4TYOA

Ppiase in complex with a non-phosphate small molecule inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (III): Optimizing affinity beyond the phosphate recognition pocket.
pubmed doi rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 38
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tyoA00
4DIPA 1D6OA 2F2DA 1QPFA 2M08A 4DT4A 4DZ3A 1NMWA 1FD9A 2RUQA 2MNTA 3LUOA 2KI3A 3JXVA 1ZK6A 1HXVA 4JYSA 3ODKA 3JYMA 1W26A 3KAGA 1JNSA 1D7JA 2ITKA 4DRHA 4J4OA 2ZR5A 2MLYA 3O5PA 4LAXA 1ZCNA 2ZQTA 3O5FA 4TNSA 2ZR4A 3UI6A 2KFWA 1U79A 1FKIA 1D7HA 1YW5A 4GIVA 4U85A 4DRKA 5HW6A 1BL4A 4ITZA 3H9RB 3KAFA 3KCEA 4JFIA 4ODPA 1P5QA 4W9OA 5HKGA 4TW6A 2LJ4A 3UI4A 4ODQA 4N19A 4ODOA 4MGVA 2M2AA 3NI6A 2F21A 5J6EA 2LKNA 1NMVA 4TW7A 2XP4A 5I98A 2K8IA 2RUCA 4W9QA 5HWBA 3PRDA 3CGNA 1Q1CA 2D9FA 3IK8A 3IKDA 2N87A 2PV2A 4QT3A 2XP6A 2ZQSA 3RGCA 4DRIA 2UZ5A 1FKJA 3O5KA 3TDBA 3UQIA 3KZ7A 5HWCA 2RSEA 4JFLA 4DRQA 4ODNA 1QZ2A 2XPBA 3EY6A 3O5IA 5DIVA 4BF8A 4DROA 1FKTA 1ROUA 3TCZA 2MLZA 4R0XA 4LAYA 4ODKA 4QT2A 2F4EA 2XPAA 5HW7A 3IKGA 4QIBA 2DG3A 2PPPA 2MF9A 2RUDA 4JFMA 2VN1A 4LAVA 3TC5A 1BKFA 5GPGA 1FKDA 1FKRA 5BXJA 1QPLA 3IHZA 1Y0OA 1FKKA 1N1AA 5HW8A 1YATA 2PBCA 2PPOA 1F40A 2PV3A 3O5LA 3JYJA 4DZ2A 3MDYB 4JFJA 3UQBA 1FKFA 3GPKA 2XP9A 1JNTA 4IPXA 3NTPA 4C02B 2RURA 4DRNA 4DRMA 1J4IA 1J4HA 2PPNA 1TCOC 1F8AB 2ZQUA 3OOBA 4GGQA 2FKEA 3FAPA 1J6YA 5HT1A 3KAIA 1M5YA 1FAPA 2Y78A 5HUAA 5D75A 1KT0A 2DG9A 1D7IA 3PA7A 4MSPA 3NRKA 3O5OA 4G50A 2MPHA 4LAWA 4NNRA 1Q6IA 1JVWA 2DG4A 4FN2A 4U86A 2Q5AA 5B8IC 2LGOA 4TX0A 1B6CA 5HTGA 2RQSA 1Q6HA 2XP3A 4J4NA 2LPVA 2XP5A 2ZR6A 4ODRA 3PRBA 2IF4A 4IQCA 3RFWA 4DRPA 1EQ3A 3O5MA 3O5QA 2XP8A 5DIUA 4DH0A 2OFNA 4DRJA 2KGJA 1ROTA 3O5EA 3O5RA 2VCDA 3B7XA 2M1IA 3O5GA 3KAHA 3KABA 4IQ2A 1PBKA 1FKSA 3CGMA 1NSGA 4G2PA 4ODLA 1FJDA 2JZVA 1PINA 1FKGA 3WH0A 3O5DA 1A7XA 2KE0A 5DITA 3I6CA 1L1PA 1KT1A 2KO7A 2AWGA 1FKBA 2PV1A 2ZQVA 3O5JA 4ODMA 2XP7A 1T11A 2MLXA 4O2TA 1R9HA 1J4RA 3UQAA 2KR7A 1C9HA 3KACA 4JFKA 3KADA 4FAPA 3UI5A 2L2SA 1EYMA 1Q6UA 2FAPA 4U84A 1FKHA 3UF8A 4TW8A 4W9PA 4TYOA 3VAWA 1FKLA
chains in the Genus database with same CATH superfamily
1IX5A 4IT4A 2M08A 3AS2A 2WK2A 1NMWA 1LL7A 4WK9A 3ARUA 3JXVA 1FFRA 4JYSA 1LL6A 1W26A 2DSWA 3KAGA 4NZCA 2PI6A 3OA5A 4WKHA 3WQVA 2MLYA 4LAXA 2DT2A 1HJXA 2ZR4A 3UI6A 2KFWA 1U79A 3ARTA 2A3AA 3PR9A 4ITZA 1NWUA 3KAFA 1P5QA 3WD2A 2WM0A 4ODOA 2F21A 4TW7A 1FFQA 4ML4A 4DRIA 2PV2A 5HWCA 3UQIA 4JFLA 1QZ2A 3O5IA 4BF8A 1FKTA 3AROA 2MLZA 4QT2A 4ZPTR 5DF0A 3ARVA 2XPAA 4DWSD 2DSVA 4LAVA 1ITXA 3IHZA 1N1AA 4HARA 3UQBA 4IPXA 3NTPA 4DRMA 1J4IA 1J4HA 2PPNA 1F8AB 1W9VA 5HBFA 2FKEA 4HBEA 5HT1A 3PA7A 4MSPA 3O5OA 4KQZA 4LAWA 4NNRA 1Q6IA 1JVWA 1ZBVA 2DG4A 4HBOA 2P4VA 1GOIA 1B6CA 5HTGA 2RQSA 3RMEA 4J4NA 2ZR6A 3RFWA 3WKZA 1OGBA 1H0GA 2KGJA 1W1PA 1LG2A 1E6PA 3KABA 4IQ2A 1JCHB 3ARYA 1O6IA 3CHCA 4G2PA 4ODLA 3RM4A 1PINA 1FJDA 4P8VA 2AWGA 2PV1A 4ODMA 3O5JA 1T11A 4O2TA 1R9HA 1J4RA 2PN0A 4Z2JA 1C9HA 1ZB5A 5GQBA 4FAPA 1EYMA 1Q6UA 3B9EA 4DIPA 2F2DA 1QPFA 4DT4A 2RUQA 4S3JA 3LUOA 2OLHA 4L72B 3ARRA 4QZVB 3JYMA 2ITKA 4Z2LA 2ZR5A 3O5PA 1OWQA 1ZCNA 4DRKA 3CHDA 5HW6A 1NH6A 3H9RB 1WNOA 4JFIA 4ODPA 4W9OA 1HJVA 1UR8A 4TW6A 3UI4A 1UR9A 4Z2IA 2DPEA 3NI6A 1NMVA 5I98A 5HWBA 3PRDA 3CGNA 3IK8A 2D9FA 4QT3A 4NSBA 2XP6A 2ZQSA 4W5UA 3TDBA 1HKKA 3KZ7A 4DRQA 4Q22A 3EY6A 5DIVA 4Z2GA 3TCZA 4PTMA 1E6ZA 3WL0A 3ALFA 1HKIA 4URIA 1GUVA 5GPGA 1FKDA 2DT0A 3AS3A 1Y0OA 1YATA 2PBCA 2PPOA 3CHEA 4DRNA 4C02B 2RURA 3CH9A 2G41A 1TCOC 1E9LA 3ARQA 3CZ8A 1H0IA 3KAIA 1FAPA 2Y78A 2WLZA 4G50A 4KR0B 2AOSA 1LL4A 2Q5AA 5B8IC 4TX0A 1K9TA 4ODRA 2IF4A 3EIPA 3O5MA 4DWSA 1NWTA 4DH0A 5DEZA 3B7XA 3O5GA 3KAHA 3CGMA 3WIJA 4P8UA 1HJWA 5DITA 3WL1A 1L1PA 1XHGA 1FKBA 3BXWA 2ZQVA 1W1VA 2XP7A 2ETNA 4U84A 2FAPA 4TYOA 3AS1A 1D6OA 1W1TA 2O92A 2KI3A 1ZK6A 1HXVA 3ODKA 4WJXA 4MNKA 4UDMA 3PRAA 1ZU8A 5GPRA 4TNSA 1YW5A 3GTYX 2YBUA 1ZBKA 3KCEA 5HKGA 4ODQA 4N19A 2B31A 4L3NA 1X6LA 5J6EA 1EIBA 2LKNA 3WD4A 2DSZA 2XP4A 1JNEA 5DO2A 1KFWA 1Q1CA 3G6LA 3IKDA 2N87A 3AQUA 3RGCA 2UZ5A 1FKJA 3O5KA 2RSEA 4MNLA 4DWSB 4ODNA 4Z2KA 4DROA 2IUZA 1ROUA 4Z2HA 2F4EA 4MNMA 1ZBCA 3IKGA 4QIBA 3WD0A 2DG3A 2PPPA 2MF9A 2RUDA 1NWRA 3G6MA 4JFMA 3B8SA 3TC5A 1BKFA 1QPLA 1WB0A 1FKKA 5HW8A 2ESCA 2PV3A 3GU0A 3JYJA 4Q7NA 4JFJA 2A3CA 1JNTA 2YBTA 2ZQUA 3OOBA 3ALGA 3FAPA 1M5YA 3CHFA 1TFVA 1KT0A 2FDMA 1D7IA 1XRVA 3QOKA 1E15A 1Q6HA 4ZPVR 2EULA 2LPVA 3PRBA 4DWSC 5DIUA 1SR0A 2OFNA 4LGXA 4DRJA 3O5RA 2VCDA 4ZPWR 2M1IA 2QF8A 1NSGA 1FKGA 1LQ0A 2A3BA 3O5DA 1A7XA 2KE0A 3I6CA 2MLXA 3RM8A 2KR7A 3KACA 1EDQA 4JFKA 3KADA 1LJYA 2L2SA 3VAWA 1E44A 1FKHA 1ZBWA 4R0XA 4W9PA 3UF8A 3RM9A 2O9OA 1OGGA 4DZ3A 3B9AA 1FD9A 4WIWA 2MNTA 1EHNA 1JNSA 1D7JA 4DRHA 4J4OA 3W4RA 4WKFA 2ZQTA 1HKJA 3O5FA 4WKAA 1FKIA 1D7HA 4GIVA 4XAKA 4U85A 1BL4A 1GPFA 4P8WA 4R5EA 3WD1A 1HKMA 2LJ4A 4MGVA 2M2AA 3ARPA 2K8IA 2RUCA 4W9QA 1W9UA 1E6NA 4MTVA 2F23A 1NWSA 3BMBA 5JH8A 3ARZA 1GRJA 2XPBA 4LAYA 4ODKA 1CTNA 1X6NA 5HW7A 2VN1A 1FKRA 5BXJA 3FY1A 1W1YA 3ARWA 3FXYA 1F40A 1LG1A 3O5LA 4DZ2A 3MDYB 1FKFA 3GPKA 2XP9A 2A3EA 1SYTA 4GGQA 4ZS6A 1J6YA 4MAVA 2DSUA 5HUAA 5D75A 2DG9A 3ARXA 2DT3A 3NRKA 2MPHA 2DT1A 2G8ZA 3WD3A 1WAWA 4FN2A 4U86A 2LGOA 3AS0A 2WLYA 2XP3A 3B9DA 1D2KA 2XP5A 3ARSA 4IQCA 4DRPA 1EQ3A 1RD6A 3O5QA 1ZL1A 2XP8A 1E6RA 4IT6A 1ROTA 3O5EA 4S3KA 4MNJA 1PBKA 1FKSA 1JNDA 2B5UB 2JZVA 3WH0A 1VF8A 1KT1A 2KO7A 4AY1A 3UQAA 4P8XA 4MPKA 1W9PA 3UI5A 3WQWA 4TW8A 1FKLA
chains in the Genus database with same CATH topology
1IX5A 4IT4A 2M08A 3AS2A 2WK2A 1NMWA 1LL7A 4WK9A 3ARUA 3JXVA 1FFRA 4JYSA 1LL6A 1W26A 2DSWA 3KAGA 4NZCA 2PI6A 3OA5A 4WKHA 3WQVA 2MLYA 4LAXA 2DT2A 1HJXA 2ZR4A 3UI6A 2KFWA 1U79A 3ARTA 2A3AA 3PR9A 4ITZA 1NWUA 3KAFA 1P5QA 3WD2A 2WM0A 4ODOA 2F21A 4TW7A 1FFQA 4ML4A 4DRIA 2PV2A 5HWCA 3UQIA 4JFLA 1QZ2A 3O5IA 4BF8A 1FKTA 3AROA 2MLZA 4QT2A 4ZPTR 5DF0A 3ARVA 2XPAA 4DWSD 2DSVA 4LAVA 1ITXA 3IHZA 1N1AA 4HARA 3UQBA 4IPXA 3NTPA 4DRMA 1J4IA 1J4HA 2PPNA 1F8AB 1W9VA 5HBFA 2FKEA 4HBEA 5HT1A 3PA7A 4MSPA 3O5OA 4KQZA 4LAWA 4NNRA 1Q6IA 1JVWA 1ZBVA 2DG4A 4HBOA 1GOIA 1B6CA 5HTGA 2RQSA 3RMEA 4J4NA 2ZR6A 3RFWA 3WKZA 1OGBA 1H0GA 2KGJA 1W1PA 1LG2A 1E6PA 3KABA 4IQ2A 3ARYA 1O6IA 3CHCA 4G2PA 4ODLA 3RM4A 1PINA 1FJDA 4P8VA 2AWGA 2PV1A 4ODMA 3O5JA 1T11A 4O2TA 1R9HA 1J4RA 4Z2JA 1C9HA 1ZB5A 5GQBA 4FAPA 1EYMA 1Q6UA 3B9EA 4DIPA 2F2DA 1QPFA 4DT4A 2RUQA 4S3JA 3LUOA 2OLHA 4L72B 3ARRA 4QZVB 3JYMA 2ITKA 4Z2LA 2ZR5A 3O5PA 1OWQA 1ZCNA 4DRKA 3CHDA 5HW6A 1NH6A 3H9RB 1WNOA 4JFIA 4ODPA 4W9OA 1HJVA 1UR8A 4TW6A 3UI4A 1UR9A 4Z2IA 2DPEA 3NI6A 1NMVA 5I98A 5HWBA 3PRDA 3CGNA 3IK8A 2D9FA 4QT3A 4NSBA 2XP6A 2ZQSA 4W5UA 3TDBA 1HKKA 3KZ7A 4DRQA 4Q22A 3EY6A 5DIVA 4Z2GA 3TCZA 4PTMA 1E6ZA 3WL0A 3ALFA 1HKIA 4URIA 1GUVA 5GPGA 1FKDA 2DT0A 3AS3A 1Y0OA 1YATA 2PBCA 2PPOA 3CHEA 4DRNA 4C02B 2RURA 3CH9A 2G41A 1TCOC 1E9LA 3ARQA 3CZ8A 1H0IA 3KAIA 1FAPA 2Y78A 2WLZA 4G50A 4KR0B 2AOSA 1LL4A 2Q5AA 5B8IC 4TX0A 1K9TA 4ODRA 2IF4A 3O5MA 4DWSA 1NWTA 4DH0A 5DEZA 3B7XA 3O5GA 3KAHA 3CGMA 3WIJA 4P8UA 1HJWA 5DITA 3WL1A 1L1PA 1XHGA 1FKBA 3BXWA 2ZQVA 1W1VA 2XP7A 4U84A 2FAPA 4TYOA 3AS1A 1D6OA 1W1TA 2O92A 2KI3A 1ZK6A 1HXVA 3ODKA 4WJXA 4MNKA 3PRAA 1ZU8A 5GPRA 4TNSA 1YW5A 2YBUA 1ZBKA 3KCEA 5HKGA 4ODQA 4N19A 2B31A 4L3NA 1X6LA 5J6EA 1EIBA 2LKNA 3WD4A 2DSZA 2XP4A 1JNEA 5DO2A 1KFWA 1Q1CA 3IKDA 3G6LA 2N87A 3AQUA 3RGCA 2UZ5A 1FKJA 3O5KA 2RSEA 4MNLA 4DWSB 4ODNA 4Z2KA 4DROA 2IUZA 1ROUA 4Z2HA 2F4EA 4MNMA 1ZBCA 3IKGA 4QIBA 3WD0A 2DG3A 2PPPA 2MF9A 2RUDA 1NWRA 3G6MA 4JFMA 3B8SA 3TC5A 1BKFA 1QPLA 1WB0A 1FKKA 5HW8A 2ESCA 2PV3A 3JYJA 4Q7NA 4JFJA 2A3CA 1JNTA 2YBTA 2ZQUA 3OOBA 3ALGA 3FAPA 1M5YA 3CHFA 1TFVA 1KT0A 2FDMA 1D7IA 1XRVA 3QOKA 1E15A 1Q6HA 4ZPVR 2LPVA 3PRBA 4DWSC 5DIUA 1SR0A 2OFNA 4LGXA 4DRJA 3O5RA 2VCDA 4ZPWR 2M1IA 2QF8A 1NSGA 1FKGA 1LQ0A 2A3BA 3O5DA 1A7XA 2KE0A 3I6CA 2MLXA 3RM8A 2KR7A 3KACA 1EDQA 4JFKA 3KADA 1LJYA 2L2SA 3VAWA 1FKHA 4R0XA 1ZBWA 4W9PA 3UF8A 3RM9A 2O9OA 1OGGA 4DZ3A 3B9AA 1FD9A 4WIWA 2MNTA 1EHNA 1JNSA 1D7JA 4DRHA 4J4OA 3W4RA 4WKFA 2ZQTA 1HKJA 3O5FA 4WKAA 1FKIA 1D7HA 4GIVA 4XAKA 4U85A 1BL4A 1GPFA 4P8WA 4R5EA 3WD1A 1HKMA 2LJ4A 4MGVA 2M2AA 3ARPA 2K8IA 2RUCA 4W9QA 1W9UA 1E6NA 4MTVA 1NWSA 5JH8A 3ARZA 2XPBA 4LAYA 4ODKA 1CTNA 1X6NA 5HW7A 2VN1A 1FKRA 5BXJA 3FY1A 1W1YA 3ARWA 3FXYA 1F40A 1LG1A 3O5LA 4DZ2A 3MDYB 1FKFA 3GPKA 2XP9A 2A3EA 1SYTA 4GGQA 4ZS6A 1J6YA 4MAVA 2DSUA 5HUAA 5D75A 2DG9A 3ARXA 2DT3A 3NRKA 2MPHA 2DT1A 2G8ZA 3WD3A 1WAWA 4FN2A 4U86A 2LGOA 3AS0A 2WLYA 2XP3A 3B9DA 1D2KA 2XP5A 3ARSA 4IQCA 4DRPA 1EQ3A 1RD6A 3O5QA 1ZL1A 2XP8A 1E6RA 4IT6A 1ROTA 3O5EA 4S3KA 4MNJA 1PBKA 1FKSA 1JNDA 2JZVA 3WH0A 1VF8A 1KT1A 2KO7A 4AY1A 3UQAA 4P8XA 4MPKA 1W9PA 3UI5A 3WQWA 4TW8A 1FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIP A;  1D6O A;  2F2D A;  1QPF A;  2M08 A;  4DT4 A;  4DZ3 A;  1NMW A;  1FD9 A;  2RUQ A;  2MNT A;  3LUO A;  2KI3 A;  3JXV A;  1ZK6 A;  1HXV A;  4JYS A;  3ODK A;  3JYM A;  1W26 A;  3KAG A;  1JNS A;  1D7J A;  2ITK A;  4DRH A;  4J4O A;  2ZR5 A;  2MLY A;  3O5P A;  4LAX A;  1ZCN A;  2ZQT A;  3O5F A;  4TNS A;  2ZR4 A;  3UI6 A;  2KFW A;  1U79 A;  1FKI A;  1D7H A;  1YW5 A;  4GIV A;  4U85 A;  4DRK A;  5HW6 A;  1BL4 A;  4ITZ A;  3H9R B;  3KAF A;  3KCE A;  4JFI A;  4ODP A;  1P5Q A;  4W9O A;  5HKG A;  4TW6 A;  2LJ4 A;  3UI4 A;  4ODQ A;  4N19 A;  4ODO A;  4MGV A;  2M2A A;  3NI6 A;  2F21 A;  5J6E A;  2LKN A;  1NMV A;  4TW7 A;  2XP4 A;  5I98 A;  2K8I A;  2RUC A;  4W9Q A;  5HWB A;  3PRD A;  3CGN A;  1Q1C A;  2D9F A;  3IK8 A;  3IKD A;  2N87 A;  2PV2 A;  4QT3 A;  2XP6 A;  2ZQS A;  3RGC A;  4DRI A;  2UZ5 A;  1FKJ A;  3O5K A;  3TDB A;  3UQI A;  3KZ7 A;  5HWC A;  2RSE A;  4JFL A;  4DRQ A;  4ODN A;  1QZ2 A;  2XPB A;  3EY6 A;  3O5I A;  5DIV A;  4BF8 A;  4DRO A;  1FKT A;  1ROU A;  3TCZ A;  2MLZ A;  4R0X A;  4LAY A;  4ODK A;  4QT2 A;  2F4E A;  2XPA A;  5HW7 A;  3IKG A;  4QIB A;  2DG3 A;  2PPP A;  2MF9 A;  2RUD A;  4JFM A;  2VN1 A;  4LAV A;  3TC5 A;  1BKF A;  5GPG A;  1FKD A;  1FKR A;  5BXJ A;  1QPL A;  3IHZ A;  1Y0O A;  1FKK A;  1N1A A;  5HW8 A;  1YAT A;  2PBC A;  2PPO A;  1F40 A;  2PV3 A;  3O5L A;  3JYJ A;  4DZ2 A;  3MDY B;  4JFJ A;  3UQB A;  1FKF A;  3GPK A;  2XP9 A;  1JNT A;  4IPX A;  3NTP A;  4C02 B;  2RUR A;  4DRN A;  4DRM A;  1J4I A;  1J4H A;  2PPN A;  1TCO C;  1F8A B;  2ZQU A;  3OOB A;  4GGQ A;  2FKE A;  3FAP A;  1J6Y A;  5HT1 A;  3KAI A;  1M5Y A;  1FAP A;  2Y78 A;  5HUA A;  5D75 A;  1KT0 A;  2DG9 A;  1D7I A;  3PA7 A;  4MSP A;  3NRK A;  3O5O A;  4G50 A;  2MPH A;  4LAW A;  4NNR A;  1Q6I A;  1JVW A;  2DG4 A;  4FN2 A;  4U86 A;  2Q5A A;  5B8I C;  2LGO A;  4TX0 A;  1B6C A;  5HTG A;  2RQS A;  1Q6H A;  2XP3 A;  4J4N A;  2LPV A;  2XP5 A;  2ZR6 A;  4ODR A;  3PRB A;  2IF4 A;  4IQC A;  3RFW A;  4DRP A;  1EQ3 A;  3O5M A;  3O5Q A;  2XP8 A;  5DIU A;  4DH0 A;  2OFN A;  4DRJ A;  2KGJ A;  1ROT A;  3O5E A;  3O5R A;  2VCD A;  3B7X A;  2M1I A;  3O5G A;  3KAH A;  3KAB A;  4IQ2 A;  1PBK A;  1FKS A;  3CGM A;  1NSG A;  4G2P A;  4ODL A;  1FJD A;  2JZV A;  1PIN A;  1FKG A;  3WH0 A;  3O5D A;  1A7X A;  2KE0 A;  5DIT A;  3I6C A;  1L1P A;  1KT1 A;  2KO7 A;  2AWG A;  1FKB A;  2PV1 A;  2ZQV A;  3O5J A;  4ODM A;  2XP7 A;  1T11 A;  2MLX A;  4O2T A;  1R9H A;  1J4R A;  3UQA A;  2KR7 A;  1C9H A;  3KAC A;  4JFK A;  3KAD A;  4FAP A;  3UI5 A;  2L2S A;  1EYM A;  1Q6U A;  2FAP A;  4U84 A;  1FKH A;  3UF8 A;  4TW8 A;  4W9P A;  4TYO A;  3VAW A;  1FKL A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  4IT4 A;  2M08 A;  3AS2 A;  2WK2 A;  1NMW A;  1LL7 A;  4WK9 A;  3ARU A;  3JXV A;  1FFR A;  4JYS A;  1LL6 A;  1W26 A;  2DSW A;  3KAG A;  4NZC A;  2PI6 A;  3OA5 A;  4WKH A;  3WQV A;  2MLY A;  4LAX A;  2DT2 A;  1HJX A;  2ZR4 A;  3UI6 A;  2KFW A;  1U79 A;  3ART A;  2A3A A;  3PR9 A;  4ITZ A;  1NWU A;  3KAF A;  1P5Q A;  3WD2 A;  2WM0 A;  4ODO A;  2F21 A;  4TW7 A;  1FFQ A;  4ML4 A;  4DRI A;  2PV2 A;  5HWC A;  3UQI A;  4JFL A;  1QZ2 A;  3O5I A;  4BF8 A;  1FKT A;  3ARO A;  2MLZ A;  4QT2 A;  4ZPT R;  5DF0 A;  3ARV A;  2XPA A;  4DWS D;  2DSV A;  4LAV A;  1ITX A;  3IHZ A;  1N1A A;  4HAR A;  3UQB A;  4IPX A;  3NTP A;  4DRM A;  1J4I A;  1J4H A;  2PPN A;  1F8A B;  1W9V A;  5HBF A;  2FKE A;  4HBE A;  5HT1 A;  3PA7 A;  4MSP A;  3O5O A;  4KQZ A;  4LAW A;  4NNR A;  1Q6I A;  1JVW A;  1ZBV A;  2DG4 A;  4HBO A;  2P4V A;  1GOI A;  1B6C A;  5HTG A;  2RQS A;  3RME A;  4J4N A;  2ZR6 A;  3RFW A;  3WKZ A;  1OGB A;  1H0G A;  2KGJ A;  1W1P A;  1LG2 A;  1E6P A;  3KAB A;  4IQ2 A;  1JCH B;  3ARY A;  1O6I A;  3CHC A;  4G2P A;  4ODL A;  3RM4 A;  1PIN A;  1FJD A;  4P8V A;  2AWG A;  2PV1 A;  4ODM A;  3O5J A;  1T11 A;  4O2T A;  1R9H A;  1J4R A;  2PN0 A;  4Z2J A;  1C9H A;  1ZB5 A;  5GQB A;  4FAP A;  1EYM A;  1Q6U A;  3B9E A;  4DIP A;  2F2D A;  1QPF A;  4DT4 A;  2RUQ A;  4S3J A;  3LUO A;  2OLH A;  4L72 B;  3ARR A;  4QZV B;  3JYM A;  2ITK A;  4Z2L A;  2ZR5 A;  3O5P A;  1OWQ A;  1ZCN A;  4DRK A;  3CHD A;  5HW6 A;  1NH6 A;  3H9R B;  1WNO A;  4JFI A;  4ODP A;  4W9O A;  1HJV A;  1UR8 A;  4TW6 A;  3UI4 A;  1UR9 A;  4Z2I A;  2DPE A;  3NI6 A;  1NMV A;  5I98 A;  5HWB A;  3PRD A;  3CGN A;  3IK8 A;  2D9F A;  4QT3 A;  4NSB A;  2XP6 A;  2ZQS A;  4W5U A;  3TDB A;  1HKK A;  3KZ7 A;  4DRQ A;  4Q22 A;  3EY6 A;  5DIV A;  4Z2G A;  3TCZ A;  4PTM A;  1E6Z A;  3WL0 A;  3ALF A;  1HKI A;  4URI A;  1GUV A;  5GPG A;  1FKD A;  2DT0 A;  3AS3 A;  1Y0O A;  1YAT A;  2PBC A;  2PPO A;  3CHE A;  4DRN A;  4C02 B;  2RUR A;  3CH9 A;  2G41 A;  1TCO C;  1E9L A;  3ARQ A;  3CZ8 A;  1H0I A;  3KAI A;  1FAP A;  2Y78 A;  2WLZ A;  4G50 A;  4KR0 B;  2AOS A;  1LL4 A;  2Q5A A;  5B8I C;  4TX0 A;  1K9T A;  4ODR A;  2IF4 A;  3EIP A;  3O5M A;  4DWS A;  1NWT A;  4DH0 A;  5DEZ A;  3B7X A;  3O5G A;  3KAH A;  3CGM A;  3WIJ A;  4P8U A;  1HJW A;  5DIT A;  3WL1 A;  1L1P A;  1XHG A;  1FKB A;  3BXW A;  2ZQV A;  1W1V A;  2XP7 A;  2ETN A;  4U84 A;  2FAP A;  4TYO A;  3AS1 A;  1D6O A;  1W1T A;  2O92 A;  2KI3 A;  1ZK6 A;  1HXV A;  3ODK A;  4WJX A;  4MNK A;  4UDM A;  3PRA A;  1ZU8 A;  5GPR A;  4TNS A;  1YW5 A;  3GTY X;  2YBU A;  1ZBK A;  3KCE A;  5HKG A;  4ODQ A;  4N19 A;  2B31 A;  4L3N A;  1X6L A;  5J6E A;  1EIB A;  2LKN A;  3WD4 A;  2DSZ A;  2XP4 A;  1JNE A;  5DO2 A;  1KFW A;  1Q1C A;  3G6L A;  3IKD A;  2N87 A;  3AQU A;  3RGC A;  2UZ5 A;  1FKJ A;  3O5K A;  2RSE A;  4MNL A;  4DWS B;  4ODN A;  4Z2K A;  4DRO A;  2IUZ A;  1ROU A;  4Z2H A;  2F4E A;  4MNM A;  1ZBC A;  3IKG A;  4QIB A;  3WD0 A;  2DG3 A;  2PPP A;  2MF9 A;  2RUD A;  1NWR A;  3G6M A;  4JFM A;  3B8S A;  3TC5 A;  1BKF A;  1QPL A;  1WB0 A;  1FKK A;  5HW8 A;  2ESC A;  2PV3 A;  3GU0 A;  3JYJ A;  4Q7N A;  4JFJ A;  2A3C A;  1JNT A;  2YBT A;  2ZQU A;  3OOB A;  3ALG A;  3FAP A;  1M5Y A;  3CHF A;  1TFV A;  1KT0 A;  2FDM A;  1D7I A;  1XRV A;  3QOK A;  1E15 A;  1Q6H A;  4ZPV R;  2EUL A;  2LPV A;  3PRB A;  4DWS C;  5DIU A;  1SR0 A;  2OFN A;  4LGX A;  4DRJ A;  3O5R A;  2VCD A;  4ZPW R;  2M1I A;  2QF8 A;  1NSG A;  1FKG A;  1LQ0 A;  2A3B A;  3O5D A;  1A7X A;  2KE0 A;  3I6C A;  2MLX A;  3RM8 A;  2KR7 A;  3KAC A;  1EDQ A;  4JFK A;  3KAD A;  1LJY A;  2L2S A;  3VAW A;  1E44 A;  1FKH A;  1ZBW A;  4R0X A;  4W9P A;  3UF8 A;  3RM9 A;  2O9O A;  1OGG A;  4DZ3 A;  3B9A A;  1FD9 A;  4WIW A;  2MNT A;  1EHN A;  1JNS A;  1D7J A;  4DRH A;  4J4O A;  3W4R A;  4WKF A;  2ZQT A;  1HKJ A;  3O5F A;  4WKA A;  1FKI A;  1D7H A;  4GIV A;  4XAK A;  4U85 A;  1BL4 A;  1GPF A;  4P8W A;  4R5E A;  3WD1 A;  1HKM A;  2LJ4 A;  4MGV A;  2M2A A;  3ARP A;  2K8I A;  2RUC A;  4W9Q A;  1W9U A;  1E6N A;  4MTV A;  2F23 A;  1NWS A;  3BMB A;  5JH8 A;  3ARZ A;  1GRJ A;  2XPB A;  4LAY A;  4ODK A;  1CTN A;  1X6N A;  5HW7 A;  2VN1 A;  1FKR A;  5BXJ A;  3FY1 A;  1W1Y A;  3ARW A;  3FXY A;  1F40 A;  1LG1 A;  3O5L A;  4DZ2 A;  3MDY B;  1FKF A;  3GPK A;  2XP9 A;  2A3E A;  1SYT A;  4GGQ A;  4ZS6 A;  1J6Y A;  4MAV A;  2DSU A;  5HUA A;  5D75 A;  2DG9 A;  3ARX A;  2DT3 A;  3NRK A;  2MPH A;  2DT1 A;  2G8Z A;  3WD3 A;  1WAW A;  4FN2 A;  4U86 A;  2LGO A;  3AS0 A;  2WLY A;  2XP3 A;  3B9D A;  1D2K A;  2XP5 A;  3ARS A;  4IQC A;  4DRP A;  1EQ3 A;  1RD6 A;  3O5Q A;  1ZL1 A;  2XP8 A;  1E6R A;  4IT6 A;  1ROT A;  3O5E A;  4S3K A;  4MNJ A;  1PBK A;  1FKS A;  1JND A;  2B5U B;  2JZV A;  3WH0 A;  1VF8 A;  1KT1 A;  2KO7 A;  4AY1 A;  3UQA A;  4P8X A;  4MPK A;  1W9P A;  3UI5 A;  3WQW A;  4TW8 A;  1FKL A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  4IT4 A;  2M08 A;  3AS2 A;  2WK2 A;  1NMW A;  1LL7 A;  4WK9 A;  3ARU A;  3JXV A;  1FFR A;  4JYS A;  1LL6 A;  1W26 A;  2DSW A;  3KAG A;  4NZC A;  2PI6 A;  3OA5 A;  4WKH A;  3WQV A;  2MLY A;  4LAX A;  2DT2 A;  1HJX A;  2ZR4 A;  3UI6 A;  2KFW A;  1U79 A;  3ART A;  2A3A A;  3PR9 A;  4ITZ A;  1NWU A;  3KAF A;  1P5Q A;  3WD2 A;  2WM0 A;  4ODO A;  2F21 A;  4TW7 A;  1FFQ A;  4ML4 A;  4DRI A;  2PV2 A;  5HWC A;  3UQI A;  4JFL A;  1QZ2 A;  3O5I A;  4BF8 A;  1FKT A;  3ARO A;  2MLZ A;  4QT2 A;  4ZPT R;  5DF0 A;  3ARV A;  2XPA A;  4DWS D;  2DSV A;  4LAV A;  1ITX A;  3IHZ A;  1N1A A;  4HAR A;  3UQB A;  4IPX A;  3NTP A;  4DRM A;  1J4I A;  1J4H A;  2PPN A;  1F8A B;  1W9V A;  5HBF A;  2FKE A;  4HBE A;  5HT1 A;  3PA7 A;  4MSP A;  3O5O A;  4KQZ A;  4LAW A;  4NNR A;  1Q6I A;  1JVW A;  1ZBV A;  2DG4 A;  4HBO A;  1GOI A;  1B6C A;  5HTG A;  2RQS A;  3RME A;  4J4N A;  2ZR6 A;  3RFW A;  3WKZ A;  1OGB A;  1H0G A;  2KGJ A;  1W1P A;  1LG2 A;  1E6P A;  3KAB A;  4IQ2 A;  3ARY A;  1O6I A;  3CHC A;  4G2P A;  4ODL A;  3RM4 A;  1PIN A;  1FJD A;  4P8V A;  2AWG A;  2PV1 A;  4ODM A;  3O5J A;  1T11 A;  4O2T A;  1R9H A;  1J4R A;  4Z2J A;  1C9H A;  1ZB5 A;  5GQB A;  4FAP A;  1EYM A;  1Q6U A;  3B9E A;  4DIP A;  2F2D A;  1QPF A;  4DT4 A;  2RUQ A;  4S3J A;  3LUO A;  2OLH A;  4L72 B;  3ARR A;  4QZV B;  3JYM A;  2ITK A;  4Z2L A;  2ZR5 A;  3O5P A;  1OWQ A;  1ZCN A;  4DRK A;  3CHD A;  5HW6 A;  1NH6 A;  3H9R B;  1WNO A;  4JFI A;  4ODP A;  4W9O A;  1HJV A;  1UR8 A;  4TW6 A;  3UI4 A;  1UR9 A;  4Z2I A;  2DPE A;  3NI6 A;  1NMV A;  5I98 A;  5HWB A;  3PRD A;  3CGN A;  3IK8 A;  2D9F A;  4QT3 A;  4NSB A;  2XP6 A;  2ZQS A;  4W5U A;  3TDB A;  1HKK A;  3KZ7 A;  4DRQ A;  4Q22 A;  3EY6 A;  5DIV A;  4Z2G A;  3TCZ A;  4PTM A;  1E6Z A;  3WL0 A;  3ALF A;  1HKI A;  4URI A;  1GUV A;  5GPG A;  1FKD A;  2DT0 A;  3AS3 A;  1Y0O A;  1YAT A;  2PBC A;  2PPO A;  3CHE A;  4DRN A;  4C02 B;  2RUR A;  3CH9 A;  2G41 A;  1TCO C;  1E9L A;  3ARQ A;  3CZ8 A;  1H0I A;  3KAI A;  1FAP A;  2Y78 A;  2WLZ A;  4G50 A;  4KR0 B;  2AOS A;  1LL4 A;  2Q5A A;  5B8I C;  4TX0 A;  1K9T A;  4ODR A;  2IF4 A;  3O5M A;  4DWS A;  1NWT A;  4DH0 A;  5DEZ A;  3B7X A;  3O5G A;  3KAH A;  3CGM A;  3WIJ A;  4P8U A;  1HJW A;  5DIT A;  3WL1 A;  1L1P A;  1XHG A;  1FKB A;  3BXW A;  2ZQV A;  1W1V A;  2XP7 A;  4U84 A;  2FAP A;  4TYO A;  3AS1 A;  1D6O A;  1W1T A;  2O92 A;  2KI3 A;  1ZK6 A;  1HXV A;  3ODK A;  4WJX A;  4MNK A;  3PRA A;  1ZU8 A;  5GPR A;  4TNS A;  1YW5 A;  2YBU A;  1ZBK A;  3KCE A;  5HKG A;  4ODQ A;  4N19 A;  2B31 A;  4L3N A;  1X6L A;  5J6E A;  1EIB A;  2LKN A;  3WD4 A;  2DSZ A;  2XP4 A;  1JNE A;  5DO2 A;  1KFW A;  1Q1C A;  3IKD A;  3G6L A;  2N87 A;  3AQU A;  3RGC A;  2UZ5 A;  1FKJ A;  3O5K A;  2RSE A;  4MNL A;  4DWS B;  4ODN A;  4Z2K A;  4DRO A;  2IUZ A;  1ROU A;  4Z2H A;  2F4E A;  4MNM A;  1ZBC A;  3IKG A;  4QIB A;  3WD0 A;  2DG3 A;  2PPP A;  2MF9 A;  2RUD A;  1NWR A;  3G6M A;  4JFM A;  3B8S A;  3TC5 A;  1BKF A;  1QPL A;  1WB0 A;  1FKK A;  5HW8 A;  2ESC A;  2PV3 A;  3JYJ A;  4Q7N A;  4JFJ A;  2A3C A;  1JNT A;  2YBT A;  2ZQU A;  3OOB A;  3ALG A;  3FAP A;  1M5Y A;  3CHF A;  1TFV A;  1KT0 A;  2FDM A;  1D7I A;  1XRV A;  3QOK A;  1E15 A;  1Q6H A;  4ZPV R;  2LPV A;  3PRB A;  4DWS C;  5DIU A;  1SR0 A;  2OFN A;  4LGX A;  4DRJ A;  3O5R A;  2VCD A;  4ZPW R;  2M1I A;  2QF8 A;  1NSG A;  1FKG A;  1LQ0 A;  2A3B A;  3O5D A;  1A7X A;  2KE0 A;  3I6C A;  2MLX A;  3RM8 A;  2KR7 A;  3KAC A;  1EDQ A;  4JFK A;  3KAD A;  1LJY A;  2L2S A;  3VAW A;  1FKH A;  4R0X A;  1ZBW A;  4W9P A;  3UF8 A;  3RM9 A;  2O9O A;  1OGG A;  4DZ3 A;  3B9A A;  1FD9 A;  4WIW A;  2MNT A;  1EHN A;  1JNS A;  1D7J A;  4DRH A;  4J4O A;  3W4R A;  4WKF A;  2ZQT A;  1HKJ A;  3O5F A;  4WKA A;  1FKI A;  1D7H A;  4GIV A;  4XAK A;  4U85 A;  1BL4 A;  1GPF A;  4P8W A;  4R5E A;  3WD1 A;  1HKM A;  2LJ4 A;  4MGV A;  2M2A A;  3ARP A;  2K8I A;  2RUC A;  4W9Q A;  1W9U A;  1E6N A;  4MTV A;  1NWS A;  5JH8 A;  3ARZ A;  2XPB A;  4LAY A;  4ODK A;  1CTN A;  1X6N A;  5HW7 A;  2VN1 A;  1FKR A;  5BXJ A;  3FY1 A;  1W1Y A;  3ARW A;  3FXY A;  1F40 A;  1LG1 A;  3O5L A;  4DZ2 A;  3MDY B;  1FKF A;  3GPK A;  2XP9 A;  2A3E A;  1SYT A;  4GGQ A;  4ZS6 A;  1J6Y A;  4MAV A;  2DSU A;  5HUA A;  5D75 A;  2DG9 A;  3ARX A;  2DT3 A;  3NRK A;  2MPH A;  2DT1 A;  2G8Z A;  3WD3 A;  1WAW A;  4FN2 A;  4U86 A;  2LGO A;  3AS0 A;  2WLY A;  2XP3 A;  3B9D A;  1D2K A;  2XP5 A;  3ARS A;  4IQC A;  4DRP A;  1EQ3 A;  1RD6 A;  3O5Q A;  1ZL1 A;  2XP8 A;  1E6R A;  4IT6 A;  1ROT A;  3O5E A;  4S3K A;  4MNJ A;  1PBK A;  1FKS A;  1JND A;  2JZV A;  3WH0 A;  1VF8 A;  1KT1 A;  2KO7 A;  4AY1 A;  3UQA A;  4P8X A;  4MPK A;  1W9P A;  3UI5 A;  3WQW A;  4TW8 A;  1FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...