1XRVA

Crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
publication title Crystal Structure of the novel secretory signalling protein from Porcine (SPP-40) at 2.1A resolution.
rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xrvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xrvA01
4ZENA 4AIUA 1BYBA 2D0GA 3EDDA 3L2LA 4NF7A 2C8NA 2YDSA 4ACYA 3NSXA 3BGAA 3IJ7A 3CIVA 1CGXA 1K9DA 4DWSA 2OYKA 5HXMA 2XVPA 2VZOA 3WUFA 3MUY1 2W4XA 4OJYA 5E0FA 3K8KA 1B0IA 4WKFA 1HKIA 2OYMA 4P7QA 1DHKA 1OD8A 3AIQA 1E0VA 2EPOA 5JBDA 5M03A 1CLXA 1U30A 4P7NA 3L4XA 5D9PA 1NM9A 2A3BA 1HKKA 2E8ZA 1QW8A 1ZU8A 1GJUA 1B3YA 1R86A 5I6SA 4WJXA 3AIVA 4M82A 1HJWA 4D6JA 2VUYA 1BF2A 3U7BA 1AMYA 5BXRA 1OGSA 1DWIM 4WIWA 1EQCA 2XGBA 4J3VA 3PZMA 4H2CA 2BVYA 1V0KA 3IAPA 4CCDA 4JFWA 2UY2A 5BXSA 1E0WA 3SCUA 2B31A 4MAZA 3WY1A 1UH3A 3CZJA 3AZTA 1O6IA 3BAIA 3MV01 5KZ6A 3AHVA 3ARTA 1KBKA 1D7FA 2WMKA 1UOKA 1HX0A 2YL6A 3VGBA 3AS1A 5ABFB 4CD4A 5CSUA 3PTQA 2UY3A 2WCGA 1R8LA 2J7FA 1G0CA 3MMWA 1UD6A 3WEZA 2O9OA 2WC7A 3WQ4A 2DPEA 3ZQ9A 2C0HA 4OOUA 4TVUA 2VZTA 3NDYA 2EQDA 2VCAA 1I75A 4JHZA 3UR8A 3FAXA 1ZBCA 1CTNA 4EAMA 5GNXA 1WNOA 2DDXA 2ZIDA 1E4LA 3CMGA 4H8VA 3W25A 2XVKA 4OIFA 2TAAA 3HMCA 1MVYA 1IZJA 5IFPA 2D0HA 2NT1A 4TUFA 1XHGA 2V5DA 2V3FA 4DUXA 1A47A 1ISVA 1V3IA 3CUJA 3KE0A 5CSYA 4ATDA 1E73M 3EYPA 3TONA 2ZXAA 4D6GA 2CEQA 3CHEA 3VILA 1NH6A 1DWFM 3WNOA 2YJQA 1PAMA 1QBAA 3W28A 3GH4A 3W26A 2JF6A 4F66A 1JNEA 1CENA 1HNYA 1PPIA 1TUXA 3BH4A 3O2LA 3D5HA 5BCAA 3WIJA 1TR1A 1OGBA 1UR4A 3DYOA 1C90A 4JKKA 4WLCA 3N18A 3VNYA 5CJ5A 2WC4A 3A6OA 4J3SA 2XIIA 3VDAA 3U5UA 1WDSA 1H49A 5HNNA 1HL9A 2VTFA 5A6SA 1CGYA 3A47A 1H41A 1W9PA 1NOWA 1U33A 3ZIZA 1V0LA 5JBFA 1OD0A 1R7AA 5CPSA 5C71A 3GXIA 3VM7A 5IDIA 4W86A 3KZSA 4GO8A 3ZJ8A 1R87A 2J7DA 8CGTA 1E1EA 1R85A 4P8XA 1PEZA 1ECEA 2WMHA 4V2XA 4XZBA 4PUEA 3AYSA 2UWFA 3AOFA 3WUGA 1WKYA 1MFUA 4RE2A 2G3IA 3ZMRA 5C8BB 1EXPA 3KL5A 4AEEA 3PZOA 4J28A 1E70M 1W9BM 3I3DA 2ZUMA 3TTOA 1J0KA 2WYSA 2YDQA 3CHCA 2OYLA 3RIKA 3OBAA 7TAAA 1GOWA 1E71M 1W9UA 2J77A 2QPSA 1ODZA 3MS8A 3S2CA 4JFUA 2ZE0A 3GBDA 4PMUA 4PTMA 5CGMA 1UH2A 3VTRA 5A94A 4A3YA 1UKQA 1V6UA 5LYRA 4W88A 3PTMA 4X0NA 4HA1A 3CZLA 3WQ6A 5I79A 1H3GA 3WDJA 2X8RA 1JXKA 3NCOA 1KBBA 3GYCA 2WSPA 3VIOA 2E40A 1W1VA 1AQHA 5HDRA 1EHAA 3VINA 1BLIA 3QHNA 1J0JA 2X2YA 1UH4A 1PX4A 1ISXA 3O6AA 2X0HA 2A3EA 1OM0A 1NP2A 1MW1A 5BWFA 2OWCA 2DT0A 1UKTA 4HOXA 1OB0A 3BAWA 1W3KA 1VBUA 5JIPA 4KH2A 1BG4A 2EPLX 4QCFA 1VFUA 3U7VA 2EEXA 4MDPA 1L0PA 1VBRA 1E6ZA 2O92A 1GONA 4WSKA 1JZ8A 3VOCA 3WL1A 1UR1A 2YA1A 2OWXA 3L4VA 4M1RA 5A2BA 3CUFA 2CKRA 1VJZA 3PZTA 1JAKA 2E9LA 4J27A 3AMDA 2WWCA 4NI3A 3GDBA 3UESA 4D71A 2VX6A 3CPUA 1UWIA 4H8HA 5CPTA 5A2CA 4OUEA 8A3HA 4MNKA 5BYWA 1H1NA 1E0XA 1JI1A 2VC9A 2D24A 1E55A 3AIRA 4KRTA 1DP0A 2JE8A 2X0YA 3VX1A 4CKQA 3UETA 1E6XM 3W6MA 1XH2A 4PMYA 3AHZA 1H2JA 6A3HA 1CXIA 4ZFMA 2E4TA 1R7OA 2ZX9A 2UY4A 1LG2A 1E40A 4W5UA 2IXUA 2BXYA 3BMVA 2MANA 1BHGA 2XGIA 4FLRA 2CBIA 4KWUA 1LQ0A 9CGTA 2W67A 1W1YA 2NW0A 1BVNP 2DT1A 1KXVA 2WMIB 3N17A 2EPMX 5FL0A 2BY3A 5CQ1A 1KGXA 1ZS2A 3CUIA 1W9DM 1NWSA 3N11A 2D3NA 2OSYA 1FP9A 2AOSA 1HVQA 3VD4A 3CH9A 3SCWA 4HMDA 4CCCA 4V28A 3K8LA 4JIEA 3DYPA 5BRPA 2VRJA 1BSIA 5DO8A 4PSRA 1CGWA 1TMQA 5I3DA 3AIEA 4GZJA 2XM1A 1J0HA 1QPKA 3SURA 1MQQA 4IUGA 5A8PA 2G4FA 4W8LA 3ZJ7A 4MJ4A 2VVSA 1MFVA 2CITA 1GJWA 2GVYA 3UCQA 2G8ZA 3ARWA 1W32A 1E3ZA 3UEQA 4AZIA 3UERA 1DWGM 1EH9A 3OA5A 2Y5EA 3SCOA 3TA9A 3F5KA 1ITCA 3ZR5A 2DSUA 3OZOA 4AZHA 3A4XA 1E5JA 1BTCA 1V0NA 1UD5A 3ZSTA 3AS2A 4E2OA 2J7CA 4YHEA 2D2OA 1K9EA 3O9NA 3LMYA 3CZ8A 2D3LA 3NDZA 4J7RA 1JYVA 3L4TA 1VAHA 4AEFA 5A6MA 3W53A 4U5KA 3AZSA 4AD4A 4WF7A 3W27A 3OLEA 4BQ4A 4AISA 4HP5A 2DSZA 4QCEA 2BVTA 3WNNA 2Y4SA 4UCFA 1B3VA 3WF2A 2Z1SA 2WBGA 4UOZA 5CPQA 2BXZA 2D22A 3VGFA 1PIFA 2GDVA 1EOMA 2ZICA 3E1F1 4H8UA 1NWRA 4IPLA 3D3AA 3WNPA 3GNPA 4JFSA 4F8XA 4UQ9A 1OWQA 1OT1A 3NSNA 1ZBVA 4YN5A 4AD5A 3FN9A 2CCRA 5BXPA 1LL7A 1FFRA 2XVNA 5BROA 4PUDA 1S46A 1W2PA 5IFTA 1KXQA 4U3CA 3F5LA 2WVVB 1PJ9A 4FF5A 5DT7A 4X0VA 2VRKA 4U5IA 1XYZA 3VMNA 4PTXA 2Y8VA 5DFAA 3ZO9A 1WDPA 1GOQA 2C7FA 3FAWA 7CGTA 1VFMA 3QHOA 1VENA 1GVYA 1VRXA 2DSVA 1V6XA 4AZBA 5AY7A 1WP6A 3THDA 5ABHA 2CBJA 1HJSA 4CUCA 1HP4A 2XSBA 4F79A 1CEOA 1EOKA 2XVLA 3EMCA 2J7GA 1W3JA 4GINA 1TZ7A 3WF3A 2ZUVA 1JNDA 5EB8A 3ZJKA 5DEZA 3M46A 2BHZA 4W87A 3UG5A 1Q6DA 4BCEA 2FH6A 1UQZA 3PN8A 1QHPA 1FH8A 3WDIA 3CBWA 1KWKA 5AC4A 4TX6A 2VX7A 1GNXA 1LLOA 2WSKA 2WMFA 4LPCA 3GTNA 4IM4A 4JFTA 3OGSA 5HPCA 1UD8A 4W7VA 3II1A 1XCWA 4P8WA 2XWEA 1JDAA 1JAEA 3L4WA 2PWDA 4WSJA 2G3JA 2PWFA 3VVGA 4AW7A 4CN6A 2ZX7A 1CYGA 4H41A 1JD7A 1BG9A 1WO2A 5CG0A 3U57A 1MW3A 1VF8A 4PBGA 4W84A 3B9AA 5LA2A 4C7GA 3OIHA 2WW5A 1GOMA 4B3LA 1H5VA 2XHYA 1GQIA 1KCKA 1NOFA 1PX3A 3RM4A 3NUKA 1DTUA 1XYFA 3KEHA 3AICA 4UFHA 3IK2A 4K68A 2ESCA 2J74A 1UR9A 2WMJA 3WF4A 4CVUA 1CZ1A 1V0MA 3CZKA 4FMVA 4NZCA 1SFSA 1TA3B 3T0BA 4ACZA 2GJRA 4LXFA 4URIA 4AXNA 4UQDA 4JFVA 4CU7A 3W6LA 1E6NA 5FKYA 1US2A 1QNRA 2VQTA 3WMSA 2WKGA 3SUTA 5JIWA 4MNLA 1EO5A 4B9ZA 2YDRA 4TTGA 3B9EA 4AD2A 2FGZA 2A3AA 4DWSB 1GQLA 4LYRA 1EO7A 2EXOA 3PZUA 2PBGA 3VD7A 1Q6EA 4HZ8A 3WD0A 1E6PA 3ZJ6A 2WBKA 1G9HA 1RPKA 1JZ3A 3POCA 3ARQA 2QF8A 1XCXA 1JZ5A 2IXVA 5IXEA 4JKLA 4JAWA 3QR3A 1QOXA 4UFJA 3IJ9A 1FH9A 3WNMA 4ZXLA 4P8UA 2AAAA 2WVUA 1CXLA 3PZVA 3VD9A 2J75A 2JIEA 5C70A 1M7XA 1V08A 2WWDA 5A8NA 4U33A 1QHZA 2YKKA 1UHVA 4W5ZA 2XWDA 1L8NA 3EDEA 1UR2A 2BY1A 2ZUNA 3PZIA 3QHMA 4JKMA 1ZL1A 5A2AA 3AIWA 1C92A 3KL3A 3ARZA 3NJ3A 3PTKA 1HT6A 5JUVA 3N15A 4UOQA 2GK1A 5A6AA 1ZB5A 2WHKA 4AYSA 2OSXA 4M24A 4JCMA 1LWJA 2WXDM 1G01A 3VKKA 4M29A 1CLVA 1JDDA 5D9MA 4BA0A 6TAAA 3A3HA 4PMXA 1JD9A 2HVMA 5A3HA 1V3MA 4AZ5A 2FGLA 3WDHA 5F7UA 1H4PA 4Z2LA 3M7SA 4CU8A 2VVNA 1QI2A 1QNQA 3WDPP 2GJXB 3GH7A 2BVDA 3AXIA 3MU7A 4WK9A 4PCTA 1UR8A 2ZWZA 4Q22A 5I5RA 4XUYA 2CESA 4EK7A 3BAYA 4PEEA 2NSXA 5I24A 1PZ2A 4LYPA 5EMYA 5DF0A 4EKJA 4ML4A 2PWEA 3N04A 3WH6A 1SMAA 1WPCA 1OINA 3VIGA 1LG1A 2V3EA 4HU8A 3NYDA 4UOJA 5DMYA 2CPUA 2CKSA 1QI0A 4D6EA 2CBUA 5AC5A 5DT5A 4S3KA 3LPGA 3AXXA 3MUIA 2YBUA 3ARRA 5EFFA 4LGXA 1UG6A 1I1WA 4GI9A 4AD0A 2Q8XA 4UZUA 2GJPA 5HBFA 1HN1A 3EBVA 2XUCA 1UZ4A 1U2YA 2WZEA 4MDOA 1DWHM 2DIJA 1RP8A 1B1YA 2XFFA 1VFFA 3BLKA 3SCVA 1PX8A 3W82A 4HOWA 4CD7A 1EHNA 2CHOA 4UFMA 4B3KA 1J12A 3KL0A 3UG4A 2G3MA 2QMJA 2W5FA 5GQBA 4PMVA 1MYRA 2ZUWA 2OLHA 4W8BA 3VGDA 4LYQA 3MUAA 3BLPX 3N1AA 1B3XA 1ISZA 3GXDA 3OLGA 3B9DA 4D6IA 2VT0A 2ZWYA 4D6FA 1VEMA 4Z2HA 2WLYA 3WUBA 3MANA 1QNPA 2OWWA 4D6HA 1US3A 4UTFA 2XJ7A 3AMGA 1BGAA 3KWXA 4AZCA 3W4RA 2YBTA 1JGIA 3ARUA 5TD4A 3VUPA 3FXYA 5FCZA 3AMKA 1KR1A 2WHMA 4JCLA 2BS9A 2WMGA 2E8YA 5BRQA 1IZKA 1XH1A 1HVXA 1UWUA 3N13A 1ZBKA 3PBGA 3CO4A 4Z2GA 1V02A 4MAVA 1M03A 2V5CA 2UY5A 4KMQA 1W1PA 3QOKA 2VZSA 4D6CA 4PMDA 3VD5A 3AQUA 3HN3A 1GHSA 2J7BA 2VR4A 3ALFA 1ISYA 4TXEA 1W1TA 1C8YA 2BFGA 3DYMA 2WVTA 3FHQA 3MMDA 3UR7A 3BCFA 3VIJA 2VL4A 2GUYA 3L2MA 1BYCA 2EBNA 3ECQA 1V3JA 1CDGA 1MXDA 4C7DA 4ATLA 4RE3A 2DIEA 3BCDA 3VMPA 1ODUA 1W2VA 4AMCA 2E0PA 3AHXA 3G6MA 4PMNA 1E72M 1JZ2A 1XH0A 1ESWA 4P7OA 4TVDA 4GO9A 3AJ7A 4PSPA 2VZVA 1FP8A 2AMGA 1QNSA 2PWGA 4HPGA 2J8FA 1DEDA 1CXHA 1BGGA 1QHOA 3CHFA 1B2YA 3WDQA 2WK2A 4HZ7A 1EDTA 3LPPA 2VX5A 2BNJA 3WD1A 3PZ9A 3ZT5A 2ZXQA 2ZUUA 2YA2A 4QAWA 4CGTA 3VGHA 4NRRA 1E9LA 4MJ2A 4Z2IA 5AYIA 5KEZA 4PTWA 4R5EA 2G3NA 3RMEA 1XSKA 3ARYA 4HTYA 4OKDA 2QMKA 2WCAA 1UWRA 1TVPA 4MPKA 2FHFA 3W29A 2PF0A 3GZAA 3SUVA 3OLIA 1Z32X 3FW6A 2F2HA 2VQUA 4IISA 5GNZA 3IJ8A 1F4HA 4PCSA 5A69A 4W93A 3SCSA 5A8MA 1XD0A 1UKPA 2J7HA 3GM8A 4BQ2A 1UUQA 3K8MA 5ECUA 3AMLA 1K9TA 4E4PA 1C8XA 3WN6A 5M5DA 1WE5A 3WD2A 1B3WA 4ZXOA 3WNLA 1B3ZA 4QLLA 2A3HA 1GZJA 3WUEA 5E09A 1D3CA 4R27A 3AISA 2PI6A 1XD1A 4ZE4A 1BAGA 4UFLA 5M3WA 3ALGA 3WF1A 2WVVA 2YL9A 3OLDA 4S3JA 1KGWA 4WKHA 2XFRA 1H0IA 3RDKA 4M80A 1KR0A 1UYQA 2J62A 1KQYA 2F8QA 5I23A 1SR0A 1ZJBA 1GORA 4J3UA 3WH7A 1E6QM 1RP9A 1PIGA 2VURA 4HMEA 1CPUA 1LF1A 4MB3A 5HOSA 1CECA 1UD3A 2YLLA 1NARA 3TOPA 1YHTA 1JZ6A 4P7RA 3WH8A 1G94A 1N82A 1ZJAA 2GFTA 6CGTA 1JFXA 1JIBA 3ARXA 4A3HA 3AIUA 3BXWA 3EMQA 1TG7A 2VRQA 2DSKA 4OZOA 5FL1A 2YL5A 4HMCA 2ZX5A 4Z2JA 5CGTA 1KCLA 4PN2A 1V3LA 3PHAA 3RJXA 4D6DA 2O9PA 3VMOA 3CUHA 2FDMA 2A3CA 3SUUA 3RM8A 4W7WA 2EPKX 3WD3A 3WQ8A 1CXKA 1V6YA 3WMBA 5IHRA 2WZHA 4LX4A 3K4DA 3TTSA 3VU2A 2F61A 1YQ2A 4M56A 5JH8A 3WKZA 2O9TA 2XIBA 2ZUSA 4YHGA 1E4MM 4UFKA 4W89A 3TP4A 4F9JA 2ZX6A 1KGUA 5E6ZA 1ZBWA 4BS0A 1HJUA 5A6BA 4BQ3A 4CN4A 1RD6A 1E3XA 3BSGA 5D4YA 4UFIA 3VIKA 3WQVA 1E1FA 4NSBA 3IANA 3MV11 1W91A 1G1YA 1LWHA 1KB3A 1JG9A 4NRSA 3GNRA 3BAKA 4RE4A 1XSIA 1E4IA 5FOOA 3NIYA 2VCCA 1QW9A 2O9RA 1OBAA 1QBBA 4D1JA 4GQRA 4GPNA 1J11A 3WENA 5HPOA 3ARSA 3WL0A 4GZEA 4QP0A 1FHLA 4H04A 4MADA 3EDFA 4EE9A 5A8OA 1JFHA 4FLOA 2G41A 3A4WA 3ZT6A 2CBVA 1GOKA 3AZRA 3VIFA 1KXHA 4FK9A 1B9ZA 3PZNA 2WAGA 1C7TA 1VJSA 4UQBA 3WSUA 5ABFA 1M04A 1WDRA 3WQ5A 3VPLA 3WELA 3SEPA 3OG2A 3VIMA 2VMFA 3AXHA 3WMCA 4UZSA 1ITXA 3ZM8A 1CBGA 2DSWA 3MSDA 1J0ZA 4HA3A 4JHOA 4AD3A 1E6RA 1UA3A 2XVGA 3WH5A 1B31A 1UD4A 4B9YA 5D8WA 1XGZA 4HPHA 1A3HA 4UR9A 1EGZA 3BSHA 1JYWA 1TCMA 4PMQA 1Q6GA 5E70A 1CIUA 3JUGA 2D0FA 1WDQA 4ACZB 1UKOA 3W24A 2W63A 2WB5A 1HL8A 1HXJA 4GKLA 3S6TA 1NQ6A 4GIAA 2JIWA 4M8UA 1K9FA 4GXPA 3DC0A 1WZMA 4QLKA 3WBEA 3OGRA 3VO0A 3VM5A 1CGUA 3AROA 4KGLA 1GVIA 4PMRA 2WLZA 3W37A 4BF7A 2V3GA 3K1DA 1CXFA 2PC8A 5LA0A 2XSAA 3SCPA 1UKSA 1BVZA 4WKAA 2YIHA 2Z1KA 2WPGA 3VIHA 3OB8A 1QNOA 3WFZA 2QPUA 4FLQA 1EA9C 3BAXA 1M53A 3RCNA 1BYDA 2GJXA 1ISWA 1QI3A 4MNJA 2CERA 3OZPA 3EMZA 1PZ3A 1UWSA 1GCYA 2ZXDA 1VEOA 4HU0A 2DQXA 1C91A 1X1NA 1WB0A 4BZYA 3W38A 1E6SM 4U2ZA 2XTKA 4MB1A 5E6YA 3ZR6A 4HA4A 3K46A 1XSJA 3EDJA 1HP5A 2FHBA 4AIEA 2W66A 2Y24A 1UD2A 1IT0A 1OCQA 5A6KA 1EDQA 4PRWA 3SUSA 2EJ1A 4CD6A 1E4NA 5CLTA 3T09A 4N42A 3SCTA 1Y7VA 2D23A 5CZKA 2WM0A 1H11A 1B30A 2VR5A 2J47A 2JF7A 4OBSA 4Q7NA 1F4AA 3AYRA 1KQZA 4Z2KA 4XX6A 4E8CA 1KWGA 2DT3A 2GK1B 3A4AA 3VIIA 1JYXA 1KXTA 3M07A 3NSMA 1FOBA 3MMUA 3N9KA 4JL1A 4KRUA 3OGVA 3AHYA 3RPMA 1J9YA 3MKKA 2XPKA 5CLWA 3RILA 2YA0A 4U3AA 3CTTA 2EPNA 2VCBA 2CYGA 3VGEA 2RGLA 1WAWA 3CZGA 1J18A 2VZUA 3T2PA 2QHAA 5E0CA 3VDBA 1G5AA 3T2QA 2BY0A 4C7FA 2D1ZA 1SYTA 2Y2WA 2W91A 4LQ1A 3POHA 3FHAA 3FNDA 3L4ZA 1QI5A 2V3DA 4L4PA 1E56A 4M81A 2CETA 3CGTA 1LJYA 1DWAM 1TE1A 5FD0A 1V6WA 3GH5A 4P7LA 4D72A 3HU7A 3WDRA 1CWYA 1GQJA 4DUWA 3F4VA 1HJVA 5IHSA 3AS0A 2EO7A 3BMWA 4PYSA 3B8SA 1VB9A 1C93A 5CXPA 1I1XA 1C7SA 1BFNA 1V02E 2IUZA 3WEMA 3T0DA 2J8GA 1WZKA 3PZGA 5A95A 4AWEA 1SMDA 2JEQA 1O7AA 3ZT7A 4H7VA 1HJXA 2DT2A 1UR0A 2BHYA 2GDUA 2ZX8A 2DGAA 5EFDA 3CUGA 4MTVA 3TTYA 2PWHA 2WHLA 3WH9A 2DH3A 3IAQA 2X05A 3RJYA 1AQ0A 3CZEA 1BQCA 1KFWA 4UQEA 3I3EA 1W9XA 5D9NA 1V6VA 1D2KA 2CNCA 1B90A 1GQKA 4UNIA 1AQMA 1IV8A 1RH9A 3AHTA 1JZ7A 1V03A 3AI0A 4GI6A 3LPFA 2VJXA 2CHNA 3AIBA 3GNOA 1J0YA 2QV4A 1W9VA 2W62A 4JZ5A 1JF6A 4A4AA 4Y7EA 2WMIA 3L4YA 3HJEA 4U2YA 2X09A 5ABGA 4PMZA 4V27A 4OBRA 2VOTA 2WKLA 4AZ7A 2VX4A 1WZLA 4AZCB 4QFUA 3VD3A 2E9MA 3CHDA 1XRVA 1WCGA 3CMJA 4L4OA 4CD8A 1NWTA 4GZIA 3DECA 3QOMA 4AZ6A 2X1IA 5A6LA 3I3BA 1FA2A 1WZAA 1JI2A 2WANA 1CGTA 1K6AA 2VI0A 3AMCA 3M6DA 1VIWA 1W3HA 4QLJA 3PZQA 1MWOA 1QVBA 3VNZA 1XV8A 4B16A 4X9YA 2W61A 2XG9A 1UA7A 3W81A 1AVAA 2J25A 5GPRA 1NP0A 3J7HA 3VDHA 2XM2A 2WZIA 1HF6A 3WBAA 4AD1A 2E3ZA 1JF5A 2FH8A 3CLWA 3SUWA 3G6LA 1FFQA 4ZE5A 2XYLA 2JFEX 3WFLA 1C3FA 2J7EA 3ARVA 4IPNB 1J10A 4AIOA 3TTQA 4AZGA 2ZXBA 2JALA 5A6BD 4HOZA 4XB3A 2E9BA 5M17A 3RM9A 4J3XA 1CXEA 1E15A 1GHRA 3U5YA 4TOQA 1VFOA 1GPFA 2VNCA 1MQPA 1J0IA 3ARPA 5A6JA 1NOUA 4J3TA 3GXFA 4P8VA 4TX8A 4DM1A 1NWUA 1VEPA 3GXMA 4J3WA 4ZEPA 1JDCA 2CIPA 1LL4A 3AFBA 4CVWA 1X6LA 2ZUTA 4TVCA 1H09A 2FHCA 1Q6CA 3VX0A 2WHJA 4CN1A 1XC6A 1TVNA 3GBEA 3T0AA 4KGJA 4GI8A 4PMOA 1Q4NX 1JL8A 4FLSA 4DWSD 3VIPA 2YOCA 4E8DA 5EBAA 7A3HA 2WNWA 5ABEA 1DWJM 2W92A 5A8QA 3W0KA 1GOOA 1X6NA 4CD5A 3THCA 3BAJA 3VDCA 4XZWA 4U31A 5AYBA 2J78A 1V3HA 1V3KA 5GNYA 1CNVA 4CU6A 3WQWA 4DWSC 2WCSA 4XV0A 2HISA 3SIMA 4F9DA 2XFYA 1HJQA 5E9AA 1JYNA 3APGA 3RO8A 2DEPA 3N12A 2Y8KA 1UWTA 4UQCA 4PTVA 4CCEA 2BHUA 2BY2A 3DHPA 1HKJA 1E43A 4MB4A 1TFVA 1BPLB 1P6WA 4EANA 5A1AA 2YLAA 1BYAA 1UZ1A 4UQAA 3WF0A 1H0GA 5I2UA 5BXTA 2J79A 1OIFA 4D1IA 4TTUA 1JZ4A 5FIPA 1OGGA 3T2OA 1MW0A 3VGGA 3SCQA 5I0DA 1HIZA 2RGMA 3SCRA 4ATWA 3EDKA 1LL6A 4HZ6A 4JL2A 1CGVA 4W85A 4DM2A 2PB1A 1HKMA 1QI4A 1GW1A 3T08A 4OOZA 1EIBA 2QLYA 3ZSSA 2PBOA 2V38A 1OT2A 3SCNA 4MB5A 4W8AA 1E5NA 1UQYA 1J01A 4W7UA 2OSWA 4DUVA 3AS3A 3K4AA 2BV9A 2DH2A 4RL3A 4BQ5A 1OIMA 4QDMA 3F5JA 1FHDA 5D9OA 1W3LA 1UWQA 4N0RA 1OSEA 4AY1A 4GQQA 2ZOXA 3UG3A 2D20A 3QGVA 1FH7A 4AC1X 1M01A 2J4GA 3L4UA 1MQRA 5LA1A 3BC9A 1MXGA 2NT0A 3LPOA 1GUVA 5JBEA 3FY1A 3WEOA 3MO4A 4YPJA 1GOIA 1EQPA 3DHUA 1Q6FA 2CXGA 5I77A 2WVSA 3WNKA 1C8QA 1JXJA 5I78A 3WD4A 2WC3A 1TA3A 3ZOAA 4MNMA 1EDGA 1MW2A 2VO5A 4B15A 2JEPA 3MSGA 3MUZ1 2YL8A 5D8ZA 1PBGA 2GSJA
chains in the Genus database with same CATH superfamily
1ROUA 1SGJA 4ZENA 3W9ZA 3URAA 3KUMA 5TF0A 4NF7A 4IQLA 4K36A 2PDCA 5XINA 3CV7A 3W1TA 4S3CA 3GKAA 3V0UA 3BGAA 1ICQA 4O1FA 3CIVA 2YCLA 3IGUA 4XZHA 4JQ2A 2NSOA 2XVPA 1GVQA 3MUY1 2XDFA 2VP8A 4OJYA 5DY2A 3SSZA 5HR6A 1HKIA 2QCCA 1R9ZA 4D8LA 3AIQA 3N9SA 5LXXA 4GYPC 5JBDA 2DZSA 3O7UA 4P7NA 1RALA 1TB3A 4S3AA 5D9PA 4I5XA 3NL2A 1GJUA 1DE5A 1B3YA 1Y5VA 4M82A 3CV6A 5FJOA 4RDVA 3CIWA 4LNCA 5HKGA 2ITKA 1QATA 4O18A 1DWIM 4UC5A 1O12A 4B2DD 2PBCA 3RGTA 3PZMA 2R6OA 2Y7EA 1H7PA 1ZP4A 3AYVA 4QM1A 3IAPA 4LY4A 4JFWA 4HB7A 1XINA 3BLIA 5BXSA 1UH3A 3CZJA 3LRMA 3AZTA 1O6IA 2Q09A 3IEBA 3MV01 2I9EA 2KZHA 3SY8A 5KZ6A 3AHVA 4QT3A 1KBKA 1Q65A 2Q71A 1W3TA 5ABFB 4DO4A 4C6PA 4CD4A 3UJSA 2BOFX 1A3WA 3KRBA 4PCPA 3PTQA 2FZ8A 1FCVA 1XICA 1FJDA 5H8MA 4DRKA 2WSQA 3MMWA 2IPJA 2WC7A 4NI8A 4FEZA 1W1IE 3RX3A 4OOUA 2RDXA 4H19A 3A21A 3U2OA 1UUOA 3UR8A 3CPGA 3M0JA 5J5DA 1Q6UA 2YCKX 1R47A 4H8VA 4OIFA 4LAXA 2GVEA 3HMCA 1GJPA 3P6LA 1IZJA 4DYKA 2V3FA 1FXPA 4AHOA 5IRPA 4X61A 3AO0A 4MZ1A 1ISVA 3KE0A 5CZ0A 4R88A 3W07A 1OVDA 5DBUA 4D6GA 1FD9A 3CHEA 3P93A 2GGHA 1S3TC 3VILA 4RXFA 4PCNA 5CAHA 1S5MA 1PAMA 4FOUA 1VLWA 1O4UA 2FVMA 1GT8A 3E96A 3W28A 3GH4A 1Z41A 4V1YA 2JF6A 1LBMA 1HNYA 2X40A 3AXKA 3BH4A 3O2LA 1RCXB 3D5HA 3WIJA 1X97A 3DYOA 3A6OA 2XIIA 5HNNA 1VHCA 1HL9A 3T6CA 4DH0A 4GMEA 3KOWA 1W9PA 5JBFA 1MSSA 2P4VA 4GO8A 3IJIA 4BKNA 2J7DA 4P8XA 1PEZA 4PUEA 3AYSA 4CNOA 1EJWC 4AX6A 1WKYA 2G3IA 2QDHA 3QKZA 4GH3A 3EY6A 1OK6A 3KL5A 3PZOA 4N7QA 4O54A 3W73A 3EWCA 3I3DA 1Q63A 2YYUA 3S83A 3PSWA 5FF2A 7TAAA 1GOWA 2V0TA 2QVNA 1AH0A 3MS8A 1FKDA 4JFUA 4IH3A 1LQ2A 3PUDA 3QTPA 1AMKA 4PTMA 3GHSA 5T26A 1KT0A 3GQYA 3PTMA 2FZDA 4R85A 3WQ6A 1SSDA 4AVNA 1H3GA 1Q6RA 4F2TA 2ACRA 3FDKA 3NCOA 1KBBA 3BV4A 1I0BA 1QMLA 4A22A 1VPYA 3VIOA 2E40A 1W1VA 1EHAA 3MSRA 3QHNA 1UH4A 1LBLA 3O6AA 2X0HA 4ADTA 2Q02A 2QCMA 3BQ5A 3M9YA 1T8XA 2RQSA 1YNQA 3BG3A 5G4WA 2DT0A 1SJCA 4Q4MA 1MUMA 5IBXA 2EPLX 3VE7A 3MP4A 1VFUA 3U7VA 2FZBA 3TROA 2O92A 3DU0A 3VOCA 1YNPA 4QRNA 2CKRA 3PZTA 3NA8A 1JAKA 2E9LA 2QJNA 2WWCA 4QJ4B 1MDLA 3NTYA 3CPUA 2HNEA 4GI4A 1X1ZA 1RCOB 1M7JA 1H1NA 4HYVA 2D24A 1FCQA 1RY8A 4ORIA 4Z1YA 1PTGA 4KFNA 1DQWA 2UV8G 3LLXA 4CKQA 1W5QA 3M0LA 2XN1A 1XH2A 1TRDA 4EPDC 1L6WA 1UBSA 3P7YA 1DJXA 1BWVA 1CXIA 1LG2A 5D33A 4W5UA 1YMYA 3T0TA 4DLMA 2BOEX 2QKFA 3RLHA 1BHGA 4ADSA 1UWAA 1I8JA 1W1YA 2NW0A 1BVNP 4DI9A 4QS5A 4XD5A 5FL0A 4WQ6A 2SFPA 4DJFA 3G77A 4BR1A 3IRSA 3UGRA 1FDZA 4MWAD 1FP9A 2IMRA 4F3HA 2HRWA 3VD4A 3RF9A 4B5UA 3ABQA 1LDCA 3K8LA 3DYPA 2H90A 5BRPA 5DO8A 2N87A 3U2ZA 3MO7A 4B92A 1CGWA 1TMQA 5FESA 4GG9A 3GZ3A 4DBDA 1W8GA 2IKJA 5A8PA 4FXSA 4W8LA 3TN3A 2PMQA 1GVEA 3O6YX 4FALA 3O5EA 5E5CA 1SPQA 1W32A 4HARA 2EPHA 2J24A 1UJPA 3GE7A 2Q5AA 2YPIA 3GG1A 4AXKA 1DJHA 2Z1BA 1SFJA 3KVMA 3PBUA 4GD0A 4UWMA 2DSUA 1X96A 1BTCA 3DFQA 4FF7A 2J7CA 4XTIA 3BICA 1YRRA 1OCBA 3O9NA 2ISWA 4GNKB 4TV6A 2HSAA 4CCZA 3VFCA 2I56A 4LF1A 3WMLA 3LENA 1W5NA 3ONBA 4AEFA 4FOJA 3PAJA 3W02A 1VFLA 3W53A 4C6KA 4WZHA 2W6RA 3AZSA 3IHZA 3GRIA 3GIQA 4QS6A 2DSZA 1FWIC 1JPHA 1RQHA 3IVSA 1WYIA 3VABA 1FXQA 2NV9A 3IWPA 2BXZA 3GFYA 3TTEA 3VZXA 2GDVA 1QUMA 2ZICA 3H8AA 4MOZA 2OZ8A 4UQ9A 1OQFA 3NSNA 2QCEA 2B81A 3GIYA 3CGMA 4UTHA 3L9CA 3F2DA 3QLDA 2QCFA 3TAKA 4NQ1A 4AY7A 3LYEA 3NDOA 4PUDA 1F74A 4XIAA 1KM0A 4LAKA 2OZTA 1PJ9A 1H7NA 1OFQA 4X0VA 2BASA 4YXGA 3EOUA 3ZO9A 4QQ3A 1GOQA 2R1PA 2NX3A 3NURA 3FAWA 1VFMA 1T11A 3RMJA 5HJLA 1R30A 3CUXA 3TV8A 3TN4A 1HKWA 4QSFA 3RLGA 4KWSA 3EOLA 4QT2A 2A1YA 4HK5A 3WF3A 4E8GA 4HZMA 3G5EA 5DEZA 1QOQA 3M46A 2HMCA 4YVPA 3GC5A 3HQ1A 2QT3A 2BHZA 3UG5A 3TCZA 4BCEA 1PO9A 3BARA 2M1IA 1HXVA 1XUZA 3KWSA 3WDIA 5AC4A 1ZFJA 4G56A 3S3GA 1NMVA 4KR0B 5LIWX 2FPTA 3VZYA 3ZVHB 1XQLA 2XWEA 1NF7A 1JAEA 3L4WA 2G3JA 3DFSA 3VVGA 3F2BA 4AW7A 3KAIA 5J5RA 4JIIX 3WO8A 3OYXA 1I60A 3I65A 2PDFA 5FA5A 3TEVA 1OFRA 4XWUA 1XYFA 3KEHA 1LBFA 3MYPA 3BW2A 4UFHA 1TTIA 2V63A 2J74A 5JU6A 3TYCA 3PP7A 4UXDA 5AHFA 3WF4A 1AL7A 1RVKA 3W83A 4DUOA 2XN2A 2MLYA 2GJRA 4ZO9A 1PZ1A 3QQWA 2XIJA 4A6GA 3IJLA 1M7PA 4URIA 4JFJA 1WDWA 3HJZA 3OA3A 1XLFA 5FKYA 4DZ2A 3WH0A 2MNTA 3WMSA 3SUTA 1JUEA 4GWEA 4IPXA 4TTGA 3SM0A 2A3AA 4C02B 1GQLA 2EXOA 3UF9A 3UZZA 2GL5A 1J4EA 2PBGA 4LVFA 1E6PA 4H9VA 2WBKA 4O1EA 3POCA 3QYQA 1A53A 3PS7A 4DNHA 3DZ1A 4UFJA 4I7VA 1PKMA 3WFAA 3GTFA 1CXLA 4B5SA 2J75A 4QEEA 5C70A 2ZZ6A 1HTIA 4N9CA 3E2VA 1K8XA 3TW9A 5CGQA 3S9YA 3LI1A 2FDSA 2BY1A 4JKMA 2H6RA 1PHQA 3AIWA 1VBHA 3R8HA 4AWSA 3PTKA 4PR4A 3TC5A 3SBFA 3FS2A 4QZVB 3I7RA 4R7OA 4AEOA 4L1WA 2WHKA 4AYSA 3M6YA 2CLIA 5FJJA 1S5WA 1M65A 1LWJA 5F1VA 4M29A 1TZ9A 3N3TA 4BA0A 2PAJA 1F40A 1JD9A 4GYKA 4KEZA 2YCJA 4GVFA 3WK2A 2FGLA 2QAFA 3HPFA 3URBA 3STFA 4XBJA 2GJXB 3SR7A 1JCNA 5I5RA 1E9IA 4MLJA 4EK7A 1M68A 3E38A 1EA0A 3SFKA 3TR2A 5I24A 1PZ2A 5EMYA 3GTYX 4ML4A 2A85A 3G24A 2PWEA 4LUSA 2X7VA 3N04A 3CV1A 1M7OA 1OINA 3FXGA 2V3EA 3GC4A 3W1LA 2KX9A 4YWSA 3NYDA 4UOJA 5DMYA 1BD0A 4D6EA 3LEPA 4AC7C 1XFCA 3PBVA 2Z6IA 1UROA 2W79A 3B8UA 4F0KA 5EFFA 3IKDA 4LGXA 1ZHAA 3ENLA 1I1WA 4GI9A 4AD0A 3UJEA 4B90A 4PUNA 2GQ9A 1HN1A 4IMEA 1E1CB 2XUCA 2FZNA 2DIJA 5F4WA 5CC7A 4LB4A 1B1YA 4EPKA 3T40A 1RY0A 4S2BA 3VC5A 3BLKA 5CSRA 1PX8A 4HOWA 1XYAA 3HB9A 1XPGA 4XD6A 4DHGA 4B3KA 4DYEA 4JN8A 3UG4A 3I68A 4PMVA 2FTWA 2ZUWA 2OLHA 3UWYA 1I2NA 2NXGA 2VWSA 4C1KA 1D9EA 3PUEA 1GVSA 4WRHA 3F2CA 3KFTA 1XUUA 4R9XA 4KCUA 2DW7A 4D6FA 4Z2HA 4Q4QA 3WUBA 3MANA 1O95A 1P7TA 1QNPA 2CLHA 3QH2A 1RZMA 5HQLA 3AMKA 1IEXA 2WMGA 3B06A 1XG4A 1XH1A 1TUFA 4L4LA 4PL2A 2PSNA 1RAKA 1XLIA 4YYCA 3H6OA 1S1PA 5F2IA 3U9IA 4M6UA 1ZCCA 4UMAA 3A13A 4Y96A 4HNUA 3VKJA 4KMQA 3WYZA 3QOKA 4D6CA 1KC7A 3H53A 4WGXA 4AHPA 2VR4A 3TZNA 1ISYA 4TXEA 3TQKA 1W1TA 1HG3A 2BFGA 3RCMA 3W00A 3LHUA 4HCDA 5M1TA 3PANA 5K9DA 3QZEA 4IFOA 3MMDA 3BCFA 3EXTA 4MZ8A 3UXIA 1K3UA 2GUYA 3L2MA 2R91A 1S5NA 3ECQA 5FAGA 1V3JA 2P1FA 2CLFA 2DIEA 3W72A 1IT7A 1P6CA 3VMPA 3PNUA 1W2VA 2Z2AA 2E0PA 1E72M 3T05A 3GY1A 4GC3A 1XH0A 3EOSA 1ESWA 5DMLA 3PUOA 4ZQPA 4DRPA 4PSPA 2VZVA 3KS5A 1B9BA 1GEQA 3SRHA 2PWGA 1CXHA 1BGGA 1N8IA 1QHOA 1QW7A 3SSJA 4BWLC 3EWBX 2WK2A 1YATA 4LWWA 4RKAA 3RU8X 3H26A 1EDTA 2Z4GA 3LPPA 2VX5A 4RZ5A 2X7WA 4ORMA 3WD1A 1YIXA 3B8TA 3ZT5A 2LPVA 4A8IA 1AK5A 1FKFA 3PPCA 4DZIA 2PWVA 2XPAA 1MUWA 5EA9A 3C2EA 2ZR4A 4MJ2A 4R5EA 3RMEA 5LIXX 4IQDA 2ACUA 5C2GA 2QMKA 2WCAA 3KZPA 1KT1A 3PBYA 3W29A 1B6CA 3GZAA 2E1DA 1EJXC 3RPTA 3ZWSA 3BZJA 4IISA 1LOLA 4W9OA 4IG2A 1XISA 3E74A 3KBNA 2AGTA 2G37A 3IV3A 4GYFA 4F2BA 4HNCA 2E6AA 1UUQA 5ECUA 3AMLA 4KQZA 3WN6A 2GVGA 5EBUA 1B3WA 1FVPA 1L2UA 1PSCA 4JYEA 3MJYA 1KD0A 3N14A 2PV2A 1U5HA 5E09A 3W85A 3LRLA 2FJKA 4FP1A 2PI6A 4K8GA 1OEPA 3WF1A 4ASTA 3IUHA 3I6RA 3N25A 4ROQA 2XINA 4TMBA 1KGWA 2D2HA 3FA3A 4YL2A 5GJNA 1MXSA 4MMWA 1EUAA 1T41A 3B4UA 2OFNA 2P5NA 1FWHC 3LRKA 1TREA 2OQLA 4J3UA 3DFTA 2VURA 2X42A 1O5KA 1Q7ZA 2PFHA 4CEXC 4MWAE 4JTJA 4ZB2A 3FYYA 3W7LA 3TC7A 1SO3A 4N2YA 4IX0A 3TOPA 1JZ6A 4H9YA 2J66A 3R43A 3GX9A 2GFTA 4YIWA 1JIBA 3BXWA 3EMQA 1TG7A 2CLKA 2DSKA 2QDGA 2YL5A 4HMCA 4FNRA 3MHGA 1POKA 2ZX5A 3NGFA 3RJXA 2KFWA 3C4UA 2O9PA 3VMOA 3CUHA 2FDMA 3KRUA 7ENLA 3RM8A 3GVVA 4W7WA 2FMNA 2ZVIA 3DESA 1LZOA 2XZ7A 4F0LA 3K4DA 2FVKA 1JDFA 1YQ2A 5DIVA 1YE6A 3RO6A 4UFKA 3QYSA 1Q1CA 4L1XA 4F9JA 1ZBWA 5FF0A 1QK0A 4GUGA 1RD6A 2VDGA 4OV9A 3ORWA 3WK1A 2X41A 1YE4A 1E1FA 4NSBA 1JVNA 3STCA 3MV11 3W2NA 3CAKA 4IIDA 1EGVA 2VCDA 1TMHA 1JG9A 3H2FA 3P67A 4DJEA 3BAKA 4RE4A 2JQXA 5FOOA 3B7XA 1A5KC 1F3WA 2BX7A 1TZZA 2V82A 3C3UA 1K7FA 4ICMA 4NZJA 1FHLA 4GNVA 3SN0A 3UZWA 1FUYA 5A8OA 4EE9A 1JFHA 4Q6XA 6XIAA 3L7RA 2G41A 2CBVA 1J8VA 4K8HA 4FK9A 4DPPA 1VJSA 3PBMA 5H6HA 3WSUA 3LOTA 3U3HA 1M04A 1OX4B 3NQEA 3L68A 1FWDC 3WELA 3SEPA 3VIMA 2VMFA 5CC6A 4UZSA 1G4EA 1QPOA 5EU9A 4EPBC 5DXYA 1R9YA 1R3VA 3A9BA 1EX5A 1UD4A 1A3HA 3TSBA 4HNOA 1SFLA 3LMZA 1JYWA 4E38A 4PMQA 1Q6GA 4AUBA 1CIUA 1WDQA 2HBXA 1XYCA 1A4LA 1VQTA 3W24A 2WB5A 4RPPA 4GIAA 4C5YA 1FTXA 4XZ9A 1Q8JA 4GXPA 3EWWA 3TN5A 3MWAA 4QHRA 3KW3A 1CGUA 3AROA 5HMSA 3UWVA 3JVAA 4GIEA 1XIGA 4IIEA 3K1DA 4FB7A 2PC8A 1Q8AA 4DY1A 4DPQA 3FGCA 5HT1A 3M5ZA 3QY8A 2Q8ZA 4DZ5A 3WFZA 3VFLA 5LNWA 2PV1A 2YZRA 4FLQA 2VXNA 1VJIA 1M53A 3RCNA 4B5XA 1TPB1 2IS7A 5FSDC 2GJXA 3WK0A 1ISWA 4MNJA 2CERA 3UY8A 1YEYA 3OZPA 3MP5A 1D8CA 1GCYA 3EPOA 1WB0A 3L67A 2ABBA 4DRNA 2XTKA 5E6YA 3ZR6A 1IE7C 1RLCL 2W66A 1UD2A 4BFAA 3ITVA 1IT0A 3EKGA 4CD6A 4UR7A 4HYWA 5CLTA 5D38A 4K1GA 3PJUA 3LLDA 1FWEC 3T09A 1Q13A 1Y7VA 2MPHA 3KAFA 1E0TA 2JF7A 5MKGB 3AALA 2BP1A 1DBTA 3AYRA 4DBWA 4Z2KA 4XX6A 4E8CA 1KWGA 3GVQA 2GK1B 4V33A 3G1RA 2Y1HA 5EMJA 1KXTA 2A21A 4PUJA 3E0FA 3NL5A 1PKLA 1V7AA 2ANUA 3NM3A 5FI8A 3BK0A 3RILA 3MKCA 3CTTA 3LM3A 2P3ZA 4GACA 1PXGA 1CT5A 1X38A 2RGLA 1SFTA 4JYFA 3CZGA 2AGKA 4C6BA 5E0CA 1G5AA 3T2QA 3DUGA 2OT0A 4C7FA 1SYTA 4LQ1A 3POHA 4CQCA 4GABA 3FHAA 3DBPA 3L4ZA 3NQ6A 3GUWA 3FCPA 1TE1A 5JH1A 1W37A 4P7LA 3B03A 4QR6A 2POTA 4D72A 3MP3A 3CMFA 1EGMA 3WQFA 3H4GA 2OELA 3WJXA 1B3OA 3W7OA 3BMWA 2ONEA 2QJGA 3B8SA 1XRFA 1C93A 4EP8C 1V02E 3T0DA 1VCGA 4KFPA 1G7UA 1QPQA 1WZKA 5A95A 1W5OA 2PDKA 2JEQA 3U4FA 3LTSA 1O7AA 3ZT7A 1XX1A 4HD5A 1HJXA 2XP5A 2BHYA 3C52A 4R7WA 2ZX8A 4MKNA 4Q8MA 2DGAA 3MCNA 3CUGA 2D9FA 1J6OA 3SRFA 3RJYA 1EF3A 1TE6A 3I3EA 2TRSA 4PL1A 3KAOA 1W9XA 1NVMA 1PCWA 1D2KA 3WK3A 1TIMA 1AQMA 3HG2A 4HNNA 3VKCA 1H51A 1F3TA 1YLVA 4HVXA 1EP2A 2D69A 1TV7A 2V67A 2BG5A 1J0YA 1ZZMA 4PB3A 2WZMA 2XP8A 4QE4A 1XBZA 3L4YA 2WNNA 5I3KA 3ID7A 2X09A 4DRHA 2PDIA 3O5FA 4PMZA 2EULA 4OBRA 2EAWA 4AZ7A 3IUDA 5G2WA 3O07A 1BRLA 4AZCB 3VD3A 3CHDA 4LCSA 2VD9A 1WCGA 3CMJA 2Y0FA 4BY3A 4C6OA 1NWTA 3QOMA 1EJRC 2F84A 3ABRA 4AZ6A 4TW6A 3I3BA 1WZAA 1JI2A 4Y9AA 3TZFA 3UWWA 1ONWA 4B16A 1MWOA 5I7GA 2XG9A 1XLGA 3C8NA 4AMAA 4HPNA 4FNTA 1N2VA 2CFFA 1L2QA 2PP1A 3TUUA 4DBUA 4XAGA 3C86A 1H5YA 1MUCA 4RDWA 3MZNA 1W0MA 3CLWA 2H8XA 1K8ZA 3N9RA 1FFQA 4MLRA 2XYLA 3E2RA 2JFEX 2J7EA 3DOPA 3ARVA 2CZFA 3VCNA 1F6YA 3TTQA 7PTDA 1IXQA 4L65A 1GWJA 3RM9A 3CASA 4J3XA 2KO7A 1ZAHA 1E15A 1GHRA 3FIGA 4IUOA 1A3XA 4QTGA 2QS8A 3ARPA 3H9RB 5A6JA 3VKDA 2V8ZA 4LBUA 4DN1A 2PPOA 4QDWA 1LL4A 1OC7A 3AFBA 1QNVA 3VXGA 5D03A 1X6LA 3BURA 2VN1A 5CJMA 4LYKA 4CN1A 1XC6A 4A3UA 3T0AA 4FLSA 4GH1A 3ZVIA 3SZ8A 2TMDA 1Z69A 3W74A 1LOSA 5SWUA 5EBAA 3MUXA 1Z44A 3TYZA 2PCEA 1D3HA 1AJZA 4DX3A 5ABEA 1GOOA 3ZR4A 1A5CA 4AU0A 3V16A 4U31A 3SECA 5AYBA 3GG8A 5GNYA 1FBAA 1CNVA 3WQWA 1M1BA 4LAVA 2XFYA 1LORA 4NL1A 3SGGA 1XRSA 4J9JA 3F03K 5L6UA 4FSAA 2GUUA 3RO8A 2DEPA 4S3FA 4DQWA 3N12A 4UQCA 4H9UA 5AVNA 1GKRA 2BY2A 1ONXA 4JTFA 4B4HA 1LUCB 5F2GA 1W56A 3NQCA 1NEYA 1UZ1A 2CZVA 3HPZA 5I2UA 2NVAA 3GS6A 2C18A 3DAQA 4PUMA 1JZ4A 4QG9A 2ZA1A 2PDLA 1N8WA 5I0DA 4JN6A 3THAA 4JIRA 3FX4A 2V30A 1LL6A 4RXGA 1KV5A 4HZ6A 2PZNA 3R58A 3S42A 3LCWA 5C0QA 1KM6A 4W85A 3DCPA 3CQKA 1V93A 1QI4A 1GW1A 5HTGA 3Q65A 1FKHA 4IIFA 1FWRA 2ALDA 1OT2A 4IL2A 1M41A 3CYJA 2ZRWA 1SR9A 3BANA 4BQ5A 2Z7KA 2J6VA 2TYSA 2WSRA 1W3LA 5HMEA 5AB3A 1L6FA 4N0RA 1OSEA 4INFA 3T81A 4JTQA 4GRSA 4EVZA 4K39A 2ZOXA 3UG3A 2G95A 3T4WA 2NXIA 2J4GA 1UZDA 1XIDA 2A6NA 2QDEA 2ZCGA 1MXGA 2NT0A 1VR6A 1OFDA 4QROA 4AF0B 5BMXA 5BRBA 1EQPA 2I1OA 1M5WA 5FJTA 3HA1A 3VYLA 5I78A 3WBXA 4G2DA 3NVDA 1TA3A 3ZOAA 3IS4A 3PF3A 4S3BA 1UC4A 3OZMA 1TJ0A 3MSGA 2QR6A 3MBDA 2HXTA 5C9WA 2WNQA 6TIMA 1EC9A 1F7BA 4PTDA 1OX4A 3TU9A 4REQA 2YR1A 4OHQA 4AIUA 1BYBA 3EDDA 3R6IA 2L2SA 2YDSA 4ACYA 1K03A 2PGEA 1TTJA 4V15A 2PS2A 4QITA 4DWSA 2OYKA 1KM4A 5HXMA 2VZOA 3WUFA 1Q66A 3K8KA 1B0IA 5KETA 4HGXA 2OYMA 1DHKA 1LQAA 1OD8A 1UCWA 3KTXA 1E0VA 3SRDA 1YBQA 5M03A 1CLXA 1FY6A 1U30A 3L4XA 3NQFA 1NM9A 1HKKA 4WJXA 2ON3A 4C65A 3U7BA 1AMYA 5JVLA 1EQCA 4FOKA 3NI6A 4CNNA 4H2CA 2BVYA 1V0KA 2ZDSA 3T44A 4CCDA 3SCUA 2Y7GA 4MAZA 1J2WA 3STGA 5HUPA 3BTNA 3TYEA 3GU0A 3NQGA 3NZPA 1HX0A 2PTDA 3IIZA 2IW0A 2Q3RA 1UJQA 2ABAA 3G2GA 4IWWA 4XKYA 3RX2A 3SQSA 3LLFA 4I3GA 1T40A 1XL9A 2UY3A 1OG0A 2Z1WA 1R8LA 1E9YB 2J7FA 1G0CA 1G4TA 4NZFA 2DZTA 1UD6A 2YW4A 3WEZA 2O9OA 3WQ4A 3ZQ9A 3BL3A 1W3IA 4OUIA 5B80A 2AL1A 1ZBCA 3FSUA 2DDXA 2ZIDA 1X1OA 5D05A 1Z8AA 3CMGA 4O12A 3W25A 2XVKA 5LNUA 3GW3A 5HUOA 3WLIA 1MVYA 3OBKA 5IFPA 2NT1A 4GQBA 3N19B 4EIVA 2V5DA 3PVFA 4GGQA 4JTSA 4DUXA 2OVLA 4UMBA 1S2UA 1A47A 5IBXC 3EYPA 3TA6A 2RDWA 1KFJA 3C2OA 3ODKA 1NH6A 3WLNA 1RUSA 1QBAA 4R7JA 5EMKA 2VKZG 2QCLA 3W26A 1GEHA 4M3PA 3ZLFA 3O5DA 1TPWA 2FTYA 3L66A 3P2VA 3H7VA 3QPZA 1KW1A 3CM4A 3TMQA 2HE8A 1QR7A 1TR1A 1OGBA 2J9YA 1C90A 3O6DA 3N18A 3VNYA 4QX4A 1MZHA 3A24A 3U5UA 1WDSA 1H49A 5AC7A 1VHNA 3DG7A 5FAJA 1KKRA 5BOEA 2DUXA 4MY9A 4FR1A 2BDQA 2V6AA 3ME3A 3FEQA 3E6EA 3GHRA 1FDJA 1BWKA 2PPNA 4A05A 4W86A 1F9CA 1TJ2A 1SW7A 4H2HA 3KZSA 4CQDA 1VBGA 2C1GA 1R87A 3N2CA 2OOGA 3T4CA 2WMHA 1F8MA 2UWFA 3C0QA 4DJFC 4GQGA 3M0YA 2F4EA 5C5YA 2KI3A 4JX4A 5C8BB 3MC5A 1HO4A 1J5TA 3FOKA 3P62A 3TQPA 4AEEA 3S2LA 2B4GA 1W9BM 3CHCA 3WJZA 2REQB 3RIKA 1E71M 2J77A 3S2CA 3V5FA 2ZE0A 1UPMB 3B0XA 3GBDA 4JTEA 1UH2A 2OODA 3KP1A 2XU2A 1EZ2A 4HHMA 1JVWA 1TSIA 2QULA 1PIIA 3W7RA 3CZLA 5I3IA 5I79A 4S23A 1AZ2A 3WDJA 1GZ1A 3S1XA 3OQ8A 4FNQA 1YYAA 1J0JA 2VWTA 1ISXA 3RITA 5G4EA 1AW2A 4IMGA 1MW1A 5BWFA 1YXCA 2OWCA 1UKTA 3G1YA 3T8QA 2Q8LA 2I57A 5HUAA 1K6WA 2EEXA 1L0PA 4WSKA 3EEZA 2DJXA 4M1RA 2OWXA 4DEFA 3CUFA 4KFOA 3JYMA 1MEWA 2VR2A 5D2WA 1JUBA 3IACA 1MO0A 3RK8A 1EL3A 4NI3A 3GDBA 1VCFA 4FNUA 4PZVA 3UESA 2Y89A 4AH7A 4D71A 1WQ5A 1JPDX 2VX6A 4G9PA 5A2CA 1TV4A 2WV8A 4NNBA 1E0XA 2DZPA 2V2DA 2VC9A 2Q01A 2FMOA 4KRTA 2VUNA 1MMFA 2PDJA 3KDOA 4HHPA 2O7QA 2R24A 3P0WA 3HIJA 3USZA 2CLLA 3W7KA 4ZFMA 1R7OA 2UY4A 2IXUA 2ZX9A 3KVJA 3BMVA 1IIHA 1A5OC 3MDWA 2XGIA 4DF2A 3PJTA 1OFEA 1ICPA 2F2DA 3KXQA 1KXVA 5HQMA 4JTAA 3N17A 2EPMX 1YDOA 2A7NA 5CQ1A 5HULA 3CUIA 1NWSA 4YTQA 1HVQA 3CU2A 4UTTA 4JIEA 1Z9AA 3M0HA 2VRJA 4LU0A 3W76A 2WM1A 4XTDA 2CLEA 4LAMA 1XBYA 3SURA 1MQQA 4IUGA 1EF2A 2G4FA 4MJ4A 1GJWA 2CHRA 1FHVA 2G8ZA 3HFYA 1EZWA 1NFPA 4UIOA 1EH9A 3D6NA 2PLMA 2IPFA 1YPFA 4ENLA 3W7IA 3A4XA 1E5JA 3R8RA 3HV8A 3PRBA 2MLZA 3H23A 1RA0A 3EPMA 4ODLA 4E2OA 4Q8PA 4CQBA 2F9RA 1ENUA 2F38A 3LHTA 3TE9A 5JQ9A 3CZ8A 3NDZA 1JYVA 3L4TA 1T96A 3KOYA 3NZGA 2GGEA 3B05A 3VOHA 2ZA2A 1GVRA 4U5KA 6REQB 5D2VA 1UZHA 3W27A 4Z42C 4BQ4A 4AISA 1HKVA 4QCEA 2BVTA 3UNTA 3WNNA 1PTDA 2Y4SA 1XDLA 4O10A 1H7OA 2CU0A 3BG5A 1PIFA 1NWRA 3WNPA 3GNPA 7REQB 1AZ1A 5K4XA 1OT1A 1R6WA 2AQVA 4YN5A 4WCJA 3GU1A 1SZFA 2H9AB 5BXPA 1QDSA 1LL7A 3HPAA 2XVNA 4TU1A 2J9ZA 3M0VA 2OR2A 3P0XA 2VFDA 3CLMA 1ME8A 1LTDA 2AQWA 4U3CA 3F5LA 5JH2A 4FF5A 1H7WA 4UTUA 3VMNA 3OHMB 3QMTA 3BLFA 4FN2A 4MFDA 2F7FA 3QHOA 1GVYA 1V6XA 2QDDA 1WXZA 3CL6A 1WP6A 5ABHA 2E6YA 3L21A 4BWLA 1HJSA 4CUCA 2A5HA 1W1A1 1CEOA 1EOKA 1KLYA 2XVLA 1DHPA 2IPWA 4GUJA 4ERAA 1J5SA 3TFXA 2ZUVA 3CYVA 1JNDA 2D2GA 2ZYFA 4GIVA 3BV7A 1T8QA 4UUIA 1GYMA 5HANA 1BKFA 4MWAA 1QHPA 1W31A 3B0UX 2I5QA 3PC0A 1XIJA 3MYOA 1LLOA 2WMFA 4PFMA 5LKYA 3GTNA 5HPCA 4JFTA 1PINA 4LH8A 3FVDA 2Z24A 1XCWA 3I4EA 4XQ6A 4XZMX 4NXSA 3FDGA 1EP3A 3LB0A 3N29A 3M0KA 3KTSA 3OVQA 4K6AA 4CN6A 1N7KA 1XLCA 4E3VA 1JD7A 1BG9A 3Q45A 2Y6ZA 4PBGA 1WKFA 5LA2A 3W22A 3T55A 3OIHA 3H2NA 4B3LA 4PUWA 2PE4A 3UVAA 3JZUA 3AICA 1ICSA 3IK2A 2ESCA 2IKGA 2ODOA 1CZ1A 3MUCA 4Z08A 4NZCA 1SFSA 1KBIA 3T0BA 1W17A 4ACZA 4LXFA 2O4MA 1DIOA 2GZXA 4AXNA 1I6NA 4D8AA 1IZCA 2CZDA 2E1WA 1AD1A 2YCEA 3W6LA 1QNRA 1P5BA 3F4NA 4RJEA 2VQTA 2PLJA 4MNLA 4BEUA 1EO5A 2NUYA 2YDRA 5AHMA 4AD2A 5G1YA 2YCLB 4LYRA 1EO7A 3O5PA 3NQBA 4MGGA 3PZUA 5F2MA 2PU1A 1IIGA 3BPWA 3WD0A 4R3UA 5CEWA 4GY0A 4JNZA 5LSMA 2NWRA 4PEKA 4WOQA 3UZJA 3T9PA 2IXVA 5IXEA 3HQOA 4B4FA 1QOXA 4IJRA 1V4YA 4FHAA 1TELA 3GSMA 4M6QA 4NNRA 5HW6A 3UXKA 4GJJA 4JIHA 4O19A 4S1FA 1V08A 1JPKA 1TV2A 5A8NA 3N4AA 5G2IA 3GIPA 1TTQA 1QHZA 2HTMA 4JTUA 4LC8A 5I3GA 4KKXA 3EDEA 1PCKA 3ARZA 2ZQVA 3NJ3A 5TBOA 1HT6A 2INEA 4I90A 1PE1A 1TKKA 3CEUA 3HQNA 3SJNA 3N15A 5HWBA 2YXOA 4UOQA 5TQLA 3JR2A 1EYMA 1ZB5A 5I3HA 4JCMA 1FKGA 4IGNA 3QPEA 3WQEA 3NEVA 4L72B 6TAAA 3A3HA 2G0WA 3TCEA 2HVMA 3BMXA 3DGBA 1IF2A 1UPPA 1YKWA 2F6XA 2VHLA 1AG1O 4J4NA 1IX5A 1P43A 1XKYA 5EMLA 4WEVX 3M7SA 4O53A 4P2VA 1D7IA 3OTRA 4O2TA 2GOKA 3MU7A 4WK9A 4PCTA 2UBPC 1UR8A 4MHBA 2ZWZA 2CESA 1GG0A 1PUDA 4DJFD 3LNMA 3VOIA 2NXHA 1XLHA 1UIPA 1RJPA 5DF0A 4EKJA 3GO2A 1RVGA 3W86A 2NV2A 2QJJA 3C3NA 2FAPA 4ADUA 5LGZA 2IQ0A 1QWKA 1IEVA 1QI0A 4NVTA 2QJIA 4GGBA 5AC5A 1HO1A 2DY3A 4I9MA 3W71A 2YBUA 3W88A 1DVJA 4FX8A 3V18A 3K30A 5D09A 3FJNA 4AVFA 2VGFA 2Q8XA 3KBVA 4F0MA 4WXZA 3V4BA 2E6DA 2QUVA 4MDOA 3EOEA 2GPTA 1RP8A 3VKBA 1TWWA 3FSTA 4F0SA 2RJHA 4YYFA 4IIHA 3GG7A 3C0LA 3O6CA 3SCVA 4H9ZA 2PUZA 2CHOA 5XIAA 1OJXA 2QMJA 3SJ3A 5GQBA 1E51A 4GUFA 1R3SA 4W8BA 3PPFA 4LYQA 2FZMA 3MUAA 4K3ZA 1P6BA 3N1AA 4JBRA 4L3NA 1ISZA 4FPSA 2QXWA 3OLGA 2VT0A 3ITYA 1XLJA 1T0OA 4QXIA 2E5BA 3BGGA 2TODA 3S4TA 2OWWA 4ZSUA 2E09A 1TPVA 1US3A 3LTYA 5AHNA 4N9EA 4JN7A 3SDOA 1ONEA 3VUPA 2Y63A 1SZRA 1UB3A 5BRQA 2F23A 1HVXA 2L5HA 3CO4A 3LY0A 4FZIA 4Z2GA 4Y9MA 4TIMA 1V02A 4MAVA 2Z28A 1JGMA 2X1UA 1M03A 4B5VA 1EJSC 1OZMA 2RUSA 4O1DA 3CTLA 4XBKA 2VZSA 3B0YA 2YB1A 4Q4OA 3HN3A 5CC3A 1GHSA 1IXPA 3ISIX 1C29A 3ALFA 2DZVA 3A23A 2WVTA 4PRTA 5A5WA 4Q33A 3UR7A 3VIJA 1FKXA 4GISA 3UXDA 1BYCA 2R1MA 4C7DA 4ATLA 2H3DA 1QJWA 4J1OA 2C91A 3GU2A 3FA4A 1ODUA 2OEKA 2DU2A 1ZLPA 1XP3A 2OU4A 1LP6A 4IMCA 4ZCWA 4AG0A 5C9RA 4M51A 2VOMA 4AX7A 3LBMA 4EXQA 3AJ7A 4HPGA 1KM5A 4NJIA 4XD3A 3DG6A 3CHFA 3ANVA 3H4WA 2GWNA 3DEQA 3WG6A 3PAOA 4TNSA 4FXFA 4NIRA 2RURA 4KCTA 3P5ZA 2ZXQA 2YA2A 4H8NA 3KAHA 1KRBC 3AWOA 5JXQA 4QE5A 1PB0A 4CGTA 1WA3A 1AJ0A 1KFLA 1ZCNA 4JR5A 3NL6A 4PTWA 2G3NA 4XAPA 2XIMA 2H8ZA 3I4KA 1UWRA 4KIEA 1TVPA 1NMWA 5LNRA 2FHFA 2ZC1A 2QCGA 3OLIA 3TQ0A 4G7EB 2F2HA 3FW6A 1FAPA 3QZAA 2ADAA 4IL0A 1F4HA 1JPIA 4K8EA 4PCSA 4V1XA 3KRSA 3W84A 4W93A 2YZ5A 1FWCC 1TPC1 5HWCA 4C1LA 1P5QA 4LEFA 1DJYA 3GC2A 5A8MA 2OXNA 4BQ2A 2ZTJA 5GJPA 3K8MA 3R10A 1C8XA 5KINA 1OK4A 1WE5A 2CZ5A 3LS9A 7REQA 1REQA 2INFA 4S3EA 4NILA 3WUEA 3QQ1A 5BU9A 2HXUA 4JOMA 3BG9A 1WUEA 1BAGA 1DXIA 2YL9A 2ISVA 3IKGA 1WOAA 4IP7A 2QAPA 3LGDA 1GQNA 2C1IA 5G4HC 2XFRA 1VP5A 1X39A 2GGIA 2R94A 3RDKA 4LVGA 4JEQA 3H4XA 3M5YA 2E77A 1KQYA 3B40A 4L64A 4O0ZA 4GNJA 5CZJA 4L6DA 5C7VA 1RP9A 1PIGA 4KF1A 1LF1A 2ALRA 3LI0A 2PDGA 2QJHA 2OPJA 4O57A 1YHTA 4IT4A 1N82A 1L6GA 3P8IA 4R53A 1TWZA 2JK2A 1G7VA 1NF0A 2QQ6A 3B9OA 4AIBA 3UA3A 4DYJA 2UZ9A 3G3DA 4GYJA 4IGSA 4OZOA 4L6OA 3W87A 4Z2JA 4NNAA 4PN2A 3PHAA 4D6DA 3UWQA 2A3CA 3SUUA 3PBWA 2ZA3A 4WGHA 1OF6A 1XLAA 4Z1DA 4W9PA 4MYAA 2C1HA 3GNNA 2E68A 3VU2A 4M56A 5JH8A 2IQDA 1OFAA 2ZQUA 1XPYA 3UZ5A 1KGUA 3F7JA 3VNMA 2PPPA 2P10A 3DX5A 1HJUA 4HJWA 4BQ3A 1FKIA 4H6EA 5DRCA 3TYBA 3OZYA 4CN4A 5HW8A 1XC4A 2PP3A 2VEFA 3W3OA 4UFIA 2LLEA 3VIKA 4XVEA 3MDUA 4ZOEA 3IANA 3DGRA 4IFKB 1W91A 1AW5A 3HGSA 1PDYA 2VEGA 1XSIA 1E4IA 2FQIA 3ITOA 1OBAA 1P0EA 2I9UA 4IXXA 4D1JA 3WENA 3S47A 4QP0A 4POCA 4UNLA 3CL8A 4MADA 3UW6A 3W23A 1R9HA 4QDPA 3ZT6A 3UI4A 3SGZA 1KXHA 2XN0A 3MT1A 3TJLA 1FKWA 5HK4A 1WDRA 1TR9A 4JQ1A 3WMCA 3LUTA 2DVTA 1XRTA 2I17A 1CBGA 2DSWA 2NX9A 5I98A 1YNYA 2XVGA 1ZTVA 4JDYA 3A3XA 2OO0A 4B9YA 4ZL1A 1XGZA 2XSXA 3B4YA 1XJBA 4Y90A 1EGZA 3BSHA 2ATMA 3QSTA 1K1DA 3KHJA 3OP2A 4MVAA 5E70A 3JUGA 4GKLA 1PS9A 2YFNA 4X2RA 2I5GA 1PHWA 4OU1A 1AUSL 4O1CA 1K9FA 4ODOA 3DC0A 3LGEA 3OGRA 1M9HA 1QASA 2JKPA 4BF7A 1CXFA 3W1MA 2HDJA 3NOYA 3SCPA 1UKSA 3OYZA 2ZQSA 4CNTA 4N9DA 5DBTA 5ECVA 2WPGA 2MNRA 3S0CA 1EYEA 3C6CA 2QPUA 3CAWA 1K8YA 4DO6A 4K2SA 3SFWA 3F4WA 3N73A 1MEIA 4WD0A 1AODA 4NYUA 1QI3A 4DB7A 3K4WA 8TIMA 2HROA 4Q6JA 4ECLA 4NZ5A 2DQXA 2FFCA 2ACQA 1C91A 4BZYA 3W38A 3OIXA 1XXXA 4HA4A 2OOFA 4IF2A 2Y61A 2CXEA 4I6VA 2JKAA 5AHEA 4ZO8A 4AIEA 2Z27A 2B7NA 1LROA 1EDQA 4PRWA 3REQB 3OVPA 3INPA 4FI4A 4WOZA 4H3DA 2FZ9A 1IWBA 1AFSA 1B30A 4JTLA 4AFYA 3IJ6A 1Q4WA 4OBSA 1F4AA 4PUKA 1KQZA 2QUMA 2DT3A 4KESA 1GZGA 2NZLA 3NSMA 4P5UA 3FK4A 3N9KA 3MMUA 4KRUA 3CQ0A 2DZBA 3HPSA 5JMUA 2ZC8A 3SAZA 2XPKA 5A8GA 3QW4B 2YA0A 1ZY9A 3RYSA 1SM9A 4NASA 2CYGA 2D73A 3PG8A 1RR2A 2WJDA 1V51A 3AXMA 3U2CA 3RX4A 3MZ2A 3BSMA 1D8WA 3RXZA 2Y2WA 2W91A 3TNOA 4MUZA 1EFZA 2E28A 3FNDA 4ZBCA 2V3DA 4L4PA 1FKTA 1FCBA 1GVOA 1G67A 3GKFA 3CGTA 3NQ8A 1LJYA 5FSEC 3LQLA 1DWAM 4ZTYA 2EJAA 3GH5A 4TO8A 4NJKA 4LUSB 1J4RA 3W6YA 1GQJA 3S5YA 3M4HA 2ZFAA 2ZRUA 4MPQA 2A4AA 1RK6A 2IUZA 3HZ3A 4AVOA 1Q6LA 3UA4A 4AWEA 1C8VA 1TX0A 3LNPA 3K1GA 1DQXA 5F4XA 4O28A 1WKEA 5AZ1A 2C19A 4Q8OA 5EFDA 3CWOX 1GRJA 3IAQA 3UWEA 2X05A 3GWQA 3UXLA 4CQ8A 4LVDA 4UQEA 3O06A 3C61A 4GFSA 1V6VA 4WX2A 4UNIA 1RH9A 1JZ7A 4N02A 4GI6A 3LPFA 2QCDA 2KGJA 3AIBA 4C91A 4BI5A 3BJFA 5KMYA 2QV4A 4OTKA 1W9VA 3W2UA 3LHVA 4A8NA 2W62A 3WLLA 2Z2UA 4RNIA 4A3QA 5CZSA 4JZ5A 1FKKA 4A4AA 2WMIA 4PGLA 4U2YA 1P7TB 1YDNA 2QIIA 2GSEA 4XO6A 1JDEA 2WJFA 2PDWA 3S5NA 4EF9A 4DXVA 3ZLGA 3N3MA 4HCLA 4L4OA 4GZIA 3APTA 3GYEA 1PYMA 3PPHA 1CGTA 4WDTA 3AMCA 1VIWA 1W3HA 1A7XA 3GXPA 3VNZA 2QZRA 4L56A 2J25A 5GPRA 4I7WA 4Q7IA 3E0VA 1YX1A 5D02A 4AD1A 4GY7A 1Z48A 1ROTA 1YXDA 3JW7A 1KTNA 4IMAA 3TJXA 3ANYA 4AYGA 3WFLA 1C3FA 4G7EA 4HU3A 3TLLA 1J10A 3HURA 2ZXBA 4L6HA 2ZZ5A 3JXVA 3WQDA 1XKJA 2HEJA 3WBWA 1LYXA 3KBSA 1ML1A 2GUBA 4L61A 4EF8A 1MQPA 2YCIX 1N55A 4IP4A 3QKEA 1J0IA 4J3TA 4P8VA 4DJED 4TX8A 4DM1A 4BJHA 1VEPA 4G5DA 3WLQA 4J3WA 3WLJA 1RCQA 3CAQA 3TWAA 4UDMA 5DITA 2GQ8A 4FNSA 3VOJA 1IEIA 1Z3NA 4TVCA 3N6JA 4C60A 3GBEA 4KGJA 1EJ7L 4DZAA 4WDWA 2NQLA 1AL8A 3U0HA 3QEZA 3GB6A 2LKNA 4JYSA 2OG9A 1UW9A 4DRQA 2BMBA 3ITXA 2P0IA 3IGHX 2W92A 4FR6A 1X6NA 3NVTA 1DJIA 1EIXA 5K9CA 4CD5A 2NQZA 3VDCA 3LHZA 1RXOB 4XZWA 4LANA 2J78A 4YLWA 2PP0A 4NX5A 4F0HA 4CU6A 4DWSC 3S9ZA 2DUAA 3GUGA 4IG2B 3SIMA 3CUZA 3ELFA 4GIYA 2R9RA 2Z00A 2ZZ2A 5H91A 8XIAA 1J2BA 1V79A 1UWTA 2P0OA 3I10A 5FJUA 1UP3A 4MZYA 4MB4A 3B0VC 2PDMA 3VOFA 3SB0A 1F5ZA 4HN8A 1P6WA 1POJA 4G2PA 1BYAA 1MZRA 2O7SA 5LIKX 1EBHA 3MBFA 2ISSA 3KTCA 5BXTA 2J79A 4D1IA 1ZSXA 3LXCA 4TTUA 1P4CA 3QLLA 2VENA 4RW5A 4JIPA 2A7RA 2PDQA 4DBEA 1J6PA 4E0CA 3LA4A 4JL2A 2OLAA 2R1KA 4HBEA 2AMXA 3U6WA 4KERA 4DM2A 3L5AA 1EIBA 4DIPA 2V38A 5BNKA 2NWSA 3CH0A 4MB5A 1J01A 1GGOA 5BMWA 4DUVA 2DH2A 4RL3A 4IFKA 4Z0SA 8RUCA 1OIMA 1FHDA 5G5IA 1J93A 5D9OA 1DQUA 1UWQA 5HWNA 1XDJA 4AY1A 1A5MC 3DHDA 3W7PA 3AWNA 4A21A 1DXFA 3QGVA 3UD6A 1MQRA 3QVQA 1U22A 3OOQA 2QV5A 4OE7A 3LPOA 1B4EA 4HYRA 3WEOA 3MO4A 4NAEA 3TW6A 4AY8A 2PC4A 1TJRA 4Y9NA 1FKBA 1JXJA 3TCSA 3B8DA 1DE6A 3WD4A 2F21A 2I14A 4ZOAA 1KFBA 3C8FA 1EDGA 3W7CA 2VO5A 2A6LA 3B0PA 2YL8A 3W7GA 5C9XA 3H2CA 2Z1VA 2GSJA 1J4IA 3PFMA 1O1ZA 3L2LA 3ZXWA 2C8NA 3NSXA 4O16A 3H54A 1X98A 3PB2A 4KWOA 4I6KA 3GVGA 3QW3A 1YDVA 3LK6A 3K5XA 3MI3A 3SN1A 2W4XA 4ZO6A 4RW3A 1S2TA 3BMBA 5E0FA 1RBOB 1EEPA 4WKFA 1FWBC 4FX6M 3GTHA 4LAYA 4LRTA 1LWIA 3H2OA 3BO9A 3WLHA 1XLEA 2V81A 2EPOA 2OGJA 1ZENA 2A3BA 1QW8A 1ZU8A 5I6SA 4MKSA 3AIVA 3FKRA 1HJWA 4D6JA 4NAFB 1BF2A 1OGSA 4KEUA 4J3VA 3V75A 1BKHA 3FAPA 9RUBA 3O1NA 2QUUA 3LERA 3URNA 2UY2A 1E0WA 2GQAA 2PTXA 1M3UA 1VRDA 3S5SA 3BAIA 3ZWTA 5DRIA 3N4FA 2W9MA 3ARTA 1QAPA 4O17A 2NVDA 4YTUA 3PRAA 3R79A 3VGBA 3AS1A 4R0XA 1KV8A 2YSWA 5CSUA 2E7FA 3DFYA 3N2XA 4F2UA 1BKSA 2Q3OA 2WCGA 3MMTA 4QQUA 5CPLA 3GVRA 3H7UA 3PWGA 2BODX 3P74A 2DPEA 1L8PA 1M5YA 4KBXA 2VZTA 2PGRA 1I75A 1CX9A 4JHZA 1CTNA 4A8LA 1KTCA 3W7JA 5KITA 1E4LA 3REQA 3PWAA 4BEQA 2EG7A 3TDFA 5REQA 4F0RA 2D0HA 4US6A 1XHGA 3QJAA 2C15A 4EWJA 1C9HA 1YPXA 5AHIA 3CUJA 4ATDA 5CSYA 2VDHA 3DN5A 1HL2A 4DF0A 2ZXAA 4JFIA 2VGGA 3WNOA 3FGCB 1KTBA 5BOOA 1A0DA 1D3GA 3EX1A 1JNEA 3TIMA 1CENA 2RAGA 1PPIA 4UTWC 1SZNA 4UTMA 1TUXA 4E5TA 5BCAA 2HNHA 4WXYA 4WLCA 3IJDA 2FIQA 2WC4A 4P61A 1XQKA 2HV5A 3LCFA 4J3SA 1XI3A 3F4CA 5A6SA 4LV9A 1CGYA 1ZALA 1H41A 1NOWA 1U33A 1OD0A 3W1UA 4LV4A 3ICJA 2ISFA 5CG7A 1EKOA 1E1EA 4ZOCA 4IFRA 2KAUC 1ECEA 4LUYA 2AAMA 4V2XA 4DO7A 2HVOA 3CC1A 2PURA 4RE2A 3S6OA 3ZMRA 1Z42A 4ICNA 4ZS6A 4U85A 1SO4A 2AL2B 2FYMA 2VELA 4J28A 4UTTC 3TTOA 1J0KA 2PU0A 2OYLA 4GHRA 1TJ1A 5CPOA 1GPWA 1W9UA 1ODZA 4OGZA 3M16A 2QPXA 3CXOA 4PMUA 4L80A 4Y9PA 4C6MA 3VTRA 4A3YA 2MUCA 1UKQA 1V6UA 5LYRA 4W88A 4X0NA 4LVBA 3FJ6A 4Q3MA 2NV1A 2X8RA 3CHVA 1JXKA 3GYCA 1AQHA 4D8ZA 2X2YA 4Y8FA 1PX4A 2RHGA 2A3EA 1OM0A 1NP2A 3BZGA 4RNJA 1YXYA 1XS2A 4FS9A 1O60A 4ALDA 5KZDA 4TYOA 3EA3A 1OB0A 4LNYA 1W3KA 1VBUA 1OYAA 4JHMA 1BG4A 1BTMA 4QCFA 3KP0A 3WZ0E 4MDPA 4Q32A 1E6ZA 3NEHA 2PDXA 2GGJA 1UR1A 2YA1A 4ES4A 5A2BA 1K7XA 1VJZA 4IGMA 4J3ZA 4D2JA 1W3NA 1LCOA 3FFSA 3GHTA 4KWWA 3TYUA 1QFEA 3ABOA 4QJ3B 3VA8A 2EKGA 3CQHA 8A3HA 4MNKA 5BYWA 3R13A 1JI1A 4HNTA 1E55A 3DENA 1DP0A 2X0YA 2P88A 3IIPA 3VCRA 3SO7A 3UJFA 3W1QA 3LTPA 1E6XM 3M47A 3TN6A 4H9MA 1IXOA 3AHZA 3UI5A 1KFKA 1WXJA 4L7ZA 6A3HA 4LEQA 3EB2A 2A79A 3UCDA 1CI1A 1U1JA 2BXYA 2MANA 1A5AA 4XZNX 4KWUA 3GFZA 1LQ0A 1MRAA 2QGHA 4ONVA 2RFGA 3EWXA 3EKLA 1I2OA 4ML9A 1RV8A 3WBYA 4FO4A 3N11A 3L12A 1BRLB 4G1NA 4HMDA 1IEWA 4V28A 2Z1XA 1DJGA 1BSIA 4PSRA 3SGUA 2W27A 1LRNA 2KR7A 3GHUA 3N2OA 5EYWA 1QRQA 2P8CA 5FEZA 4DAFA 2J9XA 5TIMA 3AIEA 3EXSA 6PTDA 1LT7A 1J0HA 1QPKA 2XM1A 4LS0A 1U1UA 1ITUA 3IIXA 2RDUA 1MFVA 1TV8A 2CITA 2YX0A 3H2AA 4Q8UA 5HNTA 3OPSA 4MWAC 3UCQA 4F48A 3OO2A 1L6YA 1C9DA 1HQTA 2E6FA 4E4FA 3E0LA 1UP2A 2VFEA 3UERA 1DWGM 3NWRA 2Y5EA 3SCOA 3N2MA 1ITCA 1NDWA 3ZR5A 3OZOA 4CNUA 2ZZ1A 5CH9A 1B57A 3ZSTA 3AS2A 3D46A 5B7YA 4QG6A 2A3LA 2D3LA 4J7RA 2UZ5A 3LZ5A 4HIBA 4NG3A 5A6MA 3NYZA 4JNMA 4GK8A 5HINA 4H4IA 3QY7A 3TWBA 2VC5A 1YTEA 4ZODA 3USBA 1KA9F 5IOBA 3GDMA 4WF7A 3OLEA 4WDUA 4HP5A 3V35A 1GYNA 5RUBA 5T9BG 4S3GA 2PTWA 4L9YA 3GW0A 3GFXA 1B3VA 4PRRA 1ME9A 4WY0A 3VGFA 3G18A 5DXXA 3E1F1 4IPLA 3D3AA 4JFSA 3B97A 3DI0A 1OWQA 3NPWA 3RHGA 3FN9A 1F61A 4XIMA 2QEZA 1O66A 4TR9A 1H63A 3PJXA 2P8BA 3NAVA 3E0IA 1H61A 3DBNA 1W2PA 3IGSA 5IFTA 1KXQA 1AA1B 3WJSA 3G8EA 4JICA 5DT7A 4XAZA 4U5IA 1XYZA 2Y8VA 5U7SA 3GAYA 1WDPA 2C7FA 1F07A 3CV2A 4GBUA 4K7YA 1H7RA 4O0QA 1VENA 3QR0A 5AY7A 1OY0A 3THDA 1DPMA 1EYWA 1HP4A 4JDBA 4F79A 1NAL1 1LT8A 3GR4A 4LS2A 1PKNA 3WQGA 1QPNA 2V5KA 5MHBA 1GYLA 4YCPA 3E2SA 3W7DA 1K02A 5EB8A 3ZJKA 4HHLA 4G50A 4GUHA 4W87A 1Q6DA 4DLFA 3TW7A 4J35A 4ZQMA 2CLOA 4O1AA 3CBWA 3MKVA 1KWKA 1YTKA 2PCQA 3QFEA 1X8FA 1ECQA 4LPCA 2WO5A 4IM4A 3OGSA 3C2FA 5D75A 2Z29A 3D3FA 1DJWA 1JDAA 1ONRA 1R46A 1K77A 2ZX7A 3U57A 1MW3A 1VF8A 4W84A 3B9AA 1ZPTA 3S1GA 1KRAC 3GAKA 1GOMA 3L23A 1KCKA 1NOFA 2GWGA 1DTUA 4NAFA 4QIBA 4GGHA 4DT4A 3LXBA 1NELA 2WMJA 4CVUA 1V0MA 3QV8A 4FNPA 4FMVA 2ZADA 2NQ5A 4EX4A 3GDRA 1TA3B 2QW5A 3JS3A 1KRMA 2OMAA 3M0ZA 4JFVA 4CU7A 1AD4A 1Q2SA 5K7JA 4REQB 1US2A 1XW8A 3AUOA 1AH3A 4S3DA 3HFTA 5JIWA 3PULA 1KNWA 2PA6A 4H6KA 2FGZA 5ENLA 2G96A 4DWSB 2MF9A 4PCFA 4XKMA 3UYIA 1VD6A 4M7TA 3P3BA 4H00A 3VD7A 1Q6EA 2QVHA 4HZ8A 3VC6A 4IGHA 1JCLA 4ZR8A 3ZJ6A 4UTLA 1G9HA 1RPKA 1JZ3A 4S39A 1XCXA 1YBQB 1JZ5A 5HW7A 4JKLA 2ZTKA 3NTPA 1OCJA 4ZXLA 4ZTXA 2FB2A 1VCVA 3O63A 4MSPA 2AAAA 2WVUA 5EGRA 1JEZA 5DMNA 3VD9A 3S6DA 2JIEA 4H6QA 4JTHA 2P53A 3MB9A 4U33A 2YKKA 1UHVA 1P0BA 4GY1A 3BWWA 1Q2RA 4BHYA 1R2RA 4W5ZA 1RJRA 2XWDA 1MRQA 5G1TA 1PYFA 3PZIA 4NYYA 2Y5SA 5A2AA 1ZL1A 3KL3A 2V69A 2GVJA 2DZAA 4CEUC 3FA5A 4XKYB 4RZ6A 3FVMA 2P76A 2OSXA 5CZTA 1JCHB 1XIEA 5D9MA 4EAYA 3ATYA 4PMXA 5I02A 2XP3A 1TTPA 3FEMA 3FJLA 1MI3A 1V3MA 4LY8A 5G2HA 2JBMA 1A5BA 1WBJA 3NXLA 5F7UA 1RA5A 3H55A 4FAPA 4Z2LA 2PDUA 3UQAA 2PGFA 3UU0A 2VVNA 4H9XA 2R8WA 3WDPP 3OQEA 2IKHA 3WQCA 2BVDA 3AXIA 4N4PA 2PPGA 4K38A 5B8IC 5LIUX 3QSRA 3XIMA 1H62A 5ABTA 3BLDA 5AC6A 3TAOA 4Q22A 4QE1A 2DJLA 7XIMA 4RV3A 2K8IA 4HKPA 2PZ0A 2NSXA 4U10A 1SZEA 5K2ZA 2AL2A 3WH6A 1SMAA 1WPCA 4C6DA 3VIGA 1LG1A 1XR2A 2RJGA 1VFHA 2CBUA 4LUJA 3QV9A 1JRBA 1ME7A 4S3KA 3LPGA 3HG3A 3KHDA 3RRAA 3Q94A 1LRQA 4E6MA 1UG6A 1R3TA 2RKXA 1WXYA 4UZUA 4HPXA 5AECA 2DVUA 1E44A 2GJPA 5HBFA 4FXRA 3KCOA 1UZ4A 2XFWA 3ATZA 1DWHM 4DIAA 4XD4A 4MIMA 2J13A 1TX2A 3BLOA 3BUVA 1ZGDA 3CT7A 3W82A 2QF7A 4CD7A 1EHNA 4DF1A 2JGYA 5CSSA 3KL0A 3B8IA 2G3MA 2HJPA 3CNYA 3O5RA 3VGDA 3QC0A 3QGKC 3G8RA 3TXZA 5HJYA