4TYOA

Ppiase in complex with a non-phosphate small molecule inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (III): Optimizing affinity beyond the phosphate recognition pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 38
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tyoA00
3IHZA 2XP8A 3JYJA 3IK8A 2LJ4A 3ODKA 4GGQA 4IQ2A 3WH0A 1FD9A 3UF8A 1Y0OA 4C02B 1A7XA 3RGCA 2PV1A 2RSEA 4LAYA 1FKHA 1Q6HA 3UQIA 2XPBA 1QPFA 2PBCA 1L1PA 3KADA 1F8AB 2MPHA 3IKGA 4ODNA 4W9PA 1HXVA 4JFKA 4W9OA 5HTGA 5I98A 3TC5A 4ITZA 4TNSA 1J6YA 1N1AA 2L2SA 1JVWA 2M1IA 5BXJA 1D6OA 1QZ2A 3O5KA 3O5RA 3JXVA 1KT0A 2DG9A 2MLZA 2XP9A 2ZR6A 1JNTA 2LPVA 5DIUA 4ODPA 2XP3A 5D75A 2KI3A 5HWBA 2LKNA 4LAWA 2RQSA 3O5JA 2VCDA 1FKLA 4GIVA 1P5QA 2Y78A 3MDYB 4JFMA 1Q6IA 3KAHA 4QT3A 4MSPA 1NMVA 2PPNA 2XP6A 1J4IA 1T11A 4QT2A 3RFWA 2KR7A 4DT4A 3B7XA 1FKRA 1FAPA 5HKGA 2PPOA 2VN1A 2K8IA 2IF4A 4JFJA 3O5IA 4ODKA 4TW7A 4DROA 3KABA 5HW6A 3TCZA 4LAVA 3UQAA 4DRJA 1D7IA 4QIBA 3GPKA 5B8IC 4ODOA 4DRIA 1FKFA 2F21A 1FKIA 2MLXA 2KE0A 1ZCNA 3TDBA 2MF9A 1FKJA 1J4RA 3KAFA 2PV3A 1B6CA 2Q5AA 3KAGA 4DZ3A 3O5EA 4IQCA 4W9QA 1U79A 5HUAA 4ODLA 1C9HA 2JZVA 4O2TA 1PINA 2DG4A 2ZQVA 3EY6A 1YW5A 3NI6A 4J4NA 4LAXA 4BF8A 4DRPA 2UZ5A 3I6CA 2XP4A 4MGVA 4TX0A 1FKKA 1FKDA 1KT1A 4DRMA 3OOBA 3O5GA 4U85A 1TCOC 5J6EA 3O5MA 1FKGA 4DRKA 4G50A 4N19A 4ODMA 1JNSA 3VAWA 2FAPA 3JYMA 3H9RB 1EYMA 1NSGA 3UI5A 2LGOA 4DIPA 3O5OA 4ODRA 2PV2A 4DRQA 4JFLA 5HT1A 1ROTA 2ZQSA 3KZ7A 3O5DA 3CGNA 5DIVA 4ODQA 1D7HA 5DITA 1FKBA 3IKDA 1FKSA 1D7JA 2KO7A 3O5FA 2M08A 2ITKA 1M5YA 3NTPA 2RUQA 2ZR4A 3O5PA 4DH0A 2ZQUA 3NRKA 1NMWA 3O5QA 2M2AA 3UI4A 4IPXA 1PBKA 5HWCA 1QPLA 2FKEA 4DRHA 2RURA 2XPAA 4DRNA 1W26A 3KACA 3KCEA 5HW7A 2ZQTA 4DZ2A 3UQBA 4J4OA 1FKTA 1ZK6A 2F2DA 4TW8A 1ROUA 4R0XA 4TW6A 4JFIA 4JYSA 3O5LA 3KAIA 2AWGA 2MLYA 3LUOA 4NNRA 1Q6UA 2RUCA 4U84A 2KGJA 2N87A 3FAPA 2F4EA 4FN2A 4TYOA 1R9HA 1FJDA 3PRBA 1Q1CA 1BL4A 2ZR5A 3PA7A 4U86A 1BKFA 5GPGA 2D9FA 1EQ3A 2MNTA 1F40A 3UI6A 2OFNA 1J4HA 3CGMA 2RUDA 2XP7A 4FAPA 5HW8A 1YATA 4G2PA 3PRDA 2XP5A 2DG3A 2PPPA 2KFWA
chains in the Genus database with same CATH superfamily
3GTYX 1FFRA 3IK8A 3WH0A 1Y0OA 4C02B 3AROA 2RSEA 2XPBA 3KADA 1F8AB 4W9PA 1HXVA 4WJXA 4W9OA 4TNSA 3WD0A 3WD2A 4WKFA 4URIA 5BXJA 1D6OA 3O5KA 2PI6A 2DG9A 2MLZA 2ZR6A 2LPVA 4ODPA 2XP3A 4LAWA 2RQSA 2VCDA 2Y78A 2G8ZA 1Q6IA 4MSPA 2DSUA 2IF4A 1ZBWA 4S3KA 1FKFA 1NH6A 4HARA 2PN0A 2KE0A 1ZCNA 3CHCA 2Q5AA 3O5EA 1GUVA 4IQCA 4W9QA 3WKZA 4ODLA 1C9HA 1ZL1A 2JZVA 4J4NA 2WM0A 2ZQVA 3NI6A 3I6CA 4TX0A 1W9VA 4WKAA 4U85A 2WLZA 5J6EA 3O5MA 4G50A 4N19A 4ODMA 1JNSA 1HJVA 3JYMA 4DWSD 4ODRA 3RM9A 1ROTA 2ZQSA 1O6IA 4ODQA 5DITA 1FKBA 1FKSA 5GPRA 2M08A 3WQWA 1W1VA 3O5QA 1PBKA 1XRVA 5HWCA 1XHGA 2FKEA 1OGBA 1UR9A 2RURA 1W26A 5HW7A 4Z2KA 4DZ2A 1FKTA 1LQ0A 1ROUA 3KAIA 4MPKA 3LUOA 4Z2JA 4W5UA 1FJDA 4TYOA 2ETNA 4Q22A 3PA7A 4U86A 1EQ3A 1F40A 1H0GA 3UI6A 2RUDA 4KQZA 1E15A 2PPPA 2KFWA 3ARWA 4IQ2A 1FD9A 3RGCA 2PV1A 4LAYA 1FKHA 2WLYA 1L1PA 4ITZA 2L2SA 3ARXA 2M1IA 1QZ2A 3O5RA 2XP9A 3ARQA 3AS2A 5DIUA 4AY1A 3WL1A 3ALGA 3CZ8A 4GIVA 1P5QA 1LL7A 4DWSA 4DT4A 3B7XA 3WD4A 1FAPA 1OGGA 1EHNA 2VN1A 4JFJA 4TW7A 4DROA 3ARSA 5JH8A 3UQAA 4DRJA 5DEZA 3GPKA 4ODOA 2DT1A 2DT0A 2F21A 3CHFA 2MLXA 2B31A 2ESCA 3TDBA 1NWTA 2MF9A 1J4RA 3KAFA 3KAGA 1B6CA 4P8VA 3AS3A 4MNKA 2DG4A 4DRPA 5HW6A 2B5UB 2XP4A 1FKDA 3O5GA 1TCOC 4ZS6A 1JNEA 1HKKA 3VAWA 3UI5A 1NSGA 4DIPA 4WKHA 4DRQA 1E6PA 4KR0B 3ARRA 3O5DA 3CGNA 3PRAA 5DIVA 1D7HA 2YBUA 1HKMA 4S3JA 3O5FA 1M5YA 4QZVB 1ZBVA 3CHEA 4LGXA 3RM4A 1W9UA 1WNOA 4ZPVR 2ZQTA 4XAKA 1ZK6A 3QOKA 4HBEA 4TW6A 4JFIA 1FFQA 4NZCA 2AWGA 3CHDA 3FXYA 3ARVA 2RUCA 1SR0A 2KGJA 2O9OA 4DWSB 1R9HA 2IUZA 2ZR5A 1BKFA 4WIWA 2MNTA 2DT3A 5DF0A 4L72B 1E6RA 1ZU8A 4MNJA 3ARPA 4G2PA 4P8WA 2XP5A 3IHZA 2XP8A 2LJ4A 1ITXA 1A7XA 1RD6A 1JNDA 1Q6HA 1QPFA 2PBCA 3GU0A 2MPHA 3IKGA 4ODNA 3WD1A 4JFKA 5I98A 3TC5A 1N1AA 4IT4A 3BMBA 1GPFA 4Q7NA 2KI3A 1GRJA 3O5JA 2DSWA 1X6NA 2A3BA 3B8SA 4JFMA 3KAHA 4QT3A 3RFWA 1NMVA 2PPNA 2XP6A 4HBOA 4QT2A 2KR7A 1FKRA 2K8IA 1W1PA 5DO2A 1H0IA 3KABA 3TCZA 1SYTA 1W1TA 1D7IA 2DSZA 4ZPTR 4DRIA 1EDQA 2F23A 1HJWA 4DZ3A 5HWBA 1FKJA 1TFVA 2P4VA 1NWSA 1PINA 1E9LA 3EY6A 1YW5A 2UZ5A 1KT1A 1WB0A 1K9TA 1FKGA 3OA5A 3H9RB 1EYMA 4L3NA 2LGOA 1KFWA 4JFLA 5HT1A 3G6LA 4MAVA 3KZ7A 4ML4A 4Z2HA 1D2KA 1D7JA 3ARZA 2KO7A 4P8XA 2FDMA 2RUQA 2ZR4A 4DH0A 4DWSC 2M2AA 3AS1A 3UI4A 1QPLA 4DRHA 1GOIA 1W9PA 4DRNA 2A3CA 3KCEA 1LJYA 3UQBA 4J4OA 2F2DA 4R0XA 3CH9A 4MNLA 2QF8A 3ARTA 4NNRA 1Q6UA 4U84A 3RMEA 2N87A 2F4EA 1ZBCA 4Z2GA 1NWUA 5GPGA 1LG1A 2D9FA 1J4HA 2G41A 4PTMA 2XP7A 4FAPA 5HW8A 1HJXA 1YATA 3PRDA 2OLHA 3B9EA 2DG3A 4P8UA 4GGQA 1UR8A 3JYJA 3ODKA 3UF8A 3B9DA 3UQIA 4ZPWR 1IX5A 4MNMA 4R5EA 5HTGA 1J6YA 1JVWA 4NSBA 3JXVA 1KT0A 1CTNA 1HKJA 2WK2A 1E6ZA 1JNTA 3W4RA 2DPEA 5D75A 2LKNA 1FKLA 3RM8A 4Z2LA 3MDYB 1HKIA 3FY1A 1J4IA 1T11A 5HBFA 2DT2A 5HKGA 2PPOA 3WIJA 1ZB5A 3O5IA 4ODKA 1VF8A 4LAVA 1OWQA 4IT6A 4QIBA 5B8IC 1FKIA 3WD3A 2PV3A 3B9AA 3BXWA 1U79A 5HUAA 4O2TA 4LAXA 4BF8A 4MTVA 1E44A 1WAWA 1FKKA 4MGVA 4DRMA 3OOBA 1JCHB 4DRKA 1E6NA 2FAPA 2A3AA 4UDMA 3O5OA 2PV2A 2EULA 3ARYA 3AQUA 2AOSA 1W1YA 1NWRA 1LG2A 3IKDA 3WQVA 1LL4A 3EIPA 2ITKA 3NTPA 3O5PA 3AS0A 2ZQUA 3NRKA 2A3EA 1X6LA 4IPXA 1EIBA 2XPAA 3KACA 4TW8A 3WL0A 1ZBKA 3O5LA 4JYSA 2MLYA 4WK9A 3PR9A 3FAPA 4FN2A 2O92A 3G6MA 3PRBA 1Q1CA 1BL4A 3ALFA 1LL6A 2OFNA 3CGMA 2DSVA 5GQBA 3ARUA 4Z2IA 2YBTA 1NMWA
chains in the Genus database with same CATH topology
1FFRA 3IK8A 3WH0A 1Y0OA 4C02B 3AROA 2RSEA 2XPBA 3KADA 1F8AB 4W9PA 1HXVA 4WJXA 4W9OA 4TNSA 3WD0A 3WD2A 4WKFA 4URIA 5BXJA 1D6OA 3O5KA 2PI6A 2DG9A 2MLZA 2ZR6A 2LPVA 4ODPA 2XP3A 4LAWA 2RQSA 2VCDA 2Y78A 2G8ZA 1Q6IA 4MSPA 2DSUA 2IF4A 1ZBWA 4S3KA 1FKFA 1NH6A 4HARA 2KE0A 1ZCNA 3CHCA 2Q5AA 3O5EA 1GUVA 4IQCA 4W9QA 3WKZA 4ODLA 1C9HA 1ZL1A 2JZVA 4J4NA 2WM0A 2ZQVA 3NI6A 3I6CA 4TX0A 1W9VA 4WKAA 4U85A 2WLZA 5J6EA 3O5MA 4G50A 4N19A 4ODMA 1JNSA 1HJVA 3JYMA 4DWSD 4ODRA 3RM9A 1ROTA 2ZQSA 1O6IA 4ODQA 5DITA 1FKBA 1FKSA 5GPRA 2M08A 3WQWA 1W1VA 3O5QA 1PBKA 1XRVA 5HWCA 1XHGA 2FKEA 1OGBA 1UR9A 2RURA 1W26A 5HW7A 4Z2KA 4DZ2A 1FKTA 1LQ0A 1ROUA 3KAIA 4MPKA 3LUOA 4Z2JA 4W5UA 1FJDA 4TYOA 4Q22A 3PA7A 4U86A 1EQ3A 1F40A 1H0GA 3UI6A 2RUDA 4KQZA 1E15A 2PPPA 2KFWA 3ARWA 4IQ2A 1FD9A 3RGCA 2PV1A 4LAYA 1FKHA 2WLYA 1L1PA 4ITZA 2L2SA 3ARXA 2M1IA 1QZ2A 3O5RA 2XP9A 3ARQA 3AS2A 5DIUA 4AY1A 3WL1A 3ALGA 3CZ8A 4GIVA 1P5QA 1LL7A 4DWSA 4DT4A 3B7XA 3WD4A 1FAPA 1OGGA 1EHNA 2VN1A 4JFJA 4TW7A 4DROA 3ARSA 5JH8A 3UQAA 4DRJA 5DEZA 3GPKA 4ODOA 2DT1A 2DT0A 2F21A 3CHFA 2MLXA 2B31A 2ESCA 3TDBA 1NWTA 2MF9A 1J4RA 3KAFA 3KAGA 1B6CA 4P8VA 3AS3A 4MNKA 2DG4A 4DRPA 5HW6A 2XP4A 1FKDA 3O5GA 1TCOC 4ZS6A 1JNEA 1HKKA 3VAWA 3UI5A 1NSGA 4DIPA 4WKHA 4DRQA 1E6PA 4KR0B 3ARRA 3O5DA 3CGNA 3PRAA 5DIVA 1D7HA 2YBUA 1HKMA 4S3JA 3O5FA 1M5YA 4QZVB 1ZBVA 3CHEA 4LGXA 3RM4A 1W9UA 1WNOA 4ZPVR 2ZQTA 4XAKA 1ZK6A 3QOKA 4HBEA 4TW6A 4JFIA 1FFQA 4NZCA 2AWGA 3CHDA 3FXYA 3ARVA 2RUCA 1SR0A 2KGJA 2O9OA 4DWSB 1R9HA 2IUZA 2ZR5A 1BKFA 4WIWA 2MNTA 2DT3A 5DF0A 4L72B 1E6RA 1ZU8A 4MNJA 3ARPA 4G2PA 4P8WA 2XP5A 3IHZA 2XP8A 2LJ4A 1ITXA 1A7XA 1RD6A 1JNDA 1Q6HA 1QPFA 2PBCA 2MPHA 3IKGA 4ODNA 3WD1A 4JFKA 5I98A 3TC5A 1N1AA 4IT4A 1GPFA 4Q7NA 2KI3A 3O5JA 2DSWA 1X6NA 2A3BA 3B8SA 4JFMA 3KAHA 4QT3A 3RFWA 1NMVA 2PPNA 2XP6A 4HBOA 4QT2A 2KR7A 1FKRA 2K8IA 1W1PA 5DO2A 1H0IA 3KABA 3TCZA 1SYTA 1W1TA 1D7IA 2DSZA 4ZPTR 4DRIA 1EDQA 1HJWA 4DZ3A 5HWBA 1FKJA 1TFVA 1NWSA 1PINA 1E9LA 3EY6A 1YW5A 2UZ5A 1KT1A 1WB0A 1K9TA 1FKGA 3OA5A 3H9RB 1EYMA 4L3NA 2LGOA 1KFWA 4JFLA 5HT1A 3G6LA 4MAVA 3KZ7A 4ML4A 4Z2HA 1D2KA 1D7JA 3ARZA 2KO7A 4P8XA 2FDMA 2RUQA 2ZR4A 4DH0A 4DWSC 2M2AA 3AS1A 3UI4A 1QPLA 4DRHA 1GOIA 1W9PA 4DRNA 2A3CA 3KCEA 1LJYA 3UQBA 4J4OA 2F2DA 4R0XA 3CH9A 4MNLA 2QF8A 3ARTA 4NNRA 1Q6UA 4U84A 3RMEA 2N87A 2F4EA 1ZBCA 4Z2GA 1NWUA 5GPGA 1LG1A 2D9FA 1J4HA 2G41A 4PTMA 2XP7A 4FAPA 5HW8A 1HJXA 1YATA 3PRDA 2OLHA 3B9EA 2DG3A 4P8UA 4GGQA 1UR8A 3JYJA 3ODKA 3UF8A 3B9DA 3UQIA 4ZPWR 1IX5A 4MNMA 4R5EA 5HTGA 1J6YA 1JVWA 4NSBA 3JXVA 1KT0A 1CTNA 1HKJA 2WK2A 1E6ZA 1JNTA 3W4RA 2DPEA 5D75A 2LKNA 1FKLA 3RM8A 4Z2LA 3MDYB 1HKIA 3FY1A 1J4IA 1T11A 5HBFA 2DT2A 5HKGA 2PPOA 3WIJA 1ZB5A 3O5IA 4ODKA 1VF8A 4LAVA 1OWQA 4IT6A 4QIBA 5B8IC 1FKIA 3WD3A 2PV3A 3B9AA 3BXWA 1U79A 5HUAA 4O2TA 4LAXA 4BF8A 4MTVA 1WAWA 4MGVA 1FKKA 4DRMA 3OOBA 4DRKA 1E6NA 2FAPA 2A3AA 3O5OA 2PV2A 3ARYA 3AQUA 2AOSA 1W1YA 1NWRA 1LG2A 3IKDA 3WQVA 1LL4A 2ITKA 3NTPA 3O5PA 3AS0A 2ZQUA 3NRKA 2A3EA 1X6LA 4IPXA 1EIBA 2XPAA 3KACA 4TW8A 3WL0A 1ZBKA 3O5LA 4JYSA 2MLYA 4WK9A 3PR9A 3FAPA 4FN2A 2O92A 3G6MA 3PRBA 1Q1CA 1BL4A 3ALFA 1LL6A 2OFNA 3CGMA 2DSVA 5GQBA 3ARUA 4Z2IA 2YBTA 1NMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHZ A;  2XP8 A;  3JYJ A;  3IK8 A;  2LJ4 A;  3ODK A;  4GGQ A;  4IQ2 A;  3WH0 A;  1FD9 A;  3UF8 A;  1Y0O A;  4C02 B;  1A7X A;  3RGC A;  2PV1 A;  2RSE A;  4LAY A;  1FKH A;  1Q6H A;  3UQI A;  2XPB A;  1QPF A;  2PBC A;  1L1P A;  3KAD A;  1F8A B;  2MPH A;  3IKG A;  4ODN A;  4W9P A;  1HXV A;  4JFK A;  4W9O A;  5HTG A;  5I98 A;  3TC5 A;  4ITZ A;  4TNS A;  1J6Y A;  1N1A A;  2L2S A;  1JVW A;  2M1I A;  5BXJ A;  1D6O A;  1QZ2 A;  3O5K A;  3O5R A;  3JXV A;  1KT0 A;  2DG9 A;  2MLZ A;  2XP9 A;  2ZR6 A;  1JNT A;  2LPV A;  5DIU A;  4ODP A;  2XP3 A;  5D75 A;  2KI3 A;  5HWB A;  2LKN A;  4LAW A;  2RQS A;  3O5J A;  2VCD A;  1FKL A;  4GIV A;  1P5Q A;  2Y78 A;  3MDY B;  4JFM A;  1Q6I A;  3KAH A;  4QT3 A;  4MSP A;  1NMV A;  2PPN A;  2XP6 A;  1J4I A;  1T11 A;  4QT2 A;  3RFW A;  2KR7 A;  4DT4 A;  3B7X A;  1FKR A;  1FAP A;  5HKG A;  2PPO A;  2VN1 A;  2K8I A;  2IF4 A;  4JFJ A;  3O5I A;  4ODK A;  4TW7 A;  4DRO A;  3KAB A;  5HW6 A;  3TCZ A;  4LAV A;  3UQA A;  4DRJ A;  1D7I A;  4QIB A;  3GPK A;  5B8I C;  4ODO A;  4DRI A;  1FKF A;  2F21 A;  1FKI A;  2MLX A;  2KE0 A;  1ZCN A;  3TDB A;  2MF9 A;  1FKJ A;  1J4R A;  3KAF A;  2PV3 A;  1B6C A;  2Q5A A;  3KAG A;  4DZ3 A;  3O5E A;  4IQC A;  4W9Q A;  1U79 A;  5HUA A;  4ODL A;  1C9H A;  2JZV A;  4O2T A;  1PIN A;  2DG4 A;  2ZQV A;  3EY6 A;  1YW5 A;  3NI6 A;  4J4N A;  4LAX A;  4BF8 A;  4DRP A;  2UZ5 A;  3I6C A;  2XP4 A;  4MGV A;  4TX0 A;  1FKK A;  1FKD A;  1KT1 A;  4DRM A;  3OOB A;  3O5G A;  4U85 A;  1TCO C;  5J6E A;  3O5M A;  1FKG A;  4DRK A;  4G50 A;  4N19 A;  4ODM A;  1JNS A;  3VAW A;  2FAP A;  3JYM A;  3H9R B;  1EYM A;  1NSG A;  3UI5 A;  2LGO A;  4DIP A;  3O5O A;  4ODR A;  2PV2 A;  4DRQ A;  4JFL A;  5HT1 A;  1ROT A;  2ZQS A;  3KZ7 A;  3O5D A;  3CGN A;  5DIV A;  4ODQ A;  1D7H A;  5DIT A;  1FKB A;  3IKD A;  1FKS A;  1D7J A;  2KO7 A;  3O5F A;  2M08 A;  2ITK A;  1M5Y A;  3NTP A;  2RUQ A;  2ZR4 A;  3O5P A;  4DH0 A;  2ZQU A;  3NRK A;  1NMW A;  3O5Q A;  2M2A A;  3UI4 A;  4IPX A;  1PBK A;  5HWC A;  1QPL A;  2FKE A;  4DRH A;  2RUR A;  2XPA A;  4DRN A;  1W26 A;  3KAC A;  3KCE A;  5HW7 A;  2ZQT A;  4DZ2 A;  3UQB A;  4J4O A;  1FKT A;  1ZK6 A;  2F2D A;  4TW8 A;  1ROU A;  4R0X A;  4TW6 A;  4JFI A;  4JYS A;  3O5L A;  3KAI A;  2AWG A;  2MLY A;  3LUO A;  4NNR A;  1Q6U A;  2RUC A;  4U84 A;  2KGJ A;  2N87 A;  3FAP A;  2F4E A;  4FN2 A;  4TYO A;  1R9H A;  1FJD A;  3PRB A;  1Q1C A;  1BL4 A;  2ZR5 A;  3PA7 A;  4U86 A;  1BKF A;  5GPG A;  2D9F A;  1EQ3 A;  2MNT A;  1F40 A;  3UI6 A;  2OFN A;  1J4H A;  3CGM A;  2RUD A;  2XP7 A;  4FAP A;  5HW8 A;  1YAT A;  4G2P A;  3PRD A;  2XP5 A;  2DG3 A;  2PPP A;  2KFW A; 
#chains in the Genus database with same CATH topology
 3GTY X;  1FFR A;  3IK8 A;  3WH0 A;  1Y0O A;  4C02 B;  3ARO A;  2RSE A;  2XPB A;  3KAD A;  1F8A B;  4W9P A;  1HXV A;  4WJX A;  4W9O A;  4TNS A;  3WD0 A;  3WD2 A;  4WKF A;  4URI A;  5BXJ A;  1D6O A;  3O5K A;  2PI6 A;  2DG9 A;  2MLZ A;  2ZR6 A;  2LPV A;  4ODP A;  2XP3 A;  4LAW A;  2RQS A;  2VCD A;  2Y78 A;  2G8Z A;  1Q6I A;  4MSP A;  2DSU A;  2IF4 A;  1ZBW A;  4S3K A;  1FKF A;  1NH6 A;  4HAR A;  2PN0 A;  2KE0 A;  1ZCN A;  3CHC A;  2Q5A A;  3O5E A;  1GUV A;  4IQC A;  4W9Q A;  3WKZ A;  4ODL A;  1C9H A;  1ZL1 A;  2JZV A;  4J4N A;  2WM0 A;  2ZQV A;  3NI6 A;  3I6C A;  4TX0 A;  1W9V A;  4WKA A;  4U85 A;  2WLZ A;  5J6E A;  3O5M A;  4G50 A;  4N19 A;  4ODM A;  1JNS A;  1HJV A;  3JYM A;  4DWS D;  4ODR A;  3RM9 A;  1ROT A;  2ZQS A;  1O6I A;  4ODQ A;  5DIT A;  1FKB A;  1FKS A;  5GPR A;  2M08 A;  3WQW A;  1W1V A;  3O5Q A;  1PBK A;  1XRV A;  5HWC A;  1XHG A;  2FKE A;  1OGB A;  1UR9 A;  2RUR A;  1W26 A;  5HW7 A;  4Z2K A;  4DZ2 A;  1FKT A;  1LQ0 A;  1ROU A;  3KAI A;  4MPK A;  3LUO A;  4Z2J A;  4W5U A;  1FJD A;  4TYO A;  2ETN A;  4Q22 A;  3PA7 A;  4U86 A;  1EQ3 A;  1F40 A;  1H0G A;  3UI6 A;  2RUD A;  4KQZ A;  1E15 A;  2PPP A;  2KFW A;  3ARW A;  4IQ2 A;  1FD9 A;  3RGC A;  2PV1 A;  4LAY A;  1FKH A;  2WLY A;  1L1P A;  4ITZ A;  2L2S A;  3ARX A;  2M1I A;  1QZ2 A;  3O5R A;  2XP9 A;  3ARQ A;  3AS2 A;  5DIU A;  4AY1 A;  3WL1 A;  3ALG A;  3CZ8 A;  4GIV A;  1P5Q A;  1LL7 A;  4DWS A;  4DT4 A;  3B7X A;  3WD4 A;  1FAP A;  1OGG A;  1EHN A;  2VN1 A;  4JFJ A;  4TW7 A;  4DRO A;  3ARS A;  5JH8 A;  3UQA A;  4DRJ A;  5DEZ A;  3GPK A;  4ODO A;  2DT1 A;  2DT0 A;  2F21 A;  3CHF A;  2MLX A;  2B31 A;  2ESC A;  3TDB A;  1NWT A;  2MF9 A;  1J4R A;  3KAF A;  3KAG A;  1B6C A;  4P8V A;  3AS3 A;  4MNK A;  2DG4 A;  4DRP A;  5HW6 A;  2B5U B;  2XP4 A;  1FKD A;  3O5G A;  1TCO C;  4ZS6 A;  1JNE A;  1HKK A;  3VAW A;  3UI5 A;  1NSG A;  4DIP A;  4WKH A;  4DRQ A;  1E6P A;  4KR0 B;  3ARR A;  3O5D A;  3CGN A;  3PRA A;  5DIV A;  1D7H A;  2YBU A;  1HKM A;  4S3J A;  3O5F A;  1M5Y A;  4QZV B;  1ZBV A;  3CHE A;  4LGX A;  3RM4 A;  1W9U A;  1WNO A;  4ZPV R;  2ZQT A;  4XAK A;  1ZK6 A;  3QOK A;  4HBE A;  4TW6 A;  4JFI A;  1FFQ A;  4NZC A;  2AWG A;  3CHD A;  3FXY A;  3ARV A;  2RUC A;  1SR0 A;  2KGJ A;  2O9O A;  4DWS B;  1R9H A;  2IUZ A;  2ZR5 A;  1BKF A;  4WIW A;  2MNT A;  2DT3 A;  5DF0 A;  4L72 B;  1E6R A;  1ZU8 A;  4MNJ A;  3ARP A;  4G2P A;  4P8W A;  2XP5 A;  3IHZ A;  2XP8 A;  2LJ4 A;  1ITX A;  1A7X A;  1RD6 A;  1JND A;  1Q6H A;  1QPF A;  2PBC A;  3GU0 A;  2MPH A;  3IKG A;  4ODN A;  3WD1 A;  4JFK A;  5I98 A;  3TC5 A;  1N1A A;  4IT4 A;  3BMB A;  1GPF A;  4Q7N A;  2KI3 A;  1GRJ A;  3O5J A;  2DSW A;  1X6N A;  2A3B A;  3B8S A;  4JFM A;  3KAH A;  4QT3 A;  3RFW A;  1NMV A;  2PPN A;  2XP6 A;  4HBO A;  4QT2 A;  2KR7 A;  1FKR A;  2K8I A;  1W1P A;  5DO2 A;  1H0I A;  3KAB A;  3TCZ A;  1SYT A;  1W1T A;  1D7I A;  2DSZ A;  4ZPT R;  4DRI A;  1EDQ A;  2F23 A;  1HJW A;  4DZ3 A;  5HWB A;  1FKJ A;  1TFV A;  2P4V A;  1NWS A;  1PIN A;  1E9L A;  3EY6 A;  1YW5 A;  2UZ5 A;  1KT1 A;  1WB0 A;  1K9T A;  1FKG A;  3OA5 A;  3H9R B;  1EYM A;  4L3N A;  2LGO A;  1KFW A;  4JFL A;  5HT1 A;  3G6L A;  4MAV A;  3KZ7 A;  4ML4 A;  4Z2H A;  1D2K A;  1D7J A;  3ARZ A;  2KO7 A;  4P8X A;  2FDM A;  2RUQ A;  2ZR4 A;  4DH0 A;  4DWS C;  2M2A A;  3AS1 A;  3UI4 A;  1QPL A;  4DRH A;  1GOI A;  1W9P A;  4DRN A;  2A3C A;  3KCE A;  1LJY A;  3UQB A;  4J4O A;  2F2D A;  4R0X A;  3CH9 A;  4MNL A;  2QF8 A;  3ART A;  4NNR A;  1Q6U A;  4U84 A;  3RME A;  2N87 A;  2F4E A;  1ZBC A;  4Z2G A;  1NWU A;  5GPG A;  1LG1 A;  2D9F A;  1J4H A;  2G41 A;  4PTM A;  2XP7 A;  4FAP A;  5HW8 A;  1HJX A;  1YAT A;  3PRD A;  2OLH A;  3B9E A;  2DG3 A;  4P8U A;  4GGQ A;  1UR8 A;  3JYJ A;  3ODK A;  3UF8 A;  3B9D A;  3UQI A;  4ZPW R;  1IX5 A;  4MNM A;  4R5E A;  5HTG A;  1J6Y A;  1JVW A;  4NSB A;  3JXV A;  1KT0 A;  1CTN A;  1HKJ A;  2WK2 A;  1E6Z A;  1JNT A;  3W4R A;  2DPE A;  5D75 A;  2LKN A;  1FKL A;  3RM8 A;  4Z2L A;  3MDY B;  1HKI A;  3FY1 A;  1J4I A;  1T11 A;  5HBF A;  2DT2 A;  5HKG A;  2PPO A;  3WIJ A;  1ZB5 A;  3O5I A;  4ODK A;  1VF8 A;  4LAV A;  1OWQ A;  4IT6 A;  4QIB A;  5B8I C;  1FKI A;  3WD3 A;  2PV3 A;  3B9A A;  3BXW A;  1U79 A;  5HUA A;  4O2T A;  4LAX A;  4BF8 A;  4MTV A;  1E44 A;  1WAW A;  1FKK A;  4MGV A;  4DRM A;  3OOB A;  1JCH B;  4DRK A;  1E6N A;  2FAP A;  2A3A A;  4UDM A;  3O5O A;  2PV2 A;  2EUL A;  3ARY A;  3AQU A;  2AOS A;  1W1Y A;  1NWR A;  1LG2 A;  3IKD A;  3WQV A;  1LL4 A;  3EIP A;  2ITK A;  3NTP A;  3O5P A;  3AS0 A;  2ZQU A;  3NRK A;  2A3E A;  1X6L A;  4IPX A;  1EIB A;  2XPA A;  3KAC A;  4TW8 A;  3WL0 A;  1ZBK A;  3O5L A;  4JYS A;  2MLY A;  4WK9 A;  3PR9 A;  3FAP A;  4FN2 A;  2O92 A;  3G6M A;  3PRB A;  1Q1C A;  1BL4 A;  3ALF A;  1LL6 A;  2OFN A;  3CGM A;  2DSV A;  5GQB A;  3ARU A;  4Z2I A;  2YBT A;  1NMW A; 
#chains in the Genus database with same CATH homology
 1FFR A;  3IK8 A;  3WH0 A;  1Y0O A;  4C02 B;  3ARO A;  2RSE A;  2XPB A;  3KAD A;  1F8A B;  4W9P A;  1HXV A;  4WJX A;  4W9O A;  4TNS A;  3WD0 A;  3WD2 A;  4WKF A;  4URI A;  5BXJ A;  1D6O A;  3O5K A;  2PI6 A;  2DG9 A;  2MLZ A;  2ZR6 A;  2LPV A;  4ODP A;  2XP3 A;  4LAW A;  2RQS A;  2VCD A;  2Y78 A;  2G8Z A;  1Q6I A;  4MSP A;  2DSU A;  2IF4 A;  1ZBW A;  4S3K A;  1FKF A;  1NH6 A;  4HAR A;  2KE0 A;  1ZCN A;  3CHC A;  2Q5A A;  3O5E A;  1GUV A;  4IQC A;  4W9Q A;  3WKZ A;  4ODL A;  1C9H A;  1ZL1 A;  2JZV A;  4J4N A;  2WM0 A;  2ZQV A;  3NI6 A;  3I6C A;  4TX0 A;  1W9V A;  4WKA A;  4U85 A;  2WLZ A;  5J6E A;  3O5M A;  4G50 A;  4N19 A;  4ODM A;  1JNS A;  1HJV A;  3JYM A;  4DWS D;  4ODR A;  3RM9 A;  1ROT A;  2ZQS A;  1O6I A;  4ODQ A;  5DIT A;  1FKB A;  1FKS A;  5GPR A;  2M08 A;  3WQW A;  1W1V A;  3O5Q A;  1PBK A;  1XRV A;  5HWC A;  1XHG A;  2FKE A;  1OGB A;  1UR9 A;  2RUR A;  1W26 A;  5HW7 A;  4Z2K A;  4DZ2 A;  1FKT A;  1LQ0 A;  1ROU A;  3KAI A;  4MPK A;  3LUO A;  4Z2J A;  4W5U A;  1FJD A;  4TYO A;  4Q22 A;  3PA7 A;  4U86 A;  1EQ3 A;  1F40 A;  1H0G A;  3UI6 A;  2RUD A;  4KQZ A;  1E15 A;  2PPP A;  2KFW A;  3ARW A;  4IQ2 A;  1FD9 A;  3RGC A;  2PV1 A;  4LAY A;  1FKH A;  2WLY A;  1L1P A;  4ITZ A;  2L2S A;  3ARX A;  2M1I A;  1QZ2 A;  3O5R A;  2XP9 A;  3ARQ A;  3AS2 A;  5DIU A;  4AY1 A;  3WL1 A;  3ALG A;  3CZ8 A;  4GIV A;  1P5Q A;  1LL7 A;  4DWS A;  4DT4 A;  3B7X A;  3WD4 A;  1FAP A;  1OGG A;  1EHN A;  2VN1 A;  4JFJ A;  4TW7 A;  4DRO A;  3ARS A;  5JH8 A;  3UQA A;  4DRJ A;  5DEZ A;  3GPK A;  4ODO A;  2DT1 A;  2DT0 A;  2F21 A;  3CHF A;  2MLX A;  2B31 A;  2ESC A;  3TDB A;  1NWT A;  2MF9 A;  1J4R A;  3KAF A;  3KAG A;  1B6C A;  4P8V A;  3AS3 A;  4MNK A;  2DG4 A;  4DRP A;  5HW6 A;  2XP4 A;  1FKD A;  3O5G A;  1TCO C;  4ZS6 A;  1JNE A;  1HKK A;  3VAW A;  3UI5 A;  1NSG A;  4DIP A;  4WKH A;  4DRQ A;  1E6P A;  4KR0 B;  3ARR A;  3O5D A;  3CGN A;  3PRA A;  5DIV A;  1D7H A;  2YBU A;  1HKM A;  4S3J A;  3O5F A;  1M5Y A;  4QZV B;  1ZBV A;  3CHE A;  4LGX A;  3RM4 A;  1W9U A;  1WNO A;  4ZPV R;  2ZQT A;  4XAK A;  1ZK6 A;  3QOK A;  4HBE A;  4TW6 A;  4JFI A;  1FFQ A;  4NZC A;  2AWG A;  3CHD A;  3FXY A;  3ARV A;  2RUC A;  1SR0 A;  2KGJ A;  2O9O A;  4DWS B;  1R9H A;  2IUZ A;  2ZR5 A;  1BKF A;  4WIW A;  2MNT A;  2DT3 A;  5DF0 A;  4L72 B;  1E6R A;  1ZU8 A;  4MNJ A;  3ARP A;  4G2P A;  4P8W A;  2XP5 A;  3IHZ A;  2XP8 A;  2LJ4 A;  1ITX A;  1A7X A;  1RD6 A;  1JND A;  1Q6H A;  1QPF A;  2PBC A;  2MPH A;  3IKG A;  4ODN A;  3WD1 A;  4JFK A;  5I98 A;  3TC5 A;  1N1A A;  4IT4 A;  1GPF A;  4Q7N A;  2KI3 A;  3O5J A;  2DSW A;  1X6N A;  2A3B A;  3B8S A;  4JFM A;  3KAH A;  4QT3 A;  3RFW A;  1NMV A;  2PPN A;  2XP6 A;  4HBO A;  4QT2 A;  2KR7 A;  1FKR A;  2K8I A;  1W1P A;  5DO2 A;  1H0I A;  3KAB A;  3TCZ A;  1SYT A;  1W1T A;  1D7I A;  2DSZ A;  4ZPT R;  4DRI A;  1EDQ A;  1HJW A;  4DZ3 A;  5HWB A;  1FKJ A;  1TFV A;  1NWS A;  1PIN A;  1E9L A;  3EY6 A;  1YW5 A;  2UZ5 A;  1KT1 A;  1WB0 A;  1K9T A;  1FKG A;  3OA5 A;  3H9R B;  1EYM A;  4L3N A;  2LGO A;  1KFW A;  4JFL A;  5HT1 A;  3G6L A;  4MAV A;  3KZ7 A;  4ML4 A;  4Z2H A;  1D2K A;  1D7J A;  3ARZ A;  2KO7 A;  4P8X A;  2FDM A;  2RUQ A;  2ZR4 A;  4DH0 A;  4DWS C;  2M2A A;  3AS1 A;  3UI4 A;  1QPL A;  4DRH A;  1GOI A;  1W9P A;  4DRN A;  2A3C A;  3KCE A;  1LJY A;  3UQB A;  4J4O A;  2F2D A;  4R0X A;  3CH9 A;  4MNL A;  2QF8 A;  3ART A;  4NNR A;  1Q6U A;  4U84 A;  3RME A;  2N87 A;  2F4E A;  1ZBC A;  4Z2G A;  1NWU A;  5GPG A;  1LG1 A;  2D9F A;  1J4H A;  2G41 A;  4PTM A;  2XP7 A;  4FAP A;  5HW8 A;  1HJX A;  1YAT A;  3PRD A;  2OLH A;  3B9E A;  2DG3 A;  4P8U A;  4GGQ A;  1UR8 A;  3JYJ A;  3ODK A;  3UF8 A;  3B9D A;  3UQI A;  4ZPW R;  1IX5 A;  4MNM A;  4R5E A;  5HTG A;  1J6Y A;  1JVW A;  4NSB A;  3JXV A;  1KT0 A;  1CTN A;  1HKJ A;  2WK2 A;  1E6Z A;  1JNT A;  3W4R A;  2DPE A;  5D75 A;  2LKN A;  1FKL A;  3RM8 A;  4Z2L A;  3MDY B;  1HKI A;  3FY1 A;  1J4I A;  1T11 A;  5HBF A;  2DT2 A;  5HKG A;  2PPO A;  3WIJ A;  1ZB5 A;  3O5I A;  4ODK A;  1VF8 A;  4LAV A;  1OWQ A;  4IT6 A;  4QIB A;  5B8I C;  1FKI A;  3WD3 A;  2PV3 A;  3B9A A;  3BXW A;  1U79 A;  5HUA A;  4O2T A;  4LAX A;  4BF8 A;  4MTV A;  1WAW A;  4MGV A;  1FKK A;  4DRM A;  3OOB A;  4DRK A;  1E6N A;  2FAP A;  2A3A A;  3O5O A;  2PV2 A;  3ARY A;  3AQU A;  2AOS A;  1W1Y A;  1NWR A;  1LG2 A;  3IKD A;  3WQV A;  1LL4 A;  2ITK A;  3NTP A;  3O5P A;  3AS0 A;  2ZQU A;  3NRK A;  2A3E A;  1X6L A;  4IPX A;  1EIB A;  2XPA A;  3KAC A;  4TW8 A;  3WL0 A;  1ZBK A;  3O5L A;  4JYS A;  2MLY A;  4WK9 A;  3PR9 A;  3FAP A;  4FN2 A;  2O92 A;  3G6M A;  3PRB A;  1Q1C A;  1BL4 A;  3ALF A;  1LL6 A;  2OFN A;  3CGM A;  2DSV A;  5GQB A;  3ARU A;  4Z2I A;  2YBT A;  1NMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...