4TYOA

Ppiase in complex with a non-phosphate small molecule inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (III): Optimizing affinity beyond the phosphate recognition pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 38
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tyoA00
1B6CA 1FKFA 3H9RB 2VN1A 2XP3A 2RSEA 4W9OA 4MSPA 2MLYA 2LGOA 4JFIA 2OFNA 4QT3A 1FKLA 2M08A 2RUQA 2DG4A 2F21A 4DH0A 3JYJA 4G50A 1J6YA 2MNTA 4GGQA 1EYMA 1ZCNA 1U79A 4TW7A 4U84A 4LAVA 2MLXA 2XP9A 3UI5A 2KI3A 2XP8A 3KAGA 3NRKA 2PV3A 4IQ2A 1EQ3A 3O5IA 4QT2A 4W9QA 1NMWA 3IHZA 5HW6A 2D9FA 3O5OA 1W26A 4LAYA 1FKHA 4J4NA 3PRDA 1KT0A 4DT4A 3FAPA 2FKEA 1P5QA 3O5GA 2LPVA 4LAXA 5HKGA 1YW5A 2XP5A 3UF8A 4ODOA 2PBCA 1Q1CA 4JFMA 3EY6A 4JFLA 2XPBA 3ODKA 2L2SA 2MLZA 2Q5AA 3KAIA 4ODRA 3O5RA 4U85A 5DIVA 3UI6A 1C9HA 5B8IC 3PRBA 3JXVA 1N1AA 1ZK6A 4FN2A 1Q6HA 5GPGA 1JVWA 5DITA 4ODKA 5HTGA 4TX0A 4W9PA 1FAPA 3KZ7A 3B7XA 4N19A 3VAWA 2FAPA 3UQBA 1NMVA 4ODQA 1L1PA 1TCOC 3O5PA 4DROA 3IKGA 2N87A 5J6EA 3TC5A 1D7JA 2RUDA 2LJ4A 2DG3A 4ODNA 1NSGA 1FKDA 4TW6A 1BL4A 2ITKA 1HXVA 2KR7A 3UQAA 4DRKA 4JFJA 4DRHA 1Q6UA 1JNSA 2LKNA 4QIBA 2XP4A 3KADA 1PBKA 4DRPA 1Q6IA 5D75A 2ZR5A 3MDYB 1FKKA 5HT1A 1FKIA 1F40A 1J4HA 2MPHA 1D7HA 2PV1A 2RURA 1QPFA 2PPNA 1FKTA 2ZQTA 3GPKA 3NI6A 4TYOA 5HWBA 2MF9A 3LUOA 1QZ2A 1FKGA 2ZR4A 2JZVA 1PINA 4ODLA 4R0XA 2ZQVA 2KE0A 2IF4A 4GIVA 4ODPA 1FKJA 2PPOA 4ODMA 5BXJA 4TNSA 1FJDA 2M2AA 4TW8A 2KGJA 3TDBA 3RFWA 3O5EA 5HW8A 4JFKA 4J4OA 2XP6A 1YATA 2XPAA 1J4RA 3OOBA 3PA7A 4IPXA 4NNRA 3KAFA 2XP7A 5I98A 2F2DA 4U86A 1BKFA 4DRNA 4O2TA 4JYSA 4BF8A 2ZR6A 3I6CA 3IK8A 1FKRA 1T11A 3CGNA 5HUAA 4FAPA 4C02B 2K8IA 1FKBA 3O5LA 1D7IA 4DRIA 1JNTA 1FKSA 1J4IA 2KO7A 3O5QA 1A7XA 2PV2A 5HW7A 3CGMA 2DG9A 5HWCA 2KFWA 4MGVA 2M1IA 2PPPA 4ITZA 3O5DA 1QPLA 4DRMA 5DIUA 3KABA 1D6OA 2AWGA 2ZQUA 4LAWA 4DRJA 4DIPA 1R9HA 1F8AB 3O5MA 3KCEA 3RGCA 3O5JA 3TCZA 4DZ2A 3WH0A 3KACA 1ROUA 2F4EA 3IKDA 3JYMA 2RQSA 4G2PA 1KT1A 2UZ5A 3NTPA 4IQCA 3UQIA 3O5FA 1FD9A 2Y78A 1Y0OA 2ZQSA 2VCDA 2RUCA 3KAHA 3UI4A 1ROTA 4DRQA 1M5YA 4DZ3A 3O5KA
chains in the Genus database with same CATH superfamily
1E6NA 4IT6A 3CHFA 3ARRA 3H9RB 2XP3A 4MSPA 3WKZA 1D2KA 1ZBVA 4JFIA 2M08A 2DT1A 1W1YA 4GGQA 4U84A 1ZCNA 4L72B 3B8SA 3B9AA 3UI5A 2A3BA 5GQBA 4W9QA 3O5OA 1W26A 4NZCA 3AROA 3ARVA 2XP5A 2A3AA 4ODOA 2DPEA 3KAIA 5HW7A 3UI6A 1C9HA 3PRBA 4FN2A 1Q6HA 4S3JA 5DEZA 1LG2A 1W1PA 4W9PA 2PN0A 4ZS6A 1H0GA 4P8UA 1TCOC 5J6EA 2N87A 2RUDA 2G8ZA 1FKDA 3CHCA 1HXVA 4HARA 3ARXA 5D75A 3B9DA 3MDYB 5HT1A 1J4HA 2RURA 3GPKA 4DRKA 1LJYA 1FKTA 3LUOA 1QZ2A 2YBTA 2JZVA 4W5UA 2ZQVA 4GIVA 2IF4A 1FKJA 2PPOA 3AS0A 3RMEA 3TDBA 5HW8A 4JFKA 1E9LA 2XPAA 1J4RA 3PA7A 1NWSA 3KAFA 2XP7A 4R5EA 1GRJA 4QZVB 4BF8A 1T11A 4MTVA 2K8IA 4C02B 4URIA 2QF8A 4UDMA 4DRIA 2DSUA 2KO7A 3O5QA 2G41A 3CGMA 1ITXA 2KFWA 4DWSA 4ITZA 4ZPTR 3O5DA 4PTMA 3ARQA 3AS1A 1D6OA 1W9PA 3KACA 1ROUA 2EULA 1H0IA 1HKJA 4DWSC 1FD9A 2Y78A 1Y0OA 3KAHA 2FDMA 1ROTA 2ETNA 3RM8A 4Z2GA 4W9OA 1XRVA 2MLYA 1NWUA 2F21A 4DH0A 3JYJA 1XHGA 4TW7A 4LAVA 1EHNA 2KI3A 4Z2IA 4IQ2A 1EQ3A 3WD3A 4DWSB 1CTNA 1HJWA 3FAPA 2LPVA 2DSVA 4LAXA 5HKGA 2DT3A 1YW5A 3WD1A 1Q1CA 3EY6A 2WLYA 2MLZA 5GPRA 1N1AA 5GPGA 1O6IA 1SYTA 1W1TA 4WKHA 4TX0A 4Q22A 1WAWA 4N19A 1L1PA 1NH6A 3W4RA 1ZBWA 4DWSD 2LJ4A 3GU0A 4KR0B 3ARZA 4ODNA 2ESCA 1NSGA 1BL4A 1KFWA 4DRHA 4MPKA 1HJVA 2LKNA 4QIBA 2XP4A 1JCHB 2ZR5A 1F40A 2MPHA 1D7HA 1QPFA 2PPNA 1E6ZA 1GPFA 1FKGA 2ZR4A 2OLHA 4R0XA 2KE0A 1X6LA 1HKMA 4TNSA 1ZBKA 4TW8A 1IX5A 2XP6A 1EIBA 4IPXA 4Z2HA 1HJXA 1BKFA 2DT0A 3ARTA 3ARWA 4O2TA 4DRNA 3CGNA 1WB0A 1FKBA 1OGBA 3O5LA 1D7IA 1J4IA 1A7XA 1UR8A 3WD0A 4KQZA 5DIUA 3FY1A 2AWGA 1LQ0A 4DRJA 1R9HA 3TCZA 3GTYX 4DZ2A 3CHDA 4L3NA 3IKDA 3JYMA 2RQSA 3ALFA 1KT1A 2UZ5A 3EIPA 3NTPA 3G6LA 3UQIA 1WNOA 4WIWA 1E6RA 4DRQA 3WD4A 1B6CA 4Z2JA 2VN1A 1EDQA 2RSEA 2F23A 4QT3A 1FKLA 2DG4A 3WQVA 2MNTA 3WQWA 5JH8A 2XP8A 3NRKA 4ML4A 4QT2A 1GOIA 5HW6A 4LAYA 1FKHA 4DT4A 2FKEA 1P5QA 3O5GA 4JFLA 1FFRA 2WLZA 2Q5AA 1K9TA 1W9VA 4MNKA 5DIVA 2O9OA 2B5UB 4MNJA 3AQUA 1JVWA 4ODKA 2WM0A 3B7XA 2FAPA 3UQBA 1NMVA 3O5PA 1HKIA 3IKGA 5HBFA 1D7JA 2PI6A 1NWTA 2DG3A 3CZ8A 3QOKA 1RD6A 4P8VA 2ITKA 2KR7A 3BMBA 1JNSA 1PBKA 4DRPA 1Q6IA 1FKKA 3PRAA 2PV1A 3NI6A 3ARYA 4Z2KA 2MF9A 1PINA 4IT4A 4ODPA 1FJDA 2KGJA 1SR0A 3AS3A 3RFWA 3O5EA 4J4OA 3BXWA 4U86A 1UR9A 4JYSA 1ZB5A 3IK8A 4P8XA 1FKRA 5HUAA 4FAPA 1X6NA 1W1VA 1JNTA 1FKSA 4HBOA 4P8WA 1VF8A 2DG9A 4MGVA 2M1IA 2PPPA 4AY1A 2YBUA 1QPLA 3KABA 2P4VA 4WKFA 4LAWA 1OGGA 4DIPA 3KCEA 3RGCA 3O5JA 1ZBCA 3WH0A 5DO2A 3ARSA 2ZQSA 2VCDA 2RUCA 2A3EA 1E44A 4HBEA 4ZPVR 3WIJA 1FKFA 1E15A 2LGOA 5DF0A 4XAKA 1NWRA 2OFNA 2RUQA 1J6YA 4G50A 1EYMA 1U79A 4ZPWR 2MLXA 2XP9A 3KAGA 2PV3A 2B31A 3O5IA 1HKKA 1NMWA 3IHZA 2D9FA 1E6PA 4J4NA 3PRDA 1KT0A 1GUVA 3ARPA 4Z2LA 3UF8A 2PBCA 4JFMA 2XPBA 3ODKA 2L2SA 4U85A 4MAVA 4ODRA 3WL1A 3O5RA 5B8IC 3AS2A 3JXVA 1ZL1A 1ZK6A 1JNEA 4WK9A 5DITA 5HTGA 3ALGA 1FAPA 3KZ7A 3VAWA 4ODQA 4DROA 3TC5A 3RM9A 1LL7A 4WKAA 4TW6A 4S3KA 3WL0A 3UQAA 4JFJA 1LL6A 1Q6UA 1TFVA 1W9UA 3G6MA 3KADA 1FKIA 3FXYA 4WJXA 2ZQTA 2IUZA 4MNMA 4MNLA 4TYOA 5HWBA 3PR9A 4ODLA 4ODMA 2DSZA 5BXJA 2AOSA 1OWQA 2M2AA 4Q7NA 3B9EA 1YATA 3OOBA 4NSBA 4NNRA 5I98A 2F2DA 3RM4A 2ZR6A 3I6CA 3WD2A 1LL4A 1JNDA 2PV2A 3CHEA 3CH9A 4LGXA 5HWCA 2DT2A 1FFQA 2O92A 4DRMA 2WK2A 2ZQUA 3O5MA 1F8AB 2F4EA 4G2PA 2A3CA 2DSWA 1ZU8A 4IQCA 3O5FA 3ARUA 3UI4A 1M5YA 4DZ3A 3OA5A 1LG1A 3O5KA
chains in the Genus database with same CATH topology
1E6NA 4IT6A 3CHFA 3ARRA 3H9RB 2XP3A 4MSPA 3WKZA 1D2KA 1ZBVA 4JFIA 2M08A 2DT1A 1W1YA 4GGQA 4U84A 1ZCNA 4L72B 3B8SA 3B9AA 3UI5A 2A3BA 5GQBA 4W9QA 3O5OA 1W26A 4NZCA 3AROA 3ARVA 2XP5A 2A3AA 4ODOA 2DPEA 3KAIA 5HW7A 3UI6A 1C9HA 3PRBA 4FN2A 1Q6HA 4S3JA 5DEZA 1LG2A 1W1PA 4W9PA 4ZS6A 1H0GA 4P8UA 1TCOC 5J6EA 2N87A 2RUDA 2G8ZA 1FKDA 3CHCA 1HXVA 4HARA 3ARXA 5D75A 3B9DA 3MDYB 5HT1A 1J4HA 2RURA 3GPKA 4DRKA 1LJYA 1FKTA 3LUOA 1QZ2A 2YBTA 2JZVA 4W5UA 2ZQVA 4GIVA 2IF4A 1FKJA 2PPOA 3AS0A 3RMEA 3TDBA 5HW8A 4JFKA 1E9LA 2XPAA 1J4RA 3PA7A 1NWSA 3KAFA 2XP7A 4R5EA 4QZVB 4BF8A 1T11A 4MTVA 2K8IA 4C02B 4URIA 2QF8A 4DRIA 2DSUA 2KO7A 3O5QA 2G41A 3CGMA 1ITXA 2KFWA 4DWSA 4ITZA 4ZPTR 3O5DA 4PTMA 3ARQA 3AS1A 1D6OA 1W9PA 3KACA 1ROUA 1H0IA 1HKJA 4DWSC 1FD9A 2Y78A 1Y0OA 3KAHA 2FDMA 1ROTA 3RM8A 4Z2GA 4W9OA 1XRVA 2MLYA 1NWUA 2F21A 4DH0A 3JYJA 1XHGA 4TW7A 4LAVA 1EHNA 2KI3A 4Z2IA 4IQ2A 1EQ3A 3WD3A 4DWSB 1CTNA 1HJWA 3FAPA 2LPVA 2DSVA 4LAXA 5HKGA 2DT3A 1YW5A 3WD1A 1Q1CA 3EY6A 2WLYA 2MLZA 5GPRA 1N1AA 5GPGA 1O6IA 1SYTA 1W1TA 4WKHA 4TX0A 4Q22A 1WAWA 4N19A 1L1PA 1NH6A 3W4RA 1ZBWA 4DWSD 2LJ4A 4KR0B 3ARZA 4ODNA 2ESCA 1NSGA 1BL4A 1KFWA 4DRHA 4MPKA 1HJVA 2LKNA 4QIBA 2XP4A 2ZR5A 1F40A 2MPHA 1D7HA 1QPFA 2PPNA 1E6ZA 1GPFA 1FKGA 2ZR4A 2OLHA 4R0XA 2KE0A 1X6LA 1HKMA 4TNSA 1ZBKA 4TW8A 1IX5A 2XP6A 1EIBA 4IPXA 4Z2HA 1HJXA 1BKFA 2DT0A 3ARTA 3ARWA 4O2TA 4DRNA 3CGNA 1WB0A 1FKBA 1OGBA 3O5LA 1D7IA 1J4IA 1A7XA 1UR8A 3WD0A 4KQZA 5DIUA 3FY1A 2AWGA 1LQ0A 4DRJA 1R9HA 3TCZA 4DZ2A 3CHDA 4L3NA 3IKDA 3JYMA 2RQSA 3ALFA 1KT1A 2UZ5A 3NTPA 3G6LA 3UQIA 1WNOA 4WIWA 1E6RA 4DRQA 3WD4A 1B6CA 4Z2JA 2VN1A 1EDQA 2RSEA 4QT3A 1FKLA 2DG4A 3WQVA 2MNTA 3WQWA 5JH8A 2XP8A 3NRKA 4ML4A 4QT2A 1GOIA 5HW6A 4LAYA 1FKHA 4DT4A 2FKEA 1P5QA 3O5GA 4JFLA 1FFRA 2WLZA 2Q5AA 1K9TA 1W9VA 4MNKA 5DIVA 2O9OA 4MNJA 3AQUA 1JVWA 4ODKA 2WM0A 3B7XA 2FAPA 3UQBA 1NMVA 3O5PA 1HKIA 3IKGA 5HBFA 1D7JA 2PI6A 1NWTA 2DG3A 3CZ8A 3QOKA 1RD6A 4P8VA 2ITKA 2KR7A 1JNSA 1PBKA 4DRPA 1Q6IA 1FKKA 3PRAA 2PV1A 3NI6A 3ARYA 4Z2KA 2MF9A 1PINA 4IT4A 4ODPA 1FJDA 2KGJA 1SR0A 3AS3A 3RFWA 3O5EA 4J4OA 3BXWA 4U86A 1UR9A 4JYSA 1ZB5A 3IK8A 4P8XA 1FKRA 5HUAA 4FAPA 1X6NA 1W1VA 1JNTA 1FKSA 4HBOA 4P8WA 1VF8A 2DG9A 4MGVA 2M1IA 2PPPA 4AY1A 2YBUA 1QPLA 3KABA 4WKFA 4LAWA 1OGGA 4DIPA 3KCEA 3RGCA 3O5JA 1ZBCA 3WH0A 5DO2A 3ARSA 2ZQSA 2VCDA 2RUCA 2A3EA 4HBEA 4ZPVR 3WIJA 1FKFA 1E15A 2LGOA 5DF0A 4XAKA 1NWRA 2OFNA 2RUQA 1J6YA 4G50A 1EYMA 1U79A 4ZPWR 2MLXA 2XP9A 3KAGA 2PV3A 2B31A 3O5IA 1HKKA 1NMWA 3IHZA 2D9FA 1E6PA 4J4NA 3PRDA 1KT0A 1GUVA 3ARPA 4Z2LA 3UF8A 2PBCA 4JFMA 2XPBA 3ODKA 2L2SA 4U85A 4MAVA 4ODRA 3WL1A 3O5RA 5B8IC 3AS2A 3JXVA 1ZL1A 1ZK6A 1JNEA 4WK9A 5DITA 5HTGA 3ALGA 1FAPA 3KZ7A 3VAWA 4ODQA 4DROA 3TC5A 3RM9A 1LL7A 4WKAA 4TW6A 4S3KA 3WL0A 3UQAA 4JFJA 1LL6A 1Q6UA 1TFVA 1W9UA 3G6MA 3KADA 1FKIA 3FXYA 4WJXA 2ZQTA 2IUZA 4MNMA 4MNLA 4TYOA 5HWBA 3PR9A 4ODLA 4ODMA 2DSZA 5BXJA 2AOSA 1OWQA 2M2AA 4Q7NA 3B9EA 1YATA 3OOBA 4NSBA 4NNRA 5I98A 2F2DA 3RM4A 2ZR6A 3I6CA 3WD2A 1LL4A 1JNDA 2PV2A 3CHEA 3CH9A 4LGXA 5HWCA 2DT2A 1FFQA 2O92A 4DRMA 2WK2A 2ZQUA 3O5MA 1F8AB 2F4EA 4G2PA 2A3CA 2DSWA 1ZU8A 4IQCA 3O5FA 3ARUA 3UI4A 1M5YA 4DZ3A 3OA5A 1LG1A 3O5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6C A;  1FKF A;  3H9R B;  2VN1 A;  2XP3 A;  2RSE A;  4W9O A;  4MSP A;  2MLY A;  2LGO A;  4JFI A;  2OFN A;  4QT3 A;  1FKL A;  2M08 A;  2RUQ A;  2DG4 A;  2F21 A;  4DH0 A;  3JYJ A;  4G50 A;  1J6Y A;  2MNT A;  4GGQ A;  1EYM A;  1ZCN A;  1U79 A;  4TW7 A;  4U84 A;  4LAV A;  2MLX A;  2XP9 A;  3UI5 A;  2KI3 A;  2XP8 A;  3KAG A;  3NRK A;  2PV3 A;  4IQ2 A;  1EQ3 A;  3O5I A;  4QT2 A;  4W9Q A;  1NMW A;  3IHZ A;  5HW6 A;  2D9F A;  3O5O A;  1W26 A;  4LAY A;  1FKH A;  4J4N A;  3PRD A;  1KT0 A;  4DT4 A;  3FAP A;  2FKE A;  1P5Q A;  3O5G A;  2LPV A;  4LAX A;  5HKG A;  1YW5 A;  2XP5 A;  3UF8 A;  4ODO A;  2PBC A;  1Q1C A;  4JFM A;  3EY6 A;  4JFL A;  2XPB A;  3ODK A;  2L2S A;  2MLZ A;  2Q5A A;  3KAI A;  4ODR A;  3O5R A;  4U85 A;  5DIV A;  3UI6 A;  1C9H A;  5B8I C;  3PRB A;  3JXV A;  1N1A A;  1ZK6 A;  4FN2 A;  1Q6H A;  5GPG A;  1JVW A;  5DIT A;  4ODK A;  5HTG A;  4TX0 A;  4W9P A;  1FAP A;  3KZ7 A;  3B7X A;  4N19 A;  3VAW A;  2FAP A;  3UQB A;  1NMV A;  4ODQ A;  1L1P A;  1TCO C;  3O5P A;  4DRO A;  3IKG A;  2N87 A;  5J6E A;  3TC5 A;  1D7J A;  2RUD A;  2LJ4 A;  2DG3 A;  4ODN A;  1NSG A;  1FKD A;  4TW6 A;  1BL4 A;  2ITK A;  1HXV A;  2KR7 A;  3UQA A;  4DRK A;  4JFJ A;  4DRH A;  1Q6U A;  1JNS A;  2LKN A;  4QIB A;  2XP4 A;  3KAD A;  1PBK A;  4DRP A;  1Q6I A;  5D75 A;  2ZR5 A;  3MDY B;  1FKK A;  5HT1 A;  1FKI A;  1F40 A;  1J4H A;  2MPH A;  1D7H A;  2PV1 A;  2RUR A;  1QPF A;  2PPN A;  1FKT A;  2ZQT A;  3GPK A;  3NI6 A;  4TYO A;  5HWB A;  2MF9 A;  3LUO A;  1QZ2 A;  1FKG A;  2ZR4 A;  2JZV A;  1PIN A;  4ODL A;  4R0X A;  2ZQV A;  2KE0 A;  2IF4 A;  4GIV A;  4ODP A;  1FKJ A;  2PPO A;  4ODM A;  5BXJ A;  4TNS A;  1FJD A;  2M2A A;  4TW8 A;  2KGJ A;  3TDB A;  3RFW A;  3O5E A;  5HW8 A;  4JFK A;  4J4O A;  2XP6 A;  1YAT A;  2XPA A;  1J4R A;  3OOB A;  3PA7 A;  4IPX A;  4NNR A;  3KAF A;  2XP7 A;  5I98 A;  2F2D A;  4U86 A;  1BKF A;  4DRN A;  4O2T A;  4JYS A;  4BF8 A;  2ZR6 A;  3I6C A;  3IK8 A;  1FKR A;  1T11 A;  3CGN A;  5HUA A;  4FAP A;  4C02 B;  2K8I A;  1FKB A;  3O5L A;  1D7I A;  4DRI A;  1JNT A;  1FKS A;  1J4I A;  2KO7 A;  3O5Q A;  1A7X A;  2PV2 A;  5HW7 A;  3CGM A;  2DG9 A;  5HWC A;  2KFW A;  4MGV A;  2M1I A;  2PPP A;  4ITZ A;  3O5D A;  1QPL A;  4DRM A;  5DIU A;  3KAB A;  1D6O A;  2AWG A;  2ZQU A;  4LAW A;  4DRJ A;  4DIP A;  1R9H A;  1F8A B;  3O5M A;  3KCE A;  3RGC A;  3O5J A;  3TCZ A;  4DZ2 A;  3WH0 A;  3KAC A;  1ROU A;  2F4E A;  3IKD A;  3JYM A;  2RQS A;  4G2P A;  1KT1 A;  2UZ5 A;  3NTP A;  4IQC A;  3UQI A;  3O5F A;  1FD9 A;  2Y78 A;  1Y0O A;  2ZQS A;  2VCD A;  2RUC A;  3KAH A;  3UI4 A;  1ROT A;  4DRQ A;  1M5Y A;  4DZ3 A;  3O5K A; 
#chains in the Genus database with same CATH topology
 1E6N A;  4IT6 A;  3CHF A;  3ARR A;  3H9R B;  2XP3 A;  4MSP A;  3WKZ A;  1D2K A;  1ZBV A;  4JFI A;  2M08 A;  2DT1 A;  1W1Y A;  4GGQ A;  4U84 A;  1ZCN A;  4L72 B;  3B8S A;  3B9A A;  3UI5 A;  2A3B A;  5GQB A;  4W9Q A;  3O5O A;  1W26 A;  4NZC A;  3ARO A;  3ARV A;  2XP5 A;  2A3A A;  4ODO A;  2DPE A;  3KAI A;  5HW7 A;  3UI6 A;  1C9H A;  3PRB A;  4FN2 A;  1Q6H A;  4S3J A;  5DEZ A;  1LG2 A;  1W1P A;  4W9P A;  2PN0 A;  4ZS6 A;  1H0G A;  4P8U A;  1TCO C;  5J6E A;  2N87 A;  2RUD A;  2G8Z A;  1FKD A;  3CHC A;  1HXV A;  4HAR A;  3ARX A;  5D75 A;  3B9D A;  3MDY B;  5HT1 A;  1J4H A;  2RUR A;  3GPK A;  4DRK A;  1LJY A;  1FKT A;  3LUO A;  1QZ2 A;  2YBT A;  2JZV A;  4W5U A;  2ZQV A;  4GIV A;  2IF4 A;  1FKJ A;  2PPO A;  3AS0 A;  3RME A;  3TDB A;  5HW8 A;  4JFK A;  1E9L A;  2XPA A;  1J4R A;  3PA7 A;  1NWS A;  3KAF A;  2XP7 A;  4R5E A;  1GRJ A;  4QZV B;  4BF8 A;  1T11 A;  4MTV A;  2K8I A;  4C02 B;  4URI A;  2QF8 A;  4UDM A;  4DRI A;  2DSU A;  2KO7 A;  3O5Q A;  2G41 A;  3CGM A;  1ITX A;  2KFW A;  4DWS A;  4ITZ A;  4ZPT R;  3O5D A;  4PTM A;  3ARQ A;  3AS1 A;  1D6O A;  1W9P A;  3KAC A;  1ROU A;  2EUL A;  1H0I A;  1HKJ A;  4DWS C;  1FD9 A;  2Y78 A;  1Y0O A;  3KAH A;  2FDM A;  1ROT A;  2ETN A;  3RM8 A;  4Z2G A;  4W9O A;  1XRV A;  2MLY A;  1NWU A;  2F21 A;  4DH0 A;  3JYJ A;  1XHG A;  4TW7 A;  4LAV A;  1EHN A;  2KI3 A;  4Z2I A;  4IQ2 A;  1EQ3 A;  3WD3 A;  4DWS B;  1CTN A;  1HJW A;  3FAP A;  2LPV A;  2DSV A;  4LAX A;  5HKG A;  2DT3 A;  1YW5 A;  3WD1 A;  1Q1C A;  3EY6 A;  2WLY A;  2MLZ A;  5GPR A;  1N1A A;  5GPG A;  1O6I A;  1SYT A;  1W1T A;  4WKH A;  4TX0 A;  4Q22 A;  1WAW A;  4N19 A;  1L1P A;  1NH6 A;  3W4R A;  1ZBW A;  4DWS D;  2LJ4 A;  3GU0 A;  4KR0 B;  3ARZ A;  4ODN A;  2ESC A;  1NSG A;  1BL4 A;  1KFW A;  4DRH A;  4MPK A;  1HJV A;  2LKN A;  4QIB A;  2XP4 A;  1JCH B;  2ZR5 A;  1F40 A;  2MPH A;  1D7H A;  1QPF A;  2PPN A;  1E6Z A;  1GPF A;  1FKG A;  2ZR4 A;  2OLH A;  4R0X A;  2KE0 A;  1X6L A;  1HKM A;  4TNS A;  1ZBK A;  4TW8 A;  1IX5 A;  2XP6 A;  1EIB A;  4IPX A;  4Z2H A;  1HJX A;  1BKF A;  2DT0 A;  3ART A;  3ARW A;  4O2T A;  4DRN A;  3CGN A;  1WB0 A;  1FKB A;  1OGB A;  3O5L A;  1D7I A;  1J4I A;  1A7X A;  1UR8 A;  3WD0 A;  4KQZ A;  5DIU A;  3FY1 A;  2AWG A;  1LQ0 A;  4DRJ A;  1R9H A;  3TCZ A;  3GTY X;  4DZ2 A;  3CHD A;  4L3N A;  3IKD A;  3JYM A;  2RQS A;  3ALF A;  1KT1 A;  2UZ5 A;  3EIP A;  3NTP A;  3G6L A;  3UQI A;  1WNO A;  4WIW A;  1E6R A;  4DRQ A;  3WD4 A;  1B6C A;  4Z2J A;  2VN1 A;  1EDQ A;  2RSE A;  2F23 A;  4QT3 A;  1FKL A;  2DG4 A;  3WQV A;  2MNT A;  3WQW A;  5JH8 A;  2XP8 A;  3NRK A;  4ML4 A;  4QT2 A;  1GOI A;  5HW6 A;  4LAY A;  1FKH A;  4DT4 A;  2FKE A;  1P5Q A;  3O5G A;  4JFL A;  1FFR A;  2WLZ A;  2Q5A A;  1K9T A;  1W9V A;  4MNK A;  5DIV A;  2O9O A;  2B5U B;  4MNJ A;  3AQU A;  1JVW A;  4ODK A;  2WM0 A;  3B7X A;  2FAP A;  3UQB A;  1NMV A;  3O5P A;  1HKI A;  3IKG A;  5HBF A;  1D7J A;  2PI6 A;  1NWT A;  2DG3 A;  3CZ8 A;  3QOK A;  1RD6 A;  4P8V A;  2ITK A;  2KR7 A;  3BMB A;  1JNS A;  1PBK A;  4DRP A;  1Q6I A;  1FKK A;  3PRA A;  2PV1 A;  3NI6 A;  3ARY A;  4Z2K A;  2MF9 A;  1PIN A;  4IT4 A;  4ODP A;  1FJD A;  2KGJ A;  1SR0 A;  3AS3 A;  3RFW A;  3O5E A;  4J4O A;  3BXW A;  4U86 A;  1UR9 A;  4JYS A;  1ZB5 A;  3IK8 A;  4P8X A;  1FKR A;  5HUA A;  4FAP A;  1X6N A;  1W1V A;  1JNT A;  1FKS A;  4HBO A;  4P8W A;  1VF8 A;  2DG9 A;  4MGV A;  2M1I A;  2PPP A;  4AY1 A;  2YBU A;  1QPL A;  3KAB A;  2P4V A;  4WKF A;  4LAW A;  1OGG A;  4DIP A;  3KCE A;  3RGC A;  3O5J A;  1ZBC A;  3WH0 A;  5DO2 A;  3ARS A;  2ZQS A;  2VCD A;  2RUC A;  2A3E A;  1E44 A;  4HBE A;  4ZPV R;  3WIJ A;  1FKF A;  1E15 A;  2LGO A;  5DF0 A;  4XAK A;  1NWR A;  2OFN A;  2RUQ A;  1J6Y A;  4G50 A;  1EYM A;  1U79 A;  4ZPW R;  2MLX A;  2XP9 A;  3KAG A;  2PV3 A;  2B31 A;  3O5I A;  1HKK A;  1NMW A;  3IHZ A;  2D9F A;  1E6P A;  4J4N A;  3PRD A;  1KT0 A;  1GUV A;  3ARP A;  4Z2L A;  3UF8 A;  2PBC A;  4JFM A;  2XPB A;  3ODK A;  2L2S A;  4U85 A;  4MAV A;  4ODR A;  3WL1 A;  3O5R A;  5B8I C;  3AS2 A;  3JXV A;  1ZL1 A;  1ZK6 A;  1JNE A;  4WK9 A;  5DIT A;  5HTG A;  3ALG A;  1FAP A;  3KZ7 A;  3VAW A;  4ODQ A;  4DRO A;  3TC5 A;  3RM9 A;  1LL7 A;  4WKA A;  4TW6 A;  4S3K A;  3WL0 A;  3UQA A;  4JFJ A;  1LL6 A;  1Q6U A;  1TFV A;  1W9U A;  3G6M A;  3KAD A;  1FKI A;  3FXY A;  4WJX A;  2ZQT A;  2IUZ A;  4MNM A;  4MNL A;  4TYO A;  5HWB A;  3PR9 A;  4ODL A;  4ODM A;  2DSZ A;  5BXJ A;  2AOS A;  1OWQ A;  2M2A A;  4Q7N A;  3B9E A;  1YAT A;  3OOB A;  4NSB A;  4NNR A;  5I98 A;  2F2D A;  3RM4 A;  2ZR6 A;  3I6C A;  3WD2 A;  1LL4 A;  1JND A;  2PV2 A;  3CHE A;  3CH9 A;  4LGX A;  5HWC A;  2DT2 A;  1FFQ A;  2O92 A;  4DRM A;  2WK2 A;  2ZQU A;  3O5M A;  1F8A B;  2F4E A;  4G2P A;  2A3C A;  2DSW A;  1ZU8 A;  4IQC A;  3O5F A;  3ARU A;  3UI4 A;  1M5Y A;  4DZ3 A;  3OA5 A;  1LG1 A;  3O5K A; 
#chains in the Genus database with same CATH homology
 1E6N A;  4IT6 A;  3CHF A;  3ARR A;  3H9R B;  2XP3 A;  4MSP A;  3WKZ A;  1D2K A;  1ZBV A;  4JFI A;  2M08 A;  2DT1 A;  1W1Y A;  4GGQ A;  4U84 A;  1ZCN A;  4L72 B;  3B8S A;  3B9A A;  3UI5 A;  2A3B A;  5GQB A;  4W9Q A;  3O5O A;  1W26 A;  4NZC A;  3ARO A;  3ARV A;  2XP5 A;  2A3A A;  4ODO A;  2DPE A;  3KAI A;  5HW7 A;  3UI6 A;  1C9H A;  3PRB A;  4FN2 A;  1Q6H A;  4S3J A;  5DEZ A;  1LG2 A;  1W1P A;  4W9P A;  4ZS6 A;  1H0G A;  4P8U A;  1TCO C;  5J6E A;  2N87 A;  2RUD A;  2G8Z A;  1FKD A;  3CHC A;  1HXV A;  4HAR A;  3ARX A;  5D75 A;  3B9D A;  3MDY B;  5HT1 A;  1J4H A;  2RUR A;  3GPK A;  4DRK A;  1LJY A;  1FKT A;  3LUO A;  1QZ2 A;  2YBT A;  2JZV A;  4W5U A;  2ZQV A;  4GIV A;  2IF4 A;  1FKJ A;  2PPO A;  3AS0 A;  3RME A;  3TDB A;  5HW8 A;  4JFK A;  1E9L A;  2XPA A;  1J4R A;  3PA7 A;  1NWS A;  3KAF A;  2XP7 A;  4R5E A;  4QZV B;  4BF8 A;  1T11 A;  4MTV A;  2K8I A;  4C02 B;  4URI A;  2QF8 A;  4DRI A;  2DSU A;  2KO7 A;  3O5Q A;  2G41 A;  3CGM A;  1ITX A;  2KFW A;  4DWS A;  4ITZ A;  4ZPT R;  3O5D A;  4PTM A;  3ARQ A;  3AS1 A;  1D6O A;  1W9P A;  3KAC A;  1ROU A;  1H0I A;  1HKJ A;  4DWS C;  1FD9 A;  2Y78 A;  1Y0O A;  3KAH A;  2FDM A;  1ROT A;  3RM8 A;  4Z2G A;  4W9O A;  1XRV A;  2MLY A;  1NWU A;  2F21 A;  4DH0 A;  3JYJ A;  1XHG A;  4TW7 A;  4LAV A;  1EHN A;  2KI3 A;  4Z2I A;  4IQ2 A;  1EQ3 A;  3WD3 A;  4DWS B;  1CTN A;  1HJW A;  3FAP A;  2LPV A;  2DSV A;  4LAX A;  5HKG A;  2DT3 A;  1YW5 A;  3WD1 A;  1Q1C A;  3EY6 A;  2WLY A;  2MLZ A;  5GPR A;  1N1A A;  5GPG A;  1O6I A;  1SYT A;  1W1T A;  4WKH A;  4TX0 A;  4Q22 A;  1WAW A;  4N19 A;  1L1P A;  1NH6 A;  3W4R A;  1ZBW A;  4DWS D;  2LJ4 A;  4KR0 B;  3ARZ A;  4ODN A;  2ESC A;  1NSG A;  1BL4 A;  1KFW A;  4DRH A;  4MPK A;  1HJV A;  2LKN A;  4QIB A;  2XP4 A;  2ZR5 A;  1F40 A;  2MPH A;  1D7H A;  1QPF A;  2PPN A;  1E6Z A;  1GPF A;  1FKG A;  2ZR4 A;  2OLH A;  4R0X A;  2KE0 A;  1X6L A;  1HKM A;  4TNS A;  1ZBK A;  4TW8 A;  1IX5 A;  2XP6 A;  1EIB A;  4IPX A;  4Z2H A;  1HJX A;  1BKF A;  2DT0 A;  3ART A;  3ARW A;  4O2T A;  4DRN A;  3CGN A;  1WB0 A;  1FKB A;  1OGB A;  3O5L A;  1D7I A;  1J4I A;  1A7X A;  1UR8 A;  3WD0 A;  4KQZ A;  5DIU A;  3FY1 A;  2AWG A;  1LQ0 A;  4DRJ A;  1R9H A;  3TCZ A;  4DZ2 A;  3CHD A;  4L3N A;  3IKD A;  3JYM A;  2RQS A;  3ALF A;  1KT1 A;  2UZ5 A;  3NTP A;  3G6L A;  3UQI A;  1WNO A;  4WIW A;  1E6R A;  4DRQ A;  3WD4 A;  1B6C A;  4Z2J A;  2VN1 A;  1EDQ A;  2RSE A;  4QT3 A;  1FKL A;  2DG4 A;  3WQV A;  2MNT A;  3WQW A;  5JH8 A;  2XP8 A;  3NRK A;  4ML4 A;  4QT2 A;  1GOI A;  5HW6 A;  4LAY A;  1FKH A;  4DT4 A;  2FKE A;  1P5Q A;  3O5G A;  4JFL A;  1FFR A;  2WLZ A;  2Q5A A;  1K9T A;  1W9V A;  4MNK A;  5DIV A;  2O9O A;  4MNJ A;  3AQU A;  1JVW A;  4ODK A;  2WM0 A;  3B7X A;  2FAP A;  3UQB A;  1NMV A;  3O5P A;  1HKI A;  3IKG A;  5HBF A;  1D7J A;  2PI6 A;  1NWT A;  2DG3 A;  3CZ8 A;  3QOK A;  1RD6 A;  4P8V A;  2ITK A;  2KR7 A;  1JNS A;  1PBK A;  4DRP A;  1Q6I A;  1FKK A;  3PRA A;  2PV1 A;  3NI6 A;  3ARY A;  4Z2K A;  2MF9 A;  1PIN A;  4IT4 A;  4ODP A;  1FJD A;  2KGJ A;  1SR0 A;  3AS3 A;  3RFW A;  3O5E A;  4J4O A;  3BXW A;  4U86 A;  1UR9 A;  4JYS A;  1ZB5 A;  3IK8 A;  4P8X A;  1FKR A;  5HUA A;  4FAP A;  1X6N A;  1W1V A;  1JNT A;  1FKS A;  4HBO A;  4P8W A;  1VF8 A;  2DG9 A;  4MGV A;  2M1I A;  2PPP A;  4AY1 A;  2YBU A;  1QPL A;  3KAB A;  4WKF A;  4LAW A;  1OGG A;  4DIP A;  3KCE A;  3RGC A;  3O5J A;  1ZBC A;  3WH0 A;  5DO2 A;  3ARS A;  2ZQS A;  2VCD A;  2RUC A;  2A3E A;  4HBE A;  4ZPV R;  3WIJ A;  1FKF A;  1E15 A;  2LGO A;  5DF0 A;  4XAK A;  1NWR A;  2OFN A;  2RUQ A;  1J6Y A;  4G50 A;  1EYM A;  1U79 A;  4ZPW R;  2MLX A;  2XP9 A;  3KAG A;  2PV3 A;  2B31 A;  3O5I A;  1HKK A;  1NMW A;  3IHZ A;  2D9F A;  1E6P A;  4J4N A;  3PRD A;  1KT0 A;  1GUV A;  3ARP A;  4Z2L A;  3UF8 A;  2PBC A;  4JFM A;  2XPB A;  3ODK A;  2L2S A;  4U85 A;  4MAV A;  4ODR A;  3WL1 A;  3O5R A;  5B8I C;  3AS2 A;  3JXV A;  1ZL1 A;  1ZK6 A;  1JNE A;  4WK9 A;  5DIT A;  5HTG A;  3ALG A;  1FAP A;  3KZ7 A;  3VAW A;  4ODQ A;  4DRO A;  3TC5 A;  3RM9 A;  1LL7 A;  4WKA A;  4TW6 A;  4S3K A;  3WL0 A;  3UQA A;  4JFJ A;  1LL6 A;  1Q6U A;  1TFV A;  1W9U A;  3G6M A;  3KAD A;  1FKI A;  3FXY A;  4WJX A;  2ZQT A;  2IUZ A;  4MNM A;  4MNL A;  4TYO A;  5HWB A;  3PR9 A;  4ODL A;  4ODM A;  2DSZ A;  5BXJ A;  2AOS A;  1OWQ A;  2M2A A;  4Q7N A;  3B9E A;  1YAT A;  3OOB A;  4NSB A;  4NNR A;  5I98 A;  2F2D A;  3RM4 A;  2ZR6 A;  3I6C A;  3WD2 A;  1LL4 A;  1JND A;  2PV2 A;  3CHE A;  3CH9 A;  4LGX A;  5HWC A;  2DT2 A;  1FFQ A;  2O92 A;  4DRM A;  2WK2 A;  2ZQU A;  3O5M A;  1F8A B;  2F4E A;  4G2P A;  2A3C A;  2DSW A;  1ZU8 A;  4IQC A;  3O5F A;  3ARU A;  3UI4 A;  1M5Y A;  4DZ3 A;  3OA5 A;  1LG1 A;  3O5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...