1KT0A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
380
structure length
357
Chain Sequence
b'VLKIVTPMIGDKVYVHYKGKLFDSPFVFSLGKGQVIKAWDIGVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNERDRRIYANM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 51 KDA FK506-BINDING PROTEIN
publication title Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 110
structure length 357
sequence length 380
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt0A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A02
2F2DA 3PRDA 2Y78A 1F8AB 4WUYA 3LKUA 5CCLA 3MV2B 3RGCA 5HWBA 1FKDA 4AY6A 2Y4TA 3TG5A 2Q7FA 3IKGA 2PV1A 1C9HA 2FKEA 5HW6A 5D75A 3O5DA 5LCWC 2PPOA 4DRQA 4GCNA 1FCHA 4H7XA 3RU0A 1FKLA 1BKFA 4YNDA 2DBAA 4G2PA 3VTXA 3ZHEA 2XP8A 4I2WA 2XP7A 3ASGA 5CCMA 1F40A 3QWWA 2XGOA 2PZIA 1PBKA 5BXJA 4ABNA 4DRIA 1FD9A 2XP5A 5HTGA 3RKVA 4JYSA 4H7YA 4J4NA 3GZ1A 2XPAA 3KD7A 1NZNA 2IFUA 4KXKB 1EQ3A 5D0QD 4RG9A 3ESKA 4GA1A 4CGWA 4JFKA 3S7FA 4UI9J 4I1AA 1A17A 1OUVA 3MV3B 2JLBA 4KYOB 3NI6A 4XIFA 2VCDA 2XP3A 3KAHA 4KBQA 3JYMA 3KAIA 3S7BA 3NF1A 2XP9A 2PL2A 1NMVA 5G05C 2ZR5A 4QT2A 4HOUA 4N39A 3JXVA 3WXXA 2XGMA 4ODKA 5FZRA 3E4BA 3IEGA 4WNDA 4R0XA 1ZCNA 2XGSA 5LCWJ 3RIBA 1PC2A 2C0MA 1W3BA 2Q5AA 1NSGA 2D9FA 4DIPA 1ELWA 5FTPA 2PQNA 2XCCA 3TDBA 4BWRA 3LPZA 2HR2A 3GZ2A 3TCZA 3AS5A 4N3CA 4GYOA 2MLYA 1YW5A 5DBKA 5FT9A 3PE3A 5KJKA 4JFLA 4I2ZA 3KABA 1TJCA 4IN3B 3TGOA 2XPBA 4N2QA 2MLXA 3S7DA 1N1AA 4DRMA 4B94A 3ZGQA 4GYYA 3N71A 4ODNA 3UPVA 5G05J 2L2SA 3ULQA 5EX3A 4GZ6A 4U0ZA 3AS4A 1ZBPA 3LUOA 2FF4A 3CKCA 4GIVA 1FKTA 1HXIA 2P58C 3LY7A 4UI9K 5EKQD 2PPNA 5B8IC 1FKSA 5JJTA 4AIFA 3AS8A 1IYGA 5JJ6A 3FFLA 4G24A 4JL0A 2RQSA 3U3WA 1NMWA 3SF4A 3H9RB 4U04A 2VGYA 4JHRA 2NC9A 4U85A 3PRBA 3BEEA 4LAVA 5I98A 4FAPA 2BUGA 3KAFA 2YHCA 1T11A 1EYMA 5DITA 5HI7A 4I9CA 5G04C 2LKNA 5KJNA 3B7XA 3U4TA 1JNSA 4NNRA 2RUQA 2KR7A 4YVQC 4G2VA 2R5SA 3CEQA 3IK8A 3UI5A 3TC5A 4TNSA 2HO1A 3O5EA 4ODOA 4G26A 4ODMA 4DROA 3RFWA 2KCVA 3OXGA 1NA3A 1L1PA 3CVNA 2KE0A 3SZ7A 3GPKA 4AM9A 2PV2A 1FKKA 3O5PA 2ZQUA 4GGQA 5ARGA 3KADA 4ODLA 4NQ0A 3R9AB 3UF8A 1B89A 3O5MA 3OOBA 3UQBA 3CK8A 4TW7A 2PQRA 3PA7A 4BTBA 2VSNA 1E96B 3OXFA 4NRHB 3TG4A 3O5OA 2RUDA 2UZ5A 3UQIA 2LPVA 5DIZA 3ASFA 4CDRA 5G04J 1D7IA 4YVOA 1FKIA 3O5LA 4I9EA 3TAXA 4N5CA 3ASHA 2DG9A 3ODKA 4UQYA 4CGVA 4LEUA 4W9PA 3MKRA 4IQ2A 4G1TA 3RJVA 3MDYB 3URZA 3CV0A 3LY8A 5HW7A 3IHZA 5FZSA 5EX0A 1QPLA 4W9OA 4MSPA 1JNTA 2ZQTA 3KAEA 4BT8A 4O2TA 4IPXA 4TX0A 1XNFA 1BL4A 1FJDA 1PINA 4J8EA 2KC7A 1HZ4A 3GYZA 1FKFA 3O5RA 4RG6A 3O5GA 1YATA 3ZFWA 2RURA 4Y6CA 2HYZA 5HW8A 4J4OA 3EDTB 1Q6HA 3NRKA 1HXVA 4A1SA 4JA9A 3MEKA 3S7JA 4DT4A 4UQZA 4O6FA 2M08A 4GCOA 5HUAA 2J9QA 3Q49B 3KZ7A 1P5QA 1A7XA 4JFIA 4N2SA 2F21A 1FKHA 2K8IA 4GZ5A 5DIUA 4C02B 4FN2A 3O5KA 5HQ8A 2ZQSA 4LAYA 2LJ4A 3MA5A 5HWCA 3KAGA 2VGXB 3PE4A 4N3BA 2JZVA 1ELRA 2M1IA 1FKJA 4U84A 1WAO1 2M2AA 1HH8A 4BT9A 3O5IA 1Q6UA 2FAPA 2ZQVA 3CGNA 3FP3A 3LCAA 3UQAA 4DRKA 4LAWA 4GA0A 4N3AA 1Q6IA 2KO7A 2XEVA 4G23A 4ME2A 3HYMB 3JYJA 2UY1B 5A7DB 2XP6A 1WM5A 2UWJG 4ITZA 5BT1A 4J8FA 4GA2A 3CKBA 1Y0OA 2MNTA 4DRHA 3QKYA 2OOEA 3VTYA 1Q1CA 2V5FA 5KJLA 1FKGA 1KT0A 3FWVA 3CGMA 3Q15A 2XPIA 2KCLA 1M5YA 3QOUA 4W9RA 5CHEE 3LY9A 5M72A 5BNWA 4APOA 4JFJA 3FAPA 2LSUA 1FKBA 1J4HA 2DG4A 4TW6A 3UUXA 2LSVA 5A6CA 4ODPA 3ZPJA 1NA0A 2FEZA 2MF9A 2MPHA 1U79A 2VN1A 2FI7A 3GW4A 4DRPA 4GZ3A 1QZ2A 2KGJA 1D7HA 2LGOA 2N87A 4UQXA 1QPFA 2KFWA 3K9IA 1IHGA 1KT1A 2C2LA 1D7JA 2PPPA 4N19A 4U86A 1FKRA 5ARFA 1Y8MA 5KJMA 2WQHA 2QFCA 1B6CA 2E2EA 4HOTA 5HT1A 1ZU2A 2VSYA 1TCOC 3ZN3A 1FAPA 4JFMA 4AY5A 4IQCA 4GPKA 5GPGA 2OFNA 4U0UA 1J4RA 3CK9A 4JA7A 4W9QA 2VGXA 2XCBA 4QIBA 4DZ3A 3KCEA 4G25A 2RSEA 4DRJA 2RUCA 5J6EA 1KLXA 4MGVA 3Q5MA 4DH0A 3EY6A 3PDNA 3UQ3A 5BW8C 4HORA 3CK7A 3ZHEB 4BF8A 3JYSA 5DIVA 3IKDA 4LAXA 2IF4A 4WNGA 1J4IA 4F3VA 3WH0A 2GW1A 4DRNA 3CVQA 2UY1A 2MHKA 3QWPA 3UI6A 4TYOA 4U07A 4HOSA 3O48A 4XI9A 3VAWA 2FBNA 2ZR4A 2AVPA 3KS2A 4J8DA 3Q4AB 5C1DA 2PV3A 1QQEA 2ONDA 4GYWA 2C0LA 4ODQA 5FJYA 2LNIA 3QWVA 4QT3A 3I6CA 3CVPA 1D6OA 3ASDA 3NTPA 2WPVA 4G50A 5JJ7A 5D0OD 3O5JA 2VQ2A 4DZ2A 4WNEA 4HOQA 2ZR6A 2FO7A 3O5FA 1JVWA 2KATA 3RO2A 4WNFA 1J6YA 1R9HA 2F4EA 2XP4A 4ODRA 5HKGA 1YA0A 3OXLA 3QDNA 4Y6WA 2DG3A 2ITKA 3LYAA 2PBCA 3CVLA 1ROTA 3KACA 4I17A 1ZK6A 4TW8A 2L6JA 1ROUA 5FZQA 4XI0A 4J0UA 2KI3A 4BTAA 5AYWD 4UI9C 2VYIA 3RO3A 2I6HA 2KCKA 4U0SA 2MLZA 1W26A 2AWGA 2Y4UA 3Q47B 2YQ8A 3O5QA 3UI4A 4EQFA
chains in the Genus database with same CATH superfamily
4KVOA 1O5MA 2DZNA 3FUFA 5HWBA 3WD2A 4DRQA 1FCHA 3FHEA 1UR8A 5E76A 5G2NA 3MCXA 2XPYA 1JWFA 2XP8A 2J09A 3UT4A 4FULA 2RFAA 4HBDA 2PZIA 3PUJA 1OGBA 3TWSA 3ARZA 1LL7A 5FWQA 3FEYA 3KD7A 2IFUA 4UWHA 4MNKA 5CBOA 4GA1A 4JFKA 3ENEA 2WXJA 2H6FA 1W9PA 1A17A 3UM1A 3MV3B 1HJWA 5AQ7A 2R02A 3ASNE 3FU6A 3NI6A 4LG6A 1BLXB 1OCRE 4JHKA 4HNAD 2XP9A 2WXFA 3MX3A 2X3MA 4N39A 4ODKA 5FZRA 1HKMA 4GZDA 1HKKA 1H2UA 2C0MA 3NBNB 2WK2A 5AENA 2Q5AA 1NSGA 2DWZA 4DX1A 3ARSA 3PH0C 3QJZA 2PQNA 2XCCA 4HARA 4BWRA 5HS0A 4UWFA 3FUDA 2HR2A 3VLFA 3TCZA 3L9TA 4WJXA 4GYOA 4LNGA 1UG3A 1YW5A 1TN7A 5DBKA 3QC1A 3NB2A 4JFLA 3KABA 3FU5A 2J08A 4IN3B 3UIOC 3FU3A 3MZLB 4F53A 2MOWA 1N1AA 1D8DA 1CTNA 4F1PA 3IHVA 4ODNA 2A4ZA 3CHPA 3DEOA 1D8EA 3ZW3A 4TUUA 3AS4A 1UOHA 2FF4A 3CKCA 1HXIA 4DI4A 4P8WA 1YMPA 5JJTA 4AIFA 1GOIA 1SA5A 4JL0A 2RQSA 1DCEA 3U3WA 3ISMC 2DPEA 4P8UA 2ETCA 1NMWA 4ACLA 3BEEA 2X6HA 5I98A 4FAPA 1ZU8A 2IOLA 2YHCA 1T11A 5DITA 3QAQA 1N94A 4O1OA 5KJNA 5HRYA 1JNSA 2QC9A 2RUQA 2KR7A 3T5XA 3CSFA 2J49A 3IK8A 3TC5A 3IXEA 2HO1A 3O5EA 1QBQA 3PRZA 4DROA 3FDHA 2G8ZA 3CH9A 2KCVA 2Y69E 3CVNA 5ANRA 3EIQC 4AM9A 3CSTA 1ZL1A 3V2XA 1FKKA 3O5PA 2KXPC 3BMBA 3RAUA 3OA5A 4F7AA 4TXQA 1E96B 3OXFA 3EIPA 3O5OA 1WB0A 1UJJA 5DIZA 3RMEA 1LTXA 2V4LA 4YVOA 4AV7A 4I9EA 3TWUA 2AW6A 2RD0A 1N4QA 3U9WA 3DSTA 4TXPA 3EHQA 3MKRA 4GMLA 3HRAA 2BTDA 3URZA 4HFGA 4DWSC 2M63A 4MSPA 4LUNU 1BL4A 1U3DA 1FJDA 3B13A 3VLDA 4WK9A 1RW2A 2XENA 2X6IA 4Z2KA 3Q73A 4Y6CA 3EDTB 3NRKA 4XX5A 3BUAA 3DPYA 4DT4A 2M08A 4GCOA 1MX4A 2J9QA 3KZ7A 1P5QA 5KNGA 1HS6A 3WQWA 1DCQA 1A7XA 4PS3A 2F21A 3G2TA 4C02B 3KAGA 2VGXB 3PE4A 4GTMA 2QYUA 1E90A 3UMVA 4U7EB 4GTVA 1LQ0A 2VJ8A 3AU5A 3TJPA 1WAO1 5LP0A 1AP7A 3GZSA 1W9VA 4J8YA 3ML8A 1JCQA 3FUJA 3GTYX 3B9DA 3CQGB 4CT4A 1G3NB 3C5RA 4G23A 1JNEA 4JC8A 4A3VA 3CHEA 4AOFA 3HG0D 3SBSA 1JCRA 4S3KA 3G2UA 1UR9A 1Y0OA 3VTYA 1BD8A 2V5FA 3TWVA 3ZVVA 5KJLA 2HM8A 1FKGA 3FY1A 3SQVA 2XPIA 1UJKA 5M72A 3R9MA 4APOA 3UXGA 2DCPA 3E32A 1J4HA 3FUNA 5A6CA 2B0OE 3ZPJA 3ARYA 4MLPA 2WXPA 3I4RB 3UM2A 4JVSA 2FI7A 4DRPA 1QZ2A 5BXOA 4HRNA 1D7HA 1W1TA 4P8VA 3DSXA 4UQXA 2KFWA 1K8KG 1KT1A 1KZPA 4N19A 4U86A 1FKRA 5ARFA 5ENRD 2E2EA 3ABME 1OWNA 1ZU2A 1HKIA 2IU1A 3RRUA 4PH4B 4IQCA 1W1VA 1YYHA 2WQ7A 2WLYA 4IULA 2OV8A 1VF8A 4Q96A 2L0IA 2VGXA 2CHXA 2X6FA 2XCBA 4QIBA 1OWOA 3KCEA 1OXJA 3PS6A 1H0IA 2ZU6B 1KLXA 3Q5MA 3CHMA 4LRZA 3EY6A 3PDNA 5BW8C 4BF8A 3JYSA 4YDEA 2IEJA 4IT4A 1SQMA 2BKKB 2IF4A 1J4IA 5AQAA 1TEZA 1ZB5A 4V3IA 3SD5A 2WLZA 5C2YA 4TYOA 4U07A 2GGFA 3VAWA 2ZR4A 2AVPA 4J8DA 3SO8A 3TXNA 1N4SA 2H6HA 4NACA 1IX5A 4ODQA 3S2AA 3I6CA 5ANLA 3ASDA 4KMOA 4AEZC 3NTPA 1LF8A 3SGHA 5DEZA 2P2CP 2ETNA 3DRAA 3MYVA 4DZ2A 3WD3A 1ZB1A 2FO7A 1JVWA 3B9EA 3RO2A 2F8YA 4P29A 4DJAA 2F4EA 3FH5A 3SY2A 1YA0A 3T5VA 2WXOA 3QDNA 5BUZA 2DG3A 3LYAA 1BI8B 4FU3A 4DLOA 4QQIA 4DX6D 3C72A 2XS1A 1RD6A 4OAVB 1UN9A 4FA6A 3TWXA 4HVBA 1ROUA 4CT0A 1E15A 2F23A 3UINC 2KI3A 3CHCA 3WQVA 4UI9C 2VYIA 3R7RA 1H6KA 1W26A 2Y4UA 1O1RA 3Q47B 3SFXA 3UI4A 1IHBA 2IUZA 3L13A 3PRDA 5ENQD 2Y78A 1AWCB 3CGHA 4PDXA 5CCLA 3MV2B 4BSZB 3RGCA 4Z2IA 3IKGA 3HXFA 2Q7FA 2PV1A 3JCKC 1E8WA 3UX4A 4RLYA 5D75A 3TWTA 2PPOA 1JPLA 3HDXA 4GCNA 4G11A 4H7XA 3RU0A 4Z2HA 2CG2A 4NIKA 3DSUA 4G2PA 3ALFA 5CCMA 1F40A 4FLBA 2XGOA 1PBKA 2NXPA 4H7YA 5AQ9A 5J90A 1X81A 4KQZA 4KXKB 5D0QD 4C9BB 3ESKA 3CVVA 5ENOD 3S7FA 3SHFA 4UI9J 4I1AA 1OUVA 5KNHD 2OEVA 1OCZE 3B7TA 3KSLA 2VCDA 4L3NA 3KAIA 3S7BA 5CECB 1U3CA 3D9JA 1NWSA 5HKPA 3HIZA 5EN5D 4ANVA 2WVIA 4DX7D 2KZTB 2WXQA 2CHZA 3E4BA 3IEGA 4Q22A 3G6LA 1HFAA 2OLHA 1EPUA 2D9FA 2J07A 4DIPA 2J8SD 1V55E 2XEHA 5FTPA 3U66A 2LO6A 2HE0A 1DVPA 5T8IA 2YBTA 4HBEA 5JA4D 3ZXPA 5FT9A 3PE3A 5KJKA 1QYMA 5EILA 4I2ZA 3MGBA 2YHEA 3TGOA 2FULA 2MLXA 4A3TA 1XGWA 4ZS6A 2DSZA 2L2SA 3LVRE 5EX3A 4GZ6A 3QNKA 1ZBPA 4GIVA 2PM7A 4F6RD 1FKTA 2H6GA 2P58C 4GTOA 3LY7A 4MKTA 4MS6A 1ZBVA 3FTWA 2GRQB 2P9KG 3ZU7B 4CEMA 2A3EA 3FUKA 5CEAA 4OYSA 4WKAA 5D2MC 4JEUA 4C48B 1WY6A 4G24A 3MJWA 4DLQA 4NURA 3SF4A 4JD2G 1BPOA 3BQOA 2CHWA 3EHRA 5JMND 3ALGA 3I5PA 3KAFA 5JHAA 3ONLA 3KEAA 3J5PA 5DO2A 3UT7A 1JWGA 5G04C 3FTXA 1E6PA 1N9AA 4YVQC 2KZTA 3UI5A 3LEWA 3L82A 3UKUG 4C0MA 4ODOA 3G2SA 3DEPA 3RFWA 4MRUA 3HXCA 3FEXA 3OXGA 1XRVA 3PZ1A 2L9BA 2KE0A 2PV2A 3RRMB 4GTSA 1E9LA 1E8ZA 3D9KA 1MX2A 5ARGA 1B89A 3O5MA 3CK8A 4TW7A 2PQRA 2XEEA 3PA7A 1E6RA 4BTBA 1H6OA 5CRUA 2ZGGA 3SFYA 4NRHB 3V79K 3UQIA 1SVXA 3CHSA 4K5CA 1EF1C 5G04J 1D7IA 3SNXA 3Q75A 3WL0A 1INZA 4RSYA 4RVBA 3QK0A 4Q94A 2I9CA 2DG9A 3ODKA 3L54A 4IQ2A 4OVVA 4G1TA 3RJVA 3CV0A 2J4BA 3QARA 4FJZA 2MYOA 4B8AA 2LXMA 4TX0A 1JNTA 2ZQTA 3KAEA 1K1AA 1XNFA 1PINA 3ARTA 1FT1A 2KC7A 3GYZA 3CVYA 2RKKA 3O5GA 1YATA 3ZFWA 4FP7A 3B8SA 2HYZA 4J4OA 1HXVA 2IO3C 1HU3A 4O6FA 3C3RA 2OCCE 4BFRA 4FC8A 4MTVA 2K8IA 2ZGDA 4GZ5A 4FN2A 3LDZA 2ZQSA 3CVUA 5HWCA 4DK5A 3PREA 1OGGA 2JZVA 2M1IA 4J8SA 1H6PA 1Q2ZA 1FVFA 4HRMB 4LNBA 3UI2A 2M2AA 2YINA 4W5UA 3BG1B 2FAPA 1OWQA 3LCAA 3UQAA 4BY6A 4N3AA 2A5UA 5ENPD 1TN8A 4ME2A 3CVXA 2FO1E 2UWJG 4BX8A 1HJVA 4J8FA 5ENTD 3EU5A 2MNTA 4L9PA 2BEDA 1PY1A 3B7UX 1JCHB 1KT0A 2R05A 4IT6A 3QOUA 4URIA 2P9UG 3T9KA 4K03A 2LSUA 3ZEFA 1W9UA 4WKHA 3BU8A 2V4HC 5H7PA 2IOSA 1EDQA 1NA0A 4UWLA 1E44A 2MF9A 4ATGA 4GZ3A 2QF8A 2ETAA 3IHYA 4A1GA 2LGOA 3DBSA 2N87A 5KBAA 5T4YA 1IHGA 1TJFA 3UM3A 4Q7NA 1D7JA 2PPPA 4L72B 2WB2A 1D2KA 2I2OA 2WQHA 2DSUA 1S70B 1B6CA 3P1UA 3KSQA 5HT1A 1TCOC 1SZ9A 4ILGA 4AY5A 3AG3E 1HJXA 3TWRA 4R7LA 1J4RA 2V5QC 4JA7A 4MBGA 3CZ8A 1E6ZA 3JXIA 3PRAA 4G25A 2RSEA 1SW6A 1MX6A 4DRJA 5J6EA 1ZBWA 1W1YA 4DH0A 4EHMA 3CK7A 3ZHEB 2WM0A 1MQSA 3AG4E 2QY7A 2PI6A 4B8CB 4F3VA 3WH0A 4CDMA 1OCOE 3CVQA 2MHKA 4JZYA 1NWTA 3UI6A 1SYTA 4HOSA 4RQIA 3D9OA 1O6IA 4DWSB 5D66A 2L6BA 2EIME 3Q4AB 5C1DA 3HVEB 4HS2A 2ONDA 2AJAA 4GYWA 2C0LA 5FJYA 2VSXE 4O60A 5CBNA 3DXMG 4B89A 4WAFA 3O5JA 4WNEA 4M7CA 3DWLG 1R9HA 1OT8A 2XP4A 1TFVA 4ODRA 3OXLA 4M3OA 4Y6WA 4Z2GA 2PBCA 4J6IA 2WXLA 4I17A 2L6JA 3FUMA 4J0UA 2WMOA 4BTAA 4BX9A 1TNYA 4CZ2D 3OAWA 2KCKA 4XKBA 2R59A 2V0PA 2DT1A 2AWGA 2YQ8A 5EIDA 3EHMA 4KZ0A 2F2DA 4EZKA 2WXRA 4UWGA 3LKUA 3AS1A 1FKDA 4KVMA 1C9HA 3W9FA 3WD0A 3DSWA 4L7TA 1FT2A 4I6JA 4EBAA 1FKLA 1BKFA 4GPMA 5BV0A 2YBUA 3ZHEA 4CYMD 4I2WA 3ASGA 2RFMA 3QWWA 4L2LA 4AP2A 4MNJA 5AAOA 2MRIA 4ATZD 4DRIA 1FD9A 3B9AA 4J4NA 3EHNA 3AG2E 2XPAA 3EJNA 3D3MA 1EQ3A 1TN6A 1HG5A 1BU9A 2WXKA 4DWSA 2V8SE 3HVEA 2JLBA 4KYOB 2DYSE 1IKND 3IBEA 3FU0A 4ILIA 5E75A 4CCAA 3KAHA 1Z3XA 4ILHB 4KBQA 3JYMA 4L1BA 3NF1A 3UT8A 3T8KA 2XRYA 1NMVA 5G05C 5CEDB 2ZR5A 4QT2A 3JXVA 3WXXA 2XGMA 1HKJA 4R0XA 2XGSA 3RIBA 3TWQA 4UDMA 2P9LG 3JUEA 3LVQE 4OAUC 3B7RL 4DRXE 1MYOA 4FADA 3LPZA 3CHDA 2IJGX 4ZHBA 2JEKA 2WM9A 2MLYA 3APFA 2NYJA 1H0AA 2GRLA 4EZLA 2DT0A 1OWLA 2XPBA 4N2QA 3ZNGA 1S63A 3S7DA 3ZGQA 4GYYA 5G05J 4JPSA 3AROA 4QFVA 2CG3A 4HLLA 2B31A 4U0ZA 1HX8A 3ESLA 2A5EA 4UI9K 3PZDA 2DT2A 3B7SA 2B6CA 4J7WA 3Q78A 4A55A 1IYGA 4AJWA 3D9MA 2VGYA 2NC9A 4U85A 3PR9A 3CIAA 4ANXA 4GAAA 3DSVA 2LKNA 5CMYA 4E6HA 3U4TA 4NNRA 2JABA 3W9GA 3V2OA 4G2VA 4U95D 2R5SA 4G8LA 3CEQA 4TNSA 5BXUA 4G26A 4ODMA 1NA3A 2OVFA 2ESCA 3FTUA 3ARUA 3SZ7A 3GPKA 3HXEA 2DIWA 1KZOA 4GGQA 1YCSB 3CQCB 4ODLA 1X6NA 1OWPA 4UWKA 3JXJA 4HQDA 3OTNA 1GUVA 4GTPA 2WXGA 4MAVA 4ANWA 3TG4A 4N5QA 2NSZA 2LUHA 3PNLB 3EU9A 3ASFA 4CDRA 1JCSA 3T8MA 1FKIA 4B93B 3CR3A 4GZCA 3TAXA 3ZIMA 1LG1A 4P8XA 1TYQG 2VGEA 4Z2LA 4UQYA 4LEUA 5GPRA 3TL5A 4EPZA 3LY8A 5HW7A 5FQ8A 3SFZA 1NWRA 4AXHA 2AXVA 5FZSA 1RZ4A 1QPLA 4W9OA 1BI7B 4BT8A 4IPXA 2XRZA 1ZBKA 4J8EA 4O1PA 1HZ4A 4RG6A 4URKA 3PZ4A 3ARVA 5EYPF 2F0YA 5FQ7A 4U8YD 3EUVA 3RRNB 1NFIE 2R03A 5AJDA 1Q6HA 1VDYA 3D9PA 4JA9A 3MEKA 4OVUA 4JW1A 3S7JA 4Z68A 1N0RA 5HUAA 4WWNA 1NWUA 2QZAA 4JFIA 1FPPA 3PZ3A 1SR0A 1KFWA 1FKHA 3O5KA 5HQ8A 4LAYA 3MA5A 3PVLA 4N3BA 1ELRA 2XS8A 3JQ1A 4YDOA 1HH8A 1LD8A 4BT9A 1Q6UA 3ZKJA 4K5BA 4K5AB 2ZQVA 4LAWA 1Z3YA 4A63B 3D9LA 4Z2JA 4ZPVR 1E6NA 1Q6IA 5BPPA 3HYMB 4PTMA 5A7DB 3PZ2A 2XP6A 1WM5A 5KWDA 3NZSA 3C3OA 3ZYQA 3APCA 1EYHA 3EIJA 4ZFHA 3QKYA 1UW4B 2GROB 3WD4A 1H0GA 4JXTA 3AS0A 4W9RA 3ZYLA 3LY9A 2WXHA 5EYLA 2A3BA 3UKRG 5BNWA 4ANUA 3FAPA 4TV3A 3AS2A 4S3JA 2EQXA 2DG4A 4TW6A 1XHGA 1TNBA 2LSVA 1NP7A 2A3AA 3HHMA 2FEZA 4X8QA 1K9TA 4WWPA 1U79A 3GW4A 5FQ4A 2XZDG 1V54E 1GRJA 3WD1A 1QPFA 1WNOA 1OWMA 2C2LA 3B95A 2RG8A 5KJMA 3ARWA 1FFRA 1L5JA 3QOKA 1HE8A 2GRRB 3DXKG 2VSYA 1FAPA 3PNTB 4FJYA 5FIOA 4DI3A 4JFMA 3L08A 5B3SE 4GPKA 4TRQA 1GPFA 3J5QB 4U0UA 4BSXA 4W9QA 4DWSD 2O92A 1LL4A 2YNQA 5LFAA 4EBAG 2RUCA 1DC2A 4JB8P 1H2TC 3E33A 1HF8A 4HORA 3E34A 4MPKA 2ZISA 4WNGA 5AIJA 2DSWA 4LGXA 2GW1A 1N11A 4DRNA 2F8XK 4HB5A 5ITZF 4AVXA 2X38A 1S0PA 2R17C 3KS2A 3L17A 3TWWA 4QT3A 5LX8A 3QWVA 4PS8A 3RM9A 1IQUA 3CVPA 1D6OA 2WPVA 1NI1A 2AXZA 3PEVB 1PAQA 5D0OD 3WKZA 3FTYA 1E7UA 2P9IG 3BXWA 2BF0X 2KATA 4WNFA 1J6YA 4K0RA 4U63A 4BEPA 4HI9A 2X6JA 1EIBA 4DX5D 2E0IA 5AN8A 3CVLA 3MKQB 3KACA 4L23A 4XEIG 3BG0B 5KCMA 5AQBA 4JEHA 4I6GA 4KR0B 2KBXA 4PUCA 1S64A 2AWIA 5IY5E 3PUKA 4HI8A 2XHEA 3ARQA 1F8AB 5T3RA 4WUYA 3V30A 1QNFA 1IXVA 4GU5A 3ARPA 4EZJA 4IRUA 4AY6A 2AXUA 2Y4TA 3TG5A 2FKEA 5HW6A 3O5DA 4ACKA 5LCWC 4GTQA 3FUEA 4YDWA 4YNDA 2DBAA 4E85A 3VTXA 2XPZA 2XP7A 4NZCA 3GU0A 3FULA 5BXJA 4ABNA 4YDYA 3FY4A 4U96D 2XP5A 5HTGA 3RKVA 4JYSA 3GZ1A 1JNDA 1N54A 2WXNA 2OEWA 1NZNA 3AS3A 3APDA 4RG9A 2IO2C 2B5UB 4ZPWR 4CGWA 3UIPC 3L6AA 1ITXA 1WG0A 3HXDA 4XIFA 3UM0A 2XP3A 2KM4A 2P9NG 3ZUVB 3Q79A 3IV0A 2L0TB 4GB9A 2PL2A 2GRNB 3I4GA 4HOUA 3G6MA 2PNNA 4ML4A 4WNDA 1ZCNA 5LCWJ 1PC2A 2LAHA 4NSBA 1W3BA 4MNLA 4XE0A 5JHBA 5ENSD 2Y1LE 3D9HA 1N95A 1N0QA 5DF0A 3F6QA 1ELWA 3MKQA 3TDBA 4IYPA 2DZOA 3DSSA 3GZ2A 3ML9A 3SI5A 1FFQA 2I1KA 3AS5A 4N3CA 4GTRA 3DPDA 2ZIRA 2H6IA 2GRPB 1TJCA 3RSEG 3X2QE 2FDMA 1UN8A 2EINE 4U8VD 4LCTA 1X6LA 4DRMA 4B94A 2LAIA 4TXRA 2GRMA 3N71A 4GMJA 4EECA 3UPVA 1ELKA 1LL6A 3ULQA 3P2BA 3B7BA 3LUOA 3ZRHA 2PPNA 3C98A 4B0ZA 5EKQD 4HXIA 5B8IC 3ZYMA 1FKSA 4LNUD 3JUIA 4ZPTR 3AS8A 1K1BA 4FHJA 5JJ6A 3FFLA 2WXMA 1Z5SC 2XQ0A 3W4RA 1TNZA 3H9RB 4U04A 4CRWA 4JHRA 3L22A 4FHKA 3PRBA 2ZXWE 5BV1A 4LAVA 3SBTB 3WG7E 2BUGA 1EYMA 5HI7A 4I9CA 1OCCE 4I1OB 1NH6A 3KEZA 1H19A 3B7XA 5B1BE 3CHOA 2ETBA 2Y3AA 3AAAC 4LSZE 1O1TA 4JHJA 3FUIA 1D9SA 2PM6A 2WXIA 1GW6A 4F1SA 1MHQA 1ZBCA 1L1PA 2CFUA 3V31A 3AU4A 2ZQUA 3KADA 4NQ0A 3R9AB 3UF8A 4GTTA 2DT3A 4BESA 3NZUA 3LXUX 3OOBA 3NOGD 3UQBA 3CVWA 3FH8A 4I43A 5HBFA 2VSNA 4WWOA 2RUDA 2UZ5A 4R5EA 2EIJE 2LPVA 2DSVA 5EIBE 3O5LA 1Z6TA 4HLEA 4N5CA 3ASHA 3ONKA 3AQUA 4CGVA 4W9PA 3G2WA 3MDYB 3AJIA 3IHZA 1EHNA 1N52A 4U8HA 1A5EA 5EX0A 3ABLE 4UUCA 2WQ6A 4O2TA 3FTVA 3LS8A 4KZCA 1FKFA 3O5RA 1O1SA 2WMNA 3PEUB 1SZAA 3Q9NC 2RURA 1JUQA 2VSOE 5HW8A 3WIJA 4G8KA 2BKGA 1TNUA 4A1SA 3D9NA 5EDSA 3NAWA 4UQZA 2P9PG 3FTSA 3ABKE 3Q49B 4XKCA 4BERA 1TNOA 3FH7A 1HO8A 5A23A 4N2SA 1LG2A 3JQ0A 5DIUA 5AJLA 2PN0A 2LJ4A 3ULEG 5J08A 1X5BA 2QYJA 4HRLA 3CHQA 1FKJA 4WKFA 4U84A 2OVBA 3NQPA 3O5IA 4DX2A 3G2VA 3CGNA 3FP3A 4DRKA 3CHRA 3LJ3A 4GA0A 2KO7A 2XEVA 2DVWA 3ULYA 4WIWA 3C3QA 3JYJA 2UY1B 4BETA 5JH8A 4ITZA 5BT1A 3FTZA 4GA2A 1Y6IA 3CKBA 4DRHA 2I1JA 2AOSA 2OOEA 1Q1CA 1EDUA 1WDYA 5FINA 3FWVA 3CGMA 3Q15A 3Q7FA 2KCLA 1M5YA 4LERA 5CHEE 1OY3D 3WL1A 1LD7A 4JFJA 4DPRA 1FKBA 4APFA 3IKOB 3UUXA 3L16A 5B1AE 2EILE 4ODPA 1LJYA 2MPHA 2Y0BG 2VN1A 3E37A 2EIKE 2KGJA 3RM4A 1E7VA 2P9SG 3CHFA 3K9IA 1HG2A 3UTMA 4C0EA 3ARRA 1E8XA 2VTBB 3NOCD 1Y8MA 4XAKA 2QFCA 1DNPA 4HOTA 4XZ4A 1K3ZD 3R7QA 4KT6B 3ZN3A 3ASOE 4PS7A 3VLEA 1WAWA 5LOZA 5GPGA 3HXBA 4I1MA 2OFNA 1MJ0A 2DYRE 3CK9A 5CMWA 1KPSB 2G41A 4DZ3A 3U64A 4MGVA 2J4DA 4AY1A 3UQ3A 3O4ZA 3ZXSA 1IQRA 3FXYA 2LXLA 2EULA 5DIVA 2CFZA 3IKDA 4LAXA 5G55A 4CDNA 1W1PA 1FVHA 2UY1A 1U2VG 4QZVB 1SA4A 3QWPA 4DUIA 1N4RA 5FQ6A 3O48A 4XI9A 1E8YA 2FBNA 1N4PA 5CRVA 4FLHA 2PV3A 1QQEA 4L2YA 1TR4A 2IONA 2LNIA 2IQCA 4G50A 5JJ7A 3RM8A 3AG1E 1H2VC 2VQ2A 4HOQA 3Q7AA 2ZR6A 3O5FA 3RK6A 3I3NA 2O9OA 4MNMA 2P4VA 3QB2A 1MZCA 5HKGA 2A3CA 2ILRA 3CLJA 2IY0C 2ITKA 1ROTA 4GMRA 4D10C 3TXMA 1ZK6A 4TW8A 2F37A 1NL4A 2VTBA 5FZQA 4XI0A 3D9IA 3E30A 4TUMA 5AYWD 3ZYKA 3FUHA 5GQBA 3RO3A 2I6HA 4U0SA 2MLZA 2X6KA 4HBOA 5ENNA 2XZTG 3LJNA 3Q9UC 4I6EA 5CERB 5AARA 3ARXA 3O5QA 4Q69A 4EQFA 2R2LA
chains in the Genus database with same CATH topology
4KVOA 3FUFA 5HWBA 3WD2A 4DRQA 1FCHA 3FHEA 1UR8A 5E76A 5G2NA 3MCXA 2XPYA 1JWFA 2XP8A 2J09A 3UT4A 4FULA 2PZIA 3PUJA 1OGBA 3ARZA 1LL7A 5FWQA 3FEYA 3KD7A 2IFUA 4UWHA 4MNKA 4GA1A 4JFKA 3ENEA 2WXJA 1W9PA 1A17A 1HJWA 3MV3B 3NI6A 3FU6A 4JHKA 2XP9A 2WXFA 3MX3A 2X3MA 4N39A 4ODKA 5FZRA 1HKMA 4GZDA 1HKKA 1H2UA 2C0MA 2WK2A 5AENA 2Q5AA 1NSGA 3ARSA 3PH0C 3QJZA 2PQNA 2XCCA 4HARA 4BWRA 4UWFA 3FUDA 2HR2A 3VLFA 3TCZA 4WJXA 4GYOA 1UG3A 1YW5A 5DBKA 3QC1A 4JFLA 3KABA 3FU5A 2J08A 4IN3B 3FU3A 3MZLB 4F53A 2MOWA 1N1AA 1CTNA 3IHVA 4ODNA 2A4ZA 3CHPA 3ZW3A 4TUUA 3AS4A 2FF4A 3CKCA 1HXIA 4DI4A 4P8WA 5JJTA 4AIFA 1GOIA 4JL0A 2RQSA 3U3WA 2DPEA 4P8UA 1NMWA 4ACLA 3BEEA 2X6HA 5I98A 4FAPA 1ZU8A 2IOLA 2YHCA 1T11A 5DITA 3QAQA 5KJNA 1JNSA 2RUQA 2KR7A 3T5XA 3CSFA 2J49A 3IK8A 3TC5A 2HO1A 3O5EA 3PRZA 4DROA 3FDHA 2G8ZA 3CH9A 2KCVA 3CVNA 5ANRA 3EIQC 4AM9A 3CSTA 1ZL1A 1FKKA 3O5PA 3OA5A 4F7AA 1E96B 3OXFA 3O5OA 1WB0A 1UJJA 5DIZA 3RMEA 2V4LA 4YVOA 4AV7A 4I9EA 2AW6A 2RD0A 3U9WA 3MKRA 4GMLA 2BTDA 3URZA 4HFGA 4DWSC 2M63A 4MSPA 4LUNU 1BL4A 1U3DA 1FJDA 3B13A 3VLDA 4WK9A 2X6IA 4Z2KA 4Y6CA 3EDTB 3NRKA 4XX5A 4DT4A 2M08A 4GCOA 2J9QA 3KZ7A 1P5QA 1HS6A 3WQWA 1A7XA 4PS3A 2F21A 3G2TA 4C02B 3KAGA 2VGXB 3PE4A 1E90A 3UMVA 1LQ0A 2VJ8A 3AU5A 3TJPA 1WAO1 5LP0A 3GZSA 1W9VA 3ML8A 3FUJA 3B9DA 3CQGB 4CT4A 4G23A 1JNEA 4JC8A 4A3VA 3CHEA 4AOFA 3SBSA 4S3KA 3G2UA 1UR9A 1Y0OA 3VTYA 2V5FA 3ZVVA 5KJLA 2HM8A 1FKGA 3FY1A 2XPIA 1UJKA 5M72A 4APOA 2DCPA 1J4HA 3FUNA 5A6CA 3ZPJA 3ARYA 4MLPA 2WXPA 3I4RB 4JVSA 2FI7A 4DRPA 1QZ2A 1D7HA 1W1TA 4P8VA 4UQXA 2KFWA 1KT1A 4N19A 4U86A 1FKRA 5ARFA 2E2EA 1OWNA 1ZU2A 1HKIA 2IU1A 3RRUA 4PH4B 4IQCA 1W1VA 2WQ7A 2WLYA 4IULA 2OV8A 1VF8A 4Q96A 2L0IA 2VGXA 2CHXA 2X6FA 2XCBA 4QIBA 1OWOA 3KCEA 3PS6A 1H0IA 2ZU6B 1KLXA 3Q5MA 3CHMA 4LRZA 3EY6A 3PDNA 5BW8C 4BF8A 3JYSA 4IT4A 1SQMA 2IF4A 1J4IA 1TEZA 1ZB5A 4V3IA 3SD5A 2WLZA 5C2YA 4TYOA 4U07A 2GGFA 3VAWA 2ZR4A 2AVPA 4J8DA 3TXNA 4NACA 1IX5A 4ODQA 3S2AA 3I6CA 5ANLA 3ASDA 4KMOA 4AEZC 3NTPA 1LF8A 3SGHA 5DEZA 3MYVA 4DZ2A 3WD3A 2FO7A 1JVWA 3B9EA 3RO2A 4P29A 4DJAA 2F4EA 3FH5A 1YA0A 3T5VA 2WXOA 3QDNA 5BUZA 2DG3A 3LYAA 4FU3A 4DLOA 1RD6A 1ROUA 1UN9A 4FA6A 4HVBA 4CT0A 1E15A 2KI3A 3CHCA 3WQVA 4UI9C 2VYIA 3R7RA 1H6KA 1W26A 2Y4UA 3Q47B 3UI4A 2IUZA 3L13A 3PRDA 2Y78A 3CGHA 4PDXA 5CCLA 3MV2B 4Z2IA 3RGCA 3IKGA 2Q7FA 2PV1A 3JCKC 1E8WA 3UX4A 5D75A 2PPOA 1JPLA 3HDXA 4GCNA 4G11A 4H7XA 3RU0A 4Z2HA 2CG2A 4G2PA 3ALFA 5CCMA 1F40A 4FLBA 2XGOA 1PBKA 2NXPA 4H7YA 5J90A 4KQZA 4KXKB 5D0QD 4C9BB 3ESKA 3CVVA 3S7FA 3SHFA 4UI9J 4I1AA 1OUVA 3B7TA 2VCDA 4L3NA 3KAIA 3S7BA 1U3CA 3D9JA 1NWSA 3HIZA 4ANVA 2WVIA 2KZTB 2WXQA 2CHZA 3E4BA 3IEGA 4Q22A 3G6LA 1HFAA 2OLHA 1EPUA 2D9FA 2J07A 4DIPA 5FTPA 3U66A 2LO6A 1DVPA 5T8IA 2YBTA 4HBEA 5FT9A 3PE3A 5KJKA 4I2ZA 3MGBA 2YHEA 3TGOA 2FULA 2MLXA 4A3TA 1XGWA 4ZS6A 2DSZA 2L2SA 3LVRE 5EX3A 4GZ6A 3QNKA 1ZBPA 4GIVA 2PM7A 1FKTA 1ZBVA 2P58C 3LY7A 4MKTA 4MS6A 3FTWA 4CEMA 2A3EA 3FUKA 4OYSA 4WKAA 4JEUA 1WY6A 4G24A 3MJWA 4DLQA 4NURA 3SF4A 1BPOA 2CHWA 3ALGA 3I5PA 3KAFA 5JHAA 3ONLA 5DO2A 3UT7A 1JWGA 5G04C 3FTXA 1E6PA 4YVQC 2KZTA 3UI5A 3LEWA 4C0MA 4ODOA 3G2SA 3RFWA 4MRUA 3FEXA 3OXGA 1XRVA 2L9BA 2KE0A 2PV2A 3RRMB 1E9LA 1E8ZA 3D9KA 5ARGA 1B89A 3O5MA 3CK8A 4TW7A 2PQRA 3PA7A 1E6RA 4BTBA 4NRHB 3UQIA 3CHSA 1EF1C 5G04J 1D7IA 3SNXA 3WL0A 1INZA 4RSYA 4RVBA 3QK0A 4Q94A 2I9CA 2DG9A 3ODKA 3L54A 4IQ2A 4OVVA 4G1TA 3RJVA 3CV0A 2J4BA 3QARA 4FJZA 4B8AA 4TX0A 1JNTA 2ZQTA 3KAEA 1XNFA 1PINA 3ARTA 2KC7A 3GYZA 3CVYA 3O5GA 1YATA 3ZFWA 4FP7A 3B8SA 2HYZA 4J4OA 1HXVA 1HU3A 4O6FA 4BFRA 4FC8A 4MTVA 2K8IA 4GZ5A 4FN2A 3LDZA 2ZQSA 3CVUA 5HWCA 4DK5A 3PREA 1OGGA 2JZVA 2M1IA 4J8SA 1FVFA 2M2AA 2YINA 4W5UA 3BG1B 2FAPA 1OWQA 3LCAA 3UQAA 4BY6A 4N3AA 2A5UA 4ME2A 3CVXA 2UWJG 4BX8A 1HJVA 4J8FA 2MNTA 1PY1A 3B7UX 1KT0A 4IT6A 3QOUA 4URIA 4K03A 2LSUA 3ZEFA 1W9UA 4WKHA 2IOSA 1EDQA 1NA0A 4UWLA 2MF9A 4ATGA 4GZ3A 2QF8A 3IHYA 4A1GA 2LGOA 3DBSA 2N87A 5T4YA 1IHGA 1TJFA 4Q7NA 1D7JA 2PPPA 4L72B 2WB2A 1D2KA 2I2OA 2WQHA 2DSUA 1B6CA 3P1UA 5HT1A 1TCOC 1SZ9A 4ILGA 4AY5A 1HJXA 4R7LA 1J4RA 4JA7A 3CZ8A 1E6ZA 3PRAA 4G25A 2RSEA 4DRJA 5J6EA 1ZBWA 1W1YA 4DH0A 3CK7A 3ZHEB 2WM0A 1MQSA 2QY7A 2PI6A 4B8CB 4F3VA 3WH0A 4CDMA 3CVQA 2MHKA 4JZYA 1NWTA 3UI6A 1SYTA 4HOSA 3D9OA 1O6IA 4DWSB 3Q4AB 5C1DA 3HVEB 4HS2A 2ONDA 4GYWA 2C0LA 5FJYA 2VSXE 4B89A 4WAFA 3O5JA 4WNEA 1R9HA 2XP4A 1TFVA 4ODRA 3OXLA 4M3OA 4Y6WA 4Z2GA 2PBCA 4J6IA 2WXLA 4I17A 2L6JA 3FUMA 4J0UA 2WMOA 4BTAA 4BX9A 3OAWA 2KCKA 4XKBA 2DT1A 2R59A 2V0PA 2AWGA 2YQ8A 3EHMA 4KZ0A 2F2DA 4EZKA 2WXRA 4UWGA 3LKUA 3AS1A 1FKDA 4KVMA 1C9HA 3WD0A 4L7TA 4I6JA 4EBAA 1FKLA 1BKFA 5BV0A 2YBUA 3ZHEA 4I2WA 3ASGA 3QWWA 4L2LA 4AP2A 4MNJA 2MRIA 4DRIA 1FD9A 3B9AA 4J4NA 3EHNA 2XPAA 3EJNA 3D3MA 1EQ3A 1HG5A 4DWSA 2WXKA 2V8SE 3HVEA 2JLBA 4KYOB 3IBEA 3FU0A 4ILIA 5E75A 4CCAA 3KAHA 1Z3XA 4ILHB 4KBQA 3JYMA 4L1BA 3NF1A 3UT8A 2XRYA 1NMVA 5G05C 2ZR5A 4QT2A 3JXVA 3WXXA 2XGMA 1HKJA 4R0XA 2XGSA 3RIBA 3LVQE 3B7RL 4FADA 3LPZA 3CHDA 2IJGX 2JEKA 2WM9A 2MLYA 3APFA 1H0AA 2GRLA 4EZLA 2DT0A 1OWLA 2XPBA 4N2QA 3S7DA 3ZGQA 4GYYA 5G05J 4JPSA 3AROA 4QFVA 2CG3A 2B31A 4U0ZA 1HX8A 3ESLA 4UI9K 3PZDA 2DT2A 3B7SA 4A55A 1IYGA 4AJWA 3D9MA 2VGYA 2NC9A 4U85A 3PR9A 3CIAA 4ANXA 4GAAA 2LKNA 5CMYA 4E6HA 3U4TA 4NNRA 4G2VA 2R5SA 3CEQA 4TNSA 4G26A 4ODMA 1NA3A 2OVFA 2ESCA 3FTUA 3ARUA 3SZ7A 3GPKA 2DIWA 4GGQA 3CQCB 4ODLA 1X6NA 1OWPA 4UWKA 3OTNA 1GUVA 2WXGA 4MAVA 4ANWA 3TG4A 2NSZA 3PNLB 3ASFA 4CDRA 3T8MA 1FKIA 3CR3A 4GZCA 3TAXA 3ZIMA 1LG1A 4P8XA 4Z2LA 4UQYA 4LEUA 5GPRA 3TL5A 4EPZA 3LY8A 5HW7A 5FQ8A 3SFZA 1NWRA 4AXHA 2AXVA 5FZSA 1QPLA 4W9OA 4BT8A 4IPXA 2XRZA 1ZBKA 4J8EA 1HZ4A 4RG6A 4URKA 3ARVA 5FQ7A 3RRNB 5AJDA 1Q6HA 1VDYA 3D9PA 4JA9A 3MEKA 4OVUA 4JW1A 3S7JA 5HUAA 4WWNA 1NWUA 4JFIA 1SR0A 1KFWA 1FKHA 3O5KA 5HQ8A 4LAYA 3MA5A 3PVLA 4N3BA 1ELRA 3JQ1A 1HH8A 4BT9A 1Q6UA 2ZQVA 4LAWA 1Z3YA 3D9LA 4Z2JA 4ZPVR 1E6NA 1Q6IA 5BPPA 3HYMB 4PTMA 5A7DB 2XP6A 1WM5A 3NZSA 3ZYQA 3APCA 1EYHA 3EIJA 3QKYA 1UW4B 3WD4A 1H0GA 4JXTA 3AS0A 4W9RA 3ZYLA 3LY9A 2WXHA 2A3BA 5BNWA 4ANUA 3FAPA 4TV3A 3AS2A 4S3JA 2EQXA 2DG4A 4TW6A 1XHGA 2LSVA 1NP7A 2A3AA 3HHMA 2FEZA 1K9TA 4WWPA 1U79A 3GW4A 5FQ4A 3WD1A 1QPFA 1WNOA 1OWMA 2C2LA 2RG8A 5KJMA 3ARWA 1FFRA 1L5JA 3QOKA 1HE8A 2VSYA 1FAPA 3PNTB 4FJYA 4DI3A 4JFMA 3L08A 4GPKA 4TRQA 1GPFA 4U0UA 4BSXA 4W9QA 4DWSD 2O92A 1LL4A 2YNQA 5LFAA 4EBAG 2RUCA 1H2TC 1HF8A 4HORA 4MPKA 4WNGA 5AIJA 2DSWA 4LGXA 2GW1A 4DRNA 4AVXA 2X38A 1S0PA 2R17C 3KS2A 3L17A 4QT3A 5LX8A 3QWVA 4PS8A 3RM9A 1IQUA 3CVPA 1D6OA 2WPVA 2AXZA 3PEVB 1PAQA 5D0OD 3WKZA 3FTYA 1E7UA 3BXWA 2BF0X 2KATA 4WNFA 1J6YA 4K0RA 4U63A 2X6JA 1EIBA 2E0IA 3CVLA 3MKQB 3KACA 4L23A 3BG0B 5KCMA 4JEHA 4I6GA 4KR0B 4PUCA 2AWIA 3PUKA 2XHEA 3ARQA 1F8AB 5T3RA 4WUYA 1QNFA 4GU5A 3ARPA 4EZJA 4IRUA 4AY6A 2AXUA 2Y4TA 3TG5A 2FKEA 5HW6A 3O5DA 4ACKA 5LCWC 3FUEA 4YNDA 2DBAA 4E85A 3VTXA 2XPZA 2XP7A 4NZCA 3FULA 5BXJA 4ABNA 3FY4A 2XP5A 5HTGA 3RKVA 4JYSA 3GZ1A 1JNDA 1N54A 2WXNA 1NZNA 3AS3A 3APDA 4RG9A 4ZPWR 4CGWA 3L6AA 1ITXA 4XIFA 2XP3A 2KM4A 3IV0A 2L0TB 4GB9A 2PL2A 3I4GA 4HOUA 3G6MA 4ML4A 4WNDA 1ZCNA 5LCWJ 1PC2A 2LAHA 4NSBA 1W3BA 4MNLA 4XE0A 5JHBA 5DF0A 1ELWA 3MKQA 3TDBA 4IYPA 3GZ2A 3ML9A 3SI5A 1FFQA 2I1KA 3AS5A 4N3CA 3DPDA 1TJCA 2FDMA 1UN8A 4LCTA 1X6LA 4DRMA 4B94A 2LAIA 2GRMA 3N71A 4GMJA 4EECA 3UPVA 1ELKA 1LL6A 3ULQA 3P2BA 3LUOA 3ZRHA 2PPNA 3C98A 4B0ZA 5EKQD 4HXIA 5B8IC 3ZYMA 1FKSA 3JUIA 4ZPTR 3AS8A 4FHJA 5JJ6A 3FFLA 2WXMA 2XQ0A 3W4RA 3H9RB 4U04A 4CRWA 4JHRA 3L22A 4FHKA 3PRBA 5BV1A 4LAVA 3SBTB 2BUGA 1EYMA 5HI7A 4I9CA 1NH6A 4I1OB 3KEZA 1H19A 3B7XA 3CHOA 2Y3AA 4JHJA 3FUIA 2PM6A 2WXIA 1GW6A 4F1SA 1MHQA 1ZBCA 1L1PA 2CFUA 3AU4A 2ZQUA 3KADA 4NQ0A 3R9AB 3UF8A 2DT3A 3NZUA 3LXUX 3OOBA 3UQBA 3CVWA 3FH8A 4I43A 5HBFA 2VSNA 4WWOA 2RUDA 2UZ5A 4R5EA 2LPVA 2DSVA 3O5LA 1Z6TA 4HLEA 4N5CA 3ASHA 3ONKA 3AQUA 4CGVA 4W9PA 3G2WA 3MDYB 3IHZA 1EHNA 1N52A 4U8HA 5EX0A 2WQ6A 4O2TA 3FTVA 3LS8A 4KZCA 1FKFA 3O5RA 2WMNA 3PEUB 1SZAA 2RURA 1JUQA 2VSOE 5HW8A 3WIJA 4A1SA 3D9NA 5EDSA 4UQZA 3FTSA 3Q49B 4XKCA 3FH7A 1HO8A 5A23A 4N2SA 1LG2A 3JQ0A 5DIUA 5AJLA 2LJ4A 5J08A 1X5BA 3CHQA 1FKJA 4WKFA 4U84A 2OVBA 3NQPA 3O5IA 3G2VA 3CGNA 3FP3A 4DRKA 3CHRA 3LJ3A 4GA0A 2KO7A 2XEVA 4WIWA 3JYJA 2UY1B 5JH8A 4ITZA 5BT1A 3FTZA 4GA2A 1Y6IA 3CKBA 4DRHA 2I1JA 2AOSA 2OOEA 1Q1CA 1EDUA 3FWVA 3CGMA 3Q15A 2KCLA 1M5YA 4LERA 5CHEE 3WL1A 4JFJA 4DPRA 1FKBA 4APFA 3IKOB 3UUXA 3L16A 4ODPA 1LJYA 2MPHA 2VN1A 2KGJA 3RM4A 1E7VA 3CHFA 3K9IA 1HG2A 4C0EA 3ARRA 1E8XA 2VTBB 1Y8MA 4XAKA 2QFCA 1DNPA 4HOTA 4XZ4A 3R7QA 4KT6B 3ZN3A 4PS7A 3VLEA 1WAWA 5LOZA 5GPGA 4I1MA 2OFNA 3CK9A 5CMWA 2G41A 4DZ3A 3U64A 4MGVA 2J4DA 4AY1A 3UQ3A 3O4ZA 3ZXSA 1IQRA 3FXYA 5DIVA 2CFZA 3IKDA 4LAXA 5G55A 4CDNA 1W1PA 1FVHA 2UY1A 4QZVB 3QWPA 5FQ6A 3O48A 4XI9A 1E8YA 2FBNA 4FLHA 2PV3A 1QQEA 4L2YA 2IONA 2LNIA 2IQCA 4G50A 5JJ7A 3RM8A 1H2VC 2VQ2A 4HOQA 2ZR6A 3O5FA 3RK6A 3I3NA 2O9OA 4MNMA 3QB2A 5HKGA 2A3CA 2ILRA 3CLJA 2ITKA 1ROTA 4D10C 3TXMA 1ZK6A 4TW8A 2VTBA 5FZQA 4XI0A 3D9IA 5AYWD 3ZYKA 3FUHA 5GQBA 2MLZA 3RO3A 2I6HA 4U0SA 2X6KA 4HBOA 5ENNA 4I6EA 3ARXA 3O5QA 4Q69A 4EQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2D A;  3PRD A;  2Y78 A;  1F8A B;  4WUY A;  3LKU A;  5CCL A;  3MV2 B;  3RGC A;  5HWB A;  1FKD A;  4AY6 A;  2Y4T A;  3TG5 A;  2Q7F A;  3IKG A;  2PV1 A;  1C9H A;  2FKE A;  5HW6 A;  5D75 A;  3O5D A;  5LCW C;  2PPO A;  4DRQ A;  4GCN A;  1FCH A;  4H7X A;  3RU0 A;  1FKL A;  1BKF A;  4YND A;  2DBA A;  4G2P A;  3VTX A;  3ZHE A;  2XP8 A;  4I2W A;  2XP7 A;  3ASG A;  5CCM A;  1F40 A;  3QWW A;  2XGO A;  2PZI A;  1PBK A;  5BXJ A;  4ABN A;  4DRI A;  1FD9 A;  2XP5 A;  5HTG A;  3RKV A;  4JYS A;  4H7Y A;  4J4N A;  3GZ1 A;  2XPA A;  3KD7 A;  1NZN A;  2IFU A;  4KXK B;  1EQ3 A;  5D0Q D;  4RG9 A;  3ESK A;  4GA1 A;  4CGW A;  4JFK A;  3S7F A;  4UI9 J;  4I1A A;  1A17 A;  1OUV A;  3MV3 B;  2JLB A;  4KYO B;  3NI6 A;  4XIF A;  2VCD A;  2XP3 A;  3KAH A;  4KBQ A;  3JYM A;  3KAI A;  3S7B A;  3NF1 A;  2XP9 A;  2PL2 A;  1NMV A;  5G05 C;  2ZR5 A;  4QT2 A;  4HOU A;  4N39 A;  3JXV A;  3WXX A;  2XGM A;  4ODK A;  5FZR A;  3E4B A;  3IEG A;  4WND A;  4R0X A;  1ZCN A;  2XGS A;  5LCW J;  3RIB A;  1PC2 A;  2C0M A;  1W3B A;  2Q5A A;  1NSG A;  2D9F A;  4DIP A;  1ELW A;  5FTP A;  2PQN A;  2XCC A;  3TDB A;  4BWR A;  3LPZ A;  2HR2 A;  3GZ2 A;  3TCZ A;  3AS5 A;  4N3C A;  4GYO A;  2MLY A;  1YW5 A;  5DBK A;  5FT9 A;  3PE3 A;  5KJK A;  4JFL A;  4I2Z A;  3KAB A;  1TJC A;  4IN3 B;  3TGO A;  2XPB A;  4N2Q A;  2MLX A;  3S7D A;  1N1A A;  4DRM A;  4B94 A;  3ZGQ A;  4GYY A;  3N71 A;  4ODN A;  3UPV A;  5G05 J;  2L2S A;  3ULQ A;  5EX3 A;  4GZ6 A;  4U0Z A;  3AS4 A;  1ZBP A;  3LUO A;  2FF4 A;  3CKC A;  4GIV A;  1FKT A;  1HXI A;  2P58 C;  3LY7 A;  4UI9 K;  5EKQ D;  2PPN A;  5B8I C;  1FKS A;  5JJT A;  4AIF A;  3AS8 A;  1IYG A;  5JJ6 A;  3FFL A;  4G24 A;  4JL0 A;  2RQS A;  3U3W A;  1NMW A;  3SF4 A;  3H9R B;  4U04 A;  2VGY A;  4JHR A;  2NC9 A;  4U85 A;  3PRB A;  3BEE A;  4LAV A;  5I98 A;  4FAP A;  2BUG A;  3KAF A;  2YHC A;  1T11 A;  1EYM A;  5DIT A;  5HI7 A;  4I9C A;  5G04 C;  2LKN A;  5KJN A;  3B7X A;  3U4T A;  1JNS A;  4NNR A;  2RUQ A;  2KR7 A;  4YVQ C;  4G2V A;  2R5S A;  3CEQ A;  3IK8 A;  3UI5 A;  3TC5 A;  4TNS A;  2HO1 A;  3O5E A;  4ODO A;  4G26 A;  4ODM A;  4DRO A;  3RFW A;  2KCV A;  3OXG A;  1NA3 A;  1L1P A;  3CVN A;  2KE0 A;  3SZ7 A;  3GPK A;  4AM9 A;  2PV2 A;  1FKK A;  3O5P A;  2ZQU A;  4GGQ A;  5ARG A;  3KAD A;  4ODL A;  4NQ0 A;  3R9A B;  3UF8 A;  1B89 A;  3O5M A;  3OOB A;  3UQB A;  3CK8 A;  4TW7 A;  2PQR A;  3PA7 A;  4BTB A;  2VSN A;  1E96 B;  3OXF A;  4NRH B;  3TG4 A;  3O5O A;  2RUD A;  2UZ5 A;  3UQI A;  2LPV A;  5DIZ A;  3ASF A;  4CDR A;  5G04 J;  1D7I A;  4YVO A;  1FKI A;  3O5L A;  4I9E A;  3TAX A;  4N5C A;  3ASH A;  2DG9 A;  3ODK A;  4UQY A;  4CGV A;  4LEU A;  4W9P A;  3MKR A;  4IQ2 A;  4G1T A;  3RJV A;  3MDY B;  3URZ A;  3CV0 A;  3LY8 A;  5HW7 A;  3IHZ A;  5FZS A;  5EX0 A;  1QPL A;  4W9O A;  4MSP A;  1JNT A;  2ZQT A;  3KAE A;  4BT8 A;  4O2T A;  4IPX A;  4TX0 A;  1XNF A;  1BL4 A;  1FJD A;  1PIN A;  4J8E A;  2KC7 A;  1HZ4 A;  3GYZ A;  1FKF A;  3O5R A;  4RG6 A;  3O5G A;  1YAT A;  3ZFW A;  2RUR A;  4Y6C A;  2HYZ A;  5HW8 A;  4J4O A;  3EDT B;  1Q6H A;  3NRK A;  1HXV A;  4A1S A;  4JA9 A;  3MEK A;  3S7J A;  4DT4 A;  4UQZ A;  4O6F A;  2M08 A;  4GCO A;  5HUA A;  2J9Q A;  3Q49 B;  3KZ7 A;  1P5Q A;  1A7X A;  4JFI A;  4N2S A;  2F21 A;  1FKH A;  2K8I A;  4GZ5 A;  5DIU A;  4C02 B;  4FN2 A;  3O5K A;  5HQ8 A;  2ZQS A;  4LAY A;  2LJ4 A;  3MA5 A;  5HWC A;  3KAG A;  2VGX B;  3PE4 A;  4N3B A;  2JZV A;  1ELR A;  2M1I A;  1FKJ A;  4U84 A;  1WAO 1;  2M2A A;  1HH8 A;  4BT9 A;  3O5I A;  1Q6U A;  2FAP A;  2ZQV A;  3CGN A;  3FP3 A;  3LCA A;  3UQA A;  4DRK A;  4LAW A;  4GA0 A;  4N3A A;  1Q6I A;  2KO7 A;  2XEV A;  4G23 A;  4ME2 A;  3HYM B;  3JYJ A;  2UY1 B;  5A7D B;  2XP6 A;  1WM5 A;  2UWJ G;  4ITZ A;  5BT1 A;  4J8F A;  4GA2 A;  3CKB A;  1Y0O A;  2MNT A;  4DRH A;  3QKY A;  2OOE A;  3VTY A;  1Q1C A;  2V5F A;  5KJL A;  1FKG A;  1KT0 A;  3FWV A;  3CGM A;  3Q15 A;  2XPI A;  2KCL A;  1M5Y A;  3QOU A;  4W9R A;  5CHE E;  3LY9 A;  5M72 A;  5BNW A;  4APO A;  4JFJ A;  3FAP A;  2LSU A;  1FKB A;  1J4H A;  2DG4 A;  4TW6 A;  3UUX A;  2LSV A;  5A6C A;  4ODP A;  3ZPJ A;  1NA0 A;  2FEZ A;  2MF9 A;  2MPH A;  1U79 A;  2VN1 A;  2FI7 A;  3GW4 A;  4DRP A;  4GZ3 A;  1QZ2 A;  2KGJ A;  1D7H A;  2LGO A;  2N87 A;  4UQX A;  1QPF A;  2KFW A;  3K9I A;  1IHG A;  1KT1 A;  2C2L A;  1D7J A;  2PPP A;  4N19 A;  4U86 A;  1FKR A;  5ARF A;  1Y8M A;  5KJM A;  2WQH A;  2QFC A;  1B6C A;  2E2E A;  4HOT A;  5HT1 A;  1ZU2 A;  2VSY A;  1TCO C;  3ZN3 A;  1FAP A;  4JFM A;  4AY5 A;  4IQC A;  4GPK A;  5GPG A;  2OFN A;  4U0U A;  1J4R A;  3CK9 A;  4JA7 A;  4W9Q A;  2VGX A;  2XCB A;  4QIB A;  4DZ3 A;  3KCE A;  4G25 A;  2RSE A;  4DRJ A;  2RUC A;  5J6E A;  1KLX A;  4MGV A;  3Q5M A;  4DH0 A;  3EY6 A;  3PDN A;  3UQ3 A;  5BW8 C;  4HOR A;  3CK7 A;  3ZHE B;  4BF8 A;  3JYS A;  5DIV A;  3IKD A;  4LAX A;  2IF4 A;  4WNG A;  1J4I A;  4F3V A;  3WH0 A;  2GW1 A;  4DRN A;  3CVQ A;  2UY1 A;  2MHK A;  3QWP A;  3UI6 A;  4TYO A;  4U07 A;  4HOS A;  3O48 A;  4XI9 A;  3VAW A;  2FBN A;  2ZR4 A;  2AVP A;  3KS2 A;  4J8D A;  3Q4A B;  5C1D A;  2PV3 A;  1QQE A;  2OND A;  4GYW A;  2C0L A;  4ODQ A;  5FJY A;  2LNI A;  3QWV A;  4QT3 A;  3I6C A;  3CVP A;  1D6O A;  3ASD A;  3NTP A;  2WPV A;  4G50 A;  5JJ7 A;  5D0O D;  3O5J A;  2VQ2 A;  4DZ2 A;  4WNE A;  4HOQ A;  2ZR6 A;  2FO7 A;  3O5F A;  1JVW A;  2KAT A;  3RO2 A;  4WNF A;  1J6Y A;  1R9H A;  2F4E A;  2XP4 A;  4ODR A;  5HKG A;  1YA0 A;  3OXL A;  3QDN A;  4Y6W A;  2DG3 A;  2ITK A;  3LYA A;  2PBC A;  3CVL A;  1ROT A;  3KAC A;  4I17 A;  1ZK6 A;  4TW8 A;  2L6J A;  1ROU A;  5FZQ A;  4XI0 A;  4J0U A;  2KI3 A;  4BTA A;  5AYW D;  4UI9 C;  2VYI A;  3RO3 A;  2I6H A;  2KCK A;  4U0S A;  2MLZ A;  1W26 A;  2AWG A;  2Y4U A;  3Q47 B;  2YQ8 A;  3O5Q A;  3UI4 A;  4EQF A; 
#chains in the Genus database with same CATH topology
 4KVO A;  1O5M A;  2DZN A;  3FUF A;  5HWB A;  3WD2 A;  4DRQ A;  1FCH A;  3FHE A;  1UR8 A;  5E76 A;  5G2N A;  3MCX A;  2XPY A;  1JWF A;  2XP8 A;  2J09 A;  3UT4 A;  4FUL A;  2RFA A;  4HBD A;  2PZI A;  3PUJ A;  1OGB A;  3TWS A;  3ARZ A;  1LL7 A;  5FWQ A;  3FEY A;  3KD7 A;  2IFU A;  4UWH A;  4MNK A;  5CBO A;  4GA1 A;  4JFK A;  3ENE A;  2WXJ A;  2H6F A;  1W9P A;  1A17 A;  3UM1 A;  3MV3 B;  1HJW A;  5AQ7 A;  2R02 A;  3ASN E;  3FU6 A;  3NI6 A;  4LG6 A;  1BLX B;  1OCR E;  4JHK A;  4HNA D;  2XP9 A;  2WXF A;  3MX3 A;  2X3M A;  4N39 A;  4ODK A;  5FZR A;  1HKM A;  4GZD A;  1HKK A;  1H2U A;  2C0M A;  3NBN B;  2WK2 A;  5AEN A;  2Q5A A;  1NSG A;  2DWZ A;  4DX1 A;  3ARS A;  3PH0 C;  3QJZ A;  2PQN A;  2XCC A;  4HAR A;  4BWR A;  5HS0 A;  4UWF A;  3FUD A;  2HR2 A;  3VLF A;  3TCZ A;  3L9T A;  4WJX A;  4GYO A;  4LNG A;  1UG3 A;  1YW5 A;  1TN7 A;  5DBK A;  3QC1 A;  3NB2 A;  4JFL A;  3KAB A;  3FU5 A;  2J08 A;  4IN3 B;  3UIO C;  3FU3 A;  3MZL B;  4F53 A;  2MOW A;  1N1A A;  1D8D A;  1CTN A;  4F1P A;  3IHV A;  4ODN A;  2A4Z A;  3CHP A;  3DEO A;  1D8E A;  3ZW3 A;  4TUU A;  3AS4 A;  1UOH A;  2FF4 A;  3CKC A;  1HXI A;  4DI4 A;  4P8W A;  1YMP A;  5JJT A;  4AIF A;  1GOI A;  1SA5 A;  4JL0 A;  2RQS A;  1DCE A;  3U3W A;  3ISM C;  2DPE A;  4P8U A;  2ETC A;  1NMW A;  4ACL A;  3BEE A;  2X6H A;  5I98 A;  4FAP A;  1ZU8 A;  2IOL A;  2YHC A;  1T11 A;  5DIT A;  3QAQ A;  1N94 A;  4O1O A;  5KJN A;  5HRY A;  1JNS A;  2QC9 A;  2RUQ A;  2KR7 A;  3T5X A;  3CSF A;  2J49 A;  3IK8 A;  3TC5 A;  3IXE A;  2HO1 A;  3O5E A;  1QBQ A;  3PRZ A;  4DRO A;  3FDH A;  2G8Z A;  3CH9 A;  2KCV A;  2Y69 E;  3CVN A;  5ANR A;  3EIQ C;  4AM9 A;  3CST A;  1ZL1 A;  3V2X A;  1FKK A;  3O5P A;  2KXP C;  3BMB A;  3RAU A;  3OA5 A;  4F7A A;  4TXQ A;  1E96 B;  3OXF A;  3EIP A;  3O5O A;  1WB0 A;  1UJJ A;  5DIZ A;  3RME A;  1LTX A;  2V4L A;  4YVO A;  4AV7 A;  4I9E A;  3TWU A;  2AW6 A;  2RD0 A;  1N4Q A;  3U9W A;  3DST A;  4TXP A;  3EHQ A;  3MKR A;  4GML A;  3HRA A;  2BTD A;  3URZ A;  4HFG A;  4DWS C;  2M63 A;  4MSP A;  4LUN U;  1BL4 A;  1U3D A;  1FJD A;  3B13 A;  3VLD A;  4WK9 A;  1RW2 A;  2XEN A;  2X6I A;  4Z2K A;  3Q73 A;  4Y6C A;  3EDT B;  3NRK A;  4XX5 A;  3BUA A;  3DPY A;  4DT4 A;  2M08 A;  4GCO A;  1MX4 A;  2J9Q A;  3KZ7 A;  1P5Q A;  5KNG A;  1HS6 A;  3WQW A;  1DCQ A;  1A7X A;  4PS3 A;  2F21 A;  3G2T A;  4C02 B;  3KAG A;  2VGX B;  3PE4 A;  4GTM A;  2QYU A;  1E90 A;  3UMV A;  4U7E B;  4GTV A;  1LQ0 A;  2VJ8 A;  3AU5 A;  3TJP A;  1WAO 1;  5LP0 A;  1AP7 A;  3GZS A;  1W9V A;  4J8Y A;  3ML8 A;  1JCQ A;  3FUJ A;  3GTY X;  3B9D A;  3CQG B;  4CT4 A;  1G3N B;  3C5R A;  4G23 A;  1JNE A;  4JC8 A;  4A3V A;  3CHE A;  4AOF A;  3HG0 D;  3SBS A;  1JCR A;  4S3K A;  3G2U A;  1UR9 A;  1Y0O A;  3VTY A;  1BD8 A;  2V5F A;  3TWV A;  3ZVV A;  5KJL A;  2HM8 A;  1FKG A;  3FY1 A;  3SQV A;  2XPI A;  1UJK A;  5M72 A;  3R9M A;  4APO A;  3UXG A;  2DCP A;  3E32 A;  1J4H A;  3FUN A;  5A6C A;  2B0O E;  3ZPJ A;  3ARY A;  4MLP A;  2WXP A;  3I4R B;  3UM2 A;  4JVS A;  2FI7 A;  4DRP A;  1QZ2 A;  5BXO A;  4HRN A;  1D7H A;  1W1T A;  4P8V A;  3DSX A;  4UQX A;  2KFW A;  1K8K G;  1KT1 A;  1KZP A;  4N19 A;  4U86 A;  1FKR A;  5ARF A;  5ENR D;  2E2E A;  3ABM E;  1OWN A;  1ZU2 A;  1HKI A;  2IU1 A;  3RRU A;  4PH4 B;  4IQC A;  1W1V A;  1YYH A;  2WQ7 A;  2WLY A;  4IUL A;  2OV8 A;  1VF8 A;  4Q96 A;  2L0I A;  2VGX A;  2CHX A;  2X6F A;  2XCB A;  4QIB A;  1OWO A;  3KCE A;  1OXJ A;  3PS6 A;  1H0I A;  2ZU6 B;  1KLX A;  3Q5M A;  3CHM A;  4LRZ A;  3EY6 A;  3PDN A;  5BW8 C;  4BF8 A;  3JYS A;  4YDE A;  2IEJ A;  4IT4 A;  1SQM A;  2BKK B;  2IF4 A;  1J4I A;  5AQA A;  1TEZ A;  1ZB5 A;  4V3I A;  3SD5 A;  2WLZ A;  5C2Y A;  4TYO A;  4U07 A;  2GGF A;  3VAW A;  2ZR4 A;  2AVP A;  4J8D A;  3SO8 A;  3TXN A;  1N4S A;  2H6H A;  4NAC A;  1IX5 A;  4ODQ A;  3S2A A;  3I6C A;  5ANL A;  3ASD A;  4KMO A;  4AEZ C;  3NTP A;  1LF8 A;  3SGH A;  5DEZ A;  2P2C P;  2ETN A;  3DRA A;  3MYV A;  4DZ2 A;  3WD3 A;  1ZB1 A;  2FO7 A;  1JVW A;  3B9E A;  3RO2 A;  2F8Y A;  4P29 A;  4DJA A;  2F4E A;  3FH5 A;  3SY2 A;  1YA0 A;  3T5V A;  2WXO A;  3QDN A;  5BUZ A;  2DG3 A;  3LYA A;  1BI8 B;  4FU3 A;  4DLO A;  4QQI A;  4DX6 D;  3C72 A;  2XS1 A;  1RD6 A;  4OAV B;  1UN9 A;  4FA6 A;  3TWX A;  4HVB A;  1ROU A;  4CT0 A;  1E15 A;  2F23 A;  3UIN C;  2KI3 A;  3CHC A;  3WQV A;  4UI9 C;  2VYI A;  3R7R A;  1H6K A;  1W26 A;  2Y4U A;  1O1R A;  3Q47 B;  3SFX A;  3UI4 A;  1IHB A;  2IUZ A;  3L13 A;  3PRD A;  5ENQ D;  2Y78 A;  1AWC B;  3CGH A;  4PDX A;  5CCL A;  3MV2 B;  4BSZ B;  3RGC A;  4Z2I A;  3IKG A;  3HXF A;  2Q7F A;  2PV1 A;  3JCK C;  1E8W A;  3UX4 A;  4RLY A;  5D75 A;  3TWT A;  2PPO A;  1JPL A;  3HDX A;  4GCN A;  4G11 A;  4H7X A;  3RU0 A;  4Z2H A;  2CG2 A;  4NIK A;  3DSU A;  4G2P A;  3ALF A;  5CCM A;  1F40 A;  4FLB A;  2XGO A;  1PBK A;  2NXP A;  4H7Y A;  5AQ9 A;  5J90 A;  1X81 A;  4KQZ A;  4KXK B;  5D0Q D;  4C9B B;  3ESK A;  3CVV A;  5ENO D;  3S7F A;  3SHF A;  4UI9 J;  4I1A A;  1OUV A;  5KNH D;  2OEV A;  1OCZ E;  3B7T A;  3KSL A;  2VCD A;  4L3N A;  3KAI A;  3S7B A;  5CEC B;  1U3C A;  3D9J A;  1NWS A;  5HKP A;  3HIZ A;  5EN5 D;  4ANV A;  2WVI A;  4DX7 D;  2KZT B;  2WXQ A;  2CHZ A;  3E4B A;  3IEG A;  4Q22 A;  3G6L A;  1HFA A;  2OLH A;  1EPU A;  2D9F A;  2J07 A;  4DIP A;  2J8S D;  1V55 E;  2XEH A;  5FTP A;  3U66 A;  2LO6 A;  2HE0 A;  1DVP A;  5T8I A;  2YBT A;  4HBE A;  5JA4 D;  3ZXP A;  5FT9 A;  3PE3 A;  5KJK A;  1QYM A;  5EIL A;  4I2Z A;  3MGB A;  2YHE A;  3TGO A;  2FUL A;  2MLX A;  4A3T A;  1XGW A;  4ZS6 A;  2DSZ A;  2L2S A;  3LVR E;  5EX3 A;  4GZ6 A;  3QNK A;  1ZBP A;  4GIV A;  2PM7 A;  4F6R D;  1FKT A;  2H6G A;  2P58 C;  4GTO A;  3LY7 A;  4MKT A;  4MS6 A;  1ZBV A;  3FTW A;  2GRQ B;  2P9K G;  3ZU7 B;  4CEM A;  2A3E A;  3FUK A;  5CEA A;  4OYS A;  4WKA A;  5D2M C;  4JEU A;  4C48 B;  1WY6 A;  4G24 A;  3MJW A;  4DLQ A;  4NUR A;  3SF4 A;  4JD2 G;  1BPO A;  3BQO A;  2CHW A;  3EHR A;  5JMN D;  3ALG A;  3I5P A;  3KAF A;  5JHA A;  3ONL A;  3KEA A;  3J5P A;  5DO2 A;  3UT7 A;  1JWG A;  5G04 C;  3FTX A;  1E6P A;  1N9A A;  4YVQ C;  2KZT A;  3UI5 A;  3LEW A;  3L82 A;  3UKU G;  4C0M A;  4ODO A;  3G2S A;  3DEP A;  3RFW A;  4MRU A;  3HXC A;  3FEX A;  3OXG A;  1XRV A;  3PZ1 A;  2L9B A;  2KE0 A;  2PV2 A;  3RRM B;  4GTS A;  1E9L A;  1E8Z A;  3D9K A;  1MX2 A;  5ARG A;  1B89 A;  3O5M A;  3CK8 A;  4TW7 A;  2PQR A;  2XEE A;  3PA7 A;  1E6R A;  4BTB A;  1H6O A;  5CRU A;  2ZGG A;  3SFY A;  4NRH B;  3V79 K;  3UQI A;  1SVX A;  3CHS A;  4K5C A;  1EF1 C;  5G04 J;  1D7I A;  3SNX A;  3Q75 A;  3WL0 A;  1INZ A;  4RSY A;  4RVB A;  3QK0 A;  4Q94 A;  2I9C A;  2DG9 A;  3ODK A;  3L54 A;  4IQ2 A;  4OVV A;  4G1T A;  3RJV A;  3CV0 A;  2J4B A;  3QAR A;  4FJZ A;  2MYO A;  4B8A A;  2LXM A;  4TX0 A;  1JNT A;  2ZQT A;  3KAE A;  1K1A A;  1XNF A;  1PIN A;  3ART A;  1FT1 A;  2KC7 A;  3GYZ A;  3CVY A;  2RKK A;  3O5G A;  1YAT A;  3ZFW A;  4FP7 A;  3B8S A;  2HYZ A;  4J4O A;  1HXV A;  2IO3 C;  1HU3 A;  4O6F A;  3C3R A;  2OCC E;  4BFR A;  4FC8 A;  4MTV A;  2K8I A;  2ZGD A;  4GZ5 A;  4FN2 A;  3LDZ A;  2ZQS A;  3CVU A;  5HWC A;  4DK5 A;  3PRE A;  1OGG A;  2JZV A;  2M1I A;  4J8S A;  1H6P A;  1Q2Z A;  1FVF A;  4HRM B;  4LNB A;  3UI2 A;  2M2A A;  2YIN A;  4W5U A;  3BG1 B;  2FAP A;  1OWQ A;  3LCA A;  3UQA A;  4BY6 A;  4N3A A;  2A5U A;  5ENP D;  1TN8 A;  4ME2 A;  3CVX A;  2FO1 E;  2UWJ G;  4BX8 A;  1HJV A;  4J8F A;  5ENT D;  3EU5 A;  2MNT A;  4L9P A;  2BED A;  1PY1 A;  3B7U X;  1JCH B;  1KT0 A;  2R05 A;  4IT6 A;  3QOU A;  4URI A;  2P9U G;  3T9K A;  4K03 A;  2LSU A;  3ZEF A;  1W9U A;  4WKH A;  3BU8 A;  2V4H C;  5H7P A;  2IOS A;  1EDQ A;  1NA0 A;  4UWL A;  1E44 A;  2MF9 A;  4ATG A;  4GZ3 A;  2QF8 A;  2ETA A;  3IHY A;  4A1G A;  2LGO A;  3DBS A;  2N87 A;  5KBA A;  5T4Y A;  1IHG A;  1TJF A;  3UM3 A;  4Q7N A;  1D7J A;  2PPP A;  4L72 B;  2WB2 A;  1D2K A;  2I2O A;  2WQH A;  2DSU A;  1S70 B;  1B6C A;  3P1U A;  3KSQ A;  5HT1 A;  1TCO C;  1SZ9 A;  4ILG A;  4AY5 A;  3AG3 E;  1HJX A;  3TWR A;  4R7L A;  1J4R A;  2V5Q C;  4JA7 A;  4MBG A;  3CZ8 A;  1E6Z A;  3JXI A;  3PRA A;  4G25 A;  2RSE A;  1SW6 A;  1MX6 A;  4DRJ A;  5J6E A;  1ZBW A;  1W1Y A;  4DH0 A;  4EHM A;  3CK7 A;  3ZHE B;  2WM0 A;  1MQS A;  3AG4 E;  2QY7 A;  2PI6 A;  4B8C B;  4F3V A;  3WH0 A;  4CDM A;  1OCO E;  3CVQ A;  2MHK A;  4JZY A;  1NWT A;  3UI6 A;  1SYT A;  4HOS A;  4RQI A;  3D9O A;  1O6I A;  4DWS B;  5D66 A;  2L6B A;  2EIM E;  3Q4A B;  5C1D A;  3HVE B;  4HS2 A;  2OND A;  2AJA A;  4GYW A;  2C0L A;  5FJY A;  2VSX E;  4O60 A;  5CBN A;  3DXM G;  4B89 A;  4WAF A;  3O5J A;  4WNE A;  4M7C A;  3DWL G;  1R9H A;  1OT8 A;  2XP4 A;  1TFV A;  4ODR A;  3OXL A;  4M3O A;  4Y6W A;  4Z2G A;  2PBC A;  4J6I A;  2WXL A;  4I17 A;  2L6J A;  3FUM A;  4J0U A;  2WMO A;  4BTA A;  4BX9 A;  1TNY A;  4CZ2 D;  3OAW A;  2KCK A;  4XKB A;  2R59 A;  2V0P A;  2DT1 A;  2AWG A;  2YQ8 A;  5EID A;  3EHM A;  4KZ0 A;  2F2D A;  4EZK A;  2WXR A;  4UWG A;  3LKU A;  3AS1 A;  1FKD A;  4KVM A;  1C9H A;  3W9F A;  3WD0 A;  3DSW A;  4L7T A;  1FT2 A;  4I6J A;  4EBA A;  1FKL A;  1BKF A;  4GPM A;  5BV0 A;  2YBU A;  3ZHE A;  4CYM D;  4I2W A;  3ASG A;  2RFM A;  3QWW A;  4L2L A;  4AP2 A;  4MNJ A;  5AAO A;  2MRI A;  4ATZ D;  4DRI A;  1FD9 A;  3B9A A;  4J4N A;  3EHN A;  3AG2 E;  2XPA A;  3EJN A;  3D3M A;  1EQ3 A;  1TN6 A;  1HG5 A;  1BU9 A;  2WXK A;  4DWS A;  2V8S E;  3HVE A;  2JLB A;  4KYO B;  2DYS E;  1IKN D;  3IBE A;  3FU0 A;  4ILI A;  5E75 A;  4CCA A;  3KAH A;  1Z3X A;  4ILH B;  4KBQ A;  3JYM A;  4L1B A;  3NF1 A;  3UT8 A;  3T8K A;  2XRY A;  1NMV A;  5G05 C;  5CED B;  2ZR5 A;  4QT2 A;  3JXV A;  3WXX A;  2XGM A;  1HKJ A;  4R0X A;  2XGS A;  3RIB A;  3TWQ A;  4UDM A;  2P9L G;  3JUE A;  3LVQ E;  4OAU C;  3B7R L;  4DRX E;  1MYO A;  4FAD A;  3LPZ A;  3CHD A;  2IJG X;  4ZHB A;  2JEK A;  2WM9 A;  2MLY A;  3APF A;  2NYJ A;  1H0A A;  2GRL A;  4EZL A;  2DT0 A;  1OWL A;  2XPB A;  4N2Q A;  3ZNG A;  1S63 A;  3S7D A;  3ZGQ A;  4GYY A;  5G05 J;  4JPS A;  3ARO A;  4QFV A;  2CG3 A;  4HLL A;  2B31 A;  4U0Z A;  1HX8 A;  3ESL A;  2A5E A;  4UI9 K;  3PZD A;  2DT2 A;  3B7S A;  2B6C A;  4J7W A;  3Q78 A;  4A55 A;  1IYG A;  4AJW A;  3D9M A;  2VGY A;  2NC9 A;  4U85 A;  3PR9 A;  3CIA A;  4ANX A;  4GAA A;  3DSV A;  2LKN A;  5CMY A;  4E6H A;  3U4T A;  4NNR A;  2JAB A;  3W9G A;  3V2O A;  4G2V A;  4U95 D;  2R5S A;  4G8L A;  3CEQ A;  4TNS A;  5BXU A;  4G26 A;  4ODM A;  1NA3 A;  2OVF A;  2ESC A;  3FTU A;  3ARU A;  3SZ7 A;  3GPK A;  3HXE A;  2DIW A;  1KZO A;  4GGQ A;  1YCS B;  3CQC B;  4ODL A;  1X6N A;  1OWP A;  4UWK A;  3JXJ A;  4HQD A;  3OTN A;  1GUV A;  4GTP A;  2WXG A;  4MAV A;  4ANW A;  3TG4 A;  4N5Q A;  2NSZ A;  2LUH A;  3PNL B;  3EU9 A;  3ASF A;  4CDR A;  1JCS A;  3T8M A;  1FKI A;  4B93 B;  3CR3 A;  4GZC A;  3TAX A;  3ZIM A;  1LG1 A;  4P8X A;  1TYQ G;  2VGE A;  4Z2L A;  4UQY A;  4LEU A;  5GPR A;  3TL5 A;  4EPZ A;  3LY8 A;  5HW7 A;  5FQ8 A;  3SFZ A;  1NWR A;  4AXH A;  2AXV A;  5FZS A;  1RZ4 A;  1QPL A;  4W9O A;  1BI7 B;  4BT8 A;  4IPX A;  2XRZ A;  1ZBK A;  4J8E A;  4O1P A;  1HZ4 A;  4RG6 A;  4URK A;  3PZ4 A;  3ARV A;  5EYP F;  2F0Y A;  5FQ7 A;  4U8Y D;  3EUV A;  3RRN B;  1NFI E;  2R03 A;  5AJD A;  1Q6H A;  1VDY A;  3D9P A;  4JA9 A;  3MEK A;  4OVU A;  4JW1 A;  3S7J A;  4Z68 A;  1N0R A;  5HUA A;  4WWN A;  1NWU A;  2QZA A;  4JFI A;  1FPP A;  3PZ3 A;  1SR0 A;  1KFW A;  1FKH A;  3O5K A;  5HQ8 A;  4LAY A;  3MA5 A;  3PVL A;  4N3B A;  1ELR A;  2XS8 A;  3JQ1 A;  4YDO A;  1HH8 A;  1LD8 A;  4BT9 A;  1Q6U A;  3ZKJ A;  4K5B A;  4K5A B;  2ZQV A;  4LAW A;  1Z3Y A;  4A63 B;  3D9L A;  4Z2J A;  4ZPV R;  1E6N A;  1Q6I A;  5BPP A;  3HYM B;  4PTM A;  5A7D B;  3PZ2 A;  2XP6 A;  1WM5 A;  5KWD A;  3NZS A;  3C3O A;  3ZYQ A;  3APC A;  1EYH A;  3EIJ A;  4ZFH A;  3QKY A;  1UW4 B;  2GRO B;  3WD4 A;  1H0G A;  4JXT A;  3AS0 A;  4W9R A;  3ZYL A;  3LY9 A;  2WXH A;  5EYL A;  2A3B A;  3UKR G;  5BNW A;  4ANU A;  3FAP A;  4TV3 A;  3AS2 A;  4S3J A;  2EQX A;  2DG4 A;  4TW6 A;  1XHG A;  1TNB A;  2LSV A;  1NP7 A;  2A3A A;  3HHM A;  2FEZ A;  4X8Q A;  1K9T A;  4WWP A;  1U79 A;  3GW4 A;  5FQ4 A;  2XZD G;  1V54 E;  1GRJ A;  3WD1 A;  1QPF A;  1WNO A;  1OWM A;  2C2L A;  3B95 A;  2RG8 A;  5KJM A;  3ARW A;  1FFR A;  1L5J A;  3QOK A;  1HE8 A;  2GRR B;  3DXK G;  2VSY A;  1FAP A;  3PNT B;  4FJY A;  5FIO A;  4DI3 A;  4JFM A;  3L08 A;  5B3S E;  4GPK A;  4TRQ A;  1GPF A;  3J5Q B;  4U0U A;  4BSX A;  4W9Q A;  4DWS D;  2O92 A;  1LL4 A;  2YNQ A;  5LFA A;  4EBA G;  2RUC A;  1DC2 A;  4JB8 P;  1H2T C;  3E33 A;  1HF8 A;  4HOR A;  3E34 A;  4MPK A;  2ZIS A;  4WNG A;  5AIJ A;  2DSW A;  4LGX A;  2GW1 A;  1N11 A;  4DRN A;  2F8X K;  4HB5 A;  5ITZ F;  4AVX A;  2X38 A;  1S0P A;  2R17 C;  3KS2 A;  3L17 A;  3TWW A;  4QT3 A;  5LX8 A;  3QWV A;  4PS8 A;  3RM9 A;  1IQU A;  3CVP A;  1D6O A;  2WPV A;  1NI1 A;  2AXZ A;  3PEV B;  1PAQ A;  5D0O D;  3WKZ A;  3FTY A;  1E7U A;  2P9I G;  3BXW A;  2BF0 X;  2KAT A;  4WNF A;  1J6Y A;  4K0R A;  4U63 A;  4BEP A;  4HI9 A;  2X6J A;  1EIB A;  4DX5 D;  2E0I A;  5AN8 A;  3CVL A;  3MKQ B;  3KAC A;  4L23 A;  4XEI G;  3BG0 B;  5KCM A;  5AQB A;  4JEH A;  4I6G A;  4KR0 B;  2KBX A;  4PUC A;  1S64 A;  2AWI A;  5IY5 E;  3PUK A;  4HI8 A;  2XHE A;  3ARQ A;  1F8A B;  5T3R A;  4WUY A;  3V30 A;  1QNF A;  1IXV A;  4GU5 A;  3ARP A;  4EZJ A;  4IRU A;  4AY6 A;  2AXU A;  2Y4T A;  3TG5 A;  2FKE A;  5HW6 A;  3O5D A;  4ACK A;  5LCW C;  4GTQ A;  3FUE A;  4YDW A;  4YND A;  2DBA A;  4E85 A;  3VTX A;  2XPZ A;  2XP7 A;  4NZC A;  3GU0 A;  3FUL A;  5BXJ A;  4ABN A;  4YDY A;  3FY4 A;  4U96 D;  2XP5 A;  5HTG A;  3RKV A;  4JYS A;  3GZ1 A;  1JND A;  1N54 A;  2WXN A;  2OEW A;  1NZN A;  3AS3 A;  3APD A;  4RG9 A;  2IO2 C;  2B5U B;  4ZPW R;  4CGW A;  3UIP C;  3L6A A;  1ITX A;  1WG0 A;  3HXD A;  4XIF A;  3UM0 A;  2XP3 A;  2KM4 A;  2P9N G;  3ZUV B;  3Q79 A;  3IV0 A;  2L0T B;  4GB9 A;  2PL2 A;  2GRN B;  3I4G A;  4HOU A;  3G6M A;  2PNN A;  4ML4 A;  4WND A;  1ZCN A;  5LCW J;  1PC2 A;  2LAH A;  4NSB A;  1W3B A;  4MNL A;  4XE0 A;  5JHB A;  5ENS D;  2Y1L E;  3D9H A;  1N95 A;  1N0Q A;  5DF0 A;  3F6Q A;  1ELW A;  3MKQ A;  3TDB A;  4IYP A;  2DZO A;  3DSS A;  3GZ2 A;  3ML9 A;  3SI5 A;  1FFQ A;  2I1K A;  3AS5 A;  4N3C A;  4GTR A;  3DPD A;  2ZIR A;  2H6I A;  2GRP B;  1TJC A;  3RSE G;  3X2Q E;  2FDM A;  1UN8 A;  2EIN E;  4U8V D;  4LCT A;  1X6L A;  4DRM A;  4B94 A;  2LAI A;  4TXR A;  2GRM A;  3N71 A;  4GMJ A;  4EEC A;  3UPV A;  1ELK A;  1LL6 A;  3ULQ A;  3P2B A;  3B7B A;  3LUO A;  3ZRH A;  2PPN A;  3C98 A;  4B0Z A;  5EKQ D;  4HXI A;  5B8I C;  3ZYM A;  1FKS A;  4LNU D;  3JUI A;  4ZPT R;  3AS8 A;  1K1B A;  4FHJ A;  5JJ6 A;  3FFL A;  2WXM A;  1Z5S C;  2XQ0 A;  3W4R A;  1TNZ A;  3H9R B;  4U04 A;  4CRW A;  4JHR A;  3L22 A;  4FHK A;  3PRB A;  2ZXW E;  5BV1 A;  4LAV A;  3SBT B;  3WG7 E;  2BUG A;  1EYM A;  5HI7 A;  4I9C A;  1OCC E;  4I1O B;  1NH6 A;  3KEZ A;  1H19 A;  3B7X A;  5B1B E;  3CHO A;  2ETB A;  2Y3A A;  3AAA C;  4LSZ E;  1O1T A;  4JHJ A;  3FUI A;  1D9S A;  2PM6 A;  2WXI A;  1GW6 A;  4F1S A;  1MHQ A;  1ZBC A;  1L1P A;  2CFU A;  3V31 A;  3AU4 A;  2ZQU A;  3KAD A;  4NQ0 A;  3R9A B;  3UF8 A;  4GTT A;  2DT3 A;  4BES A;  3NZU A;  3LXU X;  3OOB A;  3NOG D;  3UQB A;  3CVW A;  3FH8 A;  4I43 A;  5HBF A;  2VSN A;  4WWO A;  2RUD A;  2UZ5 A;  4R5E A;  2EIJ E;  2LPV A;  2DSV A;  5EIB E;  3O5L A;  1Z6T A;  4HLE A;  4N5C A;  3ASH A;  3ONK A;  3AQU A;  4CGV A;  4W9P A;  3G2W A;  3MDY B;  3AJI A;  3IHZ A;  1EHN A;  1N52 A;  4U8H A;  1A5E A;  5EX0 A;  3ABL E;  4UUC A;  2WQ6 A;  4O2T A;  3FTV A;  3LS8 A;  4KZC A;  1FKF A;  3O5R A;  1O1S A;  2WMN A;  3PEU B;  1SZA A;  3Q9N C;  2RUR A;  1JUQ A;  2VSO E;  5HW8 A;  3WIJ A;  4G8K A;  2BKG A;  1TNU A;  4A1S A;  3D9N A;  5EDS A;  3NAW A;  4UQZ A;  2P9P G;  3FTS A;  3ABK E;  3Q49 B;  4XKC A;  4BER A;  1TNO A;  3FH7 A;  1HO8 A;  5A23 A;  4N2S A;  1LG2 A;  3JQ0 A;  5DIU A;  5AJL A;  2PN0 A;  2LJ4 A;  3ULE G;  5J08 A;  1X5B A;  2QYJ A;  4HRL A;  3CHQ A;  1FKJ A;  4WKF A;  4U84 A;  2OVB A;  3NQP A;  3O5I A;  4DX2 A;  3G2V A;  3CGN A;  3FP3 A;  4DRK A;  3CHR A;  3LJ3 A;  4GA0 A;  2KO7 A;  2XEV A;  2DVW A;  3ULY A;  4WIW A;  3C3Q A;  3JYJ A;  2UY1 B;  4BET A;  5JH8 A;  4ITZ A;  5BT1 A;  3FTZ A;  4GA2 A;  1Y6I A;  3CKB A;  4DRH A;  2I1J A;  2AOS A;  2OOE A;  1Q1C A;  1EDU A;  1WDY A;  5FIN A;  3FWV A;  3CGM A;  3Q15 A;  3Q7F A;  2KCL A;  1M5Y A;  4LER A;  5CHE E;  1OY3 D;  3WL1 A;  1LD7 A;  4JFJ A;  4DPR A;  1FKB A;  4APF A;  3IKO B;  3UUX A;  3L16 A;  5B1A E;  2EIL E;  4ODP A;  1LJY A;  2MPH A;  2Y0B G;  2VN1 A;  3E37 A;  2EIK E;  2KGJ A;  3RM4 A;  1E7V A;  2P9S G;  3CHF A;  3K9I A;  1HG2 A;  3UTM A;  4C0E A;  3ARR A;  1E8X A;  2VTB B;  3NOC D;  1Y8M A;  4XAK A;  2QFC A;  1DNP A;  4HOT A;  4XZ4 A;  1K3Z D;  3R7Q A;  4KT6 B;  3ZN3 A;  3ASO E;  4PS7 A;  3VLE A;  1WAW A;  5LOZ A;  5GPG A;  3HXB A;  4I1M A;  2OFN A;  1MJ0 A;  2DYR E;  3CK9 A;  5CMW A;  1KPS B;  2G41 A;  4DZ3 A;  3U64 A;  4MGV A;  2J4D A;  4AY1 A;  3UQ3 A;  3O4Z A;  3ZXS A;  1IQR A;  3FXY A;  2LXL A;  2EUL A;  5DIV A;  2CFZ A;  3IKD A;  4LAX A;  5G55 A;  4CDN A;  1W1P A;  1FVH A;  2UY1 A;  1U2V G;  4QZV B;  1SA4 A;  3QWP A;  4DUI A;  1N4R A;  5FQ6 A;  3O48 A;  4XI9 A;  1E8Y A;  2FBN A;  1N4P A;  5CRV A;  4FLH A;  2PV3 A;  1QQE A;  4L2Y A;  1TR4 A;  2ION A;  2LNI A;  2IQC A;  4G50 A;  5JJ7 A;  3RM8 A;  3AG1 E;  1H2V C;  2VQ2 A;  4HOQ A;  3Q7A A;  2ZR6 A;  3O5F A;  3RK6 A;  3I3N A;  2O9O A;  4MNM A;  2P4V A;  3QB2 A;  1MZC A;  5HKG A;  2A3C A;  2ILR A;  3CLJ A;  2IY0 C;  2ITK A;  1ROT A;  4GMR A;  4D10 C;  3TXM A;  1ZK6 A;  4TW8 A;  2F37 A;  1NL4 A;  2VTB A;  5FZQ A;  4XI0 A;  3D9I A;  3E30 A;  4TUM A;  5AYW D;  3ZYK A;  3FUH A;  5GQB A;  3RO3 A;  2I6H A;  4U0S A;  2MLZ A;  2X6K A;  4HBO A;  5ENN A;  2XZT G;  3LJN A;  3Q9U C;  4I6E A;  5CER B;  5AAR A;  3ARX A;  3O5Q A;  4Q69 A;  4EQF A;  2R2L A; 
#chains in the Genus database with same CATH homology
 4KVO A;  3FUF A;  5HWB A;  3WD2 A;  4DRQ A;  1FCH A;  3FHE A;  1UR8 A;  5E76 A;  5G2N A;  3MCX A;  2XPY A;  1JWF A;  2XP8 A;  2J09 A;  3UT4 A;  4FUL A;  2PZI A;  3PUJ A;  1OGB A;  3ARZ A;  1LL7 A;  5FWQ A;  3FEY A;  3KD7 A;  2IFU A;  4UWH A;  4MNK A;  4GA1 A;  4JFK A;  3ENE A;  2WXJ A;  1W9P A;  1A17 A;  1HJW A;  3MV3 B;  3NI6 A;  3FU6 A;  4JHK A;  2XP9 A;  2WXF A;  3MX3 A;  2X3M A;  4N39 A;  4ODK A;  5FZR A;  1HKM A;  4GZD A;  1HKK A;  1H2U A;  2C0M A;  2WK2 A;  5AEN A;  2Q5A A;  1NSG A;  3ARS A;  3PH0 C;  3QJZ A;  2PQN A;  2XCC A;  4HAR A;  4BWR A;  4UWF A;  3FUD A;  2HR2 A;  3VLF A;  3TCZ A;  4WJX A;  4GYO A;  1UG3 A;  1YW5 A;  5DBK A;  3QC1 A;  4JFL A;  3KAB A;  3FU5 A;  2J08 A;  4IN3 B;  3FU3 A;  3MZL B;  4F53 A;  2MOW A;  1N1A A;  1CTN A;  3IHV A;  4ODN A;  2A4Z A;  3CHP A;  3ZW3 A;  4TUU A;  3AS4 A;  2FF4 A;  3CKC A;  1HXI A;  4DI4 A;  4P8W A;  5JJT A;  4AIF A;  1GOI A;  4JL0 A;  2RQS A;  3U3W A;  2DPE A;  4P8U A;  1NMW A;  4ACL A;  3BEE A;  2X6H A;  5I98 A;  4FAP A;  1ZU8 A;  2IOL A;  2YHC A;  1T11 A;  5DIT A;  3QAQ A;  5KJN A;  1JNS A;  2RUQ A;  2KR7 A;  3T5X A;  3CSF A;  2J49 A;  3IK8 A;  3TC5 A;  2HO1 A;  3O5E A;  3PRZ A;  4DRO A;  3FDH A;  2G8Z A;  3CH9 A;  2KCV A;  3CVN A;  5ANR A;  3EIQ C;  4AM9 A;  3CST A;  1ZL1 A;  1FKK A;  3O5P A;  3OA5 A;  4F7A A;  1E96 B;  3OXF A;  3O5O A;  1WB0 A;  1UJJ A;  5DIZ A;  3RME A;  2V4L A;  4YVO A;  4AV7 A;  4I9E A;  2AW6 A;  2RD0 A;  3U9W A;  3MKR A;  4GML A;  2BTD A;  3URZ A;  4HFG A;  4DWS C;  2M63 A;  4MSP A;  4LUN U;  1BL4 A;  1U3D A;  1FJD A;  3B13 A;  3VLD A;  4WK9 A;  2X6I A;  4Z2K A;  4Y6C A;  3EDT B;  3NRK A;  4XX5 A;  4DT4 A;  2M08 A;  4GCO A;  2J9Q A;  3KZ7 A;  1P5Q A;  1HS6 A;  3WQW A;  1A7X A;  4PS3 A;  2F21 A;  3G2T A;  4C02 B;  3KAG A;  2VGX B;  3PE4 A;  1E90 A;  3UMV A;  1LQ0 A;  2VJ8 A;  3AU5 A;  3TJP A;  1WAO 1;  5LP0 A;  3GZS A;  1W9V A;  3ML8 A;  3FUJ A;  3B9D A;  3CQG B;  4CT4 A;  4G23 A;  1JNE A;  4JC8 A;  4A3V A;  3CHE A;  4AOF A;  3SBS A;  4S3K A;  3G2U A;  1UR9 A;  1Y0O A;  3VTY A;  2V5F A;  3ZVV A;  5KJL A;  2HM8 A;  1FKG A;  3FY1 A;  2XPI A;  1UJK A;  5M72 A;  4APO A;  2DCP A;  1J4H A;  3FUN A;  5A6C A;  3ZPJ A;  3ARY A;  4MLP A;  2WXP A;  3I4R B;  4JVS A;  2FI7 A;  4DRP A;  1QZ2 A;  1D7H A;  1W1T A;  4P8V A;  4UQX A;  2KFW A;  1KT1 A;  4N19 A;  4U86 A;  1FKR A;  5ARF A;  2E2E A;  1OWN A;  1ZU2 A;  1HKI A;  2IU1 A;  3RRU A;  4PH4 B;  4IQC A;  1W1V A;  2WQ7 A;  2WLY A;  4IUL A;  2OV8 A;  1VF8 A;  4Q96 A;  2L0I A;  2VGX A;  2CHX A;  2X6F A;  2XCB A;  4QIB A;  1OWO A;  3KCE A;  3PS6 A;  1H0I A;  2ZU6 B;  1KLX A;  3Q5M A;  3CHM A;  4LRZ A;  3EY6 A;  3PDN A;  5BW8 C;  4BF8 A;  3JYS A;  4IT4 A;  1SQM A;  2IF4 A;  1J4I A;  1TEZ A;  1ZB5 A;  4V3I A;  3SD5 A;  2WLZ A;  5C2Y A;  4TYO A;  4U07 A;  2GGF A;  3VAW A;  2ZR4 A;  2AVP A;  4J8D A;  3TXN A;  4NAC A;  1IX5 A;  4ODQ A;  3S2A A;  3I6C A;  5ANL A;  3ASD A;  4KMO A;  4AEZ C;  3NTP A;  1LF8 A;  3SGH A;  5DEZ A;  3MYV A;  4DZ2 A;  3WD3 A;  2FO7 A;  1JVW A;  3B9E A;  3RO2 A;  4P29 A;  4DJA A;  2F4E A;  3FH5 A;  1YA0 A;  3T5V A;  2WXO A;  3QDN A;  5BUZ A;  2DG3 A;  3LYA A;  4FU3 A;  4DLO A;  1RD6 A;  1ROU A;  1UN9 A;  4FA6 A;  4HVB A;  4CT0 A;  1E15 A;  2KI3 A;  3CHC A;  3WQV A;  4UI9 C;  2VYI A;  3R7R A;  1H6K A;  1W26 A;  2Y4U A;  3Q47 B;  3UI4 A;  2IUZ A;  3L13 A;  3PRD A;  2Y78 A;  3CGH A;  4PDX A;  5CCL A;  3MV2 B;  4Z2I A;  3RGC A;  3IKG A;  2Q7F A;  2PV1 A;  3JCK C;  1E8W A;  3UX4 A;  5D75 A;  2PPO A;  1JPL A;  3HDX A;  4GCN A;  4G11 A;  4H7X A;  3RU0 A;  4Z2H A;  2CG2 A;  4G2P A;  3ALF A;  5CCM A;  1F40 A;  4FLB A;  2XGO A;  1PBK A;  2NXP A;  4H7Y A;  5J90 A;  4KQZ A;  4KXK B;  5D0Q D;  4C9B B;  3ESK A;  3CVV A;  3S7F A;  3SHF A;  4UI9 J;  4I1A A;  1OUV A;  3B7T A;  2VCD A;  4L3N A;  3KAI A;  3S7B A;  1U3C A;  3D9J A;  1NWS A;  3HIZ A;  4ANV A;  2WVI A;  2KZT B;  2WXQ A;  2CHZ A;  3E4B A;  3IEG A;  4Q22 A;  3G6L A;  1HFA A;  2OLH A;  1EPU A;  2D9F A;  2J07 A;  4DIP A;  5FTP A;  3U66 A;  2LO6 A;  1DVP A;  5T8I A;  2YBT A;  4HBE A;  5FT9 A;  3PE3 A;  5KJK A;  4I2Z A;  3MGB A;  2YHE A;  3TGO A;  2FUL A;  2MLX A;  4A3T A;  1XGW A;  4ZS6 A;  2DSZ A;  2L2S A;  3LVR E;  5EX3 A;  4GZ6 A;  3QNK A;  1ZBP A;  4GIV A;  2PM7 A;  1FKT A;  1ZBV A;  2P58 C;  3LY7 A;  4MKT A;  4MS6 A;  3FTW A;  4CEM A;  2A3E A;  3FUK A;  4OYS A;  4WKA A;  4JEU A;  1WY6 A;  4G24 A;  3MJW A;  4DLQ A;  4NUR A;  3SF4 A;  1BPO A;  2CHW A;  3ALG A;  3I5P A;  3KAF A;  5JHA A;  3ONL A;  5DO2 A;  3UT7 A;  1JWG A;  5G04 C;  3FTX A;  1E6P A;  4YVQ C;  2KZT A;  3UI5 A;  3LEW A;  4C0M A;  4ODO A;  3G2S A;  3RFW A;  4MRU A;  3FEX A;  3OXG A;  1XRV A;  2L9B A;  2KE0 A;  2PV2 A;  3RRM B;  1E9L A;  1E8Z A;  3D9K A;  5ARG A;  1B89 A;  3O5M A;  3CK8 A;  4TW7 A;  2PQR A;  3PA7 A;  1E6R A;  4BTB A;  4NRH B;  3UQI A;  3CHS A;  1EF1 C;  5G04 J;  1D7I A;  3SNX A;  3WL0 A;  1INZ A;  4RSY A;  4RVB A;  3QK0 A;  4Q94 A;  2I9C A;  2DG9 A;  3ODK A;  3L54 A;  4IQ2 A;  4OVV A;  4G1T A;  3RJV A;  3CV0 A;  2J4B A;  3QAR A;  4FJZ A;  4B8A A;  4TX0 A;  1JNT A;  2ZQT A;  3KAE A;  1XNF A;  1PIN A;  3ART A;  2KC7 A;  3GYZ A;  3CVY A;  3O5G A;  1YAT A;  3ZFW A;  4FP7 A;  3B8S A;  2HYZ A;  4J4O A;  1HXV A;  1HU3 A;  4O6F A;  4BFR A;  4FC8 A;  4MTV A;  2K8I A;  4GZ5 A;  4FN2 A;  3LDZ A;  2ZQS A;  3CVU A;  5HWC A;  4DK5 A;  3PRE A;  1OGG A;  2JZV A;  2M1I A;  4J8S A;  1FVF A;  2M2A A;  2YIN A;  4W5U A;  3BG1 B;  2FAP A;  1OWQ A;  3LCA A;  3UQA A;  4BY6 A;  4N3A A;  2A5U A;  4ME2 A;  3CVX A;  2UWJ G;  4BX8 A;  1HJV A;  4J8F A;  2MNT A;  1PY1 A;  3B7U X;  1KT0 A;  4IT6 A;  3QOU A;  4URI A;  4K03 A;  2LSU A;  3ZEF A;  1W9U A;  4WKH A;  2IOS A;  1EDQ A;  1NA0 A;  4UWL A;  2MF9 A;  4ATG A;  4GZ3 A;  2QF8 A;  3IHY A;  4A1G A;  2LGO A;  3DBS A;  2N87 A;  5T4Y A;  1IHG A;  1TJF A;  4Q7N A;  1D7J A;  2PPP A;  4L72 B;  2WB2 A;  1D2K A;  2I2O A;  2WQH A;  2DSU A;  1B6C A;  3P1U A;  5HT1 A;  1TCO C;  1SZ9 A;  4ILG A;  4AY5 A;  1HJX A;  4R7L A;  1J4R A;  4JA7 A;  3CZ8 A;  1E6Z A;  3PRA A;  4G25 A;  2RSE A;  4DRJ A;  5J6E A;  1ZBW A;  1W1Y A;  4DH0 A;  3CK7 A;  3ZHE B;  2WM0 A;  1MQS A;  2QY7 A;  2PI6 A;  4B8C B;  4F3V A;  3WH0 A;  4CDM A;  3CVQ A;  2MHK A;  4JZY A;  1NWT A;  3UI6 A;  1SYT A;  4HOS A;  3D9O A;  1O6I A;  4DWS B;  3Q4A B;  5C1D A;  3HVE B;  4HS2 A;  2OND A;  4GYW A;  2C0L A;  5FJY A;  2VSX E;  4B89 A;  4WAF A;  3O5J A;  4WNE A;  1R9H A;  2XP4 A;  1TFV A;  4ODR A;  3OXL A;  4M3O A;  4Y6W A;  4Z2G A;  2PBC A;  4J6I A;  2WXL A;  4I17 A;  2L6J A;  3FUM A;  4J0U A;  2WMO A;  4BTA A;  4BX9 A;  3OAW A;  2KCK A;  4XKB A;  2DT1 A;  2R59 A;  2V0P A;  2AWG A;  2YQ8 A;  3EHM A;  4KZ0 A;  2F2D A;  4EZK A;  2WXR A;  4UWG A;  3LKU A;  3AS1 A;  1FKD A;  4KVM A;  1C9H A;  3WD0 A;  4L7T A;  4I6J A;  4EBA A;  1FKL A;  1BKF A;  5BV0 A;  2YBU A;  3ZHE A;  4I2W A;  3ASG A;  3QWW A;  4L2L A;  4AP2 A;  4MNJ A;  2MRI A;  4DRI A;  1FD9 A;  3B9A A;  4J4N A;  3EHN A;  2XPA A;  3EJN A;  3D3M A;  1EQ3 A;  1HG5 A;  4DWS A;  2WXK A;  2V8S E;  3HVE A;  2JLB A;  4KYO B;  3IBE A;  3FU0 A;  4ILI A;  5E75 A;  4CCA A;  3KAH A;  1Z3X A;  4ILH B;  4KBQ A;  3JYM A;  4L1B A;  3NF1 A;  3UT8 A;  2XRY A;  1NMV A;  5G05 C;  2ZR5 A;  4QT2 A;  3JXV A;  3WXX A;  2XGM A;  1HKJ A;  4R0X A;  2XGS A;  3RIB A;  3LVQ E;  3B7R L;  4FAD A;  3LPZ A;  3CHD A;  2IJG X;  2JEK A;  2WM9 A;  2MLY A;  3APF A;  1H0A A;  2GRL A;  4EZL A;  2DT0 A;  1OWL A;  2XPB A;  4N2Q A;  3S7D A;  3ZGQ A;  4GYY A;  5G05 J;  4JPS A;  3ARO A;  4QFV A;  2CG3 A;  2B31 A;  4U0Z A;  1HX8 A;  3ESL A;  4UI9 K;  3PZD A;  2DT2 A;  3B7S A;  4A55 A;  1IYG A;  4AJW A;  3D9M A;  2VGY A;  2NC9 A;  4U85 A;  3PR9 A;  3CIA A;  4ANX A;  4GAA A;  2LKN A;  5CMY A;  4E6H A;  3U4T A;  4NNR A;  4G2V A;  2R5S A;  3CEQ A;  4TNS A;  4G26 A;  4ODM A;  1NA3 A;  2OVF A;  2ESC A;  3FTU A;  3ARU A;  3SZ7 A;  3GPK A;  2DIW A;  4GGQ A;  3CQC B;  4ODL A;  1X6N A;  1OWP A;  4UWK A;  3OTN A;  1GUV A;  2WXG A;  4MAV A;  4ANW A;  3TG4 A;  2NSZ A;  3PNL B;  3ASF A;  4CDR A;  3T8M A;  1FKI A;  3CR3 A;  4GZC A;  3TAX A;  3ZIM A;  1LG1 A;  4P8X A;  4Z2L A;  4UQY A;  4LEU A;  5GPR A;  3TL5 A;  4EPZ A;  3LY8 A;  5HW7 A;  5FQ8 A;  3SFZ A;  1NWR A;  4AXH A;  2AXV A;  5FZS A;  1QPL A;  4W9O A;  4BT8 A;  4IPX A;  2XRZ A;  1ZBK A;  4J8E A;  1HZ4 A;  4RG6 A;  4URK A;  3ARV A;  5FQ7 A;  3RRN B;  5AJD A;  1Q6H A;  1VDY A;  3D9P A;  4JA9 A;  3MEK A;  4OVU A;  4JW1 A;  3S7J A;  5HUA A;  4WWN A;  1NWU A;  4JFI A;  1SR0 A;  1KFW A;  1FKH A;  3O5K A;  5HQ8 A;  4LAY A;  3MA5 A;  3PVL A;  4N3B A;  1ELR A;  3JQ1 A;  1HH8 A;  4BT9 A;  1Q6U A;  2ZQV A;  4LAW A;  1Z3Y A;  3D9L A;  4Z2J A;  4ZPV R;  1E6N A;  1Q6I A;  5BPP A;  3HYM B;  4PTM A;  5A7D B;  2XP6 A;  1WM5 A;  3NZS A;  3ZYQ A;  3APC A;  1EYH A;  3EIJ A;  3QKY A;  1UW4 B;  3WD4 A;  1H0G A;  4JXT A;  3AS0 A;  4W9R A;  3ZYL A;  3LY9 A;  2WXH A;  2A3B A;  5BNW A;  4ANU A;  3FAP A;  4TV3 A;  3AS2 A;  4S3J A;  2EQX A;  2DG4 A;  4TW6 A;  1XHG A;  2LSV A;  1NP7 A;  2A3A A;  3HHM A;  2FEZ A;  1K9T A;  4WWP A;  1U79 A;  3GW4 A;  5FQ4 A;  3WD1 A;  1QPF A;  1WNO A;  1OWM A;  2C2L A;  2RG8 A;  5KJM A;  3ARW A;  1FFR A;  1L5J A;  3QOK A;  1HE8 A;  2VSY A;  1FAP A;  3PNT B;  4FJY A;  4DI3 A;  4JFM A;  3L08 A;  4GPK A;  4TRQ A;  1GPF A;  4U0U A;  4BSX A;  4W9Q A;  4DWS D;  2O92 A;  1LL4 A;  2YNQ A;  5LFA A;  4EBA G;  2RUC A;  1H2T C;  1HF8 A;  4HOR A;  4MPK A;  4WNG A;  5AIJ A;  2DSW A;  4LGX A;  2GW1 A;  4DRN A;  4AVX A;  2X38 A;  1S0P A;  2R17 C;  3KS2 A;  3L17 A;  4QT3 A;  5LX8 A;  3QWV A;  4PS8 A;  3RM9 A;  1IQU A;  3CVP A;  1D6O A;  2WPV A;  2AXZ A;  3PEV B;  1PAQ A;  5D0O D;  3WKZ A;  3FTY A;  1E7U A;  3BXW A;  2BF0 X;  2KAT A;  4WNF A;  1J6Y A;  4K0R A;  4U63 A;  2X6J A;  1EIB A;  2E0I A;  3CVL A;  3MKQ B;  3KAC A;  4L23 A;  3BG0 B;  5KCM A;  4JEH A;  4I6G A;  4KR0 B;  4PUC A;  2AWI A;  3PUK A;  2XHE A;  3ARQ A;  1F8A B;  5T3R A;  4WUY A;  1QNF A;  4GU5 A;  3ARP A;  4EZJ A;  4IRU A;  4AY6 A;  2AXU A;  2Y4T A;  3TG5 A;  2FKE A;  5HW6 A;  3O5D A;  4ACK A;  5LCW C;  3FUE A;  4YND A;  2DBA A;  4E85 A;  3VTX A;  2XPZ A;  2XP7 A;  4NZC A;  3FUL A;  5BXJ A;  4ABN A;  3FY4 A;  2XP5 A;  5HTG A;  3RKV A;  4JYS A;  3GZ1 A;  1JND A;  1N54 A;  2WXN A;  1NZN A;  3AS3 A;  3APD A;  4RG9 A;  4ZPW R;  4CGW A;  3L6A A;  1ITX A;  4XIF A;  2XP3 A;  2KM4 A;  3IV0 A;  2L0T B;  4GB9 A;  2PL2 A;  3I4G A;  4HOU A;  3G6M A;  4ML4 A;  4WND A;  1ZCN A;  5LCW J;  1PC2 A;  2LAH A;  4NSB A;  1W3B A;  4MNL A;  4XE0 A;  5JHB A;  5DF0 A;  1ELW A;  3MKQ A;  3TDB A;  4IYP A;  3GZ2 A;  3ML9 A;  3SI5 A;  1FFQ A;  2I1K A;  3AS5 A;  4N3C A;  3DPD A;  1TJC A;  2FDM A;  1UN8 A;  4LCT A;  1X6L A;  4DRM A;  4B94 A;  2LAI A;  2GRM A;  3N71 A;  4GMJ A;  4EEC A;  3UPV A;  1ELK A;  1LL6 A;  3ULQ A;  3P2B A;  3LUO A;  3ZRH A;  2PPN A;  3C98 A;  4B0Z A;  5EKQ D;  4HXI A;  5B8I C;  3ZYM A;  1FKS A;  3JUI A;  4ZPT R;  3AS8 A;  4FHJ A;  5JJ6 A;  3FFL A;  2WXM A;  2XQ0 A;  3W4R A;  3H9R B;  4U04 A;  4CRW A;  4JHR A;  3L22 A;  4FHK A;  3PRB A;  5BV1 A;  4LAV A;  3SBT B;  2BUG A;  1EYM A;  5HI7 A;  4I9C A;  1NH6 A;  4I1O B;  3KEZ A;  1H19 A;  3B7X A;  3CHO A;  2Y3A A;  4JHJ A;  3FUI A;  2PM6 A;  2WXI A;  1GW6 A;  4F1S A;  1MHQ A;  1ZBC A;  1L1P A;  2CFU A;  3AU4 A;  2ZQU A;  3KAD A;  4NQ0 A;  3R9A B;  3UF8 A;  2DT3 A;  3NZU A;  3LXU X;  3OOB A;  3UQB A;  3CVW A;  3FH8 A;  4I43 A;  5HBF A;  2VSN A;  4WWO A;  2RUD A;  2UZ5 A;  4R5E A;  2LPV A;  2DSV A;  3O5L A;  1Z6T A;  4HLE A;  4N5C A;  3ASH A;  3ONK A;  3AQU A;  4CGV A;  4W9P A;  3G2W A;  3MDY B;  3IHZ A;  1EHN A;  1N52 A;  4U8H A;  5EX0 A;  2WQ6 A;  4O2T A;  3FTV A;  3LS8 A;  4KZC A;  1FKF A;  3O5R A;  2WMN A;  3PEU B;  1SZA A;  2RUR A;  1JUQ A;  2VSO E;  5HW8 A;  3WIJ A;  4A1S A;  3D9N A;  5EDS A;  4UQZ A;  3FTS A;  3Q49 B;  4XKC A;  3FH7 A;  1HO8 A;  5A23 A;  4N2S A;  1LG2 A;  3JQ0 A;  5DIU A;  5AJL A;  2LJ4 A;  5J08 A;  1X5B A;  3CHQ A;  1FKJ A;  4WKF A;  4U84 A;  2OVB A;  3NQP A;  3O5I A;  3G2V A;  3CGN A;  3FP3 A;  4DRK A;  3CHR A;  3LJ3 A;  4GA0 A;  2KO7 A;  2XEV A;  4WIW A;  3JYJ A;  2UY1 B;  5JH8 A;  4ITZ A;  5BT1 A;  3FTZ A;  4GA2 A;  1Y6I A;  3CKB A;  4DRH A;  2I1J A;  2AOS A;  2OOE A;  1Q1C A;  1EDU A;  3FWV A;  3CGM A;  3Q15 A;  2KCL A;  1M5Y A;  4LER A;  5CHE E;  3WL1 A;  4JFJ A;  4DPR A;  1FKB A;  4APF A;  3IKO B;  3UUX A;  3L16 A;  4ODP A;  1LJY A;  2MPH A;  2VN1 A;  2KGJ A;  3RM4 A;  1E7V A;  3CHF A;  3K9I A;  1HG2 A;  4C0E A;  3ARR A;  1E8X A;  2VTB B;  1Y8M A;  4XAK A;  2QFC A;  1DNP A;  4HOT A;  4XZ4 A;  3R7Q A;  4KT6 B;  3ZN3 A;  4PS7 A;  3VLE A;  1WAW A;  5LOZ A;  5GPG A;  4I1M A;  2OFN A;  3CK9 A;  5CMW A;  2G41 A;  4DZ3 A;  3U64 A;  4MGV A;  2J4D A;  4AY1 A;  3UQ3 A;  3O4Z A;  3ZXS A;  1IQR A;  3FXY A;  5DIV A;  2CFZ A;  3IKD A;  4LAX A;  5G55 A;  4CDN A;  1W1P A;  1FVH A;  2UY1 A;  4QZV B;  3QWP A;  5FQ6 A;  3O48 A;  4XI9 A;  1E8Y A;  2FBN A;  4FLH A;  2PV3 A;  1QQE A;  4L2Y A;  2ION A;  2LNI A;  2IQC A;  4G50 A;  5JJ7 A;  3RM8 A;  1H2V C;  2VQ2 A;  4HOQ A;  2ZR6 A;  3O5F A;  3RK6 A;  3I3N A;  2O9O A;  4MNM A;  3QB2 A;  5HKG A;  2A3C A;  2ILR A;  3CLJ A;  2ITK A;  1ROT A;  4D10 C;  3TXM A;  1ZK6 A;  4TW8 A;  2VTB A;  5FZQ A;  4XI0 A;  3D9I A;  5AYW D;  3ZYK A;  3FUH A;  5GQB A;  2MLZ A;  3RO3 A;  2I6H A;  4U0S A;  2X6K A;  4HBO A;  5ENN A;  4I6E A;  3ARX A;  3O5Q A;  4Q69 A;  4EQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...