1XRVA

Crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
publication title Crystal Structure of the novel secretory signalling protein from Porcine (SPP-40) at 2.1A resolution.
rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xrvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xrvA01
3TTQA 3EMCA 1V08A 1US2A 4QCEA 2W67A 1NH6A 1QHZA 3SCRA 3AZSA 3FHAA 3FHQA 3RJXA 1H09A 1RP8A 2X0HA 3WQ5A 1QBAA 2EJ1A 2CPUA 2WK2A 1XHGA 3WKZA 1JAEA 1LG1A 1DWIM 3VVGA 4ZE5A 2BVYA 3AS2A 3WF2A 2JIWA 1KQYA 4TVUA 4X0NA 2DSWA 2XG9A 4AIUA 5M03A 1KWGA 1LL4A 5IDIA 1V6WA 4CD7A 1ZBCA 5BRQA 1E4IA 1XD0A 7CGTA 2IXUA 2VZOA 5IXEA 5EBAA 3GYCA 1HJSA 4ACZB 3N18A 1LF1A 3SCQA 3RO8A 3BH4A 3TA9A 4MDPA 3MUY1 1RH9A 4U33A 3KE0A 5A3HA 1TG7A 2D3LA 1WDRA 1JG9A 2PBGA 4MB4A 2WVSA 4W88A 3SURA 2V3DA 3WMCA 2GVYA 4Z2JA 1JNEA 1ITXA 2WHLA 5DO8A 3W27A 1LG2A 2CXGA 1VIWA 4WF7A 1H3GA 1CGUA 1XYFA 2QLYA 4QP0A 4MJ4A 2UY5A 2WVTA 2Y8KA 4WKHA 2XYLA 3ZR5A 3WDIA 4PSPA 1J0ZA 4GPNA 3MMWA 5D4YA 1JZ3A 1SFSA 5D9PA 1QI4A 2G8ZA 2GDVA 3HN3A 1BYBA 1ZS2A 3N9KA 2GK1A 3ZMRA 2CBJA 3WNNA 1D7FA 2PF0A 4TX6A 1V02A 5JIPA 3ZT5A 1K9TA 3WUGA 1TVPA 3MUAA 4GXPA 5AC4A 1NP0A 5I3DA 1UD8A 4LQ1A 1VB9A 3MV11 2PC8A 2ZUUA 2WCSA 1WDPA 1TMQA 5A6JA 3AS1A 1E6PA 3VX0A 4XZWA 3WMSA 2CBVA 3GZAA 4UFLA 4S3KA 3VNZA 4U2ZA 5CSUA 3L2MA 1KWKA 5LA0A 4AD3A 1E6NA 2DSKA 4WJXA 1PX8A 1VF8A 4HMEA 2ZIDA 4V2XA 1SMDA 4C7FA 3M7SA 3UEQA 3NDZA 2W4XA 5I6SA 1HP5A 3IAPA 5C71A 4MJ2A 4TXEA 4CGTA 3NSNA 4GKLA 1JDAA 2WWCA 3PZNA 2BY0A 1E70M 1MXDA 4UFIA 3LPFA 3AI0A 2F61A 3G6MA 1W9DM 4NI3A 3UERA 1CGTA 1H0IA 1WNOA 3AIEA 1B3WA 3BCDA 4UZSA 5FKYA 5BXSA 3PTKA 3PZTA 4C7DA 4TTUA 1GUVA 4MPKA 3ARPA 4W89A 3S2CA 3B8SA 5EMYA 3AXIA 2XFFA 3WDRA 4UQDA 3EMZA 4D72A 3VMPA 5BXPA 1B3XA 3ZJ6A 5BRPA 1VAHA 3AHXA 4LX4A 4PMRA 1UQZA 4U31A 3VIIA 1V3KA 3GNOA 3W6MA 5HPOA 1K6AA 1OINA 4JFSA 4P7NA 4BA0A 2W63A 3VMOA 3FAXA 2QF8A 1OGGA 1TUXA 2OWWA 2VI0A 2ZX9A 3M6DA 2BY1A 4JFVA 3SCPA 1B30A 2XUCA 3VGEA 3APGA 1M03A 1UZ1A 2VX7A 4J27A 3KEHA 4KRUA 3AICA 2VRJA 1H5VA 3BLKA 2FGZA 2IUZA 4FLRA 3ZR6A 1NP2A 1VENA 5E6YA 4UQ9A 1R8LA 5GNXA 5CLTA 1W1TA 4UFKA 2BY3A 3SCTA 5CG0A 1PZ2A 1SYTA 4UNIA 2D23A 3UETA 1UYQA 3AHZA 4B3KA 4PTMA 2C8NA 1GPFA 3SUUA 3OG2A 3ZIZA 2QPSA 4AD1A 5GQBA 3WSUA 2JE8A 2X0YA 1QNQA 3OGVA 2ZWYA 3MU7A 3O9NA 3PZGA 4PEEA 4JCMA 2XJ7A 2VZSA 4WKAA 1CLXA 1E6RA 4CN6A 2QMKA 4UTFA 3ZSTA 5EFDA 5A8QA 3VIKA 2CKSA 3KL0A 1YHTA 3WH7A 2W61A 3D5HA 3WDJA 2D0GA 1MQPA 2EPLX 3ARQA 4LXFA 1KXQA 3CPUA 2CERA 1GHSA 2YL5A 3K4AA 2G3JA 2ZE0A 4MDOA 2VCCA 5BXTA 1BVZA 4AWEA 2YLAA 3VIJA 3PHAA 4FK9A 1E4MM 2E4TA 3VO0A 4Z2IA 4EAMA 1VFUA 4BS0A 1EDTA 4QLKA 1VBRA 2B31A 3N17A 3AZTA 3WEOA 4AZCB 1CGXA 4AZ5A 3K8LA 1HKKA 1DWGM 2XVGA 3OLIA 3QHNA 1QNPA 3ZT7A 3AISA 2BHUA 3CZEA 3B9EA 2C7FA 4OKDA 1BYAA 3NCOA 5E6ZA 2XFYA 3IK2A 4W93A 2ZX7A 1OWQA 2EPNA 3VGDA 1FP8A 1W1YA 1GCYA 1E4LA 2WKGA 3FNDA 4AIEA 1W3JA 2VNCA 1PX4A 1JFXA 3CGTA 4H8VA 1J01A 1B31A 4IM4A 1CGVA 2VR5A 1EDQA 1G9HA 3N12A 5BWFA 1Q6GA 2FHBA 4Z2GA 3AOFA 3WUEA 3T2QA 4LYRA 2YOCA 2HISA 4Z2KA 5HNNA 3L4XA 4BQ4A 3VMNA 2E9BA 1NWSA 4UQAA 2GJPA 1SR0A 1UWQA 2J62A 3CIVA 1HL8A 1I1XA 1OGSA 1CBGA 3PZIA 4CKQA 1ISXA 2F2HA 3AMLA 2WNWA 4AZBA 2JF6A 4LGXA 1QHPA 4J28A 3BAIA 4A4AA 2DT2A 1WP6A 4UOZA 1E6SM 3VIPA 1MVYA 1R87A 4H41A 1Q6DA 2W5FA 3T0AA 4JCLA 3AHTA 1R7AA 3SUSA 1O6IA 1XH1A 2BHYA 1UD5A 1ISWA 3CUHA 1V02E 4BQ2A 3ARUA 2JF7A 3BSHA 4GIAA 4AEFA 2OYLA 3VD3A 2OSYA 1NWUA 5I5RA 1LWJA 1W1PA 2G4FA 2VVSA 1CGYA 4ACYA 3T0BA 3ARZA 5I24A 3WFZA 4PMOA 1UH4A 5BCAA 3VU2A 2CNCA 4GI8A 2ZUNA 4MAVA 1GOOA 5A2AA 1WDQA 1E3ZA 1QNSA 3EDDA 1CECA 3OA5A 1TVNA 5A6SA 5A6BD 1DHKA 3AZRA 3UESA 5AYBA 3PTMA 6CGTA 1FFRA 4HZ6A 5I23A 2WZIA 3SUTA 2J7FA 1JNDA 3WY1A 2C0HA 2WMIA 1GJUA 1B90A 2YJQA 3GXDA 2GDUA 3O6AA 1WDSA 5LA1A 1YQ2A 2ZUTA 3MV01 4EKJA 1QHOA 4QDMA 2VUYA 3THDA 3M46A 2WC4A 3I3BA 2YDSA 1IZKA 3WDHA 1UD3A 3VIFA 3ZOAA 2GK1B 2WBGA 1E9LA 3LPOA 3WF1A 1V0NA 3BMVA 3VGFA 3WF4A 2RGMA 3W24A 5HBFA 1HKIA 3VDCA 2WWDA 4L4OA 1PZ3A 3AMKA 3W25A 4D6FA 5EB8A 4E4PA 2EPOA 3WIJA 1Q6FA 1ISVA 1KGUA 3K8KA 3NJ3A 4BZYA 2UY3A 4Z2LA 5E9AA 3CHEA 4D6GA 1BYCA 1LQ0A 1V03A 3W38A 3GBEA 1C8QA 2DEPA 3MS8A 3WDPP 1JF5A 3VIHA 3SCOA 1E72M 2YA1A 5JIWA 1E55A 3WD1A 2D0FA 3WNOA 4MADA 1CLVA 3ARXA 1MXGA 1CZ1A 4F9JA 2AMGA 4NZCA 3MSGA 1JYNA 5ABFA 1MW0A 2OSWA 1E1EA 1E0WA 1WO2A 3BAKA 4WSJA 1KQZA 3KWXA 4CVWA 2E9MA 2O9PA 3T08A 3UG3A 5AY7A 3NUKA 2NT0A 3VIOA 3WH5A 2F8QA 3MO4A 2GJRA 2WZHA 2WLZA 3VGHA 1BYDA 2EQDA 3FXYA 4H2CA 2WSKA 2BS9A 2ZX5A 1NOWA 4ML4A 3OGSA 1P6WA 3ALGA 5E0CA 1N82A 4M80A 1UD2A 1ZB5A 1W91A 5TD4A 1R7OA 4H8UA 1CPUA 4QFUA 1JZ7A 3TOPA 1CTNA 5JH8A 3WMBA 3VM5A 2DQXA 4PBGA 4DWSB 5JBDA 2Y2WA 1GOWA 1M04A 4P8UA 3POCA 4GQQA 2VJXA 4N0RA 1CXEA 3RM9A 1CNVA 1ZL1A 5E70A 1FH7A 2J7GA 1EOMA 1J0IA 3AIWA 1NARA 4MB1A 1X6NA 4AZIA 4OIFA 1X6LA 1UWRA 1MW1A 1U30A 5A8PA 1AQMA 4GO9A 3WQWA 4GO8A 1W1VA 2EPMX 4M82A 4N42A 5DT5A 1JGIA 2DT0A 1EH9A 1UA3A 3BAJA 1J18A 3L2LA 1B2YA 1C90A 2JIEA 3WNMA 4AZ7A 3B9DA 2E0PA 4CCCA 1W9UA 2VOTA 4AYSA 2A3EA 2V38A 1DWHM 4B16A 1V6YA 1BVNP 3HJEA 1FOBA 3AHYA 2V3GA 5DFAA 3ZJ7A 1KFWA 1EGZA 4X0VA 1OB0A 1C7TA 4WK9A 4KGLA 3PZ9A 3WEMA 4ZFMA 2ZUWA 1E5JA 2UY2A 3BXWA 5D8WA 4GZIA 4FLQA 1A3HA 4V27A 1UH3A 4C7GA 3WD4A 5CGMA 3KL3A 4LYQA 4B15A 2V5DA 2XSBA 3QHMA 4D6HA 4ZENA 2W92A 4UFHA 1UKPA 1G94A 3PN8A 5M17A 1BAGA 1CXIA 3CUFA 1GONA 1QI3A 5E0FA 3G6LA 5GNYA 3T0DA 2XM1A 4TOQA 1CGWA 1XGZA 3L4WA 4JIEA 2J75A 4GINA 1TA3A 2PWEA 3SEPA 2D2OA 1HJXA 1JI1A 1W3LA 3CZGA 1K9DA 4Z2HA 3PZVA 4CU6A 1E73M 3ARSA 2Y24A 2W62A 1VEOA 3KZSA 1QI5A 1B3ZA 1AVAA 1LJYA 5CJ5A 1W9VA 2G3IA 4OOZA 3K46A 4KRTA 1B1YA 1OT1A 3CUJA 2BXZA 1GOMA 3BMWA 3TTYA 2D0HA 2VR4A 1RP9A 2ZX8A 1CWYA 1XSIA 5D9NA 1UWIA 1W9XA 2TAAA 5EFFA 3VTRA 2V3FA 1VRXA 2ZICA 3SIMA 1BFNA 1QBBA 2J7BA 4D6IA 4KGJA 1JZ8A 3VX1A 3K1DA 4CD8A 1JL8A 4CD4A 4Q7NA 3A4AA 2DT3A 3A4XA 1DTUA 4GI9A 4PUEA 2WLYA 2X1IA 1PJ9A 5A69A 3AS3A 4LYPA 1E4NA 4TX8A 1M01A 3BAYA 2XVPA 3TTSA 3CZKA 4HU8A 2WVVA 3VGGA 1C92A 2WW5A 1C93A 1HVXA 1S46A 4TVCA 2DDXA 1KXTA 4HPGA 4PTWA 4F79A 1HNYA 3W6LA 3BGAA 5DMYA 4W8AA 1GVIA 3AIUA 1WZKA 4W7UA 2CKRA 1UKTA 1CDGA 1EQPA 1F4HA 1ISZA 3BLPX 1RD6A 2CITA 1JI2A 1BLIA 4WIWA 4ATDA 1JF6A 2WHKA 2WBKA 3IANA 1IV8A 4JFUA 1ZBKA 1CXLA 4FMVA 4ZEPA 4E2OA 3VOCA 3QR3A 2J25A 4KWUA 5IHRA 5DEZA 1EO5A 4XV0A 1XSKA 1ISYA 3OBAA 1A47A 3W82A 3ZJ8A 1UKSA 1TR1A 1VFMA 1GQJA 5M5DA 4MTVA 2GFTA 4AMCA 4CU8A 2JFEX 3RILA 3NSXA 1V6UA 1J10A 4AW7A 2BY2A 5HPCA 1GJWA 5BYWA 3UCQA 4YHEA 1V0KA 1JDCA 2X05A 1AQ0A 4DUWA 4FLSA 4CD5A 5A6BA 2D3NA 3I3EA 4PUDA 4NF7A 3TP4A 4FLOA 2WVUA 2ESCA 3WL1A 3CZ8A 5A6AA 1NWRA 2YL6A 2WAGA 1LLOA 3ZQ9A 1JXKA 3VM7A 1NQ6A 3AYRA 1V6VA 1LWHA 5I77A 3LMYA 1G1YA 3EYPA 2DSUA 4BCEA 4PMUA 1GZJA 3FW6A 2X2YA 3UG5A 4AY1A 3VDHA 4W86A 1VFOA 3AXHA 3AMCA 5A6KA 2FDMA 2RGLA 1HX0A 3N11A 1TZ7A 4R27A 4PMVA 1HT6A 4PCTA 2WC3A 3GXFA 3WENA 4HP5A 4HZ7A 4RL3A 3EDEA 1F4AA 2WPGA 2X09A 2QPUA 1KCKA 1Z32X 4JHOA 5KEZA 1C7SA 3SUVA 2JALA 1JZ2A 4W85A 1EXPA 1UQYA 4BF7A 4B9YA 4AEEA 1JYVA 5CPTA 1WCGA 5ABFB 5ABEA 4RE2A 2DSVA 1ZBVA 2O9OA 4D1IA 2FH8A 4D6CA 4FF5A 1QVBA 4RE3A 4D6EA 3GH4A 5E09A 3WH8A 2YL8A 2CEQA 4QLJA 4BQ5A 1J11A 4PMYA 2A3HA 4EANA 2DIEA 1E6XM 2Q8XA 3IJ8A 4ZXLA 2ZXAA 2DIJA 1UKOA 1QW8A 4GZJA 3GNPA 5IHSA 4W7VA 1E3XA 3DYOA 2WMHA 1JZ4A 3WL0A 1HKJA 2OSXA 2JEPA 1OIMA 3VPLA 3M07A 3WD3A 1UA7A 2J74A 1UR2A 2XSAA 1WZAA 3IJ7A 4E8CA 5C8BB 2Z1SA 1CEOA 1BG9A 3GXMA 3VKKA 1I75A 2DH3A 1QNOA 1DWJM 1ODZA 2VQUA 3IJ9A 3U5UA 2WYSA 3LPGA 2E40A 4HMDA 1HIZA 4AD0A 1GQLA 2VX4A 1JD7A 2WZEA 3QOKA 3AROA 3GH7A 2WM0A 4PSRA 2WANA 3THCA 4TTGA 3WD0A 2BVTA 2XTKA 2OWCA 1ZJBA 3A47A 4RE4A 3WF3A 1WB0A 1C8YA 1OT2A 1FH8A 2VO5A 1KGXA 3OZPA 3E1F1 4IPLA 1QI2A 4HA1A 3WQVA 4AZ6A 4W84A 1UWUA 1OGBA 5CQ1A 5FL1A 1MQRA 1BSIA 2PB1A 4AD2A 1HF6A 1E6ZA 3PZUA 2UWFA 1BGGA 4DUVA 2CBUA 3GNRA 1H11A 3VDAA 2NSXA 2ZXDA 3ARVA 3CH9A 1H2JA 3BSGA 4D6JA 1KB3A 1NM9A 3WH9A 1GVYA 2CHNA 3FN9A 2YDQA 2EXOA 2CBIA 4ZE4A 1OM0A 3ALFA 2YA0A 1XCWA 4BQ3A 2CCRA 2G3MA 4XX6A 3W81A 1MWOA 4JZ5A 3DECA 2WB5A 1G01A 4P7QA 1OD8A 4HPHA 1KXHA 3WQ4A 5GNZA 1B0IA 1PEZA 1J12A 1KR0A 1TA3B 1WAWA 2D24A 3L4YA 4W5ZA 3OLEA 1W32A 4M8UA 4JHZA 2JEQA 2WMGA 4PMZA 3PTQA 4L4PA 4NRSA 1XYZA 4TUFA 3AIBA 4J3VA 1FP9A 1GOKA 1MYRA 1GQIA 4PN2A 2XGIA 5BROA 3K8MA 1XH0A 4JKKA 2YDRA 4PMQA 4PMXA 4AZCA 2V3EA 1W9BM 2OYKA 4W5UA 1JAKA 3RCNA 3BAWA 3DC0A 1BTCA 2BVDA 2D20A 3N13A 1JZ5A 3CMJA 1XSJA 2PWHA 3BC9A 4CN1A 3AS0A 1HJVA 3RJYA 2EBNA 1V3LA 3SCNA 1XCXA 4UOJA 2VX5A 4H8HA 1PIGA 2EEXA 3VD7A 5FL0A 4UQCA 1Q6EA 3L4VA 2CESA 3QGVA 4DM2A 2BV9A 3ARRA 1FHLA 2CIPA 3VIMA 1C3FA 3F5LA 1XC6A 3II1A 4KH2A 3MSDA 3CBWA 4P8WA 2FHFA 3CZLA 2UY4A 4U5IA 4UFMA 3T09A 1MFVA 1L0PA 3GDBA 4GZEA 2WVVB 2ZWZA 1BHGA 3N15A 4IUGA 1E0XA 5F7UA 2WCGA 4MAZA 3VINA 1ZU8A 4M81A 1HVQA 2WSPA 2J77A 2XVKA 3VD4A 3OLDA 3SCVA 1E0VA 2VCBA 3AFBA 3VILA 3IAQA 5A8OA 1KBKA 5JUVA 2YIHA 3PZOA 5LA2A 2FGLA 2XWEA 3F5KA 1BF2A 3GH5A 4F8XA 4IPNB 4PCSA 1BQCA 1V6XA 3CTTA 1XD1A 3WH6A 5A8NA 1UR8A 1FHDA 2CETA 2WMFA 3AIVA 2G3NA 1E40A 3NYDA 3VUPA 1EDGA 1WZLA 1J0JA 4MNLA 1HJQA 5I2UA 1OBAA 5D8ZA 4CU7A 3N1AA 4JFWA 1J0HA 1H49A 2O9RA 3W4RA 4UR9A 3RPMA 2DSZA 4F9DA 2GJXA 3B9AA 1EHAA 3AXXA 4AC1X 1UWTA 1XRVA 3RDKA 4PYSA 2A3CA 1UHVA 2BFGA 5A2CA 3W37A 2J47A 1NOUA 3WDQA 2WHJA 3LPPA 3EBVA 4W8BA 3ZJKA 1VJZA 4HU0A 5I78A 1ZJAA 1UD4A 2E8YA 2W66A 1H4PA 1OIFA 5D9OA 1H1NA 2A3BA 5FCZA 2X8RA 1US3A 3MMUA 3TONA 2ZXBA 2G41A 4CUCA 3W0KA 2J8FA 3HU7A 2XIBA 3WELA 5AC5A 4NRRA 1J9YA 2VZUA 3T2PA 4JAWA 3L4UA 4MB3A 5M3WA 4AD4A 3U57A 4WSKA 1EIBA 3DYMA 3L4TA 2XHYA 1IT0A 3CMGA 1UR1A 1XH2A 3QOMA 5I79A 3AYSA 2XVNA 1JFHA 1RPKA 2PWGA 3SUWA 4WKFA 4MB5A 1B3YA 9CGTA 2VURA 4W87A 1BPLB 1UG6A 2Y4SA 2IXVA 4AISA 3ARTA 2VT0A 4HMCA 3WQ6A 1IZJA 4J7RA 1WE5A 4AD5A 1G5AA 4E8DA 1KCLA 4H7VA 5CPSA 3KL5A 3ZT6A 2GSJA 3OB8A 4P7LA 1AMYA 4J3XA 3WBAA 4XZBA 1UH2A 4Y7EA 3AQUA 3O2LA 4CCEA 2D1ZA 1UR0A 2AAAA 3W28A 1V3HA 4JFTA 1OD0A 1AQHA 4HA3A 5I0DA 1BG4A 3W53A 1H41A 1HKMA 5ABHA 2MANA 2VX6A 3CZJA 5CPQA 4WLCA 1Q6CA 5AYIA 4CD6A 1W2PA 4ATWA 3J7HA 2PI6A 1GORA 1UD6A 1OSEA 2OLHA 5CXPA 3WFLA 1E5NA 1JXJA 1DP0A 3VGBA 1CXKA 2YL9A 2VRQA 1GOIA 5CLWA 1J0YA 2YKKA 4U2YA 5HDRA 3ECQA 4KMQA 2E9LA 3WBEA 1W3HA 1L8NA 2ZXQA 2ZUSA 1VEMA 1MW3A 1HN1A 3D3AA 1ESWA 3DYPA 4PRWA 1KBBA 2VTFA 3OLGA 3PZQA 1HXJA 2PWDA 3EMQA 4R5EA 2VC9A 3VNYA 1Y7VA 1I1WA 4DWSA 3L4ZA 3GTNA 1VBUA 4DUXA 5IFPA 3CLWA 1DWAM 1B9ZA 1HL9A 3MUIA 3MKKA 4J3TA 4ACZA 5ECUA 1QNRA 2XWDA 4PMNA 5HOSA 2VZTA 1CXHA 4YN5A 2YBUA 3U5YA 4QLLA 1W9PA 2J78A 5FOOA 4NSBA 2WMIB 1D2KA 4PTVA 1ODUA 4LPCA 3FAWA 5C70A 4U3CA 1NWTA 3SCWA 2OYMA 6A3HA 3WNKA 4IISA 2YA2A 2D22A 1FH9A 2Y5EA 5A1AA 3NIYA 3U7BA 1HJUA 4AZHA 2BXYA 1JYXA 3GM8A 3ZM8A 1V0LA 5DF0A 3CUIA 3EDKA 1CXFA 1EO7A 4QCFA 3WN6A 4YHGA 3VD5A 1QW9A 7TAAA 5A6LA 5CSYA 4XB3A 1PIFA 4OZOA 1R86A 4DWSC 1OCQA 3AIRA 4CVUA 4JL2A 2WMKA 1C91A 3F5JA 3PZMA 3WEZA 4OJYA 1FA2A 3WUFA 2J7EA 1QOXA 3NSMA 1QPKA 2DGAA 4M29A 4B3LA 1XV8A 2YLLA 2J7DA 2J79A 1VJSA 5A94A 1JYWA 3CHDA 1UR4A 2HVMA 1JZ6A 4TVDA 1ITCA 1V3JA 1NOFA 2XIIA 2VVNA 2WC7A 4A3YA 4HA4A 4U5KA 1DEDA 3RIKA 3AMDA 4PMDA 3A6OA 3OGRA 1DWFM 5CZKA 4XUYA 3AHVA 1GHRA 1UZ4A 2CYGA 4YPJA 1MW2A 1UUQA 1EHNA 1MFUA 4UCFA 3RM4A 2QHAA 4OUEA 2XFRA 4J3WA 2XPKA 3BAXA 3AMGA 4JL1A 2FHCA 5KZ6A 3GXIA 3W29A 4UQEA 4CN4A 4HOWA 2E8ZA 1UR9A 1VFFA 1U2YA 3SCUA 1WZMA 3WNPA 3CUGA 2VL4A 3WF0A 4OBSA 4M24A 1KGWA 2PBOA 4DWSD 3I3DA 2ZUVA 3WD2A 1U33A 1UWSA 4P7RA 1EQCA 2OWXA 1LL6A 3POHA 1PPIA 1GW1A 4MNMA 4ZXOA 3FY1A 2WHMA 4M56A 3GBDA 4HTYA 3N04A 3UR8A 1TE1A 5JBEA 5IFTA 2DH2A 4GI6A 3ZSSA 1D3CA 1JIBA 3DHPA 4AIOA 1Q4NX 1GOQA 1HP4A 1PX3A 2E3ZA 1M7XA 4X9YA 3CHCA 1KXVA 4J3UA 2YBTA 1E71M 1QI0A 2CHOA 2J7HA 4D6DA 3HMCA 5DT7A 4HOZA 4B9ZA 1R85A 3A4WA 4W8LA 4HZ8A 2NW0A 2WMJA 3JUGA 2BHZA 3SCSA 6TAAA 1WPCA 1CENA 1K9EA 5BXRA 2GJXB 4D71A 3WNLA 1G0CA 2QMJA 4UQBA 2J7CA 1CYGA 2VRKA 7A3HA 5GPRA 4CCDA 8CGTA 1TFVA 2PWFA 2AOSA 3RM8A 3OZOA 1O7AA 4D1JA 2WKLA 1HJWA 3TTOA 4W7WA 3MANA 1W2VA 2V5CA 3CO4A 3U7VA 5A6MA 1E43A 3F4VA 1LL7A 1TCMA 4Q22A 2DPEA 4F66A 5HXMA 3T2OA 4HOXA 2J4GA 2DT1A 2Z1KA 4QAWA 3CHFA 5JBFA 3K4DA 1JDDA 4UZUA 2GUYA 1CIUA 2VZVA 2XVLA 5CGTA 4OOUA 2ZOXA 5D9MA 3WQ8A 4AZGA 2ZUMA 2FH6A 4P7OA 4UOQA 5A2BA 1V0MA 8A3HA 4UFJA 3DHUA 4A3HA 1EOKA 3MMDA 1PAMA 1KR1A 3S6TA 4M1RA 1MQQA 1BGAA 4H04A 4EK7A 1H0GA 1JD9A 1GQKA 3VD9A 3QHOA 1E56A 2EPKX 3UG4A 3ZO9A 2A3AA 3W26A 4GQRA 1SMAA 2ZX6A 3MUZ1 1E1FA 1PBGA 2WXDM 1C8XA 2J8GA 2QV4A 4PTXA 1EA9C 1V3IA 3EDFA 3RMEA 3PBGA 3UR7A 2O9TA 1B3VA 1WKYA 3ARWA 3BCFA 3AJ7A 1UKQA 2Y8VA 3NDYA 1E15A 1GNXA 2BNJA 2XM2A 3OIHA 1V3MA 3A3HA 4S3JA 2VMFA 3AIQA 4EE9A 1VEPA 2WCAA 1ZBWA 2W91A 4DM1A 3VDBA 5FD0A 5LYRA 5FIPA 1K9FA 2O92A 5A8MA 2NT1A 4MNJA 3EDJA 4K68A 1FFQA 1E6QM 3WUBA 1W3KA 4AXNA 2XGBA 5ABGA 5A95A 4JKMA 1ECEA 4MNKA 1M53A 3VIGA 4ATLA 2VCAA 1J0KA 4P8VA 4U3AA 4URIA 2VQTA 4JKLA 3ARYA 4OBRA 1UOKA 1X1NA 2EO7A 4P8XA 4J3SA 4V28A
chains in the Genus database with same CATH superfamily
3TTQA 3EMCA 3CAQA 1US2A 1TCOC 3L65A 3SCRA 5K2ZA 4OVXA 3UR2A 3AZSA 2F84A 2GVJA 1Q6LA 3CWOX 3WQ5A 4LANA 2WK2A 3W83A 5KZEA 1LG1A 2PDXA 1K70A 4HPNA 4ZE5A 4QE5A 3HV9A 4EWND 2JIWA 2QJNA 2VFFA 2DSWA 3WLLA 4AIUA 2AL1A 1KWGA 5JH2A 1V6WA 1PDYA 1XD0A 2PTDA 5HW7A 3H7RA 1FCVA 4EOUA 2RDXA 2M2AA 2YFOA 3URQA 1JJKA 4ACZB 3SCQA 2GOUA 2FVMA 3BH4A 4U33A 3KE0A 1F3WA 1TG7A 2QULA 1JG9A 2NX1A 3KP1A 4AFYA 4Q7BA 3NQ8A 1OF8A 1RK6A 1UZDA 2MLXA 2I1OA 4O11A 1AH3A 3BLLA 4XSMA 1CGUA 1XYFA 2QLYA 5G2IA 2UY5A 2FQIA 2XYLA 3GNNA 1YYAA 5D02A 4O1FA 3R1ZA 4E2DA 4WY0A 1JZ3A 3TN3A 1FWJC 4OU1A 4IIHA 1R2RA 4NZJA 3UR5A 2A2IA 1BYBA 1ZS2A 3N9KA 2INEA 1G4PA 2PF0A 1WXYA 1K9TA 1TVPA 3OZMA 3MUAA 1RY0A 4GXPA 3QSTA 5AC4A 2YCEA 4RUBA 4C1NA 5D2YA 1VB9A 1B4KA 1MDRA 1XLLA 2PC8A 3MV11 2ZUUA 1WDPA 1TMQA 1E6PA 1LDCA 4LY4A 1XKJA 3SB0A 2CBVA 2PRHA 4UFLA 5JXQA 3O5MA 3L2MA 1KWKA 5LA0A 4IUOA 2LGOA 2R1NA 1XGEA 4WJXA 2ZQUA 1PX8A 1FTXA 4I90A 3TC7A 1QPQA 1M7JA 4V2XA 2YDAA 3UEQA 3EPOA 4LFYA 4LAKA 2CWNA 2ONEA 2Z1BA 4MJ2A 4GKLA 5CPLA 2GYIA 4I7WA 2WWCA 5DANA 4UFIA 2XP7A 3AI0A 1XLGA 2F61A 5FJOA 1CGTA 4IGSA 3B0XA 1WNOA 3GNXA 4AG0A 1B3WA 5BXSA 2BGQA 4N9CA 3PTKA 2IQTA 4TTUA 2WSRA 3S42A 3KBVA 3C5QA 1GUVA 4ROQA 3TNBA 3URAA 4W89A 1D7IA 3AXIA 3REQB 2YBVA 3EMZA 1YXCA 5HNRA 3EB3A 5BXPA 1B3XA 1VAHA 3CQHA 1X6UA 4PMRA 1ZGDA 2GQ8A 4RV8A 3VNLA 1BTMA 1VR6A 1K6AA 4LS0A 4X22A 3S83A 1TUXA 3M41A 3M6DA 4JFVA 3SCPA 1B30A 5LGZA 3UJEA 1JCXA 1PYMA 2GGHA 3KEHA 4KRUA 1YNQA 1H5VA 4QG9A 1P7TA 4RZBA 4FLRA 1G4TA 4UQ9A 1MZRA 3LI0A 1PWMA 4HHPA 2GVLA 1ZFJA 2BY3A 4IFOA 3A9BA 1R0MA 1PZ2A 3C3NA 3HPXA 4UNIA 2VDIA 2W6RA 3HGOA 3UCDA 2I5QA 4B3KA 2C8NA 3T42A 4GIEA 3DIPA 2L2SA 2I57A 4ZSUA 5GQBA 3TSBA 1BXBA 5D05A 3DC8A 4ZQCA 3BTNA 2V2CA 3WSUA 1YDYA 3LXCA 2C79A 1MUMA 2ZWYA 3MU7A 3O9NA 1Q2SA 2XJ7A 4WKAA 4CNUA 3FIGA 1A53A 4LV4A 4F0MA 4DRPA 3BMXA 5EFDA 2CKSA 3KL0A 3WH7A 2XN2A 2D0GA 3T78A 2VOMA 2EPLX 3GVRA 3WQOA 4UTWC 3LCFA 4LXFA 3GTIA 1KXQA 4NJIA 1E0UA 2WJDA 4C5YA 4CQBA 3PBUA 5BXTA 1BVZA 2D69A 4EPKA 4H00A 1W8GA 1D8CA 2PWUA 4FK9A 2E4TA 5IRPA 4Z2IA 4FOJA 3W01A 4DH0A 1VFUA 4O8AA 4AX7A 1NEYA 4QLKA 1OC7A 4IX0A 1OC6A 3UA3A 1TV3A 1V93A 2O7QA 3AZTA 2PE4A 1CI1A 1CGXA 3K8LA 3UI6A 2XVGA 3ZT7A 3TYBA 2Y89A 4IMDA 2PCQA 2BHUA 2P53A 3UYCA 2C7FA 3GXPA 4HYRA 3RAOA 2QQ6A 4KKXA 4RZ5A 2EJAA 2HNEA 4DB7A 4IHCA 3S9IA 4G9PA 2B4GA 3UXAA 4OWGA 3FNDA 1W3JA 2VNCA 3I7RA 3RITA 1PX4A 4OV4A 4H8VA 1B31A 4QNEA 4DELA 1TB3A 2J9YA 3E0WA 3G1HA 4FO4A 2HISA 3SN1A 3TUUA 3UI4A 1TTPA 1UR3M 2GQ9A 2FMOA 2PSNA 4CKQA 4H9VA 4LTSA 2BASA 1IR2A 2BB0A 4J28A 2DT2A 2YSWA 2OZTA 2CZFA 4KIEA 3W75A 4PUJA 2VEFA 4H41A 2V2DA 5AOUA 5J8LA 4JCLA 4MGVA 2PZ0A 3LNPA 3OQEA 2O4QA 3LXAA 2DZPA 1ISWA 3P0WA 4PB5A 3QJAA 4UUIA 2I16A 3H2NA 2PDHA 2JF7A 2PDFA 5I3FA 2Z27A 3MUCA 4K8EA 4ZB2A 2OYLA 3RLVA 2OSYA 1LWJA 1XFCA 3BICA 1MO0A 3WLPA 2VVSA 1ZJHA 1KCXA 3ABQA 4XISA 2E77A 3BPWA 2J6XA 4OHQA 1OK6A 4PMOA 3QLLA 5IM51 1TMLA 4DJEC 2ZUNA 3P6LA 4MAVA 3K2GA 1WDQA 3EDDA 3SSZA 1CECA 3OA5A 1TVNA 1DHKA 6CGTA 4HZ6A 3GY1A 2HVOA 2J7FA 1SW7A 1K3UA 2WMIA 1VIZA 1FAPA 3GU1A 3P84A 6REQA 1J6OA 5LA1A 2ZUTA 4EKJA 1QHOA 4LAXA 2WC4A 1OJXA 3I3BA 1XL9A 4NKCA 3LBOA 3BQ5A 3GB6A 1F5ZA 3ZOAA 4TIMA 1DJWA 2WBGA 2P8BA 4ZMGA 3G77A 3KBMA 4S3BA 3WF4A 2FDSA 2TPSA 3ZS4A 5D33A 1I45A 1ICQA 2NSOA 3W24A 4HNTA 3E38A 4GVHA 5IBXC 2WWDA 1WOAA 3H54A 2MLYA 3F7JA 1XYCA 1Y0OA 3TJXA 3KHDA 3WIJA 1I6NA 4U85A 3OVGA 3C2YA 4R9OA 4WJ8A 3UNDA 3NQAA 4Z2LA 5E9AA 4D6GA 1H7PA 2FB2A 4JN6A 2X1UA 4UR8A 4MWAD 4GBDA 3FDKA 3KUMA 1NTHA 2E25A 3EPNA 3GBEA 3QF0A 4MZ1A 4EPEC 2ZZ2A 1FRBA 3PBMA 3I65A 3PAOA 1Q7QA 3MS8A 4NVTA 5F1VA 4GX8A 2HE8A 3STEA 3WDPP 3VCRA 4JDBA 2ZVRA 2QVHA 3TH6A 1U5VA 1E55A 3WD1A 3TC5A 3WNOA 5HUPA 3SADA 1MXGA 3ARXA 4HNLA 2LJ4A 4NAEB 1T41A 3L67A 3W72A 2AMGA 1GZ1A 2ACSA 1NELA 2X1TA 5ABFA 3V7PA 4K36A 4XZMX 3VK5A 1IX5A 1WO2A 3B03A 3IGUA 5HW8A 1RA5A 2XGZA 1LLWA 2E9MA 3S2MA 3QKEA 4PL1A 3LGGA 4B5WA 2UZ5A 3PFRA 1U22A 3GUWA 2GJRA 3OPSA 3LTYA 3R10A 3NZGA 1YNPA 1QUMA 3S2NA 2E09A 3NQBA 2VM8A 2BS9A 2ZX5A 1NOWA 2PC4A 1SFLA 1XQLA 3NOEA 3ALGA 1BRLA 1UD2A 1ZB5A 2ZC1A 1R7OA 4AAJA 4AVNA 4IGMA 1LM1A 4JTRA 2Z0IA 3N9SA 3TOPA 1MMFA 5JH8A 4XKYB 1M5WA 4DWSB 5JBDA 1R9HA 3NVTA 4ZR8A 4P8UA 3UXKA 4LUTA 3GHRA 3QV6A 4PTDA 4HN4A 4AY7A 3NZRA 1MXSA 5BOEA 3SBFA 1YATA 4F0LA 4DZAA 3KVJA 3L5AA 1KFJA 5A8PA 4GO9A 3E0IA 1XISA 2WNQA 2GUUA 3LRMA 2QNEA 1OYBA 3L2LA 5JU6A 2HJPA 1HGWA 3WQCA 3NVDA 4DT4A 2DORA 4H6KA 1W9UA 4AYSA 2A3EA 5HNTA 4Z0JA 3GZ3A 2YX0A 2E6AA 2I5GA 3QY6A 4B16A 2CLKA 5DX7A 2DW6A 1FOBA 3VNMA 2C15A 5DRCA 5DFAA 3LSCA 5U7SA 3FGCA 4O15A 4X0VA 5FAJA 3WLMA 4JNMA 4WXYA 1KFLA 3V3WA 3KVMA 4JQAA 1H61A 2ZQSA 2RJGA 2ZUWA 5MF5A 3E0LA 5D8WA 1A3HA 4LAYA 2FFIA 2XDFA 1FWHC 1S1PA 4ZFCA 3MQTA 3QHMA 1RVGA 4ZENA 5BMWA 4KFNA 2W92A 1EUNA 2YR1A 4F2BA 1P48A 1I8JA 3W7MA 3CC1A 4NI8A 3MI2A 3CUFA 5E0FA 1AK5A 2ZRYA 3SDOA 1XI3A 1F05A 3R5EA 4HK7A 2X30A 4TOQA 2J75A 4GINA 1TA3A 5T91A 3P61A 4IICA 3SM0A 3SEPA 3LTSA 1W3TA 2R94A 3VCNA 3LRKA 4R88A 4Z17A 3PRDA 4FALA 4M6PA 1Y5VA 1W9VA 2BWGA 1KCZA 3P7YA 4HTBA 4OOZA 3K46A 3TMQA 3B7XA 2F6UA 2BXZA 1GVRA 2V0TA 2ACUA 2HROA 1GOMA 3RLHA 3B0PA 1TPB1 1CWYA 4OT7A 5CC6A 4IMAA 2YCIX 3OHMB 3W2LA 3VTRA 2CLIA 1RK5A 1RBAA 2FZMA 4PC8A 3QSRA 2TSYA 1ZLPA 3W07A 3C61A 2X16A 3SY8A 3VNKA 4DIAA 4KGJA 4MG4A 1JZ8A 4A3UA 2AGTA 3K1DA 4CD8A 4GVGA 1EBGA 3TZNA 2DT3A 1DTUA 3NNTA 2NV2A 2WLYA 3QQ1A 5CJNA 4EXQA 2I7GA 1M01A 3BAYA 1KC7A 2XVPA 4HU8A 2WVVA 4LAOA 3MUXA 1S46A 3B04A 3O5OA 1DXEA 3LOTA 5IDZA 4JS3A 5F2LA 4C02B 3UFYA 5DMYA 4ONVA 4W7UA 1WZKA 4UIOA 1ME7A 3EWUA 1EQPA 3V35A 2OQYA 4ODKA 1RD6A 3XIMA 3IEBA 1JF6A 2ZA2A 3GPKA 3P14A 1VBHA 3KS5A 4E2OA 3MCMA 3QR3A 2HQAA 4NJKA 3M44A 4QT2A 1XDMA 4KEUA 2VEKA 1XSKA 4LVAA 3OBAA 3W82A 1I60A 1ZK6A 3ZJ8A 1TR1A 2C19A 3W9ZA 1P6CA 2FZBA 2JFEX 1ROUA 2F6XA 2VFIA 5HPCA 4ADTA 1GJWA 3WMLA 4GD0A 4AB4A 1JDCA 1DBTA 2LKNA 1E1CA 4CD5A 1IXNA 5GJPA 2OELA 4X2RA 2J9XA 3TP4A 5HANA 3OBEA 1XBVA 4G8TA 3HG3A 3CZ8A 3QV8A 5LNWA 3IJ6A 5F4SA 2YL6A 1LLOA 3NOYA 1LUCB 3ICJA 1V6VA 4G2DA 2P8CA 3CWHA 2DSUA 4QGCA 1GZJA 4ILSA 3H2OA 3UG5A 3AXHA 3N11A 3ORWA 4KETA 1D6OA 3W7EA 4TNSA 2RDTA 2ZRXA 3GXFA 3KRBA 2GJNA 5LNUA 4RL3A 2C71A 4GFSA 2WJEA 1KCKA 1Z32X 3TJLA 4PZVA 5PTDA 2EF9A 1YPXA 4CQ8A 1XIGA 3O6CA 3FYYA 2MNTA 4NXSA 5AHIA 1S5TA 3PFMA 1TV8A 4BF7A 4AEEA 2ZRVA 5CPTA 1UASA 3C4UA 2Z7GA 4FF5A 5H2ZA 4RE3A 4D6EA 3G1FA 5EL1A 3GH4A 4GE8A 3GDRA 5FACA 4QLJA 5DLCA 4UTHA 4INFA 4Q33A 4I9AA 2Q8XA 3IJ8A 1YX1A 2ZXAA 2DP3A 1EWEA 3NL3A 2Z1WA 3R2GA 1VYPX 2HS8A 5IHSA 2HEJA 4HMNA 2E28A 1RPXA 3O5EA 1QK0A 4TW8A 3DYOA 3HB9A 2F2KA 4NZ1A 5AZ0A 1ONWA 2JEPA 1OIMA 4XZ9A 3M07A 2GVGA 1EYMA 4PFMA 5FEWA 4DO4A 2QUVA 2Q71A 3IJ7A 4E8CA 5C8BB 3B8IA 4O2TA 1ZSXA 1FKDA 3KOWA 3TC3A 2VQUA 3IJ9A 1A5KC 4HARA 3LPGA 1H51A 4HMDA 2ZE3A 4QJ4B 2FKPA 4H1ZA 3QOKA 5GPGA 2GGJA 2BZNA 3RK8A 4IP4A 2VWSA 2DZWA 3THCA 3W87A 5JQ9A 1O5XA 3WD0A 2OWCA 3A47A 4RE4A 3B97A 2HTMA 1K7EA 1L2QA 4IPLA 1QI2A 3WQVA 1Z89A 3WLHA 4DNHA 4AD2A 3QW4B 4Z1DA 4A3QA 3GNRA 3VDAA 1XLJA 1N1AA 4R7OA 3ARVA 4FA3A 3IWPA 4MVAA 4A8LA 1KB3A 4Q8QA 3WH9A 4H4IA 3W1RA 3SGZA 1BSLA 2CBIA 5FAGA 2KAUC 4ZE4A 3JW7A 1DJGA 2ZRUA 4Q32A 4NQ1A 1KFKA 4MZ8A 3RXZA 4XZIA 4ZO7A 3GU2A 4JZ5A 4DO7A 1RR2A 3S5OA 1G01A 3R12A 2J88A 1OD8A 3QPYA 4G7EB 3H4GA 3HBLA 1PEZA 3R0KA 4MY8A 3C0SA 3GWQA 4NX0A 3KHJA 3L4YA 3V0UA 1EJXC 3OLEA 1A3WA 3DX5A 2JEQA 4ZQOA 3E2SA 3LLXA 4ZPTR 4GC3A 3I6CA 1BWLA 4TMCA 3PS7A 3FS2A 2YDRA 4PMXA 2V3EA 1W9BM 3HF3A 3BAWA 2ISWA 2ZR6A 4XG1A 3SY5A 1K02A 4MPQA 2D20A 1G6CA 5CBBA 2PZNA 1I2OA 4IH3A 4WDWA 1XWYA 3IIZA 3AS0A 4QDPA 2EBNA 4EPDC 1J6PA 2VX5A 2VEPA 4MYXA 4H8HA 1K1DA 1PIGA 2EEXA 1Q6EA 3HGSA 3B05A 4ZOAA 4DM2A 3UA4A 3MZ2A 2BV9A 1P0KA 4O1EA 1C3FA 3F5LA 4MLRA 3O06A 4KH2A 4U5IA 4F0KA 4UFMA 3THQA 4G1NA 2FMNA 2DZBA 1GEHA 4B4FA 4LF1A 1BHGA 5F7UA 1ZU8A 4M81A 1XIHA 3UD6A 3S6DA 1ZTVA 3I10A 4QEHA 1E0VA 1P0DA 1F40A 1IIGA 1P7TB 3IAQA 4O1DA 2PRMA 4IQJA 4IIGA 1V6XA 3OVQA 3TVAA 3CTTA 1NDWA 1OG0A 1ME8A 4QEEA 5FF4A 3O5FA 1FHDA 2WMFA 3O16A 2G3NA 3D6NA 4S23A 1WZLA 3E96A 4J4KA 4MNLA 1UW9A 3EWZA 3JRKA 1OBAA 4CU7A 3WZ0E 1J0HA 1H49A 5EU9A 4J4NA 3W4RA 1AMKA 2V68A 5EMJA 3AXXA 4AC1X 1UWTA 1XRVA 3E49A 3RDKA 2PDUA 2YW4A 3CJPA 1YNYA 3WDQA 2WHJA 1HG3A 5MKGA 1O94A 3EBVA 1XRSA 4W8BA 4US5A 1VJZA 3F1QA 2Y62A 4AU0A 1UD4A 3R4IA 1JRBA 1H4PA 3UBPC 5D9OA 1UBPC 4JGDA 1W0MA 4U86A 3OTRA 1XIEA 1WOBA 4CUCA 1TRDA 3TLLA 3FLUA 2E6YA 1TV2A 2XP3A 4JAWA 2RDUA 2VEMA 2OZ0A 4JFKA 3U57A 2PDJA 3ZVHA 1ZPTA 3LMZA 2XHYA 1IT0A 1NQKA 4Q4PA 5HNUA 3AYSA 2OZ8A 2PWGA 5H8MA 3R94A 1B3YA 4J35A 9XIAA 2PGEA 2Y4SA 1KBLA 1OG6A 2QCFA 3ARTA 3WQ6A 3IIPA 3T7VA 4AIBA 4E2VA 4RE0A 2VGIA 1KCLA 5CPSA 4F40A 1FKGA 1P1MA 4BHYA 3S5ZA 1J2BA 4P7LA 1KM2A 5G1YA 1UH2A 3WBXA 3AQUA 3BJSA 4CCEA 2C3ZA 2D1ZA 1UR0A 1OFOA 4HA3A 1Q1CA 5E5CA 1HKMA 2MANA 2VX6A 4PCFA 4F0RA 4KQNA 5FESA 3MA8A 3W6YA 2HBVA 1PB0A 4XD3A 3DESA 2KI3A 2XP5A 1E5NA 1DP0A 4R7WA 4QSFA 3UWZA 3DAQA 1TQJA 3TQ0A 4U2YA 1M1BA 2DJXA 5I07A 3HQOA 2ATSA 4XD5A 4LCQA 3QR1A 1E51A 3WJWA 3TR2A 3ME3A 2Z24A 5FJPA 4L1XA 1MW3A 2JQXA 3G3MA 3VE9A 2ZZ1A 5CGQA 1XIBA 3ZZ1A 2Y7FA 4JTIA 4N4QA 4PRWA 2VTFA 4JFJA 2QKFA 5H91A 3EMQA 2VC9A 4MSPA 3BVJA 2UV8G 1VBUA 4LC8A 3N34A 1OQFA 1GVEA 2INZA 3LGDA 4UTMA 4GGBA 3MKKA 4J3TA 4C6BA 4PMNA 5HOSA 2FFCA 4BF9A 3LCWA 1PKMA 1W9PA 5FOOA 3H70A 3A4JA 4CEUC 2WMIB 1D2KA 4PTVA 1UBSA 3TE9A 4BK9A 1ODUA 1EFZA 3ONBA 5TAOA 5TF0A 3T0CA 4JTAA 3H21A 2PDQA 2OYMA 1PDZA 6A3HA 1H62A 4IISA 4NZ3A 4BR1A 3HGRA 1S5WA 3T1GA 4AX6A 4NYYA 4HCHA 1FH9A 3U7BA 3TSDA 1V0LA 5DF0A 1XIDA 2BBFA 3QKZA 1C9DA 1X7FA 2FTPA 4XB3A 2PV1A 3M0ZA 4OGZA 3PK7A 3ZLHA 1SZGA 3AIRA 2PDIA 4CVUA 1HUVA 3PZMA 3WEZA 3A21A 3LHUA 5I3GA 2QIIA 1QPKA 2V67A 1QDSA 2YLLA 2J7DA 1QPNA 1VJSA 2JBMA 3WJXA 5A94A 4K7YA 3CHDA 1TVLA 4LAVA 1JZ6A 3VOHA 3VKDA 1V3JA 2IF4A 1NOFA 5HQEA 2VGGA 2B0MA 1ICPA 4HA4A 4U5KA 3WX7A 3RIKA 3KS6A 5AVNA 3BOXA 4YWIA 4Q8PA 3AHVA 3W7OA 3AXMA 3H22A 4S2BA 1SFTA 1UUQA 4ZL1A 3T8QA 1EHNA 4FEZA 1CW2A 3MI6A 2DUXA 3LHZA 4ODNA 3AMGA 4GX9A 4KEMA 4UQEA 1PKNA 4JQ2A 4CN4A 3BDKA 4MUPA 5DIVA 1UR9A 3LZ3A 3W1UA 2QW5A 3CUGA 2VL4A 1REQA 1XJBA 1GTHA 2FPYA 1SR9A 4ZQNA 4JTGA 4DWSD 3U6WA 1A3XA 4IG2B 3RUBL 1EJWC 3Q94A 4ZXOA 3GBDA 4HTYA 1JCYA 3LQLA 4QNWA 1Q65A 5IFTA 1D3CA 1JIBA 1VPXA 2Q8LA 2FTYA 1GOQA 5LNSA 1EIXA 1M7XA 2PTXA 3VKCA 4X9YA 4MFEA 4I5UA 1D7JA 2DUAA 2J7HA 2CHOA 2QCEA 3E02A 2RUSA 3C86A 4WGHA 3FJNA 4B5XA 4C6JA 4QE1A 5BRBA 4XVDA 3KRZA 2UBPC 2Z26A 2OO6A 1XCFA 5AECA 4HZ8A 3JUGA 2I9EA 3TFXA 5BXRA 2GJXB 3WNLA 1QPFA 2QMJA 3W7HA 2J7CA 1AD4A 1UB3A 1O5QA 2HK0A 3VA8A 5GPRA 3ZWSA 3M0JA 2KFWA 1TFVA 2PDNA 1OCNA 3RM8A 3FGCB 4HBKA 4G56A 4Q4KA 4F2UA 2MNRA 4ADUA 3IGXA 4HSNA 2JGYA 3NTYA 2F4EA 1E43A 1LL7A 1EXBA 4D8LA 2DPEA 4RPPA 4F66A 5HXMA 2HPMA 4HOXA 1TTQA 2Z1KA 2FVKA 5JBFA 4L9ZA 3EWDA 2P4VA 1S5NA 2GUYA 1EX1A 3GW3A 5C2CA 1ZAIA 2XVLA 4OOUA 4YTSA 2FH6A 4UOQA 1FCBA 5A2BA 4AVOA 4B92A 2DVXA 4DRNA 4F4RA 2PF8A 1OX6A 5HMFA 1XG3A 4O12A 1EOKA 5FI8A 4FIRA 1MQQA 3MCNA 1GQKA 4LBUA 4LCSA 1FDZA 1RA0A 1XPYA 4KQZA 1PBGA 2QV4A 1QMLA 3OEXA 2ZZ5A 4BJHA 3RYSA 3RCMA 3UR7A 2O4MA 4HK6A 3HIJA 2CW6A 4WZHA 1W26A 4G7FA 1I2NA 4Y90A 1G67A 2I17A 3V1PA 1FJDA 1VEPA 2WCAA 1ZBWA 2IKIA 3VDBA 1J93A 1K9FA 2NT1A 1W3KA 4AXNA 4H9MA 4O10A 4MNKA 2E1DA 4TYOA 3KCOA 8TIMA 1P0EA 4Q8NA 1A5CA 2INFA 4BEUA 5GJNA 3W85A 5XINA 4OBRA 3W86A 5B7YA 4LSBA 2EO7A 1CX9A 4P8XA 4YNGA 1Z44A 3D0CA 3EX4A 1C9HA 4K1GA 1V08A 4XAGA 4ERAA 4FXSA 2B7PA 2IKJA 4NAFB 3UQNA 3M0KA 1H09A 2PLKA 1RP8A 2G96A 2X0HA 4UC5A 4PUKA 1WX0A 3QFWA 1Q63A 1DWIM 2BVYA 3AS2A 3T44A 4TVUA 5MHBA 2PLMA 2XG9A 3IVSA 1LL4A 3QRHA 4CD7A 1ZBCA 7CGTA 1MI3A 5DITA 3UWEA 3VKAA 4GYPA 2VZOA 5EBAA 1P0BA 3N18A 2NXGA 3B8UA 2VEGA 2ZYFA 3TA9A 4MDPA 2Q8ZA 4JTLA 2YGYA 5A3HA 4FX8A 2D3LA 2ZZ4A 1WDRA 4QG6A 2ABAA 4IPIA 4A29A 4B2DD 1ONEA 4IIEA 2V3DA 3LY0A 1TR9A 1JNEA 3E5PA 5CBIA 1AW5A 1LT8A 1OF6A 4YYFA 3W7GA 1O68A 3W27A 1SZFA 1H3GA 4WF7A 2ZC8A 2PV3A 3ZR5A 4S1FA 3GXNA 1LTDA 4GPNA 3MHUA 4AWUA 3TCSA 4Q3MA 3CUZA 4AY8A 2IPWA 3NO5A 1QI4A 2G8ZA 2GDVA 3HN3A 2DVTA 4YYCA 4JTEA 4US6A 4ZTYA 3T8LA 3WNNA 1V02A 4QQUA 3S47A 4GVIA 1TIMA 1UIPA 5H6HA 3BCJA 3UYIA 4DRHA 3G1RA 2XH2A 1FKFA 4J2PA 2VGFA 4R7JA 6ALDA 1O5KA 4Y8FA 4DZ3A 3A22A 3L5LA 3WMSA 3GZAA 3APTA 4E38A 4AUBA 2PDWA 2YYUA 4L6DA 4RDVA 3G1YA 3WYZA 1N55A 3VNJA 5LIXX 1SZEA 3LU2A 3ELFA 1FKJA 3NDZA 5BMXA 2W4XA 3PJUA 1HP5A 3IAPA 3KZ7A 1AZ2A 3V75A 3NQEA 2NWSA 1JDAA 3PZNA 2BY0A 4IMFA 1TWDA 1W9DM 3IK8A 4NI3A 4L4LA 2V5KA 3DDMA 3AIEA 4Y9PA 5FKYA 5HJYA 1ONRA 4PE8A 1VFTA 3GIPA 3HFTA 2POZA 5E9XA 1MEIA 3S2CA 4UQDA 5HKGA 3VMPA 3CLMA 2JGQA 3VIIA 1AG1O 5HPOA 1T96A 4YVVA 1OINA 4P7NA 1UMLA 4MYAA 2QF8A 2OWWA 2VI0A 2ZX9A 3EWYA 2BY1A 2Z2BA 3WK0A 4IPPA 1E9YB 4O0QA 3AICA 3CQKA 4UTWA 4BFAA 3HTWA 1H60A 3DFYA 2FGZA 2BSLA 5AZ1A 2FYMA 1VENA 1Z42A 5E6YA 3BUVA 4V1XA 1IR1A 4GNKB 2PLCA 5CLTA 4NG3A 4KCWA 1EPXA 5CG0A 2ICSA 3UPBA 5HR7A 1UYQA 2D9FA 1OYAA 3MJMA 1GPFA 3OG2A 2G0WA 4GUFA 1IEWA 1B54A 2VELA 4NZFA 3V1HA 3PPHA 3VOIA 2NLYA 4MF4A 1GG0A 2JE8A 4RPQA 1FKBA 3PZGA 4ZO8A 4JCMA 3WLJA 2R1MA 1CLXA 1QFEA 3W2NA 2XH0A 1E6RA 4C60A 3RFAA 5A8QA 3D5HA 3W2UA 1FWGC 1MQPA 3NQ7A 4O8RA 3PTDA 2VYOA 4X61A 2QUMA 1GHSA 2YCJA 1YIXA 1JQXA 2ZE0A 3OU8A 2VCCA 1B3OA 3TYUA 5DMMA 2YLAA 3VIJA 2ZCGA 2OG9A 3PWGA 4DN1A 4BEQA 3NRKA 4I9TA 3KLKA 3QGKC 1EL3A 4Z42C 1LBLA 1VD6A 4MKVA 2OEKA 4WDUA 4FX6M 2QYGA 1HL2A 2Z1XA 1VH7A 4AZ5A 3W2KA 3S3GA 2QCMA 1HKKA 3TA6A 5HAOA 3AISA 2WSQA 3B9EA 3U4AA 1FUYA 4GIRA 2E68A 2XFYA 3E0VA 2ZX7A 1EB3A 4WXZA 3VGDA 1W1YA 1E4LA 2EG6A 2WKGA 4LAUA 4TMBA 2FZDA 1I4NA 3C6CA 1JFXA 3CGTA 4HNUA 1J01A 1CGVA 2VR5A 1EDQA 5J6EA 1VKFA 4FAMA 3JZUA 3T2QA 4O50A 1QJWA 2YOCA 4DLMA 4Z2KA 4RDWA 2E9BA 2OT1A 1OFPA 5I02A 4DLFA 2BOFX 5FF7A 1HL8A 1I1XA 1XLCA 4RR4A 3W74A 5SWUA 3PZIA 4CNNA 1V77A 1ISXA 3AMLA 3CL8A 1T6MA 2Y70A 1ZCCA 4DI8A 4XO7A 3BAIA 3UWYA 1WP6A 4L61A 1E6SM 3O07A 1MVYA 4JTHA 3MYOA 3RGTA 1NDVA 3V36A 2W5FA 2P3ZA 3G18A 4Q4SA 3FYPA 4LF2A 5AC6A 1XH1A 4IJCA 2BHYA 1UD5A 4KW2A 3G8RA 3HPZA 3MI3A 1P5QA 4BQ2A 3K30A 2P1FA 4E4FA 1U83A 5KETA 2DQWA 1KBIA 1PV8A 1R46A 5LNRA 3CH0A 3QBUA 1A0CA 4FNTA 4AEFA 2DZVA 3N14A 1NWUA 1R5YA 2G4FA 1YXYA 1EPVA 3U8GA 4R0XA 3EXRA 1OX4B 3CEUA 1P6BA 4DXXA 5I24A 3WFZA 2OU4A 1UH4A 5BCAA 1BQGA 3VU2A 2CNCA 4GI8A 3PBVA 3VXGA 1QNSA 2GDQA 4L6OA 5A6BD 3IJLA 5HW6A 3LEPA 4WD0A 1VRDA 3DG7A 5CH9A 1T11A 2C0HA 1GJUA 1B90A 1IXQA 2YJQA 3GXDA 4K37A 1FY6A 2GDUA 3C56A 3CV6A 4FP1A 2CZ5A 2YDSA 1EX5A 1UD3A 3VIFA 3O1NA 2GK1B 3GVWA 4JTCA 3LPOA 1M5YA 3A3WA 4B4HA 2RGMA 3N2TA 5HBFA 1HKIA 1P0NA 1PZ3A 3AMKA 4QBXA 4XTDA 2QJHA 1BWVA 2QDDA 1ISVA 1K77A 5G4EA 1GYLA 1P43A 4OUIA 2DV0A 2UY3A 3TQKA 1TX2A 1I9CB 3ANYA 1V03A 3S1GA 3MDWA 1E44A 4E5TA 4E0CA 4QRNA 3AU6A 2DEPA 4CLMA 2Y78A 1TCDA 3MB9A 2NZLA 2P50A 4XO6A 5T9CE 1O66A 3SCOA 3BGJA 1E72M 5JIWA 1KRMA 2D0FA 2X42A 3OYXA 4DBWA 4ORIA 1Q4WA 1JYNA 3BARA 4J40A 3LA4A 2QUNA 5C9XA 5AHLA 3CB3A 1KQZA 5EA9A 2A6NA 2G50A 4UNLA 4CVWA 1W17A 1XUUA 3VIOA 2XP6A 3WH5A 1PHWA 2OFJA 2QT3A 1UP3A 2F8QA 2NXIA 3GC2A 4HCDA 1TZZA 4H19A 1J4RA 4RK8A 4IJBA 1Y5WA 2IPFA 2YZ5A 4FIQA 1BYDA 3W00A 2WSKA 1KTBA 1GVQA 3P81A 1F6PA 3RFWA 3QEZA 3ZVIA 4FSAA 4H8UA 1EP2A 5TIMA 3OIXA 3DHFA 1AW1A 1CPUA 4QFUA 1JZ7A 1BF6A 3WMBA 4IF2A 3OG3A 3VM5A 3UPWA 4PBGA 1G69A 1KM3A 4NNBA 1R3WA 4N0RA 4LAWA 3RM9A 1ZL1A 5E70A 1EOMA 1J0IA 3AIWA 2C14A 1VFLA 3W7NA 2XN0A 3DZ1A 2ZZ6A 2H8ZA 1R9XA 5C54A 1XDJA 5F2MA 4OIFA 1X6LA 4M19A 1W1B1 1RJRA 4I9JA 4N42A 1UA3A 2VGBA 4QJ5B 4MLJA 1FWIC 1O95A 3RCYA 1C90A 3B9DA 4CCCA 1EZ2A 5LKYA 1GKPA 1R3SA 1L6YA 1BVNP 3GK0A 2O7SA 5EMLA 1T8XA 3ONCA 1IEQA 2G3FA 4OFCA 4UTTC 3STCA 3VFLA 2OLSA 3IV3A 3G3DA 4WK9A 3A9IA 4YL2A 4DZIA 3GC5A 3EOSA 3WEMA 1E5JA 3M0MA 1BVWA 2ZQTA 2A21A 5CGMA 4B15A 3WQEA 1Q85A 2V5DA 4KCTA 4D6HA 1AZ1A 2PURA 1RBOB 3EOEA 4EP8C 1G94A 2XIQA 1DTNA 5M17A 1BAGA 4HPJA 5G2WA 3Q45A 3CWNA 1CXIA 4ICMA 1GONA 3G6LA 3EKZA 3T0DA 3BG9A 3SRHA 2DZXA 3CIWA 3A64A 2E7FA 1TTIA 4V1YA 2D2OA 1DIDA 4LBRA 1JI1A 1OEPA 3CZGA 1K9DA 4Z2HA 2OLAA 4M6UA 1KFEA 2J13A 2RURA 3BG5A 3P5ZA 3KZPA 3WBWA 1XLKA 3NXFA 3EKLA 1GTEA 3EWBX 2QCDA 2O0TA 4HNNA 2W0UA 4D8AA 1OT1A 3GIQA 2TODA 5HTGA 1N8WA 3BJFA 2OO0A 1YW5A 3ABOA 5E93A 1ZNNA 2D0HA 2I56A 1RP9A 1AODA 2BGNE 2ZA3A 5FEXA 5I09A 3JYJA 5D9NA 3CGNA 3H4WA 1FKLA 2PN0A 3ITCA 2XU2A 1HO1A 2V3FA 1R3RA 2FPTA 1T0OA 1VRXA 2ZICA 1GZGA 1XIJA 3FKKA 1QBBA 3M5XA 4LVFA 1F7BA 3BJTA 2NQHA 2F7FA 5D32A 3W7KA 3PJTA 4RDZA 1GWJA 2AWGA 3A4XA 2GGEA 3A4AA 3HQPA 3PNZA 2PDKA 2X1IA 2ADAA 3DGRA 5A69A 3CXOA 3SQLA 3CZKA 4YU1A 4RKAA 1BKFA 1C92A 4YTRA 2WW5A 4DVOA 4HPGA 4HSHA 2BTMA 2E6FA 4F79A 3HM7A 2ZA1A 4E6MA 4KEVA 1FQ0A 1UJQA 1GVIA 4WSHA 2CKRA 1FXPA 1WYIA 3BLPX 1C8VA 3KBWA 1BLIA 4WIWA 3MPGA 3I7QA 3IANA 3NPVA 4JFUA 1CXLA 1VFHA 3VOCA 4YTQA 1UC4A 5AFDA 5IHRA 2E67A 5REQA 3W7PA 3LUTA 1A47A 3SR7A 3JR2A 1JGMA 3GDLA 1GQJA 4MFDA 3OVPA 3TAKA 4CU8A 3RILA 3NSXA 2Y85A 4JD4A 1J10A 2SFPA 5F2IA 3FJLA 4NX5A 5EYWA 3INPA 3OZYA 2X05A 1AQ0A 5HULA 4NF7A 5G4WA 5HMEA 3NQCA 5A6AA 3NPWA 1NWRA 4XQ6A 1RVKA 1ALDA 1QXLA 4DHGA 2WAGA 3OQ8A 1OVDA 3ZQ9A 3LCXA 3UZXA 1JXKA 1I2PA 1DXFA 3G2GA 1DL3A 1NQ6A 2NX3A 4XAZA 3LX9A 2OQLA 1ML1A 3BW2A 1PBKA 1Z8AA 3BLIA 5BU9A 2X2YA 3DBNA 4AY1A 4Y9AA 3VDHA 2FIQA 4JYDA 4LH8A 5LXXA 3UZJA 3PB2A 2FDMA 2OMAA 4IJRA 2B7NA 2RGLA 4R27A 1XPGA 4GUIA 4PMVA 4DRQA 4HP5A 4NZ5A 1F4AA 3EGJA 2XP4A 5I98A 3LGEA 4JHOA 1LCOA 2Z6JA 4XZNX 1EYEA 2ON3A 1XXXA 4LVDA 1C7SA 2JALA 1U1HA 4W85A 1EXPA 1ZALA 3C0LA 4UTKA 1Q7MA 3G1SA 4B9YA 3GAYA 2GUBA 5ABEA 3SQSA 3F2CA 5ABTA 1ZBVA 5ENLA 2XH7A 2FH8A 4D1IA 3N73A 1VQTA 2YPIA 3QY7A 3WH8A 2OGYA 3I7SA 1PWLA 3G1DA 4PMYA 4O57A 3WLNA 1E6XM 3ZXWA 2QF7A 3FVMA 4REQA 2DIJA 2PPNA 1LLZA 3GFYA 5K9CA 1SO5A 4DRSA 2Y0FA 4JOMA 2Q3RA 4JIIX 3LN3A 1KTNA 4J3ZA 1ECQA 3EB2A 4AF0A 4E3VA 3BZJA 4NNAA 1WZAA 3QLDA 3AXKA 2Z1SA 1CEOA 1BG9A 1L1PA 3W7QA 4BI5A 2DH3A 2A4AA 5H8PA 1ODZA 4TW6A 2WYSA 1VHCA 4Q6JA 4Y96A 4FB7A 3CTLA 1YPIA 2VX4A 3IIVA 1E0TA 2A3LA 2WM0A 3TYEA 3WQPA 2WZTA 7ODCA 2WANA 3L5MA 4QIUA 4KWOA 3NDOA 1D3HA 4B5NA 3GG7A 3MZNA 1ZJBA 3WF3A 3MMTA 1C8YA 3AALA 1FH8A 1KGXA 1O1ZA 2QIWA 2OZ3A 4AZ6A 1H7OA 5FL1A 1MQRA 3TWAA 3PZUA 5M2FX 2YFNA 2NSXA 3VNDA 4ZQMA 1QNVA 4I5XA 5A6TC 3BSGA 3GG1A 1Q8JA 1F76A 1NM9A 3IVUA 3OVRA 3FN9A 5K7JA 5F1UA 2EXOA 3MP5A 2WOQA 1JEZA 2PWVA 3KP0A 1OM0A 3ALFA 5EKYA 4LUSB 2CCRA 3KM8A 1KT0A 2G3MA 2R1LA 3UU0A 1GYNA 3RU8X 4P7QA 2F6KA 1QWKA 3WQ4A 5FJRA 1B0IA 5CZJA 1J12A 4ZO9A 1WAWA 3P67A 4ZZ9A 4M8UA 3BE7A 2ZRWA 3QC0A 5C2XA 4PMZA 4L4PA 1XYZA 1FP9A 1MYRA 4AHOA 4PN2A 5BROA 3QZEA 4LRTA 3D3FA 4PMQA 1V7AA 2PD5A 4ZGYA 1XLMA 3VKJA 2TMDA 2GSEA 3FYOA 4W5UA 2W9MA 1W3IA 3DFSA 4J5NA 3N13A 1JZ5A 2PWHA 1PS9A 1QPRA 1HJVA 3RJYA 2E1WA 1V3LA 3SCNA 1Q6UA 4UOJA 3DH7A 1QPLA 2MF9A 2FGBA 3AUJA 3QGVA 4Z1CA 1HZYA 1FHLA 1MUCA 5LIUX 1XC6A 1DJQA 1KFCA 3EX6A 3MSDA 5JMUA 2FHFA 4XTIA 3L9CA 4IMGA 4GZEA 1S2CA 2Q6ZA 2WCGA 3VINA 3MWAA 1F8MA 2J77A 2PDLA 4RNIA 4NT0A 4R3UA 5K3VA 2VCBA 5A8OA 3W3OA 5JUVA 2YIHA 3PZOA 1JDFA 2EG7A 2FGLA 4AHQA 2XWEA 4QDWA 1BF2A 3LBMA 4F8XA 4IPNB 4PCSA 3UP8A 1EBHA 1BQCA 5B7ZA 5HMDA 3R8HA 3WH6A 1PTGA 2QCGA 4TW7A 2KO7A 4UBPC 1PL9A 1EJUC 1EDGA 2WJFA 1J0JA 3B0YA 3P8IA 5C9RA 4GJJA 2OEJA 3UJ2A 1HJQA 1K7XA 2RHGA 8XIMA 1YE4A 3N1AA 4J2MA 3RPMA 4F9DA 2XPBA 5B8IC 1T40A 3S1UA 4NP7A 1EHAA 4PL2A 3HV8A 3W37A 4L9YA 2J47A 4U10A 7XIMA 1S3TC 1H1YA 2A85A 5AYXA 4WUIA 1HKWA 3LPPA 1ZAJA 1RAKA 1H7XA 5I78A 4NJJA 4WOQA 3HZ3A 2VDGA 1THFD 4AH7A 1FVPA 1H1NA 5FCZA 2X8RA 1US3A 3MMUA 3TONA 3GHUA 3F03K 3NFUA 5I3IA 4HJFA 3YPIA 2H8XA 2J8FA 2OCZA 4DIPA 3A24A 4MOZA 3GR8A 4GYPC 3W1QA 2VZUA 3T2PA 4FNQA 1JPKA 1SJDA 3DFNA 4WSKA 4DZ2A 3V0SA 3DYMA 3CMGA 3PUDA 1UR1A 1XH2A 2XVNA 4FPSA 4PB4A 4JIHA 4QS5A 5FA5A 1X97A 4WKFA 5C0QA 1V8EA 4HHLA 4W87A 4JTKA 1TELA 4O17A 1H1ZA 1QATA 1KRAC 4HMCA 3K5XA 1G5AA 4E8DA 4H7VA 3C2EA 4IGNA 2ISVA 3O2LA 3W28A 4G2PA 3CL7A 1SGJA 4GIYA 5BWAA 3VCCA 4WLCA 4PODA 4LB3A 2GJLA 2OKOA 1VJIA 2QVNA 4CD6A 4XAKA 1W2PA 2DZUA 2GVEA 6ENLA 1GORA 1M9HA 2BMBA 1OSEA 2OLHA 3URNA 5H1WA 3NZPA 3VGBA 3WLIA 1CXKA 2YL9A 4HT3A 2VRQA 3GNDA 7REQA 4PR4A 3WQDA 2Z28A 3BLDA 1GPWA 2PTZA 3MT1A 1W3HA 1L8NA 1GKRA 2M08A 3TAOA 4YS1A 1FKIA 4A6GA 2OOFA 3MKCA 1ESWA 4S3DA 3DYPA 1EZWA 2PWDA 1WDDA 1R30A 1XW8A 1Y7VA 1I1WA 3L4ZA 4IL0A 5CKSA 1DWAM 4IFRA 2X1SA 2FZNA 3WLTA 4KERA 1NFGA 4US5D 1RV8A 4JX4A 4ACZA 4H01A 1CXHA 1S2WA 1S3HA 3BG3A 3GR4A 1SJCA 3U5YA 2J78A 5KSWA 4DXKA 3W2JA 1VS1A 4JTTA 4L65A 4GIVA 3WNKA 4N02A 1Q6IA 4Q8WA 3FXGA 3URBA 2EKGA 5I06A 3NIYA 4H8NA 4AZHA 4ZSTA 1IQ8A 4GNVA 2HVNA 4N6EA 3CUIA 2PMQA 4C6EA 4GCXA 1CXFA 4FF7A 3RLUA 1XBYA 4HVXA 1Q6QA 4L9XA 4UMBA 1NSJA 3SI9A 1AJZA 1ELSA 5C9WA 4HA0A 4OZOA 1XS2A 5D04C 4M7TA 3OYZA 2WMKA 1C91A 3A13A 4O54A 2VC7A 2J7EA 4QISA 3DFQA 3NSMA 4IP7A 2DGAA 4M29A 4PCNA 3QH2A 4UTJA 1A4LA 3FEMA 2DJLA 1W56A 1N8FA 3HJZA 2DY3A 3TROA 2WC7A 3GLCA 4A3YA 4DRMA 3UJRA 3UT0A 3AAMA 2A7NA 2QDHA 3LB0A 3A6OA 4R53A 2V69A 4A8IA 4C6KA 4ERGA 3M0XA 2EHHA 1AH0A 3WJSA 4DF2A 1OFDA 2P3EA 1SSGA 1R9YA 1MW2A 3RU6A 1HXVA 1TIWA 4LEQA 3CV7A 1XGDA 1MFUA 4Q4MA 1SZRA 2XIMA 2XFRA 1Q13A 2FHCA 4JY9A 1MEHA 1U2YA 4Z1BA 5E0KA 2W3ZA 1TE6A 1KD0A 1ZHAA 4OBSA 4GUJA 1EJTC 4KESA 4S3GA 3REQA 1TKKA 2BXVA 4RNHA 1U5JA 2ZUVA 1VZWA 3KBJA 4JQ1A 3BLFA 4C6IA 2Z2AA 3PULA 1PPIA 4POCA 4MNMA 3FY1A 4QXIA 1NAL1 4WDXA 3KFTA 4IZGA 3KAFA 1RQEA 1TE1A 1HO4A 5JBEA 4O53A 3DHPA 3QR0A 2DZSA 1OFRA 5D38A 4I7VA 1DIOA 2NQLA 3V5OA 2E3ZA 3FA4A 3V5CA 3LV5A 2ISSA 3W71A 1KXVA 3TW7A 1W1ZA 1E71M 1QI0A 5C6MA 1EF3A 4S3AA 1SU5A 4B5TA 1IF2A 4W8LA 1GW9A 1B5TA 6TAAA 1WPCA 4DJDC 3EAUA 3EPMA 4HK5A 4UQBA 2GWNA 2J8TA 4R9XA 1I0DA 4QTGA 3O5RA 4Q8MA 3P5YA 5T9BG 1UC5A 2OEMA 3T4WA 1DORA 4IXXA 3IV8A 2PDMA 1O7AA 2WKLA 1MSSA 1M7PA 1HJWA 3TTOA 1XX1A 5FF2A 4YIWA 3CO4A 5A6MA 2O56A 3F4VA 4Q22A 4JDYA 3ITYA 2HCVA 1RQBA 4XD4A 3VFCA 3TNOA 3K4DA 4G5DA 3WK2A 4LW7A 5M1TA 2X41A 5T8GA 3HG4A 5CGTA 3RMJA 2XIJA 5D9MA 4P7OA 1YEYA 2OPJA 3NEHA 4K1WA 3NM1A 1TPH1 3MDYB 3VC6A 2PDGA 1O60A 1PAMA 1TREA 3NQDA 1XLEA 3G1AA 1BGAA 1SJAA 1H0GA 1JD9A 2VCDA 2P10A 2EPKX 3UG4A 3ZO9A 3W26A 3IJQA 3L0NA 4LV9A 3TEVA 3MUZ1 4ENLA 1UWAA 2QCDB 2WXDM 3N2BA 1C9WA 5CZSA 2XFWA 5B80A 1EA9C 1EEXA 1V3IA 1J8VA 4DF0A 3ARWA 3BCFA 1YLVA 3Q58A 2NUYA 4B91A 1V3MA 1AD1A 1N7KA 3A3HA 1O12A 4S3JA 2ZDRA 3UG8A 7PTDA 4EE9A 2HSAA 2W91A 4DM1A 1J79A 2KZHA 2JK2A 5LYRA 5D75A 2O92A 1XLFA 4PFHA 3EEGA 4K2SA 3KDNA 1VBJA 5ABGA 3NI6A 4Q4RA 3NO3A 3STFA 3EOOA 3B0VC 4JKMA 2ODOA 4NU7A 4EF8A 2POTA 3IUIA 3OA3A 5DMNA 4IQEA 4P8VA 4U3AA 4I8YA 4CCZA 1U1JA 1MUWA 3QY8A 3EWCA 1RHCA 2OB3A 2W67A 4BF8A 1CCWB 3DGBA 2DFAA 3F2DA 3FHAA 3FHQA 3L0KA 3RJXA 3STGA 3KDOA 3NGFA 4H83A 1KRCC 4O18A 1IGWA 2CPUA 1M6JA 2QS8A 3P82A 4H9TA 1XHGA 3SN4A 1JAEA 3I68A 1B4EA 5DCEA 3WF2A 4X0NA 1KQYA 4CQCA 5GVJA 3S1WA 5M03A 5IDIA 3NQMA 2CLPA 5REQB 3L21A 5IXEA 2YCLB 1LF1A 5CJMA 4QITA 4NHVA 1RH9A 3MBFA 1KKRA 3VE7A 1L6WA 4LT9A 3HPAA 4MB4A 4QHRA 4XUGA 2WVSA 3SURA 2ACRA 4XVEA 3SJNA 4JTSA 1W8SA 4Z2JA 2GVYA 3ZR4A 1FKSA 4H2HA 4O4WA 5DO8A 2J66A 1IXOA 1VIWA 4QP0A 1QAPA 4MJ4A 3SFWA 3OP2A 2WVTA 4JR5A 2Y8KA 3WDIA 4PSPA 3GFZA 2JZVA 1J0ZA 4FOUA 3MMWA 5D4YA 3N6HA 2VHLA 1SFSA 1D7KA 5F4XA 4NL1A 1O1HA 2IQ0A 3ZMRA 1D7FA 1F73A 5JIPA 3ZT5A 3WO8A 1UJPA 3LZ5A 1BKHA 3O6DA 1I2RA 3T6CA 1JCTA 1UD8A 1XLIA 4LQ1A 4PRTA 4Q8VA 1PZ1A 5A6JA 3AS1A 4GMEA 3VX0A 4ICCX 4XZWA 1IEVA 3CASA 1FKWA 3KVLA 4S3KA 1WKFA 4PBFA 3VNZA 3BLOA 2X40A 4AD3A 3BWWA 4IT6A 1Q3NA 2PUZA 3PY2A 2DSKA 1XF0A 1VGAA 1VF8A 4DI9A 4GBUA 4C7FA 4C91A 3O0KA 1YTDA 2PD9A 3P8JA 4S3FA 5C71A 1H50A 3NSNA 2I9UA 1YTKA 4IPXA 3T4CA 4NAEA 6TIMA 3H4XA 4W9PA 3CEPA 1E70M 1MXDA 3G6MA 3N2MA 3UERA 4LS2A 1S2UA 3LRLA 2HNHA 3ATZA 1H0IA 1HQTA 3BCDA 5LHFA 1X7IA 5HMSA 4C7DA 3PZTA 3KTSA 1GRJA 1JRCA 1FX6A 3N3TA 3S1XA 1MDLA 4GQBA 3ARPA 3TCEA 3B8SA 3W73A 2PV2A 2XFFA 3WDRA 4D72A 3QMTA 3BGGA 3M7WA 3ZJ6A 4N9EA 3AHXA 3ITOA 4U31A 1VYSX 1POJA 1V3KA 4TQTA 4B3ZA 4JFSA 4BA0A 3O8AA 2W63A 4CEXC 2V30A 1OGGA 2XUCA 1LORA 2V8ZA 3APGA 1LYXA 2IW0A 4XKYA 1UZ1A 2LPVA 1EJ7L 2VD9A 4DPPA 3EB4A 3H26A 2VRJA 2REQA 1XICA 5FJTA 5A5WA 2HRWA 4QE4A 3ZR6A 2A6LA 3U4FA 1NP2A 3RN6A 2CFFA 3TZFA 1R8LA 4S38A 5GNXA 3O5JA 1W1TA 4UFKA 1QW7A 2NQJA 4Z1AA 1SYTA 1GVOA 1DPMA 4ODQA 1EQ3A 2H9AB 3F4NA 1L9WA 3PRAA 2B7OA 2C18A 3UJFA 4LNCA 4PTMA 4IGHA 2XZ9A 3ZIZA 3W84A 3PSWA 3QTGA 2X0YA 4HNOA 1DKWA 1QNQA 3OGVA 3GTHA 4PEEA 2VZSA 1EGVA 3ODKA 4A2SA 5AC8A 3DCPA 4NY2A 2QMKA 4UTFA 1YHTA 2W61A 3WDJA 5AKQA 3P0XA 3ARQA 1PTDA 2Z4GA 3R43A 3DG6A 3FDGA 1UPMB 2CERA 2EG8A 2VP8A 1XYBA 3K4AA 2G3JA 4Z1YA 3VUSA 3W7RA 3B0UX 3R58A 4AWTA 2QJIA 3C0JA 4AWEA 5TQLA 4I9MA 3H2FA 3PHAA 2WSYA 3E3HA 2PODA 3C0QA 3KOXA 3APYA 1W6TA 2OVLA 4BS0A 2C1GA 1EDTA 1VHNA 1TJ1A 1B6CA 3UW6A 3JU2A 2MLZA 2Y1HA 3TIMA 5C2GA 1OC5A 3N17A 1FWAC 4JFIA 4ASTA 1EC7A 1FDYA 3AYTA 1DWGM 1MZHA 3QFEA 4BY3A 3CZEA 4OKDA 5I00A 1BYAA 1H7WA 5E6ZA 1GYMA 4W93A 3VOGA 3IARA 2A7PA 2YB4A 5DO2A 5HT1A 1FP8A 1G9HA 5BWFA 3T0TA 2FHBA 1IWPA 4BQ4A 4UQAA 4B90A 5LNVA 4XBSA 4GVFA 3NPXA 3CIVA 4GXMA 1E9ZB 1OGSA 4RNJA 2QUUA 3GG0A 2F2HA 3JXVA 2WNWA 4AZBA 2JF6A 4LGXA 1K7FA 1QHPA 1KFBA 4GWEA 2HZGA 1SO6A 2PTWA 4A4AA 4UOZA 3VIPA 2VFDA 2ABBA 3T0AA 2C16A 2R14A 2YW3A 4GHRA 3LCIA 1K03A 1O6IA 3RF9A 4NYUA 1XLDA 1R6WA 5EY5A 1LWIA 4MWAC 1FWBC 3BZGA 3VD3A 2NQ5A 5I5RA 3SRKA 4W4QA 3LHWA 3UI5A 1CGYA 5DN1A 3WJZA 3B9OA 3ARZA 3DFOA 4HB7A 3OW1A 1DQXA 5A2AA 2PP3A 5A6SA 4MIMA 3TCZA 3AZRA 4R33A 4H6QA 5I23A 1S39A 2WZIA 3TR9A 3SW6A 1JNDA 4FS9A 1MEWA 3PAJA 3HPFA 4L1WA 1RZMA 3O6AA 1XG4A 2FJUB 1X39A 1WDSA 1FWFC 2CXEA 1HFBA 1YQ2A 2YXGA 4WY0B 3VNIA 4QDMA 2VUYA 3ID7A 3BV4A 5FJIA 3EOLA 3CNYA 1IZKA 3WDHA 3W7JA 2PP1A 3PA7A 3BMVA 3VGFA 1J5TA 3IUHA 4C6PA 2QEZA 3VDCA 5HJXA 4L4OA 4C1NB 1LUCA 3W25A 5EB8A 4ZA0A 4FX7A 3LV6A 1C29A 4GA8A 3Q4DA 3IKDA 1Q6FA 1KGUA 2QAFA 3NJ3A 4BZYA 4GC4A 1DV7A 3RPDA 3CHEA 1BYCA 5DY2A 1RJQA 3EOUA 1RJPA 1EUAA 1TPFA 2ALRA 4O1AA 3PR9A 3QPEA 3W38A 3SN0A 5CZ0A 1C8QA 2AQWA 2ACQA 4EAYA 1YDOA 5C7VA 2C1HA 3TTEA 1QO5A 2WKJA 4MJMA 3VIHA 4DJED 2IPGA 2YA1A 4XZHA 4MADA 5LIWX 5HR6A 1CLVA 2ISDA 1V5XA 3NO1A 4NZCA 3LK6A 3MSGA 1UIOA 1QRQA 2VWTA 2OSWA 1E1EA 2QAPA 3RPTA 4WSJA 2HMCA 2E5BA 2O9PA 3P60A 1QR7A 5D2XA 3E0FA 3UG3A 5J5RA 5AY7A 3NUKA 2NT0A 5FEPA 1GEQA 5DRIA 3TMLA 2EPHA 2ANUA 3I4KA 1FKHA 3TYAA 2WZHA 2EQDA 3FXYA 4JFLA 1IEXA 1KM6A 4XAPA 3OGSA 3WLOA 5E0CA 1N82A 1L2UA 4M80A 1JPIA 1R2SA 4Y9MA 3JYMA 5TD4A 4XK2A 4KIRA 2OX1A 4UTTA 1TPWA 4QT3A 4DJFD 1P5BA 4JQ4A 5D2VA 2Y2WA 3KX6A 4H6RA 1Q6RA 2EKCA 1GOWA 2FKEA 3S9ZA 4GQQA 2VJXA 1H5YA 1W31A 1CNVA 1W5MA 3UNTA 1FH7A 3W7IA 2J7GA 3P74A 3O5QA 1NARA 4MB1A 1X6NA 2XP9A 2VFGA 4AZIA 2E6DA 2QXWA 1DJHA 4UCGA 3VAWA 3UZZA 3E5BA 1UWRA 1U30A 2Q09A 2OQHA 2EPMX 4M82A 5I03A 5DT5A 3UWUA 5AB3A 3BAJA 1J18A 3UGVA 1W5QA 2MUCA 3LXBA 1B2YA 4AZ7A 1G7UA 1AA1B 1TSIA 2VOTA 3O6YX 3PWIA 2V38A 4FXFA 3WBYA 4JQ3A 1DWHM 2DVUA 1V6YA 4MJZA 4O1BA 2NUWA 1EJSC 1XKYA 5AC7A 3AHYA 3E74A 3M0LA 2V3GA 5D09A 1KFWA 4C6NA 1EGZA 1OB0A 1C7TA 4KGLA 5K4XA 3PZ9A 3QTPA 4ZFMA 4GY0A 3BXWA 3NYZA 1ONXA 4GZIA 4FLQA 1UH3A 3LDVA 3WD4A 4TX9A 3QN3A 4LYQA 3H55A 3SGUA 4IQLA 4G6CA 4UFHA 1U1UA 1JCLA 2X1RA 3M16A 5AHFA 3PN8A 4LNYA 2C0AA 1PKLA 1Z69A 3MP3A 1IXPA 1QI3A 2W79A 1ITUA 4G7EA 1OCJA 1NFBA 1CGWA 3B40A 1XGZA 1KM4A 4LUJA 3AJXA 1TX0A 1W3LA 4CU6A 3QPZA 4N19A 1E73M 1XYMA 2Y24A 3WLSA 1SSDA 2QGYA 2DZTA 1QI5A 1B3ZA 3KCEA 3GR7A 1V6TA 5LIYX 3B8DA 1S38A 4ODLA 4IMCA 4ALDA 4IWWA 4UNKA 3FFSA 1B1YA 3T55A 2I5IA 1XYAA 1LOQA 3TTYA 1J4IA 4ODOA 2ZX8A 2PU0A 1XSIA 3FCPA 2IPJA 3EA2A 4RXGA 5HWJA 3GKFA 1UWIA 4DROA 3H7VA 4O19A 4I7UA 4KF1A 1BFNA 2QGHA 2Z1VA 2AL2A 4D6IA 5HUAA 2Y8UA 4WHBA 1JL8A 4U4MA 4CD4A 4GI9A 4PUEA 4UXDA 1EP1A 3LENA 4ZB5A 4XIMA 4LYPA 3A5VA 3GDTA 3SY1A 1D8WA 3CHVA 3HMJG 4GYJA 4TVCA 1HVXA 2DDXA 2RUDA 2VUNA 3HPSA 1HNYA 1PXGA