1KT0A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
380
structure length
357
Chain Sequence
VLKIVTPMIGDKVYVHYKGKLFDSPFVFSLGKGQVIKAWDIGVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNAARLQISMCQKKAKEHNERDRRIYANM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords 51 KDA FK506-BINDING PROTEIN
total genus 110
structure length 357
sequence length 380
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt0A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt0A02
1ROUA 2FF4A 4APOA 2UY1A 1PBKA 5FJYA 4GA2A 5HWCA 1T11A 3JYMA 3CK9A 4N2QA 4BT8A 4IN3B 4ODNA 4CGVA 3S7DA 3CK8A 1A17A 4LAVA 4J8EA 3NRKA 1FKLA 4JFKA 4J4NA 5CCMA 2KGJA 1OUVA 3VAWA 5FZSA 3IKGA 4ABNA 3O5GA 1PC2A 1TCOC 3JYJA 3CKBA 5GPGA 3KAGA 5BW8C 2R5SA 2KFWA 1FKFA 3AS4A 1KT1A 1FKBA 3URZA 4U0ZA 2L6JA 4RG9A 2XP7A 1HXIA 1P5QA 4I9EA 2BUGA 2HYZA 1W26A 1W3BA 4W9OA 2QFCA 1Q6UA 3CVNA 3LPZA 1FKHA 1L1PA 2VSYA 3UI6A 4JA7A 4WNFA 3UQAA 1M5YA 3CVPA 2VN1A 4WNEA 1FKTA 4IPXA 4TW7A 1Q6HA 4W9QA 4HOUA 3QWWA 2PPPA 1HXVA 1J6YA 3PDNA 4DRMA 2IFUA 2DBAA 3CK7A 4ME2A 2LJ4A 3GW4A 2MLZA 4F3VA 5HI7A 4N3AA 3NF1A 4IQCA 4QT3A 3O5IA 4Y6CA 1F8AB 2DG9A 3KABA 3RO2A 1ELWA 4GA0A 3ODKA 4AY5A 4H7YA 2Q7FA 2XGSA 1WAO1 3I6CA 3LYAA 1NA3A 2PPOA 4ODKA 1FCHA 2XP4A 2JZVA 4BTAA 1J4RA 1FJDA 3GZ1A 5JJ7A 2HO1A 4G25A 2RUQA 3QWPA 5DIUA 2OOEA 4H7XA 2FO7A 1D6OA 4U85A 3AS5A 3IEGA 3CVLA 3QOUA 2Y4TA 4N39A 5M72A 4IQ2A 2F2DA 2LGOA 3ASHA 4KYOB 4W9PA 3R9AB 2I6HA 3O5QA 1C9HA 3ZPJA 3RGCA 1FKIA 4JYSA 2PL2A 2XCCA 3PRDA 3FFLA 2AVPA 3KCEA 4J0UA 1D7HA 4ODMA 3O5KA 3N71A 3O5OA 4KBQA 5C1DA 3LKUA 2ZQTA 2J9QA 5KJLA 2PQNA 4UQZA 4DRIA 2PV1A 3NI6A 1KLXA 3ASDA 4HOSA 3CGNA 3MKRA 1HH8A 2ZQVA 1ZU2A 3O5PA 2C0LA 3O5DA 4I2WA 4GZ3A 4N3CA 3S7JA 4HOTA 1NZNA 3ESKA 2VQ2A 2VCDA 4HOQA 1ZCNA 2VGXA 4DRKA 2ZR6A 3KZ7A 2PV2A 5AYWD 1EQ3A 2M08A 3LY7A 1B89A 4EQFA 4UI9J 4N19A 3JYSA 1A7XA 4G2PA 4U04A 2YQ8A 5EKQD 3O5EA 4QIBA 4LAWA 2Y78A 3ASFA 1R9HA 2ONDA 3U4TA 4G1TA 2KO7A 4U0UA 4MGVA 4DH0A 5HW6A 3Q4AB 2MHKA 5HQ8A 4UI9C 4MSPA 4DRNA 1Q6IA 5KJMA 4TW6A 3MEKA 3ASGA 4B94A 4GIVA 4DZ2A 2M1IA 3O5JA 2MF9A 3UI5A 2RURA 3OXFA 4G24A 5D0OD 3MDYB 4WNDA 4G23A 1D7IA 5B8IC 4GYWA 2XP9A 4TW8A 5LCWJ 5JJ6A 3TGOA 1FKKA 5DBKA 2WQHA 2VYIA 3TCZA 4J4OA 3PE3A 4AY6A 4JHRA 2MLXA 4GZ6A 5HT1A 2GW1A 1PINA 3KS2A 3AS8A 4XIFA 4ODPA 2DG4A 4GGQA 3CGMA 5KJNA 3EY6A 5BNWA 2JLBA 2LSVA 4DZ3A 3TG5A 2ZQUA 4UQXA 4JA9A 3KAEA 3BEEA 1U79A 3WXXA 3CVQA 2RSEA 2LPVA 4BT9A 4J8FA 3FWVA 4TNSA 3QKYA 2ZR5A 2NC9A 3ULQA 3GZ2A 4BWRA 3FAPA 3KAFA 1BKFA 5HKGA 4AM9A 4N2SA 1Q1CA 3TG4A 3PA7A 4I9CA 4J8DA 5A6CA 5KJKA 3Q47B 3PE4A 3O5RA 2XGOA 3FP3A 3NTPA 4GZ5A 5FZQA 3RFWA 5D0QD 3IK8A 2RUDA 4G50A 4GA1A 3UI4A 3Q49B 4BF8A 4Y6WA 3SZ7A 2XCBA 5ARFA 4GPKA 3U3WA 4LAYA 3KADA 1NA0A 2PQRA 2AWGA 3ZHEB 4U0SA 1EYMA 1ZK6A 4UQYA 4KXKB 3GYZA 4AIFA 2UY1B 3RJVA 3QDNA 1TJCA 4DRPA 4YVQC 5HW8A 4I17A 1ZBPA 4QT2A 1QQEA 1N1AA 3TC5A 3TDBA 4HORA 3LCAA 3UPVA 3CKCA 3ZHEA 2L2SA 2F21A 1XNFA 4DRJA 2UZ5A 3UF8A 2XP5A 4DROA 1Y0OA 1BL4A 1NMWA 3KAHA 1QPFA 5BXJA 5G05J 5G05C 2D9FA 1B6CA 1FKRA 2KC7A 2FI7A 3Q5MA 4DIPA 2XEVA 4ITZA 1KT0A 2PZIA 2ZQSA 2HR2A 2YHCA 4UI9K 3RIBA 4DRQA 2KI3A 3O5LA 5JJTA 3UQIA 4N3BA 2OFNA 3VTYA 1NSGA 2WPVA 4U07A 2DG3A 4YNDA 3EDTB 4O2TA 2VGXB 3O48A 2KCVA 2RQSA 3OXLA 2KCLA 1NMVA 4WUYA 2KR7A 2P58C 1FKGA 4TX0A 5CCLA 1HZ4A 4R0XA 2RUCA 3PRBA 2LSUA 4I1AA 5HW7A 1IYGA 1J4IA 2FEZA 1YATA 4N5CA 2LNIA 1YW5A 5FT9A 4C02B 4U86A 1J4HA 1ROTA 4U84A 3Q15A 2ITKA 3E4BA 2PPNA 1IHGA 2K8IA 1Y8MA 2KATA 4TYOA 5DITA 4NQ0A 4RG6A 5BT1A 5FZRA 5HTGA 2KCKA 5HWBA 4BTBA 1FKDA 3HYMB 3OOBA 1JVWA 2PBCA 2IF4A 5A7DB 2V5FA 5LCWC 2FKEA 1JNSA 5HUAA 2MLYA 4YVOA 2PV3A 3UQBA 4W9RA 4JFIA 3S7FA 1QPLA 2MPHA 2C0MA 2MNTA 2C2LA 5G04C 2Q5AA 4JFMA 1FKSA 3ZN3A 3WH0A 3KAIA 3SF4A 4LEUA 3LUOA 4O6FA 3LY8A 4I2ZA 3KD7A 5CHEE 3JXVA 4ODRA 5DIVA 5G04J 2XP8A 4GYOA 3RKVA 1FAPA 2KE0A 2UWJG 3ZGQA 2ZR4A 2VSNA 4CGWA 2XPAA 5I98A 4JFJA 5EX0A 1F40A 4NRHB 2FBNA 4DRHA 4ODOA 5ARGA 3MA5A 5FTPA 4GCOA 2LKNA 3QWVA 1ELRA 4XI0A 3OXGA 3KACA 3S7BA 4A1SA 1WM5A 5J6EA 2FAPA 1QZ2A 3RU0A 2XP6A 1YA0A 4CDRA 2XPIA 5DIZA 2XP3A 4GYYA 3UQ3A 2F4EA 4JFLA 3MV3B 4ODQA 3UUXA 4WNGA 1FD9A 5D75A 3GPKA 4DT4A 4ODLA 2E2EA 3CEQA 2XGMA 4XI9A 4G26A 1FKJA 3VTXA 4FN2A 4NNRA 4JL0A 3O5FA 3H9RB 2XPBA 1E96B 3IHZA 2VGYA 3ZFWA 2M2AA 1D7JA 3CV0A 3MV2B 4GCNA 3O5MA 4G2VA 3RO3A 3TAXA 1JNTA 4FAPA 5EX3A 2Y4UA 2N87A 3B7XA 3LY9A 3K9IA 4LAXA 3IKDA
chains in the Genus database with same CATH superfamily
1ROUA 5FQ6A 4JD2G 4MPKA 1HKJA 2UY1A 1BPOA 1PBKA 2WB2A 4GA2A 3FEYA 2R59A 4EHMA 4HXIA 3WD0A 3CK9A 4YDEA 4HLLA 2XQ0A 1NH6A 4EPZA 3S7DA 5CBNA 3ARZA 3FH5A 4LAVA 3FUJA 3G2SA 5C2YA 1UG3A 4CRWA 2BKGA 4K5AB 1TCOC 3JYJA 4IT6A 5EYLA 3SBTB 3ARTA 1FKBA 3URZA 3DEPA 4RG9A 2QF8A 2XP7A 2B31A 2R2LA 4I9EA 4AP2A 3LPZA 4MAVA 1L1PA 4WNFA 4HBDA 3CVPA 3LS8A 3PUJA 4WNEA 1FKTA 4CDNA 4IPXA 3WL0A 3QWWA 2PPPA 1HXVA 3PDNA 3QB2A 5HI7A 1K3ZD 4YDYA 3O5IA 5E76A 3AAAC 4TXRA 2B0OE 1V54E 3ODKA 3Q79A 5ENOD 4I6EA 5FIOA 1EYHA 1X5BA 1W1YA 2DCPA 4ILIA 3HXEA 1ZB5A 1PY1A 2MOWA 3WL1A 3WD1A 2OOEA 3JQ1A 1D6OA 2FULA 3AS5A 3APFA 3CVLA 5KCMA 2V8SE 4IQ2A 2WXIA 5CMWA 3X2QE 3ASHA 1BI7B 2I6HA 4PUCA 3O5QA 1C9HA 3ZPJA 2GRLA 3UX4A 3B7SA 2ZISA 4J0UA 4ODMA 3O5KA 2FDMA 1E9LA 1JCQA 3FUHA 3E30A 4GU5A 2X6IA 3ASDA 4HOSA 3MKRA 1HH8A 3B95A 2ZQVA 4WJXA 3ZIMA 4CYMD 3O5PA 2WMNA 1O6IA 2EULA 4N3CA 3DXKG 5AJLA 1MX6A 2VQ2A 5DEZA 1ZCNA 4DRKA 2YHEA 2PV2A 5AYWD 1EQ3A 2A5UA 4N19A 2WXJA 4PS3A 1A7XA 4G2PA 3FDHA 3ARUA 4QIBA 4LAWA 1W9UA 3E32A 4G1TA 2CFUA 4DH0A 1JPLA 3DBSA 2MHKA 1U3CA 5ENPD 2F37A 3CGHA 3CQGB 1FPPA 1XGWA 3E33A 3KEAA 3CHRA 4BX9A 3D9NA 4GIVA 4DZ2A 1LL7A 1HKKA 4F53A 1INZA 2MF9A 3MDYB 1D7IA 2KM4A 2I1JA 3T8KA 1OWMA 4JEUA 4BESA 2FO1E 5ANLA 4LG6A 2GW1A 2DZOA 3T9KA 1OXJA 4F1PA 4DLOA 5KJNA 1TYQG 3WKZA 2JLBA 1S64A 5EN5D 1HFAA 3ALFA 4JA9A 4KQZA 2V0PA 1MX4A 1U79A 3WXXA 2KBXA 1XRVA 2R02A 1HJVA 3MYVA 2WM9A 3QKYA 3VLEA 1ZBCA 2DSVA 4A3VA 3FAPA 1OCOE 1BKFA 1Q1CA 1OGGA 3HRAA 4XZ4A 3B7RL 2EIJE 4EBAG 4FA6A 2I9CA 3PEVB 5EDSA 5DF0A 3PZ4A 3RFWA 5D0QD 4G50A 1WG0A 3TWUA 2XCBA 2CHXA 3V2XA 4A55A 3RRMB 3EHNA 3KADA 1EDQA 4U0SA 1ZK6A 3G2UA 4IYPA 4AIFA 1O1RA 3PR9A 3B7TA 1IKND 4LNUD 4X8QA 3LCAA 1H2TC 3UM0A 2ZU6B 2ETAA 3CVXA 4U95D 2F21A 1XNFA 1N94A 4DRJA 3EU9A 2UZ5A 1D2KA 3HVEB 3RAUA 3T5XA 2OCCE 3UXGA 1QPFA 1BI8B 5G05J 5IY5E 1CTNA 3ENEA 1FKRA 3CLJA 3SY2A 1OCCE 2H6IA 2PM7A 4DRQA 3B13A 3ARWA 2DSZA 3AS2A 2OFNA 3FY4A 1NSGA 2WPVA 4QZVB 3D9JA 5B1BE 2WMOA 2PM6A 3WQWA 2F23A 4ANUA 2A3BA 4J8YA 1HZ4A 4DLQA 1J4IA 4YDOA 2FEZA 3D3MA 1WDYA 4FADA 2VGEA 2LNIA 1LG2A 4TUMA 3QAQA 5DO2A 3LJ3A 4BETA 3Q15A 3D9PA 4A63B 2WXFA 4APFA 3VLFA 2EIME 2AXZA 2QYUA 3C72A 3SFZA 2K8IA 2KATA 4K5CA 1GOIA 3ARVA 5FZRA 5HTGA 1HE8A 1JNEA 5HWBA 3ARRA 4JXTA 4DX6D 4U8VD 1HO8A 4WK9A 4OVUA 3FTZA 3QNKA 5CEDB 2P9LG 5LCWC 2DSUA 2FKEA 3SFYA 4TRQA 1N4QA 1LD8A 2Q5AA 3DWLG 3ZN3A 1ZB1A 3RM9A 1FVHA 1EDUA 1O5MA 2WXQA 3E34A 5LX8A 5CHEE 3D9LA 4E85A 1NFIE 1FAPA 3FU0A 2UWJG 2A4ZA 1F40A 3BQOA 2IUZA 4FJZA 3QOKA 4NZCA 4ODOA 5ENTD 3MA5A 5FTPA 4GCOA 1OCRE 2PI6A 1ELRA 1JNDA 3OXGA 5AAOA 3TWXA 4AEZC 5J6EA 3RU0A 1YA0A 1H2UA 3L82A 5DIZA 2XP3A 4P8XA 3UQ3A 3ZYKA 4OYSA 3G2VA 3QJZA 2CFZA 2I2OA 3UUXA 3LXUX 2DIWA 1O1SA 2ILRA 1FD9A 2WQ6A 1OWQA 5D75A 2A5EA 3RM4A 1YYHA 3CEQA 3QARA 1K1BA 4C0EA 4R5EA 1FKJA 3U64A 3CQCB 2MRIA 4RLYA 1A5EA 3LVRE 5BUZA 3V30A 3O5MA 3MV2B 2J4DA 4DWSB 1JNTA 1UJJA 4GTRA 4LSZE 3SBSA 4EZKA 1N54A 2Y4UA 4Q22A 2FF4A 3RRUA 4ATGA 3DPDA 5FJYA 3UT7A 4L7TA 2QC9A 3C5RA 3EJNA 3LEWA 4N5QA 4BT8A 5J08A 4U63A 4F1SA 4HB5A 4O1OA 4TV3A 5AN8A 3FEXA 3V31A 1X6NA 4JFKA 2VTBB 4BY6A 1OUVA 5FZSA 3CSFA 5CEAA 3FUNA 3PH0C 2DZNA 3KAGA 5GPGA 2KFWA 2P9SG 2XENA 1SR0A 2GRMA 1HXIA 2E0IA 3T8MA 5AIJA 4BX8A 3UI6A 4HQDA 3Q78A 4Q7NA 1EIBA 4HOUA 1U3DA 1J6YA 5LP0A 2IFUA 3CK7A 4LERA 3L54A 3GW4A 5AENA 2MLZA 2GRQB 2GGFA 4N3AA 4IQCA 4Y6CA 1F8AB 2DG9A 3FTVA 3KABA 1OWLA 1ELWA 4GTSA 4HI9A 2XHEA 1DNPA 4MKTA 4H7YA 2L9BA 4NSBA 2XGSA 1WAO1 4HS2A 3I6CA 2ESCA 3NOCD 1FCHA 2JZVA 3U9WA 1J4RA 2XRYA 1FJDA 4MTVA 3GZ1A 3G6MA 3TWWA 4PH4B 4GTTA 2RUQA 3TWTA 4C0MA 2A3CA 3R7QA 3JXIA 3UKRG 5ENQD 2FO7A 2AJAA 5D66A 1S70B 4Z2LA 3UIOC 1E7UA 5CBOA 5M72A 2LO6A 2LGOA 2WXKA 4KYOB 1OT8A 3R9AB 4IRUA 1BU9A 3D9OA 2WM0A 2AVPA 3UT8A 1H0IA 3L9TA 1YCSB 3KCEA 4KBQA 5C1DA 3LKUA 3UI2A 2J9QA 3RRNB 3FUMA 2PQNA 1KLXA 3I5PA 3CGNA 3FUKA 4RSYA 4NIKA 2DT2A 4UWHA 2C0LA 1YMPA 4GB9A 3O5DA 4I2WA 4WWNA 3KEZA 3ESKA 3PZDA 1KPSB 4HOQA 2VCDA 4U96D 1N0QA 3KZ7A 2M08A 3LY7A 1LQ0A 2WXRA 2DWZA 3TXNA 4DX2A 1OWOA 3SHFA 3T5VA 2DT3A 2YQ8A 5FQ7A 4RVBA 1E6RA 5JMND 3J5QB 3DXMG 4U0UA 4XE0A 4UI9C 4MSPA 4DRNA 4TW6A 3AG1E 1N9AA 3GTYX 4NURA 5HKPA 1FT2A 4KZCA 4HARA 4G24A 1Q2ZA 3CHMA 5D0OD 4G23A 4GYWA 4ACLA 4K03A 1TN8A 1Z6TA 2YNQA 5AJDA 2WQHA 1WAWA 3FU3A 3ZYQA 2H6FA 4AY6A 2MLXA 3MCXA 4GZ6A 2ETNA 4XKBA 2R05A 4B8AA 3TWQA 3EY6A 3D9IA 5BNWA 3PZ1A 1NWSA 4TUUA 5ENRD 1DVPA 3ZVVA 1N11A 4UQXA 3BEEA 3P1UA 4HI8A 2IU1A 1EF1C 3ULQA 4BWRA 4ML4A 3JUEA 2WLYA 4AM9A 4N2SA 4GTPA 3PRZA 3TG4A 3PA7A 2WK2A 5KJKA 3Q47B 4P8VA 5ANRA 3O5RA 3ZNGA 3FP3A 4I6GA 3NTPA 4ANXA 1AWCB 1LL6A 3D9HA 3TXMA 3NZSA 3UI4A 1GUVA 4DI3A 3SZ7A 5ARFA 3U3WA 4LAYA 3APCA 1NA0A 2H6HA 5JHAA 2RD0A 4EZJA 4KXKB 3GYZA 2UY1B 3MX3A 3RJVA 2O9OA 4B93B 5HW8A 4YVQC 4S3KA 3SQVA 1N1AA 5FQ8A 3TC5A 1JCRA 3ZW3A 3S2AA 4Z2HA 2XP5A 1HU3A 3HXFA 3ARQA 1Y0OA 4U8YD 3UT4A 4ZPTR 5KWDA 5B1AE 1QYMA 1HX8A 4MS6A 1B6CA 2FI7A 3Q5MA 4DIPA 4FU3A 4ITZA 1KT0A 2PZIA 2ZQSA 2HR2A 1HS6A 5E75A 2KI3A 3IHYA 5JJTA 5CERB 2J8SD 4N3BA 3VTYA 1XHGA 2DG3A 3SO8A 3EDTB 4QFVA 5EIDA 2VGXB 4O2TA 3I3NA 2RQSA 3OXLA 4UWKA 5LOZA 2KCLA 3OTNA 5CCLA 2P2CP 4R0XA 3TWRA 2RUCA 2LSUA 2P9IG 3KSQA 4J7WA 3R9MA 4C02B 2M63A 4U86A 3EHRA 2G41A 4U84A 2R03A 1K9TA 2HE0A 2PPNA 1LD7A 3CHQA 5DITA 5BT1A 2DVWA 2EINE 3HXBA 2ZIRA 5BPPA 1N0RA 2IF4A 2DYRE 3FH7A 2V5FA 4PDXA 4CT0A 1JNSA 2PV3A 4LCTA 2X6FA 1QPLA 4ZHBA 1U2VG 3AU5A 2MNTA 2WLZA 2ZGGA 5G04C 1FKSA 1UR9A 1ZL1A 4KVMA 3SF4A 3LUOA 3LY8A 4I2ZA 2XEHA 5G55A 2R17C 3BMBA 3SNXA 4ODRA 2I1KA 3L08A 2DSWA 3PEUB 1JCSA 3FXYA 2KE0A 4HBOA 2ZR4A 2VSNA 4JFJA 4DX1A 2FBNA 3RK6A 5ARGA 1LL4A 3QWVA 4U8HA 4XI0A 2LKNA 3W9FA 4Z2IA 1Z5SC 3S7BA 4A1SA 3ESLA 2IEJA 3W9GA 2XP6A 3EHQA 3CVWA 3WIJA 2F4EA 4RQIA 2WXMA 2AXUA 4UUCA 3AS1A 1H0AA 4LRZA 4ODLA 2WXPA 2XGMA 4MNJA 4G26A 3B9DA 4OAUC 3CVVA 3CHSA 2V4HC 2IOLA 4ZFHA 1HKMA 2IJGX 3NQPA 1OCZE 3BG1B 1H6KA 1N95A 1KZPA 3JCKC 3ZFWA 3PS6A 3G6LA 1BLXB 3IHZA 4WIWA 3RO3A 3W4RA 3B7UX 1FFQA 1HKIA 2GRRB 2RG8A 4KZ0A 2N87A 2XZDG 4GTQA 4ATZD 1D8EA 2F8YA 3BG0B 3CR3A 1S0PA 4D10C 2LXMA 4JB8P 5HWCA 2WQ7A 3JYMA 3C3OA 4N2QA 4JHJA 4XEIG 2DPEA 3V2OA 4ILHB 5BXOA 4CGVA 3CK8A 3DSXA 4DUIA 1A17A 1FFRA 4ANVA 4PS8A 3NRKA 2IOSA 4FJYA 3R7RA 3MZLB 3IKGA 4JC8A 3O5GA 4MNKA 4AJWA 1MHQA 3CKBA 3ABLE 3CHCA 1FKFA 2EIKE 3RM8A 4K5BA 2L6JA 3PREA 2BUGA 4XKCA 4WWPA 3ALGA 5CRVA 1W3BA 4WKFA 2XZTG 1FKHA 3CSTA 2VSYA 3UQAA 1M5YA 4AV7A 4EECA 2OEWA 1Q6HA 4TW7A 1TR4A 3ONLA 4DRMA 2LJ4A 1DCQA 2IY0C 4F3VA 1E8XA 4Z2JA 4AXHA 3IKOB 3IV0A 4QT3A 2AW6A 3RO2A 3FH8A 1E8YA 5LFAA 1LG1A 5A23A 4AY5A 2P9NG 4PS7A 3DPYA 3LYAA 4ODKA 2XP4A 4BTAA 5JJ7A 4AY1A 3EHMA 4G25A 3PNTB 4Q94A 1OGBA 4L9PA 1QNFA 4UWLA 1SYTA 1FVFA 4H7XA 4FP7A 3CHFA 4U85A 4AOFA 1OWPA 3HXCA 2XPYA 3QOUA 2AXVA 1MJ0A 4HFGA 1UOHA 2PNNA 2XPZA 2X6JA 4DK5A 3ISMC 3RGCA 2P9PG 1FKIA 2PL2A 2XCCA 3FFLA 2RKKA 1KFWA 4WAFA 2L6BA 1TN6A 3N71A 3ASNE 5HS0A 3SGHA 5KJLA 4C48B 4JEHA 3E37A 1ITXA 2PV1A 3NI6A 2AWIA 1ZU2A 4WKHA 4JW1A 2NYJA 4GZ3A 4HOTA 4J8SA 3QK0A 1W9PA 2VGXA 3IBEA 2MYOA 3FUEA 2ZR6A 4BFRA 1JWFA 4R7LA 1D8DA 4HNAD 3JYSA 3NB2A 4FLHA 2GRNB 4U04A 3ML8A 5T4YA 3O5EA 2Y78A 3UIPC 3ASFA 1R9HA 1E8WA 3UTMA 4ACKA 3PZ3A 4W5UA 3TJPA 3Q4AB 3B8SA 2ZGDA 3TL5A 4CEMA 1Q6IA 4CZ2D 4B94A 3OAWA 3UMVA 5JA4D 3FU5A 4HRNA 5EILA 2JABA 3UI5A 3MKQB 3OXFA 3BU8A 4WNDA 3NBNB 2XP9A 4TW8A 5LCWJ 5JJ6A 1VDYA 3HIZA 2VYIA 5B3SE 2YBTA 3TCZA 4F7AA 3PE3A 1DCEA 3PNLB 4Z2GA 4UDMA 3AS8A 4XIFA 4FC8A 4WWOA 4YDWA 2DG4A 4FHJA 4GGQA 3CGMA 1WB0A 2YINA 4DRXE 5FWQA 1WY6A 4DZ3A 3TG5A 1S63A 3RMEA 2XRZA 1N4RA 2RSEA 2LPVA 4HBEA 2LXLA 4J8FA 3FWVA 4LNBA 4I43A 4F6RD 2ZR5A 4TNSA 2NC9A 3C98A 3KAFA 1RW2A 5HKGA 3DSTA 3FTXA 3WD3A 2IQCA 3NZUA 1SA5A 4GMRA 5A6CA 3ULYA 2O92A 3GZSA 1H2VC 1TJFA 2RFAA 2L0TB 4GZ5A 4Q96A 1N52A 2WXLA 3ZU7B 3Q49B 4BF8A 2CG2A 1Y6IA 4GPKA 2G8ZA 3ZHEB 4L23A 2IO2C 1TJCA 3DSWA 4DRPA 4QT2A 1QQEA 3PRAA 3TDBA 3ASOE 5BV0A 3UPVA 1G3NB 3ZRHA 2WXHA 3ZHEA 2L2SA 3AS0A 2RFMA 4A3TA 4BEPA 3UF8A 1RZ4A 4GMJA 4O60A 5CMYA 3DSUA 2AOSA 1BL4A 1NMWA 3KAHA 4DWSC 5G05C 1E15A 2V4LA 2D9FA 1HJWA 3AROA 2XEVA 2X6HA 3L6AA 3ZYMA 4Q69A 3RIBA 2OLHA 3O5LA 1V55E 1N4SA 4L2LA 3UQIA 4K0RA 3DSVA 4YNDA 3LVQE 4AVXA 2KCVA 2KR7A 1NMVA 4WUYA 2P58C 5J90A 1FKGA 2VSOE 3CHDA 4I1AA 4N5CA 3UM2A 3Q75A 2CHWA 4UWGA 5FT9A 1J4HA 1GPFA 1HG2A 3Q7FA 1D9SA 4OAVB 1ROTA 1GW6A 1IQRA 2VSXE 4QQIA 3E4BA 2BEDA 2WVIA 2QZAA 3UM1A 4TYOA 2B6CA 4NQ0A 4U7EB 1UJKA 2KCKA 2Y69E 4G8KA 3DEOA 2X6KA 3OOBA 1L5JA 1H6OA 1JVWA 3SI5A 1E6PA 1NWRA 5HUAA 4MBGA 2MLYA 1O1TA 3AG3E 1KZOA 4JFIA 3UQBA 2YBUA 3S7FA 2IO3C 3U66A 2F8XK 2C2LA 4JFMA 3CHPA 4Z2KA 3P2BA 2P4VA 1WNOA 3HVEA 3BUAA 5H7PA 4BERA 4BSZB 2H6GA 4O6FA 2Y0BG 3ARSA 3KD7A 3JXVA 5DIVA 5G04J 2XP8A 3EIQC 4GYOA 3ZGQA 2XPAA 5I98A 3ZUVB 5EX0A 4DRHA 3V79K 3NAWA 3HHMA 3KACA 1WM5A 2FAPA 1MQSA 1QZ2A 1BD8A 1OY3D 4CDRA 2XPIA 2A3EA 4GYYA 1X81A 4M7CA 3MV3B 3OA5A 4WNGA 4WKAA 3JXJA 3GPKA 2GROB 3L17A 4GPMA 3CVYA 3FUIA 1E90A 4B89A 4J6IA 5GQBA 4JL0A 3UM3A 4FULA 4OVVA 4Z68A 4MLPA 3O5FA 4FLBA 2VGYA 1D7JA 4KT6B 3TAXA 1LTXA 3FTWA 4GTMA 1HJXA 3AQUA 3IXEA 1PAQA 3K9IA 3ZEFA 3MKQA 1E44A 3IKDA 4UWFA 4APOA 2BKKB 3WD2A 4P8UA 1T11A 1TFVA 4GZDA 4IN3B 4ODNA 2QY7A 3L22A 3IHVA 3WD4A 3TWVA 4J8EA 1SZAA 1QBQA 1FKLA 4JVSA 4J4NA 5CCMA 3SD5A 3Q9UC 1TNYA 2KGJA 2NXPA 3VAWA 4ABNA 4C9BB 3AJIA 4XX5A 5AQAA 5EYPF 1PC2A 4EBAA 4URKA 1EPUA 3ARYA 5BW8C 2R5SA 2OEVA 3AS4A 4A1GA 1KT1A 2PN0A 4U0ZA 1E6NA 2F0YA 1P5QA 1H0GA 1TNBA 3B7XA 2HYZA 3FHEA 5D2MC 1W26A 2A3AA 4W9OA 3VLDA 2QFCA 1Q6UA 3CVNA 5BV1A 3CHOA 4B8CB 4JA7A 3B9EA 3C3RA 2VN1A 2DT0A 4W9QA 2DT1A 4DX5D 4ZPVR 2DBAA 4ME2A 4URIA 3CH9A 3NF1A 4CDMA 1EHNA 3B9AA 3FTUA 5AQBA 1X6LA 4GA0A 1UR8A 1NWUA 4DWSD 3CHEA 2X38A 2Q7FA 1DC2A 4CCAA 1NA3A 2PPOA 3HDXA 1N4PA 1H19A 4ZS6A 2HO1A 4DPRA 1IHBA 3ZYLA 3QWPA 5DIUA 2OVFA 5KNHD 3IEGA 4O1PA 4P29A 3EIPA 2Y4TA 5AQ7A 1E8ZA 2WXOA 3B7BA 2F2DA 1ZBWA 2LUHA 4V3IA 3JQ0A 5FQ4A 1ZU8A 2EILE 4W9PA 4ZPWR 1W1TA 4GTVA 3ULEG 4JYSA 3PRDA 3EUVA 1D7HA 3O5OA 3CVUA 2ZQTA 4UQZA 2CG3A 1TNUA 4DRIA 1GRJA 3ZKJA 3AG4E 2L0IA 3GU0A 3S7JA 5JHBA 1NZNA 3EU5A 3NOGD 3C3QA 1TN7A 2P9KG 3LDZA 1HF8A 2XS1A 1B89A 4EQFA 4UI9J 3FUDA 3Q7AA 4NACA 4ANWA 5EKQD 2V5QC 5AQ9A 2HM8A 2ONDA 3U4TA 2KO7A 5HW6A 4L2YA 4MGVA 5HQ8A 3D9KA 3JUIA 4IT4A 4GMLA 4DJAA 4DWSA 4GAAA 5KJMA 3MEKA 1NWTA 3ASGA 1W1VA 4XAKA 1VF8A 2DYSE 2M1IA 4HLEA 3FTYA 1W9VA 3O5JA 1HG5A 2RURA 2J08A 5EIBE 5B8IC 5GPRA 2GRPB 4GZCA 5ENNA 3TGOA 1FKKA 5DBKA 4MNMA 4J4OA 3AU4A 4L1BA 1SW6A 4JHRA 5HT1A 1PINA 3KS2A 4EZLA 3PVLA 5FINA 4ODPA 1UN9A 5CRUA 1FT1A 3ONKA 2XEEA 3G2WA 3ARPA 2LSVA 1TNOA 1E6ZA 3DRAA 4ILGA 3ABME 2ZQUA 3QC1A 3KAEA 3CVQA 3FU6A 4BT9A 5HBFA 4I6JA 4LNGA 4FHKA 2BF0X 4KMOA 4HVBA 1JUQA 3GZ2A 1MYOA 1UW4B 4LGXA 3ML9A 3FTSA 5KBAA 4BSXA 3RSEG 4I1OB 2P9UG 4I9CA 4J8DA 3ARXA 1NI1A 3PE4A 4DI4A 3ZXSA 4TXPA 1SQMA 2XGOA 1JCHB 1ZBKA 2WXNA 1MZCA 2EQXA 3Q73A 5FZQA 1TNZA 3MJWA 3IK8A 3ZXPA 2RUDA 4GA1A 2BTDA 2KXPC 1LJYA 4Y6WA 1AP7A 2PQRA 2AWGA 2X3MA 4MRUA 1EYMA 4UQYA 1Z3YA 4B0ZA 2Y1LE 3QDNA 4I17A 1ZBPA 4G8LA 3J5PA 1W1PA 4HORA 3CKCA 2JEKA 1IXVA 2WXGA 1SVXA 3HXDA 1OWNA 3L16A 4DX7D 4DROA 1H6PA 5BXJA 3TWSA 3EIJA 2J49A 2KC7A 1UN8A 2B5UB 2VJ8A 2YHCA 4UI9K 4M3OA 3CIAA 3BXWA 1ELKA 4MNLA 1SA4A 4TXQA 5BXUA 5ENSD 5KNGA 4U07A 3UINC 3O48A 1Z3XA 4TX0A 5G2NA 3PRBA 2OVBA 5HW7A 1IYGA 1YATA 1YW5A 3FY1A 2ETCA 1LF8A 2J09A 4IULA 3WQVA 5CECB 3CZ8A 2CHZA 2ITKA 5HRYA 1IHGA 5T8IA 1Y8MA 3PUKA 5JH8A 1RD6A 4RG6A 3UKUG 1IX5A 4BTBA 1FKDA 3HYMB 3WG7E 2LAIA 2J4BA 3FULA 2KZTB 2PBCA 3AS3A 5A7DB 3I4GA 4YVOA 4W9RA 4S3JA 4G11A 1NL4A 2NSZA 1SZ9A 2C0MA 5T3RA 1ZBVA 2MPHA 1K1AA 2KZTA 2OV8A 2QYJA 3KSLA 3WH0A 2LAHA 3KAIA 4KR0B 1K8KG 4LUNU 4LEUA 1NP7A 3HG0D 3Q9NC 4JHKA 3SFXA 4HRMB 4I1MA 2IONA 1E7VA 5AARA 3F6QA 4CT4A 2ETBA 3MGBA 3PZ2A 3RKVA 4JPSA 4JZYA 3DSSA 2J07A 4CGWA 2VTBA 1IQUA 4NRHB 2XS8A 2ZXWE 4P8WA 3ABKE 2Y3AA 3LJNA 1TEZA 1MX2A 4HRLA 4JFLA 4PTMA 3L13A 1JWGA 4ODQA 4KVOA 4L72B 4DT4A 5ITZF 3AG2E 2E2EA 3FUFA 4XI9A 3G2TA 4L3NA 3VTXA 4FN2A 4NNRA 3D9MA 4GTOA 3I4RB 3H9RB 3APDA 1E96B 2XPBA 2M2AA 4E6HA 3CV0A 4GCNA 4G2VA 4FAPA 5EX3A 3O4ZA 3LY9A 4N39A 4LAXA
chains in the Genus database with same CATH topology
1ROUA 5FQ6A 4MPKA 1HKJA 2UY1A 1BPOA 1PBKA 2WB2A 4GA2A 3FEYA 2R59A 4HXIA 3WD0A 3CK9A 2XQ0A 1NH6A 4EPZA 3S7DA 3ARZA 3FH5A 4LAVA 3FUJA 3G2SA 5C2YA 1UG3A 4CRWA 1TCOC 3JYJA 4IT6A 3SBTB 3ARTA 1FKBA 3URZA 4RG9A 2QF8A 2XP7A 2B31A 4I9EA 4AP2A 3LPZA 4MAVA 1L1PA 4WNFA 3CVPA 3LS8A 3PUJA 4WNEA 1FKTA 4CDNA 4IPXA 3WL0A 3QWWA 2PPPA 1HXVA 3PDNA 3QB2A 5HI7A 3O5IA 5E76A 3ODKA 4I6EA 1EYHA 1X5BA 1W1YA 2DCPA 4ILIA 1ZB5A 1PY1A 2MOWA 3WL1A 3WD1A 2OOEA 3JQ1A 1D6OA 2FULA 3AS5A 3APFA 3CVLA 5KCMA 2V8SE 4IQ2A 2WXIA 5CMWA 3ASHA 2I6HA 4PUCA 3O5QA 1C9HA 3ZPJA 2GRLA 3UX4A 3B7SA 4J0UA 4ODMA 3O5KA 2FDMA 1E9LA 3FUHA 4GU5A 2X6IA 3ASDA 4HOSA 3MKRA 1HH8A 2ZQVA 4WJXA 3ZIMA 3O5PA 2WMNA 1O6IA 4N3CA 5AJLA 2VQ2A 5DEZA 1ZCNA 4DRKA 2YHEA 2PV2A 5AYWD 1EQ3A 2A5UA 4N19A 2WXJA 4PS3A 1A7XA 4G2PA 3FDHA 3ARUA 4QIBA 4LAWA 1W9UA 4G1TA 2CFUA 4DH0A 1JPLA 3DBSA 2MHKA 1U3CA 3CGHA 3CQGB 1XGWA 3CHRA 4BX9A 3D9NA 4GIVA 4DZ2A 1LL7A 1HKKA 4F53A 1INZA 2MF9A 3MDYB 1D7IA 2KM4A 2I1JA 1OWMA 4JEUA 5ANLA 2GW1A 4DLOA 5KJNA 3WKZA 2JLBA 1HFAA 3ALFA 4JA9A 4KQZA 2V0PA 1U79A 3WXXA 1XRVA 1HJVA 3MYVA 2WM9A 3QKYA 3VLEA 1ZBCA 2DSVA 4A3VA 3FAPA 1BKFA 1Q1CA 1OGGA 4XZ4A 3B7RL 4EBAG 4FA6A 2I9CA 3PEVB 5EDSA 5DF0A 3RFWA 5D0QD 4G50A 2XCBA 2CHXA 4A55A 3RRMB 3EHNA 3KADA 1EDQA 4U0SA 1ZK6A 3G2UA 4IYPA 4AIFA 3PR9A 3B7TA 3LCAA 1H2TC 2ZU6B 3CVXA 2F21A 1XNFA 4DRJA 2UZ5A 1D2KA 3HVEB 3T5XA 1QPFA 5G05J 1CTNA 3ENEA 1FKRA 3CLJA 2PM7A 4DRQA 3B13A 3ARWA 2DSZA 3AS2A 2OFNA 3FY4A 1NSGA 2WPVA 4QZVB 3D9JA 2WMOA 2PM6A 3WQWA 4ANUA 2A3BA 1HZ4A 4DLQA 1J4IA 2FEZA 3D3MA 4FADA 2LNIA 1LG2A 3QAQA 5DO2A 3LJ3A 3Q15A 3D9PA 2WXFA 4APFA 3VLFA 2AXZA 3SFZA 2K8IA 2KATA 1GOIA 3ARVA 5FZRA 5HTGA 1HE8A 1JNEA 5HWBA 3ARRA 4JXTA 1HO8A 4WK9A 4OVUA 3FTZA 3QNKA 5LCWC 2DSUA 2FKEA 4TRQA 2Q5AA 3ZN3A 3RM9A 1FVHA 1EDUA 2WXQA 5LX8A 5CHEE 3D9LA 4E85A 1FAPA 3FU0A 2UWJG 2A4ZA 1F40A 2IUZA 4FJZA 3QOKA 4NZCA 4ODOA 3MA5A 5FTPA 4GCOA 2PI6A 1ELRA 1JNDA 3OXGA 4AEZC 5J6EA 3RU0A 1YA0A 1H2UA 5DIZA 2XP3A 4P8XA 3UQ3A 3ZYKA 4OYSA 3G2VA 3QJZA 2CFZA 2I2OA 3UUXA 3LXUX 2DIWA 2ILRA 1FD9A 2WQ6A 1OWQA 5D75A 3RM4A 3CEQA 3QARA 4C0EA 4R5EA 1FKJA 3U64A 3CQCB 2MRIA 3LVRE 5BUZA 3O5MA 3MV2B 2J4DA 4DWSB 1JNTA 1UJJA 3SBSA 4EZKA 1N54A 2Y4UA 4Q22A 2FF4A 3RRUA 4ATGA 3DPDA 5FJYA 3UT7A 4L7TA 3EJNA 3LEWA 4BT8A 5J08A 4U63A 4F1SA 4TV3A 3FEXA 1X6NA 4JFKA 2VTBB 4BY6A 1OUVA 5FZSA 3CSFA 3FUNA 3PH0C 3KAGA 5GPGA 2KFWA 1SR0A 2GRMA 1HXIA 2E0IA 3T8MA 5AIJA 4BX8A 3UI6A 4Q7NA 1EIBA 4HOUA 1U3DA 1J6YA 5LP0A 2IFUA 3CK7A 4LERA 3L54A 3GW4A 5AENA 2MLZA 2GGFA 4N3AA 4IQCA 4Y6CA 1F8AB 2DG9A 3FTVA 3KABA 1OWLA 1ELWA 2XHEA 1DNPA 4MKTA 4H7YA 2L9BA 4NSBA 2XGSA 1WAO1 4HS2A 3I6CA 2ESCA 1FCHA 2JZVA 3U9WA 1J4RA 2XRYA 1FJDA 4MTVA 3GZ1A 3G6MA 4PH4B 2RUQA 4C0MA 2A3CA 3R7QA 2FO7A 4Z2LA 1E7UA 5M72A 2LO6A 2LGOA 2WXKA 4KYOB 3R9AB 4IRUA 3D9OA 2WM0A 2AVPA 3UT8A 1H0IA 3KCEA 4KBQA 5C1DA 3LKUA 2J9QA 3RRNB 3FUMA 2PQNA 1KLXA 3I5PA 3CGNA 3FUKA 4RSYA 2DT2A 4UWHA 2C0LA 4GB9A 3O5DA 4I2WA 4WWNA 3KEZA 3ESKA 3PZDA 2VCDA 4HOQA 3KZ7A 2M08A 3LY7A 1LQ0A 2WXRA 3TXNA 1OWOA 3SHFA 3T5VA 2DT3A 2YQ8A 5FQ7A 4RVBA 1E6RA 4U0UA 4XE0A 4UI9C 4MSPA 4DRNA 4TW6A 4NURA 4KZCA 4HARA 4G24A 5D0OD 3CHMA 4G23A 4GYWA 4ACLA 4K03A 1Z6TA 2YNQA 5AJDA 2WQHA 1WAWA 3FU3A 3ZYQA 4AY6A 2MLXA 3MCXA 4GZ6A 4XKBA 4B8AA 3EY6A 3D9IA 5BNWA 1NWSA 4TUUA 1DVPA 3ZVVA 4UQXA 3BEEA 3P1UA 2IU1A 1EF1C 3ULQA 4BWRA 4ML4A 2WLYA 4AM9A 4N2SA 3TG4A 3PRZA 3PA7A 2WK2A 5KJKA 4P8VA 3Q47B 5ANRA 3O5RA 3FP3A 4I6GA 3NTPA 4ANXA 1LL6A 3TXMA 3NZSA 3UI4A 1GUVA 4DI3A 3SZ7A 5ARFA 3U3WA 4LAYA 3APCA 1NA0A 5JHAA 2RD0A 4EZJA 4KXKB 3GYZA 2UY1B 3MX3A 3RJVA 2O9OA 5HW8A 4YVQC 4S3KA 1N1AA 5FQ8A 3TC5A 3ZW3A 3S2AA 4Z2HA 2XP5A 1HU3A 3ARQA 1Y0OA 3UT4A 4ZPTR 1HX8A 4MS6A 1B6CA 2FI7A 3Q5MA 4DIPA 4FU3A 4ITZA 1KT0A 2PZIA 2ZQSA 2HR2A 1HS6A 5E75A 2KI3A 3IHYA 5JJTA 4N3BA 3VTYA 1XHGA 2DG3A 3EDTB 4QFVA 4O2TA 2VGXB 3I3NA 2RQSA 3OXLA 4UWKA 5LOZA 2KCLA 3OTNA 5CCLA 4R0XA 2RUCA 2LSUA 4C02B 2M63A 4U86A 2G41A 4U84A 1K9TA 2PPNA 3CHQA 5DITA 5BT1A 5BPPA 2IF4A 3FH7A 2V5FA 4PDXA 4CT0A 1JNSA 2PV3A 4LCTA 2X6FA 1QPLA 3AU5A 2MNTA 2WLZA 5G04C 1FKSA 1UR9A 1ZL1A 4KVMA 3SF4A 3LUOA 3LY8A 4I2ZA 5G55A 2R17C 3SNXA 4ODRA 2I1KA 3L08A 3O4ZA 2DSWA 3PEUB 3FXYA 2KE0A 4HBOA 2ZR4A 2VSNA 4JFJA 2FBNA 3RK6A 5ARGA 1LL4A 3QWVA 4U8HA 4XI0A 2LKNA 4Z2IA 3S7BA 4A1SA 3ESLA 2XP6A 3CVWA 3WIJA 2F4EA 2WXMA 2AXUA 3AS1A 1H0AA 4LRZA 4ODLA 2WXPA 2XGMA 4MNJA 4G26A 3B9DA 3CVVA 3CHSA 2IOLA 1HKMA 2IJGX 3NQPA 3BG1B 1H6KA 3G6LA 3IHZA 3JCKC 3PS6A 3ZFWA 4WIWA 3RO3A 3W4RA 3B7UX 1FFQA 1HKIA 2RG8A 4KZ0A 2N87A 3BG0B 3CR3A 1S0PA 4D10C 5HWCA 2WQ7A 3JYMA 4N2QA 4JHJA 2DPEA 4ILHB 4CGVA 3CK8A 1A17A 1FFRA 4ANVA 4PS8A 3NRKA 2IOSA 4FJYA 3R7RA 3MZLB 3IKGA 4JC8A 3O5GA 4MNKA 4AJWA 1MHQA 3CKBA 3CHCA 1FKFA 3RM8A 2L6JA 3PREA 2BUGA 4XKCA 4WWPA 3ALGA 1W3BA 4WKFA 1FKHA 3CSTA 2VSYA 3UQAA 1M5YA 4AV7A 4EECA 4TW7A 1Q6HA 3ONLA 4DRMA 2LJ4A 4F3VA 1E8XA 4Z2JA 4AXHA 3IKOB 3IV0A 4QT3A 2AW6A 3RO2A 3FH8A 1E8YA 5LFAA 1LG1A 5A23A 4AY5A 4PS7A 3LYAA 4ODKA 2XP4A 4BTAA 5JJ7A 4AY1A 3EHMA 4G25A 3PNTB 4Q94A 1OGBA 1QNFA 4UWLA 1SYTA 1FVFA 4H7XA 4FP7A 3CHFA 4U85A 4AOFA 1OWPA 2XPYA 3QOUA 2AXVA 4HFGA 2XPZA 2X6JA 4DK5A 3RGCA 1FKIA 2PL2A 2XCCA 3FFLA 1KFWA 4WAFA 3N71A 3SGHA 5KJLA 4JEHA 1ITXA 2PV1A 3NI6A 2AWIA 1ZU2A 4WKHA 4JW1A 4GZ3A 4HOTA 4J8SA 3QK0A 1W9PA 2VGXA 3IBEA 3FUEA 2ZR6A 4BFRA 1JWFA 4R7LA 3JYSA 4FLHA 4U04A 3ML8A 5T4YA 3O5EA 2Y78A 3ASFA 1R9HA 1E8WA 4ACKA 4W5UA 3TJPA 3Q4AB 3B8SA 3TL5A 4CEMA 1Q6IA 4B94A 3OAWA 3UMVA 3FU5A 3UI5A 3MKQB 3OXFA 4WNDA 2XP9A 4TW8A 5LCWJ 5JJ6A 1VDYA 3HIZA 2VYIA 2YBTA 3TCZA 4F7AA 3PE3A 4Z2GA 3PNLB 3AS8A 4XIFA 4FC8A 4WWOA 2DG4A 4FHJA 4GGQA 3CGMA 1WB0A 2YINA 5FWQA 1WY6A 4DZ3A 3TG5A 3RMEA 2XRZA 2RSEA 2LPVA 4HBEA 4J8FA 3FWVA 4I43A 2ZR5A 4TNSA 2NC9A 3C98A 3KAFA 5HKGA 3FTXA 3WD3A 2IQCA 3NZUA 5A6CA 2O92A 3GZSA 1H2VC 1TJFA 2L0TB 4GZ5A 4Q96A 1N52A 2WXLA 3Q49B 4BF8A 2CG2A 1Y6IA 4GPKA 2G8ZA 3ZHEB 4L23A 1TJCA 4DRPA 4QT2A 1QQEA 3PRAA 3TDBA 5BV0A 3UPVA 3ZRHA 2WXHA 3ZHEA 2L2SA 3AS0A 4A3TA 3UF8A 4GMJA 5CMYA 2AOSA 4DWSC 1BL4A 1NMWA 3KAHA 5G05C 1E15A 2V4LA 2D9FA 1HJWA 3AROA 2XEVA 2X6HA 3L6AA 3ZYMA 4Q69A 3RIBA 2OLHA 3O5LA 4L2LA 3UQIA 4K0RA 4YNDA 3LVQE 4AVXA 2KCVA 2KR7A 1NMVA 4WUYA 2P58C 5J90A 1FKGA 2VSOE 3CHDA 4I1AA 4N5CA 2CHWA 4UWGA 5FT9A 1J4HA 1GPFA 1HG2A 1ROTA 1GW6A 1IQRA 2VSXE 3E4BA 2WVIA 4TYOA 4NQ0A 1UJKA 2KCKA 2X6KA 3OOBA 1L5JA 1JVWA 3SI5A 1E6PA 1NWRA 5HUAA 2MLYA 3UQBA 4JFIA 2YBUA 3S7FA 3U66A 4JFMA 2C2LA 3CHPA 4Z2KA 3P2BA 1WNOA 3HVEA 4O6FA 3ARSA 3KD7A 3JXVA 5DIVA 5G04J 2XP8A 3EIQC 4GYOA 3ZGQA 2XPAA 5I98A 5EX0A 4DRHA 3HHMA 3KACA 1WM5A 2FAPA 1MQSA 1QZ2A 4CDRA 2XPIA 2A3EA 4GYYA 3MV3B 3OA5A 4WNGA 4WKAA 3GPKA 3L17A 3CVYA 3FUIA 1E90A 4B89A 4J6IA 5GQBA 4JL0A 4FULA 4OVVA 4MLPA 3O5FA 4FLBA 2VGYA 1D7JA 4KT6B 3TAXA 3FTWA 1HJXA 3AQUA 1PAQA 3K9IA 3ZEFA 3MKQA 3IKDA 4UWFA 4APOA 3WD2A 4P8UA 1T11A 1TFVA 4GZDA 4IN3B 4ODNA 2QY7A 3L22A 3IHVA 3WD4A 4J8EA 1SZAA 1FKLA 4JVSA 4J4NA 5CCMA 3SD5A 2KGJA 2NXPA 3VAWA 4ABNA 4C9BB 4XX5A 1PC2A 4EBAA 4URKA 1EPUA 3ARYA 5BW8C 2R5SA 3AS4A 4A1GA 1KT1A 4U0ZA 1E6NA 1P5QA 1H0GA 2HYZA 3FHEA 1W26A 2A3AA 4W9OA 3VLDA 2QFCA 1Q6UA 3CVNA 5BV1A 3CHOA 4B8CB 4JA7A 3B9EA 2VN1A 2DT0A 4W9QA 2DT1A 4ZPVR 2DBAA 4ME2A 4URIA 3CH9A 3NF1A 4CDMA 1EHNA 3B9AA 3FTUA 1X6LA 4GA0A 1UR8A 1NWUA 4DWSD 3CHEA 2X38A 2Q7FA 4CCAA 1NA3A 2PPOA 3HDXA 1H19A 4ZS6A 2HO1A 4DPRA 3ZYLA 3QWPA 5DIUA 2OVFA 3IEGA 4P29A 2Y4TA 1E8ZA 2WXOA 2F2DA 1ZBWA 4V3IA 3JQ0A 5FQ4A 1ZU8A 4W9PA 4ZPWR 1W1TA 4JYSA 3PRDA 1D7HA 3O5OA 3CVUA 2ZQTA 4UQZA 2CG3A 4DRIA 2L0IA 3S7JA 5JHBA 1NZNA 3LDZA 1HF8A 1B89A 4EQFA 4UI9J 3FUDA 4NACA 4ANWA 5EKQD 2HM8A 2ONDA 3U4TA 2KO7A 5HW6A 4L2YA 4MGVA 5HQ8A 3D9KA 3JUIA 4IT4A 4GMLA 4DJAA 4DWSA 4GAAA 5KJMA 3MEKA 1NWTA 3ASGA 1W1VA 4XAKA 1VF8A 2M1IA 4HLEA 3FTYA 1W9VA 3O5JA 1HG5A 2RURA 2J08A 5B8IC 5GPRA 4GZCA 5ENNA 3TGOA 1FKKA 5DBKA 4MNMA 4J4OA 3AU4A 4L1BA 4JHRA 5HT1A 1PINA 3KS2A 4EZLA 3PVLA 4ODPA 1UN9A 3ONKA 3G2WA 3ARPA 2LSVA 1E6ZA 4ILGA 2ZQUA 3QC1A 3KAEA 3CVQA 3FU6A 4BT9A 5HBFA 4I6JA 4FHKA 2BF0X 4KMOA 4HVBA 1JUQA 3GZ2A 1UW4B 4LGXA 3ML9A 3FTSA 4BSXA 4I1OB 4I9CA 4J8DA 3ARXA 3PE4A 4DI4A 3ZXSA 1SQMA 2XGOA 1ZBKA 2WXNA 2EQXA 5FZQA 3MJWA 3IK8A 2RUDA 4GA1A 2BTDA 1LJYA 4Y6WA 2PQRA 2AWGA 2X3MA 4MRUA 1EYMA 4UQYA 1Z3YA 4B0ZA 3QDNA 4I17A 1ZBPA 1W1PA 4HORA 3CKCA 2JEKA 2WXGA 1OWNA 3L16A 4DROA 5BXJA 3EIJA 2J49A 2KC7A 1UN8A 2VJ8A 2YHCA 4UI9K 4M3OA 3CIAA 3BXWA 1ELKA 4MNLA 4U07A 3O48A 1Z3XA 4TX0A 5G2NA 3PRBA 2OVBA 5HW7A 1IYGA 1YATA 1YW5A 3FY1A 1LF8A 2J09A 4IULA 3WQVA 3CZ8A 2CHZA 2ITKA 1IHGA 5T8IA 1Y8MA 3PUKA 5JH8A 1RD6A 4RG6A 1IX5A 4BTBA 1FKDA 3HYMB 2LAIA 3AS3A 2J4BA 3FULA 2KZTB 2PBCA 5A7DB 3I4GA 4YVOA 4W9RA 4S3JA 4G11A 2NSZA 5T3RA 1SZ9A 2C0MA 1ZBVA 2MPHA 2KZTA 2OV8A 3WH0A 2LAHA 3KAIA 4KR0B 4LUNU 4LEUA 1NP7A 4JHKA 4I1MA 2IONA 1E7VA 4CT4A 3MGBA 3RKVA 4JPSA 4JZYA 2J07A 4CGWA 2VTBA 1IQUA 4NRHB 4P8WA 2Y3AA 1TEZA 4JFLA 4PTMA 3L13A 1JWGA 4ODQA 4KVOA 4L72B 4DT4A 2E2EA 3FUFA 4XI9A 3G2TA 4L3NA 3VTXA 4FN2A 4NNRA 3D9MA 3I4RB 3H9RB 3APDA 1E96B 2XPBA 2M2AA 4E6HA 3CV0A 4GCNA 4G2VA 4FAPA 5EX3A 3B7XA 3LY9A 4N39A 4LAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROU A;  2FF4 A;  4APO A;  2UY1 A;  1PBK A;  5FJY A;  4GA2 A;  5HWC A;  1T11 A;  3JYM A;  3CK9 A;  4N2Q A;  4BT8 A;  4IN3 B;  4ODN A;  4CGV A;  3S7D A;  3CK8 A;  1A17 A;  4LAV A;  4J8E A;  3NRK A;  1FKL A;  4JFK A;  4J4N A;  5CCM A;  2KGJ A;  1OUV A;  3VAW A;  5FZS A;  3IKG A;  4ABN A;  3O5G A;  1PC2 A;  1TCO C;  3JYJ A;  3CKB A;  5GPG A;  3KAG A;  5BW8 C;  2R5S A;  2KFW A;  1FKF A;  3AS4 A;  1KT1 A;  1FKB A;  3URZ A;  4U0Z A;  2L6J A;  4RG9 A;  2XP7 A;  1HXI A;  1P5Q A;  4I9E A;  2BUG A;  2HYZ A;  1W26 A;  1W3B A;  4W9O A;  2QFC A;  1Q6U A;  3CVN A;  3LPZ A;  1FKH A;  1L1P A;  2VSY A;  3UI6 A;  4JA7 A;  4WNF A;  3UQA A;  1M5Y A;  3CVP A;  2VN1 A;  4WNE A;  1FKT A;  4IPX A;  4TW7 A;  1Q6H A;  4W9Q A;  4HOU A;  3QWW A;  2PPP A;  1HXV A;  1J6Y A;  3PDN A;  4DRM A;  2IFU A;  2DBA A;  3CK7 A;  4ME2 A;  2LJ4 A;  3GW4 A;  2MLZ A;  4F3V A;  5HI7 A;  4N3A A;  3NF1 A;  4IQC A;  4QT3 A;  3O5I A;  4Y6C A;  1F8A B;  2DG9 A;  3KAB A;  3RO2 A;  1ELW A;  4GA0 A;  3ODK A;  4AY5 A;  4H7Y A;  2Q7F A;  2XGS A;  1WAO 1;  3I6C A;  3LYA A;  1NA3 A;  2PPO A;  4ODK A;  1FCH A;  2XP4 A;  2JZV A;  4BTA A;  1J4R A;  1FJD A;  3GZ1 A;  5JJ7 A;  2HO1 A;  4G25 A;  2RUQ A;  3QWP A;  5DIU A;  2OOE A;  4H7X A;  2FO7 A;  1D6O A;  4U85 A;  3AS5 A;  3IEG A;  3CVL A;  3QOU A;  2Y4T A;  4N39 A;  5M72 A;  4IQ2 A;  2F2D A;  2LGO A;  3ASH A;  4KYO B;  4W9P A;  3R9A B;  2I6H A;  3O5Q A;  1C9H A;  3ZPJ A;  3RGC A;  1FKI A;  4JYS A;  2PL2 A;  2XCC A;  3PRD A;  3FFL A;  2AVP A;  3KCE A;  4J0U A;  1D7H A;  4ODM A;  3O5K A;  3N71 A;  3O5O A;  4KBQ A;  5C1D A;  3LKU A;  2ZQT A;  2J9Q A;  5KJL A;  2PQN A;  4UQZ A;  4DRI A;  2PV1 A;  3NI6 A;  1KLX A;  3ASD A;  4HOS A;  3CGN A;  3MKR A;  1HH8 A;  2ZQV A;  1ZU2 A;  3O5P A;  2C0L A;  3O5D A;  4I2W A;  4GZ3 A;  4N3C A;  3S7J A;  4HOT A;  1NZN A;  3ESK A;  2VQ2 A;  2VCD A;  4HOQ A;  1ZCN A;  2VGX A;  4DRK A;  2ZR6 A;  3KZ7 A;  2PV2 A;  5AYW D;  1EQ3 A;  2M08 A;  3LY7 A;  1B89 A;  4EQF A;  4UI9 J;  4N19 A;  3JYS A;  1A7X A;  4G2P A;  4U04 A;  2YQ8 A;  5EKQ D;  3O5E A;  4QIB A;  4LAW A;  2Y78 A;  3ASF A;  1R9H A;  2OND A;  3U4T A;  4G1T A;  2KO7 A;  4U0U A;  4MGV A;  4DH0 A;  5HW6 A;  3Q4A B;  2MHK A;  5HQ8 A;  4UI9 C;  4MSP A;  4DRN A;  1Q6I A;  5KJM A;  4TW6 A;  3MEK A;  3ASG A;  4B94 A;  4GIV A;  4DZ2 A;  2M1I A;  3O5J A;  2MF9 A;  3UI5 A;  2RUR A;  3OXF A;  4G24 A;  5D0O D;  3MDY B;  4WND A;  4G23 A;  1D7I A;  5B8I C;  4GYW A;  2XP9 A;  4TW8 A;  5LCW J;  5JJ6 A;  3TGO A;  1FKK A;  5DBK A;  2WQH A;  2VYI A;  3TCZ A;  4J4O A;  3PE3 A;  4AY6 A;  4JHR A;  2MLX A;  4GZ6 A;  5HT1 A;  2GW1 A;  1PIN A;  3KS2 A;  3AS8 A;  4XIF A;  4ODP A;  2DG4 A;  4GGQ A;  3CGM A;  5KJN A;  3EY6 A;  5BNW A;  2JLB A;  2LSV A;  4DZ3 A;  3TG5 A;  2ZQU A;  4UQX A;  4JA9 A;  3KAE A;  3BEE A;  1U79 A;  3WXX A;  3CVQ A;  2RSE A;  2LPV A;  4BT9 A;  4J8F A;  3FWV A;  4TNS A;  3QKY A;  2ZR5 A;  2NC9 A;  3ULQ A;  3GZ2 A;  4BWR A;  3FAP A;  3KAF A;  1BKF A;  5HKG A;  4AM9 A;  4N2S A;  1Q1C A;  3TG4 A;  3PA7 A;  4I9C A;  4J8D A;  5A6C A;  5KJK A;  3Q47 B;  3PE4 A;  3O5R A;  2XGO A;  3FP3 A;  3NTP A;  4GZ5 A;  5FZQ A;  3RFW A;  5D0Q D;  3IK8 A;  2RUD A;  4G50 A;  4GA1 A;  3UI4 A;  3Q49 B;  4BF8 A;  4Y6W A;  3SZ7 A;  2XCB A;  5ARF A;  4GPK A;  3U3W A;  4LAY A;  3KAD A;  1NA0 A;  2PQR A;  2AWG A;  3ZHE B;  4U0S A;  1EYM A;  1ZK6 A;  4UQY A;  4KXK B;  3GYZ A;  4AIF A;  2UY1 B;  3RJV A;  3QDN A;  1TJC A;  4DRP A;  4YVQ C;  5HW8 A;  4I17 A;  1ZBP A;  4QT2 A;  1QQE A;  1N1A A;  3TC5 A;  3TDB A;  4HOR A;  3LCA A;  3UPV A;  3CKC A;  3ZHE A;  2L2S A;  2F21 A;  1XNF A;  4DRJ A;  2UZ5 A;  3UF8 A;  2XP5 A;  4DRO A;  1Y0O A;  1BL4 A;  1NMW A;  3KAH A;  1QPF A;  5BXJ A;  5G05 J;  5G05 C;  2D9F A;  1B6C A;  1FKR A;  2KC7 A;  2FI7 A;  3Q5M A;  4DIP A;  2XEV A;  4ITZ A;  1KT0 A;  2PZI A;  2ZQS A;  2HR2 A;  2YHC A;  4UI9 K;  3RIB A;  4DRQ A;  2KI3 A;  3O5L A;  5JJT A;  3UQI A;  4N3B A;  2OFN A;  3VTY A;  1NSG A;  2WPV A;  4U07 A;  2DG3 A;  4YND A;  3EDT B;  4O2T A;  2VGX B;  3O48 A;  2KCV A;  2RQS A;  3OXL A;  2KCL A;  1NMV A;  4WUY A;  2KR7 A;  2P58 C;  1FKG A;  4TX0 A;  5CCL A;  1HZ4 A;  4R0X A;  2RUC A;  3PRB A;  2LSU A;  4I1A A;  5HW7 A;  1IYG A;  1J4I A;  2FEZ A;  1YAT A;  4N5C A;  2LNI A;  1YW5 A;  5FT9 A;  4C02 B;  4U86 A;  1J4H A;  1ROT A;  4U84 A;  3Q15 A;  2ITK A;  3E4B A;  2PPN A;  1IHG A;  2K8I A;  1Y8M A;  2KAT A;  4TYO A;  5DIT A;  4NQ0 A;  4RG6 A;  5BT1 A;  5FZR A;  5HTG A;  2KCK A;  5HWB A;  4BTB A;  1FKD A;  3HYM B;  3OOB A;  1JVW A;  2PBC A;  2IF4 A;  5A7D B;  2V5F A;  5LCW C;  2FKE A;  1JNS A;  5HUA A;  2MLY A;  4YVO A;  2PV3 A;  3UQB A;  4W9R A;  4JFI A;  3S7F A;  1QPL A;  2MPH A;  2C0M A;  2MNT A;  2C2L A;  5G04 C;  2Q5A A;  4JFM A;  1FKS A;  3ZN3 A;  3WH0 A;  3KAI A;  3SF4 A;  4LEU A;  3LUO A;  4O6F A;  3LY8 A;  4I2Z A;  3KD7 A;  5CHE E;  3JXV A;  4ODR A;  5DIV A;  5G04 J;  2XP8 A;  4GYO A;  3RKV A;  1FAP A;  2KE0 A;  2UWJ G;  3ZGQ A;  2ZR4 A;  2VSN A;  4CGW A;  2XPA A;  5I98 A;  4JFJ A;  5EX0 A;  1F40 A;  4NRH B;  2FBN A;  4DRH A;  4ODO A;  5ARG A;  3MA5 A;  5FTP A;  4GCO A;  2LKN A;  3QWV A;  1ELR A;  4XI0 A;  3OXG A;  3KAC A;  3S7B A;  4A1S A;  1WM5 A;  5J6E A;  2FAP A;  1QZ2 A;  3RU0 A;  2XP6 A;  1YA0 A;  4CDR A;  2XPI A;  5DIZ A;  2XP3 A;  4GYY A;  3UQ3 A;  2F4E A;  4JFL A;  3MV3 B;  4ODQ A;  3UUX A;  4WNG A;  1FD9 A;  5D75 A;  3GPK A;  4DT4 A;  4ODL A;  2E2E A;  3CEQ A;  2XGM A;  4XI9 A;  4G26 A;  1FKJ A;  3VTX A;  4FN2 A;  4NNR A;  4JL0 A;  3O5F A;  3H9R B;  2XPB A;  1E96 B;  3IHZ A;  2VGY A;  3ZFW A;  2M2A A;  1D7J A;  3CV0 A;  3MV2 B;  4GCN A;  3O5M A;  4G2V A;  3RO3 A;  3TAX A;  1JNT A;  4FAP A;  5EX3 A;  2Y4U A;  2N87 A;  3B7X A;  3LY9 A;  3K9I A;  4LAX A;  3IKD A; 
#chains in the Genus database with same CATH topology
 1ROU A;  5FQ6 A;  4JD2 G;  4MPK A;  1HKJ A;  2UY1 A;  1BPO A;  1PBK A;  2WB2 A;  4GA2 A;  3FEY A;  2R59 A;  4EHM A;  4HXI A;  3WD0 A;  3CK9 A;  4YDE A;  4HLL A;  2XQ0 A;  1NH6 A;  4EPZ A;  3S7D A;  5CBN A;  3ARZ A;  3FH5 A;  4LAV A;  3FUJ A;  3G2S A;  5C2Y A;  1UG3 A;  4CRW A;  2BKG A;  4K5A B;  1TCO C;  3JYJ A;  4IT6 A;  5EYL A;  3SBT B;  3ART A;  1FKB A;  3URZ A;  3DEP A;  4RG9 A;  2QF8 A;  2XP7 A;  2B31 A;  2R2L A;  4I9E A;  4AP2 A;  3LPZ A;  4MAV A;  1L1P A;  4WNF A;  4HBD A;  3CVP A;  3LS8 A;  3PUJ A;  4WNE A;  1FKT A;  4CDN A;  4IPX A;  3WL0 A;  3QWW A;  2PPP A;  1HXV A;  3PDN A;  3QB2 A;  5HI7 A;  1K3Z D;  4YDY A;  3O5I A;  5E76 A;  3AAA C;  4TXR A;  2B0O E;  1V54 E;  3ODK A;  3Q79 A;  5ENO D;  4I6E A;  5FIO A;  1EYH A;  1X5B A;  1W1Y A;  2DCP A;  4ILI A;  3HXE A;  1ZB5 A;  1PY1 A;  2MOW A;  3WL1 A;  3WD1 A;  2OOE A;  3JQ1 A;  1D6O A;  2FUL A;  3AS5 A;  3APF A;  3CVL A;  5KCM A;  2V8S E;  4IQ2 A;  2WXI A;  5CMW A;  3X2Q E;  3ASH A;  1BI7 B;  2I6H A;  4PUC A;  3O5Q A;  1C9H A;  3ZPJ A;  2GRL A;  3UX4 A;  3B7S A;  2ZIS A;  4J0U A;  4ODM A;  3O5K A;  2FDM A;  1E9L A;  1JCQ A;  3FUH A;  3E30 A;  4GU5 A;  2X6I A;  3ASD A;  4HOS A;  3MKR A;  1HH8 A;  3B95 A;  2ZQV A;  4WJX A;  3ZIM A;  4CYM D;  3O5P A;  2WMN A;  1O6I A;  2EUL A;  4N3C A;  3DXK G;  5AJL A;  1MX6 A;  2VQ2 A;  5DEZ A;  1ZCN A;  4DRK A;  2YHE A;  2PV2 A;  5AYW D;  1EQ3 A;  2A5U A;  4N19 A;  2WXJ A;  4PS3 A;  1A7X A;  4G2P A;  3FDH A;  3ARU A;  4QIB A;  4LAW A;  1W9U A;  3E32 A;  4G1T A;  2CFU A;  4DH0 A;  1JPL A;  3DBS A;  2MHK A;  1U3C A;  5ENP D;  2F37 A;  3CGH A;  3CQG B;  1FPP A;  1XGW A;  3E33 A;  3KEA A;  3CHR A;  4BX9 A;  3D9N A;  4GIV A;  4DZ2 A;  1LL7 A;  1HKK A;  4F53 A;  1INZ A;  2MF9 A;  3MDY B;  1D7I A;  2KM4 A;  2I1J A;  3T8K A;  1OWM A;  4JEU A;  4BES A;  2FO1 E;  5ANL A;  4LG6 A;  2GW1 A;  2DZO A;  3T9K A;  1OXJ A;  4F1P A;  4DLO A;  5KJN A;  1TYQ G;  3WKZ A;  2JLB A;  1S64 A;  5EN5 D;  1HFA A;  3ALF A;  4JA9 A;  4KQZ A;  2V0P A;  1MX4 A;  1U79 A;  3WXX A;  2KBX A;  1XRV A;  2R02 A;  1HJV A;  3MYV A;  2WM9 A;  3QKY A;  3VLE A;  1ZBC A;  2DSV A;  4A3V A;  3FAP A;  1OCO E;  1BKF A;  1Q1C A;  1OGG A;  3HRA A;  4XZ4 A;  3B7R L;  2EIJ E;  4EBA G;  4FA6 A;  2I9C A;  3PEV B;  5EDS A;  5DF0 A;  3PZ4 A;  3RFW A;  5D0Q D;  4G50 A;  1WG0 A;  3TWU A;  2XCB A;  2CHX A;  3V2X A;  4A55 A;  3RRM B;  3EHN A;  3KAD A;  1EDQ A;  4U0S A;  1ZK6 A;  3G2U A;  4IYP A;  4AIF A;  1O1R A;  3PR9 A;  3B7T A;  1IKN D;  4LNU D;  4X8Q A;  3LCA A;  1H2T C;  3UM0 A;  2ZU6 B;  2ETA A;  3CVX A;  4U95 D;  2F21 A;  1XNF A;  1N94 A;  4DRJ A;  3EU9 A;  2UZ5 A;  1D2K A;  3HVE B;  3RAU A;  3T5X A;  2OCC E;  3UXG A;  1QPF A;  1BI8 B;  5G05 J;  5IY5 E;  1CTN A;  3ENE A;  1FKR A;  3CLJ A;  3SY2 A;  1OCC E;  2H6I A;  2PM7 A;  4DRQ A;  3B13 A;  3ARW A;  2DSZ A;  3AS2 A;  2OFN A;  3FY4 A;  1NSG A;  2WPV A;  4QZV B;  3D9J A;  5B1B E;  2WMO A;  2PM6 A;  3WQW A;  2F23 A;  4ANU A;  2A3B A;  4J8Y A;  1HZ4 A;  4DLQ A;  1J4I A;  4YDO A;  2FEZ A;  3D3M A;  1WDY A;  4FAD A;  2VGE A;  2LNI A;  1LG2 A;  4TUM A;  3QAQ A;  5DO2 A;  3LJ3 A;  4BET A;  3Q15 A;  3D9P A;  4A63 B;  2WXF A;  4APF A;  3VLF A;  2EIM E;  2AXZ A;  2QYU A;  3C72 A;  3SFZ A;  2K8I A;  2KAT A;  4K5C A;  1GOI A;  3ARV A;  5FZR A;  5HTG A;  1HE8 A;  1JNE A;  5HWB A;  3ARR A;  4JXT A;  4DX6 D;  4U8V D;  1HO8 A;  4WK9 A;  4OVU A;  3FTZ A;  3QNK A;  5CED B;  2P9L G;  5LCW C;  2DSU A;  2FKE A;  3SFY A;  4TRQ A;  1N4Q A;  1LD8 A;  2Q5A A;  3DWL G;  3ZN3 A;  1ZB1 A;  3RM9 A;  1FVH A;  1EDU A;  1O5M A;  2WXQ A;  3E34 A;  5LX8 A;  5CHE E;  3D9L A;  4E85 A;  1NFI E;  1FAP A;  3FU0 A;  2UWJ G;  2A4Z A;  1F40 A;  3BQO A;  2IUZ A;  4FJZ A;  3QOK A;  4NZC A;  4ODO A;  5ENT D;  3MA5 A;  5FTP A;  4GCO A;  1OCR E;  2PI6 A;  1ELR A;  1JND A;  3OXG A;  5AAO A;  3TWX A;  4AEZ C;  5J6E A;  3RU0 A;  1YA0 A;  1H2U A;  3L82 A;  5DIZ A;  2XP3 A;  4P8X A;  3UQ3 A;  3ZYK A;  4OYS A;  3G2V A;  3QJZ A;  2CFZ A;  2I2O A;  3UUX A;  3LXU X;  2DIW A;  1O1S A;  2ILR A;  1FD9 A;  2WQ6 A;  1OWQ A;  5D75 A;  2A5E A;  3RM4 A;  1YYH A;  3CEQ A;  3QAR A;  1K1B A;  4C0E A;  4R5E A;  1FKJ A;  3U64 A;  3CQC B;  2MRI A;  4RLY A;  1A5E A;  3LVR E;  5BUZ A;  3V30 A;  3O5M A;  3MV2 B;  2J4D A;  4DWS B;  1JNT A;  1UJJ A;  4GTR A;  4LSZ E;  3SBS A;  4EZK A;  1N54 A;  2Y4U A;  4Q22 A;  2FF4 A;  3RRU A;  4ATG A;  3DPD A;  5FJY A;  3UT7 A;  4L7T A;  2QC9 A;  3C5R A;  3EJN A;  3LEW A;  4N5Q A;  4BT8 A;  5J08 A;  4U63 A;  4F1S A;  4HB5 A;  4O1O A;  4TV3 A;  5AN8 A;  3FEX A;  3V31 A;  1X6N A;  4JFK A;  2VTB B;  4BY6 A;  1OUV A;  5FZS A;  3CSF A;  5CEA A;  3FUN A;  3PH0 C;  2DZN A;  3KAG A;  5GPG A;  2KFW A;  2P9S G;  2XEN A;  1SR0 A;  2GRM A;  1HXI A;  2E0I A;  3T8M A;  5AIJ A;  4BX8 A;  3UI6 A;  4HQD A;  3Q78 A;  4Q7N A;  1EIB A;  4HOU A;  1U3D A;  1J6Y A;  5LP0 A;  2IFU A;  3CK7 A;  4LER A;  3L54 A;  3GW4 A;  5AEN A;  2MLZ A;  2GRQ B;  2GGF A;  4N3A A;  4IQC A;  4Y6C A;  1F8A B;  2DG9 A;  3FTV A;  3KAB A;  1OWL A;  1ELW A;  4GTS A;  4HI9 A;  2XHE A;  1DNP A;  4MKT A;  4H7Y A;  2L9B A;  4NSB A;  2XGS A;  1WAO 1;  4HS2 A;  3I6C A;  2ESC A;  3NOC D;  1FCH A;  2JZV A;  3U9W A;  1J4R A;  2XRY A;  1FJD A;  4MTV A;  3GZ1 A;  3G6M A;  3TWW A;  4PH4 B;  4GTT A;  2RUQ A;  3TWT A;  4C0M A;  2A3C A;  3R7Q A;  3JXI A;  3UKR G;  5ENQ D;  2FO7 A;  2AJA A;  5D66 A;  1S70 B;  4Z2L A;  3UIO C;  1E7U A;  5CBO A;  5M72 A;  2LO6 A;  2LGO A;  2WXK A;  4KYO B;  1OT8 A;  3R9A B;  4IRU A;  1BU9 A;  3D9O A;  2WM0 A;  2AVP A;  3UT8 A;  1H0I A;  3L9T A;  1YCS B;  3KCE A;  4KBQ A;  5C1D A;  3LKU A;  3UI2 A;  2J9Q A;  3RRN B;  3FUM A;  2PQN A;  1KLX A;  3I5P A;  3CGN A;  3FUK A;  4RSY A;  4NIK A;  2DT2 A;  4UWH A;  2C0L A;  1YMP A;  4GB9 A;  3O5D A;  4I2W A;  4WWN A;  3KEZ A;  3ESK A;  3PZD A;  1KPS B;  4HOQ A;  2VCD A;  4U96 D;  1N0Q A;  3KZ7 A;  2M08 A;  3LY7 A;  1LQ0 A;  2WXR A;  2DWZ A;  3TXN A;  4DX2 A;  1OWO A;  3SHF A;  3T5V A;  2DT3 A;  2YQ8 A;  5FQ7 A;  4RVB A;  1E6R A;  5JMN D;  3J5Q B;  3DXM G;  4U0U A;  4XE0 A;  4UI9 C;  4MSP A;  4DRN A;  4TW6 A;  3AG1 E;  1N9A A;  3GTY X;  4NUR A;  5HKP A;  1FT2 A;  4KZC A;  4HAR A;  4G24 A;  1Q2Z A;  3CHM A;  5D0O D;  4G23 A;  4GYW A;  4ACL A;  4K03 A;  1TN8 A;  1Z6T A;  2YNQ A;  5AJD A;  2WQH A;  1WAW A;  3FU3 A;  3ZYQ A;  2H6F A;  4AY6 A;  2MLX A;  3MCX A;  4GZ6 A;  2ETN A;  4XKB A;  2R05 A;  4B8A A;  3TWQ A;  3EY6 A;  3D9I A;  5BNW A;  3PZ1 A;  1NWS A;  4TUU A;  5ENR D;  1DVP A;  3ZVV A;  1N11 A;  4UQX A;  3BEE A;  3P1U A;  4HI8 A;  2IU1 A;  1EF1 C;  3ULQ A;  4BWR A;  4ML4 A;  3JUE A;  2WLY A;  4AM9 A;  4N2S A;  4GTP A;  3PRZ A;  3TG4 A;  3PA7 A;  2WK2 A;  5KJK A;  3Q47 B;  4P8V A;  5ANR A;  3O5R A;  3ZNG A;  3FP3 A;  4I6G A;  3NTP A;  4ANX A;  1AWC B;  1LL6 A;  3D9H A;  3TXM A;  3NZS A;  3UI4 A;  1GUV A;  4DI3 A;  3SZ7 A;  5ARF A;  3U3W A;  4LAY A;  3APC A;  1NA0 A;  2H6H A;  5JHA A;  2RD0 A;  4EZJ A;  4KXK B;  3GYZ A;  2UY1 B;  3MX3 A;  3RJV A;  2O9O A;  4B93 B;  5HW8 A;  4YVQ C;  4S3K A;  3SQV A;  1N1A A;  5FQ8 A;  3TC5 A;  1JCR A;  3ZW3 A;  3S2A A;  4Z2H A;  2XP5 A;  1HU3 A;  3HXF A;  3ARQ A;  1Y0O A;  4U8Y D;  3UT4 A;  4ZPT R;  5KWD A;  5B1A E;  1QYM A;  1HX8 A;  4MS6 A;  1B6C A;  2FI7 A;  3Q5M A;  4DIP A;  4FU3 A;  4ITZ A;  1KT0 A;  2PZI A;  2ZQS A;  2HR2 A;  1HS6 A;  5E75 A;  2KI3 A;  3IHY A;  5JJT A;  5CER B;  2J8S D;  4N3B A;  3VTY A;  1XHG A;  2DG3 A;  3SO8 A;  3EDT B;  4QFV A;  5EID A;  2VGX B;  4O2T A;  3I3N A;  2RQS A;  3OXL A;  4UWK A;  5LOZ A;  2KCL A;  3OTN A;  5CCL A;  2P2C P;  4R0X A;  3TWR A;  2RUC A;  2LSU A;  2P9I G;  3KSQ A;  4J7W A;  3R9M A;  4C02 B;  2M63 A;  4U86 A;  3EHR A;  2G41 A;  4U84 A;  2R03 A;  1K9T A;  2HE0 A;  2PPN A;  1LD7 A;  3CHQ A;  5DIT A;  5BT1 A;  2DVW A;  2EIN E;  3HXB A;  2ZIR A;  5BPP A;  1N0R A;  2IF4 A;  2DYR E;  3FH7 A;  2V5F A;  4PDX A;  4CT0 A;  1JNS A;  2PV3 A;  4LCT A;  2X6F A;  1QPL A;  4ZHB A;  1U2V G;  3AU5 A;  2MNT A;  2WLZ A;  2ZGG A;  5G04 C;  1FKS A;  1UR9 A;  1ZL1 A;  4KVM A;  3SF4 A;  3LUO A;  3LY8 A;  4I2Z A;  2XEH A;  5G55 A;  2R17 C;  3BMB A;  3SNX A;  4ODR A;  2I1K A;  3L08 A;  2DSW A;  3PEU B;  1JCS A;  3FXY A;  2KE0 A;  4HBO A;  2ZR4 A;  2VSN A;  4JFJ A;  4DX1 A;  2FBN A;  3RK6 A;  5ARG A;  1LL4 A;  3QWV A;  4U8H A;  4XI0 A;  2LKN A;  3W9F A;  4Z2I A;  1Z5S C;  3S7B A;  4A1S A;  3ESL A;  2IEJ A;  3W9G A;  2XP6 A;  3EHQ A;  3CVW A;  3WIJ A;  2F4E A;  4RQI A;  2WXM A;  2AXU A;  4UUC A;  3AS1 A;  1H0A A;  4LRZ A;  4ODL A;  2WXP A;  2XGM A;  4MNJ A;  4G26 A;  3B9D A;  4OAU C;  3CVV A;  3CHS A;  2V4H C;  2IOL A;  4ZFH A;  1HKM A;  2IJG X;  3NQP A;  1OCZ E;  3BG1 B;  1H6K A;  1N95 A;  1KZP A;  3JCK C;  3ZFW A;  3PS6 A;  3G6L A;  1BLX B;  3IHZ A;  4WIW A;  3RO3 A;  3W4R A;  3B7U X;  1FFQ A;  1HKI A;  2GRR B;  2RG8 A;  4KZ0 A;  2N87 A;  2XZD G;  4GTQ A;  4ATZ D;  1D8E A;  2F8Y A;  3BG0 B;  3CR3 A;  1S0P A;  4D10 C;  2LXM A;  4JB8 P;  5HWC A;  2WQ7 A;  3JYM A;  3C3O A;  4N2Q A;  4JHJ A;  4XEI G;  2DPE A;  3V2O A;  4ILH B;  5BXO A;  4CGV A;  3CK8 A;  3DSX A;  4DUI A;  1A17 A;  1FFR A;  4ANV A;  4PS8 A;  3NRK A;  2IOS A;  4FJY A;  3R7R A;  3MZL B;  3IKG A;  4JC8 A;  3O5G A;  4MNK A;  4AJW A;  1MHQ A;  3CKB A;  3ABL E;  3CHC A;  1FKF A;  2EIK E;  3RM8 A;  4K5B A;  2L6J A;  3PRE A;  2BUG A;  4XKC A;  4WWP A;  3ALG A;  5CRV A;  1W3B A;  4WKF A;  2XZT G;  1FKH A;  3CST A;  2VSY A;  3UQA A;  1M5Y A;  4AV7 A;  4EEC A;  2OEW A;  1Q6H A;  4TW7 A;  1TR4 A;  3ONL A;  4DRM A;  2LJ4 A;  1DCQ A;  2IY0 C;  4F3V A;  1E8X A;  4Z2J A;  4AXH A;  3IKO B;  3IV0 A;  4QT3 A;  2AW6 A;  3RO2 A;  3FH8 A;  1E8Y A;  5LFA A;  1LG1 A;  5A23 A;  4AY5 A;  2P9N G;  4PS7 A;  3DPY A;  3LYA A;  4ODK A;  2XP4 A;  4BTA A;  5JJ7 A;  4AY1 A;  3EHM A;  4G25 A;  3PNT B;  4Q94 A;  1OGB A;  4L9P A;  1QNF A;  4UWL A;  1SYT A;  1FVF A;  4H7X A;  4FP7 A;  3CHF A;  4U85 A;  4AOF A;  1OWP A;  3HXC A;  2XPY A;  3QOU A;  2AXV A;  1MJ0 A;  4HFG A;  1UOH A;  2PNN A;  2XPZ A;  2X6J A;  4DK5 A;  3ISM C;  3RGC A;  2P9P G;  1FKI A;  2PL2 A;  2XCC A;  3FFL A;  2RKK A;  1KFW A;  4WAF A;  2L6B A;  1TN6 A;  3N71 A;  3ASN E;  5HS0 A;  3SGH A;  5KJL A;  4C48 B;  4JEH A;  3E37 A;  1ITX A;  2PV1 A;  3NI6 A;  2AWI A;  1ZU2 A;  4WKH A;  4JW1 A;  2NYJ A;  4GZ3 A;  4HOT A;  4J8S A;  3QK0 A;  1W9P A;  2VGX A;  3IBE A;  2MYO A;  3FUE A;  2ZR6 A;  4BFR A;  1JWF A;  4R7L A;  1D8D A;  4HNA D;  3JYS A;  3NB2 A;  4FLH A;  2GRN B;  4U04 A;  3ML8 A;  5T4Y A;  3O5E A;  2Y78 A;  3UIP C;  3ASF A;  1R9H A;  1E8W A;  3UTM A;  4ACK A;  3PZ3 A;  4W5U A;  3TJP A;  3Q4A B;  3B8S A;  2ZGD A;  3TL5 A;  4CEM A;  1Q6I A;  4CZ2 D;  4B94 A;  3OAW A;  3UMV A;  5JA4 D;  3FU5 A;  4HRN A;  5EIL A;  2JAB A;  3UI5 A;  3MKQ B;  3OXF A;  3BU8 A;  4WND A;  3NBN B;  2XP9 A;  4TW8 A;  5LCW J;  5JJ6 A;  1VDY A;  3HIZ A;  2VYI A;  5B3S E;  2YBT A;  3TCZ A;  4F7A A;  3PE3 A;  1DCE A;  3PNL B;  4Z2G A;  4UDM A;  3AS8 A;  4XIF A;  4FC8 A;  4WWO A;  4YDW A;  2DG4 A;  4FHJ A;  4GGQ A;  3CGM A;  1WB0 A;  2YIN A;  4DRX E;  5FWQ A;  1WY6 A;  4DZ3 A;  3TG5 A;  1S63 A;  3RME A;  2XRZ A;  1N4R A;  2RSE A;  2LPV A;  4HBE A;  2LXL A;  4J8F A;  3FWV A;  4LNB A;  4I43 A;  4F6R D;  2ZR5 A;  4TNS A;  2NC9 A;  3C98 A;  3KAF A;  1RW2 A;  5HKG A;  3DST A;  3FTX A;  3WD3 A;  2IQC A;  3NZU A;  1SA5 A;  4GMR A;  5A6C A;  3ULY A;  2O92 A;  3GZS A;  1H2V C;  1TJF A;  2RFA A;  2L0T B;  4GZ5 A;  4Q96 A;  1N52 A;  2WXL A;  3ZU7 B;  3Q49 B;  4BF8 A;  2CG2 A;  1Y6I A;  4GPK A;  2G8Z A;  3ZHE B;  4L23 A;  2IO2 C;  1TJC A;  3DSW A;  4DRP A;  4QT2 A;  1QQE A;  3PRA A;  3TDB A;  3ASO E;  5BV0 A;  3UPV A;  1G3N B;  3ZRH A;  2WXH A;  3ZHE A;  2L2S A;  3AS0 A;  2RFM A;  4A3T A;  4BEP A;  3UF8 A;  1RZ4 A;  4GMJ A;  4O60 A;  5CMY A;  3DSU A;  2AOS A;  1BL4 A;  1NMW A;  3KAH A;  4DWS C;  5G05 C;  1E15 A;  2V4L A;  2D9F A;  1HJW A;  3ARO A;  2XEV A;  2X6H A;  3L6A A;  3ZYM A;  4Q69 A;  3RIB A;  2OLH A;  3O5L A;  1V55 E;  1N4S A;  4L2L A;  3UQI A;  4K0R A;  3DSV A;  4YND A;  3LVQ E;  4AVX A;  2KCV A;  2KR7 A;  1NMV A;  4WUY A;  2P58 C;  5J90 A;  1FKG A;  2VSO E;  3CHD A;  4I1A A;  4N5C A;  3UM2 A;  3Q75 A;  2CHW A;  4UWG A;  5FT9 A;  1J4H A;  1GPF A;  1HG2 A;  3Q7F A;  1D9S A;  4OAV B;  1ROT A;  1GW6 A;  1IQR A;  2VSX E;  4QQI A;  3E4B A;  2BED A;  2WVI A;  2QZA A;  3UM1 A;  4TYO A;  2B6C A;  4NQ0 A;  4U7E B;  1UJK A;  2KCK A;  2Y69 E;  4G8K A;  3DEO A;  2X6K A;  3OOB A;  1L5J A;  1H6O A;  1JVW A;  3SI5 A;  1E6P A;  1NWR A;  5HUA A;  4MBG A;  2MLY A;  1O1T A;  3AG3 E;  1KZO A;  4JFI A;  3UQB A;  2YBU A;  3S7F A;  2IO3 C;  3U66 A;  2F8X K;  2C2L A;  4JFM A;  3CHP A;  4Z2K A;  3P2B A;  2P4V A;  1WNO A;  3HVE A;  3BUA A;  5H7P A;  4BER A;  4BSZ B;  2H6G A;  4O6F A;  2Y0B G;  3ARS A;  3KD7 A;  3JXV A;  5DIV A;  5G04 J;  2XP8 A;  3EIQ C;  4GYO A;  3ZGQ A;  2XPA A;  5I98 A;  3ZUV B;  5EX0 A;  4DRH A;  3V79 K;  3NAW A;  3HHM A;  3KAC A;  1WM5 A;  2FAP A;  1MQS A;  1QZ2 A;  1BD8 A;  1OY3 D;  4CDR A;  2XPI A;  2A3E A;  4GYY A;  1X81 A;  4M7C A;  3MV3 B;  3OA5 A;  4WNG A;  4WKA A;  3JXJ A;  3GPK A;  2GRO B;  3L17 A;  4GPM A;  3CVY A;  3FUI A;  1E90 A;  4B89 A;  4J6I A;  5GQB A;  4JL0 A;  3UM3 A;  4FUL A;  4OVV A;  4Z68 A;  4MLP A;  3O5F A;  4FLB A;  2VGY A;  1D7J A;  4KT6 B;  3TAX A;  1LTX A;  3FTW A;  4GTM A;  1HJX A;  3AQU A;  3IXE A;  1PAQ A;  3K9I A;  3ZEF A;  3MKQ A;  1E44 A;  3IKD A;  4UWF A;  4APO A;  2BKK B;  3WD2 A;  4P8U A;  1T11 A;  1TFV A;  4GZD A;  4IN3 B;  4ODN A;  2QY7 A;  3L22 A;  3IHV A;  3WD4 A;  3TWV A;  4J8E A;  1SZA A;  1QBQ A;  1FKL A;  4JVS A;  4J4N A;  5CCM A;  3SD5 A;  3Q9U C;  1TNY A;  2KGJ A;  2NXP A;  3VAW A;  4ABN A;  4C9B B;  3AJI A;  4XX5 A;  5AQA A;  5EYP F;  1PC2 A;  4EBA A;  4URK A;  1EPU A;  3ARY A;  5BW8 C;  2R5S A;  2OEV A;  3AS4 A;  4A1G A;  1KT1 A;  2PN0 A;  4U0Z A;  1E6N A;  2F0Y A;  1P5Q A;  1H0G A;  1TNB A;  3B7X A;  2HYZ A;  3FHE A;  5D2M C;  1W26 A;  2A3A A;  4W9O A;  3VLD A;  2QFC A;  1Q6U A;  3CVN A;  5BV1 A;  3CHO A;  4B8C B;  4JA7 A;  3B9E A;  3C3R A;  2VN1 A;  2DT0 A;  4W9Q A;  2DT1 A;  4DX5 D;  4ZPV R;  2DBA A;  4ME2 A;  4URI A;  3CH9 A;  3NF1 A;  4CDM A;  1EHN A;  3B9A A;  3FTU A;  5AQB A;  1X6L A;  4GA0 A;  1UR8 A;  1NWU A;  4DWS D;  3CHE A;  2X38 A;  2Q7F A;  1DC2 A;  4CCA A;  1NA3 A;  2PPO A;  3HDX A;  1N4P A;  1H19 A;  4ZS6 A;  2HO1 A;  4DPR A;  1IHB A;  3ZYL A;  3QWP A;  5DIU A;  2OVF A;  5KNH D;  3IEG A;  4O1P A;  4P29 A;  3EIP A;  2Y4T A;  5AQ7 A;  1E8Z A;  2WXO A;  3B7B A;  2F2D A;  1ZBW A;  2LUH A;  4V3I A;  3JQ0 A;  5FQ4 A;  1ZU8 A;  2EIL E;  4W9P A;  4ZPW R;  1W1T A;  4GTV A;  3ULE G;  4JYS A;  3PRD A;  3EUV A;  1D7H A;  3O5O A;  3CVU A;  2ZQT A;  4UQZ A;  2CG3 A;  1TNU A;  4DRI A;  1GRJ A;  3ZKJ A;  3AG4 E;  2L0I A;  3GU0 A;  3S7J A;  5JHB A;  1NZN A;  3EU5 A;  3NOG D;  3C3Q A;  1TN7 A;  2P9K G;  3LDZ A;  1HF8 A;  2XS1 A;  1B89 A;  4EQF A;  4UI9 J;  3FUD A;  3Q7A A;  4NAC A;  4ANW A;  5EKQ D;  2V5Q C;  5AQ9 A;  2HM8 A;  2OND A;  3U4T A;  2KO7 A;  5HW6 A;  4L2Y A;  4MGV A;  5HQ8 A;  3D9K A;  3JUI A;  4IT4 A;  4GML A;  4DJA A;  4DWS A;  4GAA A;  5KJM A;  3MEK A;  1NWT A;  3ASG A;  1W1V A;  4XAK A;  1VF8 A;  2DYS E;  2M1I A;  4HLE A;  3FTY A;  1W9V A;  3O5J A;  1HG5 A;  2RUR A;  2J08 A;  5EIB E;  5B8I C;  5GPR A;  2GRP B;  4GZC A;  5ENN A;  3TGO A;  1FKK A;  5DBK A;  4MNM A;  4J4O A;  3AU4 A;  4L1B A;  1SW6 A;  4JHR A;  5HT1 A;  1PIN A;  3KS2 A;  4EZL A;  3PVL A;  5FIN A;  4ODP A;  1UN9 A;  5CRU A;  1FT1 A;  3ONK A;  2XEE A;  3G2W A;  3ARP A;  2LSV A;  1TNO A;  1E6Z A;  3DRA A;  4ILG A;  3ABM E;  2ZQU A;  3QC1 A;  3KAE A;  3CVQ A;  3FU6 A;  4BT9 A;  5HBF A;  4I6J A;  4LNG A;  4FHK A;  2BF0 X;  4KMO A;  4HVB A;  1JUQ A;  3GZ2 A;  1MYO A;  1UW4 B;  4LGX A;  3ML9 A;  3FTS A;  5KBA A;  4BSX A;  3RSE G;  4I1O B;  2P9U G;  4I9C A;  4J8D A;  3ARX A;  1NI1 A;  3PE4 A;  4DI4 A;  3ZXS A;  4TXP A;  1SQM A;  2XGO A;  1JCH B;  1ZBK A;  2WXN A;  1MZC A;  2EQX A;  3Q73 A;  5FZQ A;  1TNZ A;  3MJW A;  3IK8 A;  3ZXP A;  2RUD A;  4GA1 A;  2BTD A;  2KXP C;  1LJY A;  4Y6W A;  1AP7 A;  2PQR A;  2AWG A;  2X3M A;  4MRU A;  1EYM A;  4UQY A;  1Z3Y A;  4B0Z A;  2Y1L E;  3QDN A;  4I17 A;  1ZBP A;  4G8L A;  3J5P A;  1W1P A;  4HOR A;  3CKC A;  2JEK A;  1IXV A;  2WXG A;  1SVX A;  3HXD A;  1OWN A;  3L16 A;  4DX7 D;  4DRO A;  1H6P A;  5BXJ A;  3TWS A;  3EIJ A;  2J49 A;  2KC7 A;  1UN8 A;  2B5U B;  2VJ8 A;  2YHC A;  4UI9 K;  4M3O A;  3CIA A;  3BXW A;  1ELK A;  4MNL A;  1SA4 A;  4TXQ A;  5BXU A;  5ENS D;  5KNG A;  4U07 A;  3UIN C;  3O48 A;  1Z3X A;  4TX0 A;  5G2N A;  3PRB A;  2OVB A;  5HW7 A;  1IYG A;  1YAT A;  1YW5 A;  3FY1 A;  2ETC A;  1LF8 A;  2J09 A;  4IUL A;  3WQV A;  5CEC B;  3CZ8 A;  2CHZ A;  2ITK A;  5HRY A;  1IHG A;  5T8I A;  1Y8M A;  3PUK A;  5JH8 A;  1RD6 A;  4RG6 A;  3UKU G;  1IX5 A;  4BTB A;  1FKD A;  3HYM B;  3WG7 E;  2LAI A;  2J4B A;  3FUL A;  2KZT B;  2PBC A;  3AS3 A;  5A7D B;  3I4G A;  4YVO A;  4W9R A;  4S3J A;  4G11 A;  1NL4 A;  2NSZ A;  1SZ9 A;  2C0M A;  5T3R A;  1ZBV A;  2MPH A;  1K1A A;  2KZT A;  2OV8 A;  2QYJ A;  3KSL A;  3WH0 A;  2LAH A;  3KAI A;  4KR0 B;  1K8K G;  4LUN U;  4LEU A;  1NP7 A;  3HG0 D;  3Q9N C;  4JHK A;  3SFX A;  4HRM B;  4I1M A;  2ION A;  1E7V A;  5AAR A;  3F6Q A;  4CT4 A;  2ETB A;  3MGB A;  3PZ2 A;  3RKV A;  4JPS A;  4JZY A;  3DSS A;  2J07 A;  4CGW A;  2VTB A;  1IQU A;  4NRH B;  2XS8 A;  2ZXW E;  4P8W A;  3ABK E;  2Y3A A;  3LJN A;  1TEZ A;  1MX2 A;  4HRL A;  4JFL A;  4PTM A;  3L13 A;  1JWG A;  4ODQ A;  4KVO A;  4L72 B;  4DT4 A;  5ITZ F;  3AG2 E;  2E2E A;  3FUF A;  4XI9 A;  3G2T A;  4L3N A;  3VTX A;  4FN2 A;  4NNR A;  3D9M A;  4GTO A;  3I4R B;  3H9R B;  3APD A;  1E96 B;  2XPB A;  2M2A A;  4E6H A;  3CV0 A;  4GCN A;  4G2V A;  4FAP A;  5EX3 A;  3O4Z A;  3LY9 A;  4N39 A;  4LAX A; 
#chains in the Genus database with same CATH homology
 1ROU A;  5FQ6 A;  4MPK A;  1HKJ A;  2UY1 A;  1BPO A;  1PBK A;  2WB2 A;  4GA2 A;  3FEY A;  2R59 A;  4HXI A;  3WD0 A;  3CK9 A;  2XQ0 A;  1NH6 A;  4EPZ A;  3S7D A;  3ARZ A;  3FH5 A;  4LAV A;  3FUJ A;  3G2S A;  5C2Y A;  1UG3 A;  4CRW A;  1TCO C;  3JYJ A;  4IT6 A;  3SBT B;  3ART A;  1FKB A;  3URZ A;  4RG9 A;  2QF8 A;  2XP7 A;  2B31 A;  4I9E A;  4AP2 A;  3LPZ A;  4MAV A;  1L1P A;  4WNF A;  3CVP A;  3LS8 A;  3PUJ A;  4WNE A;  1FKT A;  4CDN A;  4IPX A;  3WL0 A;  3QWW A;  2PPP A;  1HXV A;  3PDN A;  3QB2 A;  5HI7 A;  3O5I A;  5E76 A;  3ODK A;  4I6E A;  1EYH A;  1X5B A;  1W1Y A;  2DCP A;  4ILI A;  1ZB5 A;  1PY1 A;  2MOW A;  3WL1 A;  3WD1 A;  2OOE A;  3JQ1 A;  1D6O A;  2FUL A;  3AS5 A;  3APF A;  3CVL A;  5KCM A;  2V8S E;  4IQ2 A;  2WXI A;  5CMW A;  3ASH A;  2I6H A;  4PUC A;  3O5Q A;  1C9H A;  3ZPJ A;  2GRL A;  3UX4 A;  3B7S A;  4J0U A;  4ODM A;  3O5K A;  2FDM A;  1E9L A;  3FUH A;  4GU5 A;  2X6I A;  3ASD A;  4HOS A;  3MKR A;  1HH8 A;  2ZQV A;  4WJX A;  3ZIM A;  3O5P A;  2WMN A;  1O6I A;  4N3C A;  5AJL A;  2VQ2 A;  5DEZ A;  1ZCN A;  4DRK A;  2YHE A;  2PV2 A;  5AYW D;  1EQ3 A;  2A5U A;  4N19 A;  2WXJ A;  4PS3 A;  1A7X A;  4G2P A;  3FDH A;  3ARU A;  4QIB A;  4LAW A;  1W9U A;  4G1T A;  2CFU A;  4DH0 A;  1JPL A;  3DBS A;  2MHK A;  1U3C A;  3CGH A;  3CQG B;  1XGW A;  3CHR A;  4BX9 A;  3D9N A;  4GIV A;  4DZ2 A;  1LL7 A;  1HKK A;  4F53 A;  1INZ A;  2MF9 A;  3MDY B;  1D7I A;  2KM4 A;  2I1J A;  1OWM A;  4JEU A;  5ANL A;  2GW1 A;  4DLO A;  5KJN A;  3WKZ A;  2JLB A;  1HFA A;  3ALF A;  4JA9 A;  4KQZ A;  2V0P A;  1U79 A;  3WXX A;  1XRV A;  1HJV A;  3MYV A;  2WM9 A;  3QKY A;  3VLE A;  1ZBC A;  2DSV A;  4A3V A;  3FAP A;  1BKF A;  1Q1C A;  1OGG A;  4XZ4 A;  3B7R L;  4EBA G;  4FA6 A;  2I9C A;  3PEV B;  5EDS A;  5DF0 A;  3RFW A;  5D0Q D;  4G50 A;  2XCB A;  2CHX A;  4A55 A;  3RRM B;  3EHN A;  3KAD A;  1EDQ A;  4U0S A;  1ZK6 A;  3G2U A;  4IYP A;  4AIF A;  3PR9 A;  3B7T A;  3LCA A;  1H2T C;  2ZU6 B;  3CVX A;  2F21 A;  1XNF A;  4DRJ A;  2UZ5 A;  1D2K A;  3HVE B;  3T5X A;  1QPF A;  5G05 J;  1CTN A;  3ENE A;  1FKR A;  3CLJ A;  2PM7 A;  4DRQ A;  3B13 A;  3ARW A;  2DSZ A;  3AS2 A;  2OFN A;  3FY4 A;  1NSG A;  2WPV A;  4QZV B;  3D9J A;  2WMO A;  2PM6 A;  3WQW A;  4ANU A;  2A3B A;  1HZ4 A;  4DLQ A;  1J4I A;  2FEZ A;  3D3M A;  4FAD A;  2LNI A;  1LG2 A;  3QAQ A;  5DO2 A;  3LJ3 A;  3Q15 A;  3D9P A;  2WXF A;  4APF A;  3VLF A;  2AXZ A;  3SFZ A;  2K8I A;  2KAT A;  1GOI A;  3ARV A;  5FZR A;  5HTG A;  1HE8 A;  1JNE A;  5HWB A;  3ARR A;  4JXT A;  1HO8 A;  4WK9 A;  4OVU A;  3FTZ A;  3QNK A;  5LCW C;  2DSU A;  2FKE A;  4TRQ A;  2Q5A A;  3ZN3 A;  3RM9 A;  1FVH A;  1EDU A;  2WXQ A;  5LX8 A;  5CHE E;  3D9L A;  4E85 A;  1FAP A;  3FU0 A;  2UWJ G;  2A4Z A;  1F40 A;  2IUZ A;  4FJZ A;  3QOK A;  4NZC A;  4ODO A;  3MA5 A;  5FTP A;  4GCO A;  2PI6 A;  1ELR A;  1JND A;  3OXG A;  4AEZ C;  5J6E A;  3RU0 A;  1YA0 A;  1H2U A;  5DIZ A;  2XP3 A;  4P8X A;  3UQ3 A;  3ZYK A;  4OYS A;  3G2V A;  3QJZ A;  2CFZ A;  2I2O A;  3UUX A;  3LXU X;  2DIW A;  2ILR A;  1FD9 A;  2WQ6 A;  1OWQ A;  5D75 A;  3RM4 A;  3CEQ A;  3QAR A;  4C0E A;  4R5E A;  1FKJ A;  3U64 A;  3CQC B;  2MRI A;  3LVR E;  5BUZ A;  3O5M A;  3MV2 B;  2J4D A;  4DWS B;  1JNT A;  1UJJ A;  3SBS A;  4EZK A;  1N54 A;  2Y4U A;  4Q22 A;  2FF4 A;  3RRU A;  4ATG A;  3DPD A;  5FJY A;  3UT7 A;  4L7T A;  3EJN A;  3LEW A;  4BT8 A;  5J08 A;  4U63 A;  4F1S A;  4TV3 A;  3FEX A;  1X6N A;  4JFK A;  2VTB B;  4BY6 A;  1OUV A;  5FZS A;  3CSF A;  3FUN A;  3PH0 C;  3KAG A;  5GPG A;  2KFW A;  1SR0 A;  2GRM A;  1HXI A;  2E0I A;  3T8M A;  5AIJ A;  4BX8 A;  3UI6 A;  4Q7N A;  1EIB A;  4HOU A;  1U3D A;  1J6Y A;  5LP0 A;  2IFU A;  3CK7 A;  4LER A;  3L54 A;  3GW4 A;  5AEN A;  2MLZ A;  2GGF A;  4N3A A;  4IQC A;  4Y6C A;  1F8A B;  2DG9 A;  3FTV A;  3KAB A;  1OWL A;  1ELW A;  2XHE A;  1DNP A;  4MKT A;  4H7Y A;  2L9B A;  4NSB A;  2XGS A;  1WAO 1;  4HS2 A;  3I6C A;  2ESC A;  1FCH A;  2JZV A;  3U9W A;  1J4R A;  2XRY A;  1FJD A;  4MTV A;  3GZ1 A;  3G6M A;  4PH4 B;  2RUQ A;  4C0M A;  2A3C A;  3R7Q A;  2FO7 A;  4Z2L A;  1E7U A;  5M72 A;  2LO6 A;  2LGO A;  2WXK A;  4KYO B;  3R9A B;  4IRU A;  3D9O A;  2WM0 A;  2AVP A;  3UT8 A;  1H0I A;  3KCE A;  4KBQ A;  5C1D A;  3LKU A;  2J9Q A;  3RRN B;  3FUM A;  2PQN A;  1KLX A;  3I5P A;  3CGN A;  3FUK A;  4RSY A;  2DT2 A;  4UWH A;  2C0L A;  4GB9 A;  3O5D A;  4I2W A;  4WWN A;  3KEZ A;  3ESK A;  3PZD A;  2VCD A;  4HOQ A;  3KZ7 A;  2M08 A;  3LY7 A;  1LQ0 A;  2WXR A;  3TXN A;  1OWO A;  3SHF A;  3T5V A;  2DT3 A;  2YQ8 A;  5FQ7 A;  4RVB A;  1E6R A;  4U0U A;  4XE0 A;  4UI9 C;  4MSP A;  4DRN A;  4TW6 A;  4NUR A;  4KZC A;  4HAR A;  4G24 A;  5D0O D;  3CHM A;  4G23 A;  4GYW A;  4ACL A;  4K03 A;  1Z6T A;  2YNQ A;  5AJD A;  2WQH A;  1WAW A;  3FU3 A;  3ZYQ A;  4AY6 A;  2MLX A;  3MCX A;  4GZ6 A;  4XKB A;  4B8A A;  3EY6 A;  3D9I A;  5BNW A;  1NWS A;  4TUU A;  1DVP A;  3ZVV A;  4UQX A;  3BEE A;  3P1U A;  2IU1 A;  1EF1 C;  3ULQ A;  4BWR A;  4ML4 A;  2WLY A;  4AM9 A;  4N2S A;  3TG4 A;  3PRZ A;  3PA7 A;  2WK2 A;  5KJK A;  4P8V A;  3Q47 B;  5ANR A;  3O5R A;  3FP3 A;  4I6G A;  3NTP A;  4ANX A;  1LL6 A;  3TXM A;  3NZS A;  3UI4 A;  1GUV A;  4DI3 A;  3SZ7 A;  5ARF A;  3U3W A;  4LAY A;  3APC A;  1NA0 A;  5JHA A;  2RD0 A;  4EZJ A;  4KXK B;  3GYZ A;  2UY1 B;  3MX3 A;  3RJV A;  2O9O A;  5HW8 A;  4YVQ C;  4S3K A;  1N1A A;  5FQ8 A;  3TC5 A;  3ZW3 A;  3S2A A;  4Z2H A;  2XP5 A;  1HU3 A;  3ARQ A;  1Y0O A;  3UT4 A;  4ZPT R;  1HX8 A;  4MS6 A;  1B6C A;  2FI7 A;  3Q5M A;  4DIP A;  4FU3 A;  4ITZ A;  1KT0 A;  2PZI A;  2ZQS A;  2HR2 A;  1HS6 A;  5E75 A;  2KI3 A;  3IHY A;  5JJT A;  4N3B A;  3VTY A;  1XHG A;  2DG3 A;  3EDT B;  4QFV A;  4O2T A;  2VGX B;  3I3N A;  2RQS A;  3OXL A;  4UWK A;  5LOZ A;  2KCL A;  3OTN A;  5CCL A;  4R0X A;  2RUC A;  2LSU A;  4C02 B;  2M63 A;  4U86 A;  2G41 A;  4U84 A;  1K9T A;  2PPN A;  3CHQ A;  5DIT A;  5BT1 A;  5BPP A;  2IF4 A;  3FH7 A;  2V5F A;  4PDX A;  4CT0 A;  1JNS A;  2PV3 A;  4LCT A;  2X6F A;  1QPL A;  3AU5 A;  2MNT A;  2WLZ A;  5G04 C;  1FKS A;  1UR9 A;  1ZL1 A;  4KVM A;  3SF4 A;  3LUO A;  3LY8 A;  4I2Z A;  5G55 A;  2R17 C;  3SNX A;  4ODR A;  2I1K A;  3L08 A;  3O4Z A;  2DSW A;  3PEU B;  3FXY A;  2KE0 A;  4HBO A;  2ZR4 A;  2VSN A;  4JFJ A;  2FBN A;  3RK6 A;  5ARG A;  1LL4 A;  3QWV A;  4U8H A;  4XI0 A;  2LKN A;  4Z2I A;  3S7B A;  4A1S A;  3ESL A;  2XP6 A;  3CVW A;  3WIJ A;  2F4E A;  2WXM A;  2AXU A;  3AS1 A;  1H0A A;  4LRZ A;  4ODL A;  2WXP A;  2XGM A;  4MNJ A;  4G26 A;  3B9D A;  3CVV A;  3CHS A;  2IOL A;  1HKM A;  2IJG X;  3NQP A;  3BG1 B;  1H6K A;  3G6L A;  3IHZ A;  3JCK C;  3PS6 A;  3ZFW A;  4WIW A;  3RO3 A;  3W4R A;  3B7U X;  1FFQ A;  1HKI A;  2RG8 A;  4KZ0 A;  2N87 A;  3BG0 B;  3CR3 A;  1S0P A;  4D10 C;  5HWC A;  2WQ7 A;  3JYM A;  4N2Q A;  4JHJ A;  2DPE A;  4ILH B;  4CGV A;  3CK8 A;  1A17 A;  1FFR A;  4ANV A;  4PS8 A;  3NRK A;  2IOS A;  4FJY A;  3R7R A;  3MZL B;  3IKG A;  4JC8 A;  3O5G A;  4MNK A;  4AJW A;  1MHQ A;  3CKB A;  3CHC A;  1FKF A;  3RM8 A;  2L6J A;  3PRE A;  2BUG A;  4XKC A;  4WWP A;  3ALG A;  1W3B A;  4WKF A;  1FKH A;  3CST A;  2VSY A;  3UQA A;  1M5Y A;  4AV7 A;  4EEC A;  4TW7 A;  1Q6H A;  3ONL A;  4DRM A;  2LJ4 A;  4F3V A;  1E8X A;  4Z2J A;  4AXH A;  3IKO B;  3IV0 A;  4QT3 A;  2AW6 A;  3RO2 A;  3FH8 A;  1E8Y A;  5LFA A;  1LG1 A;  5A23 A;  4AY5 A;  4PS7 A;  3LYA A;  4ODK A;  2XP4 A;  4BTA A;  5JJ7 A;  4AY1 A;  3EHM A;  4G25 A;  3PNT B;  4Q94 A;  1OGB A;  1QNF A;  4UWL A;  1SYT A;  1FVF A;  4H7X A;  4FP7 A;  3CHF A;  4U85 A;  4AOF A;  1OWP A;  2XPY A;  3QOU A;  2AXV A;  4HFG A;  2XPZ A;  2X6J A;  4DK5 A;  3RGC A;  1FKI A;  2PL2 A;  2XCC A;  3FFL A;  1KFW A;  4WAF A;  3N71 A;  3SGH A;  5KJL A;  4JEH A;  1ITX A;  2PV1 A;  3NI6 A;  2AWI A;  1ZU2 A;  4WKH A;  4JW1 A;  4GZ3 A;  4HOT A;  4J8S A;  3QK0 A;  1W9P A;  2VGX A;  3IBE A;  3FUE A;  2ZR6 A;  4BFR A;  1JWF A;  4R7L A;  3JYS A;  4FLH A;  4U04 A;  3ML8 A;  5T4Y A;  3O5E A;  2Y78 A;  3ASF A;  1R9H A;  1E8W A;  4ACK A;  4W5U A;  3TJP A;  3Q4A B;  3B8S A;  3TL5 A;  4CEM A;  1Q6I A;  4B94 A;  3OAW A;  3UMV A;  3FU5 A;  3UI5 A;  3MKQ B;  3OXF A;  4WND A;  2XP9 A;  4TW8 A;  5LCW J;  5JJ6 A;  1VDY A;  3HIZ A;  2VYI A;  2YBT A;  3TCZ A;  4F7A A;  3PE3 A;  4Z2G A;  3PNL B;  3AS8 A;  4XIF A;  4FC8 A;  4WWO A;  2DG4 A;  4FHJ A;  4GGQ A;  3CGM A;  1WB0 A;  2YIN A;  5FWQ A;  1WY6 A;  4DZ3 A;  3TG5 A;  3RME A;  2XRZ A;  2RSE A;  2LPV A;  4HBE A;  4J8F A;  3FWV A;  4I43 A;  2ZR5 A;  4TNS A;  2NC9 A;  3C98 A;  3KAF A;  5HKG A;  3FTX A;  3WD3 A;  2IQC A;  3NZU A;  5A6C A;  2O92 A;  3GZS A;  1H2V C;  1TJF A;  2L0T B;  4GZ5 A;  4Q96 A;  1N52 A;  2WXL A;  3Q49 B;  4BF8 A;  2CG2 A;  1Y6I A;  4GPK A;  2G8Z A;  3ZHE B;  4L23 A;  1TJC A;  4DRP A;  4QT2 A;  1QQE A;  3PRA A;  3TDB A;  5BV0 A;  3UPV A;  3ZRH A;  2WXH A;  3ZHE A;  2L2S A;  3AS0 A;  4A3T A;  3UF8 A;  4GMJ A;  5CMY A;  2AOS A;  4DWS C;  1BL4 A;  1NMW A;  3KAH A;  5G05 C;  1E15 A;  2V4L A;  2D9F A;  1HJW A;  3ARO A;  2XEV A;  2X6H A;  3L6A A;  3ZYM A;  4Q69 A;  3RIB A;  2OLH A;  3O5L A;  4L2L A;  3UQI A;  4K0R A;  4YND A;  3LVQ E;  4AVX A;  2KCV A;  2KR7 A;  1NMV A;  4WUY A;  2P58 C;  5J90 A;  1FKG A;  2VSO E;  3CHD A;  4I1A A;  4N5C A;  2CHW A;  4UWG A;  5FT9 A;  1J4H A;  1GPF A;  1HG2 A;  1ROT A;  1GW6 A;  1IQR A;  2VSX E;  3E4B A;  2WVI A;  4TYO A;  4NQ0 A;  1UJK A;  2KCK A;  2X6K A;  3OOB A;  1L5J A;  1JVW A;  3SI5 A;  1E6P A;  1NWR A;  5HUA A;  2MLY A;  3UQB A;  4JFI A;  2YBU A;  3S7F A;  3U66 A;  4JFM A;  2C2L A;  3CHP A;  4Z2K A;  3P2B A;  1WNO A;  3HVE A;  4O6F A;  3ARS A;  3KD7 A;  3JXV A;  5DIV A;  5G04 J;  2XP8 A;  3EIQ C;  4GYO A;  3ZGQ A;  2XPA A;  5I98 A;  5EX0 A;  4DRH A;  3HHM A;  3KAC A;  1WM5 A;  2FAP A;  1MQS A;  1QZ2 A;  4CDR A;  2XPI A;  2A3E A;  4GYY A;  3MV3 B;  3OA5 A;  4WNG A;  4WKA A;  3GPK A;  3L17 A;  3CVY A;  3FUI A;  1E90 A;  4B89 A;  4J6I A;  5GQB A;  4JL0 A;  4FUL A;  4OVV A;  4MLP A;  3O5F A;  4FLB A;  2VGY A;  1D7J A;  4KT6 B;  3TAX A;  3FTW A;  1HJX A;  3AQU A;  1PAQ A;  3K9I A;  3ZEF A;  3MKQ A;  3IKD A;  4UWF A;  4APO A;  3WD2 A;  4P8U A;  1T11 A;  1TFV A;  4GZD A;  4IN3 B;  4ODN A;  2QY7 A;  3L22 A;  3IHV A;  3WD4 A;  4J8E A;  1SZA A;  1FKL A;  4JVS A;  4J4N A;  5CCM A;  3SD5 A;  2KGJ A;  2NXP A;  3VAW A;  4ABN A;  4C9B B;  4XX5 A;  1PC2 A;  4EBA A;  4URK A;  1EPU A;  3ARY A;  5BW8 C;  2R5S A;  3AS4 A;  4A1G A;  1KT1 A;  4U0Z A;  1E6N A;  1P5Q A;  1H0G A;  2HYZ A;  3FHE A;  1W26 A;  2A3A A;  4W9O A;  3VLD A;  2QFC A;  1Q6U A;  3CVN A;  5BV1 A;  3CHO A;  4B8C B;  4JA7 A;  3B9E A;  2VN1 A;  2DT0 A;  4W9Q A;  2DT1 A;  4ZPV R;  2DBA A;  4ME2 A;  4URI A;  3CH9 A;  3NF1 A;  4CDM A;  1EHN A;  3B9A A;  3FTU A;  1X6L A;  4GA0 A;  1UR8 A;  1NWU A;  4DWS D;  3CHE A;  2X38 A;  2Q7F A;  4CCA A;  1NA3 A;  2PPO A;  3HDX A;  1H19 A;  4ZS6 A;  2HO1 A;  4DPR A;  3ZYL A;  3QWP A;  5DIU A;  2OVF A;  3IEG A;  4P29 A;  2Y4T A;  1E8Z A;  2WXO A;  2F2D A;  1ZBW A;  4V3I A;  3JQ0 A;  5FQ4 A;  1ZU8 A;  4W9P A;  4ZPW R;  1W1T A;  4JYS A;  3PRD A;  1D7H A;  3O5O A;  3CVU A;  2ZQT A;  4UQZ A;  2CG3 A;  4DRI A;  2L0I A;  3S7J A;  5JHB A;  1NZN A;  3LDZ A;  1HF8 A;  1B89 A;  4EQF A;  4UI9 J;  3FUD A;  4NAC A;  4ANW A;  5EKQ D;  2HM8 A;  2OND A;  3U4T A;  2KO7 A;  5HW6 A;  4L2Y A;  4MGV A;  5HQ8 A;  3D9K A;  3JUI A;  4IT4 A;  4GML A;  4DJA A;  4DWS A;  4GAA A;  5KJM A;  3MEK A;  1NWT A;  3ASG A;  1W1V A;  4XAK A;  1VF8 A;  2M1I A;  4HLE A;  3FTY A;  1W9V A;  3O5J A;  1HG5 A;  2RUR A;  2J08 A;  5B8I C;  5GPR A;  4GZC A;  5ENN A;  3TGO A;  1FKK A;  5DBK A;  4MNM A;  4J4O A;  3AU4 A;  4L1B A;  4JHR A;  5HT1 A;  1PIN A;  3KS2 A;  4EZL A;  3PVL A;  4ODP A;  1UN9 A;  3ONK A;  3G2W A;  3ARP A;  2LSV A;  1E6Z A;  4ILG A;  2ZQU A;  3QC1 A;  3KAE A;  3CVQ A;  3FU6 A;  4BT9 A;  5HBF A;  4I6J A;  4FHK A;  2BF0 X;  4KMO A;  4HVB A;  1JUQ A;  3GZ2 A;  1UW4 B;  4LGX A;  3ML9 A;  3FTS A;  4BSX A;  4I1O B;  4I9C A;  4J8D A;  3ARX A;  3PE4 A;  4DI4 A;  3ZXS A;  1SQM A;  2XGO A;  1ZBK A;  2WXN A;  2EQX A;  5FZQ A;  3MJW A;  3IK8 A;  2RUD A;  4GA1 A;  2BTD A;  1LJY A;  4Y6W A;  2PQR A;  2AWG A;  2X3M A;  4MRU A;  1EYM A;  4UQY A;  1Z3Y A;  4B0Z A;  3QDN A;  4I17 A;  1ZBP A;  1W1P A;  4HOR A;  3CKC A;  2JEK A;  2WXG A;  1OWN A;  3L16 A;  4DRO A;  5BXJ A;  3EIJ A;  2J49 A;  2KC7 A;  1UN8 A;  2VJ8 A;  2YHC A;  4UI9 K;  4M3O A;  3CIA A;  3BXW A;  1ELK A;  4MNL A;  4U07 A;  3O48 A;  1Z3X A;  4TX0 A;  5G2N A;  3PRB A;  2OVB A;  5HW7 A;  1IYG A;  1YAT A;  1YW5 A;  3FY1 A;  1LF8 A;  2J09 A;  4IUL A;  3WQV A;  3CZ8 A;  2CHZ A;  2ITK A;  1IHG A;  5T8I A;  1Y8M A;  3PUK A;  5JH8 A;  1RD6 A;  4RG6 A;  1IX5 A;  4BTB A;  1FKD A;  3HYM B;  2LAI A;  3AS3 A;  2J4B A;  3FUL A;  2KZT B;  2PBC A;  5A7D B;  3I4G A;  4YVO A;  4W9R A;  4S3J A;  4G11 A;  2NSZ A;  5T3R A;  1SZ9 A;  2C0M A;  1ZBV A;  2MPH A;  2KZT A;  2OV8 A;  3WH0 A;  2LAH A;  3KAI A;  4KR0 B;  4LUN U;  4LEU A;  1NP7 A;  4JHK A;  4I1M A;  2ION A;  1E7V A;  4CT4 A;  3MGB A;  3RKV A;  4JPS A;  4JZY A;  2J07 A;  4CGW A;  2VTB A;  1IQU A;  4NRH B;  4P8W A;  2Y3A A;  1TEZ A;  4JFL A;  4PTM A;  3L13 A;  1JWG A;  4ODQ A;  4KVO A;  4L72 B;  4DT4 A;  2E2E A;  3FUF A;  4XI9 A;  3G2T A;  4L3N A;  3VTX A;  4FN2 A;  4NNR A;  3D9M A;  3I4R B;  3H9R B;  3APD A;  1E96 B;  2XPB A;  2M2A A;  4E6H A;  3CV0 A;  4GCN A;  4G2V A;  4FAP A;  5EX3 A;  3B7X A;  3LY9 A;  4N39 A;  4LAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...