4TYOA

Ppiase in complex with a non-phosphate small molecule inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
molecule tags Isomerase/isomerase inhibitor
source organism Homo sapiens
publication title Structure-based design of novel human Pin1 inhibitors (III): Optimizing affinity beyond the phosphate recognition pocket.
pubmed doi rcsb
total genus 38
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tyoA00
2DG4A 3FAPA 4LAVA 4G50A 4U84A 2XP6A 3O5EA 3KAIA 4ODOA 4GIVA 2RUQA 4DZ3A 2XP9A 2L2SA 4U86A 4DRNA 2N87A 3PRBA 2LPVA 5BXJA 2KI3A 2XP5A 1J4IA 4DRMA 4JFLA 5DIUA 3VAWA 1J4RA 4G2PA 2KR7A 5HWBA 4FAPA 4LAWA 4MSPA 1FKTA 3GPKA 3TCZA 2M1IA 2KGJA 3B7XA 5HW6A 2ZR5A 1PINA 3O5IA 4DZ2A 2UZ5A 3UQBA 1B6CA 2M2AA 3KACA 1FKSA 1Y0OA 1BKFA 4QT2A 4DT4A 2PPNA 1Q6HA 2F2DA 4TW7A 5D75A 2KE0A 3KAHA 1J6YA 1ROUA 2MPHA 4TYOA 1FAPA 1W26A 1ZK6A 4DRHA 1NSGA 1Q1CA 2MF9A 3O5LA 1FKRA 1L1PA 3O5OA 5HW8A 5DIVA 3O5PA 3UI5A 3IKGA 2DG3A 2ZR4A 4LAXA 2ZQVA 5DITA 1Q6IA 1QZ2A 2RQSA 3IK8A 3O5QA 1NMWA 1HXVA 2LKNA 2PV1A 2VCDA 2XPBA 1Q6UA 2AWGA 2VN1A 1ZCNA 4DROA 1JNSA 4J4NA 2D9FA 1J4HA 4DRJA 1D7IA 2ZR6A 5I98A 1FKBA 4ODLA 2XP8A 1FKFA 3O5JA 4QT3A 1JNTA 5HWCA 3JYJA 1D7HA 3EY6A 1P5QA 2F4EA 1D6OA 4ODNA 1QPLA 1PBKA 2MLXA 3UI4A 4DIPA 2XPAA 5HW7A 3KAGA 1D7JA 1NMVA 1ROTA 3UQIA 1FKKA 1KT1A 1FKHA 1FKIA 2DG9A 3H9RB 4U85A 3NI6A 3KAFA 3O5GA 2K8IA 3KZ7A 3PRDA 4W9PA 2RUCA 2KFWA 1A7XA 2FAPA 2MLZA 3O5RA 3NRKA 4J4OA 4TNSA 3O5FA 1FJDA 1BL4A 2Q5AA 2RUDA 5HUAA 3UF8A 2LJ4A 2ITKA 1YW5A 2PV3A 3NTPA 2Y78A 3ODKA 1JVWA 5HT1A 4DH0A 2F21A 4NNRA 2KO7A 1EYMA 3PA7A 3TC5A 2ZQSA 1N1AA 2OFNA 3KCEA 3MDYB 4IQ2A 2MLYA 3KADA 4LAYA 4N19A 4ODPA 2PPOA 3RFWA 2PV2A 3UI6A 4FN2A 2PBCA 4JFIA 1YATA 1C9HA 3CGMA 3IKDA 3KABA 2MNTA 1FKDA 3OOBA 5GPGA 4ODRA 3RGCA 4JFMA 4BF8A 5HKGA 4TX0A 4TW8A 3CGNA 4IQCA 4ITZA 2ZQUA 4C02B 3O5KA 3O5DA 2XP3A 1QPFA 2M08A 2RSEA 4IPXA 2RURA 4JFKA 4JYSA 4W9QA 5HTGA 2IF4A 1TCOC 2XP4A 2XP7A 4DRQA 1U79A 2PPPA 3JYMA 4GGQA 2ZQTA 4W9OA 3IHZA 2FKEA 3WH0A 1F8AB 3I6CA 5B8IC 1FD9A 3O5MA 4DRPA 5J6EA 1F40A 3LUOA 1T11A 4TW6A 4DRIA 1FKLA 4ODMA 4R0XA 4JFJA 2LGOA 4ODQA 4O2TA 1FKGA 4QIBA 2JZVA 4DRKA 1R9HA 4MGVA 1FKJA 3UQAA 1EQ3A 1KT0A 4ODKA 3JXVA 3TDBA 1M5YA
chains in the Genus database with same CATH superfamily
4LAVA 1W1TA 3WD1A 2XP6A 3ALFA 3O5EA 4P8WA 3KAIA 1X6LA 4GIVA 4DRNA 2XP5A 4KR0B 4G2PA 2KR7A 4LAWA 4Z2JA 3EIPA 4Z2LA 1HKKA 1PINA 4WJXA 1B6CA 2M2AA 1Y0OA 4QT2A 4DT4A 2PPNA 1J6YA 5D75A 1X6NA 4MNMA 1ZK6A 1E6ZA 4Q22A 1NSGA 1Q1CA 4DRHA 5JH8A 3O5OA 3ARWA 5HW8A 3O5PA 2DSWA 1Q6IA 1QZ2A 2AWGA 2VN1A 4WIWA 1J4HA 1D7IA 1FKBA 1HKIA 3O5JA 4QT3A 1JNTA 5HWCA 3PRAA 4MNJA 3KAGA 1SR0A 1FKKA 4U85A 2DG9A 1NH6A 4ZPWR 1OGGA 4DWSB 2WM0A 4WK9A 1A7XA 4TNSA 1GRJA 1E6PA 1IX5A 1YW5A 2O9OA 3WD3A 2Y78A 4LGXA 4DH0A 1EYMA 2ZQSA 3KCEA 5B8IC 2MLYA 3KADA 1XHGA 1D2KA 4ODPA 1SYTA 5DF0A 3ARYA 4Q7NA 2PBCA 1UR9A 4JFMA 5HKGA 4IT6A 4TX0A 3AS0A 1ZBWA 3ALGA 4TW8A 3FXYA 1W1VA 4C02B 4WKFA 1UR8A 2RSEA 4JYSA 5HTGA 2XP4A 4DRQA 2PPPA 1OGBA 5J6EA 4DRIA 4R0XA 4JFJA 1LQ0A 2JZVA 3BMBA 4DRKA 1EQ3A 2ZQVA 4WKHA 5GPRA 4G50A 4ODOA 1HKMA 2XP9A 2L2SA 4U86A 1TFVA 2WK2A 2N87A 1FFQA 3AS1A 3VAWA 5HWBA 5DEZA 2DSZA 1FKTA 1CTNA 3TCZA 2KGJA 2ZR5A 1HJVA 3KACA 4L3NA 1Q6HA 2F2DA 4TW7A 3KAHA 1O6IA 1ROUA 1FAPA 1W26A 4IT4A 5DIVA 3B9EA 2WLYA 4MPKA 2DG3A 3IK8A 3O5QA 2P4VA 1HJWA 2PV1A 1Q6UA 1HJXA 4DRJA 5I98A 3WD0A 2XP8A 4P8UA 3JYJA 2F4EA 1D6OA 4ODNA 1E9LA 2XPAA 3RMEA 4Z2IA 1ROTA 1KT1A 3O5GA 1E44A 2K8IA 2RUCA 4DWSD 2FAPA 1GUVA 3NRKA 3O5RA 3WD4A 2RUDA 3ARUA 3ARTA 2PV3A 3WL1A 4ZS6A 3GU0A 2F21A 3PA7A 3TC5A 1LL6A 3WIJA 1N1AA 2OFNA 4LAYA 4N19A 2PPOA 1ZBCA 2DT0A 1FFRA 4ML4A 4JFIA 3QOKA 1YATA 1C9HA 3CGMA 3KABA 1FKDA 3RGCA 4BF8A 1OWQA 2PI6A 4ITZA 2ZQUA 3WD2A 1ZB5A 4MNLA 2RURA 4W9QA 2XP7A 2ZQTA 3IHZA 2DT3A 4ZPVR 1F8AB 3I6CA 3O5MA 1LG2A 4DRPA 1FKLA 3ARZA 1ZU8A 2LGOA 4ODQA 1FKGA 1E6RA 1R9HA 4HBOA 3CHFA 3UQIA 1W1PA 1M5YA 3FAPA 3B9AA 4U84A 2AOSA 4S3KA 3ARSA 1EDQA 4Z2HA 1NWSA 5BXJA 2KI3A 3G6MA 4Z2GA 4DRMA 4JFLA 3RM8A 2ESCA 4NZCA 3RM9A 3W4RA 4MSPA 4UDMA 3GPKA 3GTYX 3WKZA 1RD6A 3B9DA 4DZ2A 3O5IA 3G6LA 2KE0A 3RM4A 2IUZA 4MTVA 4L72B 1L1PA 1W9UA 1NWRA 3ARQA 3UI5A 4MAVA 3CHCA 2ZR4A 3CHEA 1NMWA 2LKNA 2VCDA 2XPBA 3ARRA 1ZCNA 4DROA 4J4NA 2ZR6A 2WLZA 2ETNA 1WB0A 4NSBA 1D7HA 3EY6A 1QPLA 1PBKA 2MLXA 3UI4A 4DIPA 5HW7A 1WNOA 1FKHA 1FKIA 3H9RB 3KAFA 1H0IA 3PRDA 2MLZA 4DWSC 1FJDA 1BL4A 1NWUA 2LJ4A 4XAKA 4MNKA 4R5EA 3ODKA 1JVWA 2F23A 4ZPTR 4NNRA 4IQ2A 3ARPA 3MDYB 2PV2A 3UI6A 1LL7A 4P8VA 1NWTA 3IKDA 5GPGA 3PR9A 4ODRA 3B8SA 3CGNA 4IQCA 1E15A 5DO2A 3O5DA 1QPFA 4IPXA 4JFKA 4DWSA 2IF4A 1U79A 4GGQA 4W9OA 2FKEA 3WH0A 5HBFA 1FD9A 1ZBKA 3ARXA 3AS2A 3LUOA 2DT1A 4TW6A 1E6NA 3AQUA 1LL4A 4O2TA 4QZVB 2DSUA 4HARA 4MGVA 2DT2A 3UQAA 5GQBA 3JXVA 3TDBA 2DG4A 1JCHB 3AS3A 2G8ZA 2B5UB 1ZL1A 2RUQA 4DZ3A 2YBTA 3PRBA 2LPVA 2A3CA 1EIBA 1J4IA 3BXWA 1K9TA 5DIUA 1J4RA 4FAPA 2M1IA 3B7XA 5HW6A 2UZ5A 3UQBA 1FKSA 3FY1A 1BKFA 1KFWA 1GPFA 1LJYA 3WQWA 2MPHA 4TYOA 2MF9A 3O5LA 1FKRA 4AY1A 3IKGA 4LAXA 5DITA 1HXVA 2RQSA 1WAWA 1JNSA 4W5UA 2D9FA 1W1YA 4ODLA 1ITXA 1FKFA 1P5QA 1W9VA 1D7JA 1NMVA 4WKAA 1EHNA 3NI6A 4PTMA 4W9PA 3KZ7A 2KFWA 4J4OA 1VF8A 2YBUA 2B31A 3O5FA 1H0GA 2Q5AA 5HUAA 3UF8A 2ITKA 2OLHA 3NTPA 4Z2KA 2EULA 2QF8A 5HT1A 2KO7A 4URIA 3CHDA 3WL0A 3RFWA 3AROA 2O92A 4FN2A 2G41A 3OOBA 2MNTA 2PN0A 1GOIA 2A3BA 2FDMA 2DSVA 1JNDA 1LG1A 3O5KA 2XP3A 4HBEA 3CH9A 1ZBVA 2M08A 4P8XA 1TCOC 2A3AA 1HKJA 2DPEA 3WQVA 1W9PA 3ARVA 1JNEA 1F40A 1T11A 3OA5A 2A3EA 4ODMA 4KQZA 4S3JA 1XRVA 4QIBA 3CZ8A 1FKJA 1KT0A 4ODKA 3JYMA
chains in the Genus database with same CATH topology
4LAVA 1W1TA 3WD1A 2XP6A 3ALFA 3O5EA 4P8WA 3KAIA 1X6LA 4GIVA 4DRNA 2XP5A 4KR0B 4G2PA 2KR7A 4LAWA 4Z2JA 4Z2LA 1PINA 1HKKA 4WJXA 1B6CA 2M2AA 1Y0OA 4QT2A 4DT4A 2PPNA 1J6YA 5D75A 1X6NA 4MNMA 1ZK6A 1E6ZA 4Q22A 1NSGA 1Q1CA 4DRHA 5JH8A 3O5OA 3ARWA 5HW8A 3O5PA 2DSWA 1Q6IA 1QZ2A 2AWGA 2VN1A 4WIWA 1J4HA 1D7IA 1FKBA 1HKIA 3O5JA 4QT3A 1JNTA 5HWCA 3PRAA 4MNJA 3KAGA 1SR0A 1FKKA 4U85A 2DG9A 1NH6A 4ZPWR 1OGGA 4DWSB 2WM0A 4WK9A 1A7XA 4TNSA 1E6PA 1IX5A 1YW5A 2O9OA 3WD3A 2Y78A 4LGXA 4DH0A 1EYMA 2ZQSA 3KCEA 5B8IC 2MLYA 3KADA 1XHGA 1D2KA 4ODPA 1SYTA 5DF0A 3ARYA 4Q7NA 2PBCA 1UR9A 4JFMA 5HKGA 4IT6A 4TX0A 3AS0A 1ZBWA 3ALGA 4TW8A 3FXYA 1W1VA 4C02B 4WKFA 1UR8A 2RSEA 4JYSA 5HTGA 2XP4A 4DRQA 2PPPA 1OGBA 5J6EA 4DRIA 4R0XA 4JFJA 1LQ0A 2JZVA 4DRKA 1EQ3A 2ZQVA 4WKHA 5GPRA 4G50A 4ODOA 1HKMA 2XP9A 2L2SA 4U86A 1TFVA 2WK2A 2N87A 1FFQA 3AS1A 3VAWA 5HWBA 5DEZA 2DSZA 1FKTA 1CTNA 3TCZA 2KGJA 2ZR5A 1HJVA 3KACA 4L3NA 1Q6HA 2F2DA 4TW7A 3KAHA 1O6IA 1ROUA 1FAPA 1W26A 4IT4A 5DIVA 3B9EA 2WLYA 4MPKA 2DG3A 3IK8A 3O5QA 1HJWA 2PV1A 1Q6UA 1HJXA 4DRJA 5I98A 3WD0A 2XP8A 4P8UA 3JYJA 2F4EA 1D6OA 4ODNA 1E9LA 2XPAA 3RMEA 4Z2IA 1ROTA 1KT1A 3O5GA 2K8IA 2RUCA 4DWSD 2FAPA 1GUVA 3NRKA 3O5RA 3WD4A 2RUDA 3ARUA 3ARTA 2PV3A 3WL1A 4ZS6A 2F21A 3PA7A 3TC5A 1LL6A 3WIJA 1N1AA 2OFNA 4LAYA 4N19A 2PPOA 1ZBCA 2DT0A 1FFRA 4ML4A 4JFIA 3QOKA 1YATA 1C9HA 3CGMA 3KABA 1FKDA 3RGCA 4BF8A 1OWQA 2PI6A 4ITZA 2ZQUA 3WD2A 1ZB5A 4MNLA 2RURA 4W9QA 2XP7A 2ZQTA 3IHZA 2DT3A 4ZPVR 1F8AB 3I6CA 3O5MA 1LG2A 4DRPA 1FKLA 3ARZA 1ZU8A 2LGOA 4ODQA 1FKGA 1E6RA 1R9HA 4HBOA 3CHFA 3UQIA 1W1PA 1M5YA 3FAPA 3B9AA 4U84A 2AOSA 4S3KA 3ARSA 1EDQA 4Z2HA 1NWSA 5BXJA 2KI3A 3G6MA 4Z2GA 4DRMA 4JFLA 3RM8A 2ESCA 4NZCA 3RM9A 3W4RA 4MSPA 3GPKA 3WKZA 1RD6A 3B9DA 4DZ2A 3O5IA 3G6LA 2KE0A 3RM4A 2IUZA 4MTVA 4L72B 1L1PA 1W9UA 1NWRA 3ARQA 3UI5A 4MAVA 3CHCA 2ZR4A 3CHEA 1NMWA 2LKNA 2VCDA 2XPBA 3ARRA 1ZCNA 4DROA 4J4NA 2ZR6A 2WLZA 1WB0A 4NSBA 1D7HA 3EY6A 1QPLA 1PBKA 2MLXA 3UI4A 4DIPA 5HW7A 1WNOA 1FKHA 1FKIA 3H9RB 3KAFA 1H0IA 3PRDA 2MLZA 4DWSC 1FJDA 1BL4A 1NWUA 2LJ4A 4XAKA 4MNKA 4R5EA 3ODKA 1JVWA 4ZPTR 4NNRA 4IQ2A 3ARPA 3MDYB 2PV2A 3UI6A 1LL7A 4P8VA 1NWTA 3IKDA 5GPGA 3PR9A 4ODRA 4IQCA 3B8SA 3CGNA 1E15A 5DO2A 3O5DA 1QPFA 4IPXA 4JFKA 4DWSA 2IF4A 1U79A 4GGQA 4W9OA 2FKEA 3WH0A 5HBFA 1FD9A 1ZBKA 3ARXA 3AS2A 3LUOA 2DT1A 4TW6A 1E6NA 3AQUA 1LL4A 4O2TA 4QZVB 2DSUA 4HARA 4MGVA 2DT2A 3UQAA 5GQBA 3JXVA 3TDBA 2DG4A 3AS3A 2G8ZA 1ZL1A 2RUQA 4DZ3A 2YBTA 3PRBA 2LPVA 2A3CA 1EIBA 1J4IA 3BXWA 1K9TA 5DIUA 1J4RA 4FAPA 2M1IA 3B7XA 5HW6A 2UZ5A 3UQBA 1FKSA 3FY1A 1BKFA 1KFWA 1GPFA 1LJYA 3WQWA 2MPHA 4TYOA 2MF9A 3O5LA 1FKRA 4AY1A 3IKGA 4LAXA 5DITA 1HXVA 2RQSA 1WAWA 1JNSA 4W5UA 2D9FA 1W1YA 4ODLA 1ITXA 1FKFA 1P5QA 1W9VA 1D7JA 1NMVA 4WKAA 1EHNA 3NI6A 4PTMA 4W9PA 3KZ7A 2KFWA 4J4OA 1VF8A 2YBUA 2B31A 3O5FA 1H0GA 2Q5AA 5HUAA 3UF8A 2ITKA 2OLHA 3NTPA 4Z2KA 2QF8A 5HT1A 2KO7A 4URIA 3CHDA 3WL0A 3RFWA 3AROA 2O92A 4FN2A 2G41A 3OOBA 2MNTA 1GOIA 2A3BA 2FDMA 2DSVA 1JNDA 1LG1A 3O5KA 2XP3A 4HBEA 3CH9A 1ZBVA 2M08A 4P8XA 1TCOC 2A3AA 1HKJA 2DPEA 3WQVA 1W9PA 3ARVA 1JNEA 1F40A 1T11A 3OA5A 2A3EA 4ODMA 4KQZA 4S3JA 1XRVA 4QIBA 3CZ8A 1FKJA 1KT0A 4ODKA 3JYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG4 A;  3FAP A;  4LAV A;  4G50 A;  4U84 A;  2XP6 A;  3O5E A;  3KAI A;  4ODO A;  4GIV A;  2RUQ A;  4DZ3 A;  2XP9 A;  2L2S A;  4U86 A;  4DRN A;  2N87 A;  3PRB A;  2LPV A;  5BXJ A;  2KI3 A;  2XP5 A;  1J4I A;  4DRM A;  4JFL A;  5DIU A;  3VAW A;  1J4R A;  4G2P A;  2KR7 A;  5HWB A;  4FAP A;  4LAW A;  4MSP A;  1FKT A;  3GPK A;  3TCZ A;  2M1I A;  2KGJ A;  3B7X A;  5HW6 A;  2ZR5 A;  1PIN A;  3O5I A;  4DZ2 A;  2UZ5 A;  3UQB A;  1B6C A;  2M2A A;  3KAC A;  1FKS A;  1Y0O A;  1BKF A;  4QT2 A;  4DT4 A;  2PPN A;  1Q6H A;  2F2D A;  4TW7 A;  5D75 A;  2KE0 A;  3KAH A;  1J6Y A;  1ROU A;  2MPH A;  4TYO A;  1FAP A;  1W26 A;  1ZK6 A;  4DRH A;  1NSG A;  1Q1C A;  2MF9 A;  3O5L A;  1FKR A;  1L1P A;  3O5O A;  5HW8 A;  5DIV A;  3O5P A;  3UI5 A;  3IKG A;  2DG3 A;  2ZR4 A;  4LAX A;  2ZQV A;  5DIT A;  1Q6I A;  1QZ2 A;  2RQS A;  3IK8 A;  3O5Q A;  1NMW A;  1HXV A;  2LKN A;  2PV1 A;  2VCD A;  2XPB A;  1Q6U A;  2AWG A;  2VN1 A;  1ZCN A;  4DRO A;  1JNS A;  4J4N A;  2D9F A;  1J4H A;  4DRJ A;  1D7I A;  2ZR6 A;  5I98 A;  1FKB A;  4ODL A;  2XP8 A;  1FKF A;  3O5J A;  4QT3 A;  1JNT A;  5HWC A;  3JYJ A;  1D7H A;  3EY6 A;  1P5Q A;  2F4E A;  1D6O A;  4ODN A;  1QPL A;  1PBK A;  2MLX A;  3UI4 A;  4DIP A;  2XPA A;  5HW7 A;  3KAG A;  1D7J A;  1NMV A;  1ROT A;  3UQI A;  1FKK A;  1KT1 A;  1FKH A;  1FKI A;  2DG9 A;  3H9R B;  4U85 A;  3NI6 A;  3KAF A;  3O5G A;  2K8I A;  3KZ7 A;  3PRD A;  4W9P A;  2RUC A;  2KFW A;  1A7X A;  2FAP A;  2MLZ A;  3O5R A;  3NRK A;  4J4O A;  4TNS A;  3O5F A;  1FJD A;  1BL4 A;  2Q5A A;  2RUD A;  5HUA A;  3UF8 A;  2LJ4 A;  2ITK A;  1YW5 A;  2PV3 A;  3NTP A;  2Y78 A;  3ODK A;  1JVW A;  5HT1 A;  4DH0 A;  2F21 A;  4NNR A;  2KO7 A;  1EYM A;  3PA7 A;  3TC5 A;  2ZQS A;  1N1A A;  2OFN A;  3KCE A;  3MDY B;  4IQ2 A;  2MLY A;  3KAD A;  4LAY A;  4N19 A;  4ODP A;  2PPO A;  3RFW A;  2PV2 A;  3UI6 A;  4FN2 A;  2PBC A;  4JFI A;  1YAT A;  1C9H A;  3CGM A;  3IKD A;  3KAB A;  2MNT A;  1FKD A;  3OOB A;  5GPG A;  4ODR A;  3RGC A;  4JFM A;  4BF8 A;  5HKG A;  4TX0 A;  4TW8 A;  3CGN A;  4IQC A;  4ITZ A;  2ZQU A;  4C02 B;  3O5K A;  3O5D A;  2XP3 A;  1QPF A;  2M08 A;  2RSE A;  4IPX A;  2RUR A;  4JFK A;  4JYS A;  4W9Q A;  5HTG A;  2IF4 A;  1TCO C;  2XP4 A;  2XP7 A;  4DRQ A;  1U79 A;  2PPP A;  3JYM A;  4GGQ A;  2ZQT A;  4W9O A;  3IHZ A;  2FKE A;  3WH0 A;  1F8A B;  3I6C A;  5B8I C;  1FD9 A;  3O5M A;  4DRP A;  5J6E A;  1F40 A;  3LUO A;  1T11 A;  4TW6 A;  4DRI A;  1FKL A;  4ODM A;  4R0X A;  4JFJ A;  2LGO A;  4ODQ A;  4O2T A;  1FKG A;  4QIB A;  2JZV A;  4DRK A;  1R9H A;  4MGV A;  1FKJ A;  3UQA A;  1EQ3 A;  1KT0 A;  4ODK A;  3JXV A;  3TDB A;  1M5Y A; 
#chains in the Genus database with same CATH topology
 4LAV A;  1W1T A;  3WD1 A;  2XP6 A;  3ALF A;  3O5E A;  4P8W A;  3KAI A;  1X6L A;  4GIV A;  4DRN A;  2XP5 A;  4KR0 B;  4G2P A;  2KR7 A;  4LAW A;  4Z2J A;  3EIP A;  4Z2L A;  1HKK A;  1PIN A;  4WJX A;  1B6C A;  2M2A A;  1Y0O A;  4QT2 A;  4DT4 A;  2PPN A;  1J6Y A;  5D75 A;  1X6N A;  4MNM A;  1ZK6 A;  1E6Z A;  4Q22 A;  1NSG A;  1Q1C A;  4DRH A;  5JH8 A;  3O5O A;  3ARW A;  5HW8 A;  3O5P A;  2DSW A;  1Q6I A;  1QZ2 A;  2AWG A;  2VN1 A;  4WIW A;  1J4H A;  1D7I A;  1FKB A;  1HKI A;  3O5J A;  4QT3 A;  1JNT A;  5HWC A;  3PRA A;  4MNJ A;  3KAG A;  1SR0 A;  1FKK A;  4U85 A;  2DG9 A;  1NH6 A;  4ZPW R;  1OGG A;  4DWS B;  2WM0 A;  4WK9 A;  1A7X A;  4TNS A;  1GRJ A;  1E6P A;  1IX5 A;  1YW5 A;  2O9O A;  3WD3 A;  2Y78 A;  4LGX A;  4DH0 A;  1EYM A;  2ZQS A;  3KCE A;  5B8I C;  2MLY A;  3KAD A;  1XHG A;  1D2K A;  4ODP A;  1SYT A;  5DF0 A;  3ARY A;  4Q7N A;  2PBC A;  1UR9 A;  4JFM A;  5HKG A;  4IT6 A;  4TX0 A;  3AS0 A;  1ZBW A;  3ALG A;  4TW8 A;  3FXY A;  1W1V A;  4C02 B;  4WKF A;  1UR8 A;  2RSE A;  4JYS A;  5HTG A;  2XP4 A;  4DRQ A;  2PPP A;  1OGB A;  5J6E A;  4DRI A;  4R0X A;  4JFJ A;  1LQ0 A;  2JZV A;  3BMB A;  4DRK A;  1EQ3 A;  2ZQV A;  4WKH A;  5GPR A;  4G50 A;  4ODO A;  1HKM A;  2XP9 A;  2L2S A;  4U86 A;  1TFV A;  2WK2 A;  2N87 A;  1FFQ A;  3AS1 A;  3VAW A;  5HWB A;  5DEZ A;  2DSZ A;  1FKT A;  1CTN A;  3TCZ A;  2KGJ A;  2ZR5 A;  1HJV A;  3KAC A;  4L3N A;  1Q6H A;  2F2D A;  4TW7 A;  3KAH A;  1O6I A;  1ROU A;  1FAP A;  1W26 A;  4IT4 A;  5DIV A;  3B9E A;  2WLY A;  4MPK A;  2DG3 A;  3IK8 A;  3O5Q A;  2P4V A;  1HJW A;  2PV1 A;  1Q6U A;  1HJX A;  4DRJ A;  5I98 A;  3WD0 A;  2XP8 A;  4P8U A;  3JYJ A;  2F4E A;  1D6O A;  4ODN A;  1E9L A;  2XPA A;  3RME A;  4Z2I A;  1ROT A;  1KT1 A;  3O5G A;  1E44 A;  2K8I A;  2RUC A;  4DWS D;  2FAP A;  1GUV A;  3NRK A;  3O5R A;  3WD4 A;  2RUD A;  3ARU A;  3ART A;  2PV3 A;  3WL1 A;  4ZS6 A;  3GU0 A;  2F21 A;  3PA7 A;  3TC5 A;  1LL6 A;  3WIJ A;  1N1A A;  2OFN A;  4LAY A;  4N19 A;  2PPO A;  1ZBC A;  2DT0 A;  1FFR A;  4ML4 A;  4JFI A;  3QOK A;  1YAT A;  1C9H A;  3CGM A;  3KAB A;  1FKD A;  3RGC A;  4BF8 A;  1OWQ A;  2PI6 A;  4ITZ A;  2ZQU A;  3WD2 A;  1ZB5 A;  4MNL A;  2RUR A;  4W9Q A;  2XP7 A;  2ZQT A;  3IHZ A;  2DT3 A;  4ZPV R;  1F8A B;  3I6C A;  3O5M A;  1LG2 A;  4DRP A;  1FKL A;  3ARZ A;  1ZU8 A;  2LGO A;  4ODQ A;  1FKG A;  1E6R A;  1R9H A;  4HBO A;  3CHF A;  3UQI A;  1W1P A;  1M5Y A;  3FAP A;  3B9A A;  4U84 A;  2AOS A;  4S3K A;  3ARS A;  1EDQ A;  4Z2H A;  1NWS A;  5BXJ A;  2KI3 A;  3G6M A;  4Z2G A;  4DRM A;  4JFL A;  3RM8 A;  2ESC A;  4NZC A;  3RM9 A;  3W4R A;  4MSP A;  4UDM A;  3GPK A;  3GTY X;  3WKZ A;  1RD6 A;  3B9D A;  4DZ2 A;  3O5I A;  3G6L A;  2KE0 A;  3RM4 A;  2IUZ A;  4MTV A;  4L72 B;  1L1P A;  1W9U A;  1NWR A;  3ARQ A;  3UI5 A;  4MAV A;  3CHC A;  2ZR4 A;  3CHE A;  1NMW A;  2LKN A;  2VCD A;  2XPB A;  3ARR A;  1ZCN A;  4DRO A;  4J4N A;  2ZR6 A;  2WLZ A;  2ETN A;  1WB0 A;  4NSB A;  1D7H A;  3EY6 A;  1QPL A;  1PBK A;  2MLX A;  3UI4 A;  4DIP A;  5HW7 A;  1WNO A;  1FKH A;  1FKI A;  3H9R B;  3KAF A;  1H0I A;  3PRD A;  2MLZ A;  4DWS C;  1FJD A;  1BL4 A;  1NWU A;  2LJ4 A;  4XAK A;  4MNK A;  4R5E A;  3ODK A;  1JVW A;  2F23 A;  4ZPT R;  4NNR A;  4IQ2 A;  3ARP A;  3MDY B;  2PV2 A;  3UI6 A;  1LL7 A;  4P8V A;  1NWT A;  3IKD A;  5GPG A;  3PR9 A;  4ODR A;  3B8S A;  3CGN A;  4IQC A;  1E15 A;  5DO2 A;  3O5D A;  1QPF A;  4IPX A;  4JFK A;  4DWS A;  2IF4 A;  1U79 A;  4GGQ A;  4W9O A;  2FKE A;  3WH0 A;  5HBF A;  1FD9 A;  1ZBK A;  3ARX A;  3AS2 A;  3LUO A;  2DT1 A;  4TW6 A;  1E6N A;  3AQU A;  1LL4 A;  4O2T A;  4QZV B;  2DSU A;  4HAR A;  4MGV A;  2DT2 A;  3UQA A;  5GQB A;  3JXV A;  3TDB A;  2DG4 A;  1JCH B;  3AS3 A;  2G8Z A;  2B5U B;  1ZL1 A;  2RUQ A;  4DZ3 A;  2YBT A;  3PRB A;  2LPV A;  2A3C A;  1EIB A;  1J4I A;  3BXW A;  1K9T A;  5DIU A;  1J4R A;  4FAP A;  2M1I A;  3B7X A;  5HW6 A;  2UZ5 A;  3UQB A;  1FKS A;  3FY1 A;  1BKF A;  1KFW A;  1GPF A;  1LJY A;  3WQW A;  2MPH A;  4TYO A;  2MF9 A;  3O5L A;  1FKR A;  4AY1 A;  3IKG A;  4LAX A;  5DIT A;  1HXV A;  2RQS A;  1WAW A;  1JNS A;  4W5U A;  2D9F A;  1W1Y A;  4ODL A;  1ITX A;  1FKF A;  1P5Q A;  1W9V A;  1D7J A;  1NMV A;  4WKA A;  1EHN A;  3NI6 A;  4PTM A;  4W9P A;  3KZ7 A;  2KFW A;  4J4O A;  1VF8 A;  2YBU A;  2B31 A;  3O5F A;  1H0G A;  2Q5A A;  5HUA A;  3UF8 A;  2ITK A;  2OLH A;  3NTP A;  4Z2K A;  2EUL A;  2QF8 A;  5HT1 A;  2KO7 A;  4URI A;  3CHD A;  3WL0 A;  3RFW A;  3ARO A;  2O92 A;  4FN2 A;  2G41 A;  3OOB A;  2MNT A;  2PN0 A;  1GOI A;  2A3B A;  2FDM A;  2DSV A;  1JND A;  1LG1 A;  3O5K A;  2XP3 A;  4HBE A;  3CH9 A;  1ZBV A;  2M08 A;  4P8X A;  1TCO C;  2A3A A;  1HKJ A;  2DPE A;  3WQV A;  1W9P A;  3ARV A;  1JNE A;  1F40 A;  1T11 A;  3OA5 A;  2A3E A;  4ODM A;  4KQZ A;  4S3J A;  1XRV A;  4QIB A;  3CZ8 A;  1FKJ A;  1KT0 A;  4ODK A;  3JYM A; 
#chains in the Genus database with same CATH homology
 4LAV A;  1W1T A;  3WD1 A;  2XP6 A;  3ALF A;  3O5E A;  4P8W A;  3KAI A;  1X6L A;  4GIV A;  4DRN A;  2XP5 A;  4KR0 B;  4G2P A;  2KR7 A;  4LAW A;  4Z2J A;  4Z2L A;  1PIN A;  1HKK A;  4WJX A;  1B6C A;  2M2A A;  1Y0O A;  4QT2 A;  4DT4 A;  2PPN A;  1J6Y A;  5D75 A;  1X6N A;  4MNM A;  1ZK6 A;  1E6Z A;  4Q22 A;  1NSG A;  1Q1C A;  4DRH A;  5JH8 A;  3O5O A;  3ARW A;  5HW8 A;  3O5P A;  2DSW A;  1Q6I A;  1QZ2 A;  2AWG A;  2VN1 A;  4WIW A;  1J4H A;  1D7I A;  1FKB A;  1HKI A;  3O5J A;  4QT3 A;  1JNT A;  5HWC A;  3PRA A;  4MNJ A;  3KAG A;  1SR0 A;  1FKK A;  4U85 A;  2DG9 A;  1NH6 A;  4ZPW R;  1OGG A;  4DWS B;  2WM0 A;  4WK9 A;  1A7X A;  4TNS A;  1E6P A;  1IX5 A;  1YW5 A;  2O9O A;  3WD3 A;  2Y78 A;  4LGX A;  4DH0 A;  1EYM A;  2ZQS A;  3KCE A;  5B8I C;  2MLY A;  3KAD A;  1XHG A;  1D2K A;  4ODP A;  1SYT A;  5DF0 A;  3ARY A;  4Q7N A;  2PBC A;  1UR9 A;  4JFM A;  5HKG A;  4IT6 A;  4TX0 A;  3AS0 A;  1ZBW A;  3ALG A;  4TW8 A;  3FXY A;  1W1V A;  4C02 B;  4WKF A;  1UR8 A;  2RSE A;  4JYS A;  5HTG A;  2XP4 A;  4DRQ A;  2PPP A;  1OGB A;  5J6E A;  4DRI A;  4R0X A;  4JFJ A;  1LQ0 A;  2JZV A;  4DRK A;  1EQ3 A;  2ZQV A;  4WKH A;  5GPR A;  4G50 A;  4ODO A;  1HKM A;  2XP9 A;  2L2S A;  4U86 A;  1TFV A;  2WK2 A;  2N87 A;  1FFQ A;  3AS1 A;  3VAW A;  5HWB A;  5DEZ A;  2DSZ A;  1FKT A;  1CTN A;  3TCZ A;  2KGJ A;  2ZR5 A;  1HJV A;  3KAC A;  4L3N A;  1Q6H A;  2F2D A;  4TW7 A;  3KAH A;  1O6I A;  1ROU A;  1FAP A;  1W26 A;  4IT4 A;  5DIV A;  3B9E A;  2WLY A;  4MPK A;  2DG3 A;  3IK8 A;  3O5Q A;  1HJW A;  2PV1 A;  1Q6U A;  1HJX A;  4DRJ A;  5I98 A;  3WD0 A;  2XP8 A;  4P8U A;  3JYJ A;  2F4E A;  1D6O A;  4ODN A;  1E9L A;  2XPA A;  3RME A;  4Z2I A;  1ROT A;  1KT1 A;  3O5G A;  2K8I A;  2RUC A;  4DWS D;  2FAP A;  1GUV A;  3NRK A;  3O5R A;  3WD4 A;  2RUD A;  3ARU A;  3ART A;  2PV3 A;  3WL1 A;  4ZS6 A;  2F21 A;  3PA7 A;  3TC5 A;  1LL6 A;  3WIJ A;  1N1A A;  2OFN A;  4LAY A;  4N19 A;  2PPO A;  1ZBC A;  2DT0 A;  1FFR A;  4ML4 A;  4JFI A;  3QOK A;  1YAT A;  1C9H A;  3CGM A;  3KAB A;  1FKD A;  3RGC A;  4BF8 A;  1OWQ A;  2PI6 A;  4ITZ A;  2ZQU A;  3WD2 A;  1ZB5 A;  4MNL A;  2RUR A;  4W9Q A;  2XP7 A;  2ZQT A;  3IHZ A;  2DT3 A;  4ZPV R;  1F8A B;  3I6C A;  3O5M A;  1LG2 A;  4DRP A;  1FKL A;  3ARZ A;  1ZU8 A;  2LGO A;  4ODQ A;  1FKG A;  1E6R A;  1R9H A;  4HBO A;  3CHF A;  3UQI A;  1W1P A;  1M5Y A;  3FAP A;  3B9A A;  4U84 A;  2AOS A;  4S3K A;  3ARS A;  1EDQ A;  4Z2H A;  1NWS A;  5BXJ A;  2KI3 A;  3G6M A;  4Z2G A;  4DRM A;  4JFL A;  3RM8 A;  2ESC A;  4NZC A;  3RM9 A;  3W4R A;  4MSP A;  3GPK A;  3WKZ A;  1RD6 A;  3B9D A;  4DZ2 A;  3O5I A;  3G6L A;  2KE0 A;  3RM4 A;  2IUZ A;  4MTV A;  4L72 B;  1L1P A;  1W9U A;  1NWR A;  3ARQ A;  3UI5 A;  4MAV A;  3CHC A;  2ZR4 A;  3CHE A;  1NMW A;  2LKN A;  2VCD A;  2XPB A;  3ARR A;  1ZCN A;  4DRO A;  4J4N A;  2ZR6 A;  2WLZ A;  1WB0 A;  4NSB A;  1D7H A;  3EY6 A;  1QPL A;  1PBK A;  2MLX A;  3UI4 A;  4DIP A;  5HW7 A;  1WNO A;  1FKH A;  1FKI A;  3H9R B;  3KAF A;  1H0I A;  3PRD A;  2MLZ A;  4DWS C;  1FJD A;  1BL4 A;  1NWU A;  2LJ4 A;  4XAK A;  4MNK A;  4R5E A;  3ODK A;  1JVW A;  4ZPT R;  4NNR A;  4IQ2 A;  3ARP A;  3MDY B;  2PV2 A;  3UI6 A;  1LL7 A;  4P8V A;  1NWT A;  3IKD A;  5GPG A;  3PR9 A;  4ODR A;  4IQC A;  3B8S A;  3CGN A;  1E15 A;  5DO2 A;  3O5D A;  1QPF A;  4IPX A;  4JFK A;  4DWS A;  2IF4 A;  1U79 A;  4GGQ A;  4W9O A;  2FKE A;  3WH0 A;  5HBF A;  1FD9 A;  1ZBK A;  3ARX A;  3AS2 A;  3LUO A;  2DT1 A;  4TW6 A;  1E6N A;  3AQU A;  1LL4 A;  4O2T A;  4QZV B;  2DSU A;  4HAR A;  4MGV A;  2DT2 A;  3UQA A;  5GQB A;  3JXV A;  3TDB A;  2DG4 A;  3AS3 A;  2G8Z A;  1ZL1 A;  2RUQ A;  4DZ3 A;  2YBT A;  3PRB A;  2LPV A;  2A3C A;  1EIB A;  1J4I A;  3BXW A;  1K9T A;  5DIU A;  1J4R A;  4FAP A;  2M1I A;  3B7X A;  5HW6 A;  2UZ5 A;  3UQB A;  1FKS A;  3FY1 A;  1BKF A;  1KFW A;  1GPF A;  1LJY A;  3WQW A;  2MPH A;  4TYO A;  2MF9 A;  3O5L A;  1FKR A;  4AY1 A;  3IKG A;  4LAX A;  5DIT A;  1HXV A;  2RQS A;  1WAW A;  1JNS A;  4W5U A;  2D9F A;  1W1Y A;  4ODL A;  1ITX A;  1FKF A;  1P5Q A;  1W9V A;  1D7J A;  1NMV A;  4WKA A;  1EHN A;  3NI6 A;  4PTM A;  4W9P A;  3KZ7 A;  2KFW A;  4J4O A;  1VF8 A;  2YBU A;  2B31 A;  3O5F A;  1H0G A;  2Q5A A;  5HUA A;  3UF8 A;  2ITK A;  2OLH A;  3NTP A;  4Z2K A;  2QF8 A;  5HT1 A;  2KO7 A;  4URI A;  3CHD A;  3WL0 A;  3RFW A;  3ARO A;  2O92 A;  4FN2 A;  2G41 A;  3OOB A;  2MNT A;  1GOI A;  2A3B A;  2FDM A;  2DSV A;  1JND A;  1LG1 A;  3O5K A;  2XP3 A;  4HBE A;  3CH9 A;  1ZBV A;  2M08 A;  4P8X A;  1TCO C;  2A3A A;  1HKJ A;  2DPE A;  3WQV A;  1W9P A;  3ARV A;  1JNE A;  1F40 A;  1T11 A;  3OA5 A;  2A3E A;  4ODM A;  4KQZ A;  4S3J A;  1XRV A;  4QIB A;  3CZ8 A;  1FKJ A;  1KT0 A;  4ODK A;  3JYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...