4TYOA

Ppiase in complex with a non-phosphate small molecule inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (III): Optimizing affinity beyond the phosphate recognition pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 38
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tyoA00
4LAWA 4DRJA 1YW5A 4QT3A 3OOBA 4DRKA 1FKDA 1JVWA 3KCEA 4GIVA 5D75A 3B7XA 3O5RA 3NTPA 1KT0A 1R9HA 1ROTA 4LAXA 1TCOC 4ITZA 4U84A 1PBKA 4W9QA 2F4EA 2XP7A 4JFIA 5J6EA 2LGOA 4U86A 1ROUA 3TC5A 2F2DA 3KAFA 2MNTA 4DRIA 4LAVA 4DRMA 4DZ2A 3CGMA 2PV3A 3PRBA 1BKFA 2M1IA 5DITA 3EY6A 2ZQVA 5GPGA 1PINA 4N19A 3IKDA 3FAPA 2Q5AA 4C02B 5B8IC 2ZR4A 4R0XA 1EYMA 4TW6A 1ZCNA 1Q6HA 2F21A 2FKEA 1FKBA 2PBCA 2MLXA 2XP9A 4JYSA 3UI6A 3UQIA 2XP3A 5DIUA 4DT4A 4LAYA 2AWGA 2ZQSA 1FKFA 5HWCA 5HTGA 1M5YA 1KT1A 1A7XA 1U79A 4ODMA 2M2AA 3TDBA 4TYOA 4DROA 5HWBA 3RFWA 4QIBA 3O5FA 1P5QA 4JFKA 2M08A 3O5QA 2KO7A 4ODKA 2UZ5A 4DZ3A 3KACA 3KAIA 2PPOA 1F8AB 4ODNA 1ZK6A 5DIVA 3JXVA 4BF8A 4DRPA 3PA7A 3O5DA 3O5OA 2KI3A 2RSEA 2VN1A 2ZQUA 4FN2A 2PV2A 2XPBA 2LKNA 1W26A 4TW8A 3TCZA 4ODQA 3UF8A 2RUQA 3GPKA 2XP6A 4MGVA 4ODOA 3UI5A 2KR7A 4NNRA 1Y0OA 3O5KA 1L1PA 4IQ2A 1Q6UA 1FKSA 4DRHA 1FKKA 2ITKA 3O5PA 2LPVA 4MSPA 2JZVA 2K8IA 3O5JA 1QZ2A 3UQBA 2IF4A 2LJ4A 3IKGA 3JYJA 4O2TA 5I98A 5BXJA 4G2PA 4U85A 2DG9A 3I6CA 4QT2A 1Q1CA 3IK8A 4JFLA 1NSGA 5HT1A 4J4OA 4W9PA 3NI6A 3O5MA 1D7JA 1Q6IA 4ODLA 4FAPA 1QPFA 2PV1A 2RURA 4DIPA 4J4NA 1F40A 2MF9A 4DH0A 3VAWA 3IHZA 2MLZA 2RUDA 1FD9A 4G50A 2MLYA 4JFMA 1NMWA 3KZ7A 3O5EA 1EQ3A 3KAGA 3O5LA 3JYMA 3H9RB 3KABA 2XP5A 2VCDA 2XPAA 1JNTA 4ODPA 2D9FA 2RQSA 2ZR5A 1FKGA 1N1AA 2OFNA 3LUOA 1C9HA 1D6OA 1HXVA 2PPNA 2PPPA 1FKTA 4TW7A 1B6CA 3O5IA 1D7IA 2DG4A 2Y78A 1FAPA 2KE0A 1FKLA 3ODKA 5HUAA 3PRDA 2XP4A 3NRKA 3UQAA 1QPLA 2ZQTA 4TX0A 3RGCA 3WH0A 1FKRA 4IPXA 1J4IA 1J4RA 1T11A 4TNSA 1J4HA 4W9OA 4DRQA 2KGJA 1BL4A 1FKJA 1NMVA 3CGNA 3O5GA 2N87A 4JFJA 4ODRA 4GGQA 5HW7A 1J6YA 1FJDA 5HKGA 3UI4A 1FKHA 2DG3A 2MPHA 3KADA 1JNSA 4IQCA 5HW8A 2KFWA 3KAHA 1FKIA 2L2SA 2FAPA 4DRNA 3MDYB 2XP8A 2RUCA 2ZR6A 1D7HA 5HW6A 1YATA
chains in the Genus database with same CATH superfamily
1YW5A 4QT3A 1WB0A 1JVWA 4AY1A 5D75A 1LL4A 1KT0A 1R9HA 1ROTA 3G6LA 1TCOC 2F4EA 5J6EA 3TC5A 4MAVA 1JNDA 3CGMA 1BKFA 5DITA 3EY6A 5GPGA 3ARZA 1PINA 4N19A 4C02B 1JCHB 4R0XA 4ML4A 1HJXA 4TW6A 2XP9A 3OA5A 4JYSA 1EHNA 1HJVA 1UR9A 4NZCA 4LAYA 2AWGA 1FKFA 1ZBWA 3WD0A 1A7XA 3AS1A 3WL0A 4Z2JA 3G6MA 1W1VA 1W1YA 4TYOA 4DROA 1OWQA 4JFKA 1LG1A 2M08A 3O5QA 2KO7A 1SR0A 2ETNA 2UZ5A 2PPOA 1F8AB 4BF8A 3B9DA 3JXVA 2VN1A 5DEZA 2PV2A 2LKNA 1W26A 1CTNA 3GPKA 2DSUA 4ODOA 1L1PA 4L3NA 3WIJA 2LPVA 4MSPA 4Q7NA 2JZVA 2K8IA 5GQBA 3JYJA 4W5UA 1HJWA 2DG9A 4DWSC 4S3JA 3I6CA 1NWSA 1D7JA 1WNOA 2RURA 3B9AA 2MF9A 3VAWA 3IHZA 4G50A 3KAGA 3H9RB 2DT2A 2XPAA 2YBUA 2D9FA 2ZR5A 3LUOA 1C9HA 1D6OA 2P4VA 1D7IA 2Y78A 1RD6A 3UQAA 3RMEA 2ZQTA 3RGCA 4WIWA 4NSBA 4TNSA 1J4HA 4W9OA 1BL4A 4URIA 5HW7A 2OLHA 4PTMA 1NWRA 1NWUA 5HW8A 3WQWA 1E9LA 1FKIA 1GUVA 2FAPA 2WLZA 3MDYB 4MTVA 1D7HA 4L72B 4LGXA 1OGGA 3OOBA 2QF8A 3B7XA 2A3CA 3O5RA 3ARUA 4LAXA 1ZB5A 4JFIA 1ROUA 3FY1A 4DRIA 1LL6A 2MNTA 1H0IA 2PV3A 3PRBA 2M1IA 2ZQVA 1HKKA 1WAWA 2EULA 3ALGA 1ZBKA 3FAPA 4P8UA 1X6LA 3GU0A 1ZCNA 1Q6HA 2AOSA 2F21A 2PBCA 3UQIA 2MLXA 3WD4A 4DT4A 3W4RA 5HTGA 1EDQA 4ODMA 1LJYA 1ZBCA 2M2AA 3TDBA 4ZPTR 1SYTA 3RM9A 4ODKA 2A3AA 3KAIA 4ODNA 4DRPA 3WD1A 2KI3A 2RSEA 3FXYA 4TW8A 3TCZA 4ODQA 3UF8A 4P8WA 4WKAA 4ZS6A 1FKKA 2ITKA 1FFQA 1JNEA 2PN0A 1QZ2A 1W9VA 2LJ4A 3IKGA 5I98A 3AROA 1FFRA 4S3KA 1Q1CA 3IK8A 4JFLA 4W9PA 2F23A 3AS3A 4XAKA 4Z2KA 4ODLA 1Q6IA 1W1PA 4FAPA 1QPFA 2PV1A 4DIPA 3WD3A 2RUDA 4JFMA 4HARA 3PRAA 1EQ3A 3JYMA 3KABA 2XP5A 2VCDA 3WD2A 1JNTA 3AS2A 1FKGA 2G8ZA 1LL7A 1HXVA 4MNKA 4HBEA 1FAPA 3ODKA 3NRKA 3PR9A 4Q22A 3WH0A 1J4IA 1T11A 4MNLA 1FKJA 1NMVA 1J6YA 1KFWA 2IUZA 1FKHA 3KADA 2DT3A 3CHCA 1XHGA 2XP8A 2ZR6A 4IT4A 1YATA 4DRJA 4DRKA 1OGBA 2DSZA 2PI6A 3B8SA 4U84A 1E6ZA 4ITZA 4W9QA 3ARPA 4U86A 1ZU8A 1K9TA 3GTYX 1E6PA 2G41A 3IKDA 3CZ8A 1D2KA 2B31A 3UI6A 1FKBA 5GPRA 1VF8A 3RM4A 3WKZA 4WK9A 3ARYA 4ZPWR 2ZQSA 5HWCA 1LQ0A 4QIBA 1X6NA 3KACA 3PA7A 3O5DA 3O5OA 2ZQUA 4FN2A 1E6NA 3CH9A 3ARWA 2XP6A 3UI5A 3EIPA 1Y0OA 3O5KA 1Q6UA 1FKSA 5HBFA 2DT0A 3O5PA 3O5JA 5JH8A 3UQBA 4O2TA 3ARTA 5BXJA 4G2PA 4MNMA 3ARXA 4QT2A 4QZVB 3NI6A 1W1TA 1F40A 4J4NA 2MLZA 1FD9A 3AS0A 1HKMA 3BMBA 3KZ7A 1TFVA 4MPKA 1ZL1A 2OFNA 4IT6A 4WKHA 1GRJA 4Z2HA 4ZPVR 4DWSA 1W9UA 1E44A 2DPEA 4KQZA 4TW7A 1B6CA 3O5IA 2DG4A 2WK2A 2KE0A 5HUAA 1FKLA 3ARSA 4TX0A 1LG2A 1J4RA 4DRQA 2KGJA 3O5GA 3ARQA 4JFJA 3CGNA 4Z2GA 2N87A 3AQUA 4ODRA 2A3EA 4WKFA 4WJXA 1FJDA 5HKGA 2DG3A 1JNSA 1HKJA 4IQCA 2KFWA 1NH6A 5HW6A 4LAWA 1FKDA 3KCEA 1HKIA 4GIVA 3CHFA 1O6IA 3NTPA 1PBKA 2XP7A 2LGOA 2F2DA 3KAFA 5DF0A 4DZ2A 4LAVA 4DRMA 2A3BA 2FDMA 2DT1A 3B9EA 1EIBA 2DSWA 2WM0A 3ALFA 2O9OA 2Q5AA 5B8IC 2ZR4A 1EYMA 4HBOA 3WL1A 1E6RA 2FKEA 5DO2A 2XP3A 2O92A 4Z2LA 5DIUA 1XRVA 4UDMA 1M5YA 1KT1A 1ZBVA 1U79A 5HWBA 3RFWA 3O5FA 1P5QA 4P8XA 4DZ3A 5DIVA 1NWTA 1ZK6A 3ARVA 2YBTA 2XPBA 4DWSB 2DSVA 2RUQA 4MGVA 2KR7A 4NNRA 1GPFA 4IQ2A 4DRHA 3CHDA 2IF4A 4U85A 1H0GA 1NSGA 5HT1A 4J4OA 3O5MA 4Z2IA 4DH0A 2WLYA 3RM8A 4P8VA 2MLYA 4KR0B 1NMWA 3O5EA 3O5LA 3QOKA 1W9PA 3WQVA 4ODPA 2RQSA 3ARRA 1N1AA 4R5EA 1UR8A 2B5UB 2PPNA 1IX5A 2PPPA 1FKTA 1ITXA 3PRDA 2XP4A 1E15A 1FKRA 4IPXA 4MNJA 4GGQA 3UI4A 3BXWA 2MPHA 3KAHA 2L2SA 4DRNA 1GOIA 4DWSD 3CHEA 2RUCA 2ESCA 1QPLA
chains in the Genus database with same CATH topology
1YW5A 4QT3A 1WB0A 1JVWA 4AY1A 5D75A 1LL4A 1KT0A 1R9HA 1ROTA 3G6LA 1TCOC 2F4EA 5J6EA 3TC5A 4MAVA 1JNDA 3CGMA 1BKFA 5DITA 3EY6A 5GPGA 3ARZA 1PINA 4N19A 4C02B 4R0XA 4ML4A 1HJXA 4TW6A 2XP9A 3OA5A 4JYSA 1EHNA 1HJVA 1UR9A 4NZCA 4LAYA 2AWGA 1FKFA 1ZBWA 3WD0A 1A7XA 3AS1A 3WL0A 4Z2JA 3G6MA 1W1VA 1W1YA 4TYOA 4DROA 1OWQA 4JFKA 1LG1A 2M08A 3O5QA 2KO7A 1SR0A 2UZ5A 2PPOA 1F8AB 4BF8A 3B9DA 3JXVA 2VN1A 5DEZA 2PV2A 2LKNA 1W26A 1CTNA 3GPKA 2DSUA 4ODOA 1L1PA 4L3NA 3WIJA 2LPVA 4MSPA 4Q7NA 2JZVA 2K8IA 5GQBA 3JYJA 4W5UA 1HJWA 2DG9A 4DWSC 4S3JA 3I6CA 1NWSA 1D7JA 1WNOA 2RURA 3B9AA 2MF9A 3VAWA 3IHZA 4G50A 3KAGA 3H9RB 2DT2A 2XPAA 2YBUA 2D9FA 2ZR5A 3LUOA 1C9HA 1D6OA 1D7IA 2Y78A 1RD6A 3UQAA 3RMEA 2ZQTA 3RGCA 4WIWA 4NSBA 4TNSA 1J4HA 4W9OA 1BL4A 4URIA 5HW7A 2OLHA 4PTMA 1NWRA 1NWUA 5HW8A 3WQWA 1E9LA 1FKIA 1GUVA 2FAPA 2WLZA 3MDYB 4MTVA 1D7HA 4L72B 4LGXA 1OGGA 3OOBA 2QF8A 3B7XA 2A3CA 3O5RA 3ARUA 4LAXA 1ZB5A 4JFIA 1ROUA 3FY1A 4DRIA 1LL6A 2MNTA 1H0IA 2PV3A 3PRBA 2M1IA 2ZQVA 1HKKA 1WAWA 3ALGA 1ZBKA 3FAPA 4P8UA 1X6LA 1ZCNA 1Q6HA 2AOSA 2F21A 2PBCA 3UQIA 2MLXA 3WD4A 4DT4A 3W4RA 5HTGA 1EDQA 4ODMA 1LJYA 1ZBCA 2M2AA 3TDBA 4ZPTR 1SYTA 3RM9A 4ODKA 2A3AA 3KAIA 4ODNA 4DRPA 3WD1A 2KI3A 2RSEA 3FXYA 4TW8A 3TCZA 4ODQA 3UF8A 4P8WA 4WKAA 4ZS6A 1FKKA 2ITKA 1FFQA 1JNEA 1QZ2A 1W9VA 2LJ4A 3IKGA 5I98A 3AROA 1FFRA 4S3KA 1Q1CA 3IK8A 4JFLA 4W9PA 3AS3A 4XAKA 4Z2KA 4ODLA 1Q6IA 1W1PA 4FAPA 1QPFA 2PV1A 4DIPA 3WD3A 2RUDA 4JFMA 4HARA 3PRAA 1EQ3A 3JYMA 3KABA 2XP5A 2VCDA 3WD2A 1JNTA 3AS2A 1FKGA 2G8ZA 1LL7A 1HXVA 4MNKA 4HBEA 1FAPA 3ODKA 3NRKA 3PR9A 4Q22A 3WH0A 1J4IA 1T11A 4MNLA 1FKJA 1NMVA 1J6YA 1KFWA 2IUZA 1FKHA 3KADA 2DT3A 3CHCA 1XHGA 2XP8A 2ZR6A 4IT4A 1YATA 4DRJA 4DRKA 1OGBA 2DSZA 2PI6A 3B8SA 4U84A 1E6ZA 4ITZA 4W9QA 3ARPA 4U86A 1ZU8A 1K9TA 1E6PA 2G41A 3IKDA 3CZ8A 1D2KA 2B31A 3UI6A 1FKBA 5GPRA 1VF8A 3RM4A 3WKZA 4WK9A 3ARYA 4ZPWR 2ZQSA 5HWCA 1LQ0A 4QIBA 1X6NA 3KACA 3PA7A 3O5DA 3O5OA 2ZQUA 4FN2A 1E6NA 3CH9A 3ARWA 2XP6A 3UI5A 1Y0OA 3O5KA 1Q6UA 1FKSA 5HBFA 2DT0A 3O5PA 3O5JA 5JH8A 3UQBA 4O2TA 3ARTA 5BXJA 4G2PA 4MNMA 3ARXA 4QT2A 4QZVB 3NI6A 1W1TA 1F40A 4J4NA 2MLZA 1FD9A 3AS0A 1HKMA 3KZ7A 1TFVA 4MPKA 1ZL1A 2OFNA 4IT6A 4WKHA 4Z2HA 4ZPVR 4DWSA 1W9UA 2DPEA 4KQZA 4TW7A 1B6CA 3O5IA 2DG4A 2WK2A 2KE0A 5HUAA 1FKLA 3ARSA 4TX0A 1LG2A 1J4RA 4DRQA 2KGJA 3O5GA 3ARQA 4JFJA 3CGNA 4Z2GA 2N87A 3AQUA 4ODRA 2A3EA 4WKFA 4WJXA 1FJDA 5HKGA 2DG3A 1JNSA 1HKJA 4IQCA 2KFWA 1NH6A 5HW6A 4LAWA 1FKDA 3KCEA 1HKIA 4GIVA 3CHFA 1O6IA 3NTPA 1PBKA 2XP7A 2LGOA 2F2DA 3KAFA 5DF0A 4DZ2A 4LAVA 4DRMA 2A3BA 2FDMA 2DT1A 3B9EA 1EIBA 2DSWA 2WM0A 3ALFA 2O9OA 2Q5AA 5B8IC 2ZR4A 1EYMA 4HBOA 3WL1A 1E6RA 2FKEA 5DO2A 2XP3A 2O92A 4Z2LA 5DIUA 1XRVA 1M5YA 1KT1A 1ZBVA 1U79A 5HWBA 3RFWA 3O5FA 1P5QA 4P8XA 4DZ3A 5DIVA 1NWTA 1ZK6A 3ARVA 2YBTA 2XPBA 4DWSB 2DSVA 2RUQA 4MGVA 2KR7A 4NNRA 1GPFA 4IQ2A 4DRHA 3CHDA 2IF4A 4U85A 1H0GA 1NSGA 5HT1A 4J4OA 3O5MA 4Z2IA 4DH0A 2WLYA 3RM8A 4P8VA 2MLYA 4KR0B 1NMWA 3O5EA 3O5LA 3QOKA 1W9PA 3WQVA 4ODPA 2RQSA 3ARRA 1N1AA 4R5EA 1UR8A 2PPNA 1IX5A 2PPPA 1FKTA 1ITXA 3PRDA 2XP4A 1E15A 1FKRA 4IPXA 4MNJA 4GGQA 3UI4A 3BXWA 2MPHA 3KAHA 2L2SA 4DRNA 1GOIA 4DWSD 3CHEA 2RUCA 2ESCA 1QPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAW A;  4DRJ A;  1YW5 A;  4QT3 A;  3OOB A;  4DRK A;  1FKD A;  1JVW A;  3KCE A;  4GIV A;  5D75 A;  3B7X A;  3O5R A;  3NTP A;  1KT0 A;  1R9H A;  1ROT A;  4LAX A;  1TCO C;  4ITZ A;  4U84 A;  1PBK A;  4W9Q A;  2F4E A;  2XP7 A;  4JFI A;  5J6E A;  2LGO A;  4U86 A;  1ROU A;  3TC5 A;  2F2D A;  3KAF A;  2MNT A;  4DRI A;  4LAV A;  4DRM A;  4DZ2 A;  3CGM A;  2PV3 A;  3PRB A;  1BKF A;  2M1I A;  5DIT A;  3EY6 A;  2ZQV A;  5GPG A;  1PIN A;  4N19 A;  3IKD A;  3FAP A;  2Q5A A;  4C02 B;  5B8I C;  2ZR4 A;  4R0X A;  1EYM A;  4TW6 A;  1ZCN A;  1Q6H A;  2F21 A;  2FKE A;  1FKB A;  2PBC A;  2MLX A;  2XP9 A;  4JYS A;  3UI6 A;  3UQI A;  2XP3 A;  5DIU A;  4DT4 A;  4LAY A;  2AWG A;  2ZQS A;  1FKF A;  5HWC A;  5HTG A;  1M5Y A;  1KT1 A;  1A7X A;  1U79 A;  4ODM A;  2M2A A;  3TDB A;  4TYO A;  4DRO A;  5HWB A;  3RFW A;  4QIB A;  3O5F A;  1P5Q A;  4JFK A;  2M08 A;  3O5Q A;  2KO7 A;  4ODK A;  2UZ5 A;  4DZ3 A;  3KAC A;  3KAI A;  2PPO A;  1F8A B;  4ODN A;  1ZK6 A;  5DIV A;  3JXV A;  4BF8 A;  4DRP A;  3PA7 A;  3O5D A;  3O5O A;  2KI3 A;  2RSE A;  2VN1 A;  2ZQU A;  4FN2 A;  2PV2 A;  2XPB A;  2LKN A;  1W26 A;  4TW8 A;  3TCZ A;  4ODQ A;  3UF8 A;  2RUQ A;  3GPK A;  2XP6 A;  4MGV A;  4ODO A;  3UI5 A;  2KR7 A;  4NNR A;  1Y0O A;  3O5K A;  1L1P A;  4IQ2 A;  1Q6U A;  1FKS A;  4DRH A;  1FKK A;  2ITK A;  3O5P A;  2LPV A;  4MSP A;  2JZV A;  2K8I A;  3O5J A;  1QZ2 A;  3UQB A;  2IF4 A;  2LJ4 A;  3IKG A;  3JYJ A;  4O2T A;  5I98 A;  5BXJ A;  4G2P A;  4U85 A;  2DG9 A;  3I6C A;  4QT2 A;  1Q1C A;  3IK8 A;  4JFL A;  1NSG A;  5HT1 A;  4J4O A;  4W9P A;  3NI6 A;  3O5M A;  1D7J A;  1Q6I A;  4ODL A;  4FAP A;  1QPF A;  2PV1 A;  2RUR A;  4DIP A;  4J4N A;  1F40 A;  2MF9 A;  4DH0 A;  3VAW A;  3IHZ A;  2MLZ A;  2RUD A;  1FD9 A;  4G50 A;  2MLY A;  4JFM A;  1NMW A;  3KZ7 A;  3O5E A;  1EQ3 A;  3KAG A;  3O5L A;  3JYM A;  3H9R B;  3KAB A;  2XP5 A;  2VCD A;  2XPA A;  1JNT A;  4ODP A;  2D9F A;  2RQS A;  2ZR5 A;  1FKG A;  1N1A A;  2OFN A;  3LUO A;  1C9H A;  1D6O A;  1HXV A;  2PPN A;  2PPP A;  1FKT A;  4TW7 A;  1B6C A;  3O5I A;  1D7I A;  2DG4 A;  2Y78 A;  1FAP A;  2KE0 A;  1FKL A;  3ODK A;  5HUA A;  3PRD A;  2XP4 A;  3NRK A;  3UQA A;  1QPL A;  2ZQT A;  4TX0 A;  3RGC A;  3WH0 A;  1FKR A;  4IPX A;  1J4I A;  1J4R A;  1T11 A;  4TNS A;  1J4H A;  4W9O A;  4DRQ A;  2KGJ A;  1BL4 A;  1FKJ A;  1NMV A;  3CGN A;  3O5G A;  2N87 A;  4JFJ A;  4ODR A;  4GGQ A;  5HW7 A;  1J6Y A;  1FJD A;  5HKG A;  3UI4 A;  1FKH A;  2DG3 A;  2MPH A;  3KAD A;  1JNS A;  4IQC A;  5HW8 A;  2KFW A;  3KAH A;  1FKI A;  2L2S A;  2FAP A;  4DRN A;  3MDY B;  2XP8 A;  2RUC A;  2ZR6 A;  1D7H A;  5HW6 A;  1YAT A; 
#chains in the Genus database with same CATH topology
 1YW5 A;  4QT3 A;  1WB0 A;  1JVW A;  4AY1 A;  5D75 A;  1LL4 A;  1KT0 A;  1R9H A;  1ROT A;  3G6L A;  1TCO C;  2F4E A;  5J6E A;  3TC5 A;  4MAV A;  1JND A;  3CGM A;  1BKF A;  5DIT A;  3EY6 A;  5GPG A;  3ARZ A;  1PIN A;  4N19 A;  4C02 B;  1JCH B;  4R0X A;  4ML4 A;  1HJX A;  4TW6 A;  2XP9 A;  3OA5 A;  4JYS A;  1EHN A;  1HJV A;  1UR9 A;  4NZC A;  4LAY A;  2AWG A;  1FKF A;  1ZBW A;  3WD0 A;  1A7X A;  3AS1 A;  3WL0 A;  4Z2J A;  3G6M A;  1W1V A;  1W1Y A;  4TYO A;  4DRO A;  1OWQ A;  4JFK A;  1LG1 A;  2M08 A;  3O5Q A;  2KO7 A;  1SR0 A;  2ETN A;  2UZ5 A;  2PPO A;  1F8A B;  4BF8 A;  3B9D A;  3JXV A;  2VN1 A;  5DEZ A;  2PV2 A;  2LKN A;  1W26 A;  1CTN A;  3GPK A;  2DSU A;  4ODO A;  1L1P A;  4L3N A;  3WIJ A;  2LPV A;  4MSP A;  4Q7N A;  2JZV A;  2K8I A;  5GQB A;  3JYJ A;  4W5U A;  1HJW A;  2DG9 A;  4DWS C;  4S3J A;  3I6C A;  1NWS A;  1D7J A;  1WNO A;  2RUR A;  3B9A A;  2MF9 A;  3VAW A;  3IHZ A;  4G50 A;  3KAG A;  3H9R B;  2DT2 A;  2XPA A;  2YBU A;  2D9F A;  2ZR5 A;  3LUO A;  1C9H A;  1D6O A;  2P4V A;  1D7I A;  2Y78 A;  1RD6 A;  3UQA A;  3RME A;  2ZQT A;  3RGC A;  4WIW A;  4NSB A;  4TNS A;  1J4H A;  4W9O A;  1BL4 A;  4URI A;  5HW7 A;  2OLH A;  4PTM A;  1NWR A;  1NWU A;  5HW8 A;  3WQW A;  1E9L A;  1FKI A;  1GUV A;  2FAP A;  2WLZ A;  3MDY B;  4MTV A;  1D7H A;  4L72 B;  4LGX A;  1OGG A;  3OOB A;  2QF8 A;  3B7X A;  2A3C A;  3O5R A;  3ARU A;  4LAX A;  1ZB5 A;  4JFI A;  1ROU A;  3FY1 A;  4DRI A;  1LL6 A;  2MNT A;  1H0I A;  2PV3 A;  3PRB A;  2M1I A;  2ZQV A;  1HKK A;  1WAW A;  2EUL A;  3ALG A;  1ZBK A;  3FAP A;  4P8U A;  1X6L A;  3GU0 A;  1ZCN A;  1Q6H A;  2AOS A;  2F21 A;  2PBC A;  3UQI A;  2MLX A;  3WD4 A;  4DT4 A;  3W4R A;  5HTG A;  1EDQ A;  4ODM A;  1LJY A;  1ZBC A;  2M2A A;  3TDB A;  4ZPT R;  1SYT A;  3RM9 A;  4ODK A;  2A3A A;  3KAI A;  4ODN A;  4DRP A;  3WD1 A;  2KI3 A;  2RSE A;  3FXY A;  4TW8 A;  3TCZ A;  4ODQ A;  3UF8 A;  4P8W A;  4WKA A;  4ZS6 A;  1FKK A;  2ITK A;  1FFQ A;  1JNE A;  2PN0 A;  1QZ2 A;  1W9V A;  2LJ4 A;  3IKG A;  5I98 A;  3ARO A;  1FFR A;  4S3K A;  1Q1C A;  3IK8 A;  4JFL A;  4W9P A;  2F23 A;  3AS3 A;  4XAK A;  4Z2K A;  4ODL A;  1Q6I A;  1W1P A;  4FAP A;  1QPF A;  2PV1 A;  4DIP A;  3WD3 A;  2RUD A;  4JFM A;  4HAR A;  3PRA A;  1EQ3 A;  3JYM A;  3KAB A;  2XP5 A;  2VCD A;  3WD2 A;  1JNT A;  3AS2 A;  1FKG A;  2G8Z A;  1LL7 A;  1HXV A;  4MNK A;  4HBE A;  1FAP A;  3ODK A;  3NRK A;  3PR9 A;  4Q22 A;  3WH0 A;  1J4I A;  1T11 A;  4MNL A;  1FKJ A;  1NMV A;  1J6Y A;  1KFW A;  2IUZ A;  1FKH A;  3KAD A;  2DT3 A;  3CHC A;  1XHG A;  2XP8 A;  2ZR6 A;  4IT4 A;  1YAT A;  4DRJ A;  4DRK A;  1OGB A;  2DSZ A;  2PI6 A;  3B8S A;  4U84 A;  1E6Z A;  4ITZ A;  4W9Q A;  3ARP A;  4U86 A;  1ZU8 A;  1K9T A;  3GTY X;  1E6P A;  2G41 A;  3IKD A;  3CZ8 A;  1D2K A;  2B31 A;  3UI6 A;  1FKB A;  5GPR A;  1VF8 A;  3RM4 A;  3WKZ A;  4WK9 A;  3ARY A;  4ZPW R;  2ZQS A;  5HWC A;  1LQ0 A;  4QIB A;  1X6N A;  3KAC A;  3PA7 A;  3O5D A;  3O5O A;  2ZQU A;  4FN2 A;  1E6N A;  3CH9 A;  3ARW A;  2XP6 A;  3UI5 A;  3EIP A;  1Y0O A;  3O5K A;  1Q6U A;  1FKS A;  5HBF A;  2DT0 A;  3O5P A;  3O5J A;  5JH8 A;  3UQB A;  4O2T A;  3ART A;  5BXJ A;  4G2P A;  4MNM A;  3ARX A;  4QT2 A;  4QZV B;  3NI6 A;  1W1T A;  1F40 A;  4J4N A;  2MLZ A;  1FD9 A;  3AS0 A;  1HKM A;  3BMB A;  3KZ7 A;  1TFV A;  4MPK A;  1ZL1 A;  2OFN A;  4IT6 A;  4WKH A;  1GRJ A;  4Z2H A;  4ZPV R;  4DWS A;  1W9U A;  1E44 A;  2DPE A;  4KQZ A;  4TW7 A;  1B6C A;  3O5I A;  2DG4 A;  2WK2 A;  2KE0 A;  5HUA A;  1FKL A;  3ARS A;  4TX0 A;  1LG2 A;  1J4R A;  4DRQ A;  2KGJ A;  3O5G A;  3ARQ A;  4JFJ A;  3CGN A;  4Z2G A;  2N87 A;  3AQU A;  4ODR A;  2A3E A;  4WKF A;  4WJX A;  1FJD A;  5HKG A;  2DG3 A;  1JNS A;  1HKJ A;  4IQC A;  2KFW A;  1NH6 A;  5HW6 A;  4LAW A;  1FKD A;  3KCE A;  1HKI A;  4GIV A;  3CHF A;  1O6I A;  3NTP A;  1PBK A;  2XP7 A;  2LGO A;  2F2D A;  3KAF A;  5DF0 A;  4DZ2 A;  4LAV A;  4DRM A;  2A3B A;  2FDM A;  2DT1 A;  3B9E A;  1EIB A;  2DSW A;  2WM0 A;  3ALF A;  2O9O A;  2Q5A A;  5B8I C;  2ZR4 A;  1EYM A;  4HBO A;  3WL1 A;  1E6R A;  2FKE A;  5DO2 A;  2XP3 A;  2O92 A;  4Z2L A;  5DIU A;  1XRV A;  4UDM A;  1M5Y A;  1KT1 A;  1ZBV A;  1U79 A;  5HWB A;  3RFW A;  3O5F A;  1P5Q A;  4P8X A;  4DZ3 A;  5DIV A;  1NWT A;  1ZK6 A;  3ARV A;  2YBT A;  2XPB A;  4DWS B;  2DSV A;  2RUQ A;  4MGV A;  2KR7 A;  4NNR A;  1GPF A;  4IQ2 A;  4DRH A;  3CHD A;  2IF4 A;  4U85 A;  1H0G A;  1NSG A;  5HT1 A;  4J4O A;  3O5M A;  4Z2I A;  4DH0 A;  2WLY A;  3RM8 A;  4P8V A;  2MLY A;  4KR0 B;  1NMW A;  3O5E A;  3O5L A;  3QOK A;  1W9P A;  3WQV A;  4ODP A;  2RQS A;  3ARR A;  1N1A A;  4R5E A;  1UR8 A;  2B5U B;  2PPN A;  1IX5 A;  2PPP A;  1FKT A;  1ITX A;  3PRD A;  2XP4 A;  1E15 A;  1FKR A;  4IPX A;  4MNJ A;  4GGQ A;  3UI4 A;  3BXW A;  2MPH A;  3KAH A;  2L2S A;  4DRN A;  1GOI A;  4DWS D;  3CHE A;  2RUC A;  2ESC A;  1QPL A; 
#chains in the Genus database with same CATH homology
 1YW5 A;  4QT3 A;  1WB0 A;  1JVW A;  4AY1 A;  5D75 A;  1LL4 A;  1KT0 A;  1R9H A;  1ROT A;  3G6L A;  1TCO C;  2F4E A;  5J6E A;  3TC5 A;  4MAV A;  1JND A;  3CGM A;  1BKF A;  5DIT A;  3EY6 A;  5GPG A;  3ARZ A;  1PIN A;  4N19 A;  4C02 B;  4R0X A;  4ML4 A;  1HJX A;  4TW6 A;  2XP9 A;  3OA5 A;  4JYS A;  1EHN A;  1HJV A;  1UR9 A;  4NZC A;  4LAY A;  2AWG A;  1FKF A;  1ZBW A;  3WD0 A;  1A7X A;  3AS1 A;  3WL0 A;  4Z2J A;  3G6M A;  1W1V A;  1W1Y A;  4TYO A;  4DRO A;  1OWQ A;  4JFK A;  1LG1 A;  2M08 A;  3O5Q A;  2KO7 A;  1SR0 A;  2UZ5 A;  2PPO A;  1F8A B;  4BF8 A;  3B9D A;  3JXV A;  2VN1 A;  5DEZ A;  2PV2 A;  2LKN A;  1W26 A;  1CTN A;  3GPK A;  2DSU A;  4ODO A;  1L1P A;  4L3N A;  3WIJ A;  2LPV A;  4MSP A;  4Q7N A;  2JZV A;  2K8I A;  5GQB A;  3JYJ A;  4W5U A;  1HJW A;  2DG9 A;  4DWS C;  4S3J A;  3I6C A;  1NWS A;  1D7J A;  1WNO A;  2RUR A;  3B9A A;  2MF9 A;  3VAW A;  3IHZ A;  4G50 A;  3KAG A;  3H9R B;  2DT2 A;  2XPA A;  2YBU A;  2D9F A;  2ZR5 A;  3LUO A;  1C9H A;  1D6O A;  1D7I A;  2Y78 A;  1RD6 A;  3UQA A;  3RME A;  2ZQT A;  3RGC A;  4WIW A;  4NSB A;  4TNS A;  1J4H A;  4W9O A;  1BL4 A;  4URI A;  5HW7 A;  2OLH A;  4PTM A;  1NWR A;  1NWU A;  5HW8 A;  3WQW A;  1E9L A;  1FKI A;  1GUV A;  2FAP A;  2WLZ A;  3MDY B;  4MTV A;  1D7H A;  4L72 B;  4LGX A;  1OGG A;  3OOB A;  2QF8 A;  3B7X A;  2A3C A;  3O5R A;  3ARU A;  4LAX A;  1ZB5 A;  4JFI A;  1ROU A;  3FY1 A;  4DRI A;  1LL6 A;  2MNT A;  1H0I A;  2PV3 A;  3PRB A;  2M1I A;  2ZQV A;  1HKK A;  1WAW A;  3ALG A;  1ZBK A;  3FAP A;  4P8U A;  1X6L A;  1ZCN A;  1Q6H A;  2AOS A;  2F21 A;  2PBC A;  3UQI A;  2MLX A;  3WD4 A;  4DT4 A;  3W4R A;  5HTG A;  1EDQ A;  4ODM A;  1LJY A;  1ZBC A;  2M2A A;  3TDB A;  4ZPT R;  1SYT A;  3RM9 A;  4ODK A;  2A3A A;  3KAI A;  4ODN A;  4DRP A;  3WD1 A;  2KI3 A;  2RSE A;  3FXY A;  4TW8 A;  3TCZ A;  4ODQ A;  3UF8 A;  4P8W A;  4WKA A;  4ZS6 A;  1FKK A;  2ITK A;  1FFQ A;  1JNE A;  1QZ2 A;  1W9V A;  2LJ4 A;  3IKG A;  5I98 A;  3ARO A;  1FFR A;  4S3K A;  1Q1C A;  3IK8 A;  4JFL A;  4W9P A;  3AS3 A;  4XAK A;  4Z2K A;  4ODL A;  1Q6I A;  1W1P A;  4FAP A;  1QPF A;  2PV1 A;  4DIP A;  3WD3 A;  2RUD A;  4JFM A;  4HAR A;  3PRA A;  1EQ3 A;  3JYM A;  3KAB A;  2XP5 A;  2VCD A;  3WD2 A;  1JNT A;  3AS2 A;  1FKG A;  2G8Z A;  1LL7 A;  1HXV A;  4MNK A;  4HBE A;  1FAP A;  3ODK A;  3NRK A;  3PR9 A;  4Q22 A;  3WH0 A;  1J4I A;  1T11 A;  4MNL A;  1FKJ A;  1NMV A;  1J6Y A;  1KFW A;  2IUZ A;  1FKH A;  3KAD A;  2DT3 A;  3CHC A;  1XHG A;  2XP8 A;  2ZR6 A;  4IT4 A;  1YAT A;  4DRJ A;  4DRK A;  1OGB A;  2DSZ A;  2PI6 A;  3B8S A;  4U84 A;  1E6Z A;  4ITZ A;  4W9Q A;  3ARP A;  4U86 A;  1ZU8 A;  1K9T A;  1E6P A;  2G41 A;  3IKD A;  3CZ8 A;  1D2K A;  2B31 A;  3UI6 A;  1FKB A;  5GPR A;  1VF8 A;  3RM4 A;  3WKZ A;  4WK9 A;  3ARY A;  4ZPW R;  2ZQS A;  5HWC A;  1LQ0 A;  4QIB A;  1X6N A;  3KAC A;  3PA7 A;  3O5D A;  3O5O A;  2ZQU A;  4FN2 A;  1E6N A;  3CH9 A;  3ARW A;  2XP6 A;  3UI5 A;  1Y0O A;  3O5K A;  1Q6U A;  1FKS A;  5HBF A;  2DT0 A;  3O5P A;  3O5J A;  5JH8 A;  3UQB A;  4O2T A;  3ART A;  5BXJ A;  4G2P A;  4MNM A;  3ARX A;  4QT2 A;  4QZV B;  3NI6 A;  1W1T A;  1F40 A;  4J4N A;  2MLZ A;  1FD9 A;  3AS0 A;  1HKM A;  3KZ7 A;  1TFV A;  4MPK A;  1ZL1 A;  2OFN A;  4IT6 A;  4WKH A;  4Z2H A;  4ZPV R;  4DWS A;  1W9U A;  2DPE A;  4KQZ A;  4TW7 A;  1B6C A;  3O5I A;  2DG4 A;  2WK2 A;  2KE0 A;  5HUA A;  1FKL A;  3ARS A;  4TX0 A;  1LG2 A;  1J4R A;  4DRQ A;  2KGJ A;  3O5G A;  3ARQ A;  4JFJ A;  3CGN A;  4Z2G A;  2N87 A;  3AQU A;  4ODR A;  2A3E A;  4WKF A;  4WJX A;  1FJD A;  5HKG A;  2DG3 A;  1JNS A;  1HKJ A;  4IQC A;  2KFW A;  1NH6 A;  5HW6 A;  4LAW A;  1FKD A;  3KCE A;  1HKI A;  4GIV A;  3CHF A;  1O6I A;  3NTP A;  1PBK A;  2XP7 A;  2LGO A;  2F2D A;  3KAF A;  5DF0 A;  4DZ2 A;  4LAV A;  4DRM A;  2A3B A;  2FDM A;  2DT1 A;  3B9E A;  1EIB A;  2DSW A;  2WM0 A;  3ALF A;  2O9O A;  2Q5A A;  5B8I C;  2ZR4 A;  1EYM A;  4HBO A;  3WL1 A;  1E6R A;  2FKE A;  5DO2 A;  2XP3 A;  2O92 A;  4Z2L A;  5DIU A;  1XRV A;  1M5Y A;  1KT1 A;  1ZBV A;  1U79 A;  5HWB A;  3RFW A;  3O5F A;  1P5Q A;  4P8X A;  4DZ3 A;  5DIV A;  1NWT A;  1ZK6 A;  3ARV A;  2YBT A;  2XPB A;  4DWS B;  2DSV A;  2RUQ A;  4MGV A;  2KR7 A;  4NNR A;  1GPF A;  4IQ2 A;  4DRH A;  3CHD A;  2IF4 A;  4U85 A;  1H0G A;  1NSG A;  5HT1 A;  4J4O A;  3O5M A;  4Z2I A;  4DH0 A;  2WLY A;  3RM8 A;  4P8V A;  2MLY A;  4KR0 B;  1NMW A;  3O5E A;  3O5L A;  3QOK A;  1W9P A;  3WQV A;  4ODP A;  2RQS A;  3ARR A;  1N1A A;  4R5E A;  1UR8 A;  2PPN A;  1IX5 A;  2PPP A;  1FKT A;  1ITX A;  3PRD A;  2XP4 A;  1E15 A;  1FKR A;  4IPX A;  4MNJ A;  4GGQ A;  3UI4 A;  3BXW A;  2MPH A;  3KAH A;  2L2S A;  4DRN A;  1GOI A;  4DWS D;  3CHE A;  2RUC A;  2ESC A;  1QPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...