANRA 3FP3A 3FTZA 4JPSA 4W9PA 3OAWA 4NNRA 3RMEA 2KCVA 1Q6IA 2AXVA 3HDXA 1E8ZA 3D9MA 4DK5A 2FEZA 4AVXA 4URIA 3G2VA 2RURA 4Q96A 3CVVA 5JHBA 2KCKA 4W9QA 3B8SA 4MNMA 2WLZA 5M72A 1JVWA 4KQZA 5JH8A 3KS2A 4G24A 4AM9A 3CIAA 5HW8A 5BW8C 4UI9K 3O4ZA 2VYIA 4TV3A 5EKQD 3WD0A 2XCBA 4UWKA 3PRDA 2QY7A 1EHNA 3I6CA 3LS8A 1HF8A 4TW6A 4QIBA 1E6ZA 3CK9A 3D9OA 4P29A 4K0RA 3CV0A 2QFCA 4F7AA 5JJTA 3IHYA 1XNFA 3ARYA 1W9VA 4U07A 4J8DA 1ROUA 2MPHA 1FJDA 3NRKA 2FBNA 3L54A 4TW8A 2RG8A 2OVBA 4I1OB 4XKCA 3CHEA 1FKTA 4G2VA 3JYJA 4G25A 2KE0A 3NF1A 2WXGA 3O48A 3I5PA 5AJDA 1NP7A 4A3VA 3Q47B 4J4OA 2FI7A 2KC7A 3KEZA 1HKJA 4C0MA 5BV1A 1FCHA 4BX8A 2PM7A 3APFA 1E8YA 2Q7FA 1JWFA 3MA5A 3EJNA 3MGBA 4YVQC 4J8FA 4JA7A 4HOTA 3HYMB 2FULA 3UX4A 4WKHA 4IRUA 4DLQA 4BF8A 3S7JA 3B9AA 1W1TA 2R59A 3IHVA 3ODKA 3S2AA 2X38A 4XIFA 2DPEA 4GCNA 2KFWA 1WY6A 3FU3A 3C98A 3ARPA 4BX9A 3TL5A 4UI9C 4JA9A 2X6IA 5JJ6A 1ZBKA 3RFWA 4B8CB 4WIWA 3JQ1A 1GUVA 2UY1A 2XP5A 3U3WA 3G6LA 3CHMA 4N2SA 3CZ8A 2FAPA 3SBSA 1H0GA 3RGCA 5AENA 5JJ7A 4ABNA 4N5CA 3ZYMA 1C9HA 1E96B 2MHKA 4GZ3A 2E2EA 2HYZA 4NURA 1WNOA 4HBOA 3RM4A 3CK8A 3FUMA 2HR2A 2CHZA 3EIQC 4ME2A 4JEHA 4FAPA 5LFAA 3PNLB 4E6HA 2J49A 1HE8A 3L13A 4GGQA 3FH8A 2PL2A 3GZSA 3BG0B 4FU3A 1M5YA 4DRPA 3ARWA 4L1BA 1LL4A 1KT1A 4WWPA 1RD6A 5CCLA 1LG2A 2K8IA 4CGVA 4Z2LA 4CT4A 1HJWA 5BV0A 4CDNA 5ENNA 4I1MA 3LJ3A 3I3NA 3LKUA 1JWGA 5ANLA 3WD2A 4A1SA 4KR0B 3TC5A 4DWSD 3CVWA 1Y6IA 4JFMA 4FLBA 3FFLA 4MAVA 4ZPWR 3VTYA 4CEMA 2A3EA 3CGMA 2L9BA 3SZ7A 5C1DA 2YBUA 2F2DA 2ZQTA 3CVLA 2M63A 3ZHEA 4GZ5A 2NXPA 4GA2A 1SYTA 2KATA 3IK8A 1HG2A 1LQ0A 5DIUA 2FDMA 3VLDA 3U4TA 3CVYA 3SBTB 4N19A 4EZKA 4JFIA 1JNSA 1SQMA 4KYOB 3UI4A 3WL1A 3B7TA 4JVSA 2G8ZA 2BTDA 4FA6A 3FXYA 4L3NA 2N87A 4DLOA 4ODOA 3ALFA 4QZVB 3HVEB 3ARTA 4IQ2A 3UT8A 1TJCA 1ELRA 3PH0C 3MKRA 2FKEA 4W5UA 3LPZA 2WXHA 5T8IA 3E4BA 3ZFWA 3U9WA 1E9LA 4KBQA 4Z2KA 3KCEA 5AJLA 2DG3A 2FF4A 2XPIA 2VSNA 1E6PA 4UQXA 1A17A 5CCMA 4XI9A 1EDUA 2CG3A 3CHDA 2VGYA 1HJVA 4TX0A 3JXVA 4R5EA 2I9CA 2BF0X 4GYOA 2IU1A 3ARVA 5A6CA 4DJAA 1EIBA 2IOSA 4GAAA 3ZYLA 4FP7A 1U3CA 3UF8A 4DPRA 1JNTA 3ZVVA 4ODQA 2XP8A 3FH7A 3KZ7A 4JHKA 3U64A 4CGWA 3MCXA 1ZB5A 2AXUA 2XRYA 4DRHA 5FQ4A 3FULA 2VTBA 3RK6A 4IYPA 4A55A 1NWSA 3TJPA 1HZ4A 1Z3XA 2X6JA 2GGFA 1A7XA 3O5FA 5FWQA 2RD0A 2XEVA 1JNDA 5FJYA 4DRMA 2HM8A 3JYMA 4YVOA 2QF8A 3RO3A 2XPAA 5J08A 2VQ2A 4NZCA 1IQUA 2ESCA 4FJYA 1HFAA 2F4EA 3GPKA 5HKGA 1ZBPA 1QNFA 1EPUA 2BUGA 2RUDA 1OWLA 3EIJA 1TJFA 3FAPA 2ITKA 3Q5MA 1ZK6A 4JC8A 4EQFA 2G41A 3LY9A 3QOUA 2NC9A 2IF4A 3JCKC 2X6HA 3RJVA 4BT8A 4PS8A 5HI7A 1Q1CA 2LAIA 3PEVB 4RG9A 3QC1A 3H9RB 4IT4A 4NRHB 1KT0A 1VDYA 2XCCA 2Y3AA 4H7YA 4I6GA 3CGHA 3RO2A 4I6EA 2KCLA 2KGJA 3FTSA 2WB2A 1WB0A 1O6IA 3O5EA 1ZL1A 1U3DA 5DO2A 4ZPVR 4PH4B 2UZ5A 3L6AA 3O5PA 4MNLA 4GMLA 3CLJA 3LEWA 1N1AA 2X6KA 4ODNA 1E90A 2PZIA 2VTBB 1PY1A 3R7RA 1D6OA 1HH8A 5G2NA 4ANUA 3UQIA 3RIBA 3WQVA 2J08A 3CQCB 3FTWA 4YNDA 3TG4A 2LPVA 2C0MA 2A3BA 4WNGA 3ZRHA 2EQXA 3QARA 3CVPA 3P1UA 5G04J 4B89A 1ZCNA 1FKHA 1PC2A 4MNJA 2UY1B 1U79A 3PR9A 4J4NA 4U85A 3L22A 3RU0A 4BTBA 3Q4AB 3ASHA 1EF1C 1X6NA 4HXIA 1PAQA 5HBFA 3FUDA 2MF9A 3O5RA 1W1VA 4LCTA 1NWRA 3D3MA 4IN3B 1TEZA 3PZDA 3D9NA 4I43A 4JXTA 5BPPA 3NZUA 4L7TA 2V5FA 4JFJA 3O5KA 1WM5A 3IBEA 1HKIA 2VJ8A 3CVUA 2DBAA 3KAGA 4LAWA 5FT9A 4XI0A 3GYZA 3OOBA 4N3BA 3L08A 3ZYQA 1JNEA 4MTVA 1Y0OA 1NWTA 3AU5A 1S0PA 3FY4A 4GZCA 1LL7A 3O5QA 3UQBA 3CEQA 3FUKA 3N71A 3SNXA 3FUNA 5HQ8A 3ESKA 1UJJA 5D75A 4V3IA 4UQZA 2XP3A 3FUIA 2IJGX 4AIFA 3FTXA 1N54A 5ARFA 3B9DA 3FUJA 3AS1A 1E8XA 2GRLA 4G50A 2XHEA 2L6JA 5DBKA 3QNKA 4MKTA 3PUJA 1R9HA 3CGNA 3JQ0A 3MDYB 4Z2GA 3KAIA 3IHZA 4WNFA 3VAWA 4C0EA 1BPOA 1VF8A 4FHKA 4DWSA 3IKDA 1NA3A 4DT4A 3QAQA 5G05C 4QFVA 2F21A 1NMVA 2HO1A 3ZHEB 4Y6CA 1HS6A 4J8SA 2VN1A 1FAPA 4XX5A 3L17A 5EX0A 1XHGA 3QK0A 1UW4B 4B8AA 2WM0A 3WD3A 3LY7A 4AP2A 3JYSA 4MLPA 3LXUX 1W1YA 3LCAA 4CT0A 2AXZA 2A5UA 5BNWA 4DRNA 5DEZA 3PRBA 4I2ZA 4H7XA 4AOFA 1Q6UA 1E7VA 4JYSA 5GPRA 5KJNA 3SHFA 2RQSA 4BFRA 3B13A 4EBAA 3PS6A 4ODLA 4DRJA 1GOIA 4O6FA 2WM9A 3PEUB 2CHWA 2OOEA 4I6JA 3AS3A 4UWFA 1FKBA 4TYOA 1PBKA 1YATA 3RRUA 2C0LA 3WQWA 4Z2IA 5LX8A 4XKBA 5C2YA 1TFVA 4NACA 2DIWA 3IKOB 2PQNA 1LJYA 3CHFA 5ARGA 2KR7A 4HVBA 1GW6A 4MGVA 4DRQA 3O5JA 2XQ0A 4F53A 2PPPA 4WWOA 4IPXA 4G11A 2X3MA 4BTAA 3AS5A 3EHMA 1W9PA 2ZU6B 2PV2A 2CHXA 2XP4A 3FH5A 3CHQA 4I17A 3DPDA 2MOWA 4J6IA 1OGBA 1H0AA 4ODRA 1UN8A 2V0PA 4XE0A 5DIZA 5AYWD 1YW5A 2P58C 5CMWA 2VSOE 3CKBA 3FUHA 1B6CA 1Z3YA 3MEKA 3B7XA 4B94A 4MRUA 3FU5A 1UG3A 2I6HA 4MNKA 1H6KA 5B8IC 1IYGA 1NH6A 1HX8A 3QJZA 5FQ7A 5JHAA 4TNSA 3SD5A 2LJ4A 2DSWA 3UI6A 2CFUA 2LSUA 1T11A 3D9IA 1HO8A 4I9EA 5J90A 1HKKA 1OWPA 2V4LA 1EYMA 4O2TA 3FHEA 3AS2A 4GA0A 4J8EA 1HXIA 3ZEFA 1W9UA 2J4BA 5BUZA 5HUAA 1FVFA 4GZDA 3ASFA 3NI6A 3O5GA 4UWHA 2D9FA 3TG5A 1QPLA 3MKQB 1BKFA 3ZGQA 4C02B 3ZYKA 5EDSA 1B89A 3RM9A 4GMJA 4P8WA 5AIJA 4WKAA 1FKGA 1L5JA 2ZR6A 4G2PA 2I1KA 2FO7A 3ENEA 2VSXE 2J4DA 4Y6WA 2ZR5A 4LERA 4RSYA 3R7QA 4G26A 2YQ8A 4PS7A 3CKCA 3Q49B 4KXKB 3CH9A 3ARUA 4OVUA 3O5OA 4WKFA 2J09A 3WH0A 3CR3A 5FZSA 3ZN3A 1HG5A 4TRQA 3O5DA 1FKDA 3FTVA 4A1GA 3AS4A 3MKQA 2DSVA 3TXNA 1IHGA 3TXMA 3UQAA 3TCZA 5T4YA 5J6EA 4CDRA 4EZLA 2WLYA 1E7UA 2XGMA 4B0ZA 3QWVA 1MQSA 4IULA 4KT6B 4U0SA 3ZW3A 3S7DA 4HORA 4JHRA 1P5QA 1ZBCA 1H19A 1WAO1 4N39A 4I1AA 3UMVA 4P8XA 2DG9A 1DVPA 3MV2B 4S3JA 3NZSA 4U86A 2O9OA 3MZLB 4KVMA 1ELKA 4GB9A 3OXLA 2OV8A 3ONLA 5DIVA 4DZ2A 2WXIA 3OTNA 1FKSA 5A23A 3APCA 4Z2HA 3PRZA 5LCWJ 2LO6A 3QWPA 4U8HA 3T5VA 1H2UA 1L1PA 3ARXA 3CVNA 4OVVA 4AY1A 2UWJG 3ARSA 4ACLA 2WPVA 3PDNA 3HVEA 4ILHB 3KABA 1ZBWA 4N3CA 1FVHA 5CHEE 2LAHA 3G2UA 1UJKA 4PS3A 3WIJA 2ZQUA 2ZQSA 3QB2A 4DI3A 3G2WA 3EDTB 2WQHA 2WXKA 3ULQA 1ZBVA 1JUQA 4LUNU 3RRNB 3FTUA 4DIPA 4M3OA 4FULA 3PRAA 5FQ6A 1SZAA 3ZPJA 4UWGA 5GPGA 1JPLA 4Q69A 5A7DB 3WKZA 2Y4UA 4R7LA 4ODKA 4AV7A 2MLYA 4OYSA 1Y8MA 1OWOA 3TGOA 4I2WA 4WNEA 4DWSC 3CHPA 4N2QA 4GPKA 4UQYA 3PA7A 1E6RA 3U66A 2NSZA 2X6FA 4J0UA 4ANVA 3FUFA 3FU6A 4JFKA 1DNPA 4ODPA 2C2LA 4ANXA 1IQRA 4LAYA 3CHSA 2AOSA 3SI5A 4GA1A 3BG1B 4JHJA 3CVQA 2WVIA 3I4GA 4HOUA 4K03A 2YINA 5I98A 3CK7A 1J6YA 2MNTA 4IQCA 1ZU2A 3VLEA 4P8UA 1J4HA 2L0IA 4P8VA 4G1TA 4UI9J 4FN2A 1H0IA 1N52A 4APFA 1J4RA 4U04A 5E76A 2DT0A 4LAXA 5BXJA 5HWCA 4GCOA 2VCDA 3NQPA 5T3RA 4HLEA 2KZTB 2DCPA 2XP6A 4PDXA 4ILGA 2MLXA 5CMYA 3ARZA 4WJXA 2JZVA 2PV1A 4N3AA 3D9PA 2R17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYY A;  3KAF A;  2Y78 A;  4DZ3 A;  4ODO A;  4JL0 A;  4ODL A;  5DIT A;  3ASG A;  4DRJ A;  4O6F A;  4IQ2 A;  3RKV A;  2LSV A;  1TJC A;  1F40 A;  1ELR A;  2OOE A;  5BT1 A;  2J9Q A;  1NZN A;  1FKB A;  4TYO A;  2PPO A;  3MKR A;  1PBK A;  1YAT A;  1QZ2 A;  3QDN A;  2C0L A;  3AS8 A;  2FKE A;  2YHC A;  2M08 A;  4G23 A;  3LPZ A;  1OUV A;  3E4B A;  3ZFW A;  2PQN A;  5ARG A;  2KR7 A;  3KAE A;  4U0Z A;  2LKN A;  3TDB A;  4KBQ A;  2LNI A;  1FKK A;  4HOQ A;  4DRO A;  4AY6 A;  3KCE A;  3O5I A;  4R0X A;  1EQ3 A;  2DG3 A;  4MGV A;  2PQR A;  5D0O D;  2FF4 A;  2XPI A;  2VSN A;  4DRQ A;  4UQX A;  1A17 A;  5CCM A;  3UUX A;  3O5J A;  1D7H A;  2RUC A;  2PPP A;  4XI9 A;  4IPX A;  4HOS A;  2VGY A;  2L2S A;  1KLX A;  4BTA A;  1FKF A;  4TX0 A;  3JXV A;  2M2A A;  3AS5 A;  5FZR A;  5HT1 A;  4GYO A;  5A6C A;  5KJK A;  2PV2 A;  4WUY A;  3GZ2 A;  3S7B A;  2XP4 A;  2AWG A;  3LY8 A;  4I17 A;  1YA0 A;  4ITZ A;  2MLZ A;  3FWV A;  3UF8 A;  4BT9 A;  1JNT A;  1ROT A;  4ODR A;  4ODQ A;  2XP8 A;  5DIZ A;  5AYW D;  5KJM A;  2RUQ A;  3KZ7 A;  1YW5 A;  4CGW A;  4WND A;  4DRI A;  2P58 C;  3CKB A;  4DRH A;  1B6C A;  2R5S A;  3MEK A;  3B7X A;  4B94 A;  2I6H A;  3FP3 A;  5B8I C;  4W9P A;  1IYG A;  1HZ4 A;  1A7X A;  3O5F A;  4TNS A;  4NNR A;  2KCV A;  2XEV A;  2LJ4 A;  1PIN A;  1Q6I A;  3GZ1 A;  5FJY A;  4ODM A;  4DRM A;  5G04 C;  3UI6 A;  2FEZ A;  3KAC A;  2LSU A;  3NTP A;  3UI5 A;  1T11 A;  4I9E A;  4F3V A;  3QKY A;  3PE4 A;  2XGS A;  3JYM A;  4YVO A;  1EYM A;  2RUR A;  3RO3 A;  2XPA A;  3K9I A;  4O2T A;  2KCK A;  2VQ2 A;  1FD9 A;  4W9Q A;  4GA0 A;  5M72 A;  2F4E A;  3GPK A;  1JVW A;  4J8E A;  5HKG A;  1HXI A;  1ZBP A;  2Y4T A;  3KS2 A;  2PV3 A;  4G24 A;  1NMW A;  2BUG A;  4AM9 A;  3IKG A;  2RUD A;  5HW8 A;  5HUA A;  3FAP A;  2ITK A;  5BW8 C;  2OND A;  3OXG A;  3Q5M A;  4UI9 K;  3ASF A;  3NI6 A;  1ZK6 A;  2VYI A;  4EQF A;  3LY9 A;  3O5G A;  3IEG A;  5EKQ D;  2XCB A;  3QOU A;  2NC9 A;  2IF4 A;  2D9F A;  3TG5 A;  5HW7 A;  3RJV A;  1QPL A;  4BT8 A;  3PRD A;  1BKF A;  3OXF A;  3ZGQ A;  4C02 B;  3I6C A;  5HI7 A;  1Q1C A;  1B89 A;  4RG9 A;  4AY5 A;  4I9C A;  2ZR4 A;  4TW6 A;  5KJL A;  3H9R B;  4QIB A;  1FKG A;  2ZR6 A;  4G2P A;  4NRH B;  1KT0 A;  5HTG A;  3CK9 A;  2GW1 A;  2XCC A;  1QQE A;  2FO7 A;  4H7Y A;  3GW4 A;  3BEE A;  4Y6W A;  2LGO A;  2IFU A;  2ZR5 A;  3WXX A;  3RO2 A;  2Q5A A;  2KCL A;  2KGJ A;  3CV0 A;  4G26 A;  2QFC A;  2YQ8 A;  1J4I A;  5JJT A;  3O5E A;  5HWB A;  1XNF A;  3CKC A;  3TAX A;  2XPB A;  3Q49 B;  4KXK B;  3UQ3 A;  1QPF A;  3O5O A;  2VGX B;  4J8D A;  4U07 A;  1ROU A;  2MPH A;  1FJD A;  4DRK A;  3MV3 B;  3WH0 A;  5FZS A;  3NRK A;  2FBN A;  2UZ5 A;  3ZN3 A;  3O5P A;  2XP9 A;  3O5D A;  1FKD A;  4TW8 A;  4LEU A;  1N1A A;  4W9R A;  4ODN A;  3AS4 A;  2PZI A;  1FKT A;  4G2V A;  1IHG A;  3JYJ A;  4GIV A;  4G25 A;  2KE0 A;  1D6O A;  1HH8 A;  3UQA A;  3TCZ A;  3UQI A;  3NF1 A;  3RIB A;  5EX3 A;  1NA0 A;  4TW7 A;  4APO A;  5J6E A;  3O48 A;  3R9A B;  4CDR A;  1FKR A;  4YND A;  3TG4 A;  2XGM A;  2LPV A;  3ASD A;  2C0M A;  3QWV A;  4WNG A;  3Q47 B;  4U0S A;  3CVP A;  5G04 J;  4J4O A;  3S7D A;  4HOR A;  2FI7 A;  1BL4 A;  4JHR A;  2KC7 A;  1ZCN A;  1FKH A;  1PC2 A;  1P5Q A;  1FCH A;  2VSY A;  4BWR A;  1W3B A;  5FTP A;  1WAO 1;  4N39 A;  4JFL A;  2UY1 B;  4I1A A;  1U79 A;  2Q7F A;  2DG9 A;  4J4N A;  3MA5 A;  4GZ6 A;  4U85 A;  3SF4 A;  4GYW A;  3MV2 B;  3RU0 A;  4YVQ C;  4J8F A;  4BTB A;  4JA7 A;  2DG4 A;  4U86 A;  3Q4A B;  1F8A B;  3ASH A;  3OXL A;  4HOT A;  3HYM B;  3QWW A;  2MF9 A;  1HXV A;  1W26 A;  5DIV A;  3KD7 A;  4BF8 A;  3O5R A;  3S7J A;  4DZ2 A;  1FKS A;  5D0Q D;  3KAH A;  4W9O A;  5G05 J;  3ODK A;  4IN3 B;  5LCW J;  3QWP A;  4XIF A;  4QT2 A;  4GCN A;  2KFW A;  1L1P A;  3CVN A;  2UWJ G;  4JFJ A;  2V5F A;  3O5K A;  1WM5 A;  3Q15 A;  4UI9 C;  4JA9 A;  1ELW A;  5JJ6 A;  2WPV A;  2ZQV A;  3RFW A;  3PDN A;  2KI3 A;  2DBA A;  3KAG A;  4LAW A;  1TCO C;  5FT9 A;  4XI0 A;  3GYZ A;  1FKJ A;  3OOB A;  3KAB A;  4N3B A;  4N3C A;  5CHE E;  4DH0 A;  2UY1 A;  1FKI A;  2XP5 A;  3O5L A;  3U3W A;  2ZQU A;  2ZQS A;  4N2S A;  1Y0O A;  2FAP A;  1Q6H A;  3RGC A;  5JJ7 A;  3EDT B;  2WQH A;  4ABN A;  3ULQ A;  4N5C A;  4U0U A;  4DIP A;  2AVP A;  3O5Q A;  3UQB A;  3CEQ A;  1C9H A;  3N71 A;  3LYA A;  5HQ8 A;  3ESK A;  1D7J A;  5D75 A;  1E96 B;  4U84 A;  3ZPJ A;  4UQZ A;  2MHK A;  4GZ3 A;  2XP3 A;  5GPG A;  2E2E A;  2XGO A;  4AIF A;  3S7F A;  2HYZ A;  5ARF A;  5A7D B;  3EY6 A;  3CK8 A;  2Y4U A;  2HR2 A;  4ODK A;  2OFN A;  2MLY A;  4ME2 A;  1Y8M A;  3TGO A;  4I2W A;  4WNE A;  4FAP A;  4G50 A;  2VGX A;  2KO7 A;  2L6J A;  4N2Q A;  4GPK A;  4UQY A;  3PA7 A;  2PPN A;  3O5M A;  4GGQ A;  2PL2 A;  5DBK A;  3URZ A;  4J0U A;  4NQ0 A;  1M5Y A;  3CGN A;  1R9H A;  4JFK A;  4DRP A;  4ODP A;  2C2L A;  3MDY B;  4LAY A;  1KT1 A;  2M1I A;  3KAI A;  5CCL A;  3IHZ A;  4GA1 A;  2K8I A;  5HW6 A;  4CGV A;  4WNF A;  3VAW A;  3CVQ A;  3UPV A;  4HOU A;  4RG6 A;  2JLB A;  3LKU A;  1D7I A;  5I98 A;  3CK7 A;  1J6Y A;  2MNT A;  4IQC A;  3IKD A;  4A1S A;  1NA3 A;  3KAD A;  3TC5 A;  4DT4 A;  3LUO A;  1ZU2 A;  5G05 C;  2XP7 A;  4JFM A;  5LCW C;  3FFL A;  2F21 A;  1NMV A;  1J4H A;  2HO1 A;  3VTY A;  2PBC A;  3ZHE B;  4Y6C A;  2VN1 A;  3CGM A;  1FAP A;  5EX0 A;  4QT3 A;  3SZ7 A;  5C1D A;  3PE3 A;  2F2D A;  4G1T A;  5FZQ A;  2RSE A;  2ZQT A;  4LAV A;  4UI9 J;  4FN2 A;  3CVL A;  1NSG A;  3LY7 A;  3ZHE A;  4GZ5 A;  3VTX A;  1J4R A;  3JYS A;  4U04 A;  4GA2 A;  4LAX A;  2KAT A;  3IK8 A;  3LCA A;  4MSP A;  5BXJ A;  5HWC A;  5DIU A;  4GCO A;  5BNW A;  4DRN A;  2VCD A;  3U4T A;  3PRB A;  4I2Z A;  4H7X A;  1Q6U A;  4N19 A;  2XP6 A;  4JFI A;  1JNS A;  4KYO B;  3UI4 A;  1FKL A;  4JYS A;  5KJN A;  2MLX A;  2RQS A;  2N87 A;  2JZV A;  2PV1 A;  4N3A A; 
#chains in the Genus database with same CATH topology
 4KVO A;  3HHM A;  4DI4 A;  1X6L A;  4GPM A;  2Y78 A;  1E6N A;  4DZ3 A;  4KZ0 A;  5DIT A;  4ML4 A;  3UTM A;  2LSV A;  4BET A;  4F1S A;  4OAU C;  2J9Q A;  1NZN A;  2PPO A;  3CHO A;  1LF8 A;  1QZ2 A;  4L2Y A;  3AS0 A;  3QDN A;  3AS8 A;  1IX5 A;  1MZC A;  2M08 A;  4O1O A;  1D2K A;  3NB2 A;  2GRN B;  2PI6 A;  1OUV A;  3UKR G;  3SFZ A;  3CVX A;  3W4R A;  4GTT A;  4U0Z A;  2LNI A;  4LNB A;  4DRO A;  4AY6 A;  1HJX A;  1O1T A;  4EPZ A;  3HIZ A;  2PQR A;  5D0O D;  2H6F A;  1ZB1 A;  1O5M A;  1D7H A;  2BKK B;  2RUC A;  5HRY A;  4HOS A;  3RM8 A;  2I2O A;  1FKF A;  4UDM A;  3ONK A;  2M2A A;  1FFR A;  5AQ9 A;  1EDQ A;  5HT1 A;  2P9K G;  3LY8 A;  2XEH A;  3Q9U C;  3AG3 E;  2MLZ A;  1MHQ A;  1K1B A;  3SGH A;  4BT9 A;  2OVF A;  1ROT A;  4BSX A;  5GQB A;  2WMN A;  2B31 A;  4WND A;  1WDY A;  2ILR A;  4HS2 A;  3FY1 A;  1MX6 A;  3D9H A;  3AG2 E;  3G6M A;  4ZHB A;  5G55 A;  1HKM A;  1D8E A;  3ALG A;  2YNQ A;  4FLH A;  4U63 A;  4MS6 A;  4RVB A;  2KZT A;  5BXO A;  1K9T A;  1PIN A;  1HU3 A;  3GZ1 A;  4WWN A;  4ODM A;  5G04 C;  4KMO A;  3KAC A;  3NTP A;  3UI5 A;  1OCR E;  4LSZ E;  3Q9N C;  3JUI A;  4F3V A;  1TYQ G;  3CST A;  3PE4 A;  2XGS A;  3QKY A;  1GPF A;  4K5C A;  1U2V G;  3K9I A;  4OAV B;  2AWI A;  5AN8 A;  1FD9 A;  4ANW A;  3I4R B;  3ARO A;  2Y4T A;  2PV3 A;  1ITX A;  1NMW A;  2V8S E;  3IKG A;  1FFQ A;  1MYO A;  3LDZ A;  1NWU A;  2OND A;  3OXG A;  4L72 B;  3IEG A;  4HI9 A;  1K8K G;  4E85 A;  3ARQ A;  5HW7 A;  2WXP A;  3OXF A;  5B1B E;  3V2O A;  2HE0 A;  3DSS A;  4AY5 A;  1TN8 A;  3HXD A;  4I9C A;  2ION A;  2ZR4 A;  5KJL A;  2CFZ A;  5D2M C;  4ZS6 A;  4ILI A;  2R05 A;  2PN0 A;  2DSU A;  5HTG A;  1E8W A;  2GW1 A;  3SO8 A;  1QQE A;  5DF0 A;  3GW4 A;  3BEE A;  2DT2 A;  2LGO A;  2IFU A;  2IO3 C;  4WAF A;  3WXX A;  2Q5A A;  1J4I A;  5FQ8 A;  5HWB A;  3TAX A;  2XPB A;  2EIL E;  3UQ3 A;  5LOZ A;  5AAR A;  1QPF A;  2A4Z A;  2VGX B;  3HG0 D;  4DRK A;  2WQ7 A;  3MV3 B;  2H6H A;  4ZPT R;  3PUK A;  4PTM A;  1NL4 A;  2XP9 A;  4JEU A;  1H2T C;  2GRP B;  4LEU A;  4A3T A;  3J5P A;  4W9R A;  1EYH A;  2WXL A;  2ETA A;  4FHJ A;  2DSZ A;  4GIV A;  3RAU A;  5EX3 A;  1NA0 A;  4TW7 A;  4APO A;  3CSF A;  4XAK A;  2GRQ B;  3R9A B;  1FKR A;  3HRA A;  5AAO A;  3ASD A;  3FUE A;  1MX4 A;  3FU0 A;  4A63 B;  4G8K A;  4JZY A;  5CER B;  2PM6 A;  3T8M A;  1BL4 A;  3MX3 A;  4Z2J A;  2WXR A;  3TWU A;  4BES A;  3ABK E;  3ARR A;  3DWL G;  3LVQ E;  2XRZ A;  2VSY A;  4BWR A;  2R03 A;  1W3B A;  5FTP A;  3NOG D;  4XZ4 A;  4JFL A;  4ACK A;  3ESL A;  2YHE A;  1YMP A;  4GZ6 A;  3UXG A;  1MJ0 A;  3SF4 A;  4GYW A;  1Z6T A;  1LD7 A;  3L9T A;  4TUU A;  3EIP A;  2DG4 A;  4AJW A;  1F8A B;  2EIJ E;  4LRZ A;  3Q75 A;  2KM4 A;  3QWW A;  3T9K A;  1HXV A;  1W26 A;  3KD7 A;  2H6I A;  3Q78 A;  5D0Q D;  4ATG A;  1RW2 A;  3KAH A;  2J07 A;  4C9B B;  4W9O A;  3VLF A;  5G05 J;  3B7U X;  5ENP D;  4KZC A;  3B7R L;  4QT2 A;  2WXJ A;  1V55 E;  3DSW A;  4DX6 D;  1O1R A;  4IT6 A;  1TNU A;  1V54 E;  3Q15 A;  1ELW A;  3G2T A;  2ZQV A;  1N0Q A;  2WMO A;  3BQO A;  3D9K A;  2ZXW E;  2KI3 A;  1TCO C;  3FEX A;  2F8Y A;  1FKJ A;  4YDY A;  3ZXS A;  4CDM A;  3OA5 A;  4WK9 A;  4DH0 A;  3FEY A;  4HAR A;  1FKI A;  3O5L A;  1NFI E;  2ZGD A;  2AW6 A;  3ZUV B;  1INZ A;  2QYJ A;  3AU4 A;  5KNG A;  4BY6 A;  2WXM A;  4FJZ A;  2GRM A;  4U8V D;  3QOK A;  1GRJ A;  1Q6H A;  4NSB A;  4Q7N A;  5FIO A;  3DPY A;  4HRN A;  4U0U A;  2IQC A;  5ENQ D;  2XEN A;  2AVP A;  5LP0 A;  3UT4 A;  4DUI A;  1H2V C;  4MPK A;  3LYA A;  3CQG B;  1IHB A;  1WAW A;  2DT3 A;  1YCS B;  1D7J A;  1KFW A;  5AQA A;  3FTY A;  4U84 A;  3IV0 A;  2EIK E;  2XGO A;  3D9L A;  3S7F A;  1SA5 A;  3EHQ A;  3B9E A;  2A3A A;  2WQ6 A;  4HFG A;  3EY6 A;  1UR8 A;  2B0O E;  4FAD A;  4QQI A;  1CTN A;  2OFN A;  4UWL A;  1BI8 B;  4N5Q A;  4GTR A;  2VGX A;  1SR0 A;  3MJW A;  2KO7 A;  1OGG A;  2PPN A;  3O5M A;  2E0I A;  2XPZ A;  3URZ A;  1LL6 A;  3DXM G;  4NQ0 A;  3TWS A;  3PNT B;  3CHR A;  1ZU8 A;  3PVL A;  4Q22 A;  2M1I A;  3L16 A;  3EU5 A;  5ENS D;  2MRI A;  5HW6 A;  4O1P A;  5CEC B;  2CG2 A;  3B7S A;  2WXF A;  1D9S A;  3UPV A;  4RG6 A;  4CYM D;  2JLB A;  1D7I A;  4FC8 A;  3KAD A;  5CBN A;  3LUO A;  2XP7 A;  5KCM A;  5LCW C;  5HS0 A;  4RLY A;  2PBC A;  2XZT G;  3HXF A;  1JCH B;  3ASN E;  5ENT D;  5E75 A;  4QT3 A;  3P2B A;  3PE3 A;  5FZQ A;  2RSE A;  1D8D A;  4LAV A;  4PUC A;  2L0T B;  1NSG A;  3ML8 A;  2A3C A;  3VTX A;  4HQD A;  3D9J A;  1W1P A;  4LGX A;  3WD4 A;  2WXQ A;  2P9S G;  4MSP A;  4AEZ C;  1IKN D;  4L23 A;  2QYU A;  5FIN A;  3FDH A;  2O92 A;  2YBT A;  4EBA G;  3WL0 A;  4L2L A;  4HRL A;  4HBE A;  2KBX A;  3DBS A;  1FKL A;  2WK2 A;  4GU5 A;  3PRE A;  1S70 B;  3MYV A;  3GTY X;  1DCE A;  3RRM B;  4GYY A;  4JW1 A;  3KAF A;  4JL0 A;  3ASG A;  3RSE G;  3L82 A;  1OWM A;  3RKV A;  1F40 A;  1SZ9 A;  5D66 A;  5BT1 A;  3ZIM A;  3UT7 A;  2JEK A;  3APD A;  3LVR E;  4CRW A;  2YHC A;  3SFY A;  3G2S A;  3ML9 A;  4HBD A;  4G23 A;  3J5Q B;  4S3K A;  3UM2 A;  4AXH A;  1UR9 A;  3KAE A;  2LKN A;  1OWN A;  2VGE A;  3TDB A;  1FKK A;  4HOQ A;  2DT1 A;  3BXW A;  3O5I A;  4R0X A;  5CRU A;  1KPS B;  2WXO A;  1EQ3 A;  2IOL A;  1XRV A;  3UUX A;  3EHN A;  4EZJ A;  1X5B A;  3HXC A;  4DWS B;  2L2S A;  1LG1 A;  1KLX A;  2XPY A;  2IUZ A;  2OLH A;  3ZU7 B;  5FZR A;  4U96 D;  4NIK A;  3CHC A;  5KJK A;  4WUY A;  3GZ2 A;  3S7B A;  2AWG A;  1YA0 A;  4ITZ A;  2EIN E;  3FWV A;  3T5X A;  3WD1 A;  1XGW A;  4EEC A;  3Q7A A;  4Q94 A;  2I1J A;  5KJM A;  3NOC D;  2RUQ A;  1UN9 A;  4DRI A;  1N4R A;  4CCA A;  1E15 A;  4URK A;  2WXN A;  2P2C P;  2R5S A;  1OWQ A;  1FT2 A;  4D10 C;  3KSQ A;  2GRR B;  2P4V A;  3AQU A;  5ANR A;  3FP3 A;  3FTZ A;  1A5E A;  4JPS A;  4W9P A;  3OAW A;  4NNR A;  3RME A;  2KCV A;  1OXJ A;  4MBG A;  1Q6I A;  2AXV A;  3HDX A;  1E8Z A;  3D9M A;  1IXV A;  4DK5 A;  2FEZ A;  4AVX A;  3C5R A;  4URI A;  3G2V A;  4YDE A;  2RUR A;  4Q96 A;  3CVV A;  5JHB A;  2KCK A;  4W9Q A;  3W9G A;  4GTO A;  2DWZ A;  3B8S A;  4MNM A;  2WLZ A;  5M72 A;  1JVW A;  4KQZ A;  5JH8 A;  3KS2 A;  4G24 A;  4AM9 A;  3CIA A;  5HW8 A;  1UOH A;  5BW8 C;  4UI9 K;  3O4Z A;  2VYI A;  4TV3 A;  5EKQ D;  3WD0 A;  2XCB A;  4UWK A;  4JB8 P;  3PRD A;  2QY7 A;  1X81 A;  1EHN A;  1DCQ A;  3I6C A;  3LS8 A;  1HF8 A;  5JMN D;  4TW6 A;  4QIB A;  1E6Z A;  3TWW A;  3CK9 A;  3D9O A;  3UIN C;  4P29 A;  4K0R A;  3CV0 A;  2QFC A;  4F7A A;  5JJT A;  3IHY A;  1XNF A;  3ARY A;  1W9V A;  4U07 A;  4J8D A;  1ROU A;  2MPH A;  1FJD A;  3NRK A;  3UM1 A;  2FBN A;  3L54 A;  5CED B;  4TW8 A;  2RG8 A;  2OVB A;  2BKG A;  3KEA A;  4I1O B;  4XKC A;  5HKP A;  3CHE A;  1FKT A;  4G2V A;  3JYJ A;  2R2L A;  4G25 A;  2KE0 A;  3NF1 A;  2WXG A;  3O48 A;  1N4Q A;  3I5P A;  5AJD A;  1NP7 A;  4A3V A;  4HI8 A;  3Q47 B;  5EN5 D;  2P9L G;  3TWQ A;  4J4O A;  2FI7 A;  2KC7 A;  3KEZ A;  4DX5 D;  1HKJ A;  4Z68 A;  4C0M A;  5BV1 A;  1FCH A;  4BX8 A;  2PM7 A;  3APF A;  1E8Y A;  2ETB A;  4GTV A;  2Q7F A;  1JWF A;  3MA5 A;  3EJN A;  2F37 A;  3MGB A;  4YVQ C;  4J8F A;  4JA7 A;  4HOT A;  3HYM B;  2FUL A;  2Y69 E;  3UX4 A;  4WKH A;  4IRU A;  4DLQ A;  4BF8 A;  3S7J A;  3B9A A;  2Y1L E;  1W1T A;  2R59 A;  5EYP F;  3IHV A;  2P9N G;  3ODK A;  3S2A A;  3PZ2 A;  2X38 A;  4XIF A;  2DPE A;  4GCN A;  2KFW A;  1WY6 A;  3FU3 A;  3AG4 E;  3C98 A;  4L9P A;  3ARP A;  4BX9 A;  3TWX A;  3TL5 A;  4UI9 C;  4JA9 A;  2X6I A;  5JJ6 A;  1ZBK A;  3RFW A;  4B8C B;  4WIW A;  3JQ1 A;  1GUV A;  5CBO A;  2UY1 A;  5ITZ F;  2XP5 A;  3U3W A;  3G6L A;  3CHM A;  4N2S A;  3CZ8 A;  2FAP A;  3SBS A;  1H0G A;  3RGC A;  5AEN A;  5JJ7 A;  4ABN A;  4N5C A;  2IO2 C;  3ZYM A;  1C9H A;  4M7C A;  1E96 B;  2MHK A;  4GZ3 A;  2E2E A;  2HYZ A;  4NUR A;  1WNO A;  4HBO A;  3RM4 A;  3CK8 A;  4K5B A;  2JAB A;  3FUM A;  2HR2 A;  4HRM B;  2CHZ A;  3EIQ C;  4ME2 A;  4JEH A;  4FAP A;  5LFA A;  3PNL B;  4E6H A;  2J49 A;  4BER A;  1HE8 A;  3L13 A;  4GGQ A;  3FH8 A;  3ZXP A;  2PL2 A;  3GZS A;  3BG0 B;  3UI2 A;  4FU3 A;  1M5Y A;  4DRP A;  3ARW A;  4L1B A;  1LL4 A;  1KT1 A;  4WWP A;  1N94 A;  1RD6 A;  5CCL A;  4JD2 G;  3DEP A;  1LG2 A;  2K8I A;  1S64 A;  4CGV A;  4Z2L A;  4CT4 A;  1HJW A;  2B6C A;  5BV0 A;  2MYO A;  4CDN A;  5ENN A;  4I1M A;  3LJ3 A;  3I3N A;  3LKU A;  1JWG A;  5ANL A;  3WD2 A;  4A1S A;  4KR0 B;  3TC5 A;  4DWS D;  3CVW A;  1H6P A;  1Y6I A;  4JFM A;  4FLB A;  3FFL A;  4MAV A;  4ZPW R;  3VTY A;  4CEM A;  2A3E A;  3CGM A;  2L9B A;  3SZ7 A;  5C1D A;  1OCZ E;  2YBU A;  2F2D A;  3ISM C;  2ZQT A;  3UM3 A;  3CVL A;  2M63 A;  3ZHE A;  4GZ5 A;  2NXP A;  1RZ4 A;  4GA2 A;  1SYT A;  2KAT A;  3IK8 A;  1HG2 A;  1LQ0 A;  5DIU A;  2FDM A;  3VLD A;  1OCO E;  4ATZ D;  3U4T A;  3CVY A;  3SBT B;  4N19 A;  1N4P A;  4EZK A;  4JFI A;  1JNS A;  1SQM A;  4KYO B;  3UI4 A;  1YYH A;  3WL1 A;  3B7T A;  4JVS A;  2G8Z A;  2BTD A;  4FA6 A;  2ZIS A;  3FXY A;  4L3N A;  2N87 A;  4DLO A;  3EHR A;  4U8Y D;  4ODO A;  3ALF A;  4QZV B;  4YDO A;  3HVE B;  3ART A;  5KBA A;  4IQ2 A;  3UT8 A;  1TJC A;  1ELR A;  1BI7 B;  3PH0 C;  3MKR A;  2FKE A;  4W5U A;  1JCQ A;  3LPZ A;  2WXH A;  5T8I A;  1KZO A;  3HXE A;  3E4B A;  3ZFW A;  3U9W A;  3DST A;  1E9L A;  4KBQ A;  1OY3 D;  4Z2K A;  3KCE A;  5AJL A;  2DZO A;  2DG3 A;  2FF4 A;  2XPI A;  2VSN A;  1E6P A;  4UQX A;  1A17 A;  5KNH D;  5CCM A;  2A5E A;  4XI9 A;  1EDU A;  2CG3 A;  3CHD A;  2VGY A;  1HJV A;  4TX0 A;  1BU9 A;  3JXV A;  4R5E A;  2I9C A;  2BF0 X;  4GYO A;  2IU1 A;  3ARV A;  5A6C A;  4DJA A;  1EIB A;  1BLX B;  2IOS A;  4GAA A;  3ZYL A;  4FP7 A;  1U3C A;  3UF8 A;  4DPR A;  2XEE A;  1JNT A;  3ZVV A;  4X8Q A;  4ODQ A;  3ZNG A;  2XP8 A;  3FH7 A;  3KZ7 A;  4JHK A;  3U64 A;  4CGW A;  1K3Z D;  3MCX A;  1ZB5 A;  3X2Q E;  5CRV A;  2AXU A;  2XRY A;  4DRH A;  5FQ4 A;  3FUL A;  4DX2 A;  1O1S A;  2VTB A;  3RK6 A;  4IYP A;  4GTP A;  1JCR A;  2P9I G;  4A55 A;  1WG0 A;  1NWS A;  3TJP A;  1HZ4 A;  1Z3X A;  2X6J A;  2GGF A;  1A7X A;  3O5F A;  5FWQ A;  2RD0 A;  2XEV A;  3LJN A;  1JND A;  5FJY A;  3SFX A;  4DRM A;  2HM8 A;  2B5U B;  4B93 B;  5EID A;  3JYM A;  4YVO A;  2QF8 A;  3RO3 A;  2XPA A;  1TNY A;  5J08 A;  2VQ2 A;  4NZC A;  1IQU A;  2ESC A;  4FJY A;  4GTS A;  2ETN A;  1HFA A;  2F4E A;  3GPK A;  5HKG A;  2OEV A;  1ZBP A;  1QNF A;  1EPU A;  2BUG A;  4RQI A;  2NYJ A;  5IY5 E;  4TXQ A;  2RUD A;  1OWL A;  3EIJ A;  1TJF A;  3FAP A;  2ITK A;  3Q5M A;  1ZK6 A;  4JC8 A;  4EQF A;  2G41 A;  3LY9 A;  3BUA A;  3QOU A;  2NC9 A;  2IF4 A;  3JCK C;  2X6H A;  3RJV A;  4BT8 A;  4PS8 A;  5HI7 A;  1Q1C A;  2LAI A;  3PEV B;  4RG9 A;  3QC1 A;  4G8L A;  3H9R B;  3C3O A;  4IT4 A;  4NRH B;  1KT0 A;  1VDY A;  2XCC A;  4F6R D;  2Y3A A;  4H7Y A;  4I6G A;  3CGH A;  3RO2 A;  4I6E A;  2KCL A;  2KGJ A;  3FTS A;  2WB2 A;  1WB0 A;  1O6I A;  3O5E A;  1ZL1 A;  1MX2 A;  3E33 A;  1U3D A;  5DO2 A;  2EUL A;  4ZPV R;  4PH4 B;  2R02 A;  2UZ5 A;  3L6A A;  3O5P A;  4MNL A;  4GML A;  3CLJ A;  3LEW A;  1N1A A;  2X6K A;  4ODN A;  2LXM A;  4HNA D;  1E90 A;  2PZI A;  1N9A A;  4ZFH A;  2VTB B;  1PY1 A;  3R7R A;  1D6O A;  1HH8 A;  5G2N A;  4ANU A;  3UQI A;  3RIB A;  3WQV A;  2J08 A;  3CQC B;  1QBQ A;  3JXJ A;  3FTW A;  4YND A;  3TG4 A;  2LPV A;  1LTX A;  2C0M A;  2A3B A;  4WNG A;  3ZRH A;  2EQX A;  3QAR A;  3JXI A;  3CVP A;  3P1U A;  2P9P G;  5G04 J;  4B89 A;  4K5A B;  1ZCN A;  1FKH A;  1PC2 A;  3E37 A;  2XS1 A;  4MNJ A;  2UY1 B;  1U79 A;  3PR9 A;  4J4N A;  4LNG A;  4U85 A;  3L22 A;  1OCC E;  3RU0 A;  4BTB A;  3Q4A B;  3ASH A;  1EF1 C;  1X6N A;  4HXI A;  1PAQ A;  5HBF A;  3FUD A;  2MF9 A;  3O5R A;  1W1V A;  4LCT A;  3E32 A;  1NWR A;  3D3M A;  4IN3 B;  5EIB E;  4U7E B;  3Q73 A;  1TEZ A;  3PZD A;  3D9N A;  4I43 A;  3UM0 A;  4JXT A;  5BPP A;  3NZU A;  4L7T A;  2V5F A;  4JFJ A;  3O5K A;  1WM5 A;  3IBE A;  1HKI A;  2VJ8 A;  3C3Q A;  2GRO B;  3CVU A;  2DBA A;  3KAG A;  4LAW A;  5FT9 A;  4XI0 A;  3GYZ A;  3PZ1 A;  2F23 A;  3OOB A;  4N3B A;  3L08 A;  3ZYQ A;  1JNE A;  4HLL A;  4MTV A;  1Y0O A;  1NWT A;  3AU5 A;  1S0P A;  3DSU A;  3FY4 A;  4GZC A;  1LL7 A;  3O5Q A;  3UQB A;  3CEQ A;  3FUK A;  3N71 A;  3SNX A;  3FUN A;  5HQ8 A;  3ESK A;  1UJJ A;  5D75 A;  1SW6 A;  4V3I A;  4UQZ A;  2XP3 A;  3FUI A;  3C3R A;  2IJG X;  4AIF A;  3PZ4 A;  1Z5S C;  3FTX A;  1N54 A;  5ARF A;  2RFA A;  2Y0B G;  2IY0 C;  3B9D A;  3FUJ A;  1E8X A;  2GRL A;  3AS1 A;  4G50 A;  4J7W A;  2XHE A;  2L6J A;  3PZ3 A;  5DBK A;  3QNK A;  4MKT A;  3PUJ A;  1R9H A;  3CGN A;  2F8X K;  3C72 A;  3JQ0 A;  3BMB A;  3MDY B;  4Z2G A;  3KAI A;  3IHZ A;  3T8K A;  2V5Q C;  4WNF A;  3VAW A;  4C0E A;  1BPO A;  1VF8 A;  3HXB A;  4FHK A;  3ABL E;  4DWS A;  2P9U G;  3IKD A;  4TXR A;  1NA3 A;  4DT4 A;  3QAQ A;  5G05 C;  4QFV A;  1N0R A;  1N95 A;  1OT8 A;  2F21 A;  1NMV A;  2DVW A;  2V4H C;  2HO1 A;  3ULE G;  3ZHE B;  4Y6C A;  1HS6 A;  4J8S A;  2VN1 A;  1FAP A;  4XX5 A;  3L17 A;  5EX0 A;  2AJA A;  1XHG A;  3QK0 A;  1UW4 B;  3AAA C;  4B8A A;  1TNZ A;  2WM0 A;  3WD3 A;  1E44 A;  3LY7 A;  4AP2 A;  4EHM A;  3JYS A;  4MLP A;  3LXU X;  1W1Y A;  3LCA A;  4CT0 A;  2AXZ A;  2A5U A;  5BNW A;  4DRN A;  5DEZ A;  3PRB A;  4I2Z A;  4H7X A;  4AOF A;  2RFM A;  1Q6U A;  1E7V A;  3TWV A;  2LUH A;  5ENR D;  4JYS A;  5GPR A;  5KJN A;  2H6G A;  3SHF A;  2RQS A;  3SQV A;  5AQB A;  4BFR A;  3Q7F A;  3B13 A;  1AP7 A;  4EBA A;  3PS6 A;  1SVX A;  4ODL A;  1G3N B;  2DYS E;  2ZIR A;  4DRJ A;  1GOI A;  4O6F A;  2IEJ A;  2WM9 A;  3PEU B;  2CHW A;  2OOE A;  4I6J A;  3AS3 A;  4UWF A;  1FKB A;  4TYO A;  1PBK A;  1YAT A;  3R9M A;  3RRU A;  2C0L A;  3WG7 E;  3WQW A;  5KWD A;  4Z2I A;  1TN6 A;  2EIM E;  5LX8 A;  4XKB A;  3ULY A;  5C2Y A;  5B3S E;  1TFV A;  4NAC A;  2DIW A;  3IKO B;  2PQN A;  1LJY A;  3CHF A;  5ARG A;  2KR7 A;  4HVB A;  2DZN A;  1GW6 A;  5AQ7 A;  2RKK A;  4MGV A;  4DRQ A;  3O5J A;  4YDW A;  3KSL A;  2XQ0 A;  4F53 A;  2PPP A;  4WWO A;  4IPX A;  4G11 A;  2X3M A;  4BTA A;  3AS5 A;  4HB5 A;  3EHM A;  1W9P A;  2ZU6 B;  2PV2 A;  2CHX A;  2XP4 A;  3FH5 A;  3CHQ A;  4I17 A;  3DPD A;  2MOW A;  4J6I A;  1OGB A;  1H0A A;  4ODR A;  1UN8 A;  2V0P A;  4XE0 A;  5DIZ A;  5AYW D;  5JA4 D;  1YW5 A;  3DXK G;  2P58 C;  3W9F A;  5CMW A;  2VSO E;  3CKB A;  3FUH A;  3UIO C;  2XZD G;  5EYL A;  1B6C A;  1Z3Y A;  4GTM A;  3MEK A;  3B7X A;  4B94 A;  1N11 A;  2BED A;  4MRU A;  3FU5 A;  1UG3 A;  2I6H A;  1S63 A;  4MNK A;  1H6K A;  5B8I C;  1IYG A;  1NH6 A;  1HX8 A;  3QJZ A;  4DRX E;  5FQ7 A;  5JHA A;  4TNS A;  3SD5 A;  2LJ4 A;  4DX7 D;  2DSW A;  3ZKJ A;  3UI6 A;  3V2X A;  2CFU A;  3NAW A;  2LSU A;  1BD8 A;  1T11 A;  3D9I A;  1HO8 A;  4I9E A;  5J90 A;  1HKK A;  1OWP A;  3V31 A;  2V4L A;  1EYM A;  4LG6 A;  4O2T A;  3FHE A;  2KXP C;  3AS2 A;  4GA0 A;  4J8E A;  1HXI A;  3B7B A;  5B1A E;  3ZEF A;  1W9U A;  3UIP C;  2J4B A;  3AG1 E;  5BUZ A;  5HUA A;  1FVF A;  4GZD A;  3ASF A;  3NI6 A;  3O5G A;  4UWH A;  2D9F A;  3TG5 A;  1QPL A;  3MKQ B;  1BKF A;  3ZGQ A;  4C02 B;  2OCC E;  3TWR A;  4GMR A;  3ZYK A;  5EDS A;  1B89 A;  3RM9 A;  4GMJ A;  4P8W A;  5AIJ A;  4WKA A;  4TUM A;  1FKG A;  1L5J A;  2ZR6 A;  3TWT A;  4G2P A;  4F1P A;  3DSX A;  1KZP A;  2I1K A;  2FO7 A;  3ENE A;  2VSX E;  2J4D A;  4Y6W A;  2ZR5 A;  4LER A;  4RSY A;  3R7Q A;  4G26 A;  1SA4 A;  2YQ8 A;  4PS7 A;  3CKC A;  3Q49 B;  4KXK B;  3AJI A;  3CH9 A;  3ARU A;  4OVU A;  3O5O A;  4WKF A;  2J09 A;  3WH0 A;  3CR3 A;  5FZS A;  3ZN3 A;  1HG5 A;  4TRQ A;  3O5D A;  1FKD A;  3FTV A;  4A1G A;  2FO1 E;  3AS4 A;  3MKQ A;  2DSV A;  2QZA A;  3TXN A;  1IHG A;  1NI1 A;  2LXL A;  3EUV A;  3TXM A;  3UQA A;  3TCZ A;  5T4Y A;  5J6E A;  4CDR A;  4EZL A;  2WLY A;  1E7U A;  2XGM A;  4B0Z A;  3DRA A;  3QWV A;  1MQS A;  3Q79 A;  4IUL A;  4KT6 B;  4U0S A;  1H6O A;  3ZW3 A;  3S7D A;  4HOR A;  4JHR A;  1TNO A;  3GU0 A;  1LD8 A;  1P5Q A;  1ZBC A;  1H19 A;  1WAO 1;  4N39 A;  4I1A A;  3UMV A;  4P8X A;  2ETC A;  2F0Y A;  2DG9 A;  1DVP A;  3MV2 B;  4S3J A;  3NZS A;  4U86 A;  2O9O A;  3MZL B;  4KVM A;  1ELK A;  4GB9 A;  3OXL A;  3UKU G;  2DYR E;  2OV8 A;  3ONL A;  5DIV A;  4DZ2 A;  2WXI A;  3OTN A;  1FKS A;  4LNU D;  5A23 A;  2ZGG A;  3DEO A;  3APC A;  4Z2H A;  3PRZ A;  5LCW J;  1TN7 A;  2LO6 A;  3QWP A;  4U8H A;  3T5V A;  1H2U A;  1L1P A;  3ARX A;  3CVN A;  4OVV A;  5H7P A;  4AY1 A;  2UWJ G;  1FPP A;  3SY2 A;  4BSZ B;  3ARS A;  3F6Q A;  4ACL A;  2WPV A;  1DC2 A;  3PDN A;  3HVE A;  4ILH B;  3KAB A;  1ZBW A;  1K1A A;  4N3C A;  1FVH A;  4J8Y A;  2LAH A;  3G2U A;  5CHE E;  1UJK A;  4PS3 A;  1AWC B;  3WIJ A;  2ZQU A;  3EU9 A;  2ZQS A;  3QB2 A;  4DI3 A;  3G2W A;  2OEW A;  3V79 K;  3EDT B;  2WQH A;  2WXK A;  3ULQ A;  1ZBV A;  1JUQ A;  4LUN U;  3RRN B;  4GTQ A;  3FTU A;  4DIP A;  4M3O A;  4FUL A;  3PRA A;  5FQ6 A;  1TR4 A;  4XEI G;  5EIL A;  1QYM A;  1SZA A;  3ZPJ A;  4UWG A;  5GPG A;  1JPL A;  4Q69 A;  2QC9 A;  4UUC A;  5A7D B;  1JCS A;  3WKZ A;  2Y4U A;  4R7L A;  4ODK A;  4AV7 A;  5ENO D;  2MLY A;  4OYS A;  1Y8M A;  1OWO A;  3TGO A;  4I2W A;  4WNE A;  4DWS C;  3CHP A;  4N2Q A;  4GPK A;  4UQY A;  3PA7 A;  1E6R A;  3U66 A;  2NSZ A;  2X6F A;  4J0U A;  4ANV A;  3FUF A;  3B95 A;  3FU6 A;  4JFK A;  1DNP A;  4ODP A;  2C2L A;  4ANX A;  1IQR A;  4LAY A;  3CHS A;  3IXE A;  3ASO E;  1N4S A;  2AOS A;  1Q2Z A;  3SI5 A;  4GA1 A;  3BG1 B;  4JHJ A;  4C48 B;  3CVQ A;  2PNN A;  3JUE A;  2WVI A;  3I4G A;  4HOU A;  4K03 A;  2YIN A;  3DSV A;  5I98 A;  3CK7 A;  1J6Y A;  2MNT A;  4IQC A;  3ABM E;  4CZ2 D;  4DX1 A;  1ZU2 A;  2J8S D;  3BU8 A;  3V30 A;  3VLE A;  4P8U A;  1J4H A;  4U95 D;  2XS8 A;  3NBN B;  5BXU A;  2L0I A;  4P8V A;  4G1T A;  4UI9 J;  4FN2 A;  1H0I A;  4BEP A;  1TNB A;  1N52 A;  4APF A;  1J4R A;  4U04 A;  3E34 A;  5E76 A;  2DT0 A;  4LAX A;  4O60 A;  5BXJ A;  5HWC A;  4GCO A;  2VCD A;  3NQP A;  5T3R A;  4TXP A;  4HLE A;  2KZT B;  2DCP A;  2XP6 A;  4PDX A;  2L6B A;  4ILG A;  5CEA A;  2MLX A;  5CMY A;  3ARZ A;  4WJX A;  3E30 A;  1FT1 A;  2JZV A;  2PV1 A;  4N3A A;  3D9P A;  2R17 C; 
#chains in the Genus database with same CATH homology
 4KVO A;  3HHM A;  4DI4 A;  1X6L A;  2Y78 A;  1E6N A;  4DZ3 A;  4KZ0 A;  5DIT A;  4ML4 A;  2LSV A;  4F1S A;  2J9Q A;  1NZN A;  2PPO A;  3CHO A;  1LF8 A;  1QZ2 A;  4L2Y A;  3AS0 A;  3QDN A;  3AS8 A;  1IX5 A;  2M08 A;  1D2K A;  2PI6 A;  1OUV A;  3SFZ A;  3CVX A;  3W4R A;  4U0Z A;  2LNI A;  4DRO A;  4AY6 A;  1HJX A;  4EPZ A;  3HIZ A;  2PQR A;  5D0O D;  1D7H A;  2RUC A;  4HOS A;  3RM8 A;  2I2O A;  1FKF A;  3ONK A;  2M2A A;  1FFR A;  5HT1 A;  1EDQ A;  3LY8 A;  2MLZ A;  1MHQ A;  3SGH A;  4BT9 A;  2OVF A;  1ROT A;  4BSX A;  5GQB A;  2WMN A;  2B31 A;  4WND A;  2ILR A;  4HS2 A;  3FY1 A;  3G6M A;  5G55 A;  1HKM A;  3ALG A;  2YNQ A;  4FLH A;  4U63 A;  4MS6 A;  4RVB A;  2KZT A;  1K9T A;  1PIN A;  1HU3 A;  3GZ1 A;  4WWN A;  4ODM A;  5G04 C;  4KMO A;  3KAC A;  3NTP A;  3UI5 A;  3JUI A;  4F3V A;  3QKY A;  3CST A;  3PE4 A;  2XGS A;  1GPF A;  3K9I A;  2AWI A;  1FD9 A;  4ANW A;  3I4R B;  3ARO A;  2Y4T A;  2PV3 A;  1ITX A;  1NMW A;  2V8S E;  3IKG A;  1FFQ A;  3LDZ A;  1NWU A;  2OND A;  3OXG A;  4L72 B;  3IEG A;  4E85 A;  3ARQ A;  5HW7 A;  2WXP A;  3OXF A;  4AY5 A;  4I9C A;  2ION A;  2ZR4 A;  5KJL A;  2CFZ A;  4ZS6 A;  4ILI A;  2DSU A;  5HTG A;  1E8W A;  2GW1 A;  1QQE A;  5DF0 A;  3GW4 A;  3BEE A;  2DT2 A;  2LGO A;  2IFU A;  4WAF A;  3WXX A;  2Q5A A;  1J4I A;  5FQ8 A;  5HWB A;  3TAX A;  2XPB A;  3UQ3 A;  5LOZ A;  1QPF A;  2A4Z A;  2VGX B;  4DRK A;  2WQ7 A;  3MV3 B;  4ZPT R;  4PTM A;  3PUK A;  2XP9 A;  4JEU A;  1H2T C;  4LEU A;  4A3T A;  4W9R A;  1EYH A;  2WXL A;  4FHJ A;  2DSZ A;  4GIV A;  5EX3 A;  1NA0 A;  4TW7 A;  4APO A;  3CSF A;  4XAK A;  3R9A B;  1FKR A;  3ASD A;  3FUE A;  3FU0 A;  4JZY A;  2PM6 A;  3T8M A;  1BL4 A;  3MX3 A;  4Z2J A;  2WXR A;  3ARR A;  2XRZ A;  3LVQ E;  2VSY A;  4BWR A;  1W3B A;  5FTP A;  4XZ4 A;  4JFL A;  4ACK A;  3ESL A;  2YHE A;  4GZ6 A;  3SF4 A;  4GYW A;  1Z6T A;  4TUU A;  2DG4 A;  4AJW A;  1F8A B;  4LRZ A;  2KM4 A;  3QWW A;  1HXV A;  1W26 A;  3KD7 A;  5D0Q D;  4ATG A;  3KAH A;  2J07 A;  4C9B B;  4W9O A;  3VLF A;  5G05 J;  3B7U X;  4KZC A;  3B7R L;  4QT2 A;  2WXJ A;  4IT6 A;  3Q15 A;  1ELW A;  3G2T A;  2ZQV A;  2WMO A;  3D9K A;  2KI3 A;  1TCO C;  3FEX A;  1FKJ A;  4WK9 A;  3ZXS A;  4CDM A;  3OA5 A;  4DH0 A;  3FEY A;  4HAR A;  1FKI A;  3O5L A;  2AW6 A;  1INZ A;  3AU4 A;  4BY6 A;  2WXM A;  3QOK A;  4FJZ A;  2GRM A;  1Q6H A;  4NSB A;  4Q7N A;  4U0U A;  2IQC A;  2AVP A;  5LP0 A;  3UT4 A;  1H2V C;  4MPK A;  3LYA A;  3CQG B;  1WAW A;  2DT3 A;  1D7J A;  1KFW A;  3FTY A;  4U84 A;  3IV0 A;  2XGO A;  3D9L A;  3S7F A;  3B9E A;  2A3A A;  2WQ6 A;  4HFG A;  3EY6 A;  1UR8 A;  4FAD A;  1CTN A;  2OFN A;  4UWL A;  2VGX A;  1SR0 A;  3MJW A;  2KO7 A;  1OGG A;  2PPN A;  3O5M A;  2E0I A;  2XPZ A;  3URZ A;  1LL6 A;  4NQ0 A;  3PNT B;  3CHR A;  1ZU8 A;  3PVL A;  4Q22 A;  2M1I A;  3L16 A;  2MRI A;  5HW6 A;  2CG2 A;  3B7S A;  2WXF A;  3UPV A;  4RG6 A;  2JLB A;  1D7I A;  4FC8 A;  3KAD A;  3LUO A;  2XP7 A;  5KCM A;  5LCW C;  2PBC A;  5E75 A;  4QT3 A;  3P2B A;  3PE3 A;  5FZQ A;  2RSE A;  4LAV A;  4PUC A;  2L0T B;  1NSG A;  3ML8 A;  2A3C A;  3VTX A;  3D9J A;  1W1P A;  4LGX A;  3WD4 A;  2WXQ A;  4MSP A;  4AEZ C;  4L23 A;  3FDH A;  2O92 A;  2YBT A;  4EBA G;  3WL0 A;  4L2L A;  4HBE A;  3DBS A;  1FKL A;  2WK2 A;  4GU5 A;  3PRE A;  3MYV A;  3RRM B;  4GYY A;  4JW1 A;  3KAF A;  4JL0 A;  3ASG A;  1OWM A;  3RKV A;  1F40 A;  1SZ9 A;  5BT1 A;  3ZIM A;  3UT7 A;  2JEK A;  3APD A;  3LVR E;  4CRW A;  2YHC A;  3G2S A;  3ML9 A;  4G23 A;  4S3K A;  4AXH A;  1UR9 A;  3KAE A;  2LKN A;  1OWN A;  3TDB A;  1FKK A;  4HOQ A;  2DT1 A;  3BXW A;  3O5I A;  4R0X A;  2WXO A;  1EQ3 A;  2IOL A;  1XRV A;  3UUX A;  3EHN A;  4EZJ A;  1X5B A;  4DWS B;  2L2S A;  1LG1 A;  1KLX A;  2XPY A;  2IUZ A;  2OLH A;  5FZR A;  3CHC A;  5KJK A;  4WUY A;  3GZ2 A;  3S7B A;  2AWG A;  1YA0 A;  4ITZ A;  3FWV A;  3T5X A;  3WD1 A;  1XGW A;  4EEC A;  4Q94 A;  2I1J A;  5KJM A;  2RUQ A;  1UN9 A;  4DRI A;  4CCA A;  1E15 A;  4URK A;  2WXN A;  2R5S A;  1OWQ A;  4D10 C;  3AQU A;  5ANR A;  3FP3 A;  3FTZ A;  4JPS A;  4W9P A;  3OAW A;  4NNR A;  3RME A;  2KCV A;  1Q6I A;  2AXV A;  3HDX A;  1E8Z A;  3D9M A;  4DK5 A;  2FEZ A;  4AVX A;  4URI A;  3G2V A;  2RUR A;  4Q96 A;  3CVV A;  5JHB A;  2KCK A;  4W9Q A;  3B8S A;  4MNM A;  2WLZ A;  5M72 A;  1JVW A;  4KQZ A;  5JH8 A;  3KS2 A;  4G24 A;  4AM9 A;  3CIA A;  5HW8 A;  5BW8 C;  4UI9 K;  3O4Z A;  2VYI A;  4TV3 A;  5EKQ D;  3WD0 A;  2XCB A;  4UWK A;  3PRD A;  2QY7 A;  1EHN A;  3I6C A;  3LS8 A;  1HF8 A;  4TW6 A;  4QIB A;  1E6Z A;  3CK9 A;  3D9O A;  4P29 A;  4K0R A;  3CV0 A;  2QFC A;  4F7A A;  5JJT A;  3IHY A;  1XNF A;  3ARY A;  1W9V A;  4U07 A;  4J8D A;  1ROU A;  2MPH A;  1FJD A;  3NRK A;  2FBN A;  3L54 A;  4TW8 A;  2RG8 A;  2OVB A;  4I1O B;  4XKC A;  3CHE A;  1FKT A;  4G2V A;  3JYJ A;  4G25 A;  2KE0 A;  3NF1 A;  2WXG A;  3O48 A;  3I5P A;  5AJD A;  1NP7 A;  4A3V A;  3Q47 B;  4J4O A;  2FI7 A;  2KC7 A;  3KEZ A;  1HKJ A;  4C0M A;  5BV1 A;  1FCH A;  4BX8 A;  2PM7 A;  3APF A;  1E8Y A;  2Q7F A;  1JWF A;  3MA5 A;  3EJN A;  3MGB A;  4YVQ C;  4J8F A;  4JA7 A;  4HOT A;  3HYM B;  2FUL A;  3UX4 A;  4WKH A;  4IRU A;  4DLQ A;  4BF8 A;  3S7J A;  3B9A A;  1W1T A;  2R59 A;  3IHV A;  3ODK A;  3S2A A;  2X38 A;  4XIF A;  2DPE A;  4GCN A;  2KFW A;  1WY6 A;  3FU3 A;  3C98 A;  3ARP A;  4BX9 A;  3TL5 A;  4UI9 C;  4JA9 A;  2X6I A;  5JJ6 A;  1ZBK A;  3RFW A;  4B8C B;  4WIW A;  3JQ1 A;  1GUV A;  2UY1 A;  2XP5 A;  3U3W A;  3G6L A;  3CHM A;  4N2S A;  3CZ8 A;  2FAP A;  3SBS A;  1H0G A;  3RGC A;  5AEN A;  5JJ7 A;  4ABN A;  4N5C A;  3ZYM A;  1C9H A;  1E96 B;  2MHK A;  4GZ3 A;  2E2E A;  2HYZ A;  4NUR A;  1WNO A;  4HBO A;  3RM4 A;  3CK8 A;  3FUM A;  2HR2 A;  2CHZ A;  3EIQ C;  4ME2 A;  4JEH A;  4FAP A;  5LFA A;  3PNL B;  4E6H A;  2J49 A;  1HE8 A;  3L13 A;  4GGQ A;  3FH8 A;  2PL2 A;  3GZS A;  3BG0 B;  4FU3 A;  1M5Y A;  4DRP A;  3ARW A;  4L1B A;  1LL4 A;  1KT1 A;  4WWP A;  1RD6 A;  5CCL A;  1LG2 A;  2K8I A;  4CGV A;  4Z2L A;  4CT4 A;  1HJW A;  5BV0 A;  4CDN A;  5ENN A;  4I1M A;  3LJ3 A;  3I3N A;  3LKU A;  1JWG A;  5ANL A;  3WD2 A;  4A1S A;  4KR0 B;  3TC5 A;  4DWS D;  3CVW A;  1Y6I A;  4JFM A;  4FLB A;  3FFL A;  4MAV A;  4ZPW R;  3VTY A;  4CEM A;  2A3E A;  3CGM A;  2L9B A;  3SZ7 A;  5C1D A;  2YBU A;  2F2D A;  2ZQT A;  3CVL A;  2M63 A;  3ZHE A;  4GZ5 A;  2NXP A;  4GA2 A;  1SYT A;  2KAT A;  3IK8 A;  1HG2 A;  1LQ0 A;  5DIU A;  2FDM A;  3VLD A;  3U4T A;  3CVY A;  3SBT B;  4N19 A;  4EZK A;  4JFI A;  1JNS A;  1SQM A;  4KYO B;  3UI4 A;  3WL1 A;  3B7T A;  4JVS A;  2G8Z A;  2BTD A;  4FA6 A;  3FXY A;  4L3N A;  2N87 A;  4DLO A;  4ODO A;  3ALF A;  4QZV B;  3HVE B;  3ART A;  4IQ2 A;  3UT8 A;  1TJC A;  1ELR A;  3PH0 C;  3MKR A;  2FKE A;  4W5U A;  3LPZ A;  2WXH A;  5T8I A;  3E4B A;  3ZFW A;  3U9W A;  1E9L A;  4KBQ A;  4Z2K A;  3KCE A;  5AJL A;  2DG3 A;  2FF4 A;  2XPI A;  2VSN A;  1E6P A;  4UQX A;  1A17 A;  5CCM A;  4XI9 A;  1EDU A;  2CG3 A;  3CHD A;  2VGY A;  1HJV A;  4TX0 A;  3JXV A;  4R5E A;  2I9C A;  2BF0 X;  4GYO A;  2IU1 A;  3ARV A;  5A6C A;  4DJA A;  1EIB A;  2IOS A;  4GAA A;  3ZYL A;  4FP7 A;  1U3C A;  3UF8 A;  4DPR A;  1JNT A;  3ZVV A;  4ODQ A;  2XP8 A;  3FH7 A;  3KZ7 A;  4JHK A;  3U64 A;  4CGW A;  3MCX A;  1ZB5 A;  2AXU A;  2XRY A;  4DRH A;  5FQ4 A;  3FUL A;  2VTB A;  3RK6 A;  4IYP A;  4A55 A;  1NWS A;  3TJP A;  1HZ4 A;  1Z3X A;  2X6J A;  2GGF A;  1A7X A;  3O5F A;  5FWQ A;  2RD0 A;  2XEV A;  1JND A;  5FJY A;  4DRM A;  2HM8 A;  3JYM A;  4YVO A;  2QF8 A;  3RO3 A;  2XPA A;  5J08 A;  2VQ2 A;  4NZC A;  1IQU A;  2ESC A;  4FJY A;  1HFA A;  2F4E A;  3GPK A;  5HKG A;  1ZBP A;  1QNF A;  1EPU A;  2BUG A;  2RUD A;  1OWL A;  3EIJ A;  1TJF A;  3FAP A;  2ITK A;  3Q5M A;  1ZK6 A;  4JC8 A;  4EQF A;  2G41 A;  3LY9 A;  3QOU A;  2NC9 A;  2IF4 A;  3JCK C;  2X6H A;  3RJV A;  4BT8 A;  4PS8 A;  5HI7 A;  1Q1C A;  2LAI A;  3PEV B;  4RG9 A;  3QC1 A;  3H9R B;  4IT4 A;  4NRH B;  1KT0 A;  1VDY A;  2XCC A;  2Y3A A;  4H7Y A;  4I6G A;  3CGH A;  3RO2 A;  4I6E A;  2KCL A;  2KGJ A;  3FTS A;  2WB2 A;  1WB0 A;  1O6I A;  3O5E A;  1ZL1 A;  1U3D A;  5DO2 A;  4ZPV R;  4PH4 B;  2UZ5 A;  3L6A A;  3O5P A;  4MNL A;  4GML A;  3CLJ A;  3LEW A;  1N1A A;  2X6K A;  4ODN A;  1E90 A;  2PZI A;  2VTB B;  1PY1 A;  3R7R A;  1D6O A;  1HH8 A;  5G2N A;  4ANU A;  3UQI A;  3RIB A;  3WQV A;  2J08 A;  3CQC B;  3FTW A;  4YND A;  3TG4 A;  2LPV A;  2C0M A;  2A3B A;  4WNG A;  3ZRH A;  2EQX A;  3QAR A;  3CVP A;  3P1U A;  5G04 J;  4B89 A;  1ZCN A;  1FKH A;  1PC2 A;  4MNJ A;  2UY1 B;  1U79 A;  3PR9 A;  4J4N A;  4U85 A;  3L22 A;  3RU0 A;  4BTB A;  3Q4A B;  3ASH A;  1EF1 C;  1X6N A;  4HXI A;  1PAQ A;  5HBF A;  3FUD A;  2MF9 A;  3O5R A;  1W1V A;  4LCT A;  1NWR A;  3D3M A;  4IN3 B;  1TEZ A;  3PZD A;  3D9N A;  4I43 A;  4JXT A;  5BPP A;  3NZU A;  4L7T A;  2V5F A;  4JFJ A;  3O5K A;  1WM5 A;  3IBE A;  1HKI A;  2VJ8 A;  3CVU A;  2DBA A;  3KAG A;  4LAW A;  5FT9 A;  4XI0 A;  3GYZ A;  3OOB A;  4N3B A;  3L08 A;  3ZYQ A;  1JNE A;  4MTV A;  1Y0O A;  1NWT A;  3AU5 A;  1S0P A;  3FY4 A;  4GZC A;  1LL7 A;  3O5Q A;  3UQB A;  3CEQ A;  3FUK A;  3N71 A;  3SNX A;  3FUN A;  5HQ8 A;  3ESK A;  1UJJ A;  5D75 A;  4V3I A;  4UQZ A;  2XP3 A;  3FUI A;  2IJG X;  4AIF A;  3FTX A;  1N54 A;  5ARF A;  3B9D A;  3FUJ A;  3AS1 A;  1E8X A;  2GRL A;  4G50 A;  2XHE A;  2L6J A;  5DBK A;  3QNK A;  4MKT A;  3PUJ A;  1R9H A;  3CGN A;  3JQ0 A;  3MDY B;  4Z2G A;  3KAI A;  3IHZ A;  4WNF A;  3VAW A;  4C0E A;  1BPO A;  1VF8 A;  4FHK A;  4DWS A;  3IKD A;  1NA3 A;  4DT4 A;  3QAQ A;  5G05 C;  4QFV A;  2F21 A;  1NMV A;  2HO1 A;  3ZHE B;  4Y6C A;  1HS6 A;  4J8S A;  2VN1 A;  1FAP A;  4XX5 A;  3L17 A;  5EX0 A;  1XHG A;  3QK0 A;  1UW4 B;  4B8A A;  2WM0 A;  3WD3 A;  3LY7 A;  4AP2 A;  3JYS A;  4MLP A;  3LXU X;  1W1Y A;  3LCA A;  4CT0 A;  2AXZ A;  2A5U A;  5BNW A;  4DRN A;  5DEZ A;  3PRB A;  4I2Z A;  4H7X A;  4AOF A;  1Q6U A;  1E7V A;  4JYS A;  5GPR A;  5KJN A;  3SHF A;  2RQS A;  4BFR A;  3B13 A;  4EBA A;  3PS6 A;  4ODL A;  4DRJ A;  1GOI A;  4O6F A;  2WM9 A;  3PEU B;  2CHW A;  2OOE A;  4I6J A;  3AS3 A;  4UWF A;  1FKB A;  4TYO A;  1PBK A;  1YAT A;  3RRU A;  2C0L A;  3WQW A;  4Z2I A;  5LX8 A;  4XKB A;  5C2Y A;  1TFV A;  4NAC A;  2DIW A;  3IKO B;  2PQN A;  1LJY A;  3CHF A;  5ARG A;  2KR7 A;  4HVB A;  1GW6 A;  4MGV A;  4DRQ A;  3O5J A;  2XQ0 A;  4F53 A;  2PPP A;  4WWO A;  4IPX A;  4G11 A;  2X3M A;  4BTA A;  3AS5 A;  3EHM A;  1W9P A;  2ZU6 B;  2PV2 A;  2CHX A;  2XP4 A;  3FH5 A;  3CHQ A;  4I17 A;  3DPD A;  2MOW A;  4J6I A;  1OGB A;  1H0A A;  4ODR A;  1UN8 A;  2V0P A;  4XE0 A;  5DIZ A;  5AYW D;  1YW5 A;  2P58 C;  5CMW A;  2VSO E;  3CKB A;  3FUH A;  1B6C A;  1Z3Y A;  3MEK A;  3B7X A;  4B94 A;  4MRU A;  3FU5 A;  1UG3 A;  2I6H A;  4MNK A;  1H6K A;  5B8I C;  1IYG A;  1NH6 A;  1HX8 A;  3QJZ A;  5FQ7 A;  5JHA A;  4TNS A;  3SD5 A;  2LJ4 A;  2DSW A;  3UI6 A;  2CFU A;  2LSU A;  1T11 A;  3D9I A;  1HO8 A;  4I9E A;  5J90 A;  1HKK A;  1OWP A;  2V4L A;  1EYM A;  4O2T A;  3FHE A;  3AS2 A;  4GA0 A;  4J8E A;  1HXI A;  3ZEF A;  1W9U A;  2J4B A;  5BUZ A;  5HUA A;  1FVF A;  4GZD A;  3ASF A;  3NI6 A;  3O5G A;  4UWH A;  2D9F A;  3TG5 A;  1QPL A;  3MKQ B;  1BKF A;  3ZGQ A;  4C02 B;  3ZYK A;  5EDS A;  1B89 A;  3RM9 A;  4GMJ A;  4P8W A;  5AIJ A;  4WKA A;  1FKG A;  1L5J A;  2ZR6 A;  4G2P A;  2I1K A;  2FO7 A;  3ENE A;  2VSX E;  2J4D A;  4Y6W A;  2ZR5 A;  4LER A;  4RSY A;  3R7Q A;  4G26 A;  2YQ8 A;  4PS7 A;  3CKC A;  3Q49 B;  4KXK B;  3CH9 A;  3ARU A;  4OVU A;  3O5O A;  4WKF A;  2J09 A;  3WH0 A;  3CR3 A;  5FZS A;  3ZN3 A;  1HG5 A;  4TRQ A;  3O5D A;  1FKD A;  3FTV A;  4A1G A;  3AS4 A;  3MKQ A;  2DSV A;  3TXN A;  1IHG A;  3TXM A;  3UQA A;  3TCZ A;  5T4Y A;  5J6E A;  4CDR A;  4EZL A;  2WLY A;  1E7U A;  2XGM A;  4B0Z A;  3QWV A;  1MQS A;  4IUL A;  4KT6 B;  4U0S A;  3ZW3 A;  3S7D A;  4HOR A;  4JHR A;  1P5Q A;  1ZBC A;  1H19 A;  1WAO 1;  4N39 A;  4I1A A;  3UMV A;  4P8X A;  2DG9 A;  1DVP A;  3MV2 B;  4S3J A;  3NZS A;  4U86 A;  2O9O A;  3MZL B;  4KVM A;  1ELK A;  4GB9 A;  3OXL A;  2OV8 A;  3ONL A;  5DIV A;  4DZ2 A;  2WXI A;  3OTN A;  1FKS A;  5A23 A;  3APC A;  4Z2H A;  3PRZ A;  5LCW J;  2LO6 A;  3QWP A;  4U8H A;  3T5V A;  1H2U A;  1L1P A;  3ARX A;  3CVN A;  4OVV A;  4AY1 A;  2UWJ G;  3ARS A;  4ACL A;  2WPV A;  3PDN A;  3HVE A;  4ILH B;  3KAB A;  1ZBW A;  4N3C A;  1FVH A;  5CHE E;  2LAH A;  3G2U A;  1UJK A;  4PS3 A;  3WIJ A;  2ZQU A;  2ZQS A;  3QB2 A;  4DI3 A;  3G2W A;  3EDT B;  2WQH A;  2WXK A;  3ULQ A;  1ZBV A;  1JUQ A;  4LUN U;  3RRN B;  3FTU A;  4DIP A;  4M3O A;  4FUL A;  3PRA A;  5FQ6 A;  1SZA A;  3ZPJ A;  4UWG A;  5GPG A;  1JPL A;  4Q69 A;  5A7D B;  3WKZ A;  2Y4U A;  4R7L A;  4ODK A;  4AV7 A;  2MLY A;  4OYS A;  1Y8M A;  1OWO A;  3TGO A;  4I2W A;  4WNE A;  4DWS C;  3CHP A;  4N2Q A;  4GPK A;  4UQY A;  3PA7 A;  1E6R A;  3U66 A;  2NSZ A;  2X6F A;  4J0U A;  4ANV A;  3FUF A;  3FU6 A;  4JFK A;  1DNP A;  4ODP A;  2C2L A;  4ANX A;  1IQR A;  4LAY A;  3CHS A;  2AOS A;  3SI5 A;  4GA1 A;  3BG1 B;  4JHJ A;  3CVQ A;  2WVI A;  3I4G A;  4HOU A;  4K03 A;  2YIN A;  5I98 A;  3CK7 A;  1J6Y A;  2MNT A;  4IQC A;  1ZU2 A;  3VLE A;  4P8U A;  1J4H A;  2L0I A;  4P8V A;  4G1T A;  4UI9 J;  4FN2 A;  1H0I A;  1N52 A;  4APF A;  1J4R A;  4U04 A;  5E76 A;  2DT0 A;  4LAX A;  5BXJ A;  5HWC A;  4GCO A;  2VCD A;  3NQP A;  5T3R A;  4HLE A;  2KZT B;  2DCP A;  2XP6 A;  4PDX A;  4ILG A;  2MLX A;  5CMY A;  3ARZ A;  4WJX A;  2JZV A;  2PV1 A;  4N3A A;  3D9P A;  2R17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...