4TYOA

Ppiase in complex with a non-phosphate small molecule inhibitor.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (III): Optimizing affinity beyond the phosphate recognition pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 38
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tyoA00
1D6OA 2LPVA 5HT1A 1QPLA 5BXJA 4TW7A 2LKNA 3LUOA 2LGOA 4C02B 4DIPA 1D7HA 1QZ2A 3VAWA 5HUAA 2M08A 1NMVA 1B6CA 1P5QA 1BKFA 2VCDA 3KAIA 1KT1A 2FKEA 3JYMA 3PA7A 4TW6A 5DITA 1J6YA 1FKGA 3KCEA 3KABA 3KAFA 4JFKA 4IQ2A 5I98A 3B7XA 4DRJA 5HTGA 4W9PA 4QT3A 2Y78A 2XP9A 1FKKA 3CGMA 4W9OA 3KACA 4TX0A 4G50A 4DRIA 1ZCNA 2DG9A 2UZ5A 1FKJA 2ZQVA 3GPKA 4DZ3A 3PRBA 4ODLA 5J6EA 2XP3A 4ODOA 2MLZA 2VN1A 3OOBA 1NSGA 3EY6A 2MNTA 1BL4A 3O5JA 2FAPA 4JFIA 3UQAA 4DRKA 4G2PA 4NNRA 2RUDA 1Y0OA 1PINA 4LAWA 4JFMA 3TDBA 1NMWA 2N87A 3O5RA 2DG4A 4DZ2A 2DG3A 1Q1CA 2IF4A 3O5DA 3KZ7A 2RQSA 3UF8A 2MLYA 2KE0A 2ZR6A 3KAGA 4U85A 2K8IA 5HW8A 1FKSA 2Q5AA 1FKHA 3UI6A 4JFJA 1L1PA 3O5KA 4W9QA 3O5OA 4ITZA 2PPNA 3O5QA 4TYOA 4R0XA 3RFWA 2RUQA 4J4NA 3O5GA 4DRHA 5DIVA 3PRDA 3WH0A 1FKIA 4IPXA 4DT4A 2PPPA 3UQIA 4ODRA 2PBCA 5HKGA 4J4OA 1HXVA 1YATA 3IHZA 3RGCA 3MDYB 2KO7A 4DH0A 2M1IA 3KAHA 2RSEA 2RUCA 4LAYA 5HWBA 4GIVA 4TNSA 4FAPA 4U86A 4LAXA 4ODQA 1JNTA 1KT0A 2ITKA 1D7JA 2ZR4A 1EYMA 3O5IA 3ODKA 2PV3A 1FKRA 2XPBA 2PV1A 5HW6A 4IQCA 4GGQA 5D75A 2LJ4A 4JYSA 1FJDA 3UI5A 1TCOC 2ZQTA 1FKTA 1T11A 1JNSA 1F40A 3O5PA 3I6CA 4DRMA 5HW7A 2XP7A 1R9HA 1C9HA 2F4EA 2XP5A 3KADA 4ODKA 4DRNA 1Q6IA 1QPFA 2XP4A 2MPHA 2AWGA 2F2DA 2JZVA 4N19A 5B8IC 3O5MA 2ZR5A 2F21A 3CGNA 4O2TA 4U84A 1N1AA 2XPAA 4ODPA 1J4HA 2L2SA 1JVWA 3TC5A 3IK8A 1A7XA 4JFLA 4MSPA 2ZQSA 1U79A 4DRPA 2RURA 1FD9A 3IKDA 2OFNA 3UQBA 2XP8A 4ODNA 4BF8A 1EQ3A 2KR7A 4TW8A 3O5FA 3H9RB 3NTPA 5GPGA 3NRKA 4FN2A 1FAPA 1ROTA 2KFWA 4QIBA 3NI6A 1FKFA 3FAPA 1FKDA 2XP6A 3JXVA 4LAVA 5DIUA 3TCZA 4DRQA 2MLXA 1ZK6A 2KI3A 1W26A 2PV2A 2PPOA 1D7IA 1F8AB 1FKLA 1Q6UA 1J4IA 3O5EA 2KGJA 1FKBA 1YW5A 1ROUA 2M2AA 3JYJA 1Q6HA 3IKGA 1PBKA 3UI4A 2MF9A 4ODMA 4QT2A 4DROA 5HWCA 3O5LA 2ZQUA 1M5YA 4MGVA 1J4RA 2D9FA
chains in the Genus database with same CATH superfamily
1D6OA 2LPVA 5HT1A 4TW7A 2LKNA 1W9UA 4DIPA 1W9PA 1P5QA 1W1VA 3KAIA 5DITA 3CHEA 4JFKA 5HTGA 4MNLA 2Y78A 3CGMA 1ZBKA 2DG9A 1LG2A 3ARTA 1FKJA 3PRBA 3AS0A 2FAPA 4MNMA 2A3BA 4DRKA 3AS3A 4NNRA 3CHDA 1NMWA 4DZ2A 2A3EA 1E15A 2K8IA 1GRJA 3UI6A 1L1PA 3O5KA 4P8VA 4Q22A 3WD3A 3O5QA 2A3CA 5DIVA 1HXVA 1NH6A 3IHZA 3RGCA 1HKMA 3KAHA 2RSEA 2RUCA 4GIVA 4Q7NA 1LG1A 3WL0A 2ZR4A 1GUVA 2PV3A 1E6ZA 3OA5A 1ZL1A 3CH9A 1OGBA 1FKTA 1UR8A 4MNJA 1E6NA 1GOIA 5JH8A 3GTYX 1W9VA 2ZR5A 1RD6A 2F21A 1J4HA 2L2SA 3ALGA 1LJYA 4MPKA 1CTNA 2ZQSA 1U79A 1FD9A 2EULA 2OFNA 1NWRA 4URIA 4ODNA 3WD4A 4WKFA 3ARWA 2KR7A 4R5EA 3O5FA 3NTPA 5GPGA 4S3JA 4FN2A 2KFWA 4XAKA 2WK2A 1WNOA 2A3AA 1K9TA 2PPOA 1D7IA 1E6PA 1Q6UA 1J4IA 1ITXA 1EIBA 1XRVA 2M2AA 1HJWA 3JYJA 1Q6HA 4QZVB 1PBKA 4QT2A 3O5LA 2ZQUA 3WD0A 4Z2GA 3ARUA 4MGVA 1VF8A 1J4RA 2D9FA 2PN0A 3B9EA 3WKZA 1OGGA 2YBTA 1D7HA 3VAWA 2M08A 1NMVA 1FFQA 4TW6A 1X6NA 1ZU8A 5I98A 3KAFA 3B7XA 2QF8A 4W9PA 4QT3A 4W9OA 1FKKA 4TX0A 2ESCA 4L3NA 1UR9A 1WB0A 5J6EA 1OWQA 2DSZA 3EY6A 2MNTA 3UQAA 1E6RA 2RUDA 1PINA 4JFMA 3TDBA 4WIWA 3O5RA 3WQWA 4WKHA 1GPFA 3KZ7A 4S3KA 4Z2LA 3UF8A 2MLYA 5HW8A 2Q5AA 4WJXA 4W9QA 3O5OA 3RFWA 2PI6A 3O5GA 4IT4A 1FKIA 4IPXA 4ODRA 2PBCA 5HKGA 1ZBVA 4J4OA 3MDYB 2KO7A 2M1IA 5HWBA 1ZBWA 4LAXA 1JNTA 1D7JA 3ODKA 1H0IA 1FKRA 2XPBA 3CHFA 4IT6A 4GGQA 5D75A 1FJDA 3ARRA 1TCOC 1HKIA 1KFWA 1W1YA 1TFVA 1JNSA 5GQBA 3O5PA 4DRMA 2XP7A 4HBEA 4AY1A 1R9HA 1QPFA 1NWSA 1E44A 3ARVA 1ZB5A 1ZBCA 2B5UB 3AROA 4P8WA 4O2TA 4U84A 3IK8A 3ARXA 2RURA 3WD1A 1EQ3A 4ZPVR 4TW8A 2O9OA 2DT3A 3NRKA 1FAPA 1ROTA 3NI6A 1WAWA 3ARZA 2XP6A 3FAPA 4MNKA 2MLXA 3ARYA 1JCHB 3O5EA 4ZPTR 1ROUA 4HARA 4DROA 3IKGA 4KR0B 4NSBA 4BF8A 4ZPWR 3EIPA 4DWSB 4C02B 1IX5A 2DSWA 1B6CA 1SYTA 1BKFA 2VCDA 3JYMA 3RMEA 3PA7A 1FKGA 1HJVA 3KABA 3W4RA 2WLZA 3BMBA 4IQ2A 3B9DA 2DT0A 4DRJA 1LQ0A 4DRIA 2G41A 3KACA 4G50A 1ZCNA 2UZ5A 2WLYA 1LL4A 2ZQVA 4ODLA 1NSGA 3G6MA 2DSUA 5DF0A 4ZS6A 4P8XA 1BL4A 3O5JA 4JFIA 4G2PA 1Y0OA 1XHGA 2N87A 3B8SA 2DG3A 1Q1CA 2ZR6A 2KE0A 3KAGA 3WQVA 1FKSA 2P4VA 4JFJA 3BXWA 3CHCA 4ITZA 1LL7A 2PPNA 1HKKA 4P8UA 4R0XA 4J4NA 3PRDA 2PPPA 3UQIA 4Z2KA 2B31A 1YATA 3WIJA 4LAYA 3B9AA 4FAPA 4TNSA 4Z2JA 4ODQA 1KT0A 3O5IA 3AS2A 1HJXA 1D2KA 2LJ4A 4JYSA 4DWSD 3I6CA 2G8ZA 2XP5A 3KADA 2F23A 2DPEA 2F2DA 2JZVA 4N19A 1H0GA 4WKAA 2FDMA 1FFRA 3FXYA 4L72B 3FY1A 4MTVA 1EHNA 3ALFA 4HBOA 3IKDA 1FKFA 4NZCA 4LAVA 4ML4A 4Z2IA 1ZK6A 3ARSA 2KI3A 1W26A 3PRAA 1E9LA 1YW5A 1W1PA 2IUZA 3ARQA 1LL6A 5BXJA 1QPLA 3LUOA 2LGOA 4MAVA 1QZ2A 5HUAA 3RM4A 2WM0A 3PR9A 1KT1A 2FKEA 1J6YA 3KCEA 3QOKA 4UDMA 5GPRA 2XP9A 3ARPA 4KQZA 3GPKA 4DZ3A 2XP3A 4ODOA 2MLZA 2VN1A 3OOBA 4W5UA 3AQUA 4Z2HA 2OLHA 4LAWA 4DWSA 1NWTA 2DG4A 3O5DA 2IF4A 2RQSA 4U85A 1W1TA 5HBFA 1FKHA 1EDQA 4TYOA 2RUQA 4DRHA 4PTMA 5DO2A 3WH0A 4DT4A 1SR0A 4DH0A 1HKJA 2DT1A 4WK9A 4U86A 3RM8A 2ITKA 1EYMA 2PV1A 3WD2A 4IQCA 3AS1A 3UI5A 2ZQTA 1JNEA 1T11A 1X6LA 1F40A 5HW7A 2F4EA 1C9HA 4ODKA 4DRNA 1Q6IA 2O92A 2XP4A 2MPHA 2AWGA 3G6LA 3GU0A 3CZ8A 2DT2A 3O5MA 4LGXA 5B8IC 3CGNA 1NWUA 1N1AA 2XPAA 4ODPA 1JVWA 3TC5A 1A7XA 2YBUA 4JFLA 4MSPA 4DRPA 3UQBA 4DWSC 2XP8A 1O6IA 3H9RB 4QIBA 2AOSA 5DIUA 3JXVA 1FKDA 3WL1A 3TCZA 1JNDA 4DRQA 2PV2A 1F8AB 1FKLA 2DSVA 2KGJA 3RM9A 1FKBA 5DEZA 3UI4A 5HWCA 2MF9A 4ODMA 2ETNA 1M5YA 5HW6A
chains in the Genus database with same CATH topology
1D6OA 2LPVA 5HT1A 4TW7A 2LKNA 1W9UA 4DIPA 1W9PA 1P5QA 1W1VA 3KAIA 5DITA 3CHEA 4JFKA 5HTGA 4MNLA 2Y78A 3CGMA 1ZBKA 2DG9A 1LG2A 3ARTA 1FKJA 3PRBA 3AS0A 2FAPA 4MNMA 2A3BA 4DRKA 3AS3A 4NNRA 3CHDA 1NMWA 4DZ2A 2A3EA 1E15A 2K8IA 3UI6A 1L1PA 3O5KA 4P8VA 4Q22A 3WD3A 3O5QA 2A3CA 5DIVA 1HXVA 1NH6A 3IHZA 3RGCA 1HKMA 3KAHA 2RSEA 2RUCA 4GIVA 4Q7NA 1LG1A 3WL0A 2ZR4A 1GUVA 2PV3A 1E6ZA 3OA5A 1ZL1A 3CH9A 1OGBA 1FKTA 1UR8A 4MNJA 1E6NA 1GOIA 5JH8A 1W9VA 2ZR5A 1RD6A 2F21A 1J4HA 2L2SA 3ALGA 1LJYA 4MPKA 1CTNA 2ZQSA 1U79A 1FD9A 2OFNA 1NWRA 4URIA 4ODNA 3WD4A 4WKFA 3ARWA 2KR7A 4R5EA 3O5FA 3NTPA 5GPGA 4S3JA 4FN2A 2KFWA 4XAKA 2WK2A 1WNOA 2A3AA 1K9TA 2PPOA 1D7IA 1E6PA 1Q6UA 1J4IA 1ITXA 1EIBA 1XRVA 2M2AA 1HJWA 3JYJA 1Q6HA 4QZVB 1PBKA 4QT2A 3O5LA 2ZQUA 3WD0A 4Z2GA 3ARUA 4MGVA 1VF8A 1J4RA 2D9FA 3B9EA 3WKZA 1OGGA 2YBTA 1D7HA 3VAWA 2M08A 1NMVA 1FFQA 4TW6A 1X6NA 1ZU8A 5I98A 3KAFA 3B7XA 2QF8A 4W9PA 4QT3A 4W9OA 1FKKA 4TX0A 2ESCA 4L3NA 1UR9A 1WB0A 5J6EA 1OWQA 2DSZA 3EY6A 2MNTA 3UQAA 1E6RA 2RUDA 1PINA 4JFMA 3TDBA 4WIWA 3O5RA 3WQWA 4WKHA 1GPFA 3KZ7A 4S3KA 4Z2LA 3UF8A 2MLYA 5HW8A 2Q5AA 4WJXA 4W9QA 3O5OA 3RFWA 2PI6A 3O5GA 4IT4A 1FKIA 4IPXA 4ODRA 2PBCA 5HKGA 1ZBVA 4J4OA 3MDYB 2KO7A 2M1IA 5HWBA 1ZBWA 4LAXA 1JNTA 1D7JA 3ODKA 1H0IA 1FKRA 2XPBA 3CHFA 4IT6A 4GGQA 5D75A 1FJDA 3ARRA 1TCOC 1HKIA 1KFWA 1W1YA 1TFVA 1JNSA 5GQBA 3O5PA 4DRMA 2XP7A 4HBEA 4AY1A 1R9HA 1QPFA 1NWSA 3ARVA 1ZB5A 1ZBCA 3AROA 4P8WA 4O2TA 4U84A 3IK8A 3ARXA 2RURA 3WD1A 1EQ3A 4ZPVR 4TW8A 2O9OA 2DT3A 3NRKA 1FAPA 1ROTA 3NI6A 1WAWA 3ARZA 2XP6A 3FAPA 4MNKA 2MLXA 3ARYA 3O5EA 4ZPTR 1ROUA 4HARA 4DROA 3IKGA 4KR0B 4NSBA 4BF8A 4ZPWR 4DWSB 4C02B 1IX5A 2DSWA 1B6CA 1SYTA 1BKFA 2VCDA 3JYMA 3RMEA 3PA7A 1FKGA 1HJVA 3KABA 3W4RA 2WLZA 4IQ2A 3B9DA 2DT0A 4DRJA 1LQ0A 4DRIA 2G41A 3KACA 4G50A 1ZCNA 2UZ5A 2WLYA 1LL4A 2ZQVA 4ODLA 1NSGA 3G6MA 2DSUA 5DF0A 4ZS6A 4P8XA 1BL4A 3O5JA 4JFIA 4G2PA 1Y0OA 1XHGA 2N87A 3B8SA 2DG3A 1Q1CA 2ZR6A 2KE0A 3KAGA 3WQVA 1FKSA 4JFJA 3BXWA 3CHCA 4ITZA 1LL7A 2PPNA 1HKKA 4P8UA 4R0XA 4J4NA 3PRDA 2PPPA 3UQIA 4Z2KA 2B31A 1YATA 3WIJA 4LAYA 3B9AA 4FAPA 4TNSA 4Z2JA 4ODQA 1KT0A 3O5IA 3AS2A 1HJXA 1D2KA 2LJ4A 4JYSA 4DWSD 3I6CA 2G8ZA 2XP5A 3KADA 2DPEA 2F2DA 2JZVA 4N19A 1H0GA 4WKAA 2FDMA 1FFRA 3FXYA 4L72B 3FY1A 4MTVA 1EHNA 3ALFA 4HBOA 3IKDA 1FKFA 4NZCA 4LAVA 4ML4A 4Z2IA 1ZK6A 3ARSA 2KI3A 1W26A 3PRAA 1E9LA 1YW5A 1W1PA 2IUZA 3ARQA 1LL6A 5BXJA 1QPLA 3LUOA 2LGOA 4MAVA 1QZ2A 5HUAA 3RM4A 2WM0A 3PR9A 1KT1A 2FKEA 1J6YA 3KCEA 3QOKA 5GPRA 2XP9A 3ARPA 4KQZA 3GPKA 4DZ3A 2XP3A 4ODOA 2MLZA 2VN1A 3OOBA 4W5UA 3AQUA 4Z2HA 2OLHA 4LAWA 4DWSA 1NWTA 2DG4A 3O5DA 2IF4A 2RQSA 4U85A 1W1TA 5HBFA 1FKHA 1EDQA 4TYOA 2RUQA 4DRHA 4PTMA 5DO2A 3WH0A 4DT4A 1SR0A 4DH0A 1HKJA 2DT1A 4WK9A 4U86A 3RM8A 2ITKA 1EYMA 2PV1A 3WD2A 4IQCA 3AS1A 3UI5A 2ZQTA 1JNEA 1T11A 1X6LA 1F40A 5HW7A 2F4EA 1C9HA 4ODKA 4DRNA 1Q6IA 2O92A 2XP4A 2MPHA 2AWGA 3G6LA 3CZ8A 2DT2A 3O5MA 4LGXA 5B8IC 3CGNA 1NWUA 1N1AA 2XPAA 4ODPA 1JVWA 3TC5A 1A7XA 2YBUA 4JFLA 4MSPA 4DRPA 3UQBA 4DWSC 2XP8A 1O6IA 3H9RB 4QIBA 2AOSA 5DIUA 3JXVA 1FKDA 3WL1A 3TCZA 1JNDA 4DRQA 2PV2A 1F8AB 1FKLA 2DSVA 2KGJA 3RM9A 1FKBA 5DEZA 3UI4A 5HWCA 2MF9A 4ODMA 1M5YA 5HW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6O A;  2LPV A;  5HT1 A;  1QPL A;  5BXJ A;  4TW7 A;  2LKN A;  3LUO A;  2LGO A;  4C02 B;  4DIP A;  1D7H A;  1QZ2 A;  3VAW A;  5HUA A;  2M08 A;  1NMV A;  1B6C A;  1P5Q A;  1BKF A;  2VCD A;  3KAI A;  1KT1 A;  2FKE A;  3JYM A;  3PA7 A;  4TW6 A;  5DIT A;  1J6Y A;  1FKG A;  3KCE A;  3KAB A;  3KAF A;  4JFK A;  4IQ2 A;  5I98 A;  3B7X A;  4DRJ A;  5HTG A;  4W9P A;  4QT3 A;  2Y78 A;  2XP9 A;  1FKK A;  3CGM A;  4W9O A;  3KAC A;  4TX0 A;  4G50 A;  4DRI A;  1ZCN A;  2DG9 A;  2UZ5 A;  1FKJ A;  2ZQV A;  3GPK A;  4DZ3 A;  3PRB A;  4ODL A;  5J6E A;  2XP3 A;  4ODO A;  2MLZ A;  2VN1 A;  3OOB A;  1NSG A;  3EY6 A;  2MNT A;  1BL4 A;  3O5J A;  2FAP A;  4JFI A;  3UQA A;  4DRK A;  4G2P A;  4NNR A;  2RUD A;  1Y0O A;  1PIN A;  4LAW A;  4JFM A;  3TDB A;  1NMW A;  2N87 A;  3O5R A;  2DG4 A;  4DZ2 A;  2DG3 A;  1Q1C A;  2IF4 A;  3O5D A;  3KZ7 A;  2RQS A;  3UF8 A;  2MLY A;  2KE0 A;  2ZR6 A;  3KAG A;  4U85 A;  2K8I A;  5HW8 A;  1FKS A;  2Q5A A;  1FKH A;  3UI6 A;  4JFJ A;  1L1P A;  3O5K A;  4W9Q A;  3O5O A;  4ITZ A;  2PPN A;  3O5Q A;  4TYO A;  4R0X A;  3RFW A;  2RUQ A;  4J4N A;  3O5G A;  4DRH A;  5DIV A;  3PRD A;  3WH0 A;  1FKI A;  4IPX A;  4DT4 A;  2PPP A;  3UQI A;  4ODR A;  2PBC A;  5HKG A;  4J4O A;  1HXV A;  1YAT A;  3IHZ A;  3RGC A;  3MDY B;  2KO7 A;  4DH0 A;  2M1I A;  3KAH A;  2RSE A;  2RUC A;  4LAY A;  5HWB A;  4GIV A;  4TNS A;  4FAP A;  4U86 A;  4LAX A;  4ODQ A;  1JNT A;  1KT0 A;  2ITK A;  1D7J A;  2ZR4 A;  1EYM A;  3O5I A;  3ODK A;  2PV3 A;  1FKR A;  2XPB A;  2PV1 A;  5HW6 A;  4IQC A;  4GGQ A;  5D75 A;  2LJ4 A;  4JYS A;  1FJD A;  3UI5 A;  1TCO C;  2ZQT A;  1FKT A;  1T11 A;  1JNS A;  1F40 A;  3O5P A;  3I6C A;  4DRM A;  5HW7 A;  2XP7 A;  1R9H A;  1C9H A;  2F4E A;  2XP5 A;  3KAD A;  4ODK A;  4DRN A;  1Q6I A;  1QPF A;  2XP4 A;  2MPH A;  2AWG A;  2F2D A;  2JZV A;  4N19 A;  5B8I C;  3O5M A;  2ZR5 A;  2F21 A;  3CGN A;  4O2T A;  4U84 A;  1N1A A;  2XPA A;  4ODP A;  1J4H A;  2L2S A;  1JVW A;  3TC5 A;  3IK8 A;  1A7X A;  4JFL A;  4MSP A;  2ZQS A;  1U79 A;  4DRP A;  2RUR A;  1FD9 A;  3IKD A;  2OFN A;  3UQB A;  2XP8 A;  4ODN A;  4BF8 A;  1EQ3 A;  2KR7 A;  4TW8 A;  3O5F A;  3H9R B;  3NTP A;  5GPG A;  3NRK A;  4FN2 A;  1FAP A;  1ROT A;  2KFW A;  4QIB A;  3NI6 A;  1FKF A;  3FAP A;  1FKD A;  2XP6 A;  3JXV A;  4LAV A;  5DIU A;  3TCZ A;  4DRQ A;  2MLX A;  1ZK6 A;  2KI3 A;  1W26 A;  2PV2 A;  2PPO A;  1D7I A;  1F8A B;  1FKL A;  1Q6U A;  1J4I A;  3O5E A;  2KGJ A;  1FKB A;  1YW5 A;  1ROU A;  2M2A A;  3JYJ A;  1Q6H A;  3IKG A;  1PBK A;  3UI4 A;  2MF9 A;  4ODM A;  4QT2 A;  4DRO A;  5HWC A;  3O5L A;  2ZQU A;  1M5Y A;  4MGV A;  1J4R A;  2D9F A; 
#chains in the Genus database with same CATH topology
 1D6O A;  2LPV A;  5HT1 A;  4TW7 A;  2LKN A;  1W9U A;  4DIP A;  1W9P A;  1P5Q A;  1W1V A;  3KAI A;  5DIT A;  3CHE A;  4JFK A;  5HTG A;  4MNL A;  2Y78 A;  3CGM A;  1ZBK A;  2DG9 A;  1LG2 A;  3ART A;  1FKJ A;  3PRB A;  3AS0 A;  2FAP A;  4MNM A;  2A3B A;  4DRK A;  3AS3 A;  4NNR A;  3CHD A;  1NMW A;  4DZ2 A;  2A3E A;  1E15 A;  2K8I A;  1GRJ A;  3UI6 A;  1L1P A;  3O5K A;  4P8V A;  4Q22 A;  3WD3 A;  3O5Q A;  2A3C A;  5DIV A;  1HXV A;  1NH6 A;  3IHZ A;  3RGC A;  1HKM A;  3KAH A;  2RSE A;  2RUC A;  4GIV A;  4Q7N A;  1LG1 A;  3WL0 A;  2ZR4 A;  1GUV A;  2PV3 A;  1E6Z A;  3OA5 A;  1ZL1 A;  3CH9 A;  1OGB A;  1FKT A;  1UR8 A;  4MNJ A;  1E6N A;  1GOI A;  5JH8 A;  3GTY X;  1W9V A;  2ZR5 A;  1RD6 A;  2F21 A;  1J4H A;  2L2S A;  3ALG A;  1LJY A;  4MPK A;  1CTN A;  2ZQS A;  1U79 A;  1FD9 A;  2EUL A;  2OFN A;  1NWR A;  4URI A;  4ODN A;  3WD4 A;  4WKF A;  3ARW A;  2KR7 A;  4R5E A;  3O5F A;  3NTP A;  5GPG A;  4S3J A;  4FN2 A;  2KFW A;  4XAK A;  2WK2 A;  1WNO A;  2A3A A;  1K9T A;  2PPO A;  1D7I A;  1E6P A;  1Q6U A;  1J4I A;  1ITX A;  1EIB A;  1XRV A;  2M2A A;  1HJW A;  3JYJ A;  1Q6H A;  4QZV B;  1PBK A;  4QT2 A;  3O5L A;  2ZQU A;  3WD0 A;  4Z2G A;  3ARU A;  4MGV A;  1VF8 A;  1J4R A;  2D9F A;  2PN0 A;  3B9E A;  3WKZ A;  1OGG A;  2YBT A;  1D7H A;  3VAW A;  2M08 A;  1NMV A;  1FFQ A;  4TW6 A;  1X6N A;  1ZU8 A;  5I98 A;  3KAF A;  3B7X A;  2QF8 A;  4W9P A;  4QT3 A;  4W9O A;  1FKK A;  4TX0 A;  2ESC A;  4L3N A;  1UR9 A;  1WB0 A;  5J6E A;  1OWQ A;  2DSZ A;  3EY6 A;  2MNT A;  3UQA A;  1E6R A;  2RUD A;  1PIN A;  4JFM A;  3TDB A;  4WIW A;  3O5R A;  3WQW A;  4WKH A;  1GPF A;  3KZ7 A;  4S3K A;  4Z2L A;  3UF8 A;  2MLY A;  5HW8 A;  2Q5A A;  4WJX A;  4W9Q A;  3O5O A;  3RFW A;  2PI6 A;  3O5G A;  4IT4 A;  1FKI A;  4IPX A;  4ODR A;  2PBC A;  5HKG A;  1ZBV A;  4J4O A;  3MDY B;  2KO7 A;  2M1I A;  5HWB A;  1ZBW A;  4LAX A;  1JNT A;  1D7J A;  3ODK A;  1H0I A;  1FKR A;  2XPB A;  3CHF A;  4IT6 A;  4GGQ A;  5D75 A;  1FJD A;  3ARR A;  1TCO C;  1HKI A;  1KFW A;  1W1Y A;  1TFV A;  1JNS A;  5GQB A;  3O5P A;  4DRM A;  2XP7 A;  4HBE A;  4AY1 A;  1R9H A;  1QPF A;  1NWS A;  1E44 A;  3ARV A;  1ZB5 A;  1ZBC A;  2B5U B;  3ARO A;  4P8W A;  4O2T A;  4U84 A;  3IK8 A;  3ARX A;  2RUR A;  3WD1 A;  1EQ3 A;  4ZPV R;  4TW8 A;  2O9O A;  2DT3 A;  3NRK A;  1FAP A;  1ROT A;  3NI6 A;  1WAW A;  3ARZ A;  2XP6 A;  3FAP A;  4MNK A;  2MLX A;  3ARY A;  1JCH B;  3O5E A;  4ZPT R;  1ROU A;  4HAR A;  4DRO A;  3IKG A;  4KR0 B;  4NSB A;  4BF8 A;  4ZPW R;  3EIP A;  4DWS B;  4C02 B;  1IX5 A;  2DSW A;  1B6C A;  1SYT A;  1BKF A;  2VCD A;  3JYM A;  3RME A;  3PA7 A;  1FKG A;  1HJV A;  3KAB A;  3W4R A;  2WLZ A;  3BMB A;  4IQ2 A;  3B9D A;  2DT0 A;  4DRJ A;  1LQ0 A;  4DRI A;  2G41 A;  3KAC A;  4G50 A;  1ZCN A;  2UZ5 A;  2WLY A;  1LL4 A;  2ZQV A;  4ODL A;  1NSG A;  3G6M A;  2DSU A;  5DF0 A;  4ZS6 A;  4P8X A;  1BL4 A;  3O5J A;  4JFI A;  4G2P A;  1Y0O A;  1XHG A;  2N87 A;  3B8S A;  2DG3 A;  1Q1C A;  2ZR6 A;  2KE0 A;  3KAG A;  3WQV A;  1FKS A;  2P4V A;  4JFJ A;  3BXW A;  3CHC A;  4ITZ A;  1LL7 A;  2PPN A;  1HKK A;  4P8U A;  4R0X A;  4J4N A;  3PRD A;  2PPP A;  3UQI A;  4Z2K A;  2B31 A;  1YAT A;  3WIJ A;  4LAY A;  3B9A A;  4FAP A;  4TNS A;  4Z2J A;  4ODQ A;  1KT0 A;  3O5I A;  3AS2 A;  1HJX A;  1D2K A;  2LJ4 A;  4JYS A;  4DWS D;  3I6C A;  2G8Z A;  2XP5 A;  3KAD A;  2F23 A;  2DPE A;  2F2D A;  2JZV A;  4N19 A;  1H0G A;  4WKA A;  2FDM A;  1FFR A;  3FXY A;  4L72 B;  3FY1 A;  4MTV A;  1EHN A;  3ALF A;  4HBO A;  3IKD A;  1FKF A;  4NZC A;  4LAV A;  4ML4 A;  4Z2I A;  1ZK6 A;  3ARS A;  2KI3 A;  1W26 A;  3PRA A;  1E9L A;  1YW5 A;  1W1P A;  2IUZ A;  3ARQ A;  1LL6 A;  5BXJ A;  1QPL A;  3LUO A;  2LGO A;  4MAV A;  1QZ2 A;  5HUA A;  3RM4 A;  2WM0 A;  3PR9 A;  1KT1 A;  2FKE A;  1J6Y A;  3KCE A;  3QOK A;  4UDM A;  5GPR A;  2XP9 A;  3ARP A;  4KQZ A;  3GPK A;  4DZ3 A;  2XP3 A;  4ODO A;  2MLZ A;  2VN1 A;  3OOB A;  4W5U A;  3AQU A;  4Z2H A;  2OLH A;  4LAW A;  4DWS A;  1NWT A;  2DG4 A;  3O5D A;  2IF4 A;  2RQS A;  4U85 A;  1W1T A;  5HBF A;  1FKH A;  1EDQ A;  4TYO A;  2RUQ A;  4DRH A;  4PTM A;  5DO2 A;  3WH0 A;  4DT4 A;  1SR0 A;  4DH0 A;  1HKJ A;  2DT1 A;  4WK9 A;  4U86 A;  3RM8 A;  2ITK A;  1EYM A;  2PV1 A;  3WD2 A;  4IQC A;  3AS1 A;  3UI5 A;  2ZQT A;  1JNE A;  1T11 A;  1X6L A;  1F40 A;  5HW7 A;  2F4E A;  1C9H A;  4ODK A;  4DRN A;  1Q6I A;  2O92 A;  2XP4 A;  2MPH A;  2AWG A;  3G6L A;  3GU0 A;  3CZ8 A;  2DT2 A;  3O5M A;  4LGX A;  5B8I C;  3CGN A;  1NWU A;  1N1A A;  2XPA A;  4ODP A;  1JVW A;  3TC5 A;  1A7X A;  2YBU A;  4JFL A;  4MSP A;  4DRP A;  3UQB A;  4DWS C;  2XP8 A;  1O6I A;  3H9R B;  4QIB A;  2AOS A;  5DIU A;  3JXV A;  1FKD A;  3WL1 A;  3TCZ A;  1JND A;  4DRQ A;  2PV2 A;  1F8A B;  1FKL A;  2DSV A;  2KGJ A;  3RM9 A;  1FKB A;  5DEZ A;  3UI4 A;  5HWC A;  2MF9 A;  4ODM A;  2ETN A;  1M5Y A;  5HW6 A; 
#chains in the Genus database with same CATH homology
 1D6O A;  2LPV A;  5HT1 A;  4TW7 A;  2LKN A;  1W9U A;  4DIP A;  1W9P A;  1P5Q A;  1W1V A;  3KAI A;  5DIT A;  3CHE A;  4JFK A;  5HTG A;  4MNL A;  2Y78 A;  3CGM A;  1ZBK A;  2DG9 A;  1LG2 A;  3ART A;  1FKJ A;  3PRB A;  3AS0 A;  2FAP A;  4MNM A;  2A3B A;  4DRK A;  3AS3 A;  4NNR A;  3CHD A;  1NMW A;  4DZ2 A;  2A3E A;  1E15 A;  2K8I A;  3UI6 A;  1L1P A;  3O5K A;  4P8V A;  4Q22 A;  3WD3 A;  3O5Q A;  2A3C A;  5DIV A;  1HXV A;  1NH6 A;  3IHZ A;  3RGC A;  1HKM A;  3KAH A;  2RSE A;  2RUC A;  4GIV A;  4Q7N A;  1LG1 A;  3WL0 A;  2ZR4 A;  1GUV A;  2PV3 A;  1E6Z A;  3OA5 A;  1ZL1 A;  3CH9 A;  1OGB A;  1FKT A;  1UR8 A;  4MNJ A;  1E6N A;  1GOI A;  5JH8 A;  1W9V A;  2ZR5 A;  1RD6 A;  2F21 A;  1J4H A;  2L2S A;  3ALG A;  1LJY A;  4MPK A;  1CTN A;  2ZQS A;  1U79 A;  1FD9 A;  2OFN A;  1NWR A;  4URI A;  4ODN A;  3WD4 A;  4WKF A;  3ARW A;  2KR7 A;  4R5E A;  3O5F A;  3NTP A;  5GPG A;  4S3J A;  4FN2 A;  2KFW A;  4XAK A;  2WK2 A;  1WNO A;  2A3A A;  1K9T A;  2PPO A;  1D7I A;  1E6P A;  1Q6U A;  1J4I A;  1ITX A;  1EIB A;  1XRV A;  2M2A A;  1HJW A;  3JYJ A;  1Q6H A;  4QZV B;  1PBK A;  4QT2 A;  3O5L A;  2ZQU A;  3WD0 A;  4Z2G A;  3ARU A;  4MGV A;  1VF8 A;  1J4R A;  2D9F A;  3B9E A;  3WKZ A;  1OGG A;  2YBT A;  1D7H A;  3VAW A;  2M08 A;  1NMV A;  1FFQ A;  4TW6 A;  1X6N A;  1ZU8 A;  5I98 A;  3KAF A;  3B7X A;  2QF8 A;  4W9P A;  4QT3 A;  4W9O A;  1FKK A;  4TX0 A;  2ESC A;  4L3N A;  1UR9 A;  1WB0 A;  5J6E A;  1OWQ A;  2DSZ A;  3EY6 A;  2MNT A;  3UQA A;  1E6R A;  2RUD A;  1PIN A;  4JFM A;  3TDB A;  4WIW A;  3O5R A;  3WQW A;  4WKH A;  1GPF A;  3KZ7 A;  4S3K A;  4Z2L A;  3UF8 A;  2MLY A;  5HW8 A;  2Q5A A;  4WJX A;  4W9Q A;  3O5O A;  3RFW A;  2PI6 A;  3O5G A;  4IT4 A;  1FKI A;  4IPX A;  4ODR A;  2PBC A;  5HKG A;  1ZBV A;  4J4O A;  3MDY B;  2KO7 A;  2M1I A;  5HWB A;  1ZBW A;  4LAX A;  1JNT A;  1D7J A;  3ODK A;  1H0I A;  1FKR A;  2XPB A;  3CHF A;  4IT6 A;  4GGQ A;  5D75 A;  1FJD A;  3ARR A;  1TCO C;  1HKI A;  1KFW A;  1W1Y A;  1TFV A;  1JNS A;  5GQB A;  3O5P A;  4DRM A;  2XP7 A;  4HBE A;  4AY1 A;  1R9H A;  1QPF A;  1NWS A;  3ARV A;  1ZB5 A;  1ZBC A;  3ARO A;  4P8W A;  4O2T A;  4U84 A;  3IK8 A;  3ARX A;  2RUR A;  3WD1 A;  1EQ3 A;  4ZPV R;  4TW8 A;  2O9O A;  2DT3 A;  3NRK A;  1FAP A;  1ROT A;  3NI6 A;  1WAW A;  3ARZ A;  2XP6 A;  3FAP A;  4MNK A;  2MLX A;  3ARY A;  3O5E A;  4ZPT R;  1ROU A;  4HAR A;  4DRO A;  3IKG A;  4KR0 B;  4NSB A;  4BF8 A;  4ZPW R;  4DWS B;  4C02 B;  1IX5 A;  2DSW A;  1B6C A;  1SYT A;  1BKF A;  2VCD A;  3JYM A;  3RME A;  3PA7 A;  1FKG A;  1HJV A;  3KAB A;  3W4R A;  2WLZ A;  4IQ2 A;  3B9D A;  2DT0 A;  4DRJ A;  1LQ0 A;  4DRI A;  2G41 A;  3KAC A;  4G50 A;  1ZCN A;  2UZ5 A;  2WLY A;  1LL4 A;  2ZQV A;  4ODL A;  1NSG A;  3G6M A;  2DSU A;  5DF0 A;  4ZS6 A;  4P8X A;  1BL4 A;  3O5J A;  4JFI A;  4G2P A;  1Y0O A;  1XHG A;  2N87 A;  3B8S A;  2DG3 A;  1Q1C A;  2ZR6 A;  2KE0 A;  3KAG A;  3WQV A;  1FKS A;  4JFJ A;  3BXW A;  3CHC A;  4ITZ A;  1LL7 A;  2PPN A;  1HKK A;  4P8U A;  4R0X A;  4J4N A;  3PRD A;  2PPP A;  3UQI A;  4Z2K A;  2B31 A;  1YAT A;  3WIJ A;  4LAY A;  3B9A A;  4FAP A;  4TNS A;  4Z2J A;  4ODQ A;  1KT0 A;  3O5I A;  3AS2 A;  1HJX A;  1D2K A;  2LJ4 A;  4JYS A;  4DWS D;  3I6C A;  2G8Z A;  2XP5 A;  3KAD A;  2DPE A;  2F2D A;  2JZV A;  4N19 A;  1H0G A;  4WKA A;  2FDM A;  1FFR A;  3FXY A;  4L72 B;  3FY1 A;  4MTV A;  1EHN A;  3ALF A;  4HBO A;  3IKD A;  1FKF A;  4NZC A;  4LAV A;  4ML4 A;  4Z2I A;  1ZK6 A;  3ARS A;  2KI3 A;  1W26 A;  3PRA A;  1E9L A;  1YW5 A;  1W1P A;  2IUZ A;  3ARQ A;  1LL6 A;  5BXJ A;  1QPL A;  3LUO A;  2LGO A;  4MAV A;  1QZ2 A;  5HUA A;  3RM4 A;  2WM0 A;  3PR9 A;  1KT1 A;  2FKE A;  1J6Y A;  3KCE A;  3QOK A;  5GPR A;  2XP9 A;  3ARP A;  4KQZ A;  3GPK A;  4DZ3 A;  2XP3 A;  4ODO A;  2MLZ A;  2VN1 A;  3OOB A;  4W5U A;  3AQU A;  4Z2H A;  2OLH A;  4LAW A;  4DWS A;  1NWT A;  2DG4 A;  3O5D A;  2IF4 A;  2RQS A;  4U85 A;  1W1T A;  5HBF A;  1FKH A;  1EDQ A;  4TYO A;  2RUQ A;  4DRH A;  4PTM A;  5DO2 A;  3WH0 A;  4DT4 A;  1SR0 A;  4DH0 A;  1HKJ A;  2DT1 A;  4WK9 A;  4U86 A;  3RM8 A;  2ITK A;  1EYM A;  2PV1 A;  3WD2 A;  4IQC A;  3AS1 A;  3UI5 A;  2ZQT A;  1JNE A;  1T11 A;  1X6L A;  1F40 A;  5HW7 A;  2F4E A;  1C9H A;  4ODK A;  4DRN A;  1Q6I A;  2O92 A;  2XP4 A;  2MPH A;  2AWG A;  3G6L A;  3CZ8 A;  2DT2 A;  3O5M A;  4LGX A;  5B8I C;  3CGN A;  1NWU A;  1N1A A;  2XPA A;  4ODP A;  1JVW A;  3TC5 A;  1A7X A;  2YBU A;  4JFL A;  4MSP A;  4DRP A;  3UQB A;  4DWS C;  2XP8 A;  1O6I A;  3H9R B;  4QIB A;  2AOS A;  5DIU A;  3JXV A;  1FKD A;  3WL1 A;  3TCZ A;  1JND A;  4DRQ A;  2PV2 A;  1F8A B;  1FKL A;  2DSV A;  2KGJ A;  3RM9 A;  1FKB A;  5DEZ A;  3UI4 A;  5HWC A;  2MF9 A;  4ODM A;  1M5Y A;  5HW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...