4TYOA

Ppiase in complex with a non-phosphate small molecule inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (III): Optimizing affinity beyond the phosphate recognition pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tyoA00
4O2TA 2XPAA 4U84A 2MLZA 4W9PA 4FN2A 5HW8A 3I6CA 3O5RA 3GPKA 5HTGA 2ITKA 2KGJA 2MF9A 2RSEA 4C02B 3H9RB 2PBCA 2VN1A 1NMWA 5HW7A 4DH0A 2MNTA 5HWBA 4TX0A 3UQIA 4W9QA 3O5GA 5HT1A 2PPPA 2DG9A 2K8IA 5HW6A 1FKHA 1Y0OA 1D7IA 1QPFA 3KADA 1TCOC 3O5MA 2ZQVA 1FKJA 4TW8A 2ZQSA 4G50A 3O5IA 2FAPA 1J4IA 1T11A 4DRHA 5B8IC 1ROUA 1YATA 1QPLA 1ROTA 2FKEA 2XP5A 3O5EA 4LAYA 4QT2A 5I98A 4MGVA 2KFWA 1NSGA 3NRKA 1D7HA 4LAXA 4ODNA 3NTPA 2KO7A 2PPNA 2ZR5A 3LUOA 4JFJA 1EQ3A 2PPOA 4W9OA 4J4NA 3JXVA 1FKIA 1NMVA 1KT0A 3B7XA 2LKNA 3RGCA 2XP4A 3UI6A 4DRMA 2RUQA 4MSPA 1QZ2A 3UQAA 1FJDA 4ODLA 4ODPA 1C9HA 3IKGA 3O5OA 3ODKA 4IQ2A 4GIVA 4LAVA 4N19A 2AWGA 1F8AB 3O5FA 1M5YA 4DT4A 5HKGA 1KT1A 3O5PA 3O5KA 4DRJA 3UF8A 3KABA 3PRBA 1U79A 1R9HA 2F21A 2JZVA 2ZQTA 4ODKA 3PRDA 4U85A 5DIVA 1ZK6A 1FKRA 3O5JA 1D7JA 2PV1A 5J6EA 5D75A 3KAGA 1A7XA 4JYSA 4ODOA 3KZ7A 2UZ5A 3KAHA 2MLYA 3NI6A 5HUAA 3VAWA 4QIBA 2D9FA 4ODQA 4DRPA 1FKGA 5HWCA 1FKSA 1JNSA 5GPGA 2KI3A 3OOBA 4DRKA 3O5DA 5DITA 2DG3A 3MDYB 1W26A 2F4EA 3O5QA 3IK8A 1L1PA 1PBKA 2M1IA 2OFNA 5DIUA 3IKDA 4JFIA 4DZ2A 4DRIA 4R0XA 1F40A 3KACA 1FKDA 4TW7A 2MPHA 3KCEA 4ODMA 3PA7A 1JNTA 4G2PA 1YW5A 2F2DA 2RURA 4ODRA 2DG4A 2KE0A 2RQSA 2LPVA 1Q1CA 2XP6A 1BL4A 1J4RA 3TC5A 3UQBA 2M2AA 1D6OA 3CGNA 4TNSA 4JFKA 2KR7A 4DIPA 4IQCA 2XP9A 5BXJA 1P5QA 3WH0A 4DRQA 1FKLA 4GGQA 4BF8A 3TCZA 3EY6A 2Q5AA 3O5LA 1FD9A 1N1AA 2M08A 3JYMA 3RFWA 3UI5A 1B6CA 1Q6IA 3JYJA 2PV3A 4U86A 2XP8A 2MLXA 1FKFA 2ZR6A 2VCDA 1EYMA 4DRNA 1J6YA 4JFLA 1J4HA 3FAPA 1JVWA 3CGMA 2LJ4A 3KAFA 4DROA 2XP3A 1HXVA 1Q6UA 2IF4A 3IHZA 3TDBA 1FAPA 1FKTA 2Y78A 2L2SA 4JFMA 4FAPA 4TW6A 2RUCA 2PV2A 4J4OA 2XP7A 4DZ3A 4IPXA 1PINA 1ZCNA 2LGOA 2ZR4A 4LAWA 4QT3A 4NNRA 4ITZA 4TYOA 2RUDA 1FKKA 2XPBA 1BKFA 3KAIA 2N87A 3UI4A 1FKBA 1Q6HA 2ZQUA
chains in the Genus database with same CATH superfamily
3ARQA 4U84A 2MLZA 4W9PA 4FN2A 5HW8A 2MF9A 1JCHB 2RSEA 4Z2IA 2PBCA 2VN1A 3PR9A 4TX0A 4Z2JA 1ZB5A 5DF0A 5HW6A 2DG9A 4PTMA 1FKHA 1ZBKA 3GU0A 1FKJA 4G50A 2QF8A 5B8IC 4QT2A 1NSGA 2KFWA 3WL0A 4WK9A 2KO7A 4JFJA 1FFQA 4W9OA 2LKNA 3UQAA 4N19A 4LAVA 3GTYX 1UR8A 1LL4A 1M5YA 4DT4A 1NWRA 1KT1A 3O5PA 2F21A 1EDQA 3ALGA 3O5JA 1WAWA 5J6EA 5D75A 1A7XA 1HKIA 2DPEA 2UZ5A 1K9TA 4QIBA 4W5UA 4DRPA 4Q22A 5GPGA 2KI3A 5DITA 3MDYB 1W26A 4MNLA 1NH6A 1PBKA 4DZ2A 4JFIA 4Z2LA 4P8WA 3G6LA 1FKDA 2WLYA 4WJXA 4ODMA 3PA7A 1JNEA 2RURA 2KE0A 4LGXA 2XP6A 4TNSA 3CGNA 2XP9A 4DRQA 1FKLA 1E6RA 3OA5A 3CHFA 1O6IA 2M08A 1N1AA 2PN0A 1HJWA 4U86A 3EIPA 3G6MA 1EYMA 1J6YA 4JFLA 3AS2A 2XP3A 1FKTA 3ARZA 3BMBA 1WNOA 2RUCA 4DZ3A 3FXYA 1EIBA 4MAVA 2G8ZA 4LAWA 4TYOA 3AS0A 3FY1A 3KAIA 4WKFA 1W1TA 3WL1A 2B31A 3B9DA 4O2TA 1W9UA 1IX5A 2XPAA 3ARTA 2DSUA 3I6CA 1E6PA 4WKHA 5GQBA 4S3KA 3H9RB 3RM9A 4DH0A 3UQIA 1SYTA 3QOKA 3O5GA 1TFVA 2PPPA 2K8IA 1D7IA 3KADA 4ZS6A 2ZQVA 2FAPA 4DRHA 1T11A 4MNMA 1ROTA 5HBFA 2ZR5A 2PPOA 4KR0B 1NMVA 3PRAA 4MSPA 1W9VA 1RD6A 1C9HA 3IKGA 3O5OA 3CH9A 4DWSA 1E9LA 1LQ0A 1E44A 5HKGA 3O5KA 2F23A 1U79A 1E6ZA 5DIVA 1ZU8A 4MTVA 1W1YA 1FKRA 3WD0A 4ODOA 2MLYA 3B9EA 5HUAA 2IUZA 3ARYA 1X6NA 2D9FA 4ODQA 1LG2A 4P8XA 4NSBA 2MPHA 3ARRA 3AS3A 3TC5A 3UQBA 4DIPA 4IQCA 2AOSA 4DWSC 5BXJA 1P5QA 3TCZA 2Q5AA 1FD9A 3ALFA 4Q7NA 1HKMA 1FKFA 2A3CA 1J4HA 4WKAA 3WD3A 4DROA 3W4RA 1Q6UA 2IF4A 1LL7A 1HXVA 1FAPA 1LL6A 2L2SA 2A3EA 2ETNA 2DSVA 3WQVA 1PINA 1ZCNA 1VF8A 4QT3A 4NNRA 1FKKA 5I98A 3RMEA 2ZQUA 1CTNA 4P8UA 3ARSA 1GOIA 4P8VA 4QZVB 3O5RA 1H0GA 1LJYA 2ITKA 4NZCA 1XRVA 5HW7A 2DT0A 2B5UB 4W9QA 1GPFA 4MNKA 2DT3A 3O5MA 1TCOC 2ZQSA 1SR0A 3O5IA 1ROUA 1YATA 1QPLA 3O5EA 4LAYA 4L72B 4UDMA 3NRKA 1D7HA 4ODNA 3NTPA 4AY1A 3JXVA 1FKIA 3B7XA 3UI6A 5HWCA 4KQZA 2RUQA 3AROA 1QZ2A 2DSZA 4IT4A 2YBUA 1FJDA 4ODPA 3AS1A 3CHEA 3ODKA 4IQ2A 4GIVA 4ZPWR 2AWGA 1F8AB 3O5FA 1HJVA 4ZPVR 4DRJA 3KABA 1R9HA 2JZVA 4U85A 3ARWA 1D7JA 2O9OA 2PV1A 4IT6A 3KAGA 2P4VA 3KZ7A 3B8SA 3WIJA 3VAWA 3WD1A 1JNDA 3ARPA 1FKSA 1W9PA 3O5DA 5DO2A 3CHDA 2DG3A 3O5QA 3IK8A 5DIUA 3IKDA 1FFRA 4DRIA 4R0XA 4TW7A 4G2PA 1YW5A 2F2DA 2DG4A 2LPVA 1Q1CA 2G41A 1J4RA 2M2AA 1D6OA 2KR7A 3RM8A 3WH0A 3CHCA 2WLZA 4BF8A 3EY6A 3O5LA 2A3BA 3JYMA 3RFWA 1B6CA 1Q6IA 3JYJA 3ARVA 2ZR6A 4ZPTR 2VCDA 1NWUA 3BXWA 3CGMA 2LJ4A 3TDBA 4FAPA 4JFMA 4J4OA 2PV2A 5GPRA 2LGOA 2RUDA 4WIWA 2N87A 1FKBA 2RQSA 1W1PA 1EHNA 4Z2KA 1OWQA 5HTGA 3GPKA 4L3NA 1ITXA 2KGJA 4C02B 1ZBCA 2DT1A 1ZL1A 1NMWA 2MNTA 5HWBA 1X6LA 4Z2HA 5HT1A 1HJXA 1Y0OA 1QPFA 4TW8A 1J4IA 3B9AA 2XP5A 2FKEA 4MGVA 4LAXA 2PPNA 3LUOA 1EQ3A 4XAKA 4J4NA 3RGCA 4Z2GA 1KT0A 2XP4A 4DRMA 1NWSA 4HBEA 3CZ8A 1OGGA 2FDMA 3ARXA 4HARA 4ODLA 2EULA 1ZBVA 1H0IA 3RM4A 1ZBWA 4S3JA 5JH8A 2O92A 1NWTA 3UF8A 3PRBA 4DWSB 2WM0A 4DWSD 2ZQTA 4ODKA 2DT2A 3PRDA 1ZK6A 4URIA 4JYSA 3KAHA 2ESCA 1GUVA 3NI6A 1FKGA 1JNSA 3OOBA 4DRKA 3ARUA 2F4EA 2DSWA 1L1PA 2M1IA 2OFNA 1F40A 3KACA 1GRJA 3KCEA 1JNTA 2A3AA 4ODRA 1BL4A 4HBOA 3WQWA 1UR9A 3WKZA 4JFKA 2WK2A 1XHGA 1E15A 3AQUA 1HKKA 1LG1A 1HKJA 4MPKA 3WD4A 4GGQA 4R5EA 1W1VA 1OGBA 1D2KA 2YBTA 3UI5A 2PV3A 2XP8A 2MLXA 4DRNA 2OLHA 3FAPA 1JVWA 1KFWA 3WD2A 3KAFA 5DEZA 3IHZA 4ML4A 2Y78A 4TW6A 2PI6A 1E6NA 2XP7A 4IPXA 2ZR4A 4MNJA 1WB0A 4ITZA 3UI4A 2XPBA 1BKFA 1Q6HA
chains in the Genus database with same CATH topology
3ARQA 4U84A 2MLZA 4W9PA 4FN2A 5HW8A 2MF9A 2RSEA 4Z2IA 2PBCA 2VN1A 3PR9A 4TX0A 4Z2JA 1ZB5A 5DF0A 5HW6A 2DG9A 4PTMA 1FKHA 1ZBKA 1FKJA 4G50A 2QF8A 5B8IC 4QT2A 1NSGA 2KFWA 3WL0A 4WK9A 2KO7A 4JFJA 1FFQA 4W9OA 2LKNA 3UQAA 4N19A 4LAVA 1UR8A 1LL4A 1M5YA 4DT4A 1NWRA 1KT1A 3O5PA 2F21A 1EDQA 3ALGA 3O5JA 1WAWA 5J6EA 5D75A 1A7XA 1HKIA 2DPEA 2UZ5A 1K9TA 4QIBA 4W5UA 4DRPA 4Q22A 5GPGA 2KI3A 5DITA 3MDYB 1W26A 4MNLA 1NH6A 1PBKA 4DZ2A 4JFIA 4Z2LA 4P8WA 3G6LA 1FKDA 2WLYA 4WJXA 4ODMA 3PA7A 1JNEA 2RURA 2KE0A 4LGXA 2XP6A 4TNSA 3CGNA 2XP9A 4DRQA 1FKLA 1E6RA 3OA5A 3CHFA 1O6IA 2M08A 1N1AA 1HJWA 4U86A 3G6MA 1EYMA 1J6YA 4JFLA 3AS2A 2XP3A 1FKTA 3ARZA 1WNOA 2RUCA 4DZ3A 3FXYA 1EIBA 4MAVA 2G8ZA 4LAWA 4TYOA 3AS0A 3FY1A 3KAIA 4WKFA 1W1TA 3WL1A 2B31A 3B9DA 4O2TA 1W9UA 1IX5A 2XPAA 3ARTA 2DSUA 3I6CA 1E6PA 4WKHA 5GQBA 4S3KA 3H9RB 3RM9A 4DH0A 3UQIA 1SYTA 3QOKA 3O5GA 1TFVA 2PPPA 2K8IA 1D7IA 3KADA 4ZS6A 2ZQVA 2FAPA 4DRHA 1T11A 4MNMA 1ROTA 5HBFA 2ZR5A 2PPOA 4KR0B 1NMVA 3PRAA 4MSPA 1W9VA 1RD6A 1C9HA 3IKGA 3O5OA 3CH9A 4DWSA 1E9LA 1LQ0A 5HKGA 3O5KA 1U79A 1E6ZA 5DIVA 1ZU8A 4MTVA 1W1YA 1FKRA 3WD0A 4ODOA 2MLYA 3B9EA 5HUAA 2IUZA 3ARYA 1X6NA 2D9FA 4ODQA 1LG2A 4P8XA 4NSBA 2MPHA 3ARRA 3AS3A 3TC5A 3UQBA 4DIPA 4IQCA 2AOSA 4DWSC 5BXJA 1P5QA 3TCZA 2Q5AA 1FD9A 3ALFA 4Q7NA 1HKMA 1FKFA 2A3CA 1J4HA 4WKAA 3WD3A 4DROA 3W4RA 1Q6UA 2IF4A 1LL7A 1HXVA 1FAPA 1LL6A 2L2SA 2A3EA 2DSVA 3WQVA 1PINA 1ZCNA 1VF8A 4QT3A 4NNRA 1FKKA 5I98A 3RMEA 2ZQUA 1CTNA 4P8UA 3ARSA 1GOIA 4P8VA 4QZVB 3O5RA 1H0GA 1LJYA 2ITKA 4NZCA 1XRVA 5HW7A 2DT0A 4W9QA 1GPFA 4MNKA 2DT3A 3O5MA 1TCOC 2ZQSA 1SR0A 3O5IA 1ROUA 1YATA 1QPLA 3O5EA 4LAYA 4L72B 3NRKA 1D7HA 4ODNA 3NTPA 4AY1A 3JXVA 1FKIA 3B7XA 3UI6A 5HWCA 4KQZA 2RUQA 3AROA 1QZ2A 2DSZA 4IT4A 2YBUA 1FJDA 4ODPA 3AS1A 3CHEA 3ODKA 4IQ2A 4GIVA 4ZPWR 2AWGA 1F8AB 3O5FA 1HJVA 4ZPVR 4DRJA 3KABA 1R9HA 2JZVA 4U85A 3ARWA 1D7JA 2O9OA 2PV1A 4IT6A 3KAGA 3KZ7A 3B8SA 3WIJA 3VAWA 3WD1A 1JNDA 3ARPA 1FKSA 1W9PA 3O5DA 5DO2A 3CHDA 2DG3A 3O5QA 3IK8A 5DIUA 3IKDA 1FFRA 4DRIA 4R0XA 4TW7A 4G2PA 1YW5A 2F2DA 2DG4A 2LPVA 1Q1CA 2G41A 1J4RA 2M2AA 1D6OA 2KR7A 3RM8A 3WH0A 3CHCA 2WLZA 4BF8A 3EY6A 3O5LA 2A3BA 3JYMA 3RFWA 1B6CA 1Q6IA 3JYJA 3ARVA 2ZR6A 4ZPTR 2VCDA 1NWUA 3BXWA 3CGMA 2LJ4A 3TDBA 4FAPA 4JFMA 4J4OA 2PV2A 5GPRA 2LGOA 2RUDA 4WIWA 2N87A 1FKBA 2RQSA 1W1PA 1EHNA 4Z2KA 1OWQA 5HTGA 3GPKA 4L3NA 1ITXA 2KGJA 4C02B 1ZBCA 2DT1A 1ZL1A 1NMWA 2MNTA 5HWBA 1X6LA 4Z2HA 5HT1A 1HJXA 1Y0OA 1QPFA 4TW8A 1J4IA 3B9AA 2XP5A 2FKEA 4MGVA 4LAXA 2PPNA 3LUOA 1EQ3A 4XAKA 4J4NA 3RGCA 4Z2GA 1KT0A 2XP4A 4DRMA 1NWSA 4HBEA 3CZ8A 1OGGA 2FDMA 3ARXA 4HARA 4ODLA 1ZBVA 1H0IA 3RM4A 1ZBWA 4S3JA 5JH8A 2O92A 1NWTA 3UF8A 3PRBA 4DWSB 2WM0A 4DWSD 2ZQTA 4ODKA 2DT2A 3PRDA 1ZK6A 4URIA 4JYSA 3KAHA 2ESCA 1GUVA 3NI6A 1FKGA 1JNSA 3OOBA 4DRKA 3ARUA 2F4EA 2DSWA 1L1PA 2M1IA 2OFNA 1F40A 3KACA 3KCEA 1JNTA 2A3AA 4ODRA 1BL4A 4HBOA 3WQWA 1UR9A 3WKZA 4JFKA 2WK2A 1XHGA 1E15A 3AQUA 1HKKA 1LG1A 1HKJA 4MPKA 3WD4A 4GGQA 4R5EA 1W1VA 1OGBA 1D2KA 2YBTA 3UI5A 2PV3A 2XP8A 2MLXA 4DRNA 2OLHA 3FAPA 1JVWA 1KFWA 3WD2A 3KAFA 5DEZA 3IHZA 4ML4A 2Y78A 4TW6A 2PI6A 1E6NA 2XP7A 4IPXA 2ZR4A 4MNJA 1WB0A 4ITZA 3UI4A 2XPBA 1BKFA 1Q6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2T A;  2XPA A;  4U84 A;  2MLZ A;  4W9P A;  4FN2 A;  5HW8 A;  3I6C A;  3O5R A;  3GPK A;  5HTG A;  2ITK A;  2KGJ A;  2MF9 A;  2RSE A;  4C02 B;  3H9R B;  2PBC A;  2VN1 A;  1NMW A;  5HW7 A;  4DH0 A;  2MNT A;  5HWB A;  4TX0 A;  3UQI A;  4W9Q A;  3O5G A;  5HT1 A;  2PPP A;  2DG9 A;  2K8I A;  5HW6 A;  1FKH A;  1Y0O A;  1D7I A;  1QPF A;  3KAD A;  1TCO C;  3O5M A;  2ZQV A;  1FKJ A;  4TW8 A;  2ZQS A;  4G50 A;  3O5I A;  2FAP A;  1J4I A;  1T11 A;  4DRH A;  5B8I C;  1ROU A;  1YAT A;  1QPL A;  1ROT A;  2FKE A;  2XP5 A;  3O5E A;  4LAY A;  4QT2 A;  5I98 A;  4MGV A;  2KFW A;  1NSG A;  3NRK A;  1D7H A;  4LAX A;  4ODN A;  3NTP A;  2KO7 A;  2PPN A;  2ZR5 A;  3LUO A;  4JFJ A;  1EQ3 A;  2PPO A;  4W9O A;  4J4N A;  3JXV A;  1FKI A;  1NMV A;  1KT0 A;  3B7X A;  2LKN A;  3RGC A;  2XP4 A;  3UI6 A;  4DRM A;  2RUQ A;  4MSP A;  1QZ2 A;  3UQA A;  1FJD A;  4ODL A;  4ODP A;  1C9H A;  3IKG A;  3O5O A;  3ODK A;  4IQ2 A;  4GIV A;  4LAV A;  4N19 A;  2AWG A;  1F8A B;  3O5F A;  1M5Y A;  4DT4 A;  5HKG A;  1KT1 A;  3O5P A;  3O5K A;  4DRJ A;  3UF8 A;  3KAB A;  3PRB A;  1U79 A;  1R9H A;  2F21 A;  2JZV A;  2ZQT A;  4ODK A;  3PRD A;  4U85 A;  5DIV A;  1ZK6 A;  1FKR A;  3O5J A;  1D7J A;  2PV1 A;  5J6E A;  5D75 A;  3KAG A;  1A7X A;  4JYS A;  4ODO A;  3KZ7 A;  2UZ5 A;  3KAH A;  2MLY A;  3NI6 A;  5HUA A;  3VAW A;  4QIB A;  2D9F A;  4ODQ A;  4DRP A;  1FKG A;  5HWC A;  1FKS A;  1JNS A;  5GPG A;  2KI3 A;  3OOB A;  4DRK A;  3O5D A;  5DIT A;  2DG3 A;  3MDY B;  1W26 A;  2F4E A;  3O5Q A;  3IK8 A;  1L1P A;  1PBK A;  2M1I A;  2OFN A;  5DIU A;  3IKD A;  4JFI A;  4DZ2 A;  4DRI A;  4R0X A;  1F40 A;  3KAC A;  1FKD A;  4TW7 A;  2MPH A;  3KCE A;  4ODM A;  3PA7 A;  1JNT A;  4G2P A;  1YW5 A;  2F2D A;  2RUR A;  4ODR A;  2DG4 A;  2KE0 A;  2RQS A;  2LPV A;  1Q1C A;  2XP6 A;  1BL4 A;  1J4R A;  3TC5 A;  3UQB A;  2M2A A;  1D6O A;  3CGN A;  4TNS A;  4JFK A;  2KR7 A;  4DIP A;  4IQC A;  2XP9 A;  5BXJ A;  1P5Q A;  3WH0 A;  4DRQ A;  1FKL A;  4GGQ A;  4BF8 A;  3TCZ A;  3EY6 A;  2Q5A A;  3O5L A;  1FD9 A;  1N1A A;  2M08 A;  3JYM A;  3RFW A;  3UI5 A;  1B6C A;  1Q6I A;  3JYJ A;  2PV3 A;  4U86 A;  2XP8 A;  2MLX A;  1FKF A;  2ZR6 A;  2VCD A;  1EYM A;  4DRN A;  1J6Y A;  4JFL A;  1J4H A;  3FAP A;  1JVW A;  3CGM A;  2LJ4 A;  3KAF A;  4DRO A;  2XP3 A;  1HXV A;  1Q6U A;  2IF4 A;  3IHZ A;  3TDB A;  1FAP A;  1FKT A;  2Y78 A;  2L2S A;  4JFM A;  4FAP A;  4TW6 A;  2RUC A;  2PV2 A;  4J4O A;  2XP7 A;  4DZ3 A;  4IPX A;  1PIN A;  1ZCN A;  2LGO A;  2ZR4 A;  4LAW A;  4QT3 A;  4NNR A;  4ITZ A;  4TYO A;  2RUD A;  1FKK A;  2XPB A;  1BKF A;  3KAI A;  2N87 A;  3UI4 A;  1FKB A;  1Q6H A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 3ARQ A;  4U84 A;  2MLZ A;  4W9P A;  4FN2 A;  5HW8 A;  2MF9 A;  1JCH B;  2RSE A;  4Z2I A;  2PBC A;  2VN1 A;  3PR9 A;  4TX0 A;  4Z2J A;  1ZB5 A;  5DF0 A;  5HW6 A;  2DG9 A;  4PTM A;  1FKH A;  1ZBK A;  3GU0 A;  1FKJ A;  4G50 A;  2QF8 A;  5B8I C;  4QT2 A;  1NSG A;  2KFW A;  3WL0 A;  4WK9 A;  2KO7 A;  4JFJ A;  1FFQ A;  4W9O A;  2LKN A;  3UQA A;  4N19 A;  4LAV A;  3GTY X;  1UR8 A;  1LL4 A;  1M5Y A;  4DT4 A;  1NWR A;  1KT1 A;  3O5P A;  2F21 A;  1EDQ A;  3ALG A;  3O5J A;  1WAW A;  5J6E A;  5D75 A;  1A7X A;  1HKI A;  2DPE A;  2UZ5 A;  1K9T A;  4QIB A;  4W5U A;  4DRP A;  4Q22 A;  5GPG A;  2KI3 A;  5DIT A;  3MDY B;  1W26 A;  4MNL A;  1NH6 A;  1PBK A;  4DZ2 A;  4JFI A;  4Z2L A;  4P8W A;  3G6L A;  1FKD A;  2WLY A;  4WJX A;  4ODM A;  3PA7 A;  1JNE A;  2RUR A;  2KE0 A;  4LGX A;  2XP6 A;  4TNS A;  3CGN A;  2XP9 A;  4DRQ A;  1FKL A;  1E6R A;  3OA5 A;  3CHF A;  1O6I A;  2M08 A;  1N1A A;  2PN0 A;  1HJW A;  4U86 A;  3EIP A;  3G6M A;  1EYM A;  1J6Y A;  4JFL A;  3AS2 A;  2XP3 A;  1FKT A;  3ARZ A;  3BMB A;  1WNO A;  2RUC A;  4DZ3 A;  3FXY A;  1EIB A;  4MAV A;  2G8Z A;  4LAW A;  4TYO A;  3AS0 A;  3FY1 A;  3KAI A;  4WKF A;  1W1T A;  3WL1 A;  2B31 A;  3B9D A;  4O2T A;  1W9U A;  1IX5 A;  2XPA A;  3ART A;  2DSU A;  3I6C A;  1E6P A;  4WKH A;  5GQB A;  4S3K A;  3H9R B;  3RM9 A;  4DH0 A;  3UQI A;  1SYT A;  3QOK A;  3O5G A;  1TFV A;  2PPP A;  2K8I A;  1D7I A;  3KAD A;  4ZS6 A;  2ZQV A;  2FAP A;  4DRH A;  1T11 A;  4MNM A;  1ROT A;  5HBF A;  2ZR5 A;  2PPO A;  4KR0 B;  1NMV A;  3PRA A;  4MSP A;  1W9V A;  1RD6 A;  1C9H A;  3IKG A;  3O5O A;  3CH9 A;  4DWS A;  1E9L A;  1LQ0 A;  1E44 A;  5HKG A;  3O5K A;  2F23 A;  1U79 A;  1E6Z A;  5DIV A;  1ZU8 A;  4MTV A;  1W1Y A;  1FKR A;  3WD0 A;  4ODO A;  2MLY A;  3B9E A;  5HUA A;  2IUZ A;  3ARY A;  1X6N A;  2D9F A;  4ODQ A;  1LG2 A;  4P8X A;  4NSB A;  2MPH A;  3ARR A;  3AS3 A;  3TC5 A;  3UQB A;  4DIP A;  4IQC A;  2AOS A;  4DWS C;  5BXJ A;  1P5Q A;  3TCZ A;  2Q5A A;  1FD9 A;  3ALF A;  4Q7N A;  1HKM A;  1FKF A;  2A3C A;  1J4H A;  4WKA A;  3WD3 A;  4DRO A;  3W4R A;  1Q6U A;  2IF4 A;  1LL7 A;  1HXV A;  1FAP A;  1LL6 A;  2L2S A;  2A3E A;  2ETN A;  2DSV A;  3WQV A;  1PIN A;  1ZCN A;  1VF8 A;  4QT3 A;  4NNR A;  1FKK A;  5I98 A;  3RME A;  2ZQU A;  1CTN A;  4P8U A;  3ARS A;  1GOI A;  4P8V A;  4QZV B;  3O5R A;  1H0G A;  1LJY A;  2ITK A;  4NZC A;  1XRV A;  5HW7 A;  2DT0 A;  2B5U B;  4W9Q A;  1GPF A;  4MNK A;  2DT3 A;  3O5M A;  1TCO C;  2ZQS A;  1SR0 A;  3O5I A;  1ROU A;  1YAT A;  1QPL A;  3O5E A;  4LAY A;  4L72 B;  4UDM A;  3NRK A;  1D7H A;  4ODN A;  3NTP A;  4AY1 A;  3JXV A;  1FKI A;  3B7X A;  3UI6 A;  5HWC A;  4KQZ A;  2RUQ A;  3ARO A;  1QZ2 A;  2DSZ A;  4IT4 A;  2YBU A;  1FJD A;  4ODP A;  3AS1 A;  3CHE A;  3ODK A;  4IQ2 A;  4GIV A;  4ZPW R;  2AWG A;  1F8A B;  3O5F A;  1HJV A;  4ZPV R;  4DRJ A;  3KAB A;  1R9H A;  2JZV A;  4U85 A;  3ARW A;  1D7J A;  2O9O A;  2PV1 A;  4IT6 A;  3KAG A;  2P4V A;  3KZ7 A;  3B8S A;  3WIJ A;  3VAW A;  3WD1 A;  1JND A;  3ARP A;  1FKS A;  1W9P A;  3O5D A;  5DO2 A;  3CHD A;  2DG3 A;  3O5Q A;  3IK8 A;  5DIU A;  3IKD A;  1FFR A;  4DRI A;  4R0X A;  4TW7 A;  4G2P A;  1YW5 A;  2F2D A;  2DG4 A;  2LPV A;  1Q1C A;  2G41 A;  1J4R A;  2M2A A;  1D6O A;  2KR7 A;  3RM8 A;  3WH0 A;  3CHC A;  2WLZ A;  4BF8 A;  3EY6 A;  3O5L A;  2A3B A;  3JYM A;  3RFW A;  1B6C A;  1Q6I A;  3JYJ A;  3ARV A;  2ZR6 A;  4ZPT R;  2VCD A;  1NWU A;  3BXW A;  3CGM A;  2LJ4 A;  3TDB A;  4FAP A;  4JFM A;  4J4O A;  2PV2 A;  5GPR A;  2LGO A;  2RUD A;  4WIW A;  2N87 A;  1FKB A;  2RQS A;  1W1P A;  1EHN A;  4Z2K A;  1OWQ A;  5HTG A;  3GPK A;  4L3N A;  1ITX A;  2KGJ A;  4C02 B;  1ZBC A;  2DT1 A;  1ZL1 A;  1NMW A;  2MNT A;  5HWB A;  1X6L A;  4Z2H A;  5HT1 A;  1HJX A;  1Y0O A;  1QPF A;  4TW8 A;  1J4I A;  3B9A A;  2XP5 A;  2FKE A;  4MGV A;  4LAX A;  2PPN A;  3LUO A;  1EQ3 A;  4XAK A;  4J4N A;  3RGC A;  4Z2G A;  1KT0 A;  2XP4 A;  4DRM A;  1NWS A;  4HBE A;  3CZ8 A;  1OGG A;  2FDM A;  3ARX A;  4HAR A;  4ODL A;  2EUL A;  1ZBV A;  1H0I A;  3RM4 A;  1ZBW A;  4S3J A;  5JH8 A;  2O92 A;  1NWT A;  3UF8 A;  3PRB A;  4DWS B;  2WM0 A;  4DWS D;  2ZQT A;  4ODK A;  2DT2 A;  3PRD A;  1ZK6 A;  4URI A;  4JYS A;  3KAH A;  2ESC A;  1GUV A;  3NI6 A;  1FKG A;  1JNS A;  3OOB A;  4DRK A;  3ARU A;  2F4E A;  2DSW A;  1L1P A;  2M1I A;  2OFN A;  1F40 A;  3KAC A;  1GRJ A;  3KCE A;  1JNT A;  2A3A A;  4ODR A;  1BL4 A;  4HBO A;  3WQW A;  1UR9 A;  3WKZ A;  4JFK A;  2WK2 A;  1XHG A;  1E15 A;  3AQU A;  1HKK A;  1LG1 A;  1HKJ A;  4MPK A;  3WD4 A;  4GGQ A;  4R5E A;  1W1V A;  1OGB A;  1D2K A;  2YBT A;  3UI5 A;  2PV3 A;  2XP8 A;  2MLX A;  4DRN A;  2OLH A;  3FAP A;  1JVW A;  1KFW A;  3WD2 A;  3KAF A;  5DEZ A;  3IHZ A;  4ML4 A;  2Y78 A;  4TW6 A;  2PI6 A;  1E6N A;  2XP7 A;  4IPX A;  2ZR4 A;  4MNJ A;  1WB0 A;  4ITZ A;  3UI4 A;  2XPB A;  1BKF A;  1Q6H A; 
#chains in the Genus database with same CATH homology
 3ARQ A;  4U84 A;  2MLZ A;  4W9P A;  4FN2 A;  5HW8 A;  2MF9 A;  2RSE A;  4Z2I A;  2PBC A;  2VN1 A;  3PR9 A;  4TX0 A;  4Z2J A;  1ZB5 A;  5DF0 A;  5HW6 A;  2DG9 A;  4PTM A;  1FKH A;  1ZBK A;  1FKJ A;  4G50 A;  2QF8 A;  5B8I C;  4QT2 A;  1NSG A;  2KFW A;  3WL0 A;  4WK9 A;  2KO7 A;  4JFJ A;  1FFQ A;  4W9O A;  2LKN A;  3UQA A;  4N19 A;  4LAV A;  1UR8 A;  1LL4 A;  1M5Y A;  4DT4 A;  1NWR A;  1KT1 A;  3O5P A;  2F21 A;  1EDQ A;  3ALG A;  3O5J A;  1WAW A;  5J6E A;  5D75 A;  1A7X A;  1HKI A;  2DPE A;  2UZ5 A;  1K9T A;  4QIB A;  4W5U A;  4DRP A;  4Q22 A;  5GPG A;  2KI3 A;  5DIT A;  3MDY B;  1W26 A;  4MNL A;  1NH6 A;  1PBK A;  4DZ2 A;  4JFI A;  4Z2L A;  4P8W A;  3G6L A;  1FKD A;  2WLY A;  4WJX A;  4ODM A;  3PA7 A;  1JNE A;  2RUR A;  2KE0 A;  4LGX A;  2XP6 A;  4TNS A;  3CGN A;  2XP9 A;  4DRQ A;  1FKL A;  1E6R A;  3OA5 A;  3CHF A;  1O6I A;  2M08 A;  1N1A A;  1HJW A;  4U86 A;  3G6M A;  1EYM A;  1J6Y A;  4JFL A;  3AS2 A;  2XP3 A;  1FKT A;  3ARZ A;  1WNO A;  2RUC A;  4DZ3 A;  3FXY A;  1EIB A;  4MAV A;  2G8Z A;  4LAW A;  4TYO A;  3AS0 A;  3FY1 A;  3KAI A;  4WKF A;  1W1T A;  3WL1 A;  2B31 A;  3B9D A;  4O2T A;  1W9U A;  1IX5 A;  2XPA A;  3ART A;  2DSU A;  3I6C A;  1E6P A;  4WKH A;  5GQB A;  4S3K A;  3H9R B;  3RM9 A;  4DH0 A;  3UQI A;  1SYT A;  3QOK A;  3O5G A;  1TFV A;  2PPP A;  2K8I A;  1D7I A;  3KAD A;  4ZS6 A;  2ZQV A;  2FAP A;  4DRH A;  1T11 A;  4MNM A;  1ROT A;  5HBF A;  2ZR5 A;  2PPO A;  4KR0 B;  1NMV A;  3PRA A;  4MSP A;  1W9V A;  1RD6 A;  1C9H A;  3IKG A;  3O5O A;  3CH9 A;  4DWS A;  1E9L A;  1LQ0 A;  5HKG A;  3O5K A;  1U79 A;  1E6Z A;  5DIV A;  1ZU8 A;  4MTV A;  1W1Y A;  1FKR A;  3WD0 A;  4ODO A;  2MLY A;  3B9E A;  5HUA A;  2IUZ A;  3ARY A;  1X6N A;  2D9F A;  4ODQ A;  1LG2 A;  4P8X A;  4NSB A;  2MPH A;  3ARR A;  3AS3 A;  3TC5 A;  3UQB A;  4DIP A;  4IQC A;  2AOS A;  4DWS C;  5BXJ A;  1P5Q A;  3TCZ A;  2Q5A A;  1FD9 A;  3ALF A;  4Q7N A;  1HKM A;  1FKF A;  2A3C A;  1J4H A;  4WKA A;  3WD3 A;  4DRO A;  3W4R A;  1Q6U A;  2IF4 A;  1LL7 A;  1HXV A;  1FAP A;  1LL6 A;  2L2S A;  2A3E A;  2DSV A;  3WQV A;  1PIN A;  1ZCN A;  1VF8 A;  4QT3 A;  4NNR A;  1FKK A;  5I98 A;  3RME A;  2ZQU A;  1CTN A;  4P8U A;  3ARS A;  1GOI A;  4P8V A;  4QZV B;  3O5R A;  1H0G A;  1LJY A;  2ITK A;  4NZC A;  1XRV A;  5HW7 A;  2DT0 A;  4W9Q A;  1GPF A;  4MNK A;  2DT3 A;  3O5M A;  1TCO C;  2ZQS A;  1SR0 A;  3O5I A;  1ROU A;  1YAT A;  1QPL A;  3O5E A;  4LAY A;  4L72 B;  3NRK A;  1D7H A;  4ODN A;  3NTP A;  4AY1 A;  3JXV A;  1FKI A;  3B7X A;  3UI6 A;  5HWC A;  4KQZ A;  2RUQ A;  3ARO A;  1QZ2 A;  2DSZ A;  4IT4 A;  2YBU A;  1FJD A;  4ODP A;  3AS1 A;  3CHE A;  3ODK A;  4IQ2 A;  4GIV A;  4ZPW R;  2AWG A;  1F8A B;  3O5F A;  1HJV A;  4ZPV R;  4DRJ A;  3KAB A;  1R9H A;  2JZV A;  4U85 A;  3ARW A;  1D7J A;  2O9O A;  2PV1 A;  4IT6 A;  3KAG A;  3KZ7 A;  3B8S A;  3WIJ A;  3VAW A;  3WD1 A;  1JND A;  3ARP A;  1FKS A;  1W9P A;  3O5D A;  5DO2 A;  3CHD A;  2DG3 A;  3O5Q A;  3IK8 A;  5DIU A;  3IKD A;  1FFR A;  4DRI A;  4R0X A;  4TW7 A;  4G2P A;  1YW5 A;  2F2D A;  2DG4 A;  2LPV A;  1Q1C A;  2G41 A;  1J4R A;  2M2A A;  1D6O A;  2KR7 A;  3RM8 A;  3WH0 A;  3CHC A;  2WLZ A;  4BF8 A;  3EY6 A;  3O5L A;  2A3B A;  3JYM A;  3RFW A;  1B6C A;  1Q6I A;  3JYJ A;  3ARV A;  2ZR6 A;  4ZPT R;  2VCD A;  1NWU A;  3BXW A;  3CGM A;  2LJ4 A;  3TDB A;  4FAP A;  4JFM A;  4J4O A;  2PV2 A;  5GPR A;  2LGO A;  2RUD A;  4WIW A;  2N87 A;  1FKB A;  2RQS A;  1W1P A;  1EHN A;  4Z2K A;  1OWQ A;  5HTG A;  3GPK A;  4L3N A;  1ITX A;  2KGJ A;  4C02 B;  1ZBC A;  2DT1 A;  1ZL1 A;  1NMW A;  2MNT A;  5HWB A;  1X6L A;  4Z2H A;  5HT1 A;  1HJX A;  1Y0O A;  1QPF A;  4TW8 A;  1J4I A;  3B9A A;  2XP5 A;  2FKE A;  4MGV A;  4LAX A;  2PPN A;  3LUO A;  1EQ3 A;  4XAK A;  4J4N A;  3RGC A;  4Z2G A;  1KT0 A;  2XP4 A;  4DRM A;  1NWS A;  4HBE A;  3CZ8 A;  1OGG A;  2FDM A;  3ARX A;  4HAR A;  4ODL A;  1ZBV A;  1H0I A;  3RM4 A;  1ZBW A;  4S3J A;  5JH8 A;  2O92 A;  1NWT A;  3UF8 A;  3PRB A;  4DWS B;  2WM0 A;  4DWS D;  2ZQT A;  4ODK A;  2DT2 A;  3PRD A;  1ZK6 A;  4URI A;  4JYS A;  3KAH A;  2ESC A;  1GUV A;  3NI6 A;  1FKG A;  1JNS A;  3OOB A;  4DRK A;  3ARU A;  2F4E A;  2DSW A;  1L1P A;  2M1I A;  2OFN A;  1F40 A;  3KAC A;  3KCE A;  1JNT A;  2A3A A;  4ODR A;  1BL4 A;  4HBO A;  3WQW A;  1UR9 A;  3WKZ A;  4JFK A;  2WK2 A;  1XHG A;  1E15 A;  3AQU A;  1HKK A;  1LG1 A;  1HKJ A;  4MPK A;  3WD4 A;  4GGQ A;  4R5E A;  1W1V A;  1OGB A;  1D2K A;  2YBT A;  3UI5 A;  2PV3 A;  2XP8 A;  2MLX A;  4DRN A;  2OLH A;  3FAP A;  1JVW A;  1KFW A;  3WD2 A;  3KAF A;  5DEZ A;  3IHZ A;  4ML4 A;  2Y78 A;  4TW6 A;  2PI6 A;  1E6N A;  2XP7 A;  4IPX A;  2ZR4 A;  4MNJ A;  1WB0 A;  4ITZ A;  3UI4 A;  2XPB A;  1BKF A;  1Q6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...