1KT0A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
380
structure length
357
Chain Sequence
VLKIVTPMIGDKVYVHYKGKLFDSPFVFSLGKGQVIKAWDIGVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNERDRRIYANM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 51 KDA FK506-BINDING PROTEIN
publication title Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 110
structure length 357
sequence length 380
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt0A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A02
2XGOA 2ZR5A 3UI4A 5LCWC 4GCOA 1E96B 4GIVA 2KCVA 3LKUA 3O5MA 3KD7A 3OXGA 1ZU2A 4WNDA 2VGXB 2XPIA 3ASDA 3KABA 5BXJA 4XI0A 5DIVA 4GYWA 1M5YA 5EKQD 2KCKA 2C0LA 2FF4A 1F40A 3UQ3A 1QPLA 1HZ4A 5ARGA 1W26A 5HW6A 3MA5A 2OOEA 4I2WA 3MEKA 4GZ3A 4JA9A 1NMWA 4UI9J 5A6CA 2HYZA 1NMVA 2LSUA 3PE4A 4G2VA 5J6EA 1ELRA 4W9OA 1J4HA 3MDYB 2RUDA 3EY6A 4I1AA 1ZCNA 2MNTA 2Q5AA 5G05J 3TDBA 4DRJA 1ROTA 2RURA 4U84A 1FCHA 1IYGA 4TW8A 4U86A 4MSPA 4BTBA 4TYOA 5KJKA 2YHCA 1FAPA 2ZQSA 3MV2B 3E4BA 3O5RA 2XP7A 3Q5MA 4Y6WA 3QOUA 1NSGA 2DG4A 2ZQVA 5HTGA 3RU0A 2E2EA 5D75A 4G26A 3IEGA 5FT9A 1PINA 1YATA 5LCWJ 4ODRA 3HYMB 4DRHA 4YNDA 3ASFA 2FI7A 4JFJA 4ABNA 2FO7A 3O5LA 1FJDA 3U3WA 4IQCA 4BT9A 2VSNA 3LCAA 2MHKA 4BT8A 3KAFA 3CGNA 3IKDA 3RIBA 1D7IA 5HQ8A 4HOTA 4JFKA 1J4RA 1FD9A 5I98A 4N3CA 2XCBA 5BNWA 2UWJG 3K9IA 2KFWA 4DZ3A 3RO2A 4YVQC 2AWGA 1Q6IA 5DIUA 1HXIA 3GYZA 4WNFA 1Q6HA 3NRKA 2F2DA 4J8FA 3KADA 2MLZA 3S7FA 3BEEA 5HT1A 1YW5A 4N19A 1OUVA 1Q6UA 4DT4A 1BL4A 3GZ1A 2XP5A 4GZ5A 4DZ2A 5BT1A 1KT0A 5FJYA 2XP8A 3FAPA 3JYSA 1FKDA 2ZQTA 1HH8A 2KO7A 4GZ6A 4DH0A 4IN3B 1N1AA 4FAPA 2PQRA 4BWRA 5EX3A 1XNFA 1J4IA 4XI9A 2XCCA 4MGVA 2VCDA 2D9FA 2ZQUA 1WAO1 2BUGA 4DRQA 3ZPJA 3S7DA 2RSEA 2PBCA 2KGJA 4J0UA 4CGWA 3IHZA 5HI7A 1NZNA 3KAHA 2PZIA 3QWVA 3ZGQA 2XP6A 5CCLA 2NC9A 3OXFA 1FKTA 4ODQA 3TGOA 3UPVA 3ODKA 3AS4A 5HW7A 4JA7A 1KT1A 2IFUA 2KC7A 3UQBA 5FTPA 4HOUA 1TCOC 3U4TA 4GYYA 1QZ2A 1TJCA 3EDTB 4N3AA 4AIFA 3CVLA 4JHRA 3RO3A 3CV0A 4HORA 2WQHA 2V5FA 1IHGA 3SZ7A 3N71A 2UY1A 2VGYA 4GCNA 4XIFA 4I9CA 3TAXA 4LEUA 4ODNA 3FFLA 5FZSA 3O5KA 2DG3A 4QIBA 1FKFA 5FZQA 3CVNA 4GA2A 4GA0A 2XPAA 2PV2A 3CK9A 3WXXA 2XP3A 4N2QA 3UI6A 2VGXA 3IK8A 1HXVA 3AS8A 2R5SA 3VTXA 1C9HA 3GPKA 4FN2A 3LY9A 1ZBPA 1R9HA 4TX0A 3O5PA 4WUYA 4U04A 3CGMA 4GYOA 3B7XA 1JVWA 5HKGA 2LKNA 4YVOA 2J9QA 1D7JA 2F21A 2M08A 2PPNA 5DITA 3CEQA 4RG6A 3CKCA 5AYWD 1FKSA 3LY8A 3Q15A 3NF1A 4KBQA 3UQIA 3LY7A 4I2ZA 1FKBA 1NA3A 3KACA 3O5DA 1L1PA 5DIZA 3H9RB 4G24A 2Y4TA 1Y8MA 2HR2A 3S7BA 4A1SA 3GZ2A 5CCMA 4CDRA 1BKFA 2FBNA 1A17A 2QFCA 5GPGA 4UQYA 3TG5A 3KZ7A 2XGMA 2MLYA 2LSVA 2C2LA 4N3BA 4AY5A 4IQ2A 1YA0A 1T11A 1A7XA 5C1DA 2M1IA 4GPKA 3ULQA 2PPPA 2GW1A 3NI6A 4J4NA 3O5OA 4HOQA 3CVPA 4W9RA 2PPOA 3O48A 3Q47B 2C0MA 4JL0A 3RGCA 4N39A 2K8IA 4G23A 3SF4A 2L2SA 4JFLA 2VN1A 4H7XA 4EQFA 5JJ7A 2HO1A 2PV1A 4APOA 4WNEA 2Y4UA 2Y78A 3PA7A 1FKKA 3ZHEB 3QKYA 1KLXA 3KAIA 4O2TA 3JXVA 5HUAA 4NQ0A 3I6CA 3UUXA 4ME2A 4NRHB 3JYMA 4LAWA 3O5QA 4C02B 1NA0A 4R0XA 2MPHA 1FKRA 3O5FA 4O6FA 5DBKA 4G2PA 3KS2A 5D0QD 4ODPA 3LYAA 4JFMA 3ASHA 3JYJA 1U79A 2KE0A 1PBKA 4G50A 3RKVA 4IPXA 1QQEA 4UQXA 5M72A 4ODKA 4U07A 4DRNA 4QT3A 3UF8A 2PL2A 2XEVA 3CKBA 3KAEA 3GW4A 3OOBA 3VAWA 4BTAA 2RUQA 2MLXA 3AS5A 2XGSA 3R9AB 3PRDA 4U0SA 3LUOA 3PE3A 3UI5A 4U85A 1D6OA 2PQNA 3QWWA 3LPZA 3Q49B 4I9EA 2JLBA 5BW8C 4TW7A 3VTYA 5HW8A 3KAGA 3ASGA 3QDNA 3NTPA 3ESKA 1ELWA 4DRIA 3PDNA 4J4OA 1EYMA 3RFWA 3URZA 5JJTA 4ITZA 4U0UA 3KCEA 1FKHA 1JNTA 5HWBA 1ZK6A 4JFIA 5B8IC 4N2SA 5G04C 4F3VA 1FKLA 4DRPA 3MKRA 3MV3B 5KJMA 2N87A 1FKIA 1FKJA 2DBAA 5HWCA 3CK7A 2LPVA 5ARFA 3CK8A 3TC5A 2RUCA 5KJLA 1Y0OA 2KCLA 3TG4A 3WH0A 5EX0A 4GA1A 5D0OD 1WM5A 2L6JA 4HOSA 4J8DA 5KJNA 4LAVA 4KYOB 2IF4A 2UZ5A 2DG9A 4DIPA 4U0ZA 1D7HA 3TCZA 3O5GA 3ZFWA 4ODMA 2FEZA 5CHEE 2Q7FA 1B6CA 1PC2A 3Q4AB 4W9PA 1W3BA 1P5QA 2YQ8A 2XP4A 3QWPA 4DROA 4J8EA 4TW6A 4LAXA 4N5CA 2F4EA 2XPBA 3O5JA 4ODOA 2MF9A 4RG9A 2ITKA 2WPVA 4DRKA 4B94A 2LNIA 4ODLA 4AM9A 3RJVA 5FZRA 2I6HA 3FWVA 4NNRA 2RQSA 5G04J 5A7DB 2JZVA 2M2AA 1F8AB 2PV3A 4LAYA 4QT2A 4BF8A 2ZR6A 4UI9K 5JJ6A 4G1TA 4JYSA 4DRMA 3S7JA 2KI3A 2KR7A 3CVQA 2FAPA 2XP9A 2AVPA 3O5IA 1JNSA 4UI9C 4H7YA 4TNSA 1FKGA 4UQZA 4CGVA 2VQ2A 3FP3A 2KATA 3ZN3A 2FKEA 1Q1CA 2LGOA 1EQ3A 1J6YA 4WNGA 3O5EA 3PRBA 4KXKB 2LJ4A 5G05C 2ONDA 4W9QA 1QPFA 4Y6CA 4AY6A 3UQAA 2VYIA 3IKGA 3ZHEA 2ZR4A 2UY1B 1ROUA 1B89A 2OFNA 3OXLA 2VSYA 4I17A 4G25A 4GGQA 2P58C
chains in the Genus database with same CATH superfamily
2R02A 2XGOA 4ANVA 5ENRD 3UI4A 4K5BA 3IKOB 1GRJA 4GIVA 3AG1E 4F1SA 3LKUA 1O1TA 3FTYA 3MKQB 3TXMA 4WNDA 3ASDA 1UN9A 3KABA 3EU9A 3L6AA 1W9PA 3JUEA 3QARA 1S0PA 5DIVA 4YDEA 4MNKA 5EKQD 3D9OA 2B0OE 1LF8A 2DCPA 1QPLA 3CHCA 4J8SA 4GZ3A 2LXLA 1H2TC 2H6FA 4UI9J 5A6CA 2BEDA 5B1BE 2OLHA 1MX2A 2XS8A 4ZFHA 2KM4A 3EHMA 2RUDA 3UI2A 4URKA 3KSLA 4S3KA 2R17C 2MNTA 3AG4E 3WD2A 1KFWA 2ZU6B 1FCHA 4DX1A 4U84A 2X6JA 1JPLA 4TW8A 3PH0C 4U86A 1E15A 2QYJA 1FAPA 2ZQSA 2XP7A 2ETCA 3E37A 3FULA 2DG4A 4G26A 4C0EA 5FT9A 3QNKA 2LO6A 4AV7A 2B31A 4AEZC 3SHFA 3HYMB 3V31A 3ASOE 2FI7A 4ABNA 4TUUA 4FHJA 1FJDA 4IQCA 1E90A 4BT9A 2ESCA 3BUAA 3KAFA 3RIBA 2ZXWE 3V79K 1J4RA 1JCRA 5LX8A 1UR9A 4N3CA 4JPSA 2P9PG 2UWJG 3K9IA 2KFWA 1EDUA 1HJVA 1HXIA 3GYZA 3ZKJA 1S70B 2WXLA 4FHKA 1UR8A 4J8FA 3D9IA 3S7FA 4N19A 4DT4A 2CG3A 2WQ7A 1BL4A 3GZ1A 3ARWA 5JA4D 2IOSA 3BU8A 4DZ2A 5CEAA 3B7UX 1DVPA 4F53A 3C5RA 3JYSA 3BG0B 1FKDA 1JUQA 3CHSA 4FLHA 4GZ6A 2EILE 3RRNB 1E8YA 5ENNA 4ATGA 5FINA 4XI9A 2H6HA 2BUGA 1ZBKA 4ILIA 1FT1A 3S7DA 2RSEA 1K8KG 2PBCA 4JHJA 1WNOA 4B89A 3IHZA 5HI7A 1XHGA 1FPPA 4HFGA 2OVBA 3QWVA 2XP6A 3FUMA 5FQ7A 3PZ4A 3AS4A 1EPUA 3AS2A 3C98A 4JA7A 3RSEG 4HI8A 3UQBA 2IO3C 1HX8A 3AQUA 4HOUA 1TCOC 4CDNA 5KBAA 3EU5A 4IULA 4F6RD 4AIFA 4F7AA 4JHRA 4HORA 1OGGA 2WQHA 1IHGA 5HBFA 2VGYA 3G2SA 3RM9A 2AWIA 4XIFA 4I9CA 4RLYA 2XQ0A 5JHBA 5FIOA 2WMOA 4JW1A 4HRLA 1Y6IA 1QBQA 3R7QA 2VTBB 4GA0A 1YCSB 1SR0A 2XP3A 3IBEA 4OYSA 1LG1A 5KCMA 2RG8A 4TX0A 3CHMA 4LUNU 4FADA 1JCHB 2RFMA 1HF8A 3PEUB 2WLYA 1DCEA 1JVWA 3FUKA 2EINE 3LJ3A 2PPNA 4BSXA 4WWPA 3CKCA 3LY8A 3Q15A 2MRIA 3ZEFA 2X6IA 4KBQA 3CHPA 5FWQA 3D9JA 4G24A 1INZA 3AU5A 4MAVA 4CDRA 1BKFA 4P8WA 3I4RB 2G41A 4L72B 1GOIA 4UQYA 3TG5A 2LSVA 4AY5A 2QYUA 1A7XA 5C1DA 3NI6A 4J4NA 2KZTB 4W9RA 4FJZA 1HO8A 1S64A 2Y1LE 2LAHA 3HG0D 2LXMA 3L08A 1FFQA 3EHNA 1JCSA 1N4SA 3B7BA 2IONA 3WD3A 5JJ7A 1D9SA 1NWTA 4ZS6A 2PV1A 4WNEA 2Y78A 2ETBA 4BESA 1KLXA 2XZDG 4EECA 2XENA 3IXEA 1EDQA 1E7UA 2XRYA 4U8YD 1FKRA 3O5FA 5DEZA 4O6FA 4Q94A 1FVHA 3F6QA 4G50A 2IQCA 4IPXA 2IO2C 3EHRA 3HXDA 4DRNA 4DRXE 3HRAA 3KAEA 4F1PA 3ARZA 2RUQA 3AS1A 4BFRA 1K1AA 2MLXA 3AS5A 4XZ4A 2XGSA 3TJPA 4U0SA 4GTTA 3PE3A 4GTRA 3NB2A 4G11A 4U85A 2F0YA 1Z6TA 3MYVA 1D6OA 5B1AE 3G2UA 2JLBA 5E75A 5BW8C 3PVLA 3VTYA 3QDNA 5CECB 1HG2A 1EYMA 4ZPTR 3RFWA 2P9LG 4LSZE 2AXZA 3HHMA 4EZKA 4I6EA 2P9KG 1ZK6A 4JFIA 3CSFA 1MJ0A 3FEXA 4F3VA 2WXQA 3W9FA 1BI7B 1D8EA 1TNOA 2HM8A 5HWCA 4L1BA 4GPMA 3CK7A 2LPVA 3PZDA 2CFZA 3NOGD 5CRUA 5KJLA 1H19A 3JXIA 1Y0OA 2KCLA 5BV1A 3WH0A 2DT3A 4LAVA 2IF4A 4D10C 4DIPA 3ZXSA 3TCZA 3BMBA 1D8DA 2AXVA 2KXPC 5CHEE 2Q7FA 4MKTA 3W9GA 4URIA 3T8KA 3FU3A 4W9PA 1BPOA 2WM9A 2XP4A 1P5QA 2YQ8A 3QWPA 3HXBA 2F4EA 4Q7NA 2ITKA 4G8KA 2DWZA 3ENEA 3UIOC 3AAAC 4I43A 2I2OA 3DSTA 1W1TA 2M2AA 4PDXA 1E6PA 1F8AB 2DVWA 4HRMB 2A5UA 5CMYA 2WLZA 3LJNA 2J8SD 3CH9A 4FU3A 3PRZA 1SZ9A 3FTVA 4FULA 4I6GA 1JNSA 3PEVB 3P2BA 3ZYMA 4H7YA 4TNSA 4BX8A 4BY6A 4DI4A 3FP3A 1EQ3A 1IX5A 3PRBA 3HIZA 3KEAA 1VDYA 4UUCA 2GRQB 4KXKB 5ENTD 2LAIA 1UW4B 3C72A 1JCQA 1SA5A 4MRUA 4Y6CA 4C48B 3CQGB 3JXJA 3NQPA 1DNPA 2OVFA 4P8VA 3ISMC 4JZYA 2VSYA 4A3VA 1E6ZA 2EIJE 2X3MA 2P58C 4U7EB 4HXIA 2ZR5A 4GCOA 3WQWA 4DX7D 1E96B 3FUNA 2GRRB 3ARVA 2JABA 2JEKA 3O5MA 4XEIG 2WXGA 4CT4A 2AW6A 5AJLA 2VGXB 5D66A 2XPIA 3ML8A 2XEHA 4Z68A 5BXJA 4XI0A 4K0RA 4GYWA 1M5YA 2IY0C 2XPYA 3TWUA 2A3CA 1TNZA 4I1MA 2WMNA 3NAWA 4MS6A 5ARGA 1W26A 2YBUA 2OOEA 3ZUVB 4WWNA 1OCZE 4OAUC 1TFVA 4XX5A 1NMVA 3PE4A 4G2VA 3UTMA 5J6EA 1ELRA 5T4YA 2DSUA 3L22A 5ENSD 1ZB5A 4I1AA 1E6NA 5G05J 4DRJA 1ROTA 2YHEA 3PUKA 1O1SA 3EIJA 4AVXA 1MX6A 1U3CA 4O1PA 4MSPA 3Q79A 4G8LA 3UM2A 5JHAA 1SYTA 3WG7E 4PS7A 3MV2B 3CIAA 1HE8A 3TWVA 1TEZA 3QOUA 3LEWA 1OWPA 3RU0A 2I1KA 2E2EA 3UMVA 1NFIE 3IEGA 1PINA 1YATA 4ZPWR 3WL1A 3ASFA 2VGEA 4JFJA 2WXKA 3NOCD 1V54E 3O5LA 2NXPA 2J09A 2MHKA 3TWXA 3WD1A 2EIME 5HQ8A 3AG3E 4JFKA 3OA5A 1FD9A 5I98A 4L23A 1EIBA 2BF0X 5LFAA 2PM7A 3WQVA 3RO2A 4YVQC 2AWGA 2R2LA 5DIUA 3DSWA 4LG6A 3NRKA 2XEEA 3KADA 1YW5A 3B7TA 4J8YA 4IT4A 1KT0A 3PZ1A 1PY1A 2XP8A 1N9AA 3FAPA 4R5EA 3UKRG 2P9UG 4GAAA 3L54A 3SFZA 2KO7A 1YYHA 4DH0A 4XAKA 3CHQA 2CHXA 2PQRA 4Z2HA 5G2NA 1XNFA 1J4IA 1WAO1 3ZPJA 3P1UA 1H6KA 1JWGA 4J0UA 4Z2IA 3ZYLA 2PZIA 3RMEA 3ZGQA 3RK6A 4R7LA 3D9LA 4O1OA 3ODKA 5HW7A 1KT1A 3UX4A 3ALGA 2CG2A 3U4TA 3FTZA 4GYYA 1SQMA 2QZAA 3CVLA 2WXPA 3DBSA 2R05A 3RO3A 3N71A 4C9BB 2UY1A 2FDMA 2R03A 4LEUA 3PZ3A 4DWSC 3FFLA 5FZSA 2WXHA 4QIBA 3E32A 4ML4A 4HNAD 4J6IA 2WVIA 5FZQA 3NZSA 2XPAA 3CK9A 3MKQA 3B9AA 1HXVA 5JMND 3SBSA 3TL5A 3LY9A 1ZBPA 3SD5A 3O5PA 4WUYA 1OWNA 1UOHA 1MZCA 4U04A 4GYOA 4NACA 5HKGA 1N0QA 2J9QA 3O4ZA 1D7JA 3ULYA 3CEQA 4RG6A 5AYWD 4CT0A 1TN6A 1FKBA 4DK5A 1L1PA 4MNMA 4DWSD 2Y4TA 1Y8MA 3S7BA 5EYPF 2IU1A 4N5QA 3ARSA 2J4DA 2QFCA 5GPGA 4L3NA 3KZ7A 4CZ2D 3AG2E 3ESLA 3UINC 4OVVA 1YA0A 3DRAA 3CQCB 2V4LA 3FHEA 1PAQA 4HOQA 2WK2A 1SW6A 1L5JA 2H6GA 3L13A 2PPOA 3ZRHA 2XS1A 3Q47B 3Q7AA 3LXUX 5BPPA 2P9SG 4U8VD 1NWSA 4JFLA 1LD7A 4H7XA 4EBAG 4FC8A 2XPZA 2Y4UA 4HRNA 1FKKA 4L2YA 5D2MC 4IYPA 4UWHA 1UJKA 4NQ0A 4LRZA 3FUHA 2KBXA 4NRHB 3JYMA 2I1JA 3O5QA 3DSVA 3JQ0A 4CCAA 5AQ9A 3BG1B 3G2VA 2O92A 2F8YA 4HS2A 4HI9A 3B7RL 1MHQA 4JB8P 3KS2A 5D0QD 4FP7A 4JFMA 3ASHA 2DIWA 1O5MA 5KNGA 4CDMA 1N94A 4ODKA 5M72A 1LG2A 4U07A 3HDXA 1JNDA 3FUDA 4P29A 1N4PA 3GTYX 3GW4A 4BTAA 2FULA 3D3MA 3ZNGA 4BEPA 3Q49B 2L0TB 4TW7A 3PREA 2YNQA 1ELWA 1XGWA 3PDNA 4J4OA 1H0AA 4KVOA 4EZLA 4ITZA 1FKHA 5EIDA 4GGQA 4LNUD 4YDOA 1KPSB 1E7VA 4ACKA 5B8IC 4M7CA 1H0GA 2I9CA 3PS6A 2F8XK 3UM0A 1FKJA 3BXWA 5AQBA 5ARFA 5GPRA 3HVEB 5C2YA 1H6OA 1EYHA 3RRUA 5KWDA 1V55E 4K5AB 5EX0A 4Q22A 1WM5A 4Q96A 3OAWA 1ZB1A 2UZ5A 2VTBA 2DG9A 3AROA 1WDYA 1TNBA 4ODMA 5AARA 1OXJA 4C0MA 3MGBA 2J4BA 1OWOA 1PC2A 3Q4AB 3Q78A 2OEWA 3AJIA 1W3BA 3CHFA 4TW6A 2EULA 4E6HA 3ZXPA 1NWRA 4ODOA 2MF9A 3GZSA 4RG9A 5AJDA 1TN7A 5EN5D 2LNIA 5BUZA 4ODLA 1Z3YA 3RJVA 1K9TA 5FZRA 2RQSA 3CVWA 4BF8A 2ZR6A 2DZNA 2A5EA 5LOZA 4GZDA 4UI9K 5KNHD 4JYSA 4DRMA 3S7JA 1ZL1A 2KR7A 4PS3A 3CVQA 5JH8A 3J5QB 3O5IA 1U3DA 2OV8A 2AXUA 2KZTA 1FKGA 2L6BA 1NP7A 2E0IA 2VQ2A 2L0IA 3DSSA 2LGOA 2GRMA 4WNGA 5BXOA 3KEZA 3NZUA 3FH8A 2LJ4A 1QYMA 4Z2GA 4WJXA 3ABLE 1SVXA 1TYQG 1QPFA 4WAFA 2V0PA 3UQAA 2VYIA 3FH5A 2ZR4A 3IKGA 2WXMA 5HKPA 3OXLA 2YBTA 3LVQE 3IKDA 3HXEA 2ZIRA 1ZBCA 2L9BA 5ANLA 5LCWC 5CBOA 1ZU2A 4I6JA 1O1RA 5B3SE 4GTOA 3EIQC 3V2XA 1F40A 3UQ3A 3DEPA 2J08A 1HZ4A 1OCOE 5CBNA 5HW6A 3MEKA 4JA9A 2HYZA 5FQ6A 3CVUA 2PI6A 2RD0A 4S3JA 3KSQA 3PRAA 4W9OA 1J4HA 3E30A 3EY6A 3L82A 1HJWA 1ZCNA 1EHNA 3FY1A 4MTVA 4IT6A 1IYGA 5CRVA 4MPKA 4BTBA 4TYOA 5AQ7A 4NIKA 5KJKA 3CGHA 5BXUA 4GMJA 3Q5MA 4Y6WA 5T3RA 3UKUG 1NSGA 4A55A 5D75A 2A3EA 2H6IA 3T9KA 4ODRA 4DRHA 4HB5A 4YNDA 4JD2G 4TXPA 4RQIA 2IJGX 3T5VA 2GGFA 3U3WA 2VSNA 3LCAA 4BT8A 4B8CB 3CHEA 2XRZA 2XCBA 1WAWA 3CLJA 1K1BA 1X6NA 4DZ3A 4JEUA 2GRNB 4NURA 1HKKA 5EDSA 1RD6A 4WNFA 1Q6HA 2F2DA 1FT2A 2MLZA 1DC2A 3BEEA 3U64A 4L2LA 1IQUA 1Q6UA 4BETA 1HKIA 2GROB 2P2CP 3AS0A 1BD8A 1NH6A 4B0ZA 1Z3XA 3FTSA 3CHRA 3ONKA 4GTVA 1LL4A 2BTDA 2ZQTA 4GU5A 1IXVA 5T8IA 3R9MA 5ANRA 4BWRA 1X6LA 4DWSB 2PNNA 2XCCA 4QFVA 3SY2A 2IUZA 2D9FA 2DYRE 4DRQA 3G2WA 4GTQA 2DT2A 4YDWA 1HKMA 2KGJA 3FDHA 4DLOA 3FU6A 3LVRE 1NZNA 1KZOA 1IQRA 1OWMA 5CCLA 2NC9A 3OXFA 4TXRA 4ODQA 3TGOA 3ARYA 2KC7A 1TJCA 4N3AA 3DSXA 2V5FA 3SZ7A 1GPFA 1LL6A 4I1OB 1AP7A 4CYMD 4MBGA 3EUVA 3O5KA 3WIJA 1FKFA 2V8SE 2DZOA 2GRLA 3CVNA 2PV2A 4DPRA 3WXXA 4ZPVR 3B9DA 4N2QA 2VGXA 4FJYA 3IK8A 2FO1E 1E9LA 2R5SA 4BSZB 1RZ4A 3VTXA 4FLBA 2AOSA 3GPKA 1R9HA 3SNXA 4JXTA 4UWLA 3B7XA 2LKNA 2DSZA 4ANUA 3TWRA 3V30A 4HVBA 4EPZA 3U66A 1FKSA 4UDMA 3NF1A 4RVBA 1NA3A 3J5PA 4ATZD 5EYLA 4NSBA 4BERA 1N4RA 2HR2A 1FVFA 4P8UA 2FBNA 4CEMA 5DF0A 4JC8A 2XGMA 2MLYA 2C2LA 4N3BA 3UT8A 1T11A 3APDA 5E76A 3RRMB 4AJWA 3L9TA 3I3NA 1UG3A 3TWTA 5CMWA 3FU0A 3FU5A 2C0MA 4JL0A 2K8IA 4XKBA 4G23A 5FQ8A 4OAVB 1X5BA 3JCKC 1W1PA 2A4ZA 2VN1A 4MLPA 4Z2KA 4APOA 3V2OA 1Z5SC 3SO8A 4GB9A 3ZHEB 3Q9NC 3KAIA 4O2TA 3JXVA 2HE0A 4GTPA 4GTMA 4EBAA 3I6CA 2LUHA 3RAUA 2M63A 4WKFA 1RW2A 3QC1A 3FUIA 1OY3D 3EJNA 3PZ2A 3Q7FA 5DBKA 2NSZA 4LERA 5BV0A 3ZYKA 3LYAA 3JYJA 3DXKG 1U79A 3RKVA 4J7WA 1QQEA 4UQXA 4MNLA 2CHZA 1OWLA 1SZAA 4EHMA 1N4QA 4QT3A 2X38A 3UF8A 4JVSA 2DSVA 4MNJA 2EQXA 2GRPB 5GQBA 3AU4A 3X2QE 4QZVB 3LUOA 2ZGDA 3LPZA 3ZW3A 4V3IA 3QOKA 1E8WA 4BX9A 1OWQA 4NZCA 1X81A 3NTPA 3ASGA 3ESKA 3G6LA 4UWGA 3URZA 2VSXE 1ELKA 3KCEA 4WWOA 4PH4B 5HWBA 3DPDA 4WIWA 3Q75A 4KQZA 5G04C 4XE0A 1FKLA 3MV3B 5KJMA 5J08A 3SGHA 3CK8A 3TC5A 1HS6A 4KZCA 3R7RA 4DX6D 1AWCB 3ASNE 1K3ZD 4QQIA 3ABME 4GA1A 5D0OD 2IEJA 3G6MA 4HOSA 5KJNA 1ITXA 1H2UA 4KYOB 4CRWA 1JWFA 3FEYA 2DSWA 3CVXA 1A5EA 1D7HA 3O5GA 3ZFWA 2Y3AA 3PUJA 5EILA 4K03A 3BQOA 4UWKA 1B6CA 3UT4A 2RFAA 5AN8A 2ETNA 4DROA 4J8EA 5EIBE 1BU9A 4L9PA 4LAXA 4N5CA 3T5XA 3O5JA 2WPVA 4JEHA 4DRKA 2I6HA 3FWVA 4NNRA 2PV3A 4QT2A 1S63A 2MOWA 3W4RA 2CHWA 3TWQA 5JJ6A 3D9MA 3CVYA 1GUVA 2KI3A 1LTXA 3QAQA 4B93B 2FAPA 3B8SA 2AVPA 1O6IA 3ZU7B 3QB2A 4UI9C 4UQZA 1W9UA 4CGVA 3HXFA 2KATA 3APCA 1J6YA 3WD4A 2F23A 3O5EA 4TUMA 2WXOA 5HS0A 3C3OA 4W9QA 5DO2A 5LP0A 4AY6A 2BKGA 3CHDA 2EIKE 4AOFA 2X6FA 2QC9A 3TWSA 3RM4A 3FTUA 1XRVA 2KCVA 3SFYA 4RSYA 3KD7A 3OXGA 3ML9A 4HLLA 2P9NG 3APFA 2DT0A 4LNGA 3DXMG 2KCKA 2C0LA 2FF4A 3MJWA 3SQVA 3TXNA 2ZISA 4GZCA 3MA5A 1U2VG 4I2WA 4ILHB 5ITZF 4E85A 1NMWA 2WXRA 2LSUA 3ZVVA 2J07A 2VSOE 4LNBA 1N11A 1UN8A 3ALFA 3MDYB 3B9EA 4Q69A 2Q5AA 3TDBA 4UWFA 2RURA 3FUFA 2WB2A 4DI3A 1UJJA 3WD0A 2YHCA 1HJXA 3UIPC 3E4BA 3O5RA 4HARA 1E8ZA 2ZQVA 3Q9UC 5HTGA 4HLEA 4TXQA 5LCWJ 4XKCA 2F37A 4KZ0A 4GMLA 4K5CA 4A3TA 4ZHBA 4ILGA 3HVEA 2FO7A 2AJAA 3CGNA 1D7IA 4PTMA 3JQ1A 4HOTA 3FY4A 2V4HC 2RKKA 5BNWA 1OT8A 2XHEA 3UXGA 4KR0B 3SI5A 3MX3A 1Q6IA 4FA6A 2B6CA 2X6KA 3B13A 5HT1A 1OUVA 1IKND 2XP5A 4GZ5A 3AS3A 2ETAA 5BT1A 5FJYA 4WKAA 1W1VA 4U95D 3ZIMA 3C3RA 3U9WA 3S2AA 4DLQA 1ZU8A 1HH8A 3ULEG 2A3AA 2QY7A 4IN3B 1GW6A 1N1AA 4FAPA 2ILRA 2ZGGA 4KMOA 5EX3A 3MCXA 4MGVA 4WKHA 2VCDA 2ZQUA 1E6RA 4DUIA 2WXIA 4CGWA 5G55A 2DPEA 2PN0A 3ARTA 3KAHA 3I5PA 2X6HA 3RM8A 1FKTA 3UPVA 3VLDA 2J49A 3IV0A 1HG5A 1LL7A 2IFUA 2WXFA 5FTPA 1QZ2A 3FTWA 2YINA 3SFXA 3EDTB 4TRQA 3CV0A 1TJFA 4APFA 5CEDB 5IY5E 3WKZA 4JHKA 1HKJA 4ANWA 4GCNA 3TAXA 4PUCA 2CFUA 4ODNA 1H0IA 3ABKE 4ANXA 2MYOA 2DG3A 3FTXA 4GA2A 4YDYA 3FUJA 3UI6A 3DPYA 3AS8A 5ENOD 1C9HA 4FN2A 3JUIA 5AQAA 1N52A 5J90A 3CGMA 4EZJA 1ZBWA 4YVOA 1MQSA 2DYSE 4A1GA 5A23A 2F21A 2M08A 5HRYA 5DITA 3FXYA 4M3OA 3QJZA 3WL0A 3UQIA 3LY7A 4I2ZA 3KACA 3O5DA 3PNTB 3ARRA 5DIZA 3H9RB 4DJAA 3DEOA 3MZLB 4A1SA 3GZ2A 3FUEA 5CCMA 3E34A 3ARQA 1A17A 3EIPA 4KT6B 3OTNA 4IQ2A 1N0RA 1BLXB 2M1IA 4GPKA 3ULQA 2PPPA 2GW1A 4AXHA 3O5OA 3CVPA 1OGBA 2XZTG 3O48A 3RGCA 4N39A 3T8MA 3SF4A 1E44A 2L2SA 2PM6A 4DX5D 3EHQA 4HBDA 1YMPA 2WQ6A 4EQFA 2HO1A 1LJYA 3GU0A 1BI8B 3PA7A 3QKYA 4AP2A 3ARPA 5HUAA 3D9KA 3UUXA 4ME2A 4LAWA 2QF8A 4C02B 1NA0A 4R0XA 3ARUA 2MPHA 3ZYQA 4IRUA 4GMRA 4G2PA 1TNYA 3L16A 4DX2A 4A63B 3C3QA 4ODPA 2P9IG 3VLFA 2KE0A 4Z2JA 1TR4A 2OCCE 3DSUA 1PBKA 1W9VA 1E8XA 1FFRA 1TN8A 3E33A 2PL2A 2XEVA 3CKBA 4LGXA 1WB0A 3LDZA 3OOBA 3VAWA 4HQDA 1DCQA 2P4VA 3CZ8A 3R9AB 3PRDA 4DWSA 1IHBA 3UI5A 3PR9A 3UM1A 2PQNA 4AY1A 5AIJA 3QWWA 2G8ZA 4Z2LA 4I9EA 3VLEA 5AENA 1HFAA 2V5QC 4U63A 3KAGA 5HW8A 3G2TA 4DRIA 3UM3A 2WM0A 5H7PA 3I4GA 3IHVA 3TWWA 5JJTA 1Q2ZA 1QNFA 1TNUA 4U0UA 4PS8A 1OCCE 1JNTA 3CHOA 1KZPA 4N2SA 3Q73A 2Y69E 1H2VC 1HU3A 3MKRA 1VF8A 2N87A 4DRPA 4LCTA 1FKIA 2DBAA 1NWUA 3CVVA 4WK9A 1LQ0A 2RUCA 3IHYA 3TG4A 5FQ4A 3B95A 3NBNB 3DWLG 1MX4A 4HBOA 2L6JA 4J8DA 2B5UB 1NI1A 1N95A 4U0ZA 2DT1A 2FEZA 4L7TA 1H6PA 3HXCA 4O60A 2O9OA 3ONLA 4U96D 5CERB 3D9NA 2Y0BG 3L17A 2VJ8A 4OVUA 2XPBA 3CSTA 2R59A 4B94A 4B8AA 1ZBVA 5AAOA 4X8QA 4AM9A 2NYJA 5G04J 5A7DB 2JZVA 4LAYA 2WXNA 4W5UA 3UT7A 4G1TA 1LD8A 1MYOA 4TV3A 2IOLA 2XP9A 3D9HA 3D9PA 5ENQD 4ACLA 3LS8A 3ZN3A 2FKEA 1Q1CA 1NL4A 3CR3A 3QK0A 3ARXA 5G05C 1WG0A 2OEVA 2A3BA 4GTSA 1WY6A 2ONDA 1OCRE 2WXJA 4KVMA 2BKKB 1JNEA 1G3NB 1EF1C 5ENPD 3B7SA 3ZHEA 1D2KA 4HBEA 2UY1B 1ROUA 1SA4A 3PNLB 1B89A 4U8HA 1W1YA 2OFNA 1CTNA 1N54A 4I17A 3FH7A 4P8XA 4G25A 3SBTB
chains in the Genus database with same CATH topology
2XGOA 4ANVA 3UI4A 3IKOB 4GIVA 4F1SA 3LKUA 3FTYA 3MKQB 3TXMA 4WNDA 3ASDA 1UN9A 3KABA 3L6AA 1W9PA 3QARA 1S0PA 5DIVA 4MNKA 5EKQD 3D9OA 1LF8A 2DCPA 1QPLA 3CHCA 4J8SA 4GZ3A 1H2TC 4UI9J 5A6CA 2OLHA 2KM4A 3EHMA 2RUDA 4URKA 4S3KA 2R17C 2MNTA 3WD2A 1KFWA 2ZU6B 1FCHA 4U84A 2X6JA 1JPLA 4TW8A 3PH0C 4U86A 1E15A 1FAPA 2ZQSA 2XP7A 3FULA 2DG4A 4G26A 4C0EA 5FT9A 3QNKA 2LO6A 4AV7A 2B31A 4AEZC 3SHFA 3HYMB 2FI7A 4ABNA 4TUUA 4FHJA 1FJDA 4IQCA 1E90A 4BT9A 2ESCA 3KAFA 3RIBA 1J4RA 5LX8A 1UR9A 4N3CA 4JPSA 2UWJG 3K9IA 2KFWA 1EDUA 1HJVA 1HXIA 3GYZA 2WXLA 4FHKA 1UR8A 4J8FA 3D9IA 3S7FA 4N19A 4DT4A 2CG3A 2WQ7A 1BL4A 3GZ1A 3ARWA 2IOSA 4DZ2A 3B7UX 1DVPA 4F53A 3JYSA 3BG0B 1FKDA 1JUQA 3CHSA 4FLHA 4GZ6A 3RRNB 1E8YA 5ENNA 4ATGA 4XI9A 2BUGA 1ZBKA 4ILIA 3S7DA 2RSEA 2PBCA 4JHJA 1WNOA 4B89A 3IHZA 5HI7A 1XHGA 4HFGA 2OVBA 3QWVA 2XP6A 3FUMA 5FQ7A 3AS4A 1EPUA 3AS2A 3C98A 4JA7A 3UQBA 1HX8A 3AQUA 4HOUA 1TCOC 4CDNA 4IULA 4F7AA 4AIFA 4JHRA 4HORA 1OGGA 2WQHA 1IHGA 5HBFA 2VGYA 3G2SA 3RM9A 2AWIA 4XIFA 4I9CA 2XQ0A 5JHBA 2WMOA 4JW1A 1Y6IA 2VTBB 3R7QA 4GA0A 1SR0A 2XP3A 3IBEA 4OYSA 1LG1A 5KCMA 2RG8A 4TX0A 3CHMA 4LUNU 4FADA 1HF8A 3PEUB 2WLYA 1JVWA 3FUKA 3LJ3A 2PPNA 4BSXA 4WWPA 3CKCA 3LY8A 3Q15A 2MRIA 3ZEFA 2X6IA 4KBQA 3CHPA 5FWQA 3D9JA 4G24A 1INZA 3AU5A 4MAVA 4CDRA 1BKFA 4P8WA 3I4RB 2G41A 4L72B 1GOIA 4UQYA 3TG5A 2LSVA 4AY5A 1A7XA 5C1DA 3NI6A 4J4NA 2KZTB 4W9RA 4FJZA 1HO8A 2LAHA 3L08A 1FFQA 3EHNA 2IONA 3WD3A 5JJ7A 1NWTA 4ZS6A 2PV1A 4WNEA 2Y78A 1KLXA 4EECA 1EDQA 1E7UA 2XRYA 1FKRA 3O5FA 5DEZA 4O6FA 4Q94A 1FVHA 4G50A 2IQCA 4IPXA 4DRNA 3KAEA 3ARZA 2RUQA 3AS1A 4BFRA 2MLXA 3AS5A 4XZ4A 2XGSA 3TJPA 4U0SA 3PE3A 4G11A 4U85A 1Z6TA 3MYVA 1D6OA 3G2UA 2JLBA 5E75A 5BW8C 3PVLA 3VTYA 3QDNA 1HG2A 1EYMA 4ZPTR 3RFWA 2AXZA 3HHMA 4EZKA 4I6EA 1ZK6A 4JFIA 3CSFA 3FEXA 4F3VA 2WXQA 2HM8A 5HWCA 4L1BA 3CK7A 2LPVA 3PZDA 2CFZA 5KJLA 1H19A 1Y0OA 2KCLA 5BV1A 3WH0A 2DT3A 4LAVA 2IF4A 4D10C 4DIPA 3ZXSA 3TCZA 2AXVA 5CHEE 2Q7FA 4MKTA 4URIA 3FU3A 4W9PA 1BPOA 2WM9A 2XP4A 1P5QA 2YQ8A 3QWPA 2F4EA 4Q7NA 2ITKA 3ENEA 4I43A 2I2OA 1W1TA 2M2AA 4PDXA 1E6PA 1F8AB 2A5UA 5CMYA 2WLZA 3CH9A 4FU3A 3PRZA 1SZ9A 3FTVA 4FULA 4I6GA 1JNSA 3PEVB 3P2BA 3ZYMA 4H7YA 4TNSA 4BX8A 4BY6A 4DI4A 3FP3A 1EQ3A 1IX5A 3PRBA 3HIZA 1VDYA 4KXKB 2LAIA 1UW4B 4MRUA 4Y6CA 3CQGB 3NQPA 1DNPA 2OVFA 4P8VA 4JZYA 2VSYA 4A3VA 1E6ZA 2X3MA 2P58C 4HXIA 2ZR5A 4GCOA 3WQWA 1E96B 3FUNA 3ARVA 2JEKA 3O5MA 2WXGA 4CT4A 2AW6A 5AJLA 2VGXB 2XPIA 3ML8A 5BXJA 4XI0A 4K0RA 4GYWA 1M5YA 2XPYA 2A3CA 4I1MA 2WMNA 4MS6A 5ARGA 1W26A 2YBUA 2OOEA 4WWNA 1TFVA 4XX5A 1NMVA 3PE4A 4G2VA 5J6EA 1ELRA 5T4YA 2DSUA 3L22A 1ZB5A 4I1AA 1E6NA 5G05J 4DRJA 1ROTA 2YHEA 3PUKA 3EIJA 4AVXA 1U3CA 4MSPA 5JHAA 1SYTA 4PS7A 3MV2B 3CIAA 1HE8A 1TEZA 3QOUA 3LEWA 1OWPA 3RU0A 2I1KA 2E2EA 3UMVA 3IEGA 1PINA 1YATA 4ZPWR 3WL1A 3ASFA 4JFJA 2WXKA 3O5LA 2NXPA 2J09A 2MHKA 3WD1A 5HQ8A 4JFKA 3OA5A 1FD9A 5I98A 4L23A 1EIBA 2BF0X 5LFAA 2PM7A 3WQVA 3RO2A 4YVQC 2AWGA 5DIUA 3NRKA 3KADA 1YW5A 3B7TA 4IT4A 1KT0A 1PY1A 2XP8A 3FAPA 4R5EA 4GAAA 3L54A 3SFZA 2KO7A 4DH0A 4XAKA 3CHQA 2CHXA 2PQRA 4Z2HA 5G2NA 1XNFA 1J4IA 1WAO1 3ZPJA 3P1UA 1H6KA 1JWGA 4J0UA 4Z2IA 3ZYLA 2PZIA 3RMEA 3ZGQA 3RK6A 4R7LA 3D9LA 3ODKA 5HW7A 1KT1A 3UX4A 3ALGA 2CG2A 3U4TA 3FTZA 4GYYA 1SQMA 3CVLA 2WXPA 3DBSA 3RO3A 3N71A 4C9BB 2UY1A 2FDMA 4LEUA 4DWSC 3FFLA 5FZSA 2WXHA 4QIBA 4ML4A 4J6IA 2WVIA 5FZQA 3NZSA 2XPAA 3CK9A 3MKQA 3B9AA 1HXVA 3SBSA 3TL5A 3LY9A 1ZBPA 3SD5A 3O5PA 4WUYA 1OWNA 4U04A 4GYOA 4NACA 5HKGA 2J9QA 3O4ZA 1D7JA 3CEQA 4RG6A 5AYWD 4CT0A 1FKBA 4DK5A 1L1PA 4MNMA 4DWSD 2Y4TA 1Y8MA 3S7BA 2IU1A 3ARSA 2J4DA 2QFCA 5GPGA 4L3NA 3KZ7A 3ESLA 4OVVA 1YA0A 3CQCB 2V4LA 3FHEA 1PAQA 4HOQA 2WK2A 3L13A 1L5JA 2PPOA 3ZRHA 3Q47B 3LXUX 5BPPA 1NWSA 4JFLA 4H7XA 4EBAG 4FC8A 2XPZA 2Y4UA 1FKKA 4L2YA 4IYPA 4UWHA 1UJKA 4NQ0A 4LRZA 3FUHA 4NRHB 3JYMA 2I1JA 3O5QA 3JQ0A 4CCAA 3BG1B 3G2VA 2O92A 4HS2A 3B7RL 1MHQA 3KS2A 5D0QD 4FP7A 4JFMA 3ASHA 2DIWA 4CDMA 4ODKA 5M72A 1LG2A 4U07A 3HDXA 1JNDA 3FUDA 4P29A 3GW4A 4BTAA 2FULA 3D3MA 3Q49B 2L0TB 4TW7A 3PREA 2YNQA 1ELWA 1XGWA 3PDNA 4J4OA 1H0AA 4KVOA 4EZLA 4ITZA 1FKHA 4GGQA 5B8IC 1E7VA 4ACKA 1H0GA 2I9CA 3PS6A 1FKJA 3BXWA 5ARFA 5GPRA 3HVEB 5C2YA 1EYHA 3RRUA 5EX0A 4Q22A 1WM5A 4Q96A 3OAWA 2UZ5A 2VTBA 2DG9A 3AROA 4ODMA 4C0MA 3MGBA 2J4BA 1OWOA 1PC2A 3Q4AB 1W3BA 3CHFA 4TW6A 4E6HA 1NWRA 4ODOA 2MF9A 3GZSA 4RG9A 5AJDA 2LNIA 5BUZA 4ODLA 1Z3YA 3RJVA 1K9TA 5FZRA 2RQSA 3CVWA 4BF8A 2ZR6A 5LOZA 4GZDA 4UI9K 4JYSA 4DRMA 3S7JA 1ZL1A 2KR7A 3CVQA 4PS3A 5JH8A 3O5IA 1U3DA 2OV8A 2AXUA 2KZTA 1FKGA 1NP7A 2E0IA 2VQ2A 2L0IA 2LGOA 2GRMA 4WNGA 3KEZA 3NZUA 3FH8A 2LJ4A 4Z2GA 4WJXA 1QPFA 4WAFA 2V0PA 3UQAA 2VYIA 3FH5A 2ZR4A 3IKGA 2WXMA 3OXLA 2YBTA 3LVQE 3IKDA 1ZBCA 2L9BA 5ANLA 5LCWC 1ZU2A 4I6JA 3EIQC 1F40A 3UQ3A 2J08A 1HZ4A 5HW6A 3MEKA 4JA9A 2HYZA 5FQ6A 3CVUA 2PI6A 2RD0A 4S3JA 3PRAA 4W9OA 1J4HA 3EY6A 1HJWA 1ZCNA 1EHNA 3FY1A 4MTVA 4IT6A 1IYGA 4MPKA 4BTBA 4TYOA 5KJKA 3CGHA 4GMJA 3Q5MA 4Y6WA 5T3RA 1NSGA 4A55A 5D75A 2A3EA 4ODRA 4DRHA 4YNDA 2IJGX 3T5VA 2GGFA 3U3WA 2VSNA 3LCAA 4BT8A 4B8CB 3CHEA 2XRZA 2XCBA 1WAWA 3CLJA 4DZ3A 1X6NA 4JEUA 1HKKA 4NURA 5EDSA 1RD6A 4WNFA 1Q6HA 2F2DA 2MLZA 3BEEA 3U64A 4L2LA 1IQUA 1Q6UA 1HKIA 3AS0A 1NH6A 4B0ZA 1Z3XA 3FTSA 3CHRA 3ONKA 1LL4A 2BTDA 2ZQTA 4GU5A 5T8IA 5ANRA 4BWRA 1X6LA 4DWSB 2XCCA 4QFVA 2IUZA 2D9FA 4DRQA 3G2WA 2DT2A 1HKMA 2KGJA 3FDHA 4DLOA 3FU6A 3LVRE 1NZNA 1IQRA 1OWMA 5CCLA 2NC9A 3OXFA 4ODQA 3TGOA 3ARYA 2KC7A 1TJCA 4N3AA 2V5FA 3SZ7A 1GPFA 1LL6A 4I1OB 3O5KA 3WIJA 1FKFA 2V8SE 3CVNA 2GRLA 2PV2A 4DPRA 3WXXA 4ZPVR 3B9DA 4N2QA 2VGXA 4FJYA 3IK8A 1E9LA 2R5SA 3VTXA 4FLBA 2AOSA 3GPKA 1R9HA 3SNXA 4JXTA 4UWLA 3B7XA 2LKNA 2DSZA 4ANUA 4HVBA 4EPZA 3U66A 1FKSA 3NF1A 4RVBA 1NA3A 4NSBA 2HR2A 1FVFA 4P8UA 2FBNA 4CEMA 5DF0A 4JC8A 2XGMA 2MLYA 2C2LA 4N3BA 3UT8A 1T11A 3APDA 5E76A 3RRMB 4AJWA 3I3NA 1UG3A 5CMWA 3FU0A 3FU5A 2C0MA 4JL0A 2K8IA 4XKBA 4G23A 5FQ8A 1X5BA 3JCKC 1W1PA 2A4ZA 2VN1A 4MLPA 4Z2KA 4APOA 4GB9A 3ZHEB 3KAIA 4O2TA 3JXVA 4EBAA 3I6CA 2M63A 4WKFA 3QC1A 3FUIA 3EJNA 5DBKA 2NSZA 4LERA 5BV0A 3ZYKA 3LYAA 3JYJA 1U79A 3RKVA 1QQEA 4UQXA 4MNLA 2CHZA 1OWLA 1SZAA 4QT3A 2X38A 3UF8A 4JVSA 2DSVA 4MNJA 2EQXA 5GQBA 3AU4A 4QZVB 3LUOA 3LPZA 3ZW3A 4V3IA 3QOKA 4BX9A 1OWQA 1E8WA 4NZCA 3NTPA 3ASGA 3ESKA 3G6LA 4UWGA 3URZA 2VSXE 1ELKA 3KCEA 4WWOA 4PH4B 5HWBA 3DPDA 4WIWA 4KQZA 5G04C 4XE0A 1FKLA 3MV3B 5KJMA 5J08A 3SGHA 3CK8A 3TC5A 1HS6A 4KZCA 3R7RA 4GA1A 5D0OD 3G6MA 4HOSA 5KJNA 1ITXA 1H2UA 4KYOB 4CRWA 1JWFA 3FEYA 2DSWA 3CVXA 1D7HA 3O5GA 3ZFWA 2Y3AA 3PUJA 4K03A 4UWKA 1B6CA 3UT4A 4DROA 4J8EA 4LAXA 4N5CA 3T5XA 3O5JA 2WPVA 4JEHA 4DRKA 2I6HA 3FWVA 4NNRA 2PV3A 4QT2A 2MOWA 3W4RA 2CHWA 5JJ6A 3D9MA 3CVYA 1GUVA 2KI3A 3QAQA 2FAPA 3B8SA 2AVPA 1O6IA 3QB2A 4UI9C 4UQZA 1W9UA 4CGVA 2KATA 3APCA 1J6YA 3WD4A 3O5EA 2WXOA 4W9QA 5DO2A 5LP0A 4AY6A 3CHDA 4AOFA 2X6FA 3RM4A 3FTUA 1XRVA 2KCVA 4RSYA 3KD7A 3OXGA 3ML9A 3APFA 2DT0A 2KCKA 2C0LA 2FF4A 3MJWA 3TXNA 4GZCA 3MA5A 4I2WA 4ILHB 4E85A 1NMWA 2WXRA 2LSUA 3ZVVA 2J07A 2VSOE 3MDYB 1UN8A 3ALFA 3B9EA 4Q69A 2Q5AA 3TDBA 4UWFA 2RURA 3FUFA 2WB2A 4DI3A 1UJJA 3WD0A 2YHCA 1HJXA 4HARA 3E4BA 3O5RA 1E8ZA 2ZQVA 5HTGA 4HLEA 5LCWJ 4XKCA 4KZ0A 4GMLA 4A3TA 4ILGA 3HVEA 2FO7A 3CGNA 1D7IA 4PTMA 3JQ1A 4HOTA 3FY4A 5BNWA 2XHEA 4KR0B 3SI5A 3MX3A 1Q6IA 4FA6A 2X6KA 3B13A 5HT1A 1OUVA 2XP5A 4GZ5A 3AS3A 5BT1A 5FJYA 4WKAA 1W1VA 3ZIMA 3U9WA 3S2AA 4DLQA 1ZU8A 1HH8A 2A3AA 2QY7A 4IN3B 1GW6A 1N1AA 4FAPA 2ILRA 4KMOA 5EX3A 3MCXA 4MGVA 4WKHA 2VCDA 2ZQUA 1E6RA 2WXIA 4CGWA 5G55A 2DPEA 3ARTA 3KAHA 3I5PA 2X6HA 3RM8A 1FKTA 3UPVA 3VLDA 2J49A 3IV0A 1HG5A 1LL7A 2IFUA 2WXFA 5FTPA 1QZ2A 3FTWA 2YINA 3EDTB 4TRQA 3CV0A 1TJFA 4APFA 3WKZA 4JHKA 1HKJA 4ANWA 4GCNA 3TAXA 4PUCA 2CFUA 4ODNA 1H0IA 4ANXA 2DG3A 3FTXA 4GA2A 3FUJA 3UI6A 3AS8A 1C9HA 4FN2A 3JUIA 1N52A 5J90A 3CGMA 4EZJA 1ZBWA 4YVOA 1MQSA 4A1GA 5A23A 2F21A 2M08A 5DITA 3FXYA 4M3OA 3QJZA 3WL0A 3UQIA 3LY7A 4I2ZA 3KACA 3O5DA 3PNTB 3ARRA 5DIZA 3H9RB 4DJAA 3MZLB 4A1SA 3GZ2A 3FUEA 5CCMA 3ARQA 1A17A 4KT6B 3OTNA 4IQ2A 2M1IA 4GPKA 3ULQA 2PPPA 2GW1A 4AXHA 3O5OA 3CVPA 1OGBA 3O48A 3RGCA 4N39A 3T8MA 3SF4A 2L2SA 2PM6A 2WQ6A 4EQFA 2HO1A 1LJYA 3PA7A 3QKYA 4AP2A 3ARPA 5HUAA 3D9KA 3UUXA 4ME2A 4LAWA 2QF8A 4C02B 1NA0A 4R0XA 3ARUA 2MPHA 3ZYQA 4IRUA 4G2PA 3L16A 4ODPA 3VLFA 2KE0A 4Z2JA 1PBKA 1W9VA 1E8XA 1FFRA 2PL2A 2XEVA 3CKBA 4LGXA 1WB0A 3LDZA 3OOBA 3VAWA 3CZ8A 3R9AB 3PRDA 4DWSA 3UI5A 3PR9A 2PQNA 4AY1A 5AIJA 3QWWA 2G8ZA 4Z2LA 4I9EA 3VLEA 5AENA 1HFAA 4U63A 3KAGA 5HW8A 3G2TA 4DRIA 2WM0A 3I4GA 3IHVA 5JJTA 1QNFA 4U0UA 4PS8A 1JNTA 3CHOA 4N2SA 1H2VC 1HU3A 3MKRA 1VF8A 2N87A 4DRPA 4LCTA 1FKIA 2DBAA 1NWUA 3CVVA 4WK9A 1LQ0A 2RUCA 3IHYA 3TG4A 5FQ4A 4HBOA 2L6JA 4J8DA 4U0ZA 2DT1A 2FEZA 4L7TA 2O9OA 3ONLA 3D9NA 3L17A 2VJ8A 4OVUA 2XPBA 3CSTA 2R59A 4B94A 4B8AA 1ZBVA 4AM9A 5G04J 5A7DB 2JZVA 4LAYA 2WXNA 4W5UA 3UT7A 4G1TA 4TV3A 2IOLA 2XP9A 3D9PA 4ACLA 3LS8A 3ZN3A 2FKEA 1Q1CA 3CR3A 3QK0A 3ARXA 5G05C 2A3BA 1WY6A 2ONDA 2WXJA 4KVMA 1JNEA 1EF1C 3B7SA 3ZHEA 1D2KA 4HBEA 2UY1B 1ROUA 3PNLB 4U8HA 1W1YA 2OFNA 1B89A 1CTNA 1N54A 4I17A 3FH7A 4P8XA 4G25A 3SBTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGO A;  2ZR5 A;  3UI4 A;  5LCW C;  4GCO A;  1E96 B;  4GIV A;  2KCV A;  3LKU A;  3O5M A;  3KD7 A;  3OXG A;  1ZU2 A;  4WND A;  2VGX B;  2XPI A;  3ASD A;  3KAB A;  5BXJ A;  4XI0 A;  5DIV A;  4GYW A;  1M5Y A;  5EKQ D;  2KCK A;  2C0L A;  2FF4 A;  1F40 A;  3UQ3 A;  1QPL A;  1HZ4 A;  5ARG A;  1W26 A;  5HW6 A;  3MA5 A;  2OOE A;  4I2W A;  3MEK A;  4GZ3 A;  4JA9 A;  1NMW A;  4UI9 J;  5A6C A;  2HYZ A;  1NMV A;  2LSU A;  3PE4 A;  4G2V A;  5J6E A;  1ELR A;  4W9O A;  1J4H A;  3MDY B;  2RUD A;  3EY6 A;  4I1A A;  1ZCN A;  2MNT A;  2Q5A A;  5G05 J;  3TDB A;  4DRJ A;  1ROT A;  2RUR A;  4U84 A;  1FCH A;  1IYG A;  4TW8 A;  4U86 A;  4MSP A;  4BTB A;  4TYO A;  5KJK A;  2YHC A;  1FAP A;  2ZQS A;  3MV2 B;  3E4B A;  3O5R A;  2XP7 A;  3Q5M A;  4Y6W A;  3QOU A;  1NSG A;  2DG4 A;  2ZQV A;  5HTG A;  3RU0 A;  2E2E A;  5D75 A;  4G26 A;  3IEG A;  5FT9 A;  1PIN A;  1YAT A;  5LCW J;  4ODR A;  3HYM B;  4DRH A;  4YND A;  3ASF A;  2FI7 A;  4JFJ A;  4ABN A;  2FO7 A;  3O5L A;  1FJD A;  3U3W A;  4IQC A;  4BT9 A;  2VSN A;  3LCA A;  2MHK A;  4BT8 A;  3KAF A;  3CGN A;  3IKD A;  3RIB A;  1D7I A;  5HQ8 A;  4HOT A;  4JFK A;  1J4R A;  1FD9 A;  5I98 A;  4N3C A;  2XCB A;  5BNW A;  2UWJ G;  3K9I A;  2KFW A;  4DZ3 A;  3RO2 A;  4YVQ C;  2AWG A;  1Q6I A;  5DIU A;  1HXI A;  3GYZ A;  4WNF A;  1Q6H A;  3NRK A;  2F2D A;  4J8F A;  3KAD A;  2MLZ A;  3S7F A;  3BEE A;  5HT1 A;  1YW5 A;  4N19 A;  1OUV A;  1Q6U A;  4DT4 A;  1BL4 A;  3GZ1 A;  2XP5 A;  4GZ5 A;  4DZ2 A;  5BT1 A;  1KT0 A;  5FJY A;  2XP8 A;  3FAP A;  3JYS A;  1FKD A;  2ZQT A;  1HH8 A;  2KO7 A;  4GZ6 A;  4DH0 A;  4IN3 B;  1N1A A;  4FAP A;  2PQR A;  4BWR A;  5EX3 A;  1XNF A;  1J4I A;  4XI9 A;  2XCC A;  4MGV A;  2VCD A;  2D9F A;  2ZQU A;  1WAO 1;  2BUG A;  4DRQ A;  3ZPJ A;  3S7D A;  2RSE A;  2PBC A;  2KGJ A;  4J0U A;  4CGW A;  3IHZ A;  5HI7 A;  1NZN A;  3KAH A;  2PZI A;  3QWV A;  3ZGQ A;  2XP6 A;  5CCL A;  2NC9 A;  3OXF A;  1FKT A;  4ODQ A;  3TGO A;  3UPV A;  3ODK A;  3AS4 A;  5HW7 A;  4JA7 A;  1KT1 A;  2IFU A;  2KC7 A;  3UQB A;  5FTP A;  4HOU A;  1TCO C;  3U4T A;  4GYY A;  1QZ2 A;  1TJC A;  3EDT B;  4N3A A;  4AIF A;  3CVL A;  4JHR A;  3RO3 A;  3CV0 A;  4HOR A;  2WQH A;  2V5F A;  1IHG A;  3SZ7 A;  3N71 A;  2UY1 A;  2VGY A;  4GCN A;  4XIF A;  4I9C A;  3TAX A;  4LEU A;  4ODN A;  3FFL A;  5FZS A;  3O5K A;  2DG3 A;  4QIB A;  1FKF A;  5FZQ A;  3CVN A;  4GA2 A;  4GA0 A;  2XPA A;  2PV2 A;  3CK9 A;  3WXX A;  2XP3 A;  4N2Q A;  3UI6 A;  2VGX A;  3IK8 A;  1HXV A;  3AS8 A;  2R5S A;  3VTX A;  1C9H A;  3GPK A;  4FN2 A;  3LY9 A;  1ZBP A;  1R9H A;  4TX0 A;  3O5P A;  4WUY A;  4U04 A;  3CGM A;  4GYO A;  3B7X A;  1JVW A;  5HKG A;  2LKN A;  4YVO A;  2J9Q A;  1D7J A;  2F21 A;  2M08 A;  2PPN A;  5DIT A;  3CEQ A;  4RG6 A;  3CKC A;  5AYW D;  1FKS A;  3LY8 A;  3Q15 A;  3NF1 A;  4KBQ A;  3UQI A;  3LY7 A;  4I2Z A;  1FKB A;  1NA3 A;  3KAC A;  3O5D A;  1L1P A;  5DIZ A;  3H9R B;  4G24 A;  2Y4T A;  1Y8M A;  2HR2 A;  3S7B A;  4A1S A;  3GZ2 A;  5CCM A;  4CDR A;  1BKF A;  2FBN A;  1A17 A;  2QFC A;  5GPG A;  4UQY A;  3TG5 A;  3KZ7 A;  2XGM A;  2MLY A;  2LSV A;  2C2L A;  4N3B A;  4AY5 A;  4IQ2 A;  1YA0 A;  1T11 A;  1A7X A;  5C1D A;  2M1I A;  4GPK A;  3ULQ A;  2PPP A;  2GW1 A;  3NI6 A;  4J4N A;  3O5O A;  4HOQ A;  3CVP A;  4W9R A;  2PPO A;  3O48 A;  3Q47 B;  2C0M A;  4JL0 A;  3RGC A;  4N39 A;  2K8I A;  4G23 A;  3SF4 A;  2L2S A;  4JFL A;  2VN1 A;  4H7X A;  4EQF A;  5JJ7 A;  2HO1 A;  2PV1 A;  4APO A;  4WNE A;  2Y4U A;  2Y78 A;  3PA7 A;  1FKK A;  3ZHE B;  3QKY A;  1KLX A;  3KAI A;  4O2T A;  3JXV A;  5HUA A;  4NQ0 A;  3I6C A;  3UUX A;  4ME2 A;  4NRH B;  3JYM A;  4LAW A;  3O5Q A;  4C02 B;  1NA0 A;  4R0X A;  2MPH A;  1FKR A;  3O5F A;  4O6F A;  5DBK A;  4G2P A;  3KS2 A;  5D0Q D;  4ODP A;  3LYA A;  4JFM A;  3ASH A;  3JYJ A;  1U79 A;  2KE0 A;  1PBK A;  4G50 A;  3RKV A;  4IPX A;  1QQE A;  4UQX A;  5M72 A;  4ODK A;  4U07 A;  4DRN A;  4QT3 A;  3UF8 A;  2PL2 A;  2XEV A;  3CKB A;  3KAE A;  3GW4 A;  3OOB A;  3VAW A;  4BTA A;  2RUQ A;  2MLX A;  3AS5 A;  2XGS A;  3R9A B;  3PRD A;  4U0S A;  3LUO A;  3PE3 A;  3UI5 A;  4U85 A;  1D6O A;  2PQN A;  3QWW A;  3LPZ A;  3Q49 B;  4I9E A;  2JLB A;  5BW8 C;  4TW7 A;  3VTY A;  5HW8 A;  3KAG A;  3ASG A;  3QDN A;  3NTP A;  3ESK A;  1ELW A;  4DRI A;  3PDN A;  4J4O A;  1EYM A;  3RFW A;  3URZ A;  5JJT A;  4ITZ A;  4U0U A;  3KCE A;  1FKH A;  1JNT A;  5HWB A;  1ZK6 A;  4JFI A;  5B8I C;  4N2S A;  5G04 C;  4F3V A;  1FKL A;  4DRP A;  3MKR A;  3MV3 B;  5KJM A;  2N87 A;  1FKI A;  1FKJ A;  2DBA A;  5HWC A;  3CK7 A;  2LPV A;  5ARF A;  3CK8 A;  3TC5 A;  2RUC A;  5KJL A;  1Y0O A;  2KCL A;  3TG4 A;  3WH0 A;  5EX0 A;  4GA1 A;  5D0O D;  1WM5 A;  2L6J A;  4HOS A;  4J8D A;  5KJN A;  4LAV A;  4KYO B;  2IF4 A;  2UZ5 A;  2DG9 A;  4DIP A;  4U0Z A;  1D7H A;  3TCZ A;  3O5G A;  3ZFW A;  4ODM A;  2FEZ A;  5CHE E;  2Q7F A;  1B6C A;  1PC2 A;  3Q4A B;  4W9P A;  1W3B A;  1P5Q A;  2YQ8 A;  2XP4 A;  3QWP A;  4DRO A;  4J8E A;  4TW6 A;  4LAX A;  4N5C A;  2F4E A;  2XPB A;  3O5J A;  4ODO A;  2MF9 A;  4RG9 A;  2ITK A;  2WPV A;  4DRK A;  4B94 A;  2LNI A;  4ODL A;  4AM9 A;  3RJV A;  5FZR A;  2I6H A;  3FWV A;  4NNR A;  2RQS A;  5G04 J;  5A7D B;  2JZV A;  2M2A A;  1F8A B;  2PV3 A;  4LAY A;  4QT2 A;  4BF8 A;  2ZR6 A;  4UI9 K;  5JJ6 A;  4G1T A;  4JYS A;  4DRM A;  3S7J A;  2KI3 A;  2KR7 A;  3CVQ A;  2FAP A;  2XP9 A;  2AVP A;  3O5I A;  1JNS A;  4UI9 C;  4H7Y A;  4TNS A;  1FKG A;  4UQZ A;  4CGV A;  2VQ2 A;  3FP3 A;  2KAT A;  3ZN3 A;  2FKE A;  1Q1C A;  2LGO A;  1EQ3 A;  1J6Y A;  4WNG A;  3O5E A;  3PRB A;  4KXK B;  2LJ4 A;  5G05 C;  2OND A;  4W9Q A;  1QPF A;  4Y6C A;  4AY6 A;  3UQA A;  2VYI A;  3IKG A;  3ZHE A;  2ZR4 A;  2UY1 B;  1ROU A;  1B89 A;  2OFN A;  3OXL A;  2VSY A;  4I17 A;  4G25 A;  4GGQ A;  2P58 C; 
#chains in the Genus database with same CATH topology
 2R02 A;  2XGO A;  4ANV A;  5ENR D;  3UI4 A;  4K5B A;  3IKO B;  1GRJ A;  4GIV A;  3AG1 E;  4F1S A;  3LKU A;  1O1T A;  3FTY A;  3MKQ B;  3TXM A;  4WND A;  3ASD A;  1UN9 A;  3KAB A;  3EU9 A;  3L6A A;  1W9P A;  3JUE A;  3QAR A;  1S0P A;  5DIV A;  4YDE A;  4MNK A;  5EKQ D;  3D9O A;  2B0O E;  1LF8 A;  2DCP A;  1QPL A;  3CHC A;  4J8S A;  4GZ3 A;  2LXL A;  1H2T C;  2H6F A;  4UI9 J;  5A6C A;  2BED A;  5B1B E;  2OLH A;  1MX2 A;  2XS8 A;  4ZFH A;  2KM4 A;  3EHM A;  2RUD A;  3UI2 A;  4URK A;  3KSL A;  4S3K A;  2R17 C;  2MNT A;  3AG4 E;  3WD2 A;  1KFW A;  2ZU6 B;  1FCH A;  4DX1 A;  4U84 A;  2X6J A;  1JPL A;  4TW8 A;  3PH0 C;  4U86 A;  1E15 A;  2QYJ A;  1FAP A;  2ZQS A;  2XP7 A;  2ETC A;  3E37 A;  3FUL A;  2DG4 A;  4G26 A;  4C0E A;  5FT9 A;  3QNK A;  2LO6 A;  4AV7 A;  2B31 A;  4AEZ C;  3SHF A;  3HYM B;  3V31 A;  3ASO E;  2FI7 A;  4ABN A;  4TUU A;  4FHJ A;  1FJD A;  4IQC A;  1E90 A;  4BT9 A;  2ESC A;  3BUA A;  3KAF A;  3RIB A;  2ZXW E;  3V79 K;  1J4R A;  1JCR A;  5LX8 A;  1UR9 A;  4N3C A;  4JPS A;  2P9P G;  2UWJ G;  3K9I A;  2KFW A;  1EDU A;  1HJV A;  1HXI A;  3GYZ A;  3ZKJ A;  1S70 B;  2WXL A;  4FHK A;  1UR8 A;  4J8F A;  3D9I A;  3S7F A;  4N19 A;  4DT4 A;  2CG3 A;  2WQ7 A;  1BL4 A;  3GZ1 A;  3ARW A;  5JA4 D;  2IOS A;  3BU8 A;  4DZ2 A;  5CEA A;  3B7U X;  1DVP A;  4F53 A;  3C5R A;  3JYS A;  3BG0 B;  1FKD A;  1JUQ A;  3CHS A;  4FLH A;  4GZ6 A;  2EIL E;  3RRN B;  1E8Y A;  5ENN A;  4ATG A;  5FIN A;  4XI9 A;  2H6H A;  2BUG A;  1ZBK A;  4ILI A;  1FT1 A;  3S7D A;  2RSE A;  1K8K G;  2PBC A;  4JHJ A;  1WNO A;  4B89 A;  3IHZ A;  5HI7 A;  1XHG A;  1FPP A;  4HFG A;  2OVB A;  3QWV A;  2XP6 A;  3FUM A;  5FQ7 A;  3PZ4 A;  3AS4 A;  1EPU A;  3AS2 A;  3C98 A;  4JA7 A;  3RSE G;  4HI8 A;  3UQB A;  2IO3 C;  1HX8 A;  3AQU A;  4HOU A;  1TCO C;  4CDN A;  5KBA A;  3EU5 A;  4IUL A;  4F6R D;  4AIF A;  4F7A A;  4JHR A;  4HOR A;  1OGG A;  2WQH A;  1IHG A;  5HBF A;  2VGY A;  3G2S A;  3RM9 A;  2AWI A;  4XIF A;  4I9C A;  4RLY A;  2XQ0 A;  5JHB A;  5FIO A;  2WMO A;  4JW1 A;  4HRL A;  1Y6I A;  1QBQ A;  3R7Q A;  2VTB B;  4GA0 A;  1YCS B;  1SR0 A;  2XP3 A;  3IBE A;  4OYS A;  1LG1 A;  5KCM A;  2RG8 A;  4TX0 A;  3CHM A;  4LUN U;  4FAD A;  1JCH B;  2RFM A;  1HF8 A;  3PEU B;  2WLY A;  1DCE A;  1JVW A;  3FUK A;  2EIN E;  3LJ3 A;  2PPN A;  4BSX A;  4WWP A;  3CKC A;  3LY8 A;  3Q15 A;  2MRI A;  3ZEF A;  2X6I A;  4KBQ A;  3CHP A;  5FWQ A;  3D9J A;  4G24 A;  1INZ A;  3AU5 A;  4MAV A;  4CDR A;  1BKF A;  4P8W A;  3I4R B;  2G41 A;  4L72 B;  1GOI A;  4UQY A;  3TG5 A;  2LSV A;  4AY5 A;  2QYU A;  1A7X A;  5C1D A;  3NI6 A;  4J4N A;  2KZT B;  4W9R A;  4FJZ A;  1HO8 A;  1S64 A;  2Y1L E;  2LAH A;  3HG0 D;  2LXM A;  3L08 A;  1FFQ A;  3EHN A;  1JCS A;  1N4S A;  3B7B A;  2ION A;  3WD3 A;  5JJ7 A;  1D9S A;  1NWT A;  4ZS6 A;  2PV1 A;  4WNE A;  2Y78 A;  2ETB A;  4BES A;  1KLX A;  2XZD G;  4EEC A;  2XEN A;  3IXE A;  1EDQ A;  1E7U A;  2XRY A;  4U8Y D;  1FKR A;  3O5F A;  5DEZ A;  4O6F A;  4Q94 A;  1FVH A;  3F6Q A;  4G50 A;  2IQC A;  4IPX A;  2IO2 C;  3EHR A;  3HXD A;  4DRN A;  4DRX E;  3HRA A;  3KAE A;  4F1P A;  3ARZ A;  2RUQ A;  3AS1 A;  4BFR A;  1K1A A;  2MLX A;  3AS5 A;  4XZ4 A;  2XGS A;  3TJP A;  4U0S A;  4GTT A;  3PE3 A;  4GTR A;  3NB2 A;  4G11 A;  4U85 A;  2F0Y A;  1Z6T A;  3MYV A;  1D6O A;  5B1A E;  3G2U A;  2JLB A;  5E75 A;  5BW8 C;  3PVL A;  3VTY A;  3QDN A;  5CEC B;  1HG2 A;  1EYM A;  4ZPT R;  3RFW A;  2P9L G;  4LSZ E;  2AXZ A;  3HHM A;  4EZK A;  4I6E A;  2P9K G;  1ZK6 A;  4JFI A;  3CSF A;  1MJ0 A;  3FEX A;  4F3V A;  2WXQ A;  3W9F A;  1BI7 B;  1D8E A;  1TNO A;  2HM8 A;  5HWC A;  4L1B A;  4GPM A;  3CK7 A;  2LPV A;  3PZD A;  2CFZ A;  3NOG D;  5CRU A;  5KJL A;  1H19 A;  3JXI A;  1Y0O A;  2KCL A;  5BV1 A;  3WH0 A;  2DT3 A;  4LAV A;  2IF4 A;  4D10 C;  4DIP A;  3ZXS A;  3TCZ A;  3BMB A;  1D8D A;  2AXV A;  2KXP C;  5CHE E;  2Q7F A;  4MKT A;  3W9G A;  4URI A;  3T8K A;  3FU3 A;  4W9P A;  1BPO A;  2WM9 A;  2XP4 A;  1P5Q A;  2YQ8 A;  3QWP A;  3HXB A;  2F4E A;  4Q7N A;  2ITK A;  4G8K A;  2DWZ A;  3ENE A;  3UIO C;  3AAA C;  4I43 A;  2I2O A;  3DST A;  1W1T A;  2M2A A;  4PDX A;  1E6P A;  1F8A B;  2DVW A;  4HRM B;  2A5U A;  5CMY A;  2WLZ A;  3LJN A;  2J8S D;  3CH9 A;  4FU3 A;  3PRZ A;  1SZ9 A;  3FTV A;  4FUL A;  4I6G A;  1JNS A;  3PEV B;  3P2B A;  3ZYM A;  4H7Y A;  4TNS A;  4BX8 A;  4BY6 A;  4DI4 A;  3FP3 A;  1EQ3 A;  1IX5 A;  3PRB A;  3HIZ A;  3KEA A;  1VDY A;  4UUC A;  2GRQ B;  4KXK B;  5ENT D;  2LAI A;  1UW4 B;  3C72 A;  1JCQ A;  1SA5 A;  4MRU A;  4Y6C A;  4C48 B;  3CQG B;  3JXJ A;  3NQP A;  1DNP A;  2OVF A;  4P8V A;  3ISM C;  4JZY A;  2VSY A;  4A3V A;  1E6Z A;  2EIJ E;  2X3M A;  2P58 C;  4U7E B;  4HXI A;  2ZR5 A;  4GCO A;  3WQW A;  4DX7 D;  1E96 B;  3FUN A;  2GRR B;  3ARV A;  2JAB A;  2JEK A;  3O5M A;  4XEI G;  2WXG A;  4CT4 A;  2AW6 A;  5AJL A;  2VGX B;  5D66 A;  2XPI A;  3ML8 A;  2XEH A;  4Z68 A;  5BXJ A;  4XI0 A;  4K0R A;  4GYW A;  1M5Y A;  2IY0 C;  2XPY A;  3TWU A;  2A3C A;  1TNZ A;  4I1M A;  2WMN A;  3NAW A;  4MS6 A;  5ARG A;  1W26 A;  2YBU A;  2OOE A;  3ZUV B;  4WWN A;  1OCZ E;  4OAU C;  1TFV A;  4XX5 A;  1NMV A;  3PE4 A;  4G2V A;  3UTM A;  5J6E A;  1ELR A;  5T4Y A;  2DSU A;  3L22 A;  5ENS D;  1ZB5 A;  4I1A A;  1E6N A;  5G05 J;  4DRJ A;  1ROT A;  2YHE A;  3PUK A;  1O1S A;  3EIJ A;  4AVX A;  1MX6 A;  1U3C A;  4O1P A;  4MSP A;  3Q79 A;  4G8L A;  3UM2 A;  5JHA A;  1SYT A;  3WG7 E;  4PS7 A;  3MV2 B;  3CIA A;  1HE8 A;  3TWV A;  1TEZ A;  3QOU A;  3LEW A;  1OWP A;  3RU0 A;  2I1K A;  2E2E A;  3UMV A;  1NFI E;  3IEG A;  1PIN A;  1YAT A;  4ZPW R;  3WL1 A;  3ASF A;  2VGE A;  4JFJ A;  2WXK A;  3NOC D;  1V54 E;  3O5L A;  2NXP A;  2J09 A;  2MHK A;  3TWX A;  3WD1 A;  2EIM E;  5HQ8 A;  3AG3 E;  4JFK A;  3OA5 A;  1FD9 A;  5I98 A;  4L23 A;  1EIB A;  2BF0 X;  5LFA A;  2PM7 A;  3WQV A;  3RO2 A;  4YVQ C;  2AWG A;  2R2L A;  5DIU A;  3DSW A;  4LG6 A;  3NRK A;  2XEE A;  3KAD A;  1YW5 A;  3B7T A;  4J8Y A;  4IT4 A;  1KT0 A;  3PZ1 A;  1PY1 A;  2XP8 A;  1N9A A;  3FAP A;  4R5E A;  3UKR G;  2P9U G;  4GAA A;  3L54 A;  3SFZ A;  2KO7 A;  1YYH A;  4DH0 A;  4XAK A;  3CHQ A;  2CHX A;  2PQR A;  4Z2H A;  5G2N A;  1XNF A;  1J4I A;  1WAO 1;  3ZPJ A;  3P1U A;  1H6K A;  1JWG A;  4J0U A;  4Z2I A;  3ZYL A;  2PZI A;  3RME A;  3ZGQ A;  3RK6 A;  4R7L A;  3D9L A;  4O1O A;  3ODK A;  5HW7 A;  1KT1 A;  3UX4 A;  3ALG A;  2CG2 A;  3U4T A;  3FTZ A;  4GYY A;  1SQM A;  2QZA A;  3CVL A;  2WXP A;  3DBS A;  2R05 A;  3RO3 A;  3N71 A;  4C9B B;  2UY1 A;  2FDM A;  2R03 A;  4LEU A;  3PZ3 A;  4DWS C;  3FFL A;  5FZS A;  2WXH A;  4QIB A;  3E32 A;  4ML4 A;  4HNA D;  4J6I A;  2WVI A;  5FZQ A;  3NZS A;  2XPA A;  3CK9 A;  3MKQ A;  3B9A A;  1HXV A;  5JMN D;  3SBS A;  3TL5 A;  3LY9 A;  1ZBP A;  3SD5 A;  3O5P A;  4WUY A;  1OWN A;  1UOH A;  1MZC A;  4U04 A;  4GYO A;  4NAC A;  5HKG A;  1N0Q A;  2J9Q A;  3O4Z A;  1D7J A;  3ULY A;  3CEQ A;  4RG6 A;  5AYW D;  4CT0 A;  1TN6 A;  1FKB A;  4DK5 A;  1L1P A;  4MNM A;  4DWS D;  2Y4T A;  1Y8M A;  3S7B A;  5EYP F;  2IU1 A;  4N5Q A;  3ARS A;  2J4D A;  2QFC A;  5GPG A;  4L3N A;  3KZ7 A;  4CZ2 D;  3AG2 E;  3ESL A;  3UIN C;  4OVV A;  1YA0 A;  3DRA A;  3CQC B;  2V4L A;  3FHE A;  1PAQ A;  4HOQ A;  2WK2 A;  1SW6 A;  1L5J A;  2H6G A;  3L13 A;  2PPO A;  3ZRH A;  2XS1 A;  3Q47 B;  3Q7A A;  3LXU X;  5BPP A;  2P9S G;  4U8V D;  1NWS A;  4JFL A;  1LD7 A;  4H7X A;  4EBA G;  4FC8 A;  2XPZ A;  2Y4U A;  4HRN A;  1FKK A;  4L2Y A;  5D2M C;  4IYP A;  4UWH A;  1UJK A;  4NQ0 A;  4LRZ A;  3FUH A;  2KBX A;  4NRH B;  3JYM A;  2I1J A;  3O5Q A;  3DSV A;  3JQ0 A;  4CCA A;  5AQ9 A;  3BG1 B;  3G2V A;  2O92 A;  2F8Y A;  4HS2 A;  4HI9 A;  3B7R L;  1MHQ A;  4JB8 P;  3KS2 A;  5D0Q D;  4FP7 A;  4JFM A;  3ASH A;  2DIW A;  1O5M A;  5KNG A;  4CDM A;  1N94 A;  4ODK A;  5M72 A;  1LG2 A;  4U07 A;  3HDX A;  1JND A;  3FUD A;  4P29 A;  1N4P A;  3GTY X;  3GW4 A;  4BTA A;  2FUL A;  3D3M A;  3ZNG A;  4BEP A;  3Q49 B;  2L0T B;  4TW7 A;  3PRE A;  2YNQ A;  1ELW A;  1XGW A;  3PDN A;  4J4O A;  1H0A A;  4KVO A;  4EZL A;  4ITZ A;  1FKH A;  5EID A;  4GGQ A;  4LNU D;  4YDO A;  1KPS B;  1E7V A;  4ACK A;  5B8I C;  4M7C A;  1H0G A;  2I9C A;  3PS6 A;  2F8X K;  3UM0 A;  1FKJ A;  3BXW A;  5AQB A;  5ARF A;  5GPR A;  3HVE B;  5C2Y A;  1H6O A;  1EYH A;  3RRU A;  5KWD A;  1V55 E;  4K5A B;  5EX0 A;  4Q22 A;  1WM5 A;  4Q96 A;  3OAW A;  1ZB1 A;  2UZ5 A;  2VTB A;  2DG9 A;  3ARO A;  1WDY A;  1TNB A;  4ODM A;  5AAR A;  1OXJ A;  4C0M A;  3MGB A;  2J4B A;  1OWO A;  1PC2 A;  3Q4A B;  3Q78 A;  2OEW A;  3AJI A;  1W3B A;  3CHF A;  4TW6 A;  2EUL A;  4E6H A;  3ZXP A;  1NWR A;  4ODO A;  2MF9 A;  3GZS A;  4RG9 A;  5AJD A;  1TN7 A;  5EN5 D;  2LNI A;  5BUZ A;  4ODL A;  1Z3Y A;  3RJV A;  1K9T A;  5FZR A;  2RQS A;  3CVW A;  4BF8 A;  2ZR6 A;  2DZN A;  2A5E A;  5LOZ A;  4GZD A;  4UI9 K;  5KNH D;  4JYS A;  4DRM A;  3S7J A;  1ZL1 A;  2KR7 A;  4PS3 A;  3CVQ A;  5JH8 A;  3J5Q B;  3O5I A;  1U3D A;  2OV8 A;  2AXU A;  2KZT A;  1FKG A;  2L6B A;  1NP7 A;  2E0I A;  2VQ2 A;  2L0I A;  3DSS A;  2LGO A;  2GRM A;  4WNG A;  5BXO A;  3KEZ A;  3NZU A;  3FH8 A;  2LJ4 A;  1QYM A;  4Z2G A;  4WJX A;  3ABL E;  1SVX A;  1TYQ G;  1QPF A;  4WAF A;  2V0P A;  3UQA A;  2VYI A;  3FH5 A;  2ZR4 A;  3IKG A;  2WXM A;  5HKP A;  3OXL A;  2YBT A;  3LVQ E;  3IKD A;  3HXE A;  2ZIR A;  1ZBC A;  2L9B A;  5ANL A;  5LCW C;  5CBO A;  1ZU2 A;  4I6J A;  1O1R A;  5B3S E;  4GTO A;  3EIQ C;  3V2X A;  1F40 A;  3UQ3 A;  3DEP A;  2J08 A;  1HZ4 A;  1OCO E;  5CBN A;  5HW6 A;  3MEK A;  4JA9 A;  2HYZ A;  5FQ6 A;  3CVU A;  2PI6 A;  2RD0 A;  4S3J A;  3KSQ A;  3PRA A;  4W9O A;  1J4H A;  3E30 A;  3EY6 A;  3L82 A;  1HJW A;  1ZCN A;  1EHN A;  3FY1 A;  4MTV A;  4IT6 A;  1IYG A;  5CRV A;  4MPK A;  4BTB A;  4TYO A;  5AQ7 A;  4NIK A;  5KJK A;  3CGH A;  5BXU A;  4GMJ A;  3Q5M A;  4Y6W A;  5T3R A;  3UKU G;  1NSG A;  4A55 A;  5D75 A;  2A3E A;  2H6I A;  3T9K A;  4ODR A;  4DRH A;  4HB5 A;  4YND A;  4JD2 G;  4TXP A;  4RQI A;  2IJG X;  3T5V A;  2GGF A;  3U3W A;  2VSN A;  3LCA A;  4BT8 A;  4B8C B;  3CHE A;  2XRZ A;  2XCB A;  1WAW A;  3CLJ A;  1K1B A;  1X6N A;  4DZ3 A;  4JEU A;  2GRN B;  4NUR A;  1HKK A;  5EDS A;  1RD6 A;  4WNF A;  1Q6H A;  2F2D A;  1FT2 A;  2MLZ A;  1DC2 A;  3BEE A;  3U64 A;  4L2L A;  1IQU A;  1Q6U A;  4BET A;  1HKI A;  2GRO B;  2P2C P;  3AS0 A;  1BD8 A;  1NH6 A;  4B0Z A;  1Z3X A;  3FTS A;  3CHR A;  3ONK A;  4GTV A;  1LL4 A;  2BTD A;  2ZQT A;  4GU5 A;  1IXV A;  5T8I A;  3R9M A;  5ANR A;  4BWR A;  1X6L A;  4DWS B;  2PNN A;  2XCC A;  4QFV A;  3SY2 A;  2IUZ A;  2D9F A;  2DYR E;  4DRQ A;  3G2W A;  4GTQ A;  2DT2 A;  4YDW A;  1HKM A;  2KGJ A;  3FDH A;  4DLO A;  3FU6 A;  3LVR E;  1NZN A;  1KZO A;  1IQR A;  1OWM A;  5CCL A;  2NC9 A;  3OXF A;  4TXR A;  4ODQ A;  3TGO A;  3ARY A;  2KC7 A;  1TJC A;  4N3A A;  3DSX A;  2V5F A;  3SZ7 A;  1GPF A;  1LL6 A;  4I1O B;  1AP7 A;  4CYM D;  4MBG A;  3EUV A;  3O5K A;  3WIJ A;  1FKF A;  2V8S E;  2DZO A;  2GRL A;  3CVN A;  2PV2 A;  4DPR A;  3WXX A;  4ZPV R;  3B9D A;  4N2Q A;  2VGX A;  4FJY A;  3IK8 A;  2FO1 E;  1E9L A;  2R5S A;  4BSZ B;  1RZ4 A;  3VTX A;  4FLB A;  2AOS A;  3GPK A;  1R9H A;  3SNX A;  4JXT A;  4UWL A;  3B7X A;  2LKN A;  2DSZ A;  4ANU A;  3TWR A;  3V30 A;  4HVB A;  4EPZ A;  3U66 A;  1FKS A;  4UDM A;  3NF1 A;  4RVB A;  1NA3 A;  3J5P A;  4ATZ D;  5EYL A;  4NSB A;  4BER A;  1N4R A;  2HR2 A;  1FVF A;  4P8U A;  2FBN A;  4CEM A;  5DF0 A;  4JC8 A;  2XGM A;  2MLY A;  2C2L A;  4N3B A;  3UT8 A;  1T11 A;  3APD A;  5E76 A;  3RRM B;  4AJW A;  3L9T A;  3I3N A;  1UG3 A;  3TWT A;  5CMW A;  3FU0 A;  3FU5 A;  2C0M A;  4JL0 A;  2K8I A;  4XKB A;  4G23 A;  5FQ8 A;  4OAV B;  1X5B A;  3JCK C;  1W1P A;  2A4Z A;  2VN1 A;  4MLP A;  4Z2K A;  4APO A;  3V2O A;  1Z5S C;  3SO8 A;  4GB9 A;  3ZHE B;  3Q9N C;  3KAI A;  4O2T A;  3JXV A;  2HE0 A;  4GTP A;  4GTM A;  4EBA A;  3I6C A;  2LUH A;  3RAU A;  2M63 A;  4WKF A;  1RW2 A;  3QC1 A;  3FUI A;  1OY3 D;  3EJN A;  3PZ2 A;  3Q7F A;  5DBK A;  2NSZ A;  4LER A;  5BV0 A;  3ZYK A;  3LYA A;  3JYJ A;  3DXK G;  1U79 A;  3RKV A;  4J7W A;  1QQE A;  4UQX A;  4MNL A;  2CHZ A;  1OWL A;  1SZA A;  4EHM A;  1N4Q A;  4QT3 A;  2X38 A;  3UF8 A;  4JVS A;  2DSV A;  4MNJ A;  2EQX A;  2GRP B;  5GQB A;  3AU4 A;  3X2Q E;  4QZV B;  3LUO A;  2ZGD A;  3LPZ A;  3ZW3 A;  4V3I A;  3QOK A;  1E8W A;  4BX9 A;  1OWQ A;  4NZC A;  1X81 A;  3NTP A;  3ASG A;  3ESK A;  3G6L A;  4UWG A;  3URZ A;  2VSX E;  1ELK A;  3KCE A;  4WWO A;  4PH4 B;  5HWB A;  3DPD A;  4WIW A;  3Q75 A;  4KQZ A;  5G04 C;  4XE0 A;  1FKL A;  3MV3 B;  5KJM A;  5J08 A;  3SGH A;  3CK8 A;  3TC5 A;  1HS6 A;  4KZC A;  3R7R A;  4DX6 D;  1AWC B;  3ASN E;  1K3Z D;  4QQI A;  3ABM E;  4GA1 A;  5D0O D;  2IEJ A;  3G6M A;  4HOS A;  5KJN A;  1ITX A;  1H2U A;  4KYO B;  4CRW A;  1JWF A;  3FEY A;  2DSW A;  3CVX A;  1A5E A;  1D7H A;  3O5G A;  3ZFW A;  2Y3A A;  3PUJ A;  5EIL A;  4K03 A;  3BQO A;  4UWK A;  1B6C A;  3UT4 A;  2RFA A;  5AN8 A;  2ETN A;  4DRO A;  4J8E A;  5EIB E;  1BU9 A;  4L9P A;  4LAX A;  4N5C A;  3T5X A;  3O5J A;  2WPV A;  4JEH A;  4DRK A;  2I6H A;  3FWV A;  4NNR A;  2PV3 A;  4QT2 A;  1S63 A;  2MOW A;  3W4R A;  2CHW A;  3TWQ A;  5JJ6 A;  3D9M A;  3CVY A;  1GUV A;  2KI3 A;  1LTX A;  3QAQ A;  4B93 B;  2FAP A;  3B8S A;  2AVP A;  1O6I A;  3ZU7 B;  3QB2 A;  4UI9 C;  4UQZ A;  1W9U A;  4CGV A;  3HXF A;  2KAT A;  3APC A;  1J6Y A;  3WD4 A;  2F23 A;  3O5E A;  4TUM A;  2WXO A;  5HS0 A;  3C3O A;  4W9Q A;  5DO2 A;  5LP0 A;  4AY6 A;  2BKG A;  3CHD A;  2EIK E;  4AOF A;  2X6F A;  2QC9 A;  3TWS A;  3RM4 A;  3FTU A;  1XRV A;  2KCV A;  3SFY A;  4RSY A;  3KD7 A;  3OXG A;  3ML9 A;  4HLL A;  2P9N G;  3APF A;  2DT0 A;  4LNG A;  3DXM G;  2KCK A;  2C0L A;  2FF4 A;  3MJW A;  3SQV A;  3TXN A;  2ZIS A;  4GZC A;  3MA5 A;  1U2V G;  4I2W A;  4ILH B;  5ITZ F;  4E85 A;  1NMW A;  2WXR A;  2LSU A;  3ZVV A;  2J07 A;  2VSO E;  4LNB A;  1N11 A;  1UN8 A;  3ALF A;  3MDY B;  3B9E A;  4Q69 A;  2Q5A A;  3TDB A;  4UWF A;  2RUR A;  3FUF A;  2WB2 A;  4DI3 A;  1UJJ A;  3WD0 A;  2YHC A;  1HJX A;  3UIP C;  3E4B A;  3O5R A;  4HAR A;  1E8Z A;  2ZQV A;  3Q9U C;  5HTG A;  4HLE A;  4TXQ A;  5LCW J;  4XKC A;  2F37 A;  4KZ0 A;  4GML A;  4K5C A;  4A3T A;  4ZHB A;  4ILG A;  3HVE A;  2FO7 A;  2AJA A;  3CGN A;  1D7I A;  4PTM A;  3JQ1 A;  4HOT A;  3FY4 A;  2V4H C;  2RKK A;  5BNW A;  1OT8 A;  2XHE A;  3UXG A;  4KR0 B;  3SI5 A;  3MX3 A;  1Q6I A;  4FA6 A;  2B6C A;  2X6K A;  3B13 A;  5HT1 A;  1OUV A;  1IKN D;  2XP5 A;  4GZ5 A;  3AS3 A;  2ETA A;  5BT1 A;  5FJY A;  4WKA A;  1W1V A;  4U95 D;  3ZIM A;  3C3R A;  3U9W A;  3S2A A;  4DLQ A;  1ZU8 A;  1HH8 A;  3ULE G;  2A3A A;  2QY7 A;  4IN3 B;  1GW6 A;  1N1A A;  4FAP A;  2ILR A;  2ZGG A;  4KMO A;  5EX3 A;  3MCX A;  4MGV A;  4WKH A;  2VCD A;  2ZQU A;  1E6R A;  4DUI A;  2WXI A;  4CGW A;  5G55 A;  2DPE A;  2PN0 A;  3ART A;  3KAH A;  3I5P A;  2X6H A;  3RM8 A;  1FKT A;  3UPV A;  3VLD A;  2J49 A;  3IV0 A;  1HG5 A;  1LL7 A;  2IFU A;  2WXF A;  5FTP A;  1QZ2 A;  3FTW A;  2YIN A;  3SFX A;  3EDT B;  4TRQ A;  3CV0 A;  1TJF A;  4APF A;  5CED B;  5IY5 E;  3WKZ A;  4JHK A;  1HKJ A;  4ANW A;  4GCN A;  3TAX A;  4PUC A;  2CFU A;  4ODN A;  1H0I A;  3ABK E;  4ANX A;  2MYO A;  2DG3 A;  3FTX A;  4GA2 A;  4YDY A;  3FUJ A;  3UI6 A;  3DPY A;  3AS8 A;  5ENO D;  1C9H A;  4FN2 A;  3JUI A;  5AQA A;  1N52 A;  5J90 A;  3CGM A;  4EZJ A;  1ZBW A;  4YVO A;  1MQS A;  2DYS E;  4A1G A;  5A23 A;  2F21 A;  2M08 A;  5HRY A;  5DIT A;  3FXY A;  4M3O A;  3QJZ A;  3WL0 A;  3UQI A;  3LY7 A;  4I2Z A;  3KAC A;  3O5D A;  3PNT B;  3ARR A;  5DIZ A;  3H9R B;  4DJA A;  3DEO A;  3MZL B;  4A1S A;  3GZ2 A;  3FUE A;  5CCM A;  3E34 A;  3ARQ A;  1A17 A;  3EIP A;  4KT6 B;  3OTN A;  4IQ2 A;  1N0R A;  1BLX B;  2M1I A;  4GPK A;  3ULQ A;  2PPP A;  2GW1 A;  4AXH A;  3O5O A;  3CVP A;  1OGB A;  2XZT G;  3O48 A;  3RGC A;  4N39 A;  3T8M A;  3SF4 A;  1E44 A;  2L2S A;  2PM6 A;  4DX5 D;  3EHQ A;  4HBD A;  1YMP A;  2WQ6 A;  4EQF A;  2HO1 A;  1LJY A;  3GU0 A;  1BI8 B;  3PA7 A;  3QKY A;  4AP2 A;  3ARP A;  5HUA A;  3D9K A;  3UUX A;  4ME2 A;  4LAW A;  2QF8 A;  4C02 B;  1NA0 A;  4R0X A;  3ARU A;  2MPH A;  3ZYQ A;  4IRU A;  4GMR A;  4G2P A;  1TNY A;  3L16 A;  4DX2 A;  4A63 B;  3C3Q A;  4ODP A;  2P9I G;  3VLF A;  2KE0 A;  4Z2J A;  1TR4 A;  2OCC E;  3DSU A;  1PBK A;  1W9V A;  1E8X A;  1FFR A;  1TN8 A;  3E33 A;  2PL2 A;  2XEV A;  3CKB A;  4LGX A;  1WB0 A;  3LDZ A;  3OOB A;  3VAW A;  4HQD A;  1DCQ A;  2P4V A;  3CZ8 A;  3R9A B;  3PRD A;  4DWS A;  1IHB A;  3UI5 A;  3PR9 A;  3UM1 A;  2PQN A;  4AY1 A;  5AIJ A;  3QWW A;  2G8Z A;  4Z2L A;  4I9E A;  3VLE A;  5AEN A;  1HFA A;  2V5Q C;  4U63 A;  3KAG A;  5HW8 A;  3G2T A;  4DRI A;  3UM3 A;  2WM0 A;  5H7P A;  3I4G A;  3IHV A;  3TWW A;  5JJT A;  1Q2Z A;  1QNF A;  1TNU A;  4U0U A;  4PS8 A;  1OCC E;  1JNT A;  3CHO A;  1KZP A;  4N2S A;  3Q73 A;  2Y69 E;  1H2V C;  1HU3 A;  3MKR A;  1VF8 A;  2N87 A;  4DRP A;  4LCT A;  1FKI A;  2DBA A;  1NWU A;  3CVV A;  4WK9 A;  1LQ0 A;  2RUC A;  3IHY A;  3TG4 A;  5FQ4 A;  3B95 A;  3NBN B;  3DWL G;  1MX4 A;  4HBO A;  2L6J A;  4J8D A;  2B5U B;  1NI1 A;  1N95 A;  4U0Z A;  2DT1 A;  2FEZ A;  4L7T A;  1H6P A;  3HXC A;  4O60 A;  2O9O A;  3ONL A;  4U96 D;  5CER B;  3D9N A;  2Y0B G;  3L17 A;  2VJ8 A;  4OVU A;  2XPB A;  3CST A;  2R59 A;  4B94 A;  4B8A A;  1ZBV A;  5AAO A;  4X8Q A;  4AM9 A;  2NYJ A;  5G04 J;  5A7D B;  2JZV A;  4LAY A;  2WXN A;  4W5U A;  3UT7 A;  4G1T A;  1LD8 A;  1MYO A;  4TV3 A;  2IOL A;  2XP9 A;  3D9H A;  3D9P A;  5ENQ D;  4ACL A;  3LS8 A;  3ZN3 A;  2FKE A;  1Q1C A;  1NL4 A;  3CR3 A;  3QK0 A;  3ARX A;  5G05 C;  1WG0 A;  2OEV A;  2A3B A;  4GTS A;  1WY6 A;  2OND A;  1OCR E;  2WXJ A;  4KVM A;  2BKK B;  1JNE A;  1G3N B;  1EF1 C;  5ENP D;  3B7S A;  3ZHE A;  1D2K A;  4HBE A;  2UY1 B;  1ROU A;  1SA4 A;  3PNL B;  1B89 A;  4U8H A;  1W1Y A;  2OFN A;  1CTN A;  1N54 A;  4I17 A;  3FH7 A;  4P8X A;  4G25 A;  3SBT B; 
#chains in the Genus database with same CATH homology
 2XGO A;  4ANV A;  3UI4 A;  3IKO B;  4GIV A;  4F1S A;  3LKU A;  3FTY A;  3MKQ B;  3TXM A;  4WND A;  3ASD A;  1UN9 A;  3KAB A;  3L6A A;  1W9P A;  3QAR A;  1S0P A;  5DIV A;  4MNK A;  5EKQ D;  3D9O A;  1LF8 A;  2DCP A;  1QPL A;  3CHC A;  4J8S A;  4GZ3 A;  1H2T C;  4UI9 J;  5A6C A;  2OLH A;  2KM4 A;  3EHM A;  2RUD A;  4URK A;  4S3K A;  2R17 C;  2MNT A;  3WD2 A;  1KFW A;  2ZU6 B;  1FCH A;  4U84 A;  2X6J A;  1JPL A;  4TW8 A;  3PH0 C;  4U86 A;  1E15 A;  1FAP A;  2ZQS A;  2XP7 A;  3FUL A;  2DG4 A;  4G26 A;  4C0E A;  5FT9 A;  3QNK A;  2LO6 A;  4AV7 A;  2B31 A;  4AEZ C;  3SHF A;  3HYM B;  2FI7 A;  4ABN A;  4TUU A;  4FHJ A;  1FJD A;  4IQC A;  1E90 A;  4BT9 A;  2ESC A;  3KAF A;  3RIB A;  1J4R A;  5LX8 A;  1UR9 A;  4N3C A;  4JPS A;  2UWJ G;  3K9I A;  2KFW A;  1EDU A;  1HJV A;  1HXI A;  3GYZ A;  2WXL A;  4FHK A;  1UR8 A;  4J8F A;  3D9I A;  3S7F A;  4N19 A;  4DT4 A;  2CG3 A;  2WQ7 A;  1BL4 A;  3GZ1 A;  3ARW A;  2IOS A;  4DZ2 A;  3B7U X;  1DVP A;  4F53 A;  3JYS A;  3BG0 B;  1FKD A;  1JUQ A;  3CHS A;  4FLH A;  4GZ6 A;  3RRN B;  1E8Y A;  5ENN A;  4ATG A;  4XI9 A;  2BUG A;  1ZBK A;  4ILI A;  3S7D A;  2RSE A;  2PBC A;  4JHJ A;  1WNO A;  4B89 A;  3IHZ A;  5HI7 A;  1XHG A;  4HFG A;  2OVB A;  3QWV A;  2XP6 A;  3FUM A;  5FQ7 A;  3AS4 A;  1EPU A;  3AS2 A;  3C98 A;  4JA7 A;  3UQB A;  1HX8 A;  3AQU A;  4HOU A;  1TCO C;  4CDN A;  4IUL A;  4F7A A;  4AIF A;  4JHR A;  4HOR A;  1OGG A;  2WQH A;  1IHG A;  5HBF A;  2VGY A;  3G2S A;  3RM9 A;  2AWI A;  4XIF A;  4I9C A;  2XQ0 A;  5JHB A;  2WMO A;  4JW1 A;  1Y6I A;  2VTB B;  3R7Q A;  4GA0 A;  1SR0 A;  2XP3 A;  3IBE A;  4OYS A;  1LG1 A;  5KCM A;  2RG8 A;  4TX0 A;  3CHM A;  4LUN U;  4FAD A;  1HF8 A;  3PEU B;  2WLY A;  1JVW A;  3FUK A;  3LJ3 A;  2PPN A;  4BSX A;  4WWP A;  3CKC A;  3LY8 A;  3Q15 A;  2MRI A;  3ZEF A;  2X6I A;  4KBQ A;  3CHP A;  5FWQ A;  3D9J A;  4G24 A;  1INZ A;  3AU5 A;  4MAV A;  4CDR A;  1BKF A;  4P8W A;  3I4R B;  2G41 A;  4L72 B;  1GOI A;  4UQY A;  3TG5 A;  2LSV A;  4AY5 A;  1A7X A;  5C1D A;  3NI6 A;  4J4N A;  2KZT B;  4W9R A;  4FJZ A;  1HO8 A;  2LAH A;  3L08 A;  1FFQ A;  3EHN A;  2ION A;  3WD3 A;  5JJ7 A;  1NWT A;  4ZS6 A;  2PV1 A;  4WNE A;  2Y78 A;  1KLX A;  4EEC A;  1EDQ A;  1E7U A;  2XRY A;  1FKR A;  3O5F A;  5DEZ A;  4O6F A;  4Q94 A;  1FVH A;  4G50 A;  2IQC A;  4IPX A;  4DRN A;  3KAE A;  3ARZ A;  2RUQ A;  3AS1 A;  4BFR A;  2MLX A;  3AS5 A;  4XZ4 A;  2XGS A;  3TJP A;  4U0S A;  3PE3 A;  4G11 A;  4U85 A;  1Z6T A;  3MYV A;  1D6O A;  3G2U A;  2JLB A;  5E75 A;  5BW8 C;  3PVL A;  3VTY A;  3QDN A;  1HG2 A;  1EYM A;  4ZPT R;  3RFW A;  2AXZ A;  3HHM A;  4EZK A;  4I6E A;  1ZK6 A;  4JFI A;  3CSF A;  3FEX A;  4F3V A;  2WXQ A;  2HM8 A;  5HWC A;  4L1B A;  3CK7 A;  2LPV A;  3PZD A;  2CFZ A;  5KJL A;  1H19 A;  1Y0O A;  2KCL A;  5BV1 A;  3WH0 A;  2DT3 A;  4LAV A;  2IF4 A;  4D10 C;  4DIP A;  3ZXS A;  3TCZ A;  2AXV A;  5CHE E;  2Q7F A;  4MKT A;  4URI A;  3FU3 A;  4W9P A;  1BPO A;  2WM9 A;  2XP4 A;  1P5Q A;  2YQ8 A;  3QWP A;  2F4E A;  4Q7N A;  2ITK A;  3ENE A;  4I43 A;  2I2O A;  1W1T A;  2M2A A;  4PDX A;  1E6P A;  1F8A B;  2A5U A;  5CMY A;  2WLZ A;  3CH9 A;  4FU3 A;  3PRZ A;  1SZ9 A;  3FTV A;  4FUL A;  4I6G A;  1JNS A;  3PEV B;  3P2B A;  3ZYM A;  4H7Y A;  4TNS A;  4BX8 A;  4BY6 A;  4DI4 A;  3FP3 A;  1EQ3 A;  1IX5 A;  3PRB A;  3HIZ A;  1VDY A;  4KXK B;  2LAI A;  1UW4 B;  4MRU A;  4Y6C A;  3CQG B;  3NQP A;  1DNP A;  2OVF A;  4P8V A;  4JZY A;  2VSY A;  4A3V A;  1E6Z A;  2X3M A;  2P58 C;  4HXI A;  2ZR5 A;  4GCO A;  3WQW A;  1E96 B;  3FUN A;  3ARV A;  2JEK A;  3O5M A;  2WXG A;  4CT4 A;  2AW6 A;  5AJL A;  2VGX B;  2XPI A;  3ML8 A;  5BXJ A;  4XI0 A;  4K0R A;  4GYW A;  1M5Y A;  2XPY A;  2A3C A;  4I1M A;  2WMN A;  4MS6 A;  5ARG A;  1W26 A;  2YBU A;  2OOE A;  4WWN A;  1TFV A;  4XX5 A;  1NMV A;  3PE4 A;  4G2V A;  5J6E A;  1ELR A;  5T4Y A;  2DSU A;  3L22 A;  1ZB5 A;  4I1A A;  1E6N A;  5G05 J;  4DRJ A;  1ROT A;  2YHE A;  3PUK A;  3EIJ A;  4AVX A;  1U3C A;  4MSP A;  5JHA A;  1SYT A;  4PS7 A;  3MV2 B;  3CIA A;  1HE8 A;  1TEZ A;  3QOU A;  3LEW A;  1OWP A;  3RU0 A;  2I1K A;  2E2E A;  3UMV A;  3IEG A;  1PIN A;  1YAT A;  4ZPW R;  3WL1 A;  3ASF A;  4JFJ A;  2WXK A;  3O5L A;  2NXP A;  2J09 A;  2MHK A;  3WD1 A;  5HQ8 A;  4JFK A;  3OA5 A;  1FD9 A;  5I98 A;  4L23 A;  1EIB A;  2BF0 X;  5LFA A;  2PM7 A;  3WQV A;  3RO2 A;  4YVQ C;  2AWG A;  5DIU A;  3NRK A;  3KAD A;  1YW5 A;  3B7T A;  4IT4 A;  1KT0 A;  1PY1 A;  2XP8 A;  3FAP A;  4R5E A;  4GAA A;  3L54 A;  3SFZ A;  2KO7 A;  4DH0 A;  4XAK A;  3CHQ A;  2CHX A;  2PQR A;  4Z2H A;  5G2N A;  1XNF A;  1J4I A;  1WAO 1;  3ZPJ A;  3P1U A;  1H6K A;  1JWG A;  4J0U A;  4Z2I A;  3ZYL A;  2PZI A;  3RME A;  3ZGQ A;  3RK6 A;  4R7L A;  3D9L A;  3ODK A;  5HW7 A;  1KT1 A;  3UX4 A;  3ALG A;  2CG2 A;  3U4T A;  3FTZ A;  4GYY A;  1SQM A;  3CVL A;  2WXP A;  3DBS A;  3RO3 A;  3N71 A;  4C9B B;  2UY1 A;  2FDM A;  4LEU A;  4DWS C;  3FFL A;  5FZS A;  2WXH A;  4QIB A;  4ML4 A;  4J6I A;  2WVI A;  5FZQ A;  3NZS A;  2XPA A;  3CK9 A;  3MKQ A;  3B9A A;  1HXV A;  3SBS A;  3TL5 A;  3LY9 A;  1ZBP A;  3SD5 A;  3O5P A;  4WUY A;  1OWN A;  4U04 A;  4GYO A;  4NAC A;  5HKG A;  2J9Q A;  3O4Z A;  1D7J A;  3CEQ A;  4RG6 A;  5AYW D;  4CT0 A;  1FKB A;  4DK5 A;  1L1P A;  4MNM A;  4DWS D;  2Y4T A;  1Y8M A;  3S7B A;  2IU1 A;  3ARS A;  2J4D A;  2QFC A;  5GPG A;  4L3N A;  3KZ7 A;  3ESL A;  4OVV A;  1YA0 A;  3CQC B;  2V4L A;  3FHE A;  1PAQ A;  4HOQ A;  2WK2 A;  3L13 A;  1L5J A;  2PPO A;  3ZRH A;  3Q47 B;  3LXU X;  5BPP A;  1NWS A;  4JFL A;  4H7X A;  4EBA G;  4FC8 A;  2XPZ A;  2Y4U A;  1FKK A;  4L2Y A;  4IYP A;  4UWH A;  1UJK A;  4NQ0 A;  4LRZ A;  3FUH A;  4NRH B;  3JYM A;  2I1J A;  3O5Q A;  3JQ0 A;  4CCA A;  3BG1 B;  3G2V A;  2O92 A;  4HS2 A;  3B7R L;  1MHQ A;  3KS2 A;  5D0Q D;  4FP7 A;  4JFM A;  3ASH A;  2DIW A;  4CDM A;  4ODK A;  5M72 A;  1LG2 A;  4U07 A;  3HDX A;  1JND A;  3FUD A;  4P29 A;  3GW4 A;  4BTA A;  2FUL A;  3D3M A;  3Q49 B;  2L0T B;  4TW7 A;  3PRE A;  2YNQ A;  1ELW A;  1XGW A;  3PDN A;  4J4O A;  1H0A A;  4KVO A;  4EZL A;  4ITZ A;  1FKH A;  4GGQ A;  5B8I C;  1E7V A;  4ACK A;  1H0G A;  2I9C A;  3PS6 A;  1FKJ A;  3BXW A;  5ARF A;  5GPR A;  3HVE B;  5C2Y A;  1EYH A;  3RRU A;  5EX0 A;  4Q22 A;  1WM5 A;  4Q96 A;  3OAW A;  2UZ5 A;  2VTB A;  2DG9 A;  3ARO A;  4ODM A;  4C0M A;  3MGB A;  2J4B A;  1OWO A;  1PC2 A;  3Q4A B;  1W3B A;  3CHF A;  4TW6 A;  4E6H A;  1NWR A;  4ODO A;  2MF9 A;  3GZS A;  4RG9 A;  5AJD A;  2LNI A;  5BUZ A;  4ODL A;  1Z3Y A;  3RJV A;  1K9T A;  5FZR A;  2RQS A;  3CVW A;  4BF8 A;  2ZR6 A;  5LOZ A;  4GZD A;  4UI9 K;  4JYS A;  4DRM A;  3S7J A;  1ZL1 A;  2KR7 A;  3CVQ A;  4PS3 A;  5JH8 A;  3O5I A;  1U3D A;  2OV8 A;  2AXU A;  2KZT A;  1FKG A;  1NP7 A;  2E0I A;  2VQ2 A;  2L0I A;  2LGO A;  2GRM A;  4WNG A;  3KEZ A;  3NZU A;  3FH8 A;  2LJ4 A;  4Z2G A;  4WJX A;  1QPF A;  4WAF A;  2V0P A;  3UQA A;  2VYI A;  3FH5 A;  2ZR4 A;  3IKG A;  2WXM A;  3OXL A;  2YBT A;  3LVQ E;  3IKD A;  1ZBC A;  2L9B A;  5ANL A;  5LCW C;  1ZU2 A;  4I6J A;  3EIQ C;  1F40 A;  3UQ3 A;  2J08 A;  1HZ4 A;  5HW6 A;  3MEK A;  4JA9 A;  2HYZ A;  5FQ6 A;  3CVU A;  2PI6 A;  2RD0 A;  4S3J A;  3PRA A;  4W9O A;  1J4H A;  3EY6 A;  1HJW A;  1ZCN A;  1EHN A;  3FY1 A;  4MTV A;  4IT6 A;  1IYG A;  4MPK A;  4BTB A;  4TYO A;  5KJK A;  3CGH A;  4GMJ A;  3Q5M A;  4Y6W A;  5T3R A;  1NSG A;  4A55 A;  5D75 A;  2A3E A;  4ODR A;  4DRH A;  4YND A;  2IJG X;  3T5V A;  2GGF A;  3U3W A;  2VSN A;  3LCA A;  4BT8 A;  4B8C B;  3CHE A;  2XRZ A;  2XCB A;  1WAW A;  3CLJ A;  4DZ3 A;  1X6N A;  4JEU A;  1HKK A;  4NUR A;  5EDS A;  1RD6 A;  4WNF A;  1Q6H A;  2F2D A;  2MLZ A;  3BEE A;  3U64 A;  4L2L A;  1IQU A;  1Q6U A;  1HKI A;  3AS0 A;  1NH6 A;  4B0Z A;  1Z3X A;  3FTS A;  3CHR A;  3ONK A;  1LL4 A;  2BTD A;  2ZQT A;  4GU5 A;  5T8I A;  5ANR A;  4BWR A;  1X6L A;  4DWS B;  2XCC A;  4QFV A;  2IUZ A;  2D9F A;  4DRQ A;  3G2W A;  2DT2 A;  1HKM A;  2KGJ A;  3FDH A;  4DLO A;  3FU6 A;  3LVR E;  1NZN A;  1IQR A;  1OWM A;  5CCL A;  2NC9 A;  3OXF A;  4ODQ A;  3TGO A;  3ARY A;  2KC7 A;  1TJC A;  4N3A A;  2V5F A;  3SZ7 A;  1GPF A;  1LL6 A;  4I1O B;  3O5K A;  3WIJ A;  1FKF A;  2V8S E;  3CVN A;  2GRL A;  2PV2 A;  4DPR A;  3WXX A;  4ZPV R;  3B9D A;  4N2Q A;  2VGX A;  4FJY A;  3IK8 A;  1E9L A;  2R5S A;  3VTX A;  4FLB A;  2AOS A;  3GPK A;  1R9H A;  3SNX A;  4JXT A;  4UWL A;  3B7X A;  2LKN A;  2DSZ A;  4ANU A;  4HVB A;  4EPZ A;  3U66 A;  1FKS A;  3NF1 A;  4RVB A;  1NA3 A;  4NSB A;  2HR2 A;  1FVF A;  4P8U A;  2FBN A;  4CEM A;  5DF0 A;  4JC8 A;  2XGM A;  2MLY A;  2C2L A;  4N3B A;  3UT8 A;  1T11 A;  3APD A;  5E76 A;  3RRM B;  4AJW A;  3I3N A;  1UG3 A;  5CMW A;  3FU0 A;  3FU5 A;  2C0M A;  4JL0 A;  2K8I A;  4XKB A;  4G23 A;  5FQ8 A;  1X5B A;  3JCK C;  1W1P A;  2A4Z A;  2VN1 A;  4MLP A;  4Z2K A;  4APO A;  4GB9 A;  3ZHE B;  3KAI A;  4O2T A;  3JXV A;  4EBA A;  3I6C A;  2M63 A;  4WKF A;  3QC1 A;  3FUI A;  3EJN A;  5DBK A;  2NSZ A;  4LER A;  5BV0 A;  3ZYK A;  3LYA A;  3JYJ A;  1U79 A;  3RKV A;  1QQE A;  4UQX A;  4MNL A;  2CHZ A;  1OWL A;  1SZA A;  4QT3 A;  2X38 A;  3UF8 A;  4JVS A;  2DSV A;  4MNJ A;  2EQX A;  5GQB A;  3AU4 A;  4QZV B;  3LUO A;  3LPZ A;  3ZW3 A;  4V3I A;  3QOK A;  4BX9 A;  1OWQ A;  1E8W A;  4NZC A;  3NTP A;  3ASG A;  3ESK A;  3G6L A;  4UWG A;  3URZ A;  2VSX E;  1ELK A;  3KCE A;  4WWO A;  4PH4 B;  5HWB A;  3DPD A;  4WIW A;  4KQZ A;  5G04 C;  4XE0 A;  1FKL A;  3MV3 B;  5KJM A;  5J08 A;  3SGH A;  3CK8 A;  3TC5 A;  1HS6 A;  4KZC A;  3R7R A;  4GA1 A;  5D0O D;  3G6M A;  4HOS A;  5KJN A;  1ITX A;  1H2U A;  4KYO B;  4CRW A;  1JWF A;  3FEY A;  2DSW A;  3CVX A;  1D7H A;  3O5G A;  3ZFW A;  2Y3A A;  3PUJ A;  4K03 A;  4UWK A;  1B6C A;  3UT4 A;  4DRO A;  4J8E A;  4LAX A;  4N5C A;  3T5X A;  3O5J A;  2WPV A;  4JEH A;  4DRK A;  2I6H A;  3FWV A;  4NNR A;  2PV3 A;  4QT2 A;  2MOW A;  3W4R A;  2CHW A;  5JJ6 A;  3D9M A;  3CVY A;  1GUV A;  2KI3 A;  3QAQ A;  2FAP A;  3B8S A;  2AVP A;  1O6I A;  3QB2 A;  4UI9 C;  4UQZ A;  1W9U A;  4CGV A;  2KAT A;  3APC A;  1J6Y A;  3WD4 A;  3O5E A;  2WXO A;  4W9Q A;  5DO2 A;  5LP0 A;  4AY6 A;  3CHD A;  4AOF A;  2X6F A;  3RM4 A;  3FTU A;  1XRV A;  2KCV A;  4RSY A;  3KD7 A;  3OXG A;  3ML9 A;  3APF A;  2DT0 A;  2KCK A;  2C0L A;  2FF4 A;  3MJW A;  3TXN A;  4GZC A;  3MA5 A;  4I2W A;  4ILH B;  4E85 A;  1NMW A;  2WXR A;  2LSU A;  3ZVV A;  2J07 A;  2VSO E;  3MDY B;  1UN8 A;  3ALF A;  3B9E A;  4Q69 A;  2Q5A A;  3TDB A;  4UWF A;  2RUR A;  3FUF A;  2WB2 A;  4DI3 A;  1UJJ A;  3WD0 A;  2YHC A;  1HJX A;  4HAR A;  3E4B A;  3O5R A;  1E8Z A;  2ZQV A;  5HTG A;  4HLE A;  5LCW J;  4XKC A;  4KZ0 A;  4GML A;  4A3T A;  4ILG A;  3HVE A;  2FO7 A;  3CGN A;  1D7I A;  4PTM A;  3JQ1 A;  4HOT A;  3FY4 A;  5BNW A;  2XHE A;  4KR0 B;  3SI5 A;  3MX3 A;  1Q6I A;  4FA6 A;  2X6K A;  3B13 A;  5HT1 A;  1OUV A;  2XP5 A;  4GZ5 A;  3AS3 A;  5BT1 A;  5FJY A;  4WKA A;  1W1V A;  3ZIM A;  3U9W A;  3S2A A;  4DLQ A;  1ZU8 A;  1HH8 A;  2A3A A;  2QY7 A;  4IN3 B;  1GW6 A;  1N1A A;  4FAP A;  2ILR A;  4KMO A;  5EX3 A;  3MCX A;  4MGV A;  4WKH A;  2VCD A;  2ZQU A;  1E6R A;  2WXI A;  4CGW A;  5G55 A;  2DPE A;  3ART A;  3KAH A;  3I5P A;  2X6H A;  3RM8 A;  1FKT A;  3UPV A;  3VLD A;  2J49 A;  3IV0 A;  1HG5 A;  1LL7 A;  2IFU A;  2WXF A;  5FTP A;  1QZ2 A;  3FTW A;  2YIN A;  3EDT B;  4TRQ A;  3CV0 A;  1TJF A;  4APF A;  3WKZ A;  4JHK A;  1HKJ A;  4ANW A;  4GCN A;  3TAX A;  4PUC A;  2CFU A;  4ODN A;  1H0I A;  4ANX A;  2DG3 A;  3FTX A;  4GA2 A;  3FUJ A;  3UI6 A;  3AS8 A;  1C9H A;  4FN2 A;  3JUI A;  1N52 A;  5J90 A;  3CGM A;  4EZJ A;  1ZBW A;  4YVO A;  1MQS A;  4A1G A;  5A23 A;  2F21 A;  2M08 A;  5DIT A;  3FXY A;  4M3O A;  3QJZ A;  3WL0 A;  3UQI A;  3LY7 A;  4I2Z A;  3KAC A;  3O5D A;  3PNT B;  3ARR A;  5DIZ A;  3H9R B;  4DJA A;  3MZL B;  4A1S A;  3GZ2 A;  3FUE A;  5CCM A;  3ARQ A;  1A17 A;  4KT6 B;  3OTN A;  4IQ2 A;  2M1I A;  4GPK A;  3ULQ A;  2PPP A;  2GW1 A;  4AXH A;  3O5O A;  3CVP A;  1OGB A;  3O48 A;  3RGC A;  4N39 A;  3T8M A;  3SF4 A;  2L2S A;  2PM6 A;  2WQ6 A;  4EQF A;  2HO1 A;  1LJY A;  3PA7 A;  3QKY A;  4AP2 A;  3ARP A;  5HUA A;  3D9K A;  3UUX A;  4ME2 A;  4LAW A;  2QF8 A;  4C02 B;  1NA0 A;  4R0X A;  3ARU A;  2MPH A;  3ZYQ A;  4IRU A;  4G2P A;  3L16 A;  4ODP A;  3VLF A;  2KE0 A;  4Z2J A;  1PBK A;  1W9V A;  1E8X A;  1FFR A;  2PL2 A;  2XEV A;  3CKB A;  4LGX A;  1WB0 A;  3LDZ A;  3OOB A;  3VAW A;  3CZ8 A;  3R9A B;  3PRD A;  4DWS A;  3UI5 A;  3PR9 A;  2PQN A;  4AY1 A;  5AIJ A;  3QWW A;  2G8Z A;  4Z2L A;  4I9E A;  3VLE A;  5AEN A;  1HFA A;  4U63 A;  3KAG A;  5HW8 A;  3G2T A;  4DRI A;  2WM0 A;  3I4G A;  3IHV A;  5JJT A;  1QNF A;  4U0U A;  4PS8 A;  1JNT A;  3CHO A;  4N2S A;  1H2V C;  1HU3 A;  3MKR A;  1VF8 A;  2N87 A;  4DRP A;  4LCT A;  1FKI A;  2DBA A;  1NWU A;  3CVV A;  4WK9 A;  1LQ0 A;  2RUC A;  3IHY A;  3TG4 A;  5FQ4 A;  4HBO A;  2L6J A;  4J8D A;  4U0Z A;  2DT1 A;  2FEZ A;  4L7T A;  2O9O A;  3ONL A;  3D9N A;  3L17 A;  2VJ8 A;  4OVU A;  2XPB A;  3CST A;  2R59 A;  4B94 A;  4B8A A;  1ZBV A;  4AM9 A;  5G04 J;  5A7D B;  2JZV A;  4LAY A;  2WXN A;  4W5U A;  3UT7 A;  4G1T A;  4TV3 A;  2IOL A;  2XP9 A;  3D9P A;  4ACL A;  3LS8 A;  3ZN3 A;  2FKE A;  1Q1C A;  3CR3 A;  3QK0 A;  3ARX A;  5G05 C;  2A3B A;  1WY6 A;  2OND A;  2WXJ A;  4KVM A;  1JNE A;  1EF1 C;  3B7S A;  3ZHE A;  1D2K A;  4HBE A;  2UY1 B;  1ROU A;  3PNL B;  4U8H A;  1W1Y A;  2OFN A;  1B89 A;  1CTN A;  1N54 A;  4I17 A;  3FH7 A;  4P8X A;  4G25 A;  3SBT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...