1KT0A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
380
structure length
357
Chain Sequence
VLKIVTPMIGDKVYVHYKGKLFDSPFVFSLGKGQVIKAWDIGVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNERDRRIYANM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords 51 KDA FK506-BINDING PROTEIN
total genus 110
structure length 357
sequence length 380
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt0A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A02
3KS2A 4I9CA 1J4RA 4LAXA 1D7IA 4HOUA 2HO1A 2YQ8A 2ONDA 1TJCA 2LKNA 4AIFA 3O5IA 1NZNA 3AS5A 4NRHB 4F3VA 4GCOA 2RUCA 4W9RA 2KE0A 4TW6A 4EQFA 3IHZA 1YATA 3PDNA 3ZHEA 3O5EA 4IQ2A 3OOBA 2MLYA 3CEQA 3KAEA 1E96B 1ZK6A 3KD7A 4HOTA 1FJDA 2C2LA 4UQYA 3IKGA 3OXFA 4FAPA 2WPVA 1F8AB 1P5QA 4JA7A 3KCEA 3TDBA 3O5KA 5HI7A 1ROTA 1W3BA 4TYOA 5EX0A 3KAFA 3AS8A 4N2QA 2M2AA 2Y78A 2IF4A 4HORA 3ZHEB 2AWGA 2DBAA 3RGCA 4ODMA 3N71A 4G2VA 1FKTA 3RJVA 4KBQA 5BXJA 2FI7A 5BNWA 4BWRA 2DG4A 4ODKA 4O6FA 3PA7A 3URZA 4JFKA 4YVOA 2XPIA 4W9PA 3MV3B 5FT9A 4I2WA 3ASDA 3IEGA 1FD9A 4XIFA 1J4IA 2XP6A 2FAPA 2XP4A 4UI9C 2VN1A 1Q6IA 5LCWC 1B6CA 2XPAA 5LCWJ 3IKDA 5KJNA 3TG4A 4BTBA 2ZQSA 3KAGA 4RG9A 1FCHA 4R0XA 2NC9A 2PL2A 2RUDA 1N1AA 3QKYA 5G05C 4I9EA 3U4TA 4N19A 4I1AA 1FKKA 2UWJG 3ULQA 2N87A 2PPPA 4GIVA 3KAHA 2XCBA 3PRBA 1BKFA 2MHKA 4AM9A 2DG9A 4ODQA 5D75A 5AYWD 3QOUA 3BEEA 4I2ZA 1FKIA 1TCOC 5C1DA 2F4EA 3CKCA 4GYOA 3CVPA 2AVPA 4IQCA 2BUGA 4JL0A 4JFMA 4N3AA 4WUYA 3FAPA 4U0ZA 2LSVA 5HQ8A 2P58C 2PV2A 4U04A 3CGNA 5HWBA 2D9FA 2ITKA 1A17A 3LY9A 1NMWA 1FKGA 3JXVA 4LAWA 4CGVA 3GZ1A 3KZ7A 4ODOA 4N3CA 1WAO1 4WNGA 3QDNA 3SZ7A 1FKLA 1PBKA 3O5DA 3CK9A 3NI6A 3O5RA 2UZ5A 2GW1A 5A6CA 3LY8A 4GCNA 3TAXA 4J8FA 1FKJA 4J4OA 5HW6A 3MEKA 1J6YA 1D7JA 2XGOA 2Q7FA 2PQNA 2K8IA 1HXVA 1W26A 4DRKA 3RU0A 3ZFWA 1QZ2A 1ZBPA 4O2TA 2XP9A 2XP5A 3VTYA 5JJTA 2RQSA 1JNSA 5FTPA 5J6EA 2FO7A 2C0LA 4DROA 5KJLA 3O5JA 4ODLA 1F40A 5DIZA 4BF8A 3K9IA 3O5FA 4N3BA 3MDYB 3O5LA 3WH0A 2MPHA 2FEZA 5DIVA 1B89A 3VTXA 2FKEA 3LUOA 4U86A 4U84A 4GYYA 2KCKA 4KXKB 3ESKA 5DIUA 3UF8A 5D0OD 2LPVA 3VAWA 3KABA 5HUAA 4ODPA 3O5QA 2HYZA 2MF9A 2ZR4A 2KC7A 4WNEA 3QWVA 3TCZA 2VGYA 4A1SA 3UQ3A 2PV1A 2ZQVA 5I98A 4G25A 2ZQTA 3TC5A 2DG3A 2ZR5A 4JFLA 4IPXA 2PZIA 4QT2A 4LEUA 4MGVA 3PRDA 1FKBA 3PE3A 1QPLA 3O5OA 4WNDA 5BT1A 2E2EA 1J4HA 3Q15A 3KACA 4H7XA 2Y4UA 2KFWA 3O5MA 2IFUA 4GGQA 2WQHA 4BT9A 3CK7A 2L2SA 3TG5A 3S7FA 4NNRA 3AS4A 3HYMB 3UUXA 3GZ2A 4YVQC 1FKDA 4Y6CA 4JFIA 4FN2A 4APOA 4LAVA 5CCMA 2PPOA 4DIPA 3KADA 2RURA 1Q6HA 2J9QA 3LY7A 3LPZA 3MKRA 4UI9K 2ZR6A 4G50A 2F2DA 3NTPA 3UQBA 1FKHA 3MV2B 4TNSA 5M72A 5ARGA 1JNTA 1HXIA 2KCVA 1T11A 4MSPA 1ZU2A 4JYSA 1C9HA 4ITZA 3O5GA 1L1PA 4CGWA 4U85A 4ME2A 1HH8A 4JHRA 1Y0OA 5HT1A 5CHEE 4C02B 5HW7A 4AY5A 1ROUA 2LGOA 2HR2A 1R9HA 2MLXA 3CV0A 1Q6UA 2XP3A 5EX3A 1YW5A 4B94A 3Q4AB 1KT1A 3FWVA 4U0UA 4DZ2A 5HWCA 4BTAA 2PQRA 5FZRA 5G04C 2KO7A 2XP7A 5GPGA 3S7JA 4J8EA 2OOEA 3UI5A 2XGMA 4UQZA 2F21A 4DRHA 5DBKA 4GZ3A 2JLBA 3PE4A 4UI9J 4U0SA 3ASGA 4IN3B 3CKBA 3UQIA 4ABNA 3LCAA 4J4NA 3UQAA 1U79A 5BW8C 2KR7A 2ZQUA 4QIBA 4TW7A 3RO2A 5HTGA 2M08A 1ELRA 1NSGA 2RSEA 3LYAA 4XI0A 3GPKA 3NF1A 2FF4A 3GW4A 3QWPA 4N39A 2QFCA 2VSNA 4WNFA 5ARFA 4U07A 4J8DA 4J0UA 4BT8A 4N5CA 2LJ4A 3EY6A 2L6JA 3CVQA 3JYSA 1KT0A 3KAIA 4W9QA 4CDRA 1NMVA 4YNDA 2FBNA 1ZCNA 2XGSA 3CGMA 1NA0A 4LAYA 1QQEA 4TX0A 2YHCA 4GA0A 4TW8A 5KJKA 4DRMA 5G04J 4GYWA 5B8IC 3TGOA 2RUQA 2VGXB 2MLZA 3B7XA 4W9OA 2R5SA 1OUVA 4DRIA 1D6OA 2VGXA 2KI3A 2KATA 3QWWA 2VQ2A 4GZ6A 3UI4A 3SF4A 2PPNA 5CCLA 3I6CA 3FFLA 3MA5A 2C0MA 2Q5AA 3H9RB 4GA1A 1JVWA 3JYJA 1YA0A 4NQ0A 3UI6A 3Q47B 3UPVA 1BL4A 2PV3A 4UQXA 4QT3A 3ASFA 4GZ5A 3JYMA 2PBCA 1Q1CA 1D7HA 3Q5MA 4G24A 1A7XA 4G26A 2JZVA 2XP8A 4DH0A 3LKUA 3ODKA 4G23A 3S7DA 4RG6A 3RIBA 1IHGA 4DRPA 3U3WA 3CVNA 4H7YA 3RFWA 3WXXA 4HOQA 3CK8A 5G05J 2I6HA 2KGJA 1PINA 3S7BA 2OFNA 3CVLA 4ODRA 1FKRA 1WM5A 5FZSA 2XCCA 4G2PA 2LNIA 1ELWA 4JA9A 4DT4A 3NRKA 1HZ4A 5D0QD 4XI9A 4DZ3A 1FKFA 4N2SA 3FP3A 1XNFA 3ZN3A 4I17A 3EDTB 2V5FA 1FAPA 3GYZA 4GA2A 1QPFA 3O48A 2UY1A 4G1TA 2VCDA 4GPKA 5FZQA 5HW8A 1PC2A 3O5PA 4Y6WA 2M1IA 1NA3A 1KLXA 1FKSA 5KJMA 3ZPJA 3Q49B 3RO3A 1EYMA 1Y8MA 5HKGA 3R9AB 2XEVA 3ASHA 1EQ3A 4AY6A 5JJ7A 5JJ6A 4DRNA 2Y4TA 4JFJA 2MNTA 4DRQA 2KCLA 2XPBA 3IK8A 5EKQD 2UY1B 4KYOB 4HOSA 2LSUA 3ZGQA 5A7DB 3OXGA 3RKVA 3OXLA 5FJYA 1IYGA 2VSYA 2VYIA 5DITA 3E4BA 4DRJA 4ODNA 1M5YA
chains in the Genus database with same CATH superfamily
3KS2A 1JNDA 4LAXA 2V0PA 2YQ8A 3ZW3A 3O5IA 4MTVA 3WIJA 5G55A 4GCOA 4FADA 2RUCA 3RAUA 2DT3A 2KE0A 4I6GA 4TV3A 1YATA 1NWTA 5JHBA 2RD0A 2H6FA 2LAHA 2WXFA 3PRAA 4IQ2A 2IQCA 4CT4A 4MNJA 4HOTA 4LGXA 1H2VC 3CIAA 5FIOA 4JVSA 3AS1A 5BUZA 2I9CA 1UR8A 3ARQA 4ANVA 3FDHA 2J49A 2I2OA 1NP7A 4N2QA 2H6HA 2IJGX 2DT0A 1W1TA 1LG1A 4ANWA 4CEMA 4KBQA 3FXYA 3NOCD 3W4RA 2FI7A 5BNWA 1HKMA 3DSSA 4YDYA 3EIQC 3ASDA 2FAPA 4L1BA 1B6CA 4ACKA 5LCWJ 3HXFA 4FLHA 3ZIMA 5KJNA 3TG4A 3ZYQA 4BTBA 3KAGA 4PS3A 2RUDA 2WXLA 3EHRA 3SFYA 1ZBCA 3J5QB 2PPPA 4RSYA 1TN7A 1K9TA 1BKFA 5ITZF 2XPYA 4AM9A 3FUHA 3LVRE 4A55A 4ODQA 5D75A 3E33A 4I2ZA 1TCOC 2ZISA 1S63A 4IRUA 4CCAA 2YBTA 3ESLA 4JFMA 2LXMA 5ENQD 4N3AA 2P9LG 4WUYA 3CH9A 2PV2A 3PH0C 3CHOA 2ITKA 4GTMA 3LY9A 1NMWA 2ETBA 3JQ1A 3JXVA 1PY1A 3C98A 3DSXA 3V31A 4WNGA 1FKLA 3QDNA 4OVUA 4IYPA 4URIA 3ABME 2WXOA 1DVPA 5ENNA 3TXNA 3T8MA 1DNPA 4PS8A 3NQPA 3TAXA 4J8FA 1FKJA 4HNAD 4APFA 5HW6A 1D9SA 4LG6A 2Q7FA 1W26A 2XP9A 4UWLA 3ARPA 3NAWA 1ZBVA 5J6EA 2FO7A 3L17A 1QYMA 3S2AA 3MKQB 4ZPWR 3ARXA 1LG2A 5DIZA 3CHDA 4N3BA 4TXPA 5J08A 2WLZA 2FKEA 1XRVA 1OWNA 4K5CA 4U86A 2KCKA 4KXKB 3UIOC 1X5BA 2AJAA 1MX2A 4GTVA 3FTVA 3L82A 3FUNA 1K3ZD 3O5QA 2RG8A 4FU3A 4WNEA 3WG7E 4JPSA 4KVOA 5I98A 3ZU7B 4DRXE 1SQMA 4JFLA 4IPXA 2PZIA 4MGVA 3FU5A 1UW4B 3O5OA 5BT1A 2E2EA 3Q15A 4DPRA 2EILE 4L72B 2J4BA 3AG2E 2KFWA 3FTSA 5T8IA 5AJDA 2L2SA 3TG5A 2VSOE 3JXJA 3HYMB 4KMOA 4KQZA 4GZDA 1FKDA 3WD1A 4JFIA 4FN2A 4UUCA 2PPOA 4OAUC 4G50A 3LXUX 1Z5SC 3Q79A 2KCVA 1OWPA 4MSPA 2EINE 1N4RA 2XPZA 3O5GA 1L1PA 4CGWA 4A3VA 1HH8A 4BX8A 5ENRD 4XEIG 4DX6D 1Y0OA 3AROA 1OCZE 4CT0A 1HJXA 4C02B 3L54A 3CV0A 1HKIA 1UN8A 1FT2A 3D9MA 2R17C 1EYHA 2Y1LE 3FWVA 3ZEFA 1QNFA 3G2SA 5HWCA 3BQOA 3KSLA 3G2VA 1HKJA 1SW6A 5FZRA 4OVVA 3UI5A 4GTPA 2XGMA 5LOZA 1ZBKA 4EBAG 2JLBA 3PE4A 3BXWA 2WXJA 1E8YA 4FHKA 2P9IG 3AQUA 1N54A 3I4RB 3CKBA 4J4NA 3AG1E 3UQAA 4I1OB 1JCRA 1H2UA 2GRRB 1X6NA 4MNLA 4TW7A 2M08A 4GPMA 1NSGA 1E8XA 1TYQG 4L23A 3ZYKA 2FF4A 3CQCB 4MNMA 4U8YD 2IOLA 2HM8A 4U07A 4BT8A 5BPPA 3DXMG 2RFMA 3TJPA 3CVQA 3D9JA 3OA5A 5KNHD 4EZLA 2EIKE 3KAIA 4M3OA 3SBTB 4OYSA 4FA6A 3B7TA 1WY6A 2XGSA 4EBAA 3APCA 3WL0A 2ZU6B 1MX4A 5BV1A 1Z6TA 5BV0A 3IHVA 1IQRA 5B8IC 2GRNB 2VGXB 3FTUA 5JMND 4JHJA 1IX5A 3IV0A 4GMLA 4AY1A 4P8WA 2KATA 3SFXA 3TXMA 3UI4A 4XX5A 4HRMB 2AOSA 3I6CA 4RQIA 3MA5A 1EDUA 4FULA 1YA0A 5JA4D 4HRLA 4N5QA 2ZXWE 2WVIA 3UPVA 2J09A 1NL4A 3CHCA 2IO3C 1L5JA 3Q5MA 2XP8A 2GRMA 4G26A 3BU8A 5HKPA 3QOKA 2WM0A 3HVEB 3CVNA 3CVYA 3WXXA 4J8YA 4HOQA 3CK8A 4LSZE 3SFZA 3RK6A 3MJWA 3CVLA 4A1GA 3P1UA 1OWMA 4JA9A 3VLDA 5FQ8A 3NRKA 4AJWA 5D0QD 1FKFA 1N95A 2B6CA 3ZN3A 4I17A 3EDTB 2V5FA 2IOSA 4XZ4A 3GYZA 3O48A 3F6QA 4JW1A 1W1YA 3FUMA 4LNGA 4TUMA 3CVXA 4Z2LA 3ZPJA 3IHYA 3RO3A 3D9LA 2QF8A 2FO1E 1EQ3A 4AY6A 4AP2A 1N11A 3J5PA 2BEDA 4DRQA 2XPBA 3IK8A 3PZDA 5AJLA 2LSUA 3ZGQA 5A23A 5A7DB 5FQ6A 3RKVA 1K1BA 4K5AB 1IYGA 2CG2A 1OCOE 3Q7AA 4I9CA 2LXLA 4F7AA 2ONDA 3APDA 3IXEA 1TJCA 1SA4A 5J90A 4AIFA 3FUJA 5ANLA 5DF0A 3JQ0A 3O4ZA 3PREA 1WNOA 4EQFA 1TNYA 2L6BA 4DX7D 3PDNA 3DSTA 2F8XK 2MLYA 4JB8P 1LTXA 3D9OA 1HJWA 3KD7A 2C2LA 2QY7A 3OXFA 4JHKA 2WXGA 2V8SE 2P2CP 1D2KA 3PVLA 1ROTA 4HARA 4TYOA 5EX0A 3KAFA 2ILRA 3AS8A 3JXIA 2AWIA 3ZHEB 3ZXPA 1O1SA 4ZFHA 1SVXA 4G2VA 2JABA 3RJVA 3X2QE 1FKTA 4WAFA 1JNEA 4YDEA 1IHBA 4P8UA 1KFWA 4Z2JA 3PA7A 4C48B 2LO6A 4J6IA 4HVBA 2YHEA 4P29A 4PUCA 4WKHA 3MV3B 1FD9A 3IEGA 2XP6A 2P9UG 4UI9C 3D3MA 4WKFA 1Y6IA 4ILHB 2IU1A 1SA5A 2ZQSA 4AXHA 2WLYA 4RG9A 1FCHA 2NC9A 2PL2A 3QKYA 4I9EA 3FY1A 4WKAA 2UWJG 3LS8A 3ULQA 4DUIA 2XCBA 5CEDB 2MHKA 3AAAC 1HX8A 2DG9A 5AYWD 2F4EA 4HRNA 3CKCA 4FJZA 3CVPA 2AVPA 3ASNE 4JL0A 5HS0A 2WXRA 3ARWA 3FTYA 2WXNA 3CGNA 5KNGA 4LAWA 4WIWA 3WQVA 3KZ7A 4ODOA 3O5DA 3CK9A 4TXRA 3NI6A 3O5RA 2UZ5A 3WD4A 3B9EA 4Z2HA 3LY8A 1LQ0A 3B7SA 3WD2A 3C5RA 3MEKA 1IQUA 2PQNA 3B9DA 4DWSA 1QZ2A 1N4SA 5B1AE 3B95A 3ZVVA 4B0ZA 3VTYA 3L16A 5FTPA 3C3OA 5KJLA 4ODLA 1E15A 3FUIA 4BETA 3O5FA 3MDYB 2VGEA 1FVHA 5ANRA 3AJIA 3G2UA 3RRNB 5CRVA 4U96D 4ANXA 4GYYA 5ENPD 4KT6B 3VAWA 3HIZA 2L0IA 4E85A 1IKND 2KC7A 2WXQA 3P2BA 4A3TA 3QWVA 2LUHA 3UQ3A 4G25A 2ZQTA 1SYTA 4LCTA 4QT2A 4DX1A 1TR4A 3TWXA 4I6JA 1GPFA 2DVWA 3ONKA 3W9FA 3UI2A 2Y4UA 2J08A 2IFUA 2CHXA 2HE0A 4XE0A 1W9PA 4DLOA 4ML4A 3QK0A 4NNRA 1UJJA 1V54E 3MCXA 3PEUB 3VLEA 4LAVA 3EUVA 3KADA 3NZSA 3LEWA 2J9QA 3MKRA 3KEAA 4UI9K 2ZR6A 4Z2GA 4DWSD 1FKHA 2CFUA 3MV2B 5M72A 1JNTA 3TWTA 4L7TA 3RRMB 1NI1A 3TL5A 4S3JA 3E32A 2I1KA 5EDSA 5AQBA 4LERA 2ESCA 5CHEE 1FFRA 5HW7A 1ROUA 3ISMC 2HR2A 1R9HA 4K5BA 1TNZA 1Q6UA 2XP3A 5EX3A 4L3NA 5FINA 3Q9NC 2OLHA 4FJYA 4B94A 1KT1A 3FUEA 2H6IA 3ASOE 4HBOA 2AXUA 4DZ2A 3HHMA 1YYHA 1LD7A 5G04C 2KO7A 2CHWA 4GTTA 2P4VA 4AVXA 5GPGA 4K0RA 4URKA 2OOEA 4CZ2D 4UQZA 4DRHA 3V2OA 5DBKA 4GZ3A 3EJNA 3V79K 2WK2A 4IN3B 3LVQE 4DI3A 3E30A 4ABNA 3LCAA 4PDXA 5H7PA 1UOHA 4QIBA 1WAWA 5HTGA 2WMNA 2LAIA 2DZNA 3NF1A 4TXQA 3W9GA 2QFCA 4DX2A 5CERB 3CVWA 2LJ4A 3FULA 3EU9A 1RD6A 3CLJA 1KT0A 2OVFA 1KZPA 1SZAA 2OV8A 1OCRE 5FQ4A 3R9MA 1NMVA 1JCQA 4DLQA 4F53A 2R59A 1QQEA 4UWGA 2MYOA 2YHCA 4GA0A 5KJKA 4KVMA 4J7WA 2RUQA 1E7VA 4HI9A 4U95D 3B7XA 4W9OA 1OUVA 1FPPA 2KI3A 1YCSB 5IY5E 1S64A 2VQ2A 1DCEA 1KPSB 2OEWA 2PPNA 4HQDA 5CCLA 2DSUA 5ENSD 4JEUA 5AARA 4C9BB 4U8HA 1NFIE 1TN8A 3Q47B 2WXHA 3QAQA 2VTBB 3JUIA 4UQXA 3JYMA 4PH4B 3ZXSA 4QQIA 3ZUVB 4F6RD 2AW6A 3Q7FA 4DH0A 4ZHBA 3LKUA 2XRZA 3I5PA 4G23A 4RG6A 3CVUA 4CDMA 4MAVA 2X6KA 4DRPA 3U3WA 3ALFA 3KEZA 2DYRE 3RFWA 3LJ3A 5G05J 2I6HA 3PNTB 1PINA 3CHSA 2MOWA 4I1MA 4ODRA 1H6KA 3BG0B 1FKRA 2EQXA 4Z2KA 4JXTA 3I4GA 3Q75A 1ELWA 2DZOA 3G2WA 2A5UA 4N2SA 3FP3A 2L9BA 2DT1A 4G1TA 1INZA 4GPKA 2BF0X 3D9IA 4G8KA 3SI5A 2RFAA 1KLXA 3CHEA 5JHAA 1FKSA 2YINA 2BKKB 4QFVA 1JCHB 1TJFA 1EYMA 2XEVA 2ZGGA 3B9AA 1HKKA 5DO2A 3T5VA 4TUUA 4DRNA 3NB2A 5AQ9A 2Y4TA 4JFJA 3R7QA 2MNTA 2DCPA 5AAOA 3T9KA 2KCLA 4OAVB 5EKQD 2UY1B 5BXUA 3CGHA 2JEKA 1GRJA 1W1VA 3PZ1A 3OXGA 4FC8A 3OXLA 5FJYA 2VSYA 1MHQA 2WQ6A 2VYIA 1HO8A 1JCSA 4ODNA 4HOUA 3FUKA 4NURA 2HO1A 4X8QA 2PM7A 2R02A 3R7RA 2LKNA 4JEHA 3RSEG 4GB9A 1BU9A 4IULA 3PUJA 3RMEA 1FVFA 3MYVA 3IHZA 1MZCA 4FLBA 4I6EA 3ZHEA 3FEYA 3RM9A 3UXGA 4GMRA 3OOBA 5KWDA 1E6ZA 3IKGA 1S0PA 3DEPA 4K03A 3FUDA 2FULA 2WPVA 1F8AB 2GGFA 4FAPA 2CG3A 2QYUA 3O5KA 5HI7A 1OY3D 1VF8A 2Y78A 3EU5A 3RM8A 2IF4A 4F1PA 4HORA 2AWGA 5G2NA 2XEHA 5B3SE 3RGCA 4ODMA 3N71A 3UT4A 4BFRA 4BESA 4CRWA 5BXJA 1MYOA 2PM6A 4IT4A 4BWRA 2DG4A 4O6FA 2PN0A 4YVOA 2XPIA 4XIFA 4KZCA 2XP4A 3WD3A 3HXBA 2VN1A 5LCWC 4DK5A 3SQVA 2CHZA 3IKDA 1N1AA 5G05C 3U4TA 2A3EA 1OXJA 2N87A 1EF1C 4GIVA 1JUQA 2V4HC 1BI8B 3PZ2A 3PRBA 2KBXA 4MPKA 1AP7A 3DXKG 3QOUA 5B1BE 4CDNA 5C1DA 2WM9A 4IQCA 4MRUA 2BUGA 4L2YA 3FAPA 4U0ZA 2LSVA 1FKGA 4CGVA 1BPOA 3L9TA 3QJZA 1WAO1 1PBKA 4S3KA 1LF8A 2KXPC 5A6CA 3ARUA 3DPDA 5GQBA 2E0IA 3PZ4A 1J6YA 1HXVA 4DRKA 3FTWA 3RU0A 1H0GA 1ZBPA 4HBDA 1V55E 4J8SA 2XP5A 2X6JA 4O1OA 3O5JA 1OWQA 1Z3XA 3K9IA 2BKGA 3WH0A 3TWVA 2MPHA 4NIKA 1ELKA 5DIVA 2F37A 4ILIA 1X81A 5LP0A 2DWZA 1B89A 4U84A 3QNKA 1LJYA 1O1RA 3ESKA 5DIUA 1OGBA 3UF8A 5LFAA 5D0OD 3L08A 3IBEA 2XHEA 4ODPA 1LD8A 3UM3A 2HYZA 2VGYA 3ZRHA 2ZQVA 1BD8A 3KSQA 5CMYA 2DG3A 3WQWA 2EIME 5DEZA 4LEUA 5CMWA 1FKBA 5E76A 3PE3A 4LNBA 4HB5A 1E8ZA 1O6IA 1J4HA 2DSZA 1A5EA 1N0QA 3O5MA 3SHFA 4YDWA 1FT1A 3EIJA 3L13A 4E6HA 1EDQA 3PRZA 3S7FA 2O9OA 3OTNA 5KBAA 2DSWA 3TWRA 4RLYA 2GRLA 1YMPA 5KCMA 3GZ2A 1WB0A 4YVQC 3TWUA 4MS6A 4Y6CA 4APOA 3ARVA 5CCMA 3MKQA 1Q6HA 3LPZA 2P9KG 2F2DA 3NTPA 3UQBA 3CHPA 2IONA 1HXIA 2XZTG 3ALGA 4JYSA 1C9HA 3SNXA 3FH7A 2X3MA 3G2TA 2DT2A 1JWGA 3FU6A 3FH8A 3C3RA 3VLFA 4U85A 4ME2A 2VTBA 4JHRA 4WWNA 3EHNA 4ZPTR 4V3IA 1EHNA 5HT1A 4B8CB 4AY5A 3C72A 2V4LA 4C0MA 3CR3A 2IUZA 1BI7B 3DWLG 3CSFA 3SGHA 1YW5A 2B31A 3DSUA 3Q4AB 1UR9A 1SZ9A 4DX5D 4U0UA 4Q7NA 5AQ7A 3FTZA 3TWQA 4LNUD 2PQRA 3T5XA 3CQGB 2XRYA 2XP7A 1QBQA 1KZOA 3S7JA 4J8EA 1N4PA 2AXVA 3ONLA 2A3AA 3JCKC 4GTSA 4U0SA 3ASGA 3UKRG 4EPZA 3PNLB 4L9PA 4ANUA 5EIDA 3FU0A 2KR7A 5HRYA 4B93B 3RO2A 1D8DA 2YNQA 3TWWA 3LYAA 4XI0A 2BTDA 3V2XA 3GPKA 4WK9A 3L6AA 4WWOA 3GW4A 2IO2C 3QWPA 2PNNA 3B7RL 4WNFA 3ZNGA 4UDMA 4J8DA 4N5CA 3EY6A 3WD0A 3Q73A 4D10C 3DRAA 1ZB1A 3PEVB 3MX3A 4CDRA 4KR0B 2WMOA 3BMBA 2FBNA 3UINC 3PZ3A 4NZCA 3D9PA 2F23A 4LAYA 4UWFA 4TW8A 2NXPA 3UM1A 4HLEA 2A3CA 2MLZA 4XKBA 3SY2A 2R5SA 3HDXA 2VGXA 3B7BA 3QWWA 4GZ6A 3SF4A 1WG0A 1K8KG 3FFLA 2J8SD 3H9RB 4EHMA 3DPYA 1JVWA 3JYJA 2GRPB 4DI4A 1ZBWA 3UI6A 5T3RA 2B0OE 1BL4A 4BX9A 3D9KA 3AS3A 4BSXA 5CBOA 1W1PA 2PI6A 2DSVA 1ZL1A 2PBCA 1Q1CA 2L0TB 3UMVA 1D7HA 3PUKA 4G24A 4XKCA 2GROB 3ODKA 3PS6A 1EPUA 3DEOA 5CRUA 2XQ0A 1U2VG 1VDYA 4AEZC 2OFNA 3WL1A 2XCCA 4G2PA 2LNIA 1ZU8A 3E37A 4XI9A 2B5UB 4Q96A 3CHMA 1XNFA 5EYLA 1H6OA 1W9UA 3OAWA 4GTQA 5FZQA 3ARRA 1PC2A 3O5PA 4Y6WA 2O92A 3L22A 1MQSA 1NA3A 5KJMA 1Y8MA 4BERA 5HKGA 4W5UA 4WJXA 3ASHA 5JJ7A 2X6FA 3AG4E 5D66A 1RW2A 2QC9A 1E6NA 1DC2A 3UTMA 2F8YA 1E7UA 1MX6A 4GAAA 5LX8A 4ZPVR 4G11A 5DITA 3E4BA 4DRJA 1JPLA 1M5YA 3CVVA 1J4RA 4AOFA 2VJ8A 1D7IA 2R2LA 1TN6A 3B8SA 4ACLA 1NZNA 3AS5A 1OCCE 4NRHB 4F3VA 1EIBA 4ILGA 4BY6A 2QZAA 1Z3YA 5BXOA 4W9RA 2A4ZA 4TW6A 3ABLE 3UKUG 2Y3AA 3U64A 1LL7A 3O5EA 4GTOA 4Z68A 3ULEG 3CEQA 3KAEA 1E96B 3UT7A 4BSZB 1ZK6A 3E34A 1ITXA 1FJDA 5ENTD 5HBFA 4UQYA 2EIJE 4R7LA 1P5QA 4JA7A 3KCEA 3TDBA 3ULYA 2H6GA 1N4QA 4FHJA 1W3BA 3ENEA 2M2AA 2X6HA 1N9AA 2NYJA 2X6IA 1K1AA 4FP7A 2DBAA 4O1PA 1JWFA 3D9NA 4ATZD 3LJNA 5GPRA 1O5MA 4CYMD 4ODKA 1N52A 3URZA 3FUFA 2J4DA 4JFKA 4L2LA 4O60A 5FT9A 4W9PA 4I2WA 1J4IA 3BG1B 1UN9A 1Q6IA 3AS0A 1E90A 2XPAA 2CFZA 2DYSE 1XHGA 2P9NG 3FTXA 5CECB 2XS1A 4R0XA 3FEXA 4N19A 1U3DA 4I1AA 1FKKA 3CHQA 3KAHA 4GZCA 3DSWA 3HXCA 4HFGA 3WKZA 4EECA 2XEEA 3B7UX 1CTNA 2KZTB 5FWQA 3BEEA 1FKIA 4GYOA 3BUAA 3CHRA 2Y69E 1OT8A 1O1TA 4PTMA 2ETNA 5AQAA 4WWPA 2M63A 2A5EA 3U9WA 3HXDA 5HQ8A 2P58C 4U04A 4HI8A 5HWBA 2D9FA 1A17A 3UT8A 5E75A 1NWSA 3GZ1A 4N3CA 3SZ7A 1RZ4A 1UJKA 2GW1A 3ARYA 2OEVA 3MGBA 1SR0A 4GCNA 1FFQA 1N94A 4J4OA 1D7JA 2XGOA 2K8IA 2XENA 1TFVA 3ZFWA 4JD2G 4O2TA 1HF8A 4A63B 5JJTA 2RQSA 1JNSA 4DWSB 2C0LA 4DROA 3G6LA 1F40A 1H2TC 4BF8A 3APFA 1GW6A 3GZSA 3O5LA 2AXZA 4Q22A 4RVBA 1OGGA 4U8VD 2FEZA 1H6PA 3FH5A 1HJVA 3ARZA 3VTXA 3ARSA 3LUOA 2ZGDA 3ZYMA 2X38A 1GUVA 2ZIRA 2GRQB 1N0RA 2LPVA 4IT6A 3KABA 5HUAA 3CZ8A 2MF9A 2ZR4A 5AN8A 3ZYLA 3TCZA 4JZYA 4A1SA 2PV1A 3UM0A 3ARTA 2KM4A 4B89A 3TC5A 2ZR5A 2QYJA 3NOGD 1NWRA 4MKTA 1OWLA 3PRDA 3T8KA 1QPLA 4WNDA 5AENA 5CBNA 5CEAA 3KACA 3RRUA 1ZB5A 4H7XA 5EN5D 4GGQA 1PAQA 2WQHA 4KZ0A 4BT9A 3CK7A 5ENOD 2WXPA 5EILA 1G3NB 1E6PA 1E8WA 3AS4A 3Q78A 3UUXA 3DSVA 3Q9UC 2A3BA 4UWKA 2OCCE 3GTYX 3UIPC 4ZS6A 4DIPA 2RURA 3LY7A 3EHQA 4TNSA 5ARGA 3ML8A 1GOIA 1T11A 1TNOA 1ZU2A 4PS7A 4ITZA 2DIWA 1LL6A 4Q69A 1X6LA 1Q2ZA 3NBNB 4GU5A 1TNBA 3HVEA 1S70B 5FQ7A 2LGOA 2ETAA 2WB2A 1NWUA 2MLXA 4MNKA 3SO8A 3JUEA 3U66A 2R05A 5EIBE 4XAKA 4BTAA 3I3NA 2P9PG 4G8LA 1E44A 5JH8A 3DBSA 2KZTA 2MRIA 3AU4A 1AWCB 1H0IA 2F21A 3TWSA 4Q94A 3HRAA 2Y0BG 4R5EA 4UI9J 2R03A 2P9SG 2DPEA 2XZDG 4MLPA 1IXVA 3UQIA 2FDMA 1U79A 5BW8C 3UM2A 1WDYA 4GTRA 2ZQUA 1ELRA 2RSEA 1HS6A 4N39A 1H0AA 2VSNA 4ATGA 5ARFA 1HE8A 4J0UA 2L6JA 3HXEA 4P8XA 4HXIA 4DJAA 3JYSA 4LRZA 3FY4A 3CHFA 4EZKA 1NH6A 1LL4A 4W9QA 4NACA 4YNDA 1TNUA 5EYPF 1ZCNA 5T4YA 4LUNU 3CGMA 1NA0A 1H19A 4Z2IA 4P8VA 2NSZA 4TX0A 3NZUA 1E6RA 2V5QC 4DRMA 4HLLA 5G04J 2XS8A 4GYWA 3TGOA 2VSXE 3AU5A 3IKOB 4F1SA 3AG3E 1D6OA 4DRIA 3EHMA 2J07A 1D8EA 2Q5AA 2C0MA 4GA1A 4EZJA 3V30A 1TEZA 2I1JA 3GU0A 4NQ0A 1DCQA 3AS2A 5C2YA 2PV3A 3LDZA 4AV7A 1HFAA 2ETCA 3D9HA 3FHEA 4QT3A 3SBSA 3PR9A 2WXKA 3ASFA 4GZ5A 2G41A 4TRQA 3RM4A 1A7XA 2JZVA 3QC1A 3S7DA 3RIBA 2OVBA 1IHGA 4C0EA 1BLXB 3CSTA 3SD5A 4H7YA 3C3QA 4GMJA 2KGJA 5AIJA 2IY0C 3S7BA 2RKKA 1E9LA 2YBUA 1WM5A 3ABKE 5FZSA 3FU3A 4JC8A 1HU3A 3HG0D 1U3CA 3QB2A 1HG2A 2G8ZA 4B8AA 4DT4A 1HZ4A 1W9VA 3B13A 4DZ3A 1OWOA 4I43A 3UX4A 1FAPA 4GA2A 1QPFA 2WXMA 2UY1A 2VCDA 1MJ0A 5HW8A 2M1IA 4U7EB 4DWSC 3ZKJA 2WXIA 3Q49B 3G6MA 4HS2A 3R9AB 4YDOA 3EIPA 2WQ7A 2F0YA 5JJ6A 4BEPA 1HG5A 5D2MC 4UWHA 3QARA 4KYOB 4HOSA 2EULA 4NSBA 4U63A 3ML9A 4HBEA 1XGWA 3MZLB 2IEJA 1UG3A 4QZVB 4MBGA 4M7CA
chains in the Genus database with same CATH topology
3KS2A 1JNDA 4LAXA 2V0PA 2YQ8A 3ZW3A 3O5IA 4MTVA 3WIJA 5G55A 4GCOA 4FADA 2RUCA 2DT3A 2KE0A 4I6GA 4TV3A 1YATA 1NWTA 5JHBA 2RD0A 2LAHA 2WXFA 3PRAA 4IQ2A 2IQCA 4CT4A 4MNJA 4HOTA 4LGXA 1H2VC 3CIAA 4JVSA 3AS1A 5BUZA 2I9CA 1UR8A 3ARQA 4ANVA 3FDHA 2J49A 2I2OA 1NP7A 4N2QA 2IJGX 2DT0A 1W1TA 1LG1A 4ANWA 4CEMA 4KBQA 3FXYA 3W4RA 2FI7A 5BNWA 1HKMA 3EIQC 3ASDA 2FAPA 4L1BA 1B6CA 4ACKA 5LCWJ 4FLHA 3ZIMA 5KJNA 3TG4A 3ZYQA 4BTBA 3KAGA 4PS3A 2RUDA 2WXLA 1ZBCA 2PPPA 4RSYA 1K9TA 1BKFA 2XPYA 4AM9A 3FUHA 3LVRE 4A55A 4ODQA 5D75A 4I2ZA 1TCOC 4IRUA 4CCAA 2YBTA 3ESLA 4JFMA 4N3AA 4WUYA 3CH9A 2PV2A 3PH0C 3CHOA 2ITKA 3LY9A 1NMWA 3JQ1A 3JXVA 1PY1A 3C98A 4WNGA 1FKLA 3QDNA 4OVUA 4IYPA 4URIA 2WXOA 1DVPA 5ENNA 3TXNA 3T8MA 1DNPA 4PS8A 3NQPA 3TAXA 4J8FA 1FKJA 4APFA 5HW6A 2Q7FA 1W26A 2XP9A 4UWLA 3ARPA 1ZBVA 5J6EA 2FO7A 3L17A 3S2AA 3MKQB 4ZPWR 3ARXA 1LG2A 5DIZA 3CHDA 4N3BA 5J08A 2WLZA 2FKEA 1XRVA 1OWNA 4U86A 2KCKA 4KXKB 1X5BA 3FTVA 3FUNA 3O5QA 2RG8A 4FU3A 4WNEA 4JPSA 4KVOA 5I98A 1SQMA 4JFLA 4IPXA 2PZIA 4MGVA 3FU5A 1UW4B 3O5OA 5BT1A 2E2EA 3Q15A 4DPRA 4L72B 2J4BA 2KFWA 3FTSA 5T8IA 5AJDA 2L2SA 3TG5A 2VSOE 3HYMB 4KMOA 4KQZA 4GZDA 1FKDA 3WD1A 4JFIA 4FN2A 2PPOA 4G50A 3LXUX 2KCVA 1OWPA 4MSPA 2XPZA 3O5GA 1L1PA 4CGWA 4A3VA 1HH8A 4BX8A 1Y0OA 3AROA 4CT0A 1HJXA 4C02B 3L54A 3CV0A 1HKIA 1UN8A 3D9MA 2R17C 1EYHA 3FWVA 3ZEFA 1QNFA 3G2SA 5HWCA 3G2VA 1HKJA 5FZRA 4OVVA 3UI5A 2XGMA 5LOZA 1ZBKA 4EBAG 2JLBA 3PE4A 3BXWA 2WXJA 1E8YA 4FHKA 3AQUA 1N54A 3I4RB 3CKBA 4J4NA 3UQAA 4I1OB 1H2UA 1X6NA 4MNLA 4TW7A 2M08A 1NSGA 1E8XA 4L23A 3ZYKA 2FF4A 3CQCB 4MNMA 2IOLA 2HM8A 4U07A 4BT8A 5BPPA 3TJPA 3CVQA 3D9JA 3OA5A 4EZLA 3KAIA 4M3OA 3SBTB 4OYSA 4FA6A 3B7TA 1WY6A 2XGSA 4EBAA 3APCA 3WL0A 2ZU6B 5BV1A 1Z6TA 5BV0A 3IHVA 1IQRA 5B8IC 2VGXB 3FTUA 4JHJA 1IX5A 3IV0A 4GMLA 4AY1A 4P8WA 2KATA 3TXMA 3UI4A 4XX5A 2AOSA 3I6CA 3MA5A 1EDUA 4FULA 1YA0A 2WVIA 3UPVA 2J09A 3CHCA 1L5JA 3Q5MA 2XP8A 2GRMA 4G26A 3QOKA 2WM0A 3HVEB 3CVNA 3CVYA 3WXXA 4HOQA 3CK8A 3SFZA 3RK6A 3MJWA 3CVLA 4A1GA 3P1UA 1OWMA 4JA9A 3VLDA 5FQ8A 3NRKA 4AJWA 5D0QD 1FKFA 3ZN3A 4I17A 3EDTB 2V5FA 2IOSA 4XZ4A 3GYZA 3O48A 4JW1A 1W1YA 3FUMA 3CVXA 4Z2LA 3ZPJA 3IHYA 3RO3A 3D9LA 2QF8A 1EQ3A 4AY6A 4AP2A 4DRQA 2XPBA 3IK8A 3PZDA 5AJLA 2LSUA 3ZGQA 5A23A 5A7DB 5FQ6A 3RKVA 1IYGA 2CG2A 4I9CA 4F7AA 2ONDA 3APDA 1TJCA 5J90A 4AIFA 3FUJA 5ANLA 5DF0A 3JQ0A 3O4ZA 3PREA 1WNOA 4EQFA 3PDNA 2MLYA 3D9OA 1HJWA 3KD7A 2C2LA 2QY7A 3OXFA 4JHKA 2WXGA 2V8SE 1D2KA 3PVLA 1ROTA 4HARA 4TYOA 5EX0A 3KAFA 2ILRA 3AS8A 2AWIA 3ZHEB 4G2VA 1FKTA 3RJVA 4WAFA 1JNEA 4P8UA 1KFWA 4Z2JA 3PA7A 4HVBA 2LO6A 4J6IA 2YHEA 4P29A 4PUCA 4WKHA 3MV3B 1FD9A 3IEGA 2XP6A 4UI9C 3D3MA 4WKFA 1Y6IA 4ILHB 2IU1A 2ZQSA 4AXHA 2WLYA 4RG9A 1FCHA 2NC9A 2PL2A 3QKYA 4I9EA 3FY1A 4WKAA 2UWJG 3LS8A 3ULQA 2XCBA 2MHKA 1HX8A 2DG9A 5AYWD 2F4EA 3CKCA 4FJZA 3CVPA 2AVPA 4JL0A 2WXRA 3ARWA 3FTYA 2WXNA 3CGNA 4LAWA 4WIWA 3WQVA 3KZ7A 4ODOA 3O5DA 3CK9A 3NI6A 3O5RA 2UZ5A 3WD4A 3B9EA 4Z2HA 3LY8A 1LQ0A 3B7SA 3WD2A 3MEKA 1IQUA 2PQNA 3B9DA 4DWSA 1QZ2A 3ZVVA 4B0ZA 3VTYA 3L16A 5FTPA 5KJLA 4ODLA 1E15A 3FUIA 3O5FA 3MDYB 1FVHA 5ANRA 3G2UA 3RRNB 4ANXA 4GYYA 4KT6B 3VAWA 3HIZA 2L0IA 4E85A 2KC7A 2WXQA 3P2BA 4A3TA 3QWVA 3UQ3A 4G25A 2ZQTA 1SYTA 4LCTA 4QT2A 1GPFA 4I6JA 3ONKA 2Y4UA 2J08A 2IFUA 2CHXA 4XE0A 1W9PA 4DLOA 4ML4A 3QK0A 4NNRA 1UJJA 3MCXA 3PEUB 3VLEA 4LAVA 3KADA 3NZSA 3LEWA 2J9QA 3MKRA 4UI9K 2ZR6A 4Z2GA 4DWSD 1FKHA 2CFUA 3MV2B 5M72A 1JNTA 4L7TA 3RRMB 3TL5A 4S3JA 2I1KA 5EDSA 4LERA 2ESCA 5CHEE 1FFRA 5HW7A 1ROUA 2HR2A 1R9HA 1Q6UA 2XP3A 5EX3A 4L3NA 2OLHA 4FJYA 4B94A 1KT1A 3FUEA 4HBOA 2AXUA 4DZ2A 3HHMA 5G04C 2KO7A 2CHWA 4AVXA 5GPGA 4K0RA 4URKA 2OOEA 4UQZA 4DRHA 5DBKA 4GZ3A 3EJNA 2WK2A 4IN3B 3LVQE 4DI3A 4ABNA 3LCAA 4PDXA 4QIBA 1WAWA 5HTGA 2WMNA 2LAIA 3NF1A 2QFCA 3CVWA 2LJ4A 3FULA 1RD6A 3CLJA 1KT0A 2OVFA 1SZAA 2OV8A 5FQ4A 1NMVA 4DLQA 4F53A 2R59A 1QQEA 4UWGA 2YHCA 4GA0A 5KJKA 4KVMA 2RUQA 1E7VA 3B7XA 4W9OA 1OUVA 2KI3A 2VQ2A 2PPNA 5CCLA 2DSUA 4JEUA 4C9BB 4U8HA 3Q47B 2WXHA 3QAQA 2VTBB 3JUIA 4UQXA 3JYMA 4PH4B 3ZXSA 2AW6A 4DH0A 3LKUA 2XRZA 3I5PA 4G23A 4RG6A 3CVUA 4CDMA 4MAVA 2X6KA 4DRPA 3U3WA 3ALFA 3KEZA 3RFWA 3LJ3A 5G05J 2I6HA 3PNTB 1PINA 3CHSA 2MOWA 4I1MA 4ODRA 1H6KA 3BG0B 1FKRA 2EQXA 4Z2KA 4JXTA 3I4GA 1ELWA 3G2WA 2A5UA 4N2SA 3FP3A 2L9BA 2DT1A 4G1TA 1INZA 4GPKA 2BF0X 3D9IA 3SI5A 1KLXA 3CHEA 5JHAA 1FKSA 2YINA 4QFVA 1TJFA 1EYMA 2XEVA 3B9AA 1HKKA 5DO2A 3T5VA 4TUUA 4DRNA 2Y4TA 4JFJA 3R7QA 2MNTA 2DCPA 2KCLA 5EKQD 2UY1B 3CGHA 2JEKA 1W1VA 3OXGA 4FC8A 3OXLA 5FJYA 2VSYA 1MHQA 2WQ6A 2VYIA 1HO8A 4ODNA 4HOUA 3FUKA 4NURA 2HO1A 2PM7A 3R7RA 2LKNA 4JEHA 4GB9A 4IULA 3PUJA 3RMEA 1FVFA 3MYVA 3IHZA 4FLBA 4I6EA 3ZHEA 3FEYA 3RM9A 3OOBA 1E6ZA 3IKGA 1S0PA 4K03A 3FUDA 2FULA 2WPVA 1F8AB 2GGFA 4FAPA 2CG3A 3O5KA 5HI7A 1VF8A 2Y78A 3RM8A 2IF4A 4HORA 2AWGA 5G2NA 3RGCA 4ODMA 3N71A 3UT4A 4BFRA 4CRWA 5BXJA 2PM6A 4IT4A 4BWRA 2DG4A 4O6FA 4YVOA 2XPIA 4XIFA 4KZCA 2XP4A 3WD3A 2VN1A 5LCWC 4DK5A 2CHZA 3IKDA 1N1AA 5G05C 3U4TA 2A3EA 2N87A 1EF1C 4GIVA 1JUQA 3PRBA 4MPKA 3QOUA 4CDNA 5C1DA 2WM9A 4IQCA 4MRUA 2BUGA 4L2YA 3FAPA 4U0ZA 2LSVA 1FKGA 4CGVA 1BPOA 3QJZA 1WAO1 1PBKA 4S3KA 1LF8A 5A6CA 3ARUA 3DPDA 5GQBA 2E0IA 1J6YA 1HXVA 4DRKA 3FTWA 3RU0A 1H0GA 1ZBPA 4J8SA 2XP5A 2X6JA 3O5JA 1OWQA 1Z3XA 3K9IA 3WH0A 2MPHA 1ELKA 5DIVA 4ILIA 5LP0A 1B89A 4U84A 3QNKA 1LJYA 3ESKA 5DIUA 1OGBA 3UF8A 5LFAA 5D0OD 3L08A 3IBEA 2XHEA 4ODPA 2HYZA 2VGYA 3ZRHA 2ZQVA 5CMYA 2DG3A 3WQWA 5DEZA 4LEUA 5CMWA 1FKBA 5E76A 3PE3A 1E8ZA 1O6IA 1J4HA 2DSZA 3O5MA 3SHFA 3EIJA 3L13A 4E6HA 1EDQA 3PRZA 3S7FA 2O9OA 3OTNA 2DSWA 2GRLA 5KCMA 3GZ2A 1WB0A 4YVQC 4MS6A 4Y6CA 4APOA 3ARVA 5CCMA 3MKQA 1Q6HA 3LPZA 2F2DA 3NTPA 3UQBA 3CHPA 2IONA 1HXIA 3ALGA 4JYSA 1C9HA 3SNXA 3FH7A 2X3MA 3G2TA 2DT2A 1JWGA 3FU6A 3FH8A 3VLFA 4U85A 4ME2A 2VTBA 4JHRA 4WWNA 3EHNA 4ZPTR 4V3IA 1EHNA 5HT1A 4B8CB 4AY5A 2V4LA 4C0MA 3CR3A 2IUZA 3CSFA 3SGHA 1YW5A 2B31A 3Q4AB 1UR9A 1SZ9A 4U0UA 4Q7NA 3FTZA 3T5XA 2PQRA 3CQGB 2XRYA 2XP7A 3S7JA 4J8EA 2AXVA 3ONLA 2A3AA 3JCKC 4U0SA 3ASGA 4EPZA 3PNLB 4ANUA 3FU0A 2KR7A 3RO2A 2YNQA 3LYAA 4XI0A 2BTDA 3GPKA 4WK9A 3L6AA 4WWOA 3GW4A 3QWPA 3B7RL 4WNFA 4J8DA 4N5CA 3EY6A 3WD0A 4D10C 3PEVB 3MX3A 4CDRA 4KR0B 2WMOA 2FBNA 4NZCA 3D9PA 4LAYA 4UWFA 4TW8A 2NXPA 4HLEA 2A3CA 2MLZA 4XKBA 2R5SA 3HDXA 2VGXA 3QWWA 4GZ6A 3SF4A 3FFLA 3H9RB 1JVWA 3JYJA 4DI4A 1ZBWA 3UI6A 5T3RA 1BL4A 4BX9A 3D9KA 3AS3A 4BSXA 1W1PA 2PI6A 2DSVA 1ZL1A 2PBCA 1Q1CA 2L0TB 3UMVA 1D7HA 3PUKA 4G24A 4XKCA 3ODKA 3PS6A 1EPUA 2XQ0A 1VDYA 4AEZC 2OFNA 3WL1A 2XCCA 4G2PA 2LNIA 1ZU8A 4XI9A 4Q96A 3CHMA 1XNFA 1W9UA 3OAWA 5FZQA 3ARRA 1PC2A 3O5PA 4Y6WA 2O92A 3L22A 1MQSA 1NA3A 5KJMA 1Y8MA 5HKGA 4W5UA 4WJXA 3ASHA 5JJ7A 2X6FA 1E6NA 1E7UA 4GAAA 5LX8A 4ZPVR 4G11A 5DITA 3E4BA 4DRJA 1JPLA 1M5YA 3CVVA 1J4RA 4AOFA 2VJ8A 1D7IA 3B8SA 4ACLA 1NZNA 3AS5A 4NRHB 4F3VA 1EIBA 4ILGA 4BY6A 1Z3YA 4W9RA 2A4ZA 4TW6A 2Y3AA 3U64A 1LL7A 3O5EA 3CEQA 3KAEA 1E96B 3UT7A 1ZK6A 1ITXA 1FJDA 5HBFA 4UQYA 4R7LA 1P5QA 4JA7A 3KCEA 3TDBA 4FHJA 1W3BA 3ENEA 2M2AA 2X6HA 2X6IA 4FP7A 2DBAA 1JWFA 3D9NA 5GPRA 4ODKA 1N52A 3URZA 3FUFA 2J4DA 4JFKA 4W9PA 4L2LA 5FT9A 4I2WA 1J4IA 3BG1B 1UN9A 1Q6IA 3AS0A 1E90A 2XPAA 2CFZA 1XHGA 3FTXA 4R0XA 3FEXA 4N19A 1U3DA 4I1AA 1FKKA 3CHQA 3KAHA 4GZCA 4HFGA 3WKZA 4EECA 3B7UX 1CTNA 2KZTB 5FWQA 3BEEA 1FKIA 4GYOA 3CHRA 4PTMA 4WWPA 2M63A 3U9WA 5HQ8A 2P58C 4U04A 5HWBA 2D9FA 1A17A 3UT8A 5E75A 1NWSA 3GZ1A 4N3CA 3SZ7A 1UJKA 2GW1A 3ARYA 3MGBA 1SR0A 4GCNA 1FFQA 4J4OA 1D7JA 2XGOA 2K8IA 1TFVA 3ZFWA 4O2TA 1HF8A 5JJTA 2RQSA 1JNSA 4DWSB 2C0LA 4DROA 3G6LA 1F40A 1H2TC 4BF8A 3APFA 1GW6A 3GZSA 3O5LA 2AXZA 4Q22A 4RVBA 1OGGA 2FEZA 3FH5A 1HJVA 3ARZA 3VTXA 3ARSA 3LUOA 3ZYMA 2X38A 1GUVA 2LPVA 4IT6A 3KABA 5HUAA 3CZ8A 2MF9A 2ZR4A 3ZYLA 3TCZA 4JZYA 4A1SA 2PV1A 3ARTA 2KM4A 4B89A 3TC5A 2ZR5A 1NWRA 4MKTA 1OWLA 3PRDA 1QPLA 4WNDA 5AENA 3KACA 3RRUA 1ZB5A 4H7XA 4GGQA 1PAQA 2WQHA 4KZ0A 4BT9A 3CK7A 2WXPA 1E6PA 1E8WA 3AS4A 3UUXA 2A3BA 4UWKA 4ZS6A 4DIPA 2RURA 3LY7A 4TNSA 5ARGA 3ML8A 1GOIA 1T11A 1ZU2A 4PS7A 4ITZA 2DIWA 1LL6A 4Q69A 1X6LA 4GU5A 3HVEA 5FQ7A 2LGOA 2WB2A 1NWUA 2MLXA 4MNKA 3U66A 4XAKA 4BTAA 3I3NA 5JH8A 3DBSA 2KZTA 2MRIA 3AU4A 1H0IA 2F21A 4Q94A 4R5EA 4UI9J 2DPEA 4MLPA 3UQIA 2FDMA 1U79A 5BW8C 2ZQUA 1ELRA 2RSEA 1HS6A 4N39A 1H0AA 2VSNA 4ATGA 5ARFA 1HE8A 4J0UA 2L6JA 4P8XA 4HXIA 4DJAA 3JYSA 4LRZA 3FY4A 3CHFA 4EZKA 1NH6A 4W9QA 1LL4A 4NACA 4YNDA 1ZCNA 5T4YA 4LUNU 3CGMA 1NA0A 1H19A 4Z2IA 4P8VA 2NSZA 4TX0A 3NZUA 1E6RA 4DRMA 5G04J 4GYWA 3TGOA 2VSXE 3AU5A 3IKOB 4F1SA 4DRIA 1D6OA 3EHMA 2J07A 2Q5AA 2C0MA 4GA1A 4EZJA 1TEZA 2I1JA 4NQ0A 3AS2A 5C2YA 2PV3A 3LDZA 4AV7A 1HFAA 3FHEA 4QT3A 3SBSA 3PR9A 2WXKA 3ASFA 4GZ5A 2G41A 4TRQA 3RM4A 1A7XA 2JZVA 3QC1A 3S7DA 3RIBA 2OVBA 1IHGA 4C0EA 3CSTA 3SD5A 4H7YA 4GMJA 2KGJA 5AIJA 3S7BA 1E9LA 2YBUA 1WM5A 5FZSA 3FU3A 4JC8A 1HU3A 1U3CA 3QB2A 1HG2A 2G8ZA 4B8AA 4DT4A 1HZ4A 1W9VA 3B13A 4DZ3A 1OWOA 4I43A 3UX4A 1FAPA 4GA2A 1QPFA 2WXMA 2UY1A 2VCDA 5HW8A 2M1IA 4DWSC 2WXIA 3Q49B 3G6MA 4HS2A 3R9AB 2WQ7A 5JJ6A 1HG5A 4UWHA 3QARA 4KYOB 4HOSA 4NSBA 4U63A 3ML9A 4HBEA 1XGWA 3MZLB 1UG3A 4QZVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KS2 A;  4I9C A;  1J4R A;  4LAX A;  1D7I A;  4HOU A;  2HO1 A;  2YQ8 A;  2OND A;  1TJC A;  2LKN A;  4AIF A;  3O5I A;  1NZN A;  3AS5 A;  4NRH B;  4F3V A;  4GCO A;  2RUC A;  4W9R A;  2KE0 A;  4TW6 A;  4EQF A;  3IHZ A;  1YAT A;  3PDN A;  3ZHE A;  3O5E A;  4IQ2 A;  3OOB A;  2MLY A;  3CEQ A;  3KAE A;  1E96 B;  1ZK6 A;  3KD7 A;  4HOT A;  1FJD A;  2C2L A;  4UQY A;  3IKG A;  3OXF A;  4FAP A;  2WPV A;  1F8A B;  1P5Q A;  4JA7 A;  3KCE A;  3TDB A;  3O5K A;  5HI7 A;  1ROT A;  1W3B A;  4TYO A;  5EX0 A;  3KAF A;  3AS8 A;  4N2Q A;  2M2A A;  2Y78 A;  2IF4 A;  4HOR A;  3ZHE B;  2AWG A;  2DBA A;  3RGC A;  4ODM A;  3N71 A;  4G2V A;  1FKT A;  3RJV A;  4KBQ A;  5BXJ A;  2FI7 A;  5BNW A;  4BWR A;  2DG4 A;  4ODK A;  4O6F A;  3PA7 A;  3URZ A;  4JFK A;  4YVO A;  2XPI A;  4W9P A;  3MV3 B;  5FT9 A;  4I2W A;  3ASD A;  3IEG A;  1FD9 A;  4XIF A;  1J4I A;  2XP6 A;  2FAP A;  2XP4 A;  4UI9 C;  2VN1 A;  1Q6I A;  5LCW C;  1B6C A;  2XPA A;  5LCW J;  3IKD A;  5KJN A;  3TG4 A;  4BTB A;  2ZQS A;  3KAG A;  4RG9 A;  1FCH A;  4R0X A;  2NC9 A;  2PL2 A;  2RUD A;  1N1A A;  3QKY A;  5G05 C;  4I9E A;  3U4T A;  4N19 A;  4I1A A;  1FKK A;  2UWJ G;  3ULQ A;  2N87 A;  2PPP A;  4GIV A;  3KAH A;  2XCB A;  3PRB A;  1BKF A;  2MHK A;  4AM9 A;  2DG9 A;  4ODQ A;  5D75 A;  5AYW D;  3QOU A;  3BEE A;  4I2Z A;  1FKI A;  1TCO C;  5C1D A;  2F4E A;  3CKC A;  4GYO A;  3CVP A;  2AVP A;  4IQC A;  2BUG A;  4JL0 A;  4JFM A;  4N3A A;  4WUY A;  3FAP A;  4U0Z A;  2LSV A;  5HQ8 A;  2P58 C;  2PV2 A;  4U04 A;  3CGN A;  5HWB A;  2D9F A;  2ITK A;  1A17 A;  3LY9 A;  1NMW A;  1FKG A;  3JXV A;  4LAW A;  4CGV A;  3GZ1 A;  3KZ7 A;  4ODO A;  4N3C A;  1WAO 1;  4WNG A;  3QDN A;  3SZ7 A;  1FKL A;  1PBK A;  3O5D A;  3CK9 A;  3NI6 A;  3O5R A;  2UZ5 A;  2GW1 A;  5A6C A;  3LY8 A;  4GCN A;  3TAX A;  4J8F A;  1FKJ A;  4J4O A;  5HW6 A;  3MEK A;  1J6Y A;  1D7J A;  2XGO A;  2Q7F A;  2PQN A;  2K8I A;  1HXV A;  1W26 A;  4DRK A;  3RU0 A;  3ZFW A;  1QZ2 A;  1ZBP A;  4O2T A;  2XP9 A;  2XP5 A;  3VTY A;  5JJT A;  2RQS A;  1JNS A;  5FTP A;  5J6E A;  2FO7 A;  2C0L A;  4DRO A;  5KJL A;  3O5J A;  4ODL A;  1F40 A;  5DIZ A;  4BF8 A;  3K9I A;  3O5F A;  4N3B A;  3MDY B;  3O5L A;  3WH0 A;  2MPH A;  2FEZ A;  5DIV A;  1B89 A;  3VTX A;  2FKE A;  3LUO A;  4U86 A;  4U84 A;  4GYY A;  2KCK A;  4KXK B;  3ESK A;  5DIU A;  3UF8 A;  5D0O D;  2LPV A;  3VAW A;  3KAB A;  5HUA A;  4ODP A;  3O5Q A;  2HYZ A;  2MF9 A;  2ZR4 A;  2KC7 A;  4WNE A;  3QWV A;  3TCZ A;  2VGY A;  4A1S A;  3UQ3 A;  2PV1 A;  2ZQV A;  5I98 A;  4G25 A;  2ZQT A;  3TC5 A;  2DG3 A;  2ZR5 A;  4JFL A;  4IPX A;  2PZI A;  4QT2 A;  4LEU A;  4MGV A;  3PRD A;  1FKB A;  3PE3 A;  1QPL A;  3O5O A;  4WND A;  5BT1 A;  2E2E A;  1J4H A;  3Q15 A;  3KAC A;  4H7X A;  2Y4U A;  2KFW A;  3O5M A;  2IFU A;  4GGQ A;  2WQH A;  4BT9 A;  3CK7 A;  2L2S A;  3TG5 A;  3S7F A;  4NNR A;  3AS4 A;  3HYM B;  3UUX A;  3GZ2 A;  4YVQ C;  1FKD A;  4Y6C A;  4JFI A;  4FN2 A;  4APO A;  4LAV A;  5CCM A;  2PPO A;  4DIP A;  3KAD A;  2RUR A;  1Q6H A;  2J9Q A;  3LY7 A;  3LPZ A;  3MKR A;  4UI9 K;  2ZR6 A;  4G50 A;  2F2D A;  3NTP A;  3UQB A;  1FKH A;  3MV2 B;  4TNS A;  5M72 A;  5ARG A;  1JNT A;  1HXI A;  2KCV A;  1T11 A;  4MSP A;  1ZU2 A;  4JYS A;  1C9H A;  4ITZ A;  3O5G A;  1L1P A;  4CGW A;  4U85 A;  4ME2 A;  1HH8 A;  4JHR A;  1Y0O A;  5HT1 A;  5CHE E;  4C02 B;  5HW7 A;  4AY5 A;  1ROU A;  2LGO A;  2HR2 A;  1R9H A;  2MLX A;  3CV0 A;  1Q6U A;  2XP3 A;  5EX3 A;  1YW5 A;  4B94 A;  3Q4A B;  1KT1 A;  3FWV A;  4U0U A;  4DZ2 A;  5HWC A;  4BTA A;  2PQR A;  5FZR A;  5G04 C;  2KO7 A;  2XP7 A;  5GPG A;  3S7J A;  4J8E A;  2OOE A;  3UI5 A;  2XGM A;  4UQZ A;  2F21 A;  4DRH A;  5DBK A;  4GZ3 A;  2JLB A;  3PE4 A;  4UI9 J;  4U0S A;  3ASG A;  4IN3 B;  3CKB A;  3UQI A;  4ABN A;  3LCA A;  4J4N A;  3UQA A;  1U79 A;  5BW8 C;  2KR7 A;  2ZQU A;  4QIB A;  4TW7 A;  3RO2 A;  5HTG A;  2M08 A;  1ELR A;  1NSG A;  2RSE A;  3LYA A;  4XI0 A;  3GPK A;  3NF1 A;  2FF4 A;  3GW4 A;  3QWP A;  4N39 A;  2QFC A;  2VSN A;  4WNF A;  5ARF A;  4U07 A;  4J8D A;  4J0U A;  4BT8 A;  4N5C A;  2LJ4 A;  3EY6 A;  2L6J A;  3CVQ A;  3JYS A;  1KT0 A;  3KAI A;  4W9Q A;  4CDR A;  1NMV A;  4YND A;  2FBN A;  1ZCN A;  2XGS A;  3CGM A;  1NA0 A;  4LAY A;  1QQE A;  4TX0 A;  2YHC A;  4GA0 A;  4TW8 A;  5KJK A;  4DRM A;  5G04 J;  4GYW A;  5B8I C;  3TGO A;  2RUQ A;  2VGX B;  2MLZ A;  3B7X A;  4W9O A;  2R5S A;  1OUV A;  4DRI A;  1D6O A;  2VGX A;  2KI3 A;  2KAT A;  3QWW A;  2VQ2 A;  4GZ6 A;  3UI4 A;  3SF4 A;  2PPN A;  5CCL A;  3I6C A;  3FFL A;  3MA5 A;  2C0M A;  2Q5A A;  3H9R B;  4GA1 A;  1JVW A;  3JYJ A;  1YA0 A;  4NQ0 A;  3UI6 A;  3Q47 B;  3UPV A;  1BL4 A;  2PV3 A;  4UQX A;  4QT3 A;  3ASF A;  4GZ5 A;  3JYM A;  2PBC A;  1Q1C A;  1D7H A;  3Q5M A;  4G24 A;  1A7X A;  4G26 A;  2JZV A;  2XP8 A;  4DH0 A;  3LKU A;  3ODK A;  4G23 A;  3S7D A;  4RG6 A;  3RIB A;  1IHG A;  4DRP A;  3U3W A;  3CVN A;  4H7Y A;  3RFW A;  3WXX A;  4HOQ A;  3CK8 A;  5G05 J;  2I6H A;  2KGJ A;  1PIN A;  3S7B A;  2OFN A;  3CVL A;  4ODR A;  1FKR A;  1WM5 A;  5FZS A;  2XCC A;  4G2P A;  2LNI A;  1ELW A;  4JA9 A;  4DT4 A;  3NRK A;  1HZ4 A;  5D0Q D;  4XI9 A;  4DZ3 A;  1FKF A;  4N2S A;  3FP3 A;  1XNF A;  3ZN3 A;  4I17 A;  3EDT B;  2V5F A;  1FAP A;  3GYZ A;  4GA2 A;  1QPF A;  3O48 A;  2UY1 A;  4G1T A;  2VCD A;  4GPK A;  5FZQ A;  5HW8 A;  1PC2 A;  3O5P A;  4Y6W A;  2M1I A;  1NA3 A;  1KLX A;  1FKS A;  5KJM A;  3ZPJ A;  3Q49 B;  3RO3 A;  1EYM A;  1Y8M A;  5HKG A;  3R9A B;  2XEV A;  3ASH A;  1EQ3 A;  4AY6 A;  5JJ7 A;  5JJ6 A;  4DRN A;  2Y4T A;  4JFJ A;  2MNT A;  4DRQ A;  2KCL A;  2XPB A;  3IK8 A;  5EKQ D;  2UY1 B;  4KYO B;  4HOS A;  2LSU A;  3ZGQ A;  5A7D B;  3OXG A;  3RKV A;  3OXL A;  5FJY A;  1IYG A;  2VSY A;  2VYI A;  5DIT A;  3E4B A;  4DRJ A;  4ODN A;  1M5Y A; 
#chains in the Genus database with same CATH topology
 3KS2 A;  1JND A;  4LAX A;  2V0P A;  2YQ8 A;  3ZW3 A;  3O5I A;  4MTV A;  3WIJ A;  5G55 A;  4GCO A;  4FAD A;  2RUC A;  3RAU A;  2DT3 A;  2KE0 A;  4I6G A;  4TV3 A;  1YAT A;  1NWT A;  5JHB A;  2RD0 A;  2H6F A;  2LAH A;  2WXF A;  3PRA A;  4IQ2 A;  2IQC A;  4CT4 A;  4MNJ A;  4HOT A;  4LGX A;  1H2V C;  3CIA A;  5FIO A;  4JVS A;  3AS1 A;  5BUZ A;  2I9C A;  1UR8 A;  3ARQ A;  4ANV A;  3FDH A;  2J49 A;  2I2O A;  1NP7 A;  4N2Q A;  2H6H A;  2IJG X;  2DT0 A;  1W1T A;  1LG1 A;  4ANW A;  4CEM A;  4KBQ A;  3FXY A;  3NOC D;  3W4R A;  2FI7 A;  5BNW A;  1HKM A;  3DSS A;  4YDY A;  3EIQ C;  3ASD A;  2FAP A;  4L1B A;  1B6C A;  4ACK A;  5LCW J;  3HXF A;  4FLH A;  3ZIM A;  5KJN A;  3TG4 A;  3ZYQ A;  4BTB A;  3KAG A;  4PS3 A;  2RUD A;  2WXL A;  3EHR A;  3SFY A;  1ZBC A;  3J5Q B;  2PPP A;  4RSY A;  1TN7 A;  1K9T A;  1BKF A;  5ITZ F;  2XPY A;  4AM9 A;  3FUH A;  3LVR E;  4A55 A;  4ODQ A;  5D75 A;  3E33 A;  4I2Z A;  1TCO C;  2ZIS A;  1S63 A;  4IRU A;  4CCA A;  2YBT A;  3ESL A;  4JFM A;  2LXM A;  5ENQ D;  4N3A A;  2P9L G;  4WUY A;  3CH9 A;  2PV2 A;  3PH0 C;  3CHO A;  2ITK A;  4GTM A;  3LY9 A;  1NMW A;  2ETB A;  3JQ1 A;  3JXV A;  1PY1 A;  3C98 A;  3DSX A;  3V31 A;  4WNG A;  1FKL A;  3QDN A;  4OVU A;  4IYP A;  4URI A;  3ABM E;  2WXO A;  1DVP A;  5ENN A;  3TXN A;  3T8M A;  1DNP A;  4PS8 A;  3NQP A;  3TAX A;  4J8F A;  1FKJ A;  4HNA D;  4APF A;  5HW6 A;  1D9S A;  4LG6 A;  2Q7F A;  1W26 A;  2XP9 A;  4UWL A;  3ARP A;  3NAW A;  1ZBV A;  5J6E A;  2FO7 A;  3L17 A;  1QYM A;  3S2A A;  3MKQ B;  4ZPW R;  3ARX A;  1LG2 A;  5DIZ A;  3CHD A;  4N3B A;  4TXP A;  5J08 A;  2WLZ A;  2FKE A;  1XRV A;  1OWN A;  4K5C A;  4U86 A;  2KCK A;  4KXK B;  3UIO C;  1X5B A;  2AJA A;  1MX2 A;  4GTV A;  3FTV A;  3L82 A;  3FUN A;  1K3Z D;  3O5Q A;  2RG8 A;  4FU3 A;  4WNE A;  3WG7 E;  4JPS A;  4KVO A;  5I98 A;  3ZU7 B;  4DRX E;  1SQM A;  4JFL A;  4IPX A;  2PZI A;  4MGV A;  3FU5 A;  1UW4 B;  3O5O A;  5BT1 A;  2E2E A;  3Q15 A;  4DPR A;  2EIL E;  4L72 B;  2J4B A;  3AG2 E;  2KFW A;  3FTS A;  5T8I A;  5AJD A;  2L2S A;  3TG5 A;  2VSO E;  3JXJ A;  3HYM B;  4KMO A;  4KQZ A;  4GZD A;  1FKD A;  3WD1 A;  4JFI A;  4FN2 A;  4UUC A;  2PPO A;  4OAU C;  4G50 A;  3LXU X;  1Z5S C;  3Q79 A;  2KCV A;  1OWP A;  4MSP A;  2EIN E;  1N4R A;  2XPZ A;  3O5G A;  1L1P A;  4CGW A;  4A3V A;  1HH8 A;  4BX8 A;  5ENR D;  4XEI G;  4DX6 D;  1Y0O A;  3ARO A;  1OCZ E;  4CT0 A;  1HJX A;  4C02 B;  3L54 A;  3CV0 A;  1HKI A;  1UN8 A;  1FT2 A;  3D9M A;  2R17 C;  1EYH A;  2Y1L E;  3FWV A;  3ZEF A;  1QNF A;  3G2S A;  5HWC A;  3BQO A;  3KSL A;  3G2V A;  1HKJ A;  1SW6 A;  5FZR A;  4OVV A;  3UI5 A;  4GTP A;  2XGM A;  5LOZ A;  1ZBK A;  4EBA G;  2JLB A;  3PE4 A;  3BXW A;  2WXJ A;  1E8Y A;  4FHK A;  2P9I G;  3AQU A;  1N54 A;  3I4R B;  3CKB A;  4J4N A;  3AG1 E;  3UQA A;  4I1O B;  1JCR A;  1H2U A;  2GRR B;  1X6N A;  4MNL A;  4TW7 A;  2M08 A;  4GPM A;  1NSG A;  1E8X A;  1TYQ G;  4L23 A;  3ZYK A;  2FF4 A;  3CQC B;  4MNM A;  4U8Y D;  2IOL A;  2HM8 A;  4U07 A;  4BT8 A;  5BPP A;  3DXM G;  2RFM A;  3TJP A;  3CVQ A;  3D9J A;  3OA5 A;  5KNH D;  4EZL A;  2EIK E;  3KAI A;  4M3O A;  3SBT B;  4OYS A;  4FA6 A;  3B7T A;  1WY6 A;  2XGS A;  4EBA A;  3APC A;  3WL0 A;  2ZU6 B;  1MX4 A;  5BV1 A;  1Z6T A;  5BV0 A;  3IHV A;  1IQR A;  5B8I C;  2GRN B;  2VGX B;  3FTU A;  5JMN D;  4JHJ A;  1IX5 A;  3IV0 A;  4GML A;  4AY1 A;  4P8W A;  2KAT A;  3SFX A;  3TXM A;  3UI4 A;  4XX5 A;  4HRM B;  2AOS A;  3I6C A;  4RQI A;  3MA5 A;  1EDU A;  4FUL A;  1YA0 A;  5JA4 D;  4HRL A;  4N5Q A;  2ZXW E;  2WVI A;  3UPV A;  2J09 A;  1NL4 A;  3CHC A;  2IO3 C;  1L5J A;  3Q5M A;  2XP8 A;  2GRM A;  4G26 A;  3BU8 A;  5HKP A;  3QOK A;  2WM0 A;  3HVE B;  3CVN A;  3CVY A;  3WXX A;  4J8Y A;  4HOQ A;  3CK8 A;  4LSZ E;  3SFZ A;  3RK6 A;  3MJW A;  3CVL A;  4A1G A;  3P1U A;  1OWM A;  4JA9 A;  3VLD A;  5FQ8 A;  3NRK A;  4AJW A;  5D0Q D;  1FKF A;  1N95 A;  2B6C A;  3ZN3 A;  4I17 A;  3EDT B;  2V5F A;  2IOS A;  4XZ4 A;  3GYZ A;  3O48 A;  3F6Q A;  4JW1 A;  1W1Y A;  3FUM A;  4LNG A;  4TUM A;  3CVX A;  4Z2L A;  3ZPJ A;  3IHY A;  3RO3 A;  3D9L A;  2QF8 A;  2FO1 E;  1EQ3 A;  4AY6 A;  4AP2 A;  1N11 A;  3J5P A;  2BED A;  4DRQ A;  2XPB A;  3IK8 A;  3PZD A;  5AJL A;  2LSU A;  3ZGQ A;  5A23 A;  5A7D B;  5FQ6 A;  3RKV A;  1K1B A;  4K5A B;  1IYG A;  2CG2 A;  1OCO E;  3Q7A A;  4I9C A;  2LXL A;  4F7A A;  2OND A;  3APD A;  3IXE A;  1TJC A;  1SA4 A;  5J90 A;  4AIF A;  3FUJ A;  5ANL A;  5DF0 A;  3JQ0 A;  3O4Z A;  3PRE A;  1WNO A;  4EQF A;  1TNY A;  2L6B A;  4DX7 D;  3PDN A;  3DST A;  2F8X K;  2MLY A;  4JB8 P;  1LTX A;  3D9O A;  1HJW A;  3KD7 A;  2C2L A;  2QY7 A;  3OXF A;  4JHK A;  2WXG A;  2V8S E;  2P2C P;  1D2K A;  3PVL A;  1ROT A;  4HAR A;  4TYO A;  5EX0 A;  3KAF A;  2ILR A;  3AS8 A;  3JXI A;  2AWI A;  3ZHE B;  3ZXP A;  1O1S A;  4ZFH A;  1SVX A;  4G2V A;  2JAB A;  3RJV A;  3X2Q E;  1FKT A;  4WAF A;  1JNE A;  4YDE A;  1IHB A;  4P8U A;  1KFW A;  4Z2J A;  3PA7 A;  4C48 B;  2LO6 A;  4J6I A;  4HVB A;  2YHE A;  4P29 A;  4PUC A;  4WKH A;  3MV3 B;  1FD9 A;  3IEG A;  2XP6 A;  2P9U G;  4UI9 C;  3D3M A;  4WKF A;  1Y6I A;  4ILH B;  2IU1 A;  1SA5 A;  2ZQS A;  4AXH A;  2WLY A;  4RG9 A;  1FCH A;  2NC9 A;  2PL2 A;  3QKY A;  4I9E A;  3FY1 A;  4WKA A;  2UWJ G;  3LS8 A;  3ULQ A;  4DUI A;  2XCB A;  5CED B;  2MHK A;  3AAA C;  1HX8 A;  2DG9 A;  5AYW D;  2F4E A;  4HRN A;  3CKC A;  4FJZ A;  3CVP A;  2AVP A;  3ASN E;  4JL0 A;  5HS0 A;  2WXR A;  3ARW A;  3FTY A;  2WXN A;  3CGN A;  5KNG A;  4LAW A;  4WIW A;  3WQV A;  3KZ7 A;  4ODO A;  3O5D A;  3CK9 A;  4TXR A;  3NI6 A;  3O5R A;  2UZ5 A;  3WD4 A;  3B9E A;  4Z2H A;  3LY8 A;  1LQ0 A;  3B7S A;  3WD2 A;  3C5R A;  3MEK A;  1IQU A;  2PQN A;  3B9D A;  4DWS A;  1QZ2 A;  1N4S A;  5B1A E;  3B95 A;  3ZVV A;  4B0Z A;  3VTY A;  3L16 A;  5FTP A;  3C3O A;  5KJL A;  4ODL A;  1E15 A;  3FUI A;  4BET A;  3O5F A;  3MDY B;  2VGE A;  1FVH A;  5ANR A;  3AJI A;  3G2U A;  3RRN B;  5CRV A;  4U96 D;  4ANX A;  4GYY A;  5ENP D;  4KT6 B;  3VAW A;  3HIZ A;  2L0I A;  4E85 A;  1IKN D;  2KC7 A;  2WXQ A;  3P2B A;  4A3T A;  3QWV A;  2LUH A;  3UQ3 A;  4G25 A;  2ZQT A;  1SYT A;  4LCT A;  4QT2 A;  4DX1 A;  1TR4 A;  3TWX A;  4I6J A;  1GPF A;  2DVW A;  3ONK A;  3W9F A;  3UI2 A;  2Y4U A;  2J08 A;  2IFU A;  2CHX A;  2HE0 A;  4XE0 A;  1W9P A;  4DLO A;  4ML4 A;  3QK0 A;  4NNR A;  1UJJ A;  1V54 E;  3MCX A;  3PEU B;  3VLE A;  4LAV A;  3EUV A;  3KAD A;  3NZS A;  3LEW A;  2J9Q A;  3MKR A;  3KEA A;  4UI9 K;  2ZR6 A;  4Z2G A;  4DWS D;  1FKH A;  2CFU A;  3MV2 B;  5M72 A;  1JNT A;  3TWT A;  4L7T A;  3RRM B;  1NI1 A;  3TL5 A;  4S3J A;  3E32 A;  2I1K A;  5EDS A;  5AQB A;  4LER A;  2ESC A;  5CHE E;  1FFR A;  5HW7 A;  1ROU A;  3ISM C;  2HR2 A;  1R9H A;  4K5B A;  1TNZ A;  1Q6U A;  2XP3 A;  5EX3 A;  4L3N A;  5FIN A;  3Q9N C;  2OLH A;  4FJY A;  4B94 A;  1KT1 A;  3FUE A;  2H6I A;  3ASO E;  4HBO A;  2AXU A;  4DZ2 A;  3HHM A;  1YYH A;  1LD7 A;  5G04 C;  2KO7 A;  2CHW A;  4GTT A;  2P4V A;  4AVX A;  5GPG A;  4K0R A;  4URK A;  2OOE A;  4CZ2 D;  4UQZ A;  4DRH A;  3V2O A;  5DBK A;  4GZ3 A;  3EJN A;  3V79 K;  2WK2 A;  4IN3 B;  3LVQ E;  4DI3 A;  3E30 A;  4ABN A;  3LCA A;  4PDX A;  5H7P A;  1UOH A;  4QIB A;  1WAW A;  5HTG A;  2WMN A;  2LAI A;  2DZN A;  3NF1 A;  4TXQ A;  3W9G A;  2QFC A;  4DX2 A;  5CER B;  3CVW A;  2LJ4 A;  3FUL A;  3EU9 A;  1RD6 A;  3CLJ A;  1KT0 A;  2OVF A;  1KZP A;  1SZA A;  2OV8 A;  1OCR E;  5FQ4 A;  3R9M A;  1NMV A;  1JCQ A;  4DLQ A;  4F53 A;  2R59 A;  1QQE A;  4UWG A;  2MYO A;  2YHC A;  4GA0 A;  5KJK A;  4KVM A;  4J7W A;  2RUQ A;  1E7V A;  4HI9 A;  4U95 D;  3B7X A;  4W9O A;  1OUV A;  1FPP A;  2KI3 A;  1YCS B;  5IY5 E;  1S64 A;  2VQ2 A;  1DCE A;  1KPS B;  2OEW A;  2PPN A;  4HQD A;  5CCL A;  2DSU A;  5ENS D;  4JEU A;  5AAR A;  4C9B B;  4U8H A;  1NFI E;  1TN8 A;  3Q47 B;  2WXH A;  3QAQ A;  2VTB B;  3JUI A;  4UQX A;  3JYM A;  4PH4 B;  3ZXS A;  4QQI A;  3ZUV B;  4F6R D;  2AW6 A;  3Q7F A;  4DH0 A;  4ZHB A;  3LKU A;  2XRZ A;  3I5P A;  4G23 A;  4RG6 A;  3CVU A;  4CDM A;  4MAV A;  2X6K A;  4DRP A;  3U3W A;  3ALF A;  3KEZ A;  2DYR E;  3RFW A;  3LJ3 A;  5G05 J;  2I6H A;  3PNT B;  1PIN A;  3CHS A;  2MOW A;  4I1M A;  4ODR A;  1H6K A;  3BG0 B;  1FKR A;  2EQX A;  4Z2K A;  4JXT A;  3I4G A;  3Q75 A;  1ELW A;  2DZO A;  3G2W A;  2A5U A;  4N2S A;  3FP3 A;  2L9B A;  2DT1 A;  4G1T A;  1INZ A;  4GPK A;  2BF0 X;  3D9I A;  4G8K A;  3SI5 A;  2RFA A;  1KLX A;  3CHE A;  5JHA A;  1FKS A;  2YIN A;  2BKK B;  4QFV A;  1JCH B;  1TJF A;  1EYM A;  2XEV A;  2ZGG A;  3B9A A;  1HKK A;  5DO2 A;  3T5V A;  4TUU A;  4DRN A;  3NB2 A;  5AQ9 A;  2Y4T A;  4JFJ A;  3R7Q A;  2MNT A;  2DCP A;  5AAO A;  3T9K A;  2KCL A;  4OAV B;  5EKQ D;  2UY1 B;  5BXU A;  3CGH A;  2JEK A;  1GRJ A;  1W1V A;  3PZ1 A;  3OXG A;  4FC8 A;  3OXL A;  5FJY A;  2VSY A;  1MHQ A;  2WQ6 A;  2VYI A;  1HO8 A;  1JCS A;  4ODN A;  4HOU A;  3FUK A;  4NUR A;  2HO1 A;  4X8Q A;  2PM7 A;  2R02 A;  3R7R A;  2LKN A;  4JEH A;  3RSE G;  4GB9 A;  1BU9 A;  4IUL A;  3PUJ A;  3RME A;  1FVF A;  3MYV A;  3IHZ A;  1MZC A;  4FLB A;  4I6E A;  3ZHE A;  3FEY A;  3RM9 A;  3UXG A;  4GMR A;  3OOB A;  5KWD A;  1E6Z A;  3IKG A;  1S0P A;  3DEP A;  4K03 A;  3FUD A;  2FUL A;  2WPV A;  1F8A B;  2GGF A;  4FAP A;  2CG3 A;  2QYU A;  3O5K A;  5HI7 A;  1OY3 D;  1VF8 A;  2Y78 A;  3EU5 A;  3RM8 A;  2IF4 A;  4F1P A;  4HOR A;  2AWG A;  5G2N A;  2XEH A;  5B3S E;  3RGC A;  4ODM A;  3N71 A;  3UT4 A;  4BFR A;  4BES A;  4CRW A;  5BXJ A;  1MYO A;  2PM6 A;  4IT4 A;  4BWR A;  2DG4 A;  4O6F A;  2PN0 A;  4YVO A;  2XPI A;  4XIF A;  4KZC A;  2XP4 A;  3WD3 A;  3HXB A;  2VN1 A;  5LCW C;  4DK5 A;  3SQV A;  2CHZ A;  3IKD A;  1N1A A;  5G05 C;  3U4T A;  2A3E A;  1OXJ A;  2N87 A;  1EF1 C;  4GIV A;  1JUQ A;  2V4H C;  1BI8 B;  3PZ2 A;  3PRB A;  2KBX A;  4MPK A;  1AP7 A;  3DXK G;  3QOU A;  5B1B E;  4CDN A;  5C1D A;  2WM9 A;  4IQC A;  4MRU A;  2BUG A;  4L2Y A;  3FAP A;  4U0Z A;  2LSV A;  1FKG A;  4CGV A;  1BPO A;  3L9T A;  3QJZ A;  1WAO 1;  1PBK A;  4S3K A;  1LF8 A;  2KXP C;  5A6C A;  3ARU A;  3DPD A;  5GQB A;  2E0I A;  3PZ4 A;  1J6Y A;  1HXV A;  4DRK A;  3FTW A;  3RU0 A;  1H0G A;  1ZBP A;  4HBD A;  1V55 E;  4J8S A;  2XP5 A;  2X6J A;  4O1O A;  3O5J A;  1OWQ A;  1Z3X A;  3K9I A;  2BKG A;  3WH0 A;  3TWV A;  2MPH A;  4NIK A;  1ELK A;  5DIV A;  2F37 A;  4ILI A;  1X81 A;  5LP0 A;  2DWZ A;  1B89 A;  4U84 A;  3QNK A;  1LJY A;  1O1R A;  3ESK A;  5DIU A;  1OGB A;  3UF8 A;  5LFA A;  5D0O D;  3L08 A;  3IBE A;  2XHE A;  4ODP A;  1LD8 A;  3UM3 A;  2HYZ A;  2VGY A;  3ZRH A;  2ZQV A;  1BD8 A;  3KSQ A;  5CMY A;  2DG3 A;  3WQW A;  2EIM E;  5DEZ A;  4LEU A;  5CMW A;  1FKB A;  5E76 A;  3PE3 A;  4LNB A;  4HB5 A;  1E8Z A;  1O6I A;  1J4H A;  2DSZ A;  1A5E A;  1N0Q A;  3O5M A;  3SHF A;  4YDW A;  1FT1 A;  3EIJ A;  3L13 A;  4E6H A;  1EDQ A;  3PRZ A;  3S7F A;  2O9O A;  3OTN A;  5KBA A;  2DSW A;  3TWR A;  4RLY A;  2GRL A;  1YMP A;  5KCM A;  3GZ2 A;  1WB0 A;  4YVQ C;  3TWU A;  4MS6 A;  4Y6C A;  4APO A;  3ARV A;  5CCM A;  3MKQ A;  1Q6H A;  3LPZ A;  2P9K G;  2F2D A;  3NTP A;  3UQB A;  3CHP A;  2ION A;  1HXI A;  2XZT G;  3ALG A;  4JYS A;  1C9H A;  3SNX A;  3FH7 A;  2X3M A;  3G2T A;  2DT2 A;  1JWG A;  3FU6 A;  3FH8 A;  3C3R A;  3VLF A;  4U85 A;  4ME2 A;  2VTB A;  4JHR A;  4WWN A;  3EHN A;  4ZPT R;  4V3I A;  1EHN A;  5HT1 A;  4B8C B;  4AY5 A;  3C72 A;  2V4L A;  4C0M A;  3CR3 A;  2IUZ A;  1BI7 B;  3DWL G;  3CSF A;  3SGH A;  1YW5 A;  2B31 A;  3DSU A;  3Q4A B;  1UR9 A;  1SZ9 A;  4DX5 D;  4U0U A;  4Q7N A;  5AQ7 A;  3FTZ A;  3TWQ A;  4LNU D;  2PQR A;  3T5X A;  3CQG B;  2XRY A;  2XP7 A;  1QBQ A;  1KZO A;  3S7J A;  4J8E A;  1N4P A;  2AXV A;  3ONL A;  2A3A A;  3JCK C;  4GTS A;  4U0S A;  3ASG A;  3UKR G;  4EPZ A;  3PNL B;  4L9P A;  4ANU A;  5EID A;  3FU0 A;  2KR7 A;  5HRY A;  4B93 B;  3RO2 A;  1D8D A;  2YNQ A;  3TWW A;  3LYA A;  4XI0 A;  2BTD A;  3V2X A;  3GPK A;  4WK9 A;  3L6A A;  4WWO A;  3GW4 A;  2IO2 C;  3QWP A;  2PNN A;  3B7R L;  4WNF A;  3ZNG A;  4UDM A;  4J8D A;  4N5C A;  3EY6 A;  3WD0 A;  3Q73 A;  4D10 C;  3DRA A;  1ZB1 A;  3PEV B;  3MX3 A;  4CDR A;  4KR0 B;  2WMO A;  3BMB A;  2FBN A;  3UIN C;  3PZ3 A;  4NZC A;  3D9P A;  2F23 A;  4LAY A;  4UWF A;  4TW8 A;  2NXP A;  3UM1 A;  4HLE A;  2A3C A;  2MLZ A;  4XKB A;  3SY2 A;  2R5S A;  3HDX A;  2VGX A;  3B7B A;  3QWW A;  4GZ6 A;  3SF4 A;  1WG0 A;  1K8K G;  3FFL A;  2J8S D;  3H9R B;  4EHM A;  3DPY A;  1JVW A;  3JYJ A;  2GRP B;  4DI4 A;  1ZBW A;  3UI6 A;  5T3R A;  2B0O E;  1BL4 A;  4BX9 A;  3D9K A;  3AS3 A;  4BSX A;  5CBO A;  1W1P A;  2PI6 A;  2DSV A;  1ZL1 A;  2PBC A;  1Q1C A;  2L0T B;  3UMV A;  1D7H A;  3PUK A;  4G24 A;  4XKC A;  2GRO B;  3ODK A;  3PS6 A;  1EPU A;  3DEO A;  5CRU A;  2XQ0 A;  1U2V G;  1VDY A;  4AEZ C;  2OFN A;  3WL1 A;  2XCC A;  4G2P A;  2LNI A;  1ZU8 A;  3E37 A;  4XI9 A;  2B5U B;  4Q96 A;  3CHM A;  1XNF A;  5EYL A;  1H6O A;  1W9U A;  3OAW A;  4GTQ A;  5FZQ A;  3ARR A;  1PC2 A;  3O5P A;  4Y6W A;  2O92 A;  3L22 A;  1MQS A;  1NA3 A;  5KJM A;  1Y8M A;  4BER A;  5HKG A;  4W5U A;  4WJX A;  3ASH A;  5JJ7 A;  2X6F A;  3AG4 E;  5D66 A;  1RW2 A;  2QC9 A;  1E6N A;  1DC2 A;  3UTM A;  2F8Y A;  1E7U A;  1MX6 A;  4GAA A;  5LX8 A;  4ZPV R;  4G11 A;  5DIT A;  3E4B A;  4DRJ A;  1JPL A;  1M5Y A;  3CVV A;  1J4R A;  4AOF A;  2VJ8 A;  1D7I A;  2R2L A;  1TN6 A;  3B8S A;  4ACL A;  1NZN A;  3AS5 A;  1OCC E;  4NRH B;  4F3V A;  1EIB A;  4ILG A;  4BY6 A;  2QZA A;  1Z3Y A;  5BXO A;  4W9R A;  2A4Z A;  4TW6 A;  3ABL E;  3UKU G;  2Y3A A;  3U64 A;  1LL7 A;  3O5E A;  4GTO A;  4Z68 A;  3ULE G;  3CEQ A;  3KAE A;  1E96 B;  3UT7 A;  4BSZ B;  1ZK6 A;  3E34 A;  1ITX A;  1FJD A;  5ENT D;  5HBF A;  4UQY A;  2EIJ E;  4R7L A;  1P5Q A;  4JA7 A;  3KCE A;  3TDB A;  3ULY A;  2H6G A;  1N4Q A;  4FHJ A;  1W3B A;  3ENE A;  2M2A A;  2X6H A;  1N9A A;  2NYJ A;  2X6I A;  1K1A A;  4FP7 A;  2DBA A;  4O1P A;  1JWF A;  3D9N A;  4ATZ D;  3LJN A;  5GPR A;  1O5M A;  4CYM D;  4ODK A;  1N52 A;  3URZ A;  3FUF A;  2J4D A;  4JFK A;  4L2L A;  4O60 A;  5FT9 A;  4W9P A;  4I2W A;  1J4I A;  3BG1 B;  1UN9 A;  1Q6I A;  3AS0 A;  1E90 A;  2XPA A;  2CFZ A;  2DYS E;  1XHG A;  2P9N G;  3FTX A;  5CEC B;  2XS1 A;  4R0X A;  3FEX A;  4N19 A;  1U3D A;  4I1A A;  1FKK A;  3CHQ A;  3KAH A;  4GZC A;  3DSW A;  3HXC A;  4HFG A;  3WKZ A;  4EEC A;  2XEE A;  3B7U X;  1CTN A;  2KZT B;  5FWQ A;  3BEE A;  1FKI A;  4GYO A;  3BUA A;  3CHR A;  2Y69 E;  1OT8 A;  1O1T A;  4PTM A;  2ETN A;  5AQA A;  4WWP A;  2M63 A;  2A5E A;  3U9W A;  3HXD A;  5HQ8 A;  2P58 C;  4U04 A;  4HI8 A;  5HWB A;  2D9F A;  1A17 A;  3UT8 A;  5E75 A;  1NWS A;  3GZ1 A;  4N3C A;  3SZ7 A;  1RZ4 A;  1UJK A;  2GW1 A;  3ARY A;  2OEV A;  3MGB A;  1SR0 A;  4GCN A;  1FFQ A;  1N94 A;  4J4O A;  1D7J A;  2XGO A;  2K8I A;  2XEN A;  1TFV A;  3ZFW A;  4JD2 G;  4O2T A;  1HF8 A;  4A63 B;  5JJT A;  2RQS A;  1JNS A;  4DWS B;  2C0L A;  4DRO A;  3G6L A;  1F40 A;  1H2T C;  4BF8 A;  3APF A;  1GW6 A;  3GZS A;  3O5L A;  2AXZ A;  4Q22 A;  4RVB A;  1OGG A;  4U8V D;  2FEZ A;  1H6P A;  3FH5 A;  1HJV A;  3ARZ A;  3VTX A;  3ARS A;  3LUO A;  2ZGD A;  3ZYM A;  2X38 A;  1GUV A;  2ZIR A;  2GRQ B;  1N0R A;  2LPV A;  4IT6 A;  3KAB A;  5HUA A;  3CZ8 A;  2MF9 A;  2ZR4 A;  5AN8 A;  3ZYL A;  3TCZ A;  4JZY A;  4A1S A;  2PV1 A;  3UM0 A;  3ART A;  2KM4 A;  4B89 A;  3TC5 A;  2ZR5 A;  2QYJ A;  3NOG D;  1NWR A;  4MKT A;  1OWL A;  3PRD A;  3T8K A;  1QPL A;  4WND A;  5AEN A;  5CBN A;  5CEA A;  3KAC A;  3RRU A;  1ZB5 A;  4H7X A;  5EN5 D;  4GGQ A;  1PAQ A;  2WQH A;  4KZ0 A;  4BT9 A;  3CK7 A;  5ENO D;  2WXP A;  5EIL A;  1G3N B;  1E6P A;  1E8W A;  3AS4 A;  3Q78 A;  3UUX A;  3DSV A;  3Q9U C;  2A3B A;  4UWK A;  2OCC E;  3GTY X;  3UIP C;  4ZS6 A;  4DIP A;  2RUR A;  3LY7 A;  3EHQ A;  4TNS A;  5ARG A;  3ML8 A;  1GOI A;  1T11 A;  1TNO A;  1ZU2 A;  4PS7 A;  4ITZ A;  2DIW A;  1LL6 A;  4Q69 A;  1X6L A;  1Q2Z A;  3NBN B;  4GU5 A;  1TNB A;  3HVE A;  1S70 B;  5FQ7 A;  2LGO A;  2ETA A;  2WB2 A;  1NWU A;  2MLX A;  4MNK A;  3SO8 A;  3JUE A;  3U66 A;  2R05 A;  5EIB E;  4XAK A;  4BTA A;  3I3N A;  2P9P G;  4G8L A;  1E44 A;  5JH8 A;  3DBS A;  2KZT A;  2MRI A;  3AU4 A;  1AWC B;  1H0I A;  2F21 A;  3TWS A;  4Q94 A;  3HRA A;  2Y0B G;  4R5E A;  4UI9 J;  2R03 A;  2P9S G;  2DPE A;  2XZD G;  4MLP A;  1IXV A;  3UQI A;  2FDM A;  1U79 A;  5BW8 C;  3UM2 A;  1WDY A;  4GTR A;  2ZQU A;  1ELR A;  2RSE A;  1HS6 A;  4N39 A;  1H0A A;  2VSN A;  4ATG A;  5ARF A;  1HE8 A;  4J0U A;  2L6J A;  3HXE A;  4P8X A;  4HXI A;  4DJA A;  3JYS A;  4LRZ A;  3FY4 A;  3CHF A;  4EZK A;  1NH6 A;  1LL4 A;  4W9Q A;  4NAC A;  4YND A;  1TNU A;  5EYP F;  1ZCN A;  5T4Y A;  4LUN U;  3CGM A;  1NA0 A;  1H19 A;  4Z2I A;  4P8V A;  2NSZ A;  4TX0 A;  3NZU A;  1E6R A;  2V5Q C;  4DRM A;  4HLL A;  5G04 J;  2XS8 A;  4GYW A;  3TGO A;  2VSX E;  3AU5 A;  3IKO B;  4F1S A;  3AG3 E;  1D6O A;  4DRI A;  3EHM A;  2J07 A;  1D8E A;  2Q5A A;  2C0M A;  4GA1 A;  4EZJ A;  3V30 A;  1TEZ A;  2I1J A;  3GU0 A;  4NQ0 A;  1DCQ A;  3AS2 A;  5C2Y A;  2PV3 A;  3LDZ A;  4AV7 A;  1HFA A;  2ETC A;  3D9H A;  3FHE A;  4QT3 A;  3SBS A;  3PR9 A;  2WXK A;  3ASF A;  4GZ5 A;  2G41 A;  4TRQ A;  3RM4 A;  1A7X A;  2JZV A;  3QC1 A;  3S7D A;  3RIB A;  2OVB A;  1IHG A;  4C0E A;  1BLX B;  3CST A;  3SD5 A;  4H7Y A;  3C3Q A;  4GMJ A;  2KGJ A;  5AIJ A;  2IY0 C;  3S7B A;  2RKK A;  1E9L A;  2YBU A;  1WM5 A;  3ABK E;  5FZS A;  3FU3 A;  4JC8 A;  1HU3 A;  3HG0 D;  1U3C A;  3QB2 A;  1HG2 A;  2G8Z A;  4B8A A;  4DT4 A;  1HZ4 A;  1W9V A;  3B13 A;  4DZ3 A;  1OWO A;  4I43 A;  3UX4 A;  1FAP A;  4GA2 A;  1QPF A;  2WXM A;  2UY1 A;  2VCD A;  1MJ0 A;  5HW8 A;  2M1I A;  4U7E B;  4DWS C;  3ZKJ A;  2WXI A;  3Q49 B;  3G6M A;  4HS2 A;  3R9A B;  4YDO A;  3EIP A;  2WQ7 A;  2F0Y A;  5JJ6 A;  4BEP A;  1HG5 A;  5D2M C;  4UWH A;  3QAR A;  4KYO B;  4HOS A;  2EUL A;  4NSB A;  4U63 A;  3ML9 A;  4HBE A;  1XGW A;  3MZL B;  2IEJ A;  1UG3 A;  4QZV B;  4MBG A;  4M7C A; 
#chains in the Genus database with same CATH homology
 3KS2 A;  1JND A;  4LAX A;  2V0P A;  2YQ8 A;  3ZW3 A;  3O5I A;  4MTV A;  3WIJ A;  5G55 A;  4GCO A;  4FAD A;  2RUC A;  2DT3 A;  2KE0 A;  4I6G A;  4TV3 A;  1YAT A;  1NWT A;  5JHB A;  2RD0 A;  2LAH A;  2WXF A;  3PRA A;  4IQ2 A;  2IQC A;  4CT4 A;  4MNJ A;  4HOT A;  4LGX A;  1H2V C;  3CIA A;  4JVS A;  3AS1 A;  5BUZ A;  2I9C A;  1UR8 A;  3ARQ A;  4ANV A;  3FDH A;  2J49 A;  2I2O A;  1NP7 A;  4N2Q A;  2IJG X;  2DT0 A;  1W1T A;  1LG1 A;  4ANW A;  4CEM A;  4KBQ A;  3FXY A;  3W4R A;  2FI7 A;  5BNW A;  1HKM A;  3EIQ C;  3ASD A;  2FAP A;  4L1B A;  1B6C A;  4ACK A;  5LCW J;  4FLH A;  3ZIM A;  5KJN A;  3TG4 A;  3ZYQ A;  4BTB A;  3KAG A;  4PS3 A;  2RUD A;  2WXL A;  1ZBC A;  2PPP A;  4RSY A;  1K9T A;  1BKF A;  2XPY A;  4AM9 A;  3FUH A;  3LVR E;  4A55 A;  4ODQ A;  5D75 A;  4I2Z A;  1TCO C;  4IRU A;  4CCA A;  2YBT A;  3ESL A;  4JFM A;  4N3A A;  4WUY A;  3CH9 A;  2PV2 A;  3PH0 C;  3CHO A;  2ITK A;  3LY9 A;  1NMW A;  3JQ1 A;  3JXV A;  1PY1 A;  3C98 A;  4WNG A;  1FKL A;  3QDN A;  4OVU A;  4IYP A;  4URI A;  2WXO A;  1DVP A;  5ENN A;  3TXN A;  3T8M A;  1DNP A;  4PS8 A;  3NQP A;  3TAX A;  4J8F A;  1FKJ A;  4APF A;  5HW6 A;  2Q7F A;  1W26 A;  2XP9 A;  4UWL A;  3ARP A;  1ZBV A;  5J6E A;  2FO7 A;  3L17 A;  3S2A A;  3MKQ B;  4ZPW R;  3ARX A;  1LG2 A;  5DIZ A;  3CHD A;  4N3B A;  5J08 A;  2WLZ A;  2FKE A;  1XRV A;  1OWN A;  4U86 A;  2KCK A;  4KXK B;  1X5B A;  3FTV A;  3FUN A;  3O5Q A;  2RG8 A;  4FU3 A;  4WNE A;  4JPS A;  4KVO A;  5I98 A;  1SQM A;  4JFL A;  4IPX A;  2PZI A;  4MGV A;  3FU5 A;  1UW4 B;  3O5O A;  5BT1 A;  2E2E A;  3Q15 A;  4DPR A;  4L72 B;  2J4B A;  2KFW A;  3FTS A;  5T8I A;  5AJD A;  2L2S A;  3TG5 A;  2VSO E;  3HYM B;  4KMO A;  4KQZ A;  4GZD A;  1FKD A;  3WD1 A;  4JFI A;  4FN2 A;  2PPO A;  4G50 A;  3LXU X;  2KCV A;  1OWP A;  4MSP A;  2XPZ A;  3O5G A;  1L1P A;  4CGW A;  4A3V A;  1HH8 A;  4BX8 A;  1Y0O A;  3ARO A;  4CT0 A;  1HJX A;  4C02 B;  3L54 A;  3CV0 A;  1HKI A;  1UN8 A;  3D9M A;  2R17 C;  1EYH A;  3FWV A;  3ZEF A;  1QNF A;  3G2S A;  5HWC A;  3G2V A;  1HKJ A;  5FZR A;  4OVV A;  3UI5 A;  2XGM A;  5LOZ A;  1ZBK A;  4EBA G;  2JLB A;  3PE4 A;  3BXW A;  2WXJ A;  1E8Y A;  4FHK A;  3AQU A;  1N54 A;  3I4R B;  3CKB A;  4J4N A;  3UQA A;  4I1O B;  1H2U A;  1X6N A;  4MNL A;  4TW7 A;  2M08 A;  1NSG A;  1E8X A;  4L23 A;  3ZYK A;  2FF4 A;  3CQC B;  4MNM A;  2IOL A;  2HM8 A;  4U07 A;  4BT8 A;  5BPP A;  3TJP A;  3CVQ A;  3D9J A;  3OA5 A;  4EZL A;  3KAI A;  4M3O A;  3SBT B;  4OYS A;  4FA6 A;  3B7T A;  1WY6 A;  2XGS A;  4EBA A;  3APC A;  3WL0 A;  2ZU6 B;  5BV1 A;  1Z6T A;  5BV0 A;  3IHV A;  1IQR A;  5B8I C;  2VGX B;  3FTU A;  4JHJ A;  1IX5 A;  3IV0 A;  4GML A;  4AY1 A;  4P8W A;  2KAT A;  3TXM A;  3UI4 A;  4XX5 A;  2AOS A;  3I6C A;  3MA5 A;  1EDU A;  4FUL A;  1YA0 A;  2WVI A;  3UPV A;  2J09 A;  3CHC A;  1L5J A;  3Q5M A;  2XP8 A;  2GRM A;  4G26 A;  3QOK A;  2WM0 A;  3HVE B;  3CVN A;  3CVY A;  3WXX A;  4HOQ A;  3CK8 A;  3SFZ A;  3RK6 A;  3MJW A;  3CVL A;  4A1G A;  3P1U A;  1OWM A;  4JA9 A;  3VLD A;  5FQ8 A;  3NRK A;  4AJW A;  5D0Q D;  1FKF A;  3ZN3 A;  4I17 A;  3EDT B;  2V5F A;  2IOS A;  4XZ4 A;  3GYZ A;  3O48 A;  4JW1 A;  1W1Y A;  3FUM A;  3CVX A;  4Z2L A;  3ZPJ A;  3IHY A;  3RO3 A;  3D9L A;  2QF8 A;  1EQ3 A;  4AY6 A;  4AP2 A;  4DRQ A;  2XPB A;  3IK8 A;  3PZD A;  5AJL A;  2LSU A;  3ZGQ A;  5A23 A;  5A7D B;  5FQ6 A;  3RKV A;  1IYG A;  2CG2 A;  4I9C A;  4F7A A;  2OND A;  3APD A;  1TJC A;  5J90 A;  4AIF A;  3FUJ A;  5ANL A;  5DF0 A;  3JQ0 A;  3O4Z A;  3PRE A;  1WNO A;  4EQF A;  3PDN A;  2MLY A;  3D9O A;  1HJW A;  3KD7 A;  2C2L A;  2QY7 A;  3OXF A;  4JHK A;  2WXG A;  2V8S E;  1D2K A;  3PVL A;  1ROT A;  4HAR A;  4TYO A;  5EX0 A;  3KAF A;  2ILR A;  3AS8 A;  2AWI A;  3ZHE B;  4G2V A;  1FKT A;  3RJV A;  4WAF A;  1JNE A;  4P8U A;  1KFW A;  4Z2J A;  3PA7 A;  4HVB A;  2LO6 A;  4J6I A;  2YHE A;  4P29 A;  4PUC A;  4WKH A;  3MV3 B;  1FD9 A;  3IEG A;  2XP6 A;  4UI9 C;  3D3M A;  4WKF A;  1Y6I A;  4ILH B;  2IU1 A;  2ZQS A;  4AXH A;  2WLY A;  4RG9 A;  1FCH A;  2NC9 A;  2PL2 A;  3QKY A;  4I9E A;  3FY1 A;  4WKA A;  2UWJ G;  3LS8 A;  3ULQ A;  2XCB A;  2MHK A;  1HX8 A;  2DG9 A;  5AYW D;  2F4E A;  3CKC A;  4FJZ A;  3CVP A;  2AVP A;  4JL0 A;  2WXR A;  3ARW A;  3FTY A;  2WXN A;  3CGN A;  4LAW A;  4WIW A;  3WQV A;  3KZ7 A;  4ODO A;  3O5D A;  3CK9 A;  3NI6 A;  3O5R A;  2UZ5 A;  3WD4 A;  3B9E A;  4Z2H A;  3LY8 A;  1LQ0 A;  3B7S A;  3WD2 A;  3MEK A;  1IQU A;  2PQN A;  3B9D A;  4DWS A;  1QZ2 A;  3ZVV A;  4B0Z A;  3VTY A;  3L16 A;  5FTP A;  5KJL A;  4ODL A;  1E15 A;  3FUI A;  3O5F A;  3MDY B;  1FVH A;  5ANR A;  3G2U A;  3RRN B;  4ANX A;  4GYY A;  4KT6 B;  3VAW A;  3HIZ A;  2L0I A;  4E85 A;  2KC7 A;  2WXQ A;  3P2B A;  4A3T A;  3QWV A;  3UQ3 A;  4G25 A;  2ZQT A;  1SYT A;  4LCT A;  4QT2 A;  1GPF A;  4I6J A;  3ONK A;  2Y4U A;  2J08 A;  2IFU A;  2CHX A;  4XE0 A;  1W9P A;  4DLO A;  4ML4 A;  3QK0 A;  4NNR A;  1UJJ A;  3MCX A;  3PEU B;  3VLE A;  4LAV A;  3KAD A;  3NZS A;  3LEW A;  2J9Q A;  3MKR A;  4UI9 K;  2ZR6 A;  4Z2G A;  4DWS D;  1FKH A;  2CFU A;  3MV2 B;  5M72 A;  1JNT A;  4L7T A;  3RRM B;  3TL5 A;  4S3J A;  2I1K A;  5EDS A;  4LER A;  2ESC A;  5CHE E;  1FFR A;  5HW7 A;  1ROU A;  2HR2 A;  1R9H A;  1Q6U A;  2XP3 A;  5EX3 A;  4L3N A;  2OLH A;  4FJY A;  4B94 A;  1KT1 A;  3FUE A;  4HBO A;  2AXU A;  4DZ2 A;  3HHM A;  5G04 C;  2KO7 A;  2CHW A;  4AVX A;  5GPG A;  4K0R A;  4URK A;  2OOE A;  4UQZ A;  4DRH A;  5DBK A;  4GZ3 A;  3EJN A;  2WK2 A;  4IN3 B;  3LVQ E;  4DI3 A;  4ABN A;  3LCA A;  4PDX A;  4QIB A;  1WAW A;  5HTG A;  2WMN A;  2LAI A;  3NF1 A;  2QFC A;  3CVW A;  2LJ4 A;  3FUL A;  1RD6 A;  3CLJ A;  1KT0 A;  2OVF A;  1SZA A;  2OV8 A;  5FQ4 A;  1NMV A;  4DLQ A;  4F53 A;  2R59 A;  1QQE A;  4UWG A;  2YHC A;  4GA0 A;  5KJK A;  4KVM A;  2RUQ A;  1E7V A;  3B7X A;  4W9O A;  1OUV A;  2KI3 A;  2VQ2 A;  2PPN A;  5CCL A;  2DSU A;  4JEU A;  4C9B B;  4U8H A;  3Q47 B;  2WXH A;  3QAQ A;  2VTB B;  3JUI A;  4UQX A;  3JYM A;  4PH4 B;  3ZXS A;  2AW6 A;  4DH0 A;  3LKU A;  2XRZ A;  3I5P A;  4G23 A;  4RG6 A;  3CVU A;  4CDM A;  4MAV A;  2X6K A;  4DRP A;  3U3W A;  3ALF A;  3KEZ A;  3RFW A;  3LJ3 A;  5G05 J;  2I6H A;  3PNT B;  1PIN A;  3CHS A;  2MOW A;  4I1M A;  4ODR A;  1H6K A;  3BG0 B;  1FKR A;  2EQX A;  4Z2K A;  4JXT A;  3I4G A;  1ELW A;  3G2W A;  2A5U A;  4N2S A;  3FP3 A;  2L9B A;  2DT1 A;  4G1T A;  1INZ A;  4GPK A;  2BF0 X;  3D9I A;  3SI5 A;  1KLX A;  3CHE A;  5JHA A;  1FKS A;  2YIN A;  4QFV A;  1TJF A;  1EYM A;  2XEV A;  3B9A A;  1HKK A;  5DO2 A;  3T5V A;  4TUU A;  4DRN A;  2Y4T A;  4JFJ A;  3R7Q A;  2MNT A;  2DCP A;  2KCL A;  5EKQ D;  2UY1 B;  3CGH A;  2JEK A;  1W1V A;  3OXG A;  4FC8 A;  3OXL A;  5FJY A;  2VSY A;  1MHQ A;  2WQ6 A;  2VYI A;  1HO8 A;  4ODN A;  4HOU A;  3FUK A;  4NUR A;  2HO1 A;  2PM7 A;  3R7R A;  2LKN A;  4JEH A;  4GB9 A;  4IUL A;  3PUJ A;  3RME A;  1FVF A;  3MYV A;  3IHZ A;  4FLB A;  4I6E A;  3ZHE A;  3FEY A;  3RM9 A;  3OOB A;  1E6Z A;  3IKG A;  1S0P A;  4K03 A;  3FUD A;  2FUL A;  2WPV A;  1F8A B;  2GGF A;  4FAP A;  2CG3 A;  3O5K A;  5HI7 A;  1VF8 A;  2Y78 A;  3RM8 A;  2IF4 A;  4HOR A;  2AWG A;  5G2N A;  3RGC A;  4ODM A;  3N71 A;  3UT4 A;  4BFR A;  4CRW A;  5BXJ A;  2PM6 A;  4IT4 A;  4BWR A;  2DG4 A;  4O6F A;  4YVO A;  2XPI A;  4XIF A;  4KZC A;  2XP4 A;  3WD3 A;  2VN1 A;  5LCW C;  4DK5 A;  2CHZ A;  3IKD A;  1N1A A;  5G05 C;  3U4T A;  2A3E A;  2N87 A;  1EF1 C;  4GIV A;  1JUQ A;  3PRB A;  4MPK A;  3QOU A;  4CDN A;  5C1D A;  2WM9 A;  4IQC A;  4MRU A;  2BUG A;  4L2Y A;  3FAP A;  4U0Z A;  2LSV A;  1FKG A;  4CGV A;  1BPO A;  3QJZ A;  1WAO 1;  1PBK A;  4S3K A;  1LF8 A;  5A6C A;  3ARU A;  3DPD A;  5GQB A;  2E0I A;  1J6Y A;  1HXV A;  4DRK A;  3FTW A;  3RU0 A;  1H0G A;  1ZBP A;  4J8S A;  2XP5 A;  2X6J A;  3O5J A;  1OWQ A;  1Z3X A;  3K9I A;  3WH0 A;  2MPH A;  1ELK A;  5DIV A;  4ILI A;  5LP0 A;  1B89 A;  4U84 A;  3QNK A;  1LJY A;  3ESK A;  5DIU A;  1OGB A;  3UF8 A;  5LFA A;  5D0O D;  3L08 A;  3IBE A;  2XHE A;  4ODP A;  2HYZ A;  2VGY A;  3ZRH A;  2ZQV A;  5CMY A;  2DG3 A;  3WQW A;  5DEZ A;  4LEU A;  5CMW A;  1FKB A;  5E76 A;  3PE3 A;  1E8Z A;  1O6I A;  1J4H A;  2DSZ A;  3O5M A;  3SHF A;  3EIJ A;  3L13 A;  4E6H A;  1EDQ A;  3PRZ A;  3S7F A;  2O9O A;  3OTN A;  2DSW A;  2GRL A;  5KCM A;  3GZ2 A;  1WB0 A;  4YVQ C;  4MS6 A;  4Y6C A;  4APO A;  3ARV A;  5CCM A;  3MKQ A;  1Q6H A;  3LPZ A;  2F2D A;  3NTP A;  3UQB A;  3CHP A;  2ION A;  1HXI A;  3ALG A;  4JYS A;  1C9H A;  3SNX A;  3FH7 A;  2X3M A;  3G2T A;  2DT2 A;  1JWG A;  3FU6 A;  3FH8 A;  3VLF A;  4U85 A;  4ME2 A;  2VTB A;  4JHR A;  4WWN A;  3EHN A;  4ZPT R;  4V3I A;  1EHN A;  5HT1 A;  4B8C B;  4AY5 A;  2V4L A;  4C0M A;  3CR3 A;  2IUZ A;  3CSF A;  3SGH A;  1YW5 A;  2B31 A;  3Q4A B;  1UR9 A;  1SZ9 A;  4U0U A;  4Q7N A;  3FTZ A;  3T5X A;  2PQR A;  3CQG B;  2XRY A;  2XP7 A;  3S7J A;  4J8E A;  2AXV A;  3ONL A;  2A3A A;  3JCK C;  4U0S A;  3ASG A;  4EPZ A;  3PNL B;  4ANU A;  3FU0 A;  2KR7 A;  3RO2 A;  2YNQ A;  3LYA A;  4XI0 A;  2BTD A;  3GPK A;  4WK9 A;  3L6A A;  4WWO A;  3GW4 A;  3QWP A;  3B7R L;  4WNF A;  4J8D A;  4N5C A;  3EY6 A;  3WD0 A;  4D10 C;  3PEV B;  3MX3 A;  4CDR A;  4KR0 B;  2WMO A;  2FBN A;  4NZC A;  3D9P A;  4LAY A;  4UWF A;  4TW8 A;  2NXP A;  4HLE A;  2A3C A;  2MLZ A;  4XKB A;  2R5S A;  3HDX A;  2VGX A;  3QWW A;  4GZ6 A;  3SF4 A;  3FFL A;  3H9R B;  1JVW A;  3JYJ A;  4DI4 A;  1ZBW A;  3UI6 A;  5T3R A;  1BL4 A;  4BX9 A;  3D9K A;  3AS3 A;  4BSX A;  1W1P A;  2PI6 A;  2DSV A;  1ZL1 A;  2PBC A;  1Q1C A;  2L0T B;  3UMV A;  1D7H A;  3PUK A;  4G24 A;  4XKC A;  3ODK A;  3PS6 A;  1EPU A;  2XQ0 A;  1VDY A;  4AEZ C;  2OFN A;  3WL1 A;  2XCC A;  4G2P A;  2LNI A;  1ZU8 A;  4XI9 A;  4Q96 A;  3CHM A;  1XNF A;  1W9U A;  3OAW A;  5FZQ A;  3ARR A;  1PC2 A;  3O5P A;  4Y6W A;  2O92 A;  3L22 A;  1MQS A;  1NA3 A;  5KJM A;  1Y8M A;  5HKG A;  4W5U A;  4WJX A;  3ASH A;  5JJ7 A;  2X6F A;  1E6N A;  1E7U A;  4GAA A;  5LX8 A;  4ZPV R;  4G11 A;  5DIT A;  3E4B A;  4DRJ A;  1JPL A;  1M5Y A;  3CVV A;  1J4R A;  4AOF A;  2VJ8 A;  1D7I A;  3B8S A;  4ACL A;  1NZN A;  3AS5 A;  4NRH B;  4F3V A;  1EIB A;  4ILG A;  4BY6 A;  1Z3Y A;  4W9R A;  2A4Z A;  4TW6 A;  2Y3A A;  3U64 A;  1LL7 A;  3O5E A;  3CEQ A;  3KAE A;  1E96 B;  3UT7 A;  1ZK6 A;  1ITX A;  1FJD A;  5HBF A;  4UQY A;  4R7L A;  1P5Q A;  4JA7 A;  3KCE A;  3TDB A;  4FHJ A;  1W3B A;  3ENE A;  2M2A A;  2X6H A;  2X6I A;  4FP7 A;  2DBA A;  1JWF A;  3D9N A;  5GPR A;  4ODK A;  1N52 A;  3URZ A;  3FUF A;  2J4D A;  4JFK A;  4W9P A;  4L2L A;  5FT9 A;  4I2W A;  1J4I A;  3BG1 B;  1UN9 A;  1Q6I A;  3AS0 A;  1E90 A;  2XPA A;  2CFZ A;  1XHG A;  3FTX A;  4R0X A;  3FEX A;  4N19 A;  1U3D A;  4I1A A;  1FKK A;  3CHQ A;  3KAH A;  4GZC A;  4HFG A;  3WKZ A;  4EEC A;  3B7U X;  1CTN A;  2KZT B;  5FWQ A;  3BEE A;  1FKI A;  4GYO A;  3CHR A;  4PTM A;  4WWP A;  2M63 A;  3U9W A;  5HQ8 A;  2P58 C;  4U04 A;  5HWB A;  2D9F A;  1A17 A;  3UT8 A;  5E75 A;  1NWS A;  3GZ1 A;  4N3C A;  3SZ7 A;  1UJK A;  2GW1 A;  3ARY A;  3MGB A;  1SR0 A;  4GCN A;  1FFQ A;  4J4O A;  1D7J A;  2XGO A;  2K8I A;  1TFV A;  3ZFW A;  4O2T A;  1HF8 A;  5JJT A;  2RQS A;  1JNS A;  4DWS B;  2C0L A;  4DRO A;  3G6L A;  1F40 A;  1H2T C;  4BF8 A;  3APF A;  1GW6 A;  3GZS A;  3O5L A;  2AXZ A;  4Q22 A;  4RVB A;  1OGG A;  2FEZ A;  3FH5 A;  1HJV A;  3ARZ A;  3VTX A;  3ARS A;  3LUO A;  3ZYM A;  2X38 A;  1GUV A;  2LPV A;  4IT6 A;  3KAB A;  5HUA A;  3CZ8 A;  2MF9 A;  2ZR4 A;  3ZYL A;  3TCZ A;  4JZY A;  4A1S A;  2PV1 A;  3ART A;  2KM4 A;  4B89 A;  3TC5 A;  2ZR5 A;  1NWR A;  4MKT A;  1OWL A;  3PRD A;  1QPL A;  4WND A;  5AEN A;  3KAC A;  3RRU A;  1ZB5 A;  4H7X A;  4GGQ A;  1PAQ A;  2WQH A;  4KZ0 A;  4BT9 A;  3CK7 A;  2WXP A;  1E6P A;  1E8W A;  3AS4 A;  3UUX A;  2A3B A;  4UWK A;  4ZS6 A;  4DIP A;  2RUR A;  3LY7 A;  4TNS A;  5ARG A;  3ML8 A;  1GOI A;  1T11 A;  1ZU2 A;  4PS7 A;  4ITZ A;  2DIW A;  1LL6 A;  4Q69 A;  1X6L A;  4GU5 A;  3HVE A;  5FQ7 A;  2LGO A;  2WB2 A;  1NWU A;  2MLX A;  4MNK A;  3U66 A;  4XAK A;  4BTA A;  3I3N A;  5JH8 A;  3DBS A;  2KZT A;  2MRI A;  3AU4 A;  1H0I A;  2F21 A;  4Q94 A;  4R5E A;  4UI9 J;  2DPE A;  4MLP A;  3UQI A;  2FDM A;  1U79 A;  5BW8 C;  2ZQU A;  1ELR A;  2RSE A;  1HS6 A;  4N39 A;  1H0A A;  2VSN A;  4ATG A;  5ARF A;  1HE8 A;  4J0U A;  2L6J A;  4P8X A;  4HXI A;  4DJA A;  3JYS A;  4LRZ A;  3FY4 A;  3CHF A;  4EZK A;  1NH6 A;  4W9Q A;  1LL4 A;  4NAC A;  4YND A;  1ZCN A;  5T4Y A;  4LUN U;  3CGM A;  1NA0 A;  1H19 A;  4Z2I A;  4P8V A;  2NSZ A;  4TX0 A;  3NZU A;  1E6R A;  4DRM A;  5G04 J;  4GYW A;  3TGO A;  2VSX E;  3AU5 A;  3IKO B;  4F1S A;  4DRI A;  1D6O A;  3EHM A;  2J07 A;  2Q5A A;  2C0M A;  4GA1 A;  4EZJ A;  1TEZ A;  2I1J A;  4NQ0 A;  3AS2 A;  5C2Y A;  2PV3 A;  3LDZ A;  4AV7 A;  1HFA A;  3FHE A;  4QT3 A;  3SBS A;  3PR9 A;  2WXK A;  3ASF A;  4GZ5 A;  2G41 A;  4TRQ A;  3RM4 A;  1A7X A;  2JZV A;  3QC1 A;  3S7D A;  3RIB A;  2OVB A;  1IHG A;  4C0E A;  3CST A;  3SD5 A;  4H7Y A;  4GMJ A;  2KGJ A;  5AIJ A;  3S7B A;  1E9L A;  2YBU A;  1WM5 A;  5FZS A;  3FU3 A;  4JC8 A;  1HU3 A;  1U3C A;  3QB2 A;  1HG2 A;  2G8Z A;  4B8A A;  4DT4 A;  1HZ4 A;  1W9V A;  3B13 A;  4DZ3 A;  1OWO A;  4I43 A;  3UX4 A;  1FAP A;  4GA2 A;  1QPF A;  2WXM A;  2UY1 A;  2VCD A;  5HW8 A;  2M1I A;  4DWS C;  2WXI A;  3Q49 B;  3G6M A;  4HS2 A;  3R9A B;  2WQ7 A;  5JJ6 A;  1HG5 A;  4UWH A;  3QAR A;  4KYO B;  4HOS A;  4NSB A;  4U63 A;  3ML9 A;  4HBE A;  1XGW A;  3MZL B;  1UG3 A;  4QZV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...