1KT0A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
380
structure length
357
Chain Sequence
VLKIVTPMIGDKVYVHYKGKLFDSPFVFSLGKGQVIKAWDIGVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNERDRRIYANM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 51 KDA FK506-BINDING PROTEIN
publication title Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 110
structure length 357
sequence length 380
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt0A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A02
1NA0A 4U07A 5HTGA 3QWPA 3CGMA 4DT4A 4ABNA 5FZRA 2VGYA 3H9RB 2PL2A 4IPXA 3KCEA 5EKQD 3MV3B 1PBKA 3ULQA 3NF1A 4NNRA 2Q7FA 3PA7A 2WPVA 1R9HA 3RGCA 4N2QA 1NMVA 3KZ7A 2XPBA 4H7YA 2AWGA 5DIZA 3E4BA 2XP5A 5HWBA 3UPVA 3GPKA 2MLYA 2XP3A 4CDRA 4DRNA 1YW5A 4GPKA 4DRHA 1HH8A 2ZQVA 3PRDA 2VCDA 1QZ2A 1ZK6A 2PQRA 2E2EA 2FEZA 4GZ5A 5HUAA 2Y78A 2XP8A 4FAPA 2PV1A 5I98A 2PPNA 1Y8MA 4ITZA 1FKSA 3CK9A 3ASHA 1A17A 2VGXB 5CHEE 2VSYA 4LEUA 4I2ZA 2L6JA 1EYMA 4J0UA 5BXJA 4B94A 5J6EA 3QDNA 3GYZA 4BTBA 1ZCNA 3UQAA 1F8AB 5LCWJ 3TAXA 4U84A 3UF8A 2AVPA 3VTYA 1ELWA 3U4TA 4U04A 1Y0OA 5FZQA 1Q6HA 4GYOA 3PDNA 3HYMB 3NTPA 2LNIA 4KBQA 4G2PA 2PBCA 4IQCA 5JJTA 3KABA 4U85A 3S7DA 3TG4A 3GW4A 3O5RA 3CGNA 1EQ3A 4MSPA 4I1AA 4ODRA 3QKYA 4MGVA 3S7JA 2MHKA 5G05C 5CCMA 3BEEA 1Q1CA 4GZ3A 2DG4A 2L2SA 3AS5A 1B6CA 1NMWA 1ROUA 5JJ6A 4JYSA 4BT9A 3KAIA 5KJNA 3TC5A 4IQ2A 3OOBA 3CVLA 3KAFA 4QIBA 4UQZA 4U0UA 2V5FA 5BT1A 3LY7A 2F4EA 3VTXA 3IKDA 3VAWA 2Y4UA 3KD7A 4C02B 1QPFA 3LUOA 5HQ8A 3NI6A 5EX0A 2RUQA 2KI3A 3UQIA 3UI6A 3ZPJA 4G26A 4CGVA 3OXFA 3TGOA 4U0ZA 3K9IA 1PC2A 3JYJA 5HT1A 2QFCA 3UI4A 1YA0A 3MA5A 1KT1A 3ASFA 2F2DA 1OUVA 4ODKA 4GA1A 3RFWA 5HW6A 5EX3A 4GGQA 5HWCA 3NRKA 2UWJG 2XP9A 4HORA 3KADA 4I17A 3Q49B 2IFUA 4TW6A 2ZR6A 2I6HA 2MNTA 3RO3A 3SZ7A 2M1IA 2MLZA 4ODPA 3RO2A 2LPVA 4J8DA 2Q5AA 4AY5A 2KATA 2XGSA 5JJ7A 1ROTA 3CV0A 1FKIA 4DRKA 3O5OA 2P58C 5DBKA 4JFJA 4W9OA 3UI5A 2MPHA 4YNDA 2K8IA 2FBNA 2KE0A 2KR7A 1W26A 4I2WA 3O5PA 2ONDA 5HW7A 3O5FA 3CK8A 1KLXA 3TDBA 4HOUA 4RG9A 4UI9C 4F3VA 4RG6A 4DRJA 5ARGA 3O5IA 3KS2A 2UY1A 3ZHEA 3N71A 3B7XA 1FCHA 4XI9A 4A1SA 1YATA 2RUDA 5HI7A 2PPPA 4DROA 3RU0A 3UQBA 1ZU2A 5G04J 2XCBA 4LAXA 5DIVA 1FKLA 4GZ6A 3JXVA 4WUYA 4DH0A 4DRPA 1J6YA 5A7DB 1D7JA 2FI7A 1FKHA 2BUGA 1FKFA 1IHGA 2JLBA 2RQSA 4TYOA 1IYGA 2FF4A 4IN3B 1NA3A 2XP4A 3O5EA 4G25A 2VYIA 5GPGA 3LY9A 3FFLA 4HOQA 5C1DA 3O5DA 4JL0A 1TCOC 3RIBA 2RSEA 2JZVA 3I6CA 1KT0A 3PRBA 4FN2A 2ZQTA 2HYZA 4TW7A 4KYOB 4Y6WA 5BW8C 2GW1A 4BF8A 5A6CA 5D0QD 4U0SA 5B8IC 3KAHA 4JFIA 2RURA 3AS4A 1D7IA 4G1TA 3ASDA 3UUXA 2J9QA 4XI0A 3O5GA 4N5CA 5LCWC 1FKTA 2ZQUA 3RKVA 3MEKA 3CEQA 2KCVA 4BTAA 2KGJA 4EQFA 4HOTA 3MKRA 2IF4A 3Q5MA 4YVQC 4DZ3A 2ZR5A 1L1PA 2VGXA 1BKFA 3LKUA 5DITA 5FZSA 3FAPA 4HOSA 1B89A 3CKCA 4UI9K 2XPAA 3OXGA 3LCAA 5FTPA 4DRQA 1J4HA 2LKNA 4UQYA 3R9AB 4O6FA 3LYAA 2VN1A 4G24A 4W9QA 3GZ1A 2RUCA 2KO7A 2R5SA 3PE4A 3O5JA 2UY1B 1P5QA 1JNSA 4N3BA 4LAWA 2XEVA 4Y6CA 4WNDA 3IKGA 4BWRA 2PV3A 3JYSA 2XP6A 4JFLA 3CVQA 3FP3A 4GYYA 3SF4A 5D75A 1FKJA 3ZN3A 2ZQSA 4G2VA 1FD9A 5HKGA 1F40A 2PQNA 1A7XA 3WXXA 5FT9A 3WH0A 2KCLA 5BNWA 3CK7A 4TW8A 3O5MA 2KCKA 3JYMA 3MV2B 4GCNA 4U86A 1FAPA 1WM5A 2ZR4A 2OFNA 3ODKA 4W9PA 4GYWA 3KAEA 2PPOA 1N1AA 3S7BA 1BL4A 4GCOA 4APOA 5M72A 4KXKB 1ZBPA 2KFWA 1J4IA 4ODLA 1QPLA 4LAVA 1ELRA 2FAPA 2YHCA 1HZ4A 2LJ4A 1E96B 3IK8A 4NRHB 1J4RA 4O2TA 5HW8A 3KAGA 4JA9A 1FKDA 1M5YA 1T11A 4JFKA 4QT2A 3S7FA 4W9RA 1U79A 3QWWA 2FO7A 2NC9A 1TJCA 5D0OD 3TG5A 2XGOA 2OOEA 1C9HA 3IHZA 5KJMA 4YVOA 4N3CA 3OXLA 3CVNA 4NQ0A 2ITKA 2LGOA 3EY6A 4ODQA 3TCZA 2XGMA 1JVWA 4AM9A 4DRIA 2M08A 3FWVA 2D9FA 4LAYA 4J4NA 3O48A 2PZIA 3URZA 4AIFA 4J4OA 3AS8A 3CKBA 4TX0A 5KJLA 3PE3A 2VQ2A 2MLXA 4G23A 3LPZA 3RJVA 4N39A 2F21A 4ME2A 4H7XA 5G04C 5G05J 1QQEA 2KC7A 1WAO1 3Q4AB 2XCCA 4CGWA 1FKRA 2XP7A 2FKEA 4AY6A 3Q15A 3O5QA 1XNFA 4N3AA 1HXIA 4JHRA 1Q6IA 1FJDA 4N19A 5CCLA 1NSGA 4BT8A 1D7HA 2LSUA 2C2LA 4UQXA 5KJKA 4ODOA 2MF9A 2XPIA 3UQ3A 3QOUA 3GZ2A 3U3WA 2WQHA 4DIPA 2HR2A 1PINA 2UZ5A 1Q6UA 4DRMA 4JA7A 2YQ8A 2M2AA 4QT3A 3O5KA 3EDTB 4WNEA 4ODMA 2HO1A 4I9CA 1HXVA 2C0MA 1FKGA 4XIFA 4GA0A 3ZFWA 4G50A 2DBAA 3ZHEB 3ESKA 5AYWD 2DG3A 4JFMA 3ZGQA 4N2SA 4R0XA 4TNSA 2N87A 5ARFA 3CVPA 3KACA 4J8FA 3O5LA 2LSVA 1W3BA 1FKBA 4GA2A 3ASGA 2DG9A 4WNFA 1FKKA 5DIUA 5FJYA 4DZ2A 2C0LA 2VSNA 3MDYB 3QWVA 1NZNA 4ODNA 1D6OA 3Q47B 4GIVA 2Y4TA 3IEGA 1JNTA 4J8EA 2PV2A 3LY8A 4WNGA 4I9EA 4UI9J
chains in the Genus database with same CATH superfamily
1NA0A 5HTGA 2VGYA 4JHKA 3ULQA 1OCRE 2WXQA 5DO2A 4H7YA 2AWGA 4JEHA 1JCHB 3E4BA 3AG1E 5HWBA 4FC8A 2XS8A 2MLYA 1SW6A 4CDRA 1EIBA 1JCSA 1HH8A 2ZQVA 3PRDA 4WAFA 2VCDA 3BU8A 1TFVA 2RFMA 3BQOA 4GU5A 3RM4A 4L7TA 3SHFA 4ZPTR 1AWCB 1Z6TA 3UIOC 3WL0A 2PV1A 3UI2A 5I98A 5T3RA 1FT1A 4M3OA 2HM8A 4F7AA 3CK9A 5CHEE 2VGXB 4AVXA 4MNLA 3UT7A 2L6JA 4UUCA 5BXJA 1OGGA 3PR9A 3QDNA 1QNFA 3GYZA 1TNUA 3TWWA 3SNXA 3ZXPA 2PNNA 3U4TA 4U04A 3HIZA 1OWMA 5ITZF 4L3NA 5EIDA 2KZTB 2IUZA 1E44A 3G2UA 1Q2ZA 4GYOA 4EZLA 1G3NB 2LNIA 3FEXA 1TN6A 4V3IA 2BKKB 1N0RA 3FXYA 4U85A 5EIBE 3GW4A 3O5RA 3CGNA 3UMVA 4MSPA 1WY6A 4TXQA 4HLEA 3FEYA 2WQ6A 3KSLA 4UWFA 4BSXA 2I2OA 5CMWA 4CZ2D 4EECA 1ROUA 5JJ6A 1MX2A 4IQ2A 2V5QC 3KAFA 4QIBA 2V5FA 3LY7A 3TL5A 3KD7A 4C02B 2ETBA 3LUOA 3WG7E 2RUQA 3ARXA 1SZ9A 2OVBA 4CGVA 3RAUA 4KMOA 1PC2A 4ANXA 3UI4A 1O1SA 1UR8A 3ASFA 2F2DA 4ODKA 3GZSA 5EX3A 1NWUA 5HWCA 1GRJA 4MRUA 4IRUA 2XP9A 2BEDA 3ZIMA 2IFUA 2I6HA 1W9PA 1MZCA 3RK6A 3RO3A 2WXJA 5AJLA 3P1UA 4IULA 5HRYA 4D10C 3V79K 3C3RA 2Q5AA 2KATA 3B95A 4K5BA 2IEJA 3FTXA 5JJ7A 1N54A 3CV0A 3OA5A 1GUVA 2XRYA 3T9KA 5DBKA 4KZCA 4W9OA 1FT2A 4YNDA 2KR7A 3FUNA 4I2WA 3ARRA 2V0PA 1LL6A 3O5FA 3TDBA 4UI9C 3U9WA 4RG6A 2EIJE 4WIWA 5ARGA 3O5IA 4ATGA 3ARTA 3ZHEA 3CZ8A 3B7XA 4ILHB 1E7UA 4BERA 3PUKA 4LAXA 5DIVA 4U8HA 4WUYA 4DH0A 4J6IA 1HG5A 2IQCA 5A7DB 1ZBCA 2BUGA 3FTYA 1IHGA 3FUEA 1IQRA 1H0IA 4TYOA 5B3SE 3B13A 1NA3A 2XP4A 3FU6A 1JNEA 5EYLA 1OWPA 4DJAA 1OGBA 1TCOC 3J5PA 2A5EA 5AJDA 4NZCA 4HRLA 4EPZA 4I1OB 1HKKA 1KT0A 1YMPA 4EBAG 3D9IA 4A63B 3CHPA 2WQ7A 1OXJA 1N95A 2RFAA 4Y6WA 4U95D 1LF8A 2GW1A 4Z2JA 3SD5A 5D0QD 4U0SA 1OCZE 4ACLA 2ETNA 5CRUA 2L0IA 1D7IA 4E6HA 2IOLA 3ASDA 3SFXA 3HVEA 3RMEA 3O5GA 3QK0A 1TR4A 4HVBA 1LG2A 4OVUA 3RRMB 4HI8A 3SBSA 4B89A 2IF4A 3L08A 3MCXA 3Q5MA 3AU5A 1L1PA 1BKFA 5FZSA 1IX5A 4YDEA 2P9KG 2Y3AA 2XPAA 1MYOA 5FTPA 1N4PA 2B0OE 3C72A 4MLPA 1ZB1A 3LYAA 4W9QA 3GZ1A 3VLFA 2RUCA 2KO7A 3CVVA 1P5QA 2BTDA 4LAWA 1D8DA 4Y6CA 3IKGA 4BWRA 2PV3A 1O1RA 3D9LA 3SF4A 4G2VA 5HKGA 4HFGA 2WM0A 3L54A 4JZYA 4OAUC 2ETCA 2KCLA 3DSSA 5BNWA 2GGFA 3CK7A 2IY0C 3JYMA 2EIKE 4GCNA 5AQ9A 1FAPA 1WM5A 2DZNA 3C98A 2OFNA 4W9PA 5AARA 2QZAA 1N1AA 3S7BA 4QFVA 1BL4A 3CHMA 3ZXSA 1DC2A 3RM9A 4KXKB 4PS3A 2KFWA 4ODLA 5CEAA 2LJ4A 1E96B 3IK8A 2VSOE 3MKQA 2J07A 3V2XA 3KAGA 4JA9A 5ENOD 1T11A 2LO6A 3MGBA 3DBSA 1N52A 2YINA 1U79A 2FO7A 1DCEA 3CQCB 1ITXA 4YVOA 1WAWA 4NQ0A 1E15A 4DRIA 1BI7B 2D9FA 4U8VD 3C3QA 3PZ1A 1U2VG 3CKBA 3JUIA 3PE3A 2QY7A 1BI8B 2MLXA 3FU3A 3NZUA 3OAWA 3DSWA 5G05J 1QQEA 4GTQA 2KC7A 3FU0A 3Q15A 1E9LA 1HU3A 4JHRA 1LL7A 3G2WA 5ENSD 4DLQA 4N19A 5LOZA 1K1AA 2F8XK 1JCQA 4HXIA 1HJXA 4XKCA 2X38A 3TXMA 2HR2A 3IHVA 2GRNB 3QJZA 1EDQA 1HKMA 4JB8P 2A5UA 3LXUX 2IO3C 2HO1A 4I9CA 2ESCA 4URIA 2LXMA 4GA0A 4XIFA 5EYPF 5FQ7A 2IJGX 2DBAA 5JHAA 3DXMG 3WD0A 4YDOA 4LCTA 4TNSA 3UX4A 4DWSA 4ATZD 5ARFA 3PH0C 1PY1A 3ISMC 1GPFA 1WNOA 3O5LA 2LSVA 3ABLE 1H2TC 3D9PA 4WNFA 2WLYA 2C0LA 2VSNA 1KZPA 4CEMA 4JHJA 5HKPA 2VSXE 3Q47B 4G8KA 4GIVA 4IT6A 3ENEA 3LY8A 4MNMA 5E75A 4A3VA 3ARVA 4U07A 3CGMA 2H6HA 4DT4A 1GW6A 4DX5D 3FUMA 1OWNA 5FZRA 2PL2A 4DI3A 5EKQD 3MV3B 1IHBA 2Q7FA 1FVHA 4I6EA 3PA7A 4N2QA 5JH8A 2XPBA 5BXUA 4QZVB 2YBTA 3AS2A 1TN8A 3GPKA 2B6CA 4GPKA 3B7BA 4GZ5A 1E6NA 4O60A 2DPEA 1PAQA 2PPNA 3R7QA 4ITZA 3TWRA 3EIQC 1A17A 2VSYA 4Z2HA 4I2ZA 2J08A 4PS7A 3T5VA 5AQBA 5D66A 4BTBA 1ZCNA 3TAXA 3VLEA 4U84A 4B8CB 3UF8A 1Y6IA 2RKKA 1ELWA 2P9UG 3TWVA 3IBEA 1ZL1A 1EHNA 2MYOA 1A5EA 2O92A 4KBQA 4KZ0A 4BX9A 1LG1A 2XS1A 2WXIA 4K5AB 5JJTA 3S7DA 2IU1A 2AXUA 1EQ3A 5EN5D 1H6PA 1JUQA 1UJJA 2WXHA 4A3TA 4MGVA 4BETA 2MHKA 4FHJA 5G05C 1Q1CA 4GZ3A 1BD8A 3V30A 2L2SA 4XZ4A 1S63A 5FQ6A 1NMWA 3NQPA 3KAIA 3DPDA 1HFAA 4FJYA 3OOBA 4JC8A 4U0UA 4C0MA 4DX1A 2VJ8A 5ENTD 1QPFA 3NI6A 5EX0A 3UM2A 1H6OA 3FTSA 3OXFA 3TGOA 3AJIA 4U0ZA 3RRUA 5HT1A 2QFCA 3MA5A 4DX6D 1OUVA 4GA1A 3ASNE 5HW6A 4KT6B 4Z2IA 3KADA 1N4QA 4EHMA 2QYUA 3FUKA 3Q49B 4TW6A 5BV0A 3CVYA 1UR9A 2MLZA 4ODPA 3RO2A 1NWSA 4Z2KA 2LPVA 1MX6A 3G2SA 1E90A 3Q9UC 2AW6A 1FKIA 1K9TA 4DRKA 3O5OA 1ZBWA 5AAOA 4L2YA 4JFJA 3AQUA 4L23A 2K8IA 2FBNA 2KE0A 2ZISA 5FQ8A 3AS0A 1S0PA 1VDYA 1U3DA 4HOUA 3EHRA 4RG9A 1DCQA 3E32A 4F3VA 1FFQA 3G2VA 2UY1A 3N71A 1FCHA 1UW4B 1EPUA 4Z2LA 2OLHA 5HI7A 2F8YA 1HG2A 1HX8A 4DROA 3IXEA 3UT4A 3UQBA 3CSTA 3FTUA 4GZ6A 3JXVA 4B8AA 1K1BA 4I6JA 5IY5E 2WXPA 1FKFA 2I1KA 3GU0A 1H0GA 4ZPWR 1IYGA 4IN3B 5CRVA 2YBUA 4XE0A 4I6GA 1E8ZA 2R02A 3RIBA 4U96D 1L5JA 4LNUD 2JZVA 5KNGA 3MX3A 5FINA 1QBQA 2PN0A 2ZQTA 3DSUA 5BW8C 3EIJA 4OVVA 4IYPA 2DYRE 3UTMA 5A6CA 2GRPB 2QF8A 5B8IC 3Q7FA 4X8QA 5KNHD 2A4ZA 5LFAA 2R03A 2XZTG 1LQ0A 1W9UA 3PZDA 4N5CA 2ZQUA 3RKVA 3MEKA 3HXCA 2P9PG 2EIME 3G2TA 2WLZA 4YVQC 2X6KA 2DSWA 5CERB 1B89A 3PUJA 4HOSA 3BG0B 1LTXA 3T5XA 3LCAA 4DRQA 1ZBKA 1J4HA 3Q75A 3QC1A 4O6FA 2WXOA 4GTSA 2UY1B 4MNKA 2H6GA 3BMBA 3ZKJA 2XEVA 1NP7A 3JYSA 2XP6A 3CVQA 5JA4D 3F6QA 2FULA 4GYYA 4JEUA 1N4RA 4AY1A 5D75A 1FKJA 3FH5A 4GZDA 2PQNA 3WKZA 2R59A 1A7XA 3ARYA 1NI1A 2Y0BG 3WH0A 4Q22A 3AS3A 4U86A 3CHCA 1BLXB 2P9SG 3ODKA 4UDMA 1N0QA 5GQBA 4WKFA 5JHBA 3S2AA 1XGWA 4APOA 1FPPA 1Z5SC 1ZBPA 4K5CA 2ILRA 1WB0A 1ELRA 3R7RA 3KEZA 3ONLA 2WVIA 3CLJA 2OEWA 1OT8A 2DVWA 4CDNA 2XHEA 2VGEA 1E8WA 4TUUA 5BV1A 4FA6A 5HW8A 1W1PA 4Q7NA 3AROA 1M5YA 2M63A 4J8YA 4QT2A 3AU4A 3QWWA 1SR0A 2NC9A 4UWGA 2XGOA 1XHGA 4ODQA 4HRMB 3V31A 4J4NA 4ZPVR 3CHOA 4CDMA 4XKBA 4CYMD 4G8LA 3QB2A 3CIAA 4C9BB 3RJVA 4ME2A 2G41A 4H7XA 2NYJA 3MJWA 4YDWA 1IXVA 3PZ3A 2XCCA 4P29A 4AY6A 1AP7A 4GTMA 3O5QA 1XNFA 2L6BA 4DI4A 1Q6IA 2P9NG 5T4YA 1DVPA 2NXPA 1S64A 5E76A 3E34A 4BT8A 1NFIE 1D7HA 5AQAA 2LSUA 2C2LA 1KZOA 5KJKA 1TJFA 3QOUA 4GB9A 3GZ2A 4OYSA 2WQHA 2UZ5A 1RW2A 1Q6UA 4DRMA 3BUAA 5J08A 3IKOB 2R17C 3EDTB 3PZ2A 4PUCA 4GTOA 4AP2A 2C0MA 3VLDA 3ZFWA 3ZYQA 5BUZA 4G50A 3R9MA 3ZHEB 4R7LA 4R0XA 1W3BA 1FKBA 1E6RA 5BPPA 4DZ2A 2EQXA 3SY2A 4TRQA 1D6OA 4URKA 4YDYA 4P8XA 3FUIA 3HXEA 4I9EA 1IQUA 2F37A 3LDZA 1JNDA 3CR3A 2GRRB 3H9RB 4IPXA 4RQIA 3KCEA 3HRAA 5HBFA 1PBKA 3NF1A 2NSZA 2WXGA 4C0EA 2WPVA 3RGCA 4KR0B 2DIWA 4S3JA 3UKUG 2XP5A 4BEPA 4ML4A 4L9PA 1MX4A 1TNBA 2XP3A 3LVQE 1YW5A 1QZ2A 2Y69E 1ZK6A 4JW1A 2X6HA 4LG6A 3RSEG 2E2EA 4HBEA 3HVEB 1H2UA 2LXLA 4ACKA 5HUAA 2Y78A 4HLLA 3B9AA 5KWDA 2J8SD 3ZEFA 1Z3XA 1FKSA 3ASHA 1LD8A 3L22A 2DCPA 4LEUA 2XPYA 4M7CA 2F23A 3O4ZA 4MS6A 3DSVA 3UIPC 5J6EA 3EU5A 3PREA 3ZRHA 1JCRA 2J09A 5LCWJ 2X3MA 2AVPA 3VTYA 3FU5A 5FZQA 2VTBA 4K0RA 3PDNA 4NURA 3HYMB 4K03A 2O9OA 4GTVA 3DEOA 1EYHA 3JCKC 1K8KG 1SZAA 1W1TA 1TN7A 3CVUA 1H2VC 2DSUA 2WXMA 2DT0A 2ZGDA 2AOSA 3KABA 3TG4A 3W9FA 1X81A 3X2QE 2ZGGA 3EHNA 4FADA 3ARQA 2G8ZA 3S7JA 4LGXA 3BEEA 3W9GA 4Z2GA 3AS5A 1B6CA 3EHMA 3ALGA 2XPZA 5KJNA 3UM0A 3TC5A 4R5EA 1KFWA 2YNQA 3AG4E 3SI5A 3CVLA 3MKQB 4L1BA 5G2NA 1K3ZD 4UQZA 1OWOA 3VAWA 5HQ8A 2JEKA 4IT4A 3UKRG 3PRZA 4G26A 2WXLA 2CFZA 3JYJA 3ML9A 1TNZA 1YA0A 1XRVA 2V4LA 4OAVB 4RSYA 3U66A 3D9NA 3ZU7B 2J49A 3APFA 4MAVA 3NRKA 2UWJG 1RZ4A 2IONA 3SFYA 4I17A 1BPOA 3ZYMA 2ZR6A 2MNTA 4HB5A 3WD1A 3SZ7A 1YCSB 4J7WA 3ASOE 2WB2A 4AY5A 4DWSC 5DEZA 2AXZA 5AENA 3PS6A 1UOHA 1ROTA 3ARSA 3D3MA 4CCAA 2P58C 4U63A 3UI5A 4U8YD 1RD6A 1FVFA 4DX7D 1W26A 4FU3A 4FULA 3ARPA 3CK8A 3L16A 4HQDA 4F6RD 5KCMA 4DRJA 3NOGD 5LP0A 4NIKA 3B8SA 3ARUA 4XI9A 3ZYLA 3EJNA 4J8SA 2RUDA 2CHXA 2PPPA 3AG2E 1ZU2A 3HDXA 2XCBA 4WJXA 2WMOA 3UXGA 3HXDA 3ZUVB 3PEUB 1D7JA 3QNKA 1FKHA 5ENQD 2JLBA 2RQSA 3O5EA 2H6IA 4DLOA 4CT4A 4G25A 5GPGA 3LY9A 1LD7A 4I43A 3FFLA 4HI9A 3UINC 4JL0A 4MBGA 4DWSB 1INZA 1E8XA 2DYSE 3DEPA 4FN2A 3FY1A 4XX5A 2ZU6B 3SO8A 2E0IA 2HYZA 4TW7A 4JPSA 4KYOB 2FDMA 3FY4A 1SVXA 4FLHA 3NBNB 1OCOE 3AS4A 4ILGA 4G1TA 2CG2A 2J9QA 5LCWC 2KCVA 4BTAA 4UWKA 3CHDA 4EZKA 4EQFA 4HOTA 3MKRA 4O1PA 3D9OA 1X6NA 4DK5A 4DZ3A 2GRQB 1IKND 1SQMA 2VGXA 3ESLA 3ZYKA 1H19A 2B5UB 3WQWA 3FAPA 4ILIA 4BSZB 3CKCA 3QOKA 4ANVA 4GTPA 3FH8A 4GTRA 2LKNA 5ANRA 4E85A 4GTTA 4C48B 4TXPA 2R5SA 3O5JA 1N9AA 3WD2A 4N3BA 4WNDA 2KZTA 4JFLA 3D9HA 3FP3A 4B93B 3ZN3A 1FD9A 4ANWA 5BXOA 3PVLA 1GOIA 1F40A 1CTNA 2XQ0A 3E33A 3WXXA 5CBNA 3UM3A 3DRAA 4Z68A 1NWRA 1S70B 1NL4A 2KCKA 3MV2B 3G6LA 1D9SA 4BX8A 2MRIA 2KM4A 3ONKA 1HJVA 1MQSA 4I1MA 2PPOA 2R05A 3GTYX 4FLBA 4GCOA 4BESA 2WK2A 5M72A 4GMJA 3EHQA 4HBDA 4TUMA 1J4IA 3EUVA 2FAPA 1SA5A 3ZW3A 1HZ4A 4GPMA 2ZXWE 1J4RA 3NAWA 4CRWA 1V55E 4UWHA 1HJWA 3Q9NC 3SGHA 4O1OA 2CFUA 3S7FA 3CVWA 1JWGA 4RVBA 3TG5A 5KJMA 3BXWA 4N3CA 3CVNA 1HKJA 2ITKA 2XGMA 4AM9A 4TXRA 4UWLA 2PZIA 3URZA 3CHSA 3AS8A 3Q7AA 3L9TA 5C2YA 4CT0A 3PEVB 3MZLB 4TX0A 5KJLA 3PRAA 3LPZA 3WQVA 3CHEA 4N39A 3TWSA 1QYMA 4PTMA 1WAO1 3Q4AB 3TXNA 2MOWA 5AQ7A 1BU9A 2EULA 2WXKA 1HXIA 3I4GA 2OEVA 4AV7A 3B7SA 1NSGA 5CMYA 4WKHA 4LERA 2XPIA 3U3WA 3AG3E 3RM8A 3FUHA 1MHQA 3DPYA 2L0TB 4LNGA 4QT3A 4GMRA 3B7UX 3O5KA 5D2MC 4WNEA 4ODMA 4P8VA 4ZHBA 2CHWA 2RG8A 3Q78A 5B1BE 3FULA 2WMNA 3CHQA 5LX8A 2AWIA 3KSQA 2PM7A 3JXJA 3WL1A 3ESKA 2DG3A 3EIPA 2N87A 3CVPA 1NH6A 4J8FA 3ULYA 4GA2A 1NWTA 1FKKA 4PS8A 5FJYA 3MDYB 2FO1E 1NZNA 4ODNA 1U3CA 1JNTA 2PV2A 4LSZE 4WNGA 2I9CA 4HNAD 2XRZA 3QWPA 4G11A 1W9VA 4ABNA 3CGHA 2GRLA 4W5UA 4B0ZA 3ABKE 4GZCA 4NNRA 2L9BA 1R9HA 1NMVA 3KZ7A 5DIZA 3SFZA 2BKGA 3UPVA 4LUNU 1SA4A 4DRNA 4A55A 4DRHA 4MNJA 2PQRA 1HO8A 5ENNA 4GAAA 3TWUA 2FEZA 3SQVA 2A3EA 3FTZA 1SYTA 3E30A 1ZBVA 3NOCD 3TWQA 1W1VA 2XP8A 4FAPA 3FUFA 3D9JA 1Y8MA 5JMND 5ENPD 1OCCE 2AJAA 3B9DA 1EYMA 4L2LA 4KVOA 4HS2A 3TJPA 4J0UA 4B94A 2KXPC 4DUIA 3UQAA 1F8AB 4WWPA 2OV8A 2QC9A 3Q73A 4JXTA 2P9IG 1D2KA 1Y0OA 2GRMA 1Q6HA 5KBAA 4BFRA 3NTPA 1UN8A 4G2PA 2DZOA 3ZNGA 3CVXA 2DT1A 1H6KA 2PBCA 4IQCA 4NSBA 3I4RB 3FTWA 2V4HC 4I1AA 4ODRA 3QKYA 3CH9A 3P2BA 5CCMA 2DG4A 3FUJA 4JYSA 4BT9A 3MYVA 1OY3D 3ABME 5BT1A 4AOFA 2F4EA 3VTXA 3IKDA 3LS8A 5DF0A 2Y4UA 5HS0A 1HKIA 3E37A 5ANLA 3IHYA 2KI3A 3UQIA 3UI6A 3ZPJA 1O1TA 3K9IA 5G55A 3ALFA 4N5QA 1KT1A 1TNOA 3FH7A 3WD3A 3RFWA 2PI6A 3JUEA 4GGQA 2ZIRA 2XENA 4PH4B 4HORA 3L82A 3FUDA 1ELKA 2AXVA 3AAAC 3QARA 1W1YA 3HXFA 2M1IA 1MJ0A 1YYHA 1FFRA 3WIJA 3UM1A 3ULEG 1X5BA 2JABA 4J8DA 4NACA 4DPRA 1TEZA 2QYJA 2XGSA 3PNTB 2OVFA 2RD0A 3DSTA 4BY6A 1WDYA 3IV0A 2MPHA 3APDA 2EILE 4U7EB 1E6PA 3O5PA 2ONDA 5HW7A 4LRZA 5A23A 1KLXA 1JPLA 1OWQA 3LJ3A 1D8EA 4JVSA 4XAKA 2WXNA 3KS2A 2A3BA 4A1SA 2A3CA 1YATA 5EDSA 2IOSA 3RU0A 5G04J 5EILA 1FKLA 5GPRA 2J4DA 4KQZA 3B7TA 4DRPA 3CHRA 1J6YA 2FI7A 3D9MA 4Q69A 5AIJA 1V54E 2YHEA 2P9LG 4WKAA 4JD2G 4ZFHA 2FF4A 3ML8A 2VYIA 4HARA 2DWZA 1DNPA 3B7RL 4MKTA 4HOQA 5T8IA 5C1DA 3O5DA 2I1JA 1X6LA 2LAIA 2RSEA 3EU9A 1O6IA 3I6CA 3PRBA 4EBAA 2H6FA 4HBOA 3Q79A 4WK9A 3T8MA 2X6IA 3NB2A 4FP7A 1H0AA 2WM9A 4BF8A 3HHMA 4A1GA 2XZDG 2DT3A 1HS6A 3KAHA 4JFIA 2RURA 1TNYA 3TWXA 2IO2C 3UUXA 4XI0A 3HG0D 1FKTA 3W4RA 1HE8A 3CEQA 4F1PA 1E6ZA 2KGJA 1ZU8A 4FJZA 2LAHA 2ZR5A 5FQ4A 3FDHA 2DSZA 3LKUA 5DITA 2OCCE 2DT2A 5CEDB 2B31A 1Z3YA 4UI9K 4RLYA 3OXGA 4ANUA 4UQYA 2DSVA 1LL4A 3R9AB 2CG3A 2VN1A 4G24A 3DSXA 3RRNB 3PE4A 4GMLA 1JNSA 1E8YA 1HF8A 3TWTA 3SBTB 1O5MA 2KBXA 4AJWA 2WXRA 2ZQSA 4S3KA 1UG3A 4DRXE 1TYQG 3T8KA 1WG0A 2X6JA 3CSFA 4DWSD 5FT9A 3C3OA 3QAQA 1N4SA 3L13A 2XEHA 3O5MA 4TW8A 3FHEA 2A3AA 3C5RA 3PNLB 2ZR4A 4GYWA 2V8SE 3KAEA 4QQIA 3L6AA 3AS1A 5H7PA 3JXIA 2VTBB 1QPLA 3BG1B 4EZJA 4LAVA 1N11A 2YHCA 5B1AE 3FTVA 4NRHB 5FIOA 1ZB5A 2P2CP 3HXBA 4L72B 4O2TA 3JQ0A 4TV3A 4WWNA 5CECB 1FKDA 4JFKA 4WWOA 3ARWA 4F1SA 3J5QB 1EF1C 3D9KA 3L17A 4W9RA 4P8UA 1TJCA 5D0OD 2OOEA 1C9HA 1VF8A 3IHZA 3OXLA 2LGOA 4P8WA 3EY6A 3TCZA 1JVWA 3APCA 2M08A 2J4BA 3FWVA 1UJKA 2LUHA 4LAYA 3O48A 3B9EA 1LJYA 4AIFA 4J4OA 2F0YA 2HE0A 2VQ2A 4ZS6A 4G23A 2F21A 2EINE 3I3NA 3PZ4A 4AEZC 3LEWA 5G04C 4APFA 1EDUA 2R2LA 2BF0X 2Y1LE 1OWLA 4CGWA 1N94A 1JWFA 2GROB 1FKRA 2XP7A 3OTNA 2FKEA 3V2OA 4HRNA 4N3AA 1E7VA 2ETAA 3CHFA 1FJDA 2X6FA 4F53A 2XEEA 4MPKA 5CCLA 5ENRD 4Q94A 4UQXA 4ODOA 2MF9A 4Q96A 3UQ3A 4DX2A 5CBOA 4PDXA 4DIPA 1PINA 3DWLG 3WD4A 4FHKA 4AXHA 4JA7A 4MTVA 2YQ8A 2M2AA 1UN9A 2WXFA 5J90A 3LVRE 4LNBA 1HXVA 3G6MA 1FKGA 3KEAA 3JQ1A 3CQGB 5AYWD 1KPSB 3ZGQA 4N2SA 4JFMA 3ZVVA 3UT8A 2PM6A 3NZSA 3I5PA 4XEIG 3KACA 4KVMA 3ASGA 2DG9A 2P4VA 5AN8A 5DIUA 3ARZA 3LJNA 3QWVA 3U64A 5FWQA 2Y4TA 3IEGA 2CHZA 4J8EA 4UI9J 3DXKG
chains in the Genus database with same CATH topology
1NA0A 5HTGA 2VGYA 4JHKA 3ULQA 2WXQA 5DO2A 4H7YA 2AWGA 4JEHA 3E4BA 5HWBA 4FC8A 2MLYA 4CDRA 1EIBA 1HH8A 2ZQVA 3PRDA 4WAFA 2VCDA 1TFVA 4GU5A 3RM4A 4L7TA 3SHFA 4ZPTR 1Z6TA 3WL0A 2PV1A 5I98A 5T3RA 4M3OA 2HM8A 4F7AA 3CK9A 5CHEE 2VGXB 4AVXA 4MNLA 3UT7A 2L6JA 5BXJA 1OGGA 3PR9A 3QDNA 1QNFA 3GYZA 3SNXA 3U4TA 4U04A 3HIZA 1OWMA 4L3NA 2IUZA 2KZTB 3G2UA 4GYOA 4EZLA 2LNIA 3FEXA 4V3IA 3FXYA 4U85A 3GW4A 3O5RA 3CGNA 3UMVA 4MSPA 1WY6A 4HLEA 3FEYA 2WQ6A 4UWFA 4BSXA 2I2OA 5CMWA 4EECA 1ROUA 5JJ6A 4IQ2A 3KAFA 4QIBA 2V5FA 3LY7A 3TL5A 3KD7A 4C02B 3LUOA 2RUQA 3ARXA 1SZ9A 2OVBA 4CGVA 4KMOA 1PC2A 4ANXA 3UI4A 1UR8A 3ASFA 2F2DA 4ODKA 3GZSA 5EX3A 1NWUA 5HWCA 4MRUA 4IRUA 2XP9A 3ZIMA 2IFUA 2I6HA 1W9PA 3RK6A 3RO3A 2WXJA 5AJLA 3P1UA 4IULA 4D10C 2Q5AA 2KATA 3FTXA 5JJ7A 1N54A 3CV0A 3OA5A 1GUVA 2XRYA 5DBKA 4KZCA 4W9OA 4YNDA 2KR7A 3FUNA 4I2WA 3ARRA 2V0PA 1LL6A 3O5FA 3TDBA 4UI9C 3U9WA 4RG6A 4WIWA 5ARGA 3O5IA 4ATGA 3ARTA 3ZHEA 3CZ8A 3B7XA 4ILHB 1E7UA 3PUKA 4LAXA 5DIVA 4U8HA 4WUYA 4DH0A 4J6IA 1HG5A 2IQCA 5A7DB 1ZBCA 2BUGA 3FTYA 1IHGA 3FUEA 1IQRA 1H0IA 4TYOA 3B13A 1NA3A 2XP4A 3FU6A 1JNEA 1OWPA 4DJAA 1OGBA 1TCOC 5AJDA 4NZCA 4EPZA 4I1OB 1HKKA 1KT0A 4EBAG 3D9IA 3CHPA 2WQ7A 4Y6WA 1LF8A 2GW1A 4Z2JA 3SD5A 5D0QD 4U0SA 4ACLA 1D7IA 2L0IA 4E6HA 2IOLA 3ASDA 3HVEA 3RMEA 3O5GA 3QK0A 4HVBA 1LG2A 4OVUA 3RRMB 3SBSA 4B89A 2IF4A 3L08A 3MCXA 3Q5MA 3AU5A 1L1PA 1BKFA 5FZSA 1IX5A 2Y3AA 2XPAA 5FTPA 4MLPA 3LYAA 4W9QA 3GZ1A 3VLFA 2RUCA 2KO7A 3CVVA 1P5QA 2BTDA 4LAWA 4Y6CA 3IKGA 4BWRA 2PV3A 3D9LA 3SF4A 4G2VA 5HKGA 4HFGA 2WM0A 3L54A 4JZYA 2KCLA 5BNWA 2GGFA 3CK7A 3JYMA 4GCNA 1FAPA 1WM5A 3C98A 2OFNA 4W9PA 1N1AA 3S7BA 4QFVA 1BL4A 3CHMA 3ZXSA 3RM9A 4KXKB 4PS3A 2KFWA 4ODLA 2LJ4A 1E96B 3IK8A 2VSOE 3MKQA 3KAGA 4JA9A 1T11A 2LO6A 3MGBA 3DBSA 1N52A 2YINA 1U79A 2FO7A 3CQCB 1ITXA 4YVOA 1WAWA 4NQ0A 1E15A 4DRIA 2D9FA 3CKBA 3JUIA 3PE3A 2QY7A 2MLXA 3FU3A 3NZUA 3OAWA 5G05J 1QQEA 2KC7A 3FU0A 3Q15A 1E9LA 1HU3A 4JHRA 1LL7A 3G2WA 4DLQA 4N19A 5LOZA 4HXIA 1HJXA 4XKCA 2X38A 3TXMA 2HR2A 3IHVA 3QJZA 1EDQA 1HKMA 2A5UA 3LXUX 2HO1A 4I9CA 2ESCA 4URIA 4XIFA 4GA0A 5FQ7A 2IJGX 2DBAA 5JHAA 3WD0A 4LCTA 4TNSA 3UX4A 4DWSA 5ARFA 3PH0C 1PY1A 1GPFA 1WNOA 3O5LA 2LSVA 1H2TC 3D9PA 4WNFA 2WLYA 2C0LA 2VSNA 4CEMA 4JHJA 2VSXE 3Q47B 4GIVA 4IT6A 3ENEA 3LY8A 4MNMA 5E75A 4A3VA 3ARVA 4U07A 3CGMA 4DT4A 1GW6A 3FUMA 1OWNA 5FZRA 2PL2A 4DI3A 5EKQD 3MV3B 2Q7FA 1FVHA 4I6EA 3PA7A 4N2QA 5JH8A 2XPBA 4QZVB 2YBTA 3AS2A 3GPKA 4GPKA 4GZ5A 1E6NA 2DPEA 1PAQA 2PPNA 3R7QA 4ITZA 3EIQC 1A17A 2VSYA 4Z2HA 4I2ZA 2J08A 4PS7A 3T5VA 4BTBA 1ZCNA 3TAXA 3VLEA 4U84A 4B8CB 3UF8A 1Y6IA 1ELWA 3IBEA 1ZL1A 1EHNA 2O92A 4KBQA 4KZ0A 4BX9A 1LG1A 2WXIA 5JJTA 3S7DA 2IU1A 2AXUA 1EQ3A 1JUQA 1UJJA 2WXHA 4A3TA 4MGVA 2MHKA 4FHJA 5G05C 1Q1CA 4GZ3A 2L2SA 4XZ4A 5FQ6A 1NMWA 3NQPA 3KAIA 3DPDA 1HFAA 4FJYA 3OOBA 4JC8A 4U0UA 4C0MA 2VJ8A 1QPFA 3NI6A 5EX0A 3FTSA 3OXFA 3TGOA 4U0ZA 3RRUA 5HT1A 2QFCA 3MA5A 1OUVA 4GA1A 5HW6A 4KT6B 4Z2IA 3KADA 3FUKA 3Q49B 4TW6A 5BV0A 3CVYA 1UR9A 2MLZA 4ODPA 3RO2A 1NWSA 4Z2KA 2LPVA 3G2SA 1E90A 2AW6A 1FKIA 1K9TA 4DRKA 3O5OA 1ZBWA 4L2YA 4JFJA 3AQUA 4L23A 2K8IA 2FBNA 2KE0A 5FQ8A 3AS0A 1S0PA 1VDYA 1U3DA 4HOUA 4RG9A 4F3VA 1FFQA 3G2VA 2UY1A 3N71A 1FCHA 1UW4B 1EPUA 4Z2LA 2OLHA 5HI7A 1HG2A 1HX8A 4DROA 3UQBA 3UT4A 3CSTA 3FTUA 4GZ6A 3JXVA 4B8AA 4I6JA 2WXPA 1FKFA 2I1KA 1H0GA 4ZPWR 1IYGA 4IN3B 2YBUA 4XE0A 4I6GA 1E8ZA 3RIBA 1L5JA 2JZVA 3MX3A 2ZQTA 5BW8C 3EIJA 4OVVA 4IYPA 5A6CA 2QF8A 5B8IC 2A4ZA 5LFAA 1LQ0A 1W9UA 3PZDA 4N5CA 2ZQUA 3RKVA 3MEKA 3G2TA 2WLZA 4YVQC 2X6KA 2DSWA 4HOSA 1B89A 3PUJA 3BG0B 3T5XA 3LCAA 4DRQA 1ZBKA 1J4HA 3QC1A 4O6FA 2WXOA 2UY1B 4MNKA 2XEVA 1NP7A 3JYSA 2XP6A 3CVQA 2FULA 4GYYA 4JEUA 4AY1A 5D75A 1FKJA 3FH5A 4GZDA 2PQNA 3WKZA 2R59A 1A7XA 3ARYA 3WH0A 4Q22A 3AS3A 4U86A 3CHCA 3ODKA 5GQBA 4WKFA 5JHBA 3S2AA 1XGWA 4APOA 1ZBPA 2ILRA 1WB0A 1ELRA 3R7RA 3KEZA 3ONLA 2WVIA 3CLJA 4CDNA 2XHEA 1E8WA 4TUUA 5BV1A 4FA6A 5HW8A 1W1PA 4Q7NA 3AROA 1M5YA 2M63A 4QT2A 3AU4A 3QWWA 1SR0A 2NC9A 4UWGA 2XGOA 1XHGA 4ODQA 4J4NA 4ZPVR 3CHOA 4CDMA 4XKBA 3QB2A 3CIAA 4C9BB 3RJVA 4ME2A 2G41A 4H7XA 3MJWA 2XCCA 4P29A 4AY6A 3O5QA 1XNFA 4DI4A 1Q6IA 5T4YA 1DVPA 2NXPA 5E76A 4BT8A 1D7HA 2LSUA 2C2LA 5KJKA 1TJFA 3QOUA 4GB9A 3GZ2A 4OYSA 2WQHA 2UZ5A 1Q6UA 4DRMA 5J08A 3IKOB 2R17C 3EDTB 4PUCA 4AP2A 2C0MA 3VLDA 3ZFWA 3ZYQA 5BUZA 4G50A 3ZHEB 4R7LA 4R0XA 1W3BA 1FKBA 1E6RA 5BPPA 4DZ2A 2EQXA 1D6OA 4TRQA 4URKA 4P8XA 3FUIA 4I9EA 1IQUA 3LDZA 1JNDA 3CR3A 3H9RB 4IPXA 3KCEA 5HBFA 1PBKA 3NF1A 2NSZA 2WXGA 4C0EA 2WPVA 3RGCA 4KR0B 2DIWA 4S3JA 2XP5A 4ML4A 2XP3A 3LVQE 1YW5A 1QZ2A 1ZK6A 4JW1A 2X6HA 2E2EA 4HBEA 3HVEB 1H2UA 4ACKA 5HUAA 2Y78A 3B9AA 3ZEFA 1Z3XA 1FKSA 3ASHA 3L22A 2DCPA 4LEUA 2XPYA 3O4ZA 4MS6A 5J6EA 3PREA 3ZRHA 2J09A 5LCWJ 2X3MA 2AVPA 3VTYA 3FU5A 5FZQA 2VTBA 4K0RA 3PDNA 4NURA 3HYMB 4K03A 2O9OA 3JCKC 1EYHA 1SZAA 1W1TA 3CVUA 1H2VC 2DSUA 2WXMA 2DT0A 2AOSA 3KABA 3TG4A 3EHNA 4FADA 3ARQA 2G8ZA 3S7JA 4LGXA 3BEEA 4Z2GA 3AS5A 1B6CA 3EHMA 3ALGA 2XPZA 5KJNA 3TC5A 4R5EA 1KFWA 2YNQA 3SI5A 3CVLA 3MKQB 4L1BA 5G2NA 4UQZA 1OWOA 3VAWA 5HQ8A 2JEKA 4IT4A 3PRZA 4G26A 2WXLA 2CFZA 3JYJA 3ML9A 1YA0A 1XRVA 2V4LA 4RSYA 3U66A 3D9NA 2J49A 3APFA 4MAVA 3NRKA 2UWJG 2IONA 4I17A 1BPOA 3ZYMA 2ZR6A 2MNTA 3WD1A 3SZ7A 2WB2A 4AY5A 4DWSC 5DEZA 2AXZA 5AENA 3ARSA 3PS6A 1ROTA 3D3MA 4CCAA 2P58C 4U63A 3UI5A 1RD6A 1FVFA 1W26A 4FU3A 4FULA 3ARPA 3CK8A 3L16A 5KCMA 4DRJA 5LP0A 3B8SA 3ARUA 4XI9A 3ZYLA 3EJNA 4J8SA 2RUDA 2CHXA 2PPPA 1ZU2A 3HDXA 2XCBA 4WJXA 2WMOA 3PEUB 1D7JA 3QNKA 1FKHA 2JLBA 2RQSA 3O5EA 4DLOA 4CT4A 4G25A 5GPGA 3LY9A 4I43A 3FFLA 4JL0A 4DWSB 1INZA 1E8XA 4FN2A 3FY1A 4XX5A 2ZU6B 2E0IA 2HYZA 4TW7A 4JPSA 4KYOB 2FDMA 3FY4A 4FLHA 3AS4A 4ILGA 4G1TA 2CG2A 2J9QA 5LCWC 2KCVA 4BTAA 4UWKA 3CHDA 4EZKA 4EQFA 4HOTA 3MKRA 3D9OA 1X6NA 4DK5A 4DZ3A 1SQMA 3ESLA 2VGXA 3ZYKA 1H19A 3WQWA 3FAPA 4ILIA 3CKCA 3QOKA 4ANVA 3FH8A 2LKNA 5ANRA 4E85A 2R5SA 3O5JA 3WD2A 4N3BA 4WNDA 2KZTA 4JFLA 3FP3A 3ZN3A 1FD9A 4ANWA 1GOIA 3PVLA 1F40A 1CTNA 2XQ0A 3WXXA 1NWRA 2KCKA 3MV2B 3G6LA 4BX8A 2MRIA 2KM4A 3ONKA 1HJVA 1MQSA 4I1MA 2PPOA 4FLBA 4GCOA 2WK2A 5M72A 4GMJA 1J4IA 2FAPA 3ZW3A 1HZ4A 1J4RA 4CRWA 4UWHA 1HJWA 3SGHA 3CVWA 2CFUA 3S7FA 1JWGA 4RVBA 3TG5A 5KJMA 3BXWA 4N3CA 3CVNA 1HKJA 2ITKA 2XGMA 4AM9A 4UWLA 2PZIA 3URZA 3CHSA 3AS8A 5C2YA 4CT0A 3PEVB 3MZLB 4TX0A 5KJLA 3PRAA 3LPZA 3WQVA 3CHEA 4N39A 4PTMA 1WAO1 3Q4AB 3TXNA 2MOWA 2WXKA 1HXIA 3I4GA 4AV7A 3B7SA 1NSGA 5CMYA 4WKHA 4LERA 2XPIA 3U3WA 3RM8A 3FUHA 1MHQA 2L0TB 4QT3A 3B7UX 3O5KA 4WNEA 4ODMA 4P8VA 2CHWA 2RG8A 3FULA 2WMNA 3CHQA 5LX8A 2AWIA 2PM7A 3WL1A 3ESKA 2DG3A 2N87A 3CVPA 1NH6A 4J8FA 4GA2A 1NWTA 1FKKA 4PS8A 5FJYA 3MDYB 1NZNA 4ODNA 1U3CA 1JNTA 2PV2A 4WNGA 2I9CA 2XRZA 3QWPA 4G11A 1W9VA 4ABNA 3CGHA 2GRLA 4W5UA 4B0ZA 4GZCA 4NNRA 2L9BA 1R9HA 1NMVA 3KZ7A 5DIZA 3SFZA 3UPVA 4LUNU 4DRNA 4A55A 4DRHA 4MNJA 2PQRA 1HO8A 5ENNA 4GAAA 2FEZA 2A3EA 3FTZA 1SYTA 1ZBVA 1W1VA 2XP8A 4FAPA 3FUFA 3D9JA 1Y8MA 3B9DA 1EYMA 4L2LA 4KVOA 4HS2A 3TJPA 4J0UA 4B94A 3UQAA 1F8AB 4WWPA 2OV8A 4JXTA 1D2KA 1Y0OA 2GRMA 1Q6HA 4BFRA 3NTPA 1UN8A 4G2PA 3CVXA 2DT1A 1H6KA 2PBCA 4IQCA 4NSBA 3I4RB 3FTWA 4I1AA 4ODRA 3QKYA 3CH9A 3P2BA 5CCMA 2DG4A 3FUJA 4JYSA 4BT9A 3MYVA 5BT1A 4AOFA 2F4EA 3VTXA 3IKDA 3LS8A 5DF0A 2Y4UA 1HKIA 5ANLA 3IHYA 2KI3A 3UQIA 3UI6A 3ZPJA 3K9IA 5G55A 3ALFA 1KT1A 3FH7A 3WD3A 3RFWA 2PI6A 4GGQA 4PH4B 4HORA 3FUDA 1ELKA 2AXVA 3QARA 1W1YA 2M1IA 1FFRA 3WIJA 1X5BA 4J8DA 4NACA 4DPRA 1TEZA 2XGSA 3PNTB 2OVFA 2RD0A 4BY6A 3IV0A 2MPHA 3APDA 1E6PA 3O5PA 2ONDA 5HW7A 4LRZA 5A23A 1KLXA 1JPLA 1OWQA 3LJ3A 4JVSA 4XAKA 2WXNA 3KS2A 2A3BA 4A1SA 2A3CA 1YATA 5EDSA 2IOSA 3RU0A 5G04J 1FKLA 5GPRA 2J4DA 4KQZA 3B7TA 4DRPA 3CHRA 1J6YA 2FI7A 3D9MA 4Q69A 5AIJA 2YHEA 4WKAA 2FF4A 3ML8A 2VYIA 4HARA 1DNPA 3B7RL 4MKTA 4HOQA 5T8IA 5C1DA 3O5DA 2I1JA 1X6LA 2LAIA 2RSEA 1O6IA 3I6CA 3PRBA 4EBAA 4HBOA 4WK9A 3T8MA 2X6IA 4FP7A 1H0AA 2WM9A 4BF8A 3HHMA 4A1GA 2DT3A 1HS6A 3KAHA 4JFIA 2RURA 3UUXA 4XI0A 1FKTA 3W4RA 1HE8A 3CEQA 1E6ZA 2KGJA 1ZU8A 4FJZA 2LAHA 2ZR5A 5FQ4A 3FDHA 2DSZA 3LKUA 5DITA 2DT2A 2B31A 1Z3YA 4UI9K 3OXGA 4ANUA 4UQYA 2DSVA 1LL4A 3R9AB 2CG3A 2VN1A 4G24A 3RRNB 3PE4A 4GMLA 1JNSA 1E8YA 1HF8A 3SBTB 4AJWA 2WXRA 2ZQSA 4S3KA 1UG3A 2X6JA 3CSFA 4DWSD 5FT9A 3QAQA 3L13A 4TW8A 3O5MA 3FHEA 2A3AA 3PNLB 2ZR4A 4GYWA 2V8SE 3KAEA 3L6AA 3AS1A 2VTBB 1QPLA 3BG1B 4EZJA 4LAVA 2YHCA 3FTVA 4NRHB 1ZB5A 4L72B 4O2TA 3JQ0A 4TV3A 4WWNA 1FKDA 4JFKA 4WWOA 3ARWA 4F1SA 1EF1C 3D9KA 3L17A 4W9RA 4P8UA 1TJCA 5D0OD 2OOEA 1C9HA 1VF8A 3IHZA 3OXLA 2LGOA 4P8WA 3EY6A 3TCZA 1JVWA 3APCA 2M08A 2J4BA 3FWVA 1UJKA 4LAYA 3O48A 3B9EA 1LJYA 4AIFA 4J4OA 2VQ2A 4ZS6A 4G23A 2F21A 3I3NA 4AEZC 3LEWA 5G04C 4APFA 1EDUA 2BF0X 1OWLA 4CGWA 1JWFA 1FKRA 2XP7A 3OTNA 2FKEA 4N3AA 1E7VA 3CHFA 1FJDA 2X6FA 4F53A 4MPKA 5CCLA 4Q94A 4UQXA 4ODOA 2MF9A 4Q96A 3UQ3A 4PDXA 4DIPA 1PINA 3WD4A 4FHKA 4AXHA 4JA7A 4MTVA 2YQ8A 2M2AA 1UN9A 2WXFA 5J90A 3LVRE 1HXVA 3G6MA 1FKGA 3JQ1A 3CQGB 5AYWD 4JFMA 3ZGQA 4N2SA 3ZVVA 3UT8A 2PM6A 3NZSA 3I5PA 3KACA 4KVMA 3ASGA 2DG9A 5DIUA 3ARZA 3QWVA 3U64A 5FWQA 2Y4TA 3IEGA 2CHZA 4J8EA 4UI9J 2J07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA0 A;  4U07 A;  5HTG A;  3QWP A;  3CGM A;  4DT4 A;  4ABN A;  5FZR A;  2VGY A;  3H9R B;  2PL2 A;  4IPX A;  3KCE A;  5EKQ D;  3MV3 B;  1PBK A;  3ULQ A;  3NF1 A;  4NNR A;  2Q7F A;  3PA7 A;  2WPV A;  1R9H A;  3RGC A;  4N2Q A;  1NMV A;  3KZ7 A;  2XPB A;  4H7Y A;  2AWG A;  5DIZ A;  3E4B A;  2XP5 A;  5HWB A;  3UPV A;  3GPK A;  2MLY A;  2XP3 A;  4CDR A;  4DRN A;  1YW5 A;  4GPK A;  4DRH A;  1HH8 A;  2ZQV A;  3PRD A;  2VCD A;  1QZ2 A;  1ZK6 A;  2PQR A;  2E2E A;  2FEZ A;  4GZ5 A;  5HUA A;  2Y78 A;  2XP8 A;  4FAP A;  2PV1 A;  5I98 A;  2PPN A;  1Y8M A;  4ITZ A;  1FKS A;  3CK9 A;  3ASH A;  1A17 A;  2VGX B;  5CHE E;  2VSY A;  4LEU A;  4I2Z A;  2L6J A;  1EYM A;  4J0U A;  5BXJ A;  4B94 A;  5J6E A;  3QDN A;  3GYZ A;  4BTB A;  1ZCN A;  3UQA A;  1F8A B;  5LCW J;  3TAX A;  4U84 A;  3UF8 A;  2AVP A;  3VTY A;  1ELW A;  3U4T A;  4U04 A;  1Y0O A;  5FZQ A;  1Q6H A;  4GYO A;  3PDN A;  3HYM B;  3NTP A;  2LNI A;  4KBQ A;  4G2P A;  2PBC A;  4IQC A;  5JJT A;  3KAB A;  4U85 A;  3S7D A;  3TG4 A;  3GW4 A;  3O5R A;  3CGN A;  1EQ3 A;  4MSP A;  4I1A A;  4ODR A;  3QKY A;  4MGV A;  3S7J A;  2MHK A;  5G05 C;  5CCM A;  3BEE A;  1Q1C A;  4GZ3 A;  2DG4 A;  2L2S A;  3AS5 A;  1B6C A;  1NMW A;  1ROU A;  5JJ6 A;  4JYS A;  4BT9 A;  3KAI A;  5KJN A;  3TC5 A;  4IQ2 A;  3OOB A;  3CVL A;  3KAF A;  4QIB A;  4UQZ A;  4U0U A;  2V5F A;  5BT1 A;  3LY7 A;  2F4E A;  3VTX A;  3IKD A;  3VAW A;  2Y4U A;  3KD7 A;  4C02 B;  1QPF A;  3LUO A;  5HQ8 A;  3NI6 A;  5EX0 A;  2RUQ A;  2KI3 A;  3UQI A;  3UI6 A;  3ZPJ A;  4G26 A;  4CGV A;  3OXF A;  3TGO A;  4U0Z A;  3K9I A;  1PC2 A;  3JYJ A;  5HT1 A;  2QFC A;  3UI4 A;  1YA0 A;  3MA5 A;  1KT1 A;  3ASF A;  2F2D A;  1OUV A;  4ODK A;  4GA1 A;  3RFW A;  5HW6 A;  5EX3 A;  4GGQ A;  5HWC A;  3NRK A;  2UWJ G;  2XP9 A;  4HOR A;  3KAD A;  4I17 A;  3Q49 B;  2IFU A;  4TW6 A;  2ZR6 A;  2I6H A;  2MNT A;  3RO3 A;  3SZ7 A;  2M1I A;  2MLZ A;  4ODP A;  3RO2 A;  2LPV A;  4J8D A;  2Q5A A;  4AY5 A;  2KAT A;  2XGS A;  5JJ7 A;  1ROT A;  3CV0 A;  1FKI A;  4DRK A;  3O5O A;  2P58 C;  5DBK A;  4JFJ A;  4W9O A;  3UI5 A;  2MPH A;  4YND A;  2K8I A;  2FBN A;  2KE0 A;  2KR7 A;  1W26 A;  4I2W A;  3O5P A;  2OND A;  5HW7 A;  3O5F A;  3CK8 A;  1KLX A;  3TDB A;  4HOU A;  4RG9 A;  4UI9 C;  4F3V A;  4RG6 A;  4DRJ A;  5ARG A;  3O5I A;  3KS2 A;  2UY1 A;  3ZHE A;  3N71 A;  3B7X A;  1FCH A;  4XI9 A;  4A1S A;  1YAT A;  2RUD A;  5HI7 A;  2PPP A;  4DRO A;  3RU0 A;  3UQB A;  1ZU2 A;  5G04 J;  2XCB A;  4LAX A;  5DIV A;  1FKL A;  4GZ6 A;  3JXV A;  4WUY A;  4DH0 A;  4DRP A;  1J6Y A;  5A7D B;  1D7J A;  2FI7 A;  1FKH A;  2BUG A;  1FKF A;  1IHG A;  2JLB A;  2RQS A;  4TYO A;  1IYG A;  2FF4 A;  4IN3 B;  1NA3 A;  2XP4 A;  3O5E A;  4G25 A;  2VYI A;  5GPG A;  3LY9 A;  3FFL A;  4HOQ A;  5C1D A;  3O5D A;  4JL0 A;  1TCO C;  3RIB A;  2RSE A;  2JZV A;  3I6C A;  1KT0 A;  3PRB A;  4FN2 A;  2ZQT A;  2HYZ A;  4TW7 A;  4KYO B;  4Y6W A;  5BW8 C;  2GW1 A;  4BF8 A;  5A6C A;  5D0Q D;  4U0S A;  5B8I C;  3KAH A;  4JFI A;  2RUR A;  3AS4 A;  1D7I A;  4G1T A;  3ASD A;  3UUX A;  2J9Q A;  4XI0 A;  3O5G A;  4N5C A;  5LCW C;  1FKT A;  2ZQU A;  3RKV A;  3MEK A;  3CEQ A;  2KCV A;  4BTA A;  2KGJ A;  4EQF A;  4HOT A;  3MKR A;  2IF4 A;  3Q5M A;  4YVQ C;  4DZ3 A;  2ZR5 A;  1L1P A;  2VGX A;  1BKF A;  3LKU A;  5DIT A;  5FZS A;  3FAP A;  4HOS A;  1B89 A;  3CKC A;  4UI9 K;  2XPA A;  3OXG A;  3LCA A;  5FTP A;  4DRQ A;  1J4H A;  2LKN A;  4UQY A;  3R9A B;  4O6F A;  3LYA A;  2VN1 A;  4G24 A;  4W9Q A;  3GZ1 A;  2RUC A;  2KO7 A;  2R5S A;  3PE4 A;  3O5J A;  2UY1 B;  1P5Q A;  1JNS A;  4N3B A;  4LAW A;  2XEV A;  4Y6C A;  4WND A;  3IKG A;  4BWR A;  2PV3 A;  3JYS A;  2XP6 A;  4JFL A;  3CVQ A;  3FP3 A;  4GYY A;  3SF4 A;  5D75 A;  1FKJ A;  3ZN3 A;  2ZQS A;  4G2V A;  1FD9 A;  5HKG A;  1F40 A;  2PQN A;  1A7X A;  3WXX A;  5FT9 A;  3WH0 A;  2KCL A;  5BNW A;  3CK7 A;  4TW8 A;  3O5M A;  2KCK A;  3JYM A;  3MV2 B;  4GCN A;  4U86 A;  1FAP A;  1WM5 A;  2ZR4 A;  2OFN A;  3ODK A;  4W9P A;  4GYW A;  3KAE A;  2PPO A;  1N1A A;  3S7B A;  1BL4 A;  4GCO A;  4APO A;  5M72 A;  4KXK B;  1ZBP A;  2KFW A;  1J4I A;  4ODL A;  1QPL A;  4LAV A;  1ELR A;  2FAP A;  2YHC A;  1HZ4 A;  2LJ4 A;  1E96 B;  3IK8 A;  4NRH B;  1J4R A;  4O2T A;  5HW8 A;  3KAG A;  4JA9 A;  1FKD A;  1M5Y A;  1T11 A;  4JFK A;  4QT2 A;  3S7F A;  4W9R A;  1U79 A;  3QWW A;  2FO7 A;  2NC9 A;  1TJC A;  5D0O D;  3TG5 A;  2XGO A;  2OOE A;  1C9H A;  3IHZ A;  5KJM A;  4YVO A;  4N3C A;  3OXL A;  3CVN A;  4NQ0 A;  2ITK A;  2LGO A;  3EY6 A;  4ODQ A;  3TCZ A;  2XGM A;  1JVW A;  4AM9 A;  4DRI A;  2M08 A;  3FWV A;  2D9F A;  4LAY A;  4J4N A;  3O48 A;  2PZI A;  3URZ A;  4AIF A;  4J4O A;  3AS8 A;  3CKB A;  4TX0 A;  5KJL A;  3PE3 A;  2VQ2 A;  2MLX A;  4G23 A;  3LPZ A;  3RJV A;  4N39 A;  2F21 A;  4ME2 A;  4H7X A;  5G04 C;  5G05 J;  1QQE A;  2KC7 A;  1WAO 1;  3Q4A B;  2XCC A;  4CGW A;  1FKR A;  2XP7 A;  2FKE A;  4AY6 A;  3Q15 A;  3O5Q A;  1XNF A;  4N3A A;  1HXI A;  4JHR A;  1Q6I A;  1FJD A;  4N19 A;  5CCL A;  1NSG A;  4BT8 A;  1D7H A;  2LSU A;  2C2L A;  4UQX A;  5KJK A;  4ODO A;  2MF9 A;  2XPI A;  3UQ3 A;  3QOU A;  3GZ2 A;  3U3W A;  2WQH A;  4DIP A;  2HR2 A;  1PIN A;  2UZ5 A;  1Q6U A;  4DRM A;  4JA7 A;  2YQ8 A;  2M2A A;  4QT3 A;  3O5K A;  3EDT B;  4WNE A;  4ODM A;  2HO1 A;  4I9C A;  1HXV A;  2C0M A;  1FKG A;  4XIF A;  4GA0 A;  3ZFW A;  4G50 A;  2DBA A;  3ZHE B;  3ESK A;  5AYW D;  2DG3 A;  4JFM A;  3ZGQ A;  4N2S A;  4R0X A;  4TNS A;  2N87 A;  5ARF A;  3CVP A;  3KAC A;  4J8F A;  3O5L A;  2LSV A;  1W3B A;  1FKB A;  4GA2 A;  3ASG A;  2DG9 A;  4WNF A;  1FKK A;  5DIU A;  5FJY A;  4DZ2 A;  2C0L A;  2VSN A;  3MDY B;  3QWV A;  1NZN A;  4ODN A;  1D6O A;  3Q47 B;  4GIV A;  2Y4T A;  3IEG A;  1JNT A;  4J8E A;  2PV2 A;  3LY8 A;  4WNG A;  4I9E A;  4UI9 J; 
#chains in the Genus database with same CATH topology
 1NA0 A;  5HTG A;  2VGY A;  4JHK A;  3ULQ A;  1OCR E;  2WXQ A;  5DO2 A;  4H7Y A;  2AWG A;  4JEH A;  1JCH B;  3E4B A;  3AG1 E;  5HWB A;  4FC8 A;  2XS8 A;  2MLY A;  1SW6 A;  4CDR A;  1EIB A;  1JCS A;  1HH8 A;  2ZQV A;  3PRD A;  4WAF A;  2VCD A;  3BU8 A;  1TFV A;  2RFM A;  3BQO A;  4GU5 A;  3RM4 A;  4L7T A;  3SHF A;  4ZPT R;  1AWC B;  1Z6T A;  3UIO C;  3WL0 A;  2PV1 A;  3UI2 A;  5I98 A;  5T3R A;  1FT1 A;  4M3O A;  2HM8 A;  4F7A A;  3CK9 A;  5CHE E;  2VGX B;  4AVX A;  4MNL A;  3UT7 A;  2L6J A;  4UUC A;  5BXJ A;  1OGG A;  3PR9 A;  3QDN A;  1QNF A;  3GYZ A;  1TNU A;  3TWW A;  3SNX A;  3ZXP A;  2PNN A;  3U4T A;  4U04 A;  3HIZ A;  1OWM A;  5ITZ F;  4L3N A;  5EID A;  2KZT B;  2IUZ A;  1E44 A;  3G2U A;  1Q2Z A;  4GYO A;  4EZL A;  1G3N B;  2LNI A;  3FEX A;  1TN6 A;  4V3I A;  2BKK B;  1N0R A;  3FXY A;  4U85 A;  5EIB E;  3GW4 A;  3O5R A;  3CGN A;  3UMV A;  4MSP A;  1WY6 A;  4TXQ A;  4HLE A;  3FEY A;  2WQ6 A;  3KSL A;  4UWF A;  4BSX A;  2I2O A;  5CMW A;  4CZ2 D;  4EEC A;  1ROU A;  5JJ6 A;  1MX2 A;  4IQ2 A;  2V5Q C;  3KAF A;  4QIB A;  2V5F A;  3LY7 A;  3TL5 A;  3KD7 A;  4C02 B;  2ETB A;  3LUO A;  3WG7 E;  2RUQ A;  3ARX A;  1SZ9 A;  2OVB A;  4CGV A;  3RAU A;  4KMO A;  1PC2 A;  4ANX A;  3UI4 A;  1O1S A;  1UR8 A;  3ASF A;  2F2D A;  4ODK A;  3GZS A;  5EX3 A;  1NWU A;  5HWC A;  1GRJ A;  4MRU A;  4IRU A;  2XP9 A;  2BED A;  3ZIM A;  2IFU A;  2I6H A;  1W9P A;  1MZC A;  3RK6 A;  3RO3 A;  2WXJ A;  5AJL A;  3P1U A;  4IUL A;  5HRY A;  4D10 C;  3V79 K;  3C3R A;  2Q5A A;  2KAT A;  3B95 A;  4K5B A;  2IEJ A;  3FTX A;  5JJ7 A;  1N54 A;  3CV0 A;  3OA5 A;  1GUV A;  2XRY A;  3T9K A;  5DBK A;  4KZC A;  4W9O A;  1FT2 A;  4YND A;  2KR7 A;  3FUN A;  4I2W A;  3ARR A;  2V0P A;  1LL6 A;  3O5F A;  3TDB A;  4UI9 C;  3U9W A;  4RG6 A;  2EIJ E;  4WIW A;  5ARG A;  3O5I A;  4ATG A;  3ART A;  3ZHE A;  3CZ8 A;  3B7X A;  4ILH B;  1E7U A;  4BER A;  3PUK A;  4LAX A;  5DIV A;  4U8H A;  4WUY A;  4DH0 A;  4J6I A;  1HG5 A;  2IQC A;  5A7D B;  1ZBC A;  2BUG A;  3FTY A;  1IHG A;  3FUE A;  1IQR A;  1H0I A;  4TYO A;  5B3S E;  3B13 A;  1NA3 A;  2XP4 A;  3FU6 A;  1JNE A;  5EYL A;  1OWP A;  4DJA A;  1OGB A;  1TCO C;  3J5P A;  2A5E A;  5AJD A;  4NZC A;  4HRL A;  4EPZ A;  4I1O B;  1HKK A;  1KT0 A;  1YMP A;  4EBA G;  3D9I A;  4A63 B;  3CHP A;  2WQ7 A;  1OXJ A;  1N95 A;  2RFA A;  4Y6W A;  4U95 D;  1LF8 A;  2GW1 A;  4Z2J A;  3SD5 A;  5D0Q D;  4U0S A;  1OCZ E;  4ACL A;  2ETN A;  5CRU A;  2L0I A;  1D7I A;  4E6H A;  2IOL A;  3ASD A;  3SFX A;  3HVE A;  3RME A;  3O5G A;  3QK0 A;  1TR4 A;  4HVB A;  1LG2 A;  4OVU A;  3RRM B;  4HI8 A;  3SBS A;  4B89 A;  2IF4 A;  3L08 A;  3MCX A;  3Q5M A;  3AU5 A;  1L1P A;  1BKF A;  5FZS A;  1IX5 A;  4YDE A;  2P9K G;  2Y3A A;  2XPA A;  1MYO A;  5FTP A;  1N4P A;  2B0O E;  3C72 A;  4MLP A;  1ZB1 A;  3LYA A;  4W9Q A;  3GZ1 A;  3VLF A;  2RUC A;  2KO7 A;  3CVV A;  1P5Q A;  2BTD A;  4LAW A;  1D8D A;  4Y6C A;  3IKG A;  4BWR A;  2PV3 A;  1O1R A;  3D9L A;  3SF4 A;  4G2V A;  5HKG A;  4HFG A;  2WM0 A;  3L54 A;  4JZY A;  4OAU C;  2ETC A;  2KCL A;  3DSS A;  5BNW A;  2GGF A;  3CK7 A;  2IY0 C;  3JYM A;  2EIK E;  4GCN A;  5AQ9 A;  1FAP A;  1WM5 A;  2DZN A;  3C98 A;  2OFN A;  4W9P A;  5AAR A;  2QZA A;  1N1A A;  3S7B A;  4QFV A;  1BL4 A;  3CHM A;  3ZXS A;  1DC2 A;  3RM9 A;  4KXK B;  4PS3 A;  2KFW A;  4ODL A;  5CEA A;  2LJ4 A;  1E96 B;  3IK8 A;  2VSO E;  3MKQ A;  2J07 A;  3V2X A;  3KAG A;  4JA9 A;  5ENO D;  1T11 A;  2LO6 A;  3MGB A;  3DBS A;  1N52 A;  2YIN A;  1U79 A;  2FO7 A;  1DCE A;  3CQC B;  1ITX A;  4YVO A;  1WAW A;  4NQ0 A;  1E15 A;  4DRI A;  1BI7 B;  2D9F A;  4U8V D;  3C3Q A;  3PZ1 A;  1U2V G;  3CKB A;  3JUI A;  3PE3 A;  2QY7 A;  1BI8 B;  2MLX A;  3FU3 A;  3NZU A;  3OAW A;  3DSW A;  5G05 J;  1QQE A;  4GTQ A;  2KC7 A;  3FU0 A;  3Q15 A;  1E9L A;  1HU3 A;  4JHR A;  1LL7 A;  3G2W A;  5ENS D;  4DLQ A;  4N19 A;  5LOZ A;  1K1A A;  2F8X K;  1JCQ A;  4HXI A;  1HJX A;  4XKC A;  2X38 A;  3TXM A;  2HR2 A;  3IHV A;  2GRN B;  3QJZ A;  1EDQ A;  1HKM A;  4JB8 P;  2A5U A;  3LXU X;  2IO3 C;  2HO1 A;  4I9C A;  2ESC A;  4URI A;  2LXM A;  4GA0 A;  4XIF A;  5EYP F;  5FQ7 A;  2IJG X;  2DBA A;  5JHA A;  3DXM G;  3WD0 A;  4YDO A;  4LCT A;  4TNS A;  3UX4 A;  4DWS A;  4ATZ D;  5ARF A;  3PH0 C;  1PY1 A;  3ISM C;  1GPF A;  1WNO A;  3O5L A;  2LSV A;  3ABL E;  1H2T C;  3D9P A;  4WNF A;  2WLY A;  2C0L A;  2VSN A;  1KZP A;  4CEM A;  4JHJ A;  5HKP A;  2VSX E;  3Q47 B;  4G8K A;  4GIV A;  4IT6 A;  3ENE A;  3LY8 A;  4MNM A;  5E75 A;  4A3V A;  3ARV A;  4U07 A;  3CGM A;  2H6H A;  4DT4 A;  1GW6 A;  4DX5 D;  3FUM A;  1OWN A;  5FZR A;  2PL2 A;  4DI3 A;  5EKQ D;  3MV3 B;  1IHB A;  2Q7F A;  1FVH A;  4I6E A;  3PA7 A;  4N2Q A;  5JH8 A;  2XPB A;  5BXU A;  4QZV B;  2YBT A;  3AS2 A;  1TN8 A;  3GPK A;  2B6C A;  4GPK A;  3B7B A;  4GZ5 A;  1E6N A;  4O60 A;  2DPE A;  1PAQ A;  2PPN A;  3R7Q A;  4ITZ A;  3TWR A;  3EIQ C;  1A17 A;  2VSY A;  4Z2H A;  4I2Z A;  2J08 A;  4PS7 A;  3T5V A;  5AQB A;  5D66 A;  4BTB A;  1ZCN A;  3TAX A;  3VLE A;  4U84 A;  4B8C B;  3UF8 A;  1Y6I A;  2RKK A;  1ELW A;  2P9U G;  3TWV A;  3IBE A;  1ZL1 A;  1EHN A;  2MYO A;  1A5E A;  2O92 A;  4KBQ A;  4KZ0 A;  4BX9 A;  1LG1 A;  2XS1 A;  2WXI A;  4K5A B;  5JJT A;  3S7D A;  2IU1 A;  2AXU A;  1EQ3 A;  5EN5 D;  1H6P A;  1JUQ A;  1UJJ A;  2WXH A;  4A3T A;  4MGV A;  4BET A;  2MHK A;  4FHJ A;  5G05 C;  1Q1C A;  4GZ3 A;  1BD8 A;  3V30 A;  2L2S A;  4XZ4 A;  1S63 A;  5FQ6 A;  1NMW A;  3NQP A;  3KAI A;  3DPD A;  1HFA A;  4FJY A;  3OOB A;  4JC8 A;  4U0U A;  4C0M A;  4DX1 A;  2VJ8 A;  5ENT D;  1QPF A;  3NI6 A;  5EX0 A;  3UM2 A;  1H6O A;  3FTS A;  3OXF A;  3TGO A;  3AJI A;  4U0Z A;  3RRU A;  5HT1 A;  2QFC A;  3MA5 A;  4DX6 D;  1OUV A;  4GA1 A;  3ASN E;  5HW6 A;  4KT6 B;  4Z2I A;  3KAD A;  1N4Q A;  4EHM A;  2QYU A;  3FUK A;  3Q49 B;  4TW6 A;  5BV0 A;  3CVY A;  1UR9 A;  2MLZ A;  4ODP A;  3RO2 A;  1NWS A;  4Z2K A;  2LPV A;  1MX6 A;  3G2S A;  1E90 A;  3Q9U C;  2AW6 A;  1FKI A;  1K9T A;  4DRK A;  3O5O A;  1ZBW A;  5AAO A;  4L2Y A;  4JFJ A;  3AQU A;  4L23 A;  2K8I A;  2FBN A;  2KE0 A;  2ZIS A;  5FQ8 A;  3AS0 A;  1S0P A;  1VDY A;  1U3D A;  4HOU A;  3EHR A;  4RG9 A;  1DCQ A;  3E32 A;  4F3V A;  1FFQ A;  3G2V A;  2UY1 A;  3N71 A;  1FCH A;  1UW4 B;  1EPU A;  4Z2L A;  2OLH A;  5HI7 A;  2F8Y A;  1HG2 A;  1HX8 A;  4DRO A;  3IXE A;  3UT4 A;  3UQB A;  3CST A;  3FTU A;  4GZ6 A;  3JXV A;  4B8A A;  1K1B A;  4I6J A;  5IY5 E;  2WXP A;  1FKF A;  2I1K A;  3GU0 A;  1H0G A;  4ZPW R;  1IYG A;  4IN3 B;  5CRV A;  2YBU A;  4XE0 A;  4I6G A;  1E8Z A;  2R02 A;  3RIB A;  4U96 D;  1L5J A;  4LNU D;  2JZV A;  5KNG A;  3MX3 A;  5FIN A;  1QBQ A;  2PN0 A;  2ZQT A;  3DSU A;  5BW8 C;  3EIJ A;  4OVV A;  4IYP A;  2DYR E;  3UTM A;  5A6C A;  2GRP B;  2QF8 A;  5B8I C;  3Q7F A;  4X8Q A;  5KNH D;  2A4Z A;  5LFA A;  2R03 A;  2XZT G;  1LQ0 A;  1W9U A;  3PZD A;  4N5C A;  2ZQU A;  3RKV A;  3MEK A;  3HXC A;  2P9P G;  2EIM E;  3G2T A;  2WLZ A;  4YVQ C;  2X6K A;  2DSW A;  5CER B;  1B89 A;  3PUJ A;  4HOS A;  3BG0 B;  1LTX A;  3T5X A;  3LCA A;  4DRQ A;  1ZBK A;  1J4H A;  3Q75 A;  3QC1 A;  4O6F A;  2WXO A;  4GTS A;  2UY1 B;  4MNK A;  2H6G A;  3BMB A;  3ZKJ A;  2XEV A;  1NP7 A;  3JYS A;  2XP6 A;  3CVQ A;  5JA4 D;  3F6Q A;  2FUL A;  4GYY A;  4JEU A;  1N4R A;  4AY1 A;  5D75 A;  1FKJ A;  3FH5 A;  4GZD A;  2PQN A;  3WKZ A;  2R59 A;  1A7X A;  3ARY A;  1NI1 A;  2Y0B G;  3WH0 A;  4Q22 A;  3AS3 A;  4U86 A;  3CHC A;  1BLX B;  2P9S G;  3ODK A;  4UDM A;  1N0Q A;  5GQB A;  4WKF A;  5JHB A;  3S2A A;  1XGW A;  4APO A;  1FPP A;  1Z5S C;  1ZBP A;  4K5C A;  2ILR A;  1WB0 A;  1ELR A;  3R7R A;  3KEZ A;  3ONL A;  2WVI A;  3CLJ A;  2OEW A;  1OT8 A;  2DVW A;  4CDN A;  2XHE A;  2VGE A;  1E8W A;  4TUU A;  5BV1 A;  4FA6 A;  5HW8 A;  1W1P A;  4Q7N A;  3ARO A;  1M5Y A;  2M63 A;  4J8Y A;  4QT2 A;  3AU4 A;  3QWW A;  1SR0 A;  2NC9 A;  4UWG A;  2XGO A;  1XHG A;  4ODQ A;  4HRM B;  3V31 A;  4J4N A;  4ZPV R;  3CHO A;  4CDM A;  4XKB A;  4CYM D;  4G8L A;  3QB2 A;  3CIA A;  4C9B B;  3RJV A;  4ME2 A;  2G41 A;  4H7X A;  2NYJ A;  3MJW A;  4YDW A;  1IXV A;  3PZ3 A;  2XCC A;  4P29 A;  4AY6 A;  1AP7 A;  4GTM A;  3O5Q A;  1XNF A;  2L6B A;  4DI4 A;  1Q6I A;  2P9N G;  5T4Y A;  1DVP A;  2NXP A;  1S64 A;  5E76 A;  3E34 A;  4BT8 A;  1NFI E;  1D7H A;  5AQA A;  2LSU A;  2C2L A;  1KZO A;  5KJK A;  1TJF A;  3QOU A;  4GB9 A;  3GZ2 A;  4OYS A;  2WQH A;  2UZ5 A;  1RW2 A;  1Q6U A;  4DRM A;  3BUA A;  5J08 A;  3IKO B;  2R17 C;  3EDT B;  3PZ2 A;  4PUC A;  4GTO A;  4AP2 A;  2C0M A;  3VLD A;  3ZFW A;  3ZYQ A;  5BUZ A;  4G50 A;  3R9M A;  3ZHE B;  4R7L A;  4R0X A;  1W3B A;  1FKB A;  1E6R A;  5BPP A;  4DZ2 A;  2EQX A;  3SY2 A;  4TRQ A;  1D6O A;  4URK A;  4YDY A;  4P8X A;  3FUI A;  3HXE A;  4I9E A;  1IQU A;  2F37 A;  3LDZ A;  1JND A;  3CR3 A;  2GRR B;  3H9R B;  4IPX A;  4RQI A;  3KCE A;  3HRA A;  5HBF A;  1PBK A;  3NF1 A;  2NSZ A;  2WXG A;  4C0E A;  2WPV A;  3RGC A;  4KR0 B;  2DIW A;  4S3J A;  3UKU G;  2XP5 A;  4BEP A;  4ML4 A;  4L9P A;  1MX4 A;  1TNB A;  2XP3 A;  3LVQ E;  1YW5 A;  1QZ2 A;  2Y69 E;  1ZK6 A;  4JW1 A;  2X6H A;  4LG6 A;  3RSE G;  2E2E A;  4HBE A;  3HVE B;  1H2U A;  2LXL A;  4ACK A;  5HUA A;  2Y78 A;  4HLL A;  3B9A A;  5KWD A;  2J8S D;  3ZEF A;  1Z3X A;  1FKS A;  3ASH A;  1LD8 A;  3L22 A;  2DCP A;  4LEU A;  2XPY A;  4M7C A;  2F23 A;  3O4Z A;  4MS6 A;  3DSV A;  3UIP C;  5J6E A;  3EU5 A;  3PRE A;  3ZRH A;  1JCR A;  2J09 A;  5LCW J;  2X3M A;  2AVP A;  3VTY A;  3FU5 A;  5FZQ A;  2VTB A;  4K0R A;  3PDN A;  4NUR A;  3HYM B;  4K03 A;  2O9O A;  4GTV A;  3DEO A;  1EYH A;  3JCK C;  1K8K G;  1SZA A;  1W1T A;  1TN7 A;  3CVU A;  1H2V C;  2DSU A;  2WXM A;  2DT0 A;  2ZGD A;  2AOS A;  3KAB A;  3TG4 A;  3W9F A;  1X81 A;  3X2Q E;  2ZGG A;  3EHN A;  4FAD A;  3ARQ A;  2G8Z A;  3S7J A;  4LGX A;  3BEE A;  3W9G A;  4Z2G A;  3AS5 A;  1B6C A;  3EHM A;  3ALG A;  2XPZ A;  5KJN A;  3UM0 A;  3TC5 A;  4R5E A;  1KFW A;  2YNQ A;  3AG4 E;  3SI5 A;  3CVL A;  3MKQ B;  4L1B A;  5G2N A;  1K3Z D;  4UQZ A;  1OWO A;  3VAW A;  5HQ8 A;  2JEK A;  4IT4 A;  3UKR G;  3PRZ A;  4G26 A;  2WXL A;  2CFZ A;  3JYJ A;  3ML9 A;  1TNZ A;  1YA0 A;  1XRV A;  2V4L A;  4OAV B;  4RSY A;  3U66 A;  3D9N A;  3ZU7 B;  2J49 A;  3APF A;  4MAV A;  3NRK A;  2UWJ G;  1RZ4 A;  2ION A;  3SFY A;  4I17 A;  1BPO A;  3ZYM A;  2ZR6 A;  2MNT A;  4HB5 A;  3WD1 A;  3SZ7 A;  1YCS B;  4J7W A;  3ASO E;  2WB2 A;  4AY5 A;  4DWS C;  5DEZ A;  2AXZ A;  5AEN A;  3PS6 A;  1UOH A;  1ROT A;  3ARS A;  3D3M A;  4CCA A;  2P58 C;  4U63 A;  3UI5 A;  4U8Y D;  1RD6 A;  1FVF A;  4DX7 D;  1W26 A;  4FU3 A;  4FUL A;  3ARP A;  3CK8 A;  3L16 A;  4HQD A;  4F6R D;  5KCM A;  4DRJ A;  3NOG D;  5LP0 A;  4NIK A;  3B8S A;  3ARU A;  4XI9 A;  3ZYL A;  3EJN A;  4J8S A;  2RUD A;  2CHX A;  2PPP A;  3AG2 E;  1ZU2 A;  3HDX A;  2XCB A;  4WJX A;  2WMO A;  3UXG A;  3HXD A;  3ZUV B;  3PEU B;  1D7J A;  3QNK A;  1FKH A;  5ENQ D;  2JLB A;  2RQS A;  3O5E A;  2H6I A;  4DLO A;  4CT4 A;  4G25 A;  5GPG A;  3LY9 A;  1LD7 A;  4I43 A;  3FFL A;  4HI9 A;  3UIN C;  4JL0 A;  4MBG A;  4DWS B;  1INZ A;  1E8X A;  2DYS E;  3DEP A;  4FN2 A;  3FY1 A;  4XX5 A;  2ZU6 B;  3SO8 A;  2E0I A;  2HYZ A;  4TW7 A;  4JPS A;  4KYO B;  2FDM A;  3FY4 A;  1SVX A;  4FLH A;  3NBN B;  1OCO E;  3AS4 A;  4ILG A;  4G1T A;  2CG2 A;  2J9Q A;  5LCW C;  2KCV A;  4BTA A;  4UWK A;  3CHD A;  4EZK A;  4EQF A;  4HOT A;  3MKR A;  4O1P A;  3D9O A;  1X6N A;  4DK5 A;  4DZ3 A;  2GRQ B;  1IKN D;  1SQM A;  2VGX A;  3ESL A;  3ZYK A;  1H19 A;  2B5U B;  3WQW A;  3FAP A;  4ILI A;  4BSZ B;  3CKC A;  3QOK A;  4ANV A;  4GTP A;  3FH8 A;  4GTR A;  2LKN A;  5ANR A;  4E85 A;  4GTT A;  4C48 B;  4TXP A;  2R5S A;  3O5J A;  1N9A A;  3WD2 A;  4N3B A;  4WND A;  2KZT A;  4JFL A;  3D9H A;  3FP3 A;  4B93 B;  3ZN3 A;  1FD9 A;  4ANW A;  5BXO A;  3PVL A;  1GOI A;  1F40 A;  1CTN A;  2XQ0 A;  3E33 A;  3WXX A;  5CBN A;  3UM3 A;  3DRA A;  4Z68 A;  1NWR A;  1S70 B;  1NL4 A;  2KCK A;  3MV2 B;  3G6L A;  1D9S A;  4BX8 A;  2MRI A;  2KM4 A;  3ONK A;  1HJV A;  1MQS A;  4I1M A;  2PPO A;  2R05 A;  3GTY X;  4FLB A;  4GCO A;  4BES A;  2WK2 A;  5M72 A;  4GMJ A;  3EHQ A;  4HBD A;  4TUM A;  1J4I A;  3EUV A;  2FAP A;  1SA5 A;  3ZW3 A;  1HZ4 A;  4GPM A;  2ZXW E;  1J4R A;  3NAW A;  4CRW A;  1V55 E;  4UWH A;  1HJW A;  3Q9N C;  3SGH A;  4O1O A;  2CFU A;  3S7F A;  3CVW A;  1JWG A;  4RVB A;  3TG5 A;  5KJM A;  3BXW A;  4N3C A;  3CVN A;  1HKJ A;  2ITK A;  2XGM A;  4AM9 A;  4TXR A;  4UWL A;  2PZI A;  3URZ A;  3CHS A;  3AS8 A;  3Q7A A;  3L9T A;  5C2Y A;  4CT0 A;  3PEV B;  3MZL B;  4TX0 A;  5KJL A;  3PRA A;  3LPZ A;  3WQV A;  3CHE A;  4N39 A;  3TWS A;  1QYM A;  4PTM A;  1WAO 1;  3Q4A B;  3TXN A;  2MOW A;  5AQ7 A;  1BU9 A;  2EUL A;  2WXK A;  1HXI A;  3I4G A;  2OEV A;  4AV7 A;  3B7S A;  1NSG A;  5CMY A;  4WKH A;  4LER A;  2XPI A;  3U3W A;  3AG3 E;  3RM8 A;  3FUH A;  1MHQ A;  3DPY A;  2L0T B;  4LNG A;  4QT3 A;  4GMR A;  3B7U X;  3O5K A;  5D2M C;  4WNE A;  4ODM A;  4P8V A;  4ZHB A;  2CHW A;  2RG8 A;  3Q78 A;  5B1B E;  3FUL A;  2WMN A;  3CHQ A;  5LX8 A;  2AWI A;  3KSQ A;  2PM7 A;  3JXJ A;  3WL1 A;  3ESK A;  2DG3 A;  3EIP A;  2N87 A;  3CVP A;  1NH6 A;  4J8F A;  3ULY A;  4GA2 A;  1NWT A;  1FKK A;  4PS8 A;  5FJY A;  3MDY B;  2FO1 E;  1NZN A;  4ODN A;  1U3C A;  1JNT A;  2PV2 A;  4LSZ E;  4WNG A;  2I9C A;  4HNA D;  2XRZ A;  3QWP A;  4G11 A;  1W9V A;  4ABN A;  3CGH A;  2GRL A;  4W5U A;  4B0Z A;  3ABK E;  4GZC A;  4NNR A;  2L9B A;  1R9H A;  1NMV A;  3KZ7 A;  5DIZ A;  3SFZ A;  2BKG A;  3UPV A;  4LUN U;  1SA4 A;  4DRN A;  4A55 A;  4DRH A;  4MNJ A;  2PQR A;  1HO8 A;  5ENN A;  4GAA A;  3TWU A;  2FEZ A;  3SQV A;  2A3E A;  3FTZ A;  1SYT A;  3E30 A;  1ZBV A;  3NOC D;  3TWQ A;  1W1V A;  2XP8 A;  4FAP A;  3FUF A;  3D9J A;  1Y8M A;  5JMN D;  5ENP D;  1OCC E;  2AJA A;  3B9D A;  1EYM A;  4L2L A;  4KVO A;  4HS2 A;  3TJP A;  4J0U A;  4B94 A;  2KXP C;  4DUI A;  3UQA A;  1F8A B;  4WWP A;  2OV8 A;  2QC9 A;  3Q73 A;  4JXT A;  2P9I G;  1D2K A;  1Y0O A;  2GRM A;  1Q6H A;  5KBA A;  4BFR A;  3NTP A;  1UN8 A;  4G2P A;  2DZO A;  3ZNG A;  3CVX A;  2DT1 A;  1H6K A;  2PBC A;  4IQC A;  4NSB A;  3I4R B;  3FTW A;  2V4H C;  4I1A A;  4ODR A;  3QKY A;  3CH9 A;  3P2B A;  5CCM A;  2DG4 A;  3FUJ A;  4JYS A;  4BT9 A;  3MYV A;  1OY3 D;  3ABM E;  5BT1 A;  4AOF A;  2F4E A;  3VTX A;  3IKD A;  3LS8 A;  5DF0 A;  2Y4U A;  5HS0 A;  1HKI A;  3E37 A;  5ANL A;  3IHY A;  2KI3 A;  3UQI A;  3UI6 A;  3ZPJ A;  1O1T A;  3K9I A;  5G55 A;  3ALF A;  4N5Q A;  1KT1 A;  1TNO A;  3FH7 A;  3WD3 A;  3RFW A;  2PI6 A;  3JUE A;  4GGQ A;  2ZIR A;  2XEN A;  4PH4 B;  4HOR A;  3L82 A;  3FUD A;  1ELK A;  2AXV A;  3AAA C;  3QAR A;  1W1Y A;  3HXF A;  2M1I A;  1MJ0 A;  1YYH A;  1FFR A;  3WIJ A;  3UM1 A;  3ULE G;  1X5B A;  2JAB A;  4J8D A;  4NAC A;  4DPR A;  1TEZ A;  2QYJ A;  2XGS A;  3PNT B;  2OVF A;  2RD0 A;  3DST A;  4BY6 A;  1WDY A;  3IV0 A;  2MPH A;  3APD A;  2EIL E;  4U7E B;  1E6P A;  3O5P A;  2OND A;  5HW7 A;  4LRZ A;  5A23 A;  1KLX A;  1JPL A;  1OWQ A;  3LJ3 A;  1D8E A;  4JVS A;  4XAK A;  2WXN A;  3KS2 A;  2A3B A;  4A1S A;  2A3C A;  1YAT A;  5EDS A;  2IOS A;  3RU0 A;  5G04 J;  5EIL A;  1FKL A;  5GPR A;  2J4D A;  4KQZ A;  3B7T A;  4DRP A;  3CHR A;  1J6Y A;  2FI7 A;  3D9M A;  4Q69 A;  5AIJ A;  1V54 E;  2YHE A;  2P9L G;  4WKA A;  4JD2 G;  4ZFH A;  2FF4 A;  3ML8 A;  2VYI A;  4HAR A;  2DWZ A;  1DNP A;  3B7R L;  4MKT A;  4HOQ A;  5T8I A;  5C1D A;  3O5D A;  2I1J A;  1X6L A;  2LAI A;  2RSE A;  3EU9 A;  1O6I A;  3I6C A;  3PRB A;  4EBA A;  2H6F A;  4HBO A;  3Q79 A;  4WK9 A;  3T8M A;  2X6I A;  3NB2 A;  4FP7 A;  1H0A A;  2WM9 A;  4BF8 A;  3HHM A;  4A1G A;  2XZD G;  2DT3 A;  1HS6 A;  3KAH A;  4JFI A;  2RUR A;  1TNY A;  3TWX A;  2IO2 C;  3UUX A;  4XI0 A;  3HG0 D;  1FKT A;  3W4R A;  1HE8 A;  3CEQ A;  4F1P A;  1E6Z A;  2KGJ A;  1ZU8 A;  4FJZ A;  2LAH A;  2ZR5 A;  5FQ4 A;  3FDH A;  2DSZ A;  3LKU A;  5DIT A;  2OCC E;  2DT2 A;  5CED B;  2B31 A;  1Z3Y A;  4UI9 K;  4RLY A;  3OXG A;  4ANU A;  4UQY A;  2DSV A;  1LL4 A;  3R9A B;  2CG3 A;  2VN1 A;  4G24 A;  3DSX A;  3RRN B;  3PE4 A;  4GML A;  1JNS A;  1E8Y A;  1HF8 A;  3TWT A;  3SBT B;  1O5M A;  2KBX A;  4AJW A;  2WXR A;  2ZQS A;  4S3K A;  1UG3 A;  4DRX E;  1TYQ G;  3T8K A;  1WG0 A;  2X6J A;  3CSF A;  4DWS D;  5FT9 A;  3C3O A;  3QAQ A;  1N4S A;  3L13 A;  2XEH A;  3O5M A;  4TW8 A;  3FHE A;  2A3A A;  3C5R A;  3PNL B;  2ZR4 A;  4GYW A;  2V8S E;  3KAE A;  4QQI A;  3L6A A;  3AS1 A;  5H7P A;  3JXI A;  2VTB B;  1QPL A;  3BG1 B;  4EZJ A;  4LAV A;  1N11 A;  2YHC A;  5B1A E;  3FTV A;  4NRH B;  5FIO A;  1ZB5 A;  2P2C P;  3HXB A;  4L72 B;  4O2T A;  3JQ0 A;  4TV3 A;  4WWN A;  5CEC B;  1FKD A;  4JFK A;  4WWO A;  3ARW A;  4F1S A;  3J5Q B;  1EF1 C;  3D9K A;  3L17 A;  4W9R A;  4P8U A;  1TJC A;  5D0O D;  2OOE A;  1C9H A;  1VF8 A;  3IHZ A;  3OXL A;  2LGO A;  4P8W A;  3EY6 A;  3TCZ A;  1JVW A;  3APC A;  2M08 A;  2J4B A;  3FWV A;  1UJK A;  2LUH A;  4LAY A;  3O48 A;  3B9E A;  1LJY A;  4AIF A;  4J4O A;  2F0Y A;  2HE0 A;  2VQ2 A;  4ZS6 A;  4G23 A;  2F21 A;  2EIN E;  3I3N A;  3PZ4 A;  4AEZ C;  3LEW A;  5G04 C;  4APF A;  1EDU A;  2R2L A;  2BF0 X;  2Y1L E;  1OWL A;  4CGW A;  1N94 A;  1JWF A;  2GRO B;  1FKR A;  2XP7 A;  3OTN A;  2FKE A;  3V2O A;  4HRN A;  4N3A A;  1E7V A;  2ETA A;  3CHF A;  1FJD A;  2X6F A;  4F53 A;  2XEE A;  4MPK A;  5CCL A;  5ENR D;  4Q94 A;  4UQX A;  4ODO A;  2MF9 A;  4Q96 A;  3UQ3 A;  4DX2 A;  5CBO A;  4PDX A;  4DIP A;  1PIN A;  3DWL G;  3WD4 A;  4FHK A;  4AXH A;  4JA7 A;  4MTV A;  2YQ8 A;  2M2A A;  1UN9 A;  2WXF A;  5J90 A;  3LVR E;  4LNB A;  1HXV A;  3G6M A;  1FKG A;  3KEA A;  3JQ1 A;  3CQG B;  5AYW D;  1KPS B;  3ZGQ A;  4N2S A;  4JFM A;  3ZVV A;  3UT8 A;  2PM6 A;  3NZS A;  3I5P A;  4XEI G;  3KAC A;  4KVM A;  3ASG A;  2DG9 A;  2P4V A;  5AN8 A;  5DIU A;  3ARZ A;  3LJN A;  3QWV A;  3U64 A;  5FWQ A;  2Y4T A;  3IEG A;  2CHZ A;  4J8E A;  4UI9 J;  3DXK G; 
#chains in the Genus database with same CATH homology
 1NA0 A;  5HTG A;  2VGY A;  4JHK A;  3ULQ A;  2WXQ A;  5DO2 A;  4H7Y A;  2AWG A;  4JEH A;  3E4B A;  5HWB A;  4FC8 A;  2MLY A;  4CDR A;  1EIB A;  1HH8 A;  2ZQV A;  3PRD A;  4WAF A;  2VCD A;  1TFV A;  4GU5 A;  3RM4 A;  4L7T A;  3SHF A;  4ZPT R;  1Z6T A;  3WL0 A;  2PV1 A;  5I98 A;  5T3R A;  4M3O A;  2HM8 A;  4F7A A;  3CK9 A;  5CHE E;  2VGX B;  4AVX A;  4MNL A;  3UT7 A;  2L6J A;  5BXJ A;  1OGG A;  3PR9 A;  3QDN A;  1QNF A;  3GYZ A;  3SNX A;  3U4T A;  4U04 A;  3HIZ A;  1OWM A;  4L3N A;  2IUZ A;  2KZT B;  3G2U A;  4GYO A;  4EZL A;  2LNI A;  3FEX A;  4V3I A;  3FXY A;  4U85 A;  3GW4 A;  3O5R A;  3CGN A;  3UMV A;  4MSP A;  1WY6 A;  4HLE A;  3FEY A;  2WQ6 A;  4UWF A;  4BSX A;  2I2O A;  5CMW A;  4EEC A;  1ROU A;  5JJ6 A;  4IQ2 A;  3KAF A;  4QIB A;  2V5F A;  3LY7 A;  3TL5 A;  3KD7 A;  4C02 B;  3LUO A;  2RUQ A;  3ARX A;  1SZ9 A;  2OVB A;  4CGV A;  4KMO A;  1PC2 A;  4ANX A;  3UI4 A;  1UR8 A;  3ASF A;  2F2D A;  4ODK A;  3GZS A;  5EX3 A;  1NWU A;  5HWC A;  4MRU A;  4IRU A;  2XP9 A;  3ZIM A;  2IFU A;  2I6H A;  1W9P A;  3RK6 A;  3RO3 A;  2WXJ A;  5AJL A;  3P1U A;  4IUL A;  4D10 C;  2Q5A A;  2KAT A;  3FTX A;  5JJ7 A;  1N54 A;  3CV0 A;  3OA5 A;  1GUV A;  2XRY A;  5DBK A;  4KZC A;  4W9O A;  4YND A;  2KR7 A;  3FUN A;  4I2W A;  3ARR A;  2V0P A;  1LL6 A;  3O5F A;  3TDB A;  4UI9 C;  3U9W A;  4RG6 A;  4WIW A;  5ARG A;  3O5I A;  4ATG A;  3ART A;  3ZHE A;  3CZ8 A;  3B7X A;  4ILH B;  1E7U A;  3PUK A;  4LAX A;  5DIV A;  4U8H A;  4WUY A;  4DH0 A;  4J6I A;  1HG5 A;  2IQC A;  5A7D B;  1ZBC A;  2BUG A;  3FTY A;  1IHG A;  3FUE A;  1IQR A;  1H0I A;  4TYO A;  3B13 A;  1NA3 A;  2XP4 A;  3FU6 A;  1JNE A;  1OWP A;  4DJA A;  1OGB A;  1TCO C;  5AJD A;  4NZC A;  4EPZ A;  4I1O B;  1HKK A;  1KT0 A;  4EBA G;  3D9I A;  3CHP A;  2WQ7 A;  4Y6W A;  1LF8 A;  2GW1 A;  4Z2J A;  3SD5 A;  5D0Q D;  4U0S A;  4ACL A;  1D7I A;  2L0I A;  4E6H A;  2IOL A;  3ASD A;  3HVE A;  3RME A;  3O5G A;  3QK0 A;  4HVB A;  1LG2 A;  4OVU A;  3RRM B;  3SBS A;  4B89 A;  2IF4 A;  3L08 A;  3MCX A;  3Q5M A;  3AU5 A;  1L1P A;  1BKF A;  5FZS A;  1IX5 A;  2Y3A A;  2XPA A;  5FTP A;  4MLP A;  3LYA A;  4W9Q A;  3GZ1 A;  3VLF A;  2RUC A;  2KO7 A;  3CVV A;  1P5Q A;  2BTD A;  4LAW A;  4Y6C A;  3IKG A;  4BWR A;  2PV3 A;  3D9L A;  3SF4 A;  4G2V A;  5HKG A;  4HFG A;  2WM0 A;  3L54 A;  4JZY A;  2KCL A;  5BNW A;  2GGF A;  3CK7 A;  3JYM A;  4GCN A;  1FAP A;  1WM5 A;  3C98 A;  2OFN A;  4W9P A;  1N1A A;  3S7B A;  4QFV A;  1BL4 A;  3CHM A;  3ZXS A;  3RM9 A;  4KXK B;  4PS3 A;  2KFW A;  4ODL A;  2LJ4 A;  1E96 B;  3IK8 A;  2VSO E;  3MKQ A;  3KAG A;  4JA9 A;  1T11 A;  2LO6 A;  3MGB A;  3DBS A;  1N52 A;  2YIN A;  1U79 A;  2FO7 A;  3CQC B;  1ITX A;  4YVO A;  1WAW A;  4NQ0 A;  1E15 A;  4DRI A;  2D9F A;  3CKB A;  3JUI A;  3PE3 A;  2QY7 A;  2MLX A;  3FU3 A;  3NZU A;  3OAW A;  5G05 J;  1QQE A;  2KC7 A;  3FU0 A;  3Q15 A;  1E9L A;  1HU3 A;  4JHR A;  1LL7 A;  3G2W A;  4DLQ A;  4N19 A;  5LOZ A;  4HXI A;  1HJX A;  4XKC A;  2X38 A;  3TXM A;  2HR2 A;  3IHV A;  3QJZ A;  1EDQ A;  1HKM A;  2A5U A;  3LXU X;  2HO1 A;  4I9C A;  2ESC A;  4URI A;  4XIF A;  4GA0 A;  5FQ7 A;  2IJG X;  2DBA A;  5JHA A;  3WD0 A;  4LCT A;  4TNS A;  3UX4 A;  4DWS A;  5ARF A;  3PH0 C;  1PY1 A;  1GPF A;  1WNO A;  3O5L A;  2LSV A;  1H2T C;  3D9P A;  4WNF A;  2WLY A;  2C0L A;  2VSN A;  4CEM A;  4JHJ A;  2VSX E;  3Q47 B;  4GIV A;  4IT6 A;  3ENE A;  3LY8 A;  4MNM A;  5E75 A;  4A3V A;  3ARV A;  4U07 A;  3CGM A;  4DT4 A;  1GW6 A;  3FUM A;  1OWN A;  5FZR A;  2PL2 A;  4DI3 A;  5EKQ D;  3MV3 B;  2Q7F A;  1FVH A;  4I6E A;  3PA7 A;  4N2Q A;  5JH8 A;  2XPB A;  4QZV B;  2YBT A;  3AS2 A;  3GPK A;  4GPK A;  4GZ5 A;  1E6N A;  2DPE A;  1PAQ A;  2PPN A;  3R7Q A;  4ITZ A;  3EIQ C;  1A17 A;  2VSY A;  4Z2H A;  4I2Z A;  2J08 A;  4PS7 A;  3T5V A;  4BTB A;  1ZCN A;  3TAX A;  3VLE A;  4U84 A;  4B8C B;  3UF8 A;  1Y6I A;  1ELW A;  3IBE A;  1ZL1 A;  1EHN A;  2O92 A;  4KBQ A;  4KZ0 A;  4BX9 A;  1LG1 A;  2WXI A;  5JJT A;  3S7D A;  2IU1 A;  2AXU A;  1EQ3 A;  1JUQ A;  1UJJ A;  2WXH A;  4A3T A;  4MGV A;  2MHK A;  4FHJ A;  5G05 C;  1Q1C A;  4GZ3 A;  2L2S A;  4XZ4 A;  5FQ6 A;  1NMW A;  3NQP A;  3KAI A;  3DPD A;  1HFA A;  4FJY A;  3OOB A;  4JC8 A;  4U0U A;  4C0M A;  2VJ8 A;  1QPF A;  3NI6 A;  5EX0 A;  3FTS A;  3OXF A;  3TGO A;  4U0Z A;  3RRU A;  5HT1 A;  2QFC A;  3MA5 A;  1OUV A;  4GA1 A;  5HW6 A;  4KT6 B;  4Z2I A;  3KAD A;  3FUK A;  3Q49 B;  4TW6 A;  5BV0 A;  3CVY A;  1UR9 A;  2MLZ A;  4ODP A;  3RO2 A;  1NWS A;  4Z2K A;  2LPV A;  3G2S A;  1E90 A;  2AW6 A;  1FKI A;  1K9T A;  4DRK A;  3O5O A;  1ZBW A;  4L2Y A;  4JFJ A;  3AQU A;  4L23 A;  2K8I A;  2FBN A;  2KE0 A;  5FQ8 A;  3AS0 A;  1S0P A;  1VDY A;  1U3D A;  4HOU A;  4RG9 A;  4F3V A;  1FFQ A;  3G2V A;  2UY1 A;  3N71 A;  1FCH A;  1UW4 B;  1EPU A;  4Z2L A;  2OLH A;  5HI7 A;  1HG2 A;  1HX8 A;  4DRO A;  3UQB A;  3UT4 A;  3CST A;  3FTU A;  4GZ6 A;  3JXV A;  4B8A A;  4I6J A;  2WXP A;  1FKF A;  2I1K A;  1H0G A;  4ZPW R;  1IYG A;  4IN3 B;  2YBU A;  4XE0 A;  4I6G A;  1E8Z A;  3RIB A;  1L5J A;  2JZV A;  3MX3 A;  2ZQT A;  5BW8 C;  3EIJ A;  4OVV A;  4IYP A;  5A6C A;  2QF8 A;  5B8I C;  2A4Z A;  5LFA A;  1LQ0 A;  1W9U A;  3PZD A;  4N5C A;  2ZQU A;  3RKV A;  3MEK A;  3G2T A;  2WLZ A;  4YVQ C;  2X6K A;  2DSW A;  4HOS A;  1B89 A;  3PUJ A;  3BG0 B;  3T5X A;  3LCA A;  4DRQ A;  1ZBK A;  1J4H A;  3QC1 A;  4O6F A;  2WXO A;  2UY1 B;  4MNK A;  2XEV A;  1NP7 A;  3JYS A;  2XP6 A;  3CVQ A;  2FUL A;  4GYY A;  4JEU A;  4AY1 A;  5D75 A;  1FKJ A;  3FH5 A;  4GZD A;  2PQN A;  3WKZ A;  2R59 A;  1A7X A;  3ARY A;  3WH0 A;  4Q22 A;  3AS3 A;  4U86 A;  3CHC A;  3ODK A;  5GQB A;  4WKF A;  5JHB A;  3S2A A;  1XGW A;  4APO A;  1ZBP A;  2ILR A;  1WB0 A;  1ELR A;  3R7R A;  3KEZ A;  3ONL A;  2WVI A;  3CLJ A;  4CDN A;  2XHE A;  1E8W A;  4TUU A;  5BV1 A;  4FA6 A;  5HW8 A;  1W1P A;  4Q7N A;  3ARO A;  1M5Y A;  2M63 A;  4QT2 A;  3AU4 A;  3QWW A;  1SR0 A;  2NC9 A;  4UWG A;  2XGO A;  1XHG A;  4ODQ A;  4J4N A;  4ZPV R;  3CHO A;  4CDM A;  4XKB A;  3QB2 A;  3CIA A;  4C9B B;  3RJV A;  4ME2 A;  2G41 A;  4H7X A;  3MJW A;  2XCC A;  4P29 A;  4AY6 A;  3O5Q A;  1XNF A;  4DI4 A;  1Q6I A;  5T4Y A;  1DVP A;  2NXP A;  5E76 A;  4BT8 A;  1D7H A;  2LSU A;  2C2L A;  5KJK A;  1TJF A;  3QOU A;  4GB9 A;  3GZ2 A;  4OYS A;  2WQH A;  2UZ5 A;  1Q6U A;  4DRM A;  5J08 A;  3IKO B;  2R17 C;  3EDT B;  4PUC A;  4AP2 A;  2C0M A;  3VLD A;  3ZFW A;  3ZYQ A;  5BUZ A;  4G50 A;  3ZHE B;  4R7L A;  4R0X A;  1W3B A;  1FKB A;  1E6R A;  5BPP A;  4DZ2 A;  2EQX A;  1D6O A;  4TRQ A;  4URK A;  4P8X A;  3FUI A;  4I9E A;  1IQU A;  3LDZ A;  1JND A;  3CR3 A;  3H9R B;  4IPX A;  3KCE A;  5HBF A;  1PBK A;  3NF1 A;  2NSZ A;  2WXG A;  4C0E A;  2WPV A;  3RGC A;  4KR0 B;  2DIW A;  4S3J A;  2XP5 A;  4ML4 A;  2XP3 A;  3LVQ E;  1YW5 A;  1QZ2 A;  1ZK6 A;  4JW1 A;  2X6H A;  2E2E A;  4HBE A;  3HVE B;  1H2U A;  4ACK A;  5HUA A;  2Y78 A;  3B9A A;  3ZEF A;  1Z3X A;  1FKS A;  3ASH A;  3L22 A;  2DCP A;  4LEU A;  2XPY A;  3O4Z A;  4MS6 A;  5J6E A;  3PRE A;  3ZRH A;  2J09 A;  5LCW J;  2X3M A;  2AVP A;  3VTY A;  3FU5 A;  5FZQ A;  2VTB A;  4K0R A;  3PDN A;  4NUR A;  3HYM B;  4K03 A;  2O9O A;  3JCK C;  1EYH A;  1SZA A;  1W1T A;  3CVU A;  1H2V C;  2DSU A;  2WXM A;  2DT0 A;  2AOS A;  3KAB A;  3TG4 A;  3EHN A;  4FAD A;  3ARQ A;  2G8Z A;  3S7J A;  4LGX A;  3BEE A;  4Z2G A;  3AS5 A;  1B6C A;  3EHM A;  3ALG A;  2XPZ A;  5KJN A;  3TC5 A;  4R5E A;  1KFW A;  2YNQ A;  3SI5 A;  3CVL A;  3MKQ B;  4L1B A;  5G2N A;  4UQZ A;  1OWO A;  3VAW A;  5HQ8 A;  2JEK A;  4IT4 A;  3PRZ A;  4G26 A;  2WXL A;  2CFZ A;  3JYJ A;  3ML9 A;  1YA0 A;  1XRV A;  2V4L A;  4RSY A;  3U66 A;  3D9N A;  2J49 A;  3APF A;  4MAV A;  3NRK A;  2UWJ G;  2ION A;  4I17 A;  1BPO A;  3ZYM A;  2ZR6 A;  2MNT A;  3WD1 A;  3SZ7 A;  2WB2 A;  4AY5 A;  4DWS C;  5DEZ A;  2AXZ A;  5AEN A;  3ARS A;  3PS6 A;  1ROT A;  3D3M A;  4CCA A;  2P58 C;  4U63 A;  3UI5 A;  1RD6 A;  1FVF A;  1W26 A;  4FU3 A;  4FUL A;  3ARP A;  3CK8 A;  3L16 A;  5KCM A;  4DRJ A;  5LP0 A;  3B8S A;  3ARU A;  4XI9 A;  3ZYL A;  3EJN A;  4J8S A;  2RUD A;  2CHX A;  2PPP A;  1ZU2 A;  3HDX A;  2XCB A;  4WJX A;  2WMO A;  3PEU B;  1D7J A;  3QNK A;  1FKH A;  2JLB A;  2RQS A;  3O5E A;  4DLO A;  4CT4 A;  4G25 A;  5GPG A;  3LY9 A;  4I43 A;  3FFL A;  4JL0 A;  4DWS B;  1INZ A;  1E8X A;  4FN2 A;  3FY1 A;  4XX5 A;  2ZU6 B;  2E0I A;  2HYZ A;  4TW7 A;  4JPS A;  4KYO B;  2FDM A;  3FY4 A;  4FLH A;  3AS4 A;  4ILG A;  4G1T A;  2CG2 A;  2J9Q A;  5LCW C;  2KCV A;  4BTA A;  4UWK A;  3CHD A;  4EZK A;  4EQF A;  4HOT A;  3MKR A;  3D9O A;  1X6N A;  4DK5 A;  4DZ3 A;  1SQM A;  3ESL A;  2VGX A;  3ZYK A;  1H19 A;  3WQW A;  3FAP A;  4ILI A;  3CKC A;  3QOK A;  4ANV A;  3FH8 A;  2LKN A;  5ANR A;  4E85 A;  2R5S A;  3O5J A;  3WD2 A;  4N3B A;  4WND A;  2KZT A;  4JFL A;  3FP3 A;  3ZN3 A;  1FD9 A;  4ANW A;  1GOI A;  3PVL A;  1F40 A;  1CTN A;  2XQ0 A;  3WXX A;  1NWR A;  2KCK A;  3MV2 B;  3G6L A;  4BX8 A;  2MRI A;  2KM4 A;  3ONK A;  1HJV A;  1MQS A;  4I1M A;  2PPO A;  4FLB A;  4GCO A;  2WK2 A;  5M72 A;  4GMJ A;  1J4I A;  2FAP A;  3ZW3 A;  1HZ4 A;  1J4R A;  4CRW A;  4UWH A;  1HJW A;  3SGH A;  3CVW A;  2CFU A;  3S7F A;  1JWG A;  4RVB A;  3TG5 A;  5KJM A;  3BXW A;  4N3C A;  3CVN A;  1HKJ A;  2ITK A;  2XGM A;  4AM9 A;  4UWL A;  2PZI A;  3URZ A;  3CHS A;  3AS8 A;  5C2Y A;  4CT0 A;  3PEV B;  3MZL B;  4TX0 A;  5KJL A;  3PRA A;  3LPZ A;  3WQV A;  3CHE A;  4N39 A;  4PTM A;  1WAO 1;  3Q4A B;  3TXN A;  2MOW A;  2WXK A;  1HXI A;  3I4G A;  4AV7 A;  3B7S A;  1NSG A;  5CMY A;  4WKH A;  4LER A;  2XPI A;  3U3W A;  3RM8 A;  3FUH A;  1MHQ A;  2L0T B;  4QT3 A;  3B7U X;  3O5K A;  4WNE A;  4ODM A;  4P8V A;  2CHW A;  2RG8 A;  3FUL A;  2WMN A;  3CHQ A;  5LX8 A;  2AWI A;  2PM7 A;  3WL1 A;  3ESK A;  2DG3 A;  2N87 A;  3CVP A;  1NH6 A;  4J8F A;  4GA2 A;  1NWT A;  1FKK A;  4PS8 A;  5FJY A;  3MDY B;  1NZN A;  4ODN A;  1U3C A;  1JNT A;  2PV2 A;  4WNG A;  2I9C A;  2XRZ A;  3QWP A;  4G11 A;  1W9V A;  4ABN A;  3CGH A;  2GRL A;  4W5U A;  4B0Z A;  4GZC A;  4NNR A;  2L9B A;  1R9H A;  1NMV A;  3KZ7 A;  5DIZ A;  3SFZ A;  3UPV A;  4LUN U;  4DRN A;  4A55 A;  4DRH A;  4MNJ A;  2PQR A;  1HO8 A;  5ENN A;  4GAA A;  2FEZ A;  2A3E A;  3FTZ A;  1SYT A;  1ZBV A;  1W1V A;  2XP8 A;  4FAP A;  3FUF A;  3D9J A;  1Y8M A;  3B9D A;  1EYM A;  4L2L A;  4KVO A;  4HS2 A;  3TJP A;  4J0U A;  4B94 A;  3UQA A;  1F8A B;  4WWP A;  2OV8 A;  4JXT A;  1D2K A;  1Y0O A;  2GRM A;  1Q6H A;  4BFR A;  3NTP A;  1UN8 A;  4G2P A;  3CVX A;  2DT1 A;  1H6K A;  2PBC A;  4IQC A;  4NSB A;  3I4R B;  3FTW A;  4I1A A;  4ODR A;  3QKY A;  3CH9 A;  3P2B A;  5CCM A;  2DG4 A;  3FUJ A;  4JYS A;  4BT9 A;  3MYV A;  5BT1 A;  4AOF A;  2F4E A;  3VTX A;  3IKD A;  3LS8 A;  5DF0 A;  2Y4U A;  1HKI A;  5ANL A;  3IHY A;  2KI3 A;  3UQI A;  3UI6 A;  3ZPJ A;  3K9I A;  5G55 A;  3ALF A;  1KT1 A;  3FH7 A;  3WD3 A;  3RFW A;  2PI6 A;  4GGQ A;  4PH4 B;  4HOR A;  3FUD A;  1ELK A;  2AXV A;  3QAR A;  1W1Y A;  2M1I A;  1FFR A;  3WIJ A;  1X5B A;  4J8D A;  4NAC A;  4DPR A;  1TEZ A;  2XGS A;  3PNT B;  2OVF A;  2RD0 A;  4BY6 A;  3IV0 A;  2MPH A;  3APD A;  1E6P A;  3O5P A;  2OND A;  5HW7 A;  4LRZ A;  5A23 A;  1KLX A;  1JPL A;  1OWQ A;  3LJ3 A;  4JVS A;  4XAK A;  2WXN A;  3KS2 A;  2A3B A;  4A1S A;  2A3C A;  1YAT A;  5EDS A;  2IOS A;  3RU0 A;  5G04 J;  1FKL A;  5GPR A;  2J4D A;  4KQZ A;  3B7T A;  4DRP A;  3CHR A;  1J6Y A;  2FI7 A;  3D9M A;  4Q69 A;  5AIJ A;  2YHE A;  4WKA A;  2FF4 A;  3ML8 A;  2VYI A;  4HAR A;  1DNP A;  3B7R L;  4MKT A;  4HOQ A;  5T8I A;  5C1D A;  3O5D A;  2I1J A;  1X6L A;  2LAI A;  2RSE A;  1O6I A;  3I6C A;  3PRB A;  4EBA A;  4HBO A;  4WK9 A;  3T8M A;  2X6I A;  4FP7 A;  1H0A A;  2WM9 A;  4BF8 A;  3HHM A;  4A1G A;  2DT3 A;  1HS6 A;  3KAH A;  4JFI A;  2RUR A;  3UUX A;  4XI0 A;  1FKT A;  3W4R A;  1HE8 A;  3CEQ A;  1E6Z A;  2KGJ A;  1ZU8 A;  4FJZ A;  2LAH A;  2ZR5 A;  5FQ4 A;  3FDH A;  2DSZ A;  3LKU A;  5DIT A;  2DT2 A;  2B31 A;  1Z3Y A;  4UI9 K;  3OXG A;  4ANU A;  4UQY A;  2DSV A;  1LL4 A;  3R9A B;  2CG3 A;  2VN1 A;  4G24 A;  3RRN B;  3PE4 A;  4GML A;  1JNS A;  1E8Y A;  1HF8 A;  3SBT B;  4AJW A;  2WXR A;  2ZQS A;  4S3K A;  1UG3 A;  2X6J A;  3CSF A;  4DWS D;  5FT9 A;  3QAQ A;  3L13 A;  4TW8 A;  3O5M A;  3FHE A;  2A3A A;  3PNL B;  2ZR4 A;  4GYW A;  2V8S E;  3KAE A;  3L6A A;  3AS1 A;  2VTB B;  1QPL A;  3BG1 B;  4EZJ A;  4LAV A;  2YHC A;  3FTV A;  4NRH B;  1ZB5 A;  4L72 B;  4O2T A;  3JQ0 A;  4TV3 A;  4WWN A;  1FKD A;  4JFK A;  4WWO A;  3ARW A;  4F1S A;  1EF1 C;  3D9K A;  3L17 A;  4W9R A;  4P8U A;  1TJC A;  5D0O D;  2OOE A;  1C9H A;  1VF8 A;  3IHZ A;  3OXL A;  2LGO A;  4P8W A;  3EY6 A;  3TCZ A;  1JVW A;  3APC A;  2M08 A;  2J4B A;  3FWV A;  1UJK A;  4LAY A;  3O48 A;  3B9E A;  1LJY A;  4AIF A;  4J4O A;  2VQ2 A;  4ZS6 A;  4G23 A;  2F21 A;  3I3N A;  4AEZ C;  3LEW A;  5G04 C;  4APF A;  1EDU A;  2BF0 X;  1OWL A;  4CGW A;  1JWF A;  1FKR A;  2XP7 A;  3OTN A;  2FKE A;  4N3A A;  1E7V A;  3CHF A;  1FJD A;  2X6F A;  4F53 A;  4MPK A;  5CCL A;  4Q94 A;  4UQX A;  4ODO A;  2MF9 A;  4Q96 A;  3UQ3 A;  4PDX A;  4DIP A;  1PIN A;  3WD4 A;  4FHK A;  4AXH A;  4JA7 A;  4MTV A;  2YQ8 A;  2M2A A;  1UN9 A;  2WXF A;  5J90 A;  3LVR E;  1HXV A;  3G6M A;  1FKG A;  3JQ1 A;  3CQG B;  5AYW D;  4JFM A;  3ZGQ A;  4N2S A;  3ZVV A;  3UT8 A;  2PM6 A;  3NZS A;  3I5P A;  3KAC A;  4KVM A;  3ASG A;  2DG9 A;  5DIU A;  3ARZ A;  3QWV A;  3U64 A;  5FWQ A;  2Y4T A;  3IEG A;  2CHZ A;  4J8E A;  4UI9 J;  2J07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...