1XRVA

Crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords signal processing protein
publication title Crystal Structure of the novel secretory signalling protein from Porcine (SPP-40) at 2.1A resolution.
rcsb
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xrvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xrvA01
1AVAA 1JZ8A 2WC4A 4WIWA 3GNRA 5A3HA 3WQVA 1QW9A 2BV9A 1SMAA 3PZOA 4TX8A 4D72A 3FXYA 4CVUA 1TG7A 3T09A 4FLSA 1ITCA 3AZSA 1ISWA 1JD7A 4YHEA 1HP4A 1V3JA 3ZSTA 1UQYA 3SCTA 2WKGA 1GOOA 1OWQA 1R87A 3NDZA 2WMHA 1HT6A 5IXEA 4MNMA 2YJQA 2VQUA 4UR9A 1MVYA 3GYCA 4MADA 1UR1A 1OT1A 3A4XA 4OZOA 2QF8A 1PX8A 5AC4A 4DM1A 5DT5A 1EHNA 1OBAA 4HMCA 1H49A 3SCSA 3UEQA 2J25A 1E6XM 3ARXA 4GI9A 2PF0A 4MNLA 3K4DA 4XZWA 4D6HA 2XHYA 1SYTA 4EK7A 1MW3A 4BA0A 3ZM8A 2JIWA 1H0GA 1W9VA 2J4GA 1R7AA 3B9DA 1EDTA 4W93A 2CEQA 3A4AA 4OIFA 1TFVA 2EO7A 2W61A 1J0JA 2WSPA 4X0NA 1H3GA 3N18A 5M5DA 1J12A 3BAWA 3VGBA 2E0PA 2DEPA 1X1NA 4ATLA 1IV8A 3GXMA 3BAIA 4JKLA 2NT0A 1E56A 1W9BM 1QPKA 3UR8A 3IJ7A 1LL6A 3B8SA 3ZJ6A 1WDPA 4M1RA 2VMFA 1LF1A 3ZT5A 1FOBA 1M7XA 2BVYA 1M04A 2ZXDA 4R5EA 1IZJA 1CGTA 3S6TA 1KWGA 1W2VA 3A4WA 3UETA 4D71A 1CZ1A 4GI8A 2VZOA 4C7FA 2Y8KA 5CXPA 1RH9A 3AXHA 1E6QM 4W88A 3FNDA 1CECA 3LMYA 3UG3A 3WFLA 5CG0A 2F2HA 2VI0A 3BAJA 4UQBA 4U2ZA 2WBKA 5GNZA 2DH2A 1FH8A 1UD3A 3PBGA 1UR8A 3THCA 4Q22A 4EE9A 4D6CA 3WN6A 3ARRA 2VQTA 5GPRA 1CGUA 3NJ3A 3W26A 2E9LA 5DT7A 2WMKA 2J7BA 5FIPA 1GVIA 2A3EA 3OA5A 3BMWA 3WDHA 2DT0A 1QBAA 1G9HA 3TTQA 4UZUA 5CQ1A 1FHDA 1KWKA 2YBUA 1QI5A 3IAPA 1JNEA 2D24A 1VFMA 5CSYA 4J3UA 3M7SA 2O92A 3MSDA 3WH9A 1K9FA 4CD8A 3CHDA 4R27A 1CEOA 4P8WA 2WHKA 4W89A 4GKLA 2C0HA 1BPLB 3WEZA 1KCLA 2FH6A 4PMXA 2D2OA 2UY4A 3AXXA 4H8VA 2OYMA 2BXYA 2E9MA 4PMVA 1CXEA 2XVPA 1W1TA 4B9ZA 4JHZA 5C70A 1UKTA 3F5LA 3M6DA 2Y4SA 3AS0A 3SIMA 2V3DA 2WPGA 1DWHM 3WMSA 5BXPA 5HDRA 1ZBVA 4J3SA 3NDYA 3IJ9A 5A69A 1FFRA 1J0ZA 1US3A 4KMQA 2B31A 4UCFA 5HOSA 3AISA 3VGHA 3NSNA 4QAWA 3VILA 1A47A 3RDKA 2O9OA 1V3LA 4H04A 2WC7A 2Y24A 4TUFA 5BXRA 4AMCA 4U3CA 2DSKA 5IDIA 3CZ8A 1NP0A 1S46A 3WNMA 1D7FA 1JZ5A 1VAHA 4J3XA 3K1DA 4HPGA 4F8XA 3OGSA 4C7GA 1UR9A 1OD0A 2BS9A 3MU7A 1W9UA 1XHGA 3AICA 3O6AA 1Z32X 3ARTA 1M03A 3L4WA 1KXHA 1GONA 2BHUA 3POCA 4AY1A 1BVZA 5FKYA 1TA3A 3U7VA 1XC6A 3APGA 1OT2A 4BCEA 1OGBA 4TXEA 1LG2A 2VZTA 5A2BA 1G0CA 2XFYA 2AMGA 4FLRA 4MB4A 3LPFA 5A6SA 2VVNA 3T0BA 1DWJM 2VTFA 4MJ2A 2YDRA 3CH9A 1Q6EA 3CBWA 4RL3A 4W8LA 2WB5A 4IISA 1EO5A 1V02A 2PWFA 3EDFA 4LYPA 3ALFA 1E3XA 3ARYA 1V3HA 1ITXA 1HVQA 2XUCA 4FF5A 3RPMA 2ZUSA 4WJXA 1UOKA 3VMPA 4EANA 1JI1A 3W25A 9CGTA 4U5IA 2AOSA 1XSKA 1E70M 1CENA 4Y7EA 3UERA 2VL4A 2WYSA 5F7UA 2OWXA 3NCOA 4PSRA 3EDJA 1TVPA 1CGVA 1PIFA 2Z1KA 3SCOA 2DGAA 3CUGA 1DWAM 1M01A 3PZVA 1WDSA 4TOQA 3NYDA 2HVMA 3VNZA 4MPKA 4ZEPA 3RM9A 2WCSA 2XTKA 2D1ZA 1Q4NX 3VIKA 1V0NA 1TVNA 5JH8A 1TUXA 3K8MA 1K9TA 3VGGA 1MQRA 2YA2A 1HNYA 4AISA 3F5KA 3VD4A 3QGVA 1UA3A 1UA7A 3AYRA 4CGTA 2PWDA 3U57A 4J27A 2DT3A 5C71A 5ABFA 3VX0A 2WNWA 5FL0A 4GZEA 4MAZA 3VNYA 1UWUA 2CERA 1JYVA 3RMEA 2IXVA 2XGBA 2YLLA 3UR7A 1Q6DA 5CGMA 2YOCA 1TR1A 3FAXA 2YA1A 3VIPA 2XFFA 4WSJA 1NP2A 3WNKA 1JAKA 5A6AA 3M07A 3CTTA 5DEZA 3WQ4A 4E8DA 1OM0A 2J74A 2VX5A 3WY1A 4IUGA 3CIVA 2G4FA 3KE0A 4V2XA 1XH1A 1BF2A 1V6YA 1RD6A 3ARWA 1J0IA 3TP4A 1ECEA 2ZUNA 3RJXA 3AROA 1KCKA 2DQXA 2FDMA 5E6YA 3WDJA 3FW6A 2CIPA 4LQ1A 3VDAA 1AQ0A 1NOUA 1Q6CA 1E1EA 1K9EA 3AS2A 4AW7A 1DTUA 4AYSA 1EDGA 5AYIA 4L4PA 4HA4A 1VBRA 2CHOA 3NSMA 3UG5A 2XM2A 4UOQA 4A3HA 5BRQA 2C7FA 2DSZA 2CPUA 3CHFA 2J8FA 3FN9A 1C92A 2ZUWA 3CZKA 1QNQA 3CUIA 1C8XA 3WELA 2XIBA 4D6IA 4AD2A 3AS1A 1W3JA 3CUFA 2NW0A 1EH9A 5EMYA 1MQQA 3K8KA 5A8PA 4PMUA 3GBDA 3KWXA 3FAWA 2X0YA 3QOMA 1C91A 4OBSA 3BCFA 4CKQA 4JL2A 2BHYA 1XD0A 1UWIA 4YN5A 2WVSA 2WCAA 5A6BD 3KL5A 3ARZA 1VEOA 3WFZA 3OB8A 1DP0A 5BXTA 3TTYA 2YL5A 5GQBA 4IPNB 3WQWA 4ZENA 1JL8A 1VRXA 1Y7VA 1R7OA 3QHMA 2BVDA 5E6ZA 2ZUTA 2QPSA 1MW0A 1ZB5A 1E5JA 2OYLA 3CPUA 3AIRA 2D20A 2W67A 5EFDA 3WEMA 4QLLA 4D6FA 4GQRA 3SCVA 1OIFA 3BH4A 1F4AA 1PX4A 4M82A 1XH2A 1V02E 3WH6A 3MMDA 5A8MA 1HJXA 2XJ7A 3NUKA 4JKKA 3L4UA 1CXIA 3AZRA 1CWYA 2ZX5A 1V6XA 1OGSA 3AMCA 3DHUA 4W5UA 3WNLA 3GBEA 1JYWA 4DWSC 2VT0A 4MB3A 1H1NA 4ZE5A 3LPPA 3MUY1 1KR1A 1E6RA 4Z2GA 1KFWA 4AIOA 3W53A 4CCCA 4DWSD 4AZIA 4GXPA 3T0AA 2PWHA 3PZGA 2XWEA 2DPEA 3ALGA 3BMVA 1LL4A 1BYCA 1HKJA 1UH2A 1O6IA 1B30A 3NSXA 1UKOA 3W6MA 3WDIA 2GK1B 2EJ1A 2XSAA 4UFJA 1HL9A 2A3AA 1UUQA 3N04A 4W8BA 4X0VA 1BVNP 4RE4A 1BYAA 4GZIA 3OGRA 4BF7A 2WKLA 3E1F1 1VEPA 2CITA 2ZX6A 3WDPP 2WMJA 2J7FA 1TZ7A 4F9JA 2XGIA 4X9YA 2FHBA 5I79A 1QI0A 6CGTA 3SCUA 2OWWA 3OLGA 3MS8A 3VUPA 2CETA 3AHVA 2YA0A 4AXNA 4CVWA 3T0DA 2W91A 3DYOA 3IK2A 4JCLA 5BXSA 1EIBA 2O9PA 3MSGA 4LYRA 3WSUA 3RIKA 3ECQA 4ATDA 2VZUA 2ZXBA 2ZOXA 3HMCA 1JGIA 4AD4A 4QCEA 5A6JA 3SCWA 4JZ5A 2A3CA 2C8NA 2CKRA 5I6SA 1MQPA 1KGXA 3MMUA 2WMFA 4P8VA 1RP9A 1J18A 3ARVA 4JFVA 2UY5A 3BAYA 3VKKA 3WL1A 4W7WA 5EB8A 3BAXA 4XX6A 3CZJA 3U7BA 3ZO9A 2VR4A 2ZIDA 1BG4A 1UR0A 2WWDA 3I3EA 3D3AA 1V3IA 4MB1A 5EFFA 3N15A 2DT2A 1NOWA 1HKMA 1W9XA 2JALA 1QI2A 1PEZA 5D4YA 2WHLA 4KWUA 5D9NA 4EKJA 2E9BA 2CBVA 2WVVB 1B3XA 5BYWA 1WB0A 2IXUA 5IHSA 3W81A 2V3EA 1GVYA 4WKHA 4TTGA 4PEEA 2ZUUA 1H11A 3L4TA 3ZT6A 3LPOA 4V27A 2EPNA 2EPLX 4LX4A 4ACYA 1D3CA 4ZE4A 3O9NA 3WNPA 4NSBA 2J7CA 2XIIA 4MJ4A 1JZ7A 3I3BA 3POHA 1W3LA 3ZMRA 1E5NA 4QFUA 4AZBA 8CGTA 3EDDA 1BHGA 1WPCA 1UD6A 2ZICA 1TMQA 5JIWA 3EYPA 1VJSA 1UZ4A 1R85A 1HL8A 2IUZA 3QOKA 3VD5A 5BROA 3VMOA 1JDAA 4JIEA 2X2YA 4K68A 1BFNA 1NQ6A 1EQPA 4HZ6A 4HZ7A 4AWEA 2J77A 1N82A 5KZ6A 5GNYA 4NRRA 3CGTA 2OSWA 2WLYA 2D0HA 3EMZA 2NT1A 1ISYA 1C8YA 1BG9A 2GUYA 3CMGA 4MB5A 3OLEA 2G3NA 4U31A 3D5HA 1WNOA 3AIUA 2JF6A 5HBFA 1BLIA 1ODUA 4EAMA 2D0FA 3QHNA 1V6UA 1UD4A 4CU7A 3EDEA 1HX0A 2PWEA 1VEMA 5ABHA 4CD5A 4BQ2A 3RM4A 4JFSA 4KGJA 3RILA 1ZBWA 1MW2A 4HU0A 2ZE0A 3WL0A 5IHRA 3GH7A 4M56A 3SCPA 1E4MM 4P7LA 3MV01 4LGXA 3OLDA 4D6EA 1QNPA 1ZJBA 2CBUA 1JXJA 3ARQA 2BY1A 3AHYA 1UR2A 3EDKA 1UR4A 1WP6A 4WLCA 1G94A 3PHAA 3VOCA 2W66A 4CN1A 2J78A 4UQAA 1B1YA 2QPUA 2GSJA 4PTVA 1OD8A 3W29A 4UFMA 3VO0A 4MNJA 2YIHA 3BSGA 4JCMA 1JF5A 2D23A 1BQCA 3ARPA 2CNCA 4PMQA 3AHTA 2W4XA 2WANA 1G1YA 3BXWA 3VM5A 3K8LA 5CSUA 4AZCA 5DMYA 4J28A 2TAAA 1EQCA 1JYXA 3S2CA 1EHAA 1ZJAA 2O9TA 4N0RA 2J7EA 3MV11 2PI6A 5BWFA 4NI3A 1E4LA 1UD8A 3OIHA 3AJ7A 1E71M 2J7GA 4QLJA 1VFUA 2UY3A 4A3YA 4GZJA 1QI3A 5E09A 4ZXOA 2VC9A 3AMDA 2VR5A 3L4YA 3O2LA 1O7AA 4TX6A 3WDQA 1UQZA 3W38A 1HJSA 4BS0A 4CN4A 4PBGA 3VINA 1WZLA 3VIMA 2WK2A 4WKAA 2Z1SA 3WMBA 5A95A 1GW1A 3N1AA 4AD3A 1SR0A 5FOOA 5HNNA 1XV8A 4DWSB 2CXGA 3AIVA 4PSPA 1QW8A 4GPNA 2GJRA 4M81A 3ARSA 4XB3A 1DWFM 1VBUA 3WNOA 3WBAA 3ZIZA 1W9DM 4HPHA 2JIEA 4JFUA 1W91A 2VZSA 5E0FA 3MMWA 4RE3A 3VGDA 5A8NA 4OUEA 3ZT7A 1LG1A 3SUSA 2CBJA 2ZXQA 1EDQA 2WHJA 1KGWA 4CD4A 4WKFA 4PMRA 5E0CA 5A1AA 3SCNA 5LA0A 2WVTA 4PMNA 3BC9A 3AZTA 1HF6A 2WMIB 4HA3A 1J0HA 4D6GA 1MW1A 2D3LA 1KBKA 4AIUA 1GJUA 3WKZA 2GK1A 1Q6FA 2J75A 3QHOA 5M03A 1GOMA 2YBTA 3CZEA 3HN3A 2GDUA 5DFAA 1ODZA 3PZQA 1V3KA 3AIWA 1GJWA 2WBGA 3GNOA 5HPCA 1GOIA 3W27A 5A94A 1KXTA 5JBFA 2HISA 4B15A 4UFLA 1LLOA 1R86A 2W92A 4HP5A 4GIAA 2XWDA 2RGMA 2YL6A 1OSEA 1W1VA 1JDCA 1JIBA 4W85A 2E3ZA 1FFQA 1V6WA 3KEHA 3MKKA 1WO2A 2ZX8A 5LA2A 2X05A 4B3KA 4ML4A 5DO8A 2WMGA 4UFKA 4AEFA 3PTQA 4UFHA 1GOQA 1MFUA 1CBGA 4U3AA 3TTOA 4QCFA 3WH8A 1PBGA 1LWJA 3VD3A 1E6PA 2XPKA 1WAWA 1KB3A 4YHGA 1UH4A 3WQ6A 3N11A 4Z2LA 2XFRA 4XUYA 4HA1A 3PZUA 3UG4A 1KR0A 1XCXA 2A3BA 2EPOA 1FP9A 1LJYA 4KRTA 4W7VA 4MDOA 2VX7A 3AI0A 4GINA 1GQLA 4BQ4A 4LXFA 2QMKA 3WDRA 1GQJA 4OKDA 1AQHA 3AS3A 1EXPA 2QHAA 3DC0A 1PIGA 2WVVA 1X6NA 5I0DA 2XM1A 1CIUA 1OB0A 7A3HA 2VNCA 4GQQA 4MDPA 4AZCB 3CZLA 1H09A 1W32A 5BCAA 4JFTA 1QHOA 5JIPA 4PN2A 1E55A 4KRUA 5M3WA 1Q6GA 4TTUA 4AD5A 1E15A 4PCTA 4QLKA 3AOFA 3VPLA 1CNVA 1V0KA 4AZ5A 1NH6A 4ACZB 1F4HA 1K9DA 4CU6A 2GVYA 5AC5A 1NOFA 2J7DA 1BGGA 3CHEA 1HKIA 1V6VA 1E0WA 2BXZA 4AZGA 1JAEA 4P8XA 3HJEA 4PCSA 2ZUVA 3G6MA 5CPQA 1DWIM 1OINA 2ZX9A 1LL7A 5CPTA 2OYKA 3BAKA 1QOXA 1SFSA 4P7QA 2ZXAA 5E9AA 3WD2A 3IAQA 3VIFA 1CPUA 5DF0A 1QNOA 4HTYA 1UD2A 1B2YA 4UFIA 4F9DA 4E2OA 1GCYA 5IFTA 2XVKA 1R8LA 4QP0A 4UTFA 4HZ8A 3W82A 3BCDA 3ZJKA 2V3FA 5ABEA 3UCQA 6A3HA 1GQKA 1HN1A 1WDQA 3VGFA 4PMYA 1B0IA 5A8QA 4P7NA 1ZBKA 3BLKA 1CTNA 1VFOA 5KEZA 3UESA 1BYDA 2ZUMA 3WUBA 1JZ4A 3FY1A 3WF1A 1E73M 1W3KA 1J01A 3T2QA 1GUVA 3WF2A 1VF8A 1IZKA 3ZJ8A 4NRSA 2DSWA 1QNSA 2WWCA 4HMEA 3AQUA 4E4PA 1UYQA 4RE2A 3AMKA 4CU8A 1NWUA 1E40A 1XYZA 3WENA 3VIHA 2A3HA 3GZAA 2EPMX 1HVXA 2F61A 3PTKA 3AIQA 1GOKA 2XVGA 3KZSA 1WCGA 2VX6A 3ZOAA 2NSXA 3W6LA 4H7VA 3CLWA 5A8OA 3K4AA 1CLXA 1BTCA 1WE5A 5A6BA 4KH2A 4M29A 3W28A 2PBOA 4WF7A 2J47A 2VRKA 3SUTA 3IJ8A 4M80A 1JD9A 1QHZA 1V0LA 1C8QA 3OLIA 4J7RA 1JZ2A 3G6LA 1UKQA 1YHTA 2WVUA 3ZSSA 1MWOA 1JZ3A 1H0IA 2DT1A 3TONA 4UQEA 1HXJA 1C93A 5A6KA 5JBDA 4ZFMA 2GJPA 5D9OA 5LA1A 3VDBA 1CXKA 2PBGA 1PPIA 2GDVA 1B90A 3PZTA 2BFGA 2VCCA 4P7OA 1XGZA 4UOJA 5I5RA 1PJ9A 1HJUA 2V5CA 3MO4A 1XD1A 2QLYA 4H2CA 1K6AA 4XV0A 3U5UA 2VCAA 4W8AA 1W3HA 1W1YA 3OBAA 4PMZA 6TAAA 1DEDA 3VU2A 1E43A 4DWSA 1UZ1A 2E8ZA 4CD7A 2YL8A 1B3WA 2VX4A 4TVDA 1MXGA 1PAMA 4J3TA 1A3HA 3GXIA 1TCMA 1J9YA 2FGZA 5JBEA 3BSHA 4W86A 1E0XA 4OOZA 2V5DA 4AZ7A 5CPSA 2XG9A 3GXFA 3RM8A 4HOXA 5C8BB 3CUHA 5CLWA 4JAWA 2PWGA 2Y5EA 4CCDA 3WMCA 4F66A 2E8YA 5FL1A 3VMNA 4WSKA 1WDRA 1G01A 3GH5A 2WZIA 1W9PA 1B31A 3W24A 3OG2A 2WMIA 3VIJA 1J0KA 3I3DA 1WZKA 1KGUA 3WH7A 2YKKA 1ISVA 3K46A 2UWFA 4PYSA 2EPKX 2O9RA 4UNIA 3WBEA 3BLPX 2WXDM 4KGLA 1J11A 3KL0A 1GNXA 1GZJA 1QHPA 2QMJA 3WF0A 2OWCA 1VIWA 1HP5A 1CDGA 4NZCA 2J7HA 3VDHA 5A6LA 2DIJA 1AQMA 5ABGA 2OSXA 4DUXA 3A6OA 3ZR5A 3AIBA 2JEQA 1JNDA 1UKPA 2XSBA 4AEEA 3FHAA 1XH0A 1US2A 1FH7A 1XCWA 1E1FA 2G3JA 3CUJA 4PRWA 4AZHA 5A2AA 2W62A 2WCGA 1KXVA 1C7SA 3SURA 1U2YA 1NM9A 2Y2WA 2FH8A 4AD1A 3SEPA 3WD4A 1BAGA 2VRJA 1ZL1A 2VO5A 1UHVA 4PUDA 2J79A 2GJXB 1OGGA 4AZ6A 1X6LA 1NWTA 4URIA 4IPLA 3AIEA 4B3LA 2EQDA 1P6WA 3THDA 3WF3A 5D8ZA 1HKKA 3HU7A 2WAGA 2YDSA 2X0HA 2BHZA 1NWRA 1VJZA 4D6DA 5CZKA 1G5AA 3WQ5A 2YL9A 3MANA 3J7HA 4GO9A 8A3HA 3BGAA 5BRPA 1HJWA 1J0YA 3WD1A 4OBRA 3SUVA 3GNPA 3ZR6A 2VOTA 3F4VA 3TTSA 4NF7A 4W5ZA 2E4TA 4UQ9A 2DSUA 1E9LA 4FMVA 4S3KA 3SCQA 1JFXA 4HOWA 1JFHA 2VVSA 1E6ZA 5IFPA 1JG9A 3PZIA 5A6MA 2DDXA 1BGAA 3QR3A 3OZPA 1OIMA 2YLAA 4M24A 5HPOA 4ACZA 3L4XA 1V03A 2PC8A 3AHZA 3MUAA 2W5FA 2ZWZA 3LPGA 5TD4A 3ZJ7A 1TE1A 2RGLA 4BQ3A 2J62A 2D22A 1IT0A 3TA9A 1KQYA 5JUVA 4D1JA 1EGZA 3WD0A 1PZ2A 1UG6A 3VX1A 1XSJA 3MUZ1 4A4AA 2CESA 1C90A 4HU8A 5M17A 5A2CA 1B3VA 1ISXA 3VD9A 4UZSA 3W37A 2OSYA 2ZX7A 1WZAA 1EOKA 2WLZA 1KXQA 1DWGM 4U5KA 5D9PA 5FD0A 4TVUA 4JHOA 4CUCA 3L2LA 3B9EA 4JFWA 1L0PA 1JDDA 1J10A 3CHCA 1H41A 3NIYA 3AHXA 2BY0A 3W0KA 4C7DA 4MTVA 3WUGA 7CGTA 3L4VA 2G41A 1GHRA 3WUEA 5FCZA 4PTXA 2DIEA 1CXHA 5E70A 4J3WA 2CBIA 1GQIA 5HXMA 4P8UA 4LYQA 4H41A 2JFEX 4Z2JA 3L2MA 5AYBA 1B9ZA 4V28A 2XVLA 3VD7A 2BVTA 1E72M 1CYGA 4XZBA 1BYBA 2Q8XA 3EBVA 1U30A 2WZEA 1XYFA 2BNJA 1UWRA 2MANA 1C3FA 1EO7A 4FK9A 4HMDA 5GNXA 4HOZA 3T08A 4ATWA 1NWSA 1E3ZA 2J8GA 3AXIA 1BSIA 3VIGA 4S3JA 4GI6A 4FLQA 1B3ZA 4BQ5A 4J3VA 4D1IA 3ARUA 3VVGA 2X1IA 4UQDA 3VGEA 2VURA 5D9MA 4LPCA 2PB1A 4MNKA 4WK9A 2OLHA 4Z2IA 3WUFA 3ZQ9A 2AAAA 1VB9A 1SMDA 5CLTA 4Z2HA 3M46A 5AY7A 3F5JA 2G8ZA 2YDQA 1JZ6A 2DSVA 1I1WA 3GH4A 5CJ5A 3AFBA 1CLVA 3JUGA 2BY2A 4PMOA 3RO8A 2DH3A 2CYGA 2WW5A 2JF7A 1L8NA 3U5YA 1W1PA 3IANA 1C7TA 1YQ2A 2X8RA 1HJVA 3OGVA 3WF4A 2F8QA 2D3NA 4YPJA 3PTMA 2EXOA 4W87A 3VM7A 4B9YA 2FHCA 4Z2KA 1AMYA 3AMLA 1FH9A 3VIOA 1RPKA 1WZMA 2CHNA 1UD5A 2CCRA 1GHSA 5I77A 4CCEA 4MAVA 4AD0A 2JEPA 1OCQA 2VJXA 3T2OA 1XRVA 1I75A 3PN8A 1CGYA 1E6NA 4CD6A 3WD3A 4QDMA 4UOZA 1V3MA 4IM4A 3AYSA 1HJQA 4H8HA 3GXDA 3WH5A 4CN6A 2ZWYA 1ZS2A 1NARA 2VRQA 2WSKA 1DHKA 1M53A 3T2PA 5ECUA 2V3GA 3N17A 4Q7NA 3A3HA 4AC1X 1QVBA 4U33A 1VFFA 3GDBA 1V08A 2G3IA 4F79A 5I2UA 1CXLA 2XYLA 5I3DA 4DM2A 1XSIA 3DYPA 2WZHA 3PZNA 4JKMA 1EOMA 2BY3A 3N9KA 2W63A 1QI4A 1MFVA 3EMQA 4B16A 4W84A 2Y8VA 1PZ3A 3OZOA 3DYMA 3SCRA 4L4OA 1H2JA 1LQ0A 1RP8A 2VUYA 2VZVA 3CMJA 3CZGA 1GPFA 1W2PA 4H8UA 3B9AA 4OOUA 1JYNA 4D6JA 1UWTA 3SUUA 1HIZA 1PX3A 3RCNA 1E4IA 1CGXA 1TA3B 3WEOA 4M8UA 2E40A 4P7RA 3TOPA 2ESCA 3WNNA 1KBBA 4BZYA 4U2YA 5D8WA 3WQ8A 4DUVA 2D0GA 5CGTA 1H5VA 1QNRA 3II1A 4UQCA 2XVNA 3MUIA 3VTRA 4AIEA 1FA2A 3AMGA 4OJYA 5LYRA 4JL1A 1MYRA 4TVCA 1ZBCA 3W4RA 3WIJA 1UWSA 4PTWA 1ISZA 3RJYA 3PZMA 3N13A 1UKSA 2WHMA 2GJXA 3EMCA 3DHPA 4PUEA 1WKYA 1CXFA 1ESWA 1UH3A 3PZ9A 2EBNA 2V38A 1V0MA 2GFTA 1D2KA 2JE8A 4N42A 4E8CA 3VDCA 1FP8A 4GO8A 1E6SM 3VIIA 3FHQA 3CO4A 1JXKA 5I78A 3GM8A 1EA9C 2UY2A 3SUWA 1B3YA 2QV4A 2VCBA 7TAAA 2WM0A 2CKSA 2G3MA 1JI2A 5EBAA 4W7UA 1GORA 1E4NA 1MXDA 1VENA 2EEXA 1JF6A 2X09A 1ZU8A 4DUWA 3L4ZA 4ZXLA 1QBBA 4PTMA 1I1XA 3N12A 1UWQA 1LWHA 5ABFB 3A47A 2FGLA 1CGWA 2FHFA 3DECA 4PMDA 1GOWA 4FLOA 5I24A 1FHLA 3GTNA 5I23A 1U33A 3KL3A 1E0VA 1KQZA 1H4PA 2WC3A
chains in the Genus database with same CATH superfamily
2WC4A 4WIWA 5A3HA 1ALDA 1QW9A 5EPDA 5FESA 4HCHA 1QAPA 1YDOA 4CVUA 4RUBA 3ITGA 3SRDA 1G4TA 4R9XA 4YHEA 2HK1A 3GTYX 2R1NA 1PINA 3L0NA 3DI0A 4XBKA 3SY8A 3OA3A 2Y1HA 4HVXA 4O18A 4L4LA 3F03K 4HNNA 4MADA 4HBOA 2RUQA 4OZOA 3SN0A 4DZ5A 1LRQA 5DT5A 1OBAA 4CNNA 2Y7GA 4QS5A 1TMHA 2KO7A 3E74A 4JXCA 5EGRA 1Q85A 4D6HA 5DITA 4BA0A 3BO9A 1IF2A 2JIWA 1H0GA 1W9VA 1F5ZA 4L7ZA 4A6GA 5HQLA 1Q45A 2W61A 2AL2A 1H3GA 3BAWA 3VGBA 2E0PA 2DEPA 3FLUA 3GXMA 1YDNA 3TN5A 1BKSA 4AY8A 3PANA 1QPKA 2VC5A 3UR8A 3IJ7A 3IVUA 3B8SA 1M7OA 3O07A 3HURA 1I2PA 5AHIA 2I17A 3H4GA 3O8AA 3DFNA 1SJBA 2NWSA 2ZXDA 4OGZA 4Q6XA 1TCOC 3TJIA 1P7TB 3S6TA 4Z0SA 1KWGA 1AH0A 5HWMA 3UETA 1CZ1A 1D7JA 2VFIA 4GI8A 2XP5A 1ICPA 1WOAA 2E1DA 2VZOA 4C7FA 5JU6A 3WQDA 4KBXA 3EX6A 5DELA 4FX8A 2OG9A 2XSXA 4XD6A 3AXHA 1E6QM 3MCOA 4HPNA 1RR2A 4Y6GA 2F2HA 3E0FA 3BAJA 1AW2A 3JYMA 4UQBA 1DHPA 4QSFA 4IF2A 5GNZA 3M0XA 5DBUA 3CPGA 3FEMA 1UR8A 5BMXA 3WN6A 2QF7A 2VQTA 5GPRA 4CQ8A 4NG3A 4W9PA 1AG1O 1MDLA 3OA5A 3WDHA 4GNKB 5CQ1A 1IX5A 1TZZA 3P93A 2YBUA 4DZIA 1QI5A 3IAPA 2GSEA 3UGRA 3KABA 2ZC1A 5CAKA 3EOEA 3WLPA 2Q02A 2O92A 4IGMA 1FWBC 2ZRWA 1K9FA 3WH9A 1UP0A 5RUBA 3CHDA 5EBUA 3UJSA 1CEOA 4P8WA 4W89A 3UWWA 4GKLA 4XAPA 6PTDA 3WEZA 3RITA 1O12A 3O1NA 4M7SA 2UY4A 3AXXA 3MKCA 2BXYA 4DB7A 2E9MA 3K1GA 3M43A 4PMVA 1M5WA 3MUCA 3PK7A 1LUCB 3C2EA 2OR2A 1T8QA 1W1TA 2IKIA 4B9ZA 3GR4A 1FDZA 3AS0A 2WPGA 5HDRA 1H1ZA 1ZBVA 1F3TA 2J9ZA 2Y6ZA 1J0ZA 1US3A 4MPQA 1VJIA 4UCFA 3AISA 2Y89A 1TJPA 1AD1A 4H04A 2GJNA 5I7GA 3FJ4A 4A3RA 5IDIA 3QV7A 3WLHA 3KRUA 1SQ7A 4GNJA 3EWYA 3PWAA 1JZ5A 1MZHA 2I7GA 3OGSA 1FD9A 4O57A 1XHGA 1QNVA 4UMAA 2QCDB 4NAFA 2W6RA 1TWIA 3NPWA 3K13A 1M03A 1FKJA 3KBNA 1MXSA 2BHUA 4DRNA 4LEQA 4GFSA 1BVZA 2P0IA 3PR2A 3URQA 1KFCA 1Y5WA 3QYSA 2NLIA 1XC6A 3CO8A 1A53A 2JK2A 1FCBA 4UTLA 2VZTA 5A2BA 4GGQA 2XFYA 5A6SA 1XFCA 1DWJM 2VTFA 4MJ2A 3CH9A 1G7UA 4RL3A 4W8LA 4GABA 4IISA 4HSNA 3T9PA 1U5JA 3GTIA 2XP7A 1EJTC 3IJLA 1E3XA 1HVQA 4FF5A 4Q4MA 1GZ1A 1Q6HA 4RR4A 1TB3A 4M3PA 4TR9A 2AOSA 1XJBA 1CENA 2VL4A 3AJXA 2DIKA 1M7PA 4L61A 5F7UA 4GIRA 2RHGA 3NCOA 2GLKA 5KTLA 1YNYA 1OX5A 1TVPA 1PIFA 2CWNA 3ANVA 4BJHA 3SRHA 5HT1A 2DGAA 3L0KA 3CUGA 5FEPA 3C2VA 4TOQA 3NYDA 4YS1A 2ACSA 4ZEPA 4MPKA 1R3VA 2XTKA 2POZA 1V0NA 3EXRA 2TPSA 1K9TA 3VGGA 3MVTA 4KCVA 3IKGA 3ITOA 1V51A 4I5UA 3QGAC 4YU1A 3CNYA 5H1WA 1UA7A 3AYRA 4CGTA 2PWDA 3HQPA 2DT3A 5ABFA 3VX0A 2WNWA 2DORA 1RBOB 4GZEA 4MAZA 4L5ZA 3KS5A 3GK0A 1LTDA 2CERA 3PRAA 3JR2A 2YLLA 3UR7A 1GKPA 4NYUA 3FOKA 2OT1A 1YNPA 2ZRUA 3M07A 5DCEA 3IS4A 1TR9A 2P3ZA 1RJPA 5FJIA 5G5IA 3V36A 1SW3A 1L6GA 1Q7MA 1XLEA 4JPGA 2JKEA 1HL2A 3KE0A 3P84A 1XH1A 1L6WA 2PDIA 1ZNNA 5U4NA 4L9YA 4EOUA 1JULA 5FEZA 3UXLA 3IGSA 3VDAA 3WLMA 3PRDA 4MYAA 4O4VA 2YW4A 1TIMA 1E1EA 3AS2A 2ZZ4A 3R7MA 1VBRA 2CHOA 3UG5A 3QTPA 2Z7KA 1HG3A 3RLGA 3OQEA 2VEFA 3WBXA 3CHFA 2BG5A 5I03A 5AKQA 2I9UA 1C8XA 2XIBA 1YTEA 2C14A 4AD2A 1DIEA 1HFBA 4QEHA 4O53A 3TLLA 3KW3A 4MFDA 5H8MA 1KM0A 3VKAA 4MYXA 4JQ4A 1C91A 2P50A 1VIZA 2OODA 2IPJA 4E38A 1Z3NA 3OPSA 2BHYA 4N9DA 5FF2A 2I5QA 4YN5A 1K7FA 1F8IA 5A6BD 3H7VA 2PLCA 1DP0A 4EIVA 3O0KA 1Y0OA 2INFA 3WQWA 2PN0A 4P5UA 4ZENA 1JL8A 3ABQA 1Y7VA 1BSLA 2PV1A 1R7OA 2A85A 4DI8A 2RDWA 2BVDA 4IHCA 3MYOA 5E6ZA 1NMVA 3H8AA 3RPTA 1P7TA 3WLOA 5BU6A 1KRCC 2OYLA 2QCGA 3CPUA 3AIRA 5G2HA 4DZ3A 4QLLA 4DJDD 3SCVA 1OIFA 3LHZA 4IGNA 3NQ2A 4DBSA 1F4AA 2ZVIA 5HATA 5G2WA 3R8RA 3S83A 2ZQ0A 4UTUA 4A05A 5FACA 3CLMA 2I14A 1F3WA 5KMYA 4MZ8A 1LDCA 3DG3A 3FJLA 3N2MA 1XQKA 5IOBA 3TCSA 3G1YA 3SQMA 1CWYA 4C6QA 1O5KA 1DJWA 3G1RA 4NZ3A 4ASTA 4W5UA 3WNLA 4MY9A 5LXEA 2ZTJA 1JYWA 2X7WA 4QEEA 2B7QA 4MB3A 4ZE5A 1XDJA 2EJAA 3LPPA 4M1BA 3MUY1 4FR1A 4DEFA 4DAFA 4Z2GA 1KFWA 1K7EA 4DWSD 2PWVA 1WV2A 2IKGA 5U7SA 1O1HA 3NSXA 4MSSA 1UKOA 3N4AA 3WDIA 2A7RA 2XSAA 4FB7A 4DJED 2FDSA 1DORA 4UTTA 1XI3A 3O6CA 4GZIA 1LUCA 3E1F1 1VEPA 3WDPP 1TV4A 2WMJA 2J7FA 2VEGA 4F9JA 2XGIA 2IW0A 3W1QA 3SCUA 2OWWA 3AHVA 4AXNA 2PDGA 2W91A 1EPXA 2VFFA 2O9PA 3MI3A 3MSGA 4S3FA 4JTKA 1ZRQA 1XIJA 2ZOXA 3HMCA 4IPJA 1FKTA 5DN1A 3LCFA 5REQB 2OMAA 4US5D 5HK4A 3SCWA 4DQWA 4G56A 3PULA 4XQ6A 1AJZA 1DE5A 1JCLA 3BAYA 4DRPA 2QCDA 3VKKA 4ZTYA 4XX6A 3ZLGA 4TW8A 3IWPA 3VKCA 4DROA 3HFTA 1OHLA 3L67A 3I3EA 3TJ4A 1TPH1 1TWSA 3R0KA 3D3AA 3LMZA 4MFEA 4HNUA 1V3IA 3VYLA 1K70A 3N15A 3UQIA 1S2VA 5TNVA 1KFBA 1QI2A 5D4YA 4DJFD 4K39A 3U48A 3ITLA 1LRTA 1DXFA 4NJHA 2V3EA 4C1NA 3M0MA 3TE9A 4WKHA 1SVDA 1D3HA 2FGBA 3JZEA 3L4TA 3KS6A 2FKPA 3C61A 2ABBA 4HPXA 4V27A 3VCRA 1D3CA 2VGGA 3KBMA 3DUGA 3O9NA 5DIVA 3GG0A 4Q4PA 3W7MA 3E5BA 1WA3A 1H7WA 2J7CA 2V68A 4ES4A 1GVRA 3POHA 4WOZA 1W3LA 3GNNA 2ZKMX 3B8DA 4AZBA 4QFUA 3C4UA 4DH0A 4OUIA 1F8AB 4IJCA 4RNFA 1EP2A 2Y85A 1UZ4A 4QR6A 2YXXA 3QOKA 3RNDA 4BHYA 1BFNA 1OG6A 4DRJA 4HZ7A 3HMJG 5KZ6A 3BZGA 3VOFA 4FXJA 2OSWA 3QJAA 4PODA 5C9UA 2ALRA 3HPXA 2Q09A 4LUSB 2Z4GA 5HWCA 5TQLA 4G2PA 3O7UA 4EVZA 5HNTA 2G3NA 1WNOA 1PVNA 3HPSA 2P10A 3S0CA 2FLIA 3TDFA 1UD4A 1YRRA 1U1UA 1RBAA 2X1SA 5ABHA 1VEMA 4CD5A 3O6YX 3S9ZA 3IRSA 4JFJA 4KGJA 2HV5A 2V5KA 1ZBWA 4HU0A 3RLVA 3N6QA 3BK0A 1F6PA 3SCPA 4TQTA 3MV01 3OLDA 4D6EA 4Q4RA 3DFTA 3W3OA 4WJEA 4A8RA 4L1GA 4EWND 1IXPA 3AHYA 1UR2A 3EDKA 3XINA 4WLCA 2EG6A 3PHAA 3STFA 5FF3A 1SM9A 1HGYA 4A29A 4UQAA 1B1YA 2QPUA 2V6AA 3B8WA 4UFMA 4XG1A 4IIHA 1PWLA 1T11A 1VCVA 2XP3A 3DC8A 4XZHA 5D33A 2UZ9A 2W4XA 3O5GA 5HANA 1JCHB 4FAMA 3BXWA 1X7IA 1PS9A 5LIYX 4XBJA 2M1IA 1X8CA 1A5BA 4J28A 4NHVA 1EIXA 1MEWA 1AFSA 2TAAA 3T4WA 1EHAA 1ZP3A 4TMBA 2QUTA 1REQB 3Q2DA 1PE1A 3VCNA 4NI3A 4GJIA 1E4LA 3H22A 4CLMA 5CBJA 3LUOA 3VNDA 1DBTA 4QLJA 4DRHA 3QGKC 1FTXA 2VENA 1QI3A 2VR5A 3VABA 1O7AA 2BBFA 2PEVA 2ANUA 3WDQA 3PUOA 3OZMA 1MMFA 4BS0A 1FAPA 1R3SA 3H2EA 1WZLA 3LNMA 1YX1A 4JIIX 4O1EA 1GW1A 4TIMA 3N1AA 3LERA 4F3HA 2ON3A 5FOOA 4WR3A 3SI9A 1BQGA 3PBUA 3I65A 1DWFM 4E0CA 3NQDA 5AN7A 4XUGA 4H9TA 3FV9A 2VZSA 3NL6A 5DCBA 5JH2A 1R6WA 1SZFA 2OEMA 3VGDA 4TX9A 1LG1A 3B4YA 5G1YA 2JGQA 3QKEA 1Q63A 3LYEA 3SCNA 5LA0A 1NTHA 1TJ2A 5FJPA 4CEUC 3KBSA 4FNRA 1W3IA 1MW1A 3TW6A 1DJYA 3IK4A 1NEYA 4E3TA 4WOQA 3SSJA 2Y0FA 1TPVA 3WKZA 3I68A 3PPCA 1EUNA 1O68A 1Q6FA 2VUNA 1VS1A 1TV8A 5M03A 1GOMA 5C0QA 3NOYA 5DFAA 1ODZA 3B0UX 3BQ6A 4IQJA 3GDLA 2PDLA 3PZQA 5HPCA 1GOIA 5HMDA 3T0CA 4AC7C 3IUDA 1W5MA 1KXTA 4O50A 5JBFA 3MCMA 4GBDA 3A4JA 4HP5A 2PTXA 1EJUC 5DMNA 1JDCA 4E4UA 4W85A 1DIDA 4C1KA 3QR0A 3W2LA 3UWVA 3WLQA 4C6OA 1A5LC 2W27A 3GZ3A 5REQA 3K2GA 2WNNA 4JYSA 4UFHA 4AEFA 5KZMA 1JCYA 4KS0A 2WJFA 2YPIA 3C0JA 4XBSA 3WH8A 1JUEA 1J2WA 4LFYA 2KZHA 1E0TA 5XIMA 5GVJA 3GHRA 5K9DA 3T8LA 3PZUA 3IEBA 2PTYA 3O16A 4KEUA 3QTGA 1LJYA 3M64A 3RFWA 4GINA 1LLWA 3MW7A 2QMKA 2QCEA 4LCQA 4FX6M 4OKDA 1W26A 4U85A 1AQHA 3DC0A 4H8NA 1RCQA 2HK0A 1X6NA 5I0DA 7A3HA 3CZLA 4RZ4A 5BCAA 4GIVA 1E9IA 5M3WA 5J6EA 1Q6GA 4L1XA 4O17A 3MYPA 4TTUA 1GVQA 3T4CA 4W9OA 3VPLA 5F2LA 1CNVA 5AC5A 1TX0A 3EZ4A 3MTWA 4MSPA 2Y61A 1NSGA 3NNTA 3W74A 1E0WA 4L65A 4MWAD 1X39A 3LCHA 3N3MA 3QMSA 3VNJA 1HW6A 4BEQA 1IEQA 4PCSA 3BSMA 5MHBA 3I6RA 1N55A 1OINA 4Q8MA 3QQWA 1LL7A 2ZTKA 2OYKA 3BAKA 3FSTA 1QOXA 4P7QA 4GQ0A 4DF0A 2ZXAA 3W1UA 1W8GA 1XIBA 5DF0A 1QPNA 4CQAA 4LUSA 3LG3A 4HTYA 1UD2A 4AY7A 3FCPA 4E2OA 5IFTA 3W82A 3BCDA 3W7NA 1K4GA 1HN1A 2BB0A 4XAFA 1QJWA 2OZ8A 2Y88A 1DJGA 3WJYA 3BLKA 3IIZA 3UESA 4Z1CA 4LY4A 2ZUMA 3M1ZA 1XDLA 3MP4A 1JZ4A 1P0KA 3FY1A 4N9BA 2FJUB 1W3KA 4NJGA 1J01A 3WF2A 3F4CA 1O94A 1YXYA 2CLOA 4NRSA 2DSWA 4LB3A 3AQUA 4RE2A 3W2JA 1XCFA 2PDUA 2V5BA 4N2YA 1NWUA 4PB5A 1BXNA 2EPMX 2INZA 3TZNA 2F61A 3PTKA 1EYMA 5AVHA 2PU1A 1SJCA 3NQEA 1CLKA 3ZOAA 1GVEA 4H7VA 4BF9A 1E9ZB 4C6EA 1WXYA 3IVSA 2QAPA 4ADSA 1TWWA 1ZLPA 2XP6A 1JD9A 3IGUA 3W75A 1VLIA 1QHZA 1V0LA 2QS8A 2WVUA 4DVOA 1H50A 5HW6A 1WBHA 1QT1A 3WLRA 3SSZA 2EG7A 4PTDA 2TRSA 3WLSA 1QOQA 1REQA 4UQEA 5T9BG 1C93A 2HCVA 4C6FA 4ZFMA 2GJPA 1IR2A 2VEIA 4BFAA 3K4WA 3N2CA 2XIQA 1S5NA 5MF5A 5DXXA 4ORMA 3AAMA 2DV0A 4GK8A 6TIMA 4C6BA 3PZTA 2BFGA 4XZ9A 4P7OA 5CZTA 2QCHA 1BF6A 3W6YA 1QPOA 3MO4A 2GJLA 1XD1A 2QLYA 3QLLA 2J88A 2VDIA 2DZAA 2OO6A 1W3HA 1W1YA 2B7OA 5JQ9A 4PMZA 3VU2A 3VKJA 1P4CA 3CHVA 5IM51 4AX7A 1G67A 1UZ1A 4MMWA 1QRQA 1A5OC 2E8ZA 1B3WA 1XLBA 3E5PA 2VX4A 4E6MA 1MXGA 3STPA 3GXIA 2OOGA 1MUMA 4W86A 4O0KA 3R11A 4AZ7A 4JN6A 4LSBA 8RUCA 4HOXA 4GVFA 4PL2A 2PWGA 3MCNA 3CEUA 4GIEA 4FIQA 2E8YA 3W83A 3M0VA 3TNBA 1RV8A 4G6CA 3FA5A 3W9ZA 3CL8A 3OG2A 4HU4A 4NNBA 1J0KA 1KGUA 3TNOA 2PGFA 3LV6A 3AWNA 3GU0A 1A5SA 2O9RA 4UNIA 1SFLA 3H4WA 1WYIA 2VDGA 4Z1YA 2WSRA 5G1TA 4KWSA 2AQOA 3WF0A 1DJHA 2OWCA 3T05A 1QU4A 4HA0A 3VDHA 4KQZA 5I3JA 2OSXA 3UI5A 3UI4A 3ZR5A 3AIBA 3H4XA 4JFMA 4AEEA 1PDZA 4ZPWR 5B7YA 2KGJA 3EKGA 1FH7A 1QCWA 3S2NA 1PTAA 5D2VA 1VFTA 3CYVA 2W62A 3EOOA 3CGNA 2RH9A 6ALDA 3WD4A 2QJGA 4WQ6A 5KZEA 5L6UA 1EC8A 2GJXB 3G0UA 1NWTA 4ML9A 5ECVA 3EA2A 7ODCA 4O8RA 4LWWA 1ZCNA 3W7CA 1VKFA 2BHZA 1A0DA 1VJZA 2V67A 4I5RA 1EJRC 4GJJA 1G5AA 2EG8A 1TX2A 2YL9A 3C0LA 3OODA 3IGHX 3O5PA 3N2XA 1TPUA 1VD6A 2ZRXA 1AZ1A 3LHVA 1AL8A 3WD1A 3A21A 3MY9A 4W5ZA 1M5YA 4R3UA 1E9LA 4S3KA 3SCQA 1JFXA 4HOWA 1G6CA 1JFHA 3G18A 1RY8A 3P5YA 5A6MA 1UROA 3SGZA 2YCLA 3QR3A 1PWMA 4OHQA 4O15A 3L4XA 5AECA 1V03A 2WNQA 3M0IA 1F6KA 2ZWZA 1DIKA 2JBMA 3CB8A 2C1HA 5LIWX 3H2NA 1NJJA 4GYPC 1EBHA 5T8GA 2ZZ3A 1IT0A 2DZVA 3IUIA 2NVDA 1PZ2A 1UG6A 1M68A 2QDHA 1EL3A 3N29A 1UUOA 4HU8A 1XC4A 4HCLA 3QZEA 3UG8A 5FSEC 4JHMA 1R47A 4UZSA 3W37A 3P7YA 1GWJA 1WZAA 1BXCA 2UV8G 2A1YA 4TVUA 1MI3A 4FNQA 5CJNA 4JFWA 3B9EA 3HGRA 1PXGA 2OQLA 4IL2A 4GUFA 3AHXA 4MTVA 4ZOAA 1U83A 7CGTA 1YLVA 3L4VA 2G41A 1KM6A 2ASHA 3NTYA 1XGDA 5FCZA 4L1WA 4YTUA 5E70A 1BEUA 2HWGA 1KCZA 2CBIA 1GQIA 3GSMA 1KT0A 1B9ZA 2XVLA 1LQAA 4X63A 4YL2A 3R8GA 3W2UA 3ZLHA 1RJRA 1KBJA 2BVTA 3PUEA 2WZEA 1XYFA 1EO7A 4HMDA 2PRHA 3T08A 2A0NA 3PTDA 4BEUA 1TELA 4O1DA 1A5UA 1C9WA 3JS3A 2CW6A 3LBOA 1C8VA 2GGIA 4GXMA 2HZGA 2GWNA 2X1IA 4UQDA 3VGEA 4MNKA 2OLHA 2CU0A 2AAAA 4Z2HA 1T96A 1V93A 2AQWA 4ICMA 1Z7AA 3GH4A 2E67A 5CJ5A 3AFBA 3HPFA 2I5GA 1XX1A 1R3YA 2C6QA 4R0XA 1RXOB 2WW5A 3GW0A 3LGDA 3KOXA 4NNCA 2KX9A 2WV8A 3THAA 1HJVA 4NI8A 5F1UA 2V63A 1TPWA 2M2AA 3SN1A 2QCMA 3VZYA 1I0DA 4DX3A 2PLJA 3VM7A 4B4HA 1V7AA 1YPXA 3GUWA 1AMYA 4NNRA 1B4EA 2XZ7A 3KUMA 3UXKA 3HV9A 3WYZA 4UTKA 1WZMA 4BK9A 1UD5A 5I77A 3UPBA 4MAVA 2VJXA 1DYSA 2ZR5A 2ZVRA 5CC5A 2F7FA 1I75A 3PN8A 5I02A 3S9IA 3OYZA 2WSQA 2PPOA 1Q6OA 4DO7A 4IM4A 1HJQA 3WH5A 4C65A 2PZ0A 4CN6A 1ZS2A 2VRQA 3PB0A 4CEXC 1M53A 5ECUA 4O13A 4BKNA 4OV9A 1QVBA 5HUOA 4HHLA 1EEXA 3PPFA 2YB1A 4EPBC 1L6YA 2OLAA 4LUIA 2R1MA 3DYPA 3LX9A 3PZNA 4YNGA 4JKMA 2Z29A 1BVWA 2GUBA 2W63A 1QI4A 3IIVA 1MFVA 1RCOB 3JW7A 1F9CA 3T81A 3DYMA 2OZ3A 3WLIA 3CK5A 3TX9A 2VZVA 3HGJA 2PDKA 3U6WA 3Q67A 1GPFA 4PL1A 3B9AA 1FXQA 5LIKX 3MI2A 3UWEA 1UMLA 3CV6A 3DCPA 1GPWA 1ZQ5A 4OV4A 1TA3B 3QV6A 3OJGA 3R10A 3IARA 3KXQA 3RN6A 1TZ9A 3NGFA 1PUDA 4AEOA 3WNNA 2A4AA 3UXIA 3B03A 3WQ8A 3LLDA 2QQ6A 4FO4A 3PJUA 1NY1A 2V2HA 4EAYA 3II1A 4XD3A 4I6VA 3THUA 3MDYB 2O56A 3MUIA 4AIEA 2I9EA 2J6XA 1B3OA 2H90A 2E28A 2Z28A 1MYRA 3TC7A 1ZBCA 4KERA 1VFHA 3O3RA 1ISZA 3RJYA 3S1GA 2GJXA 1HZYA 3DHPA 4JYFA 4ZB0A 1CXFA 1KTCA 3PZ9A 1UH3A 2EBNA 1RZMA 2JE8A 4E8CA 5CZ0A 4GO8A 3B4UA 1ONEA 1JXKA 4J5NA 2PFHA 3C0SA 1JGMA 4OU1A 1Q8AA 4TNSA 1B3YA 4C60A 4UTHA 3UXAA 2VCBA 3LGEA 4HBKA 5EY5A 2VFEA 2CKSA 4W7UA 4ODLA 4XD5A 2R6OA 1TJ0A 5HMEA 3F2CA 3DOPA 1I1XA 5LIXX 3BL3A 1UWQA 1LWHA 4I9AA 4NJJA 2FGLA 3TYBA 1XRSA 4FLOA 5J04A 2D2HA 4Z08A 1UOZA 4EPDC 1TTPA 2WC3A 1AVAA 1JZ8A 1M3UA 6XIAA 3PZOA 3LBMA 4D72A 2WJZA 3EX3A 3T09A 1ITCA 1I2RA 1HP4A 1WQ5A 3ZYZA 3WQFA 1UQYA 3WO8A 3RYSA 1GOOA 1OWQA 1R87A 3VOIA 4LVAA 3R89A 4JGDA 1VPQA 2HTMA 3NDZA 3FSUA 1ECQA 4MNMA 2YJQA 1KRBC 4JEQA 3UJRA 6ENLA 2V81A 1F40A 1A49A 2A21A 2F6KA 4PR4A 1UR1A 1JNTA 2QF8A 4DM1A 1B5TA 3I6EA 4JY9A 4MKNA 1H49A 4A35A 5G1MA 2GGGA 2C15A 2Y5JA 2GYIA 2Q3RA 1R2SA 3KAHA 4C5ZA 2OT0A 2YW3A 1SYTA 4EK7A 1PCKA 1W1IE 1E9YB 2A6NA 2J4GA 3L2IA 4LRTA 1HGWA 4W93A 3A4AA 2W9MA 1M1BA 2Z6JA 3FA4A 3AXKA 4JR5A 2YFOA 4IFRA 4X0NA 4RNHA 4A2RA 1TPB1 3VUSA 3VOJA 4ATLA 3TK7A 4RZBA 1A5KC 2OEJA 3M7WA 3TR2A 1PV8A 3U3HA 3BAIA 3EGJA 1E56A 4H2HA 4QQUA 3O5JA 5F2GA 2XP8A 3ZJ6A 2XH4A 4IG2B 3ZT5A 1A3WA 1M7XA 3S2JA 5DXYA 1WOBA 2CZEA 3W1TA 2J6VA 4R5EA 4RV8A 2MPHA 1W2VA 3A4WA 1XIHA 4D71A 1LOQA 1P5BA 1XLCA 4X9SA 4I7VA 3PWIA 1XIFA 1W0MA 3FYYA 3SB0A 3QSRA 1RH9A 4XAZA 3O05A 4W88A 3FNDA 2E77A 3P0XA 2Z26A 1LLZA 2VI0A 1Z9AA 1GVOA 2WPBA 3CIXA 4G8TA 4EF8A 3PBGA 3THCA 4EE9A 1A5NC 2RDTA 5AC6A 3ARRA 5CJMA 5PTDA 3W72A 2E9LA 5DT7A 2J7BA 3DBPA 5BNKA 3IJQA 4H9YA 1G9HA 4GG9A 4Q8QA 2FB2A 3R0DA 1FHDA 1KWKA 4IP7A 2H3BA 2E1WA 2ISWA 1VFMA 2VEMA 5CSYA 2K8IA 3H6OA 3M7SA 1DOSA 4MWAE 4GZ7A 2ZR6A 4IL0A 4E2BA 4CD8A 4R27A 1IYXA 2C0HA 3KP1A 3TYZA 4GUIA 1XINA 2FH6A 3QFWA 4RX0A 5XINA 3LV5A 3PG9A 2BSLA 4DNHA 3GFXA 5G2IA 1Y5XA 1CXEA 4UR8A 1SO4A 4JHZA 1Z89A 5C70A 1ZJIA 3F5LA 3MHGA 2V3DA 2OZ0A 3U2EA 2P1FA 3D3FA 5HR6A 4Y2WA 3IJ9A 2OX1A 4I7UA 1FFRA 4KRZA 5CSSA 3VGHA 4QAWA 3H2CA 3VILA 2MLYA 1VBJA 4RV3A 4DPQA 4TUFA 5BXRA 3V4BA 5LNVA 3UPMA 4U3CA 2OPJA 3GTFA 1NP0A 4HZMA 1EEPA 1D7FA 3PS7A 3N9RA 4HPGA 4F8XA 4KESA 1EWEA 1UR9A 1XWYA 1Z32X 1X97A 2J13A 3BTNA 3ARTA 1QWKA 1GONA 3JRKA 3TVAA 4E2DA 3EOLA 3MHFA 4ZVJA 2L5HA 2F21A 4FA3A 1AH4A 3GX9A 5FKYA 1TA3A 3L5AA 3APGA 3HG3A 2SFPA 1LG2A 3UWZA 1S3HA 2QPXA 2VVNA 3VFCA 1S1PA 2Q8LA 3CBWA 4H1ZA 3CEPA 5K9XA 2E6YA 4I9JA 1FDJA 3EY6A 1AQFA 3H2MA 4C6IA 3ALFA 1V3HA 3GXTA 4V1YA 2ITKA 1J93A 1WAUA 3VMPA 4EANA 2TYSA 4U5IA 4WGHA 2R1LA 1LT7A 3UERA 1J6YA 4JTRA 2ZQTA 5CC7A 3WBYA 3JXVA 1H62A 1YXCA 4PSRA 3TAKA 1K4HA 4H83A 4XZLX 3PZVA 5I3KA 3WLNA 1WDSA 3W02A 3D46A 1Q6QA 2FZMA 3VNZA 3RM9A 3GHUA 3PM6A 2D1ZA 3VIKA 2FQIA 1XG3A 1TUXA 3K8MA 1EX1A 2VWTA 3WLTA 3P60A 4NUWA 4DBWA 1GW9A 1XF0A 3L12A 3IACA 4GYPA 1TSIA 1Q4WA 4PCPA 1SO3A 1F7BA 5C71A 5FL0A 3FAPA 3VNYA 3NQMA 4MY1A 1H61A 2IXVA 3DAQA 4KWWA 3AWOA 2YOCA 4AVOA 1TR1A 4PFMA 3VIPA 3TSMA 2IF4A 1JAKA 1KD0A 5A6AA 3CTTA 3TKFA 3BJFA 3WQ4A 4WDUA 2PDFA 4DZ2A 2J74A 3VK5A 5D38A 4DN1A 3WY1A 2GDQA 5FI8A 2G4FA 4V2XA 4N19A 3BLEA 1BF2A 7REQA 1RD6A 1J0IA 1ECEA 2RJHA 4B90A 1XIDA 5IBXC 3IPWA 4AWTA 1X8FA 4ZOBA 2DQXA 1EJVC 3FW6A 2DJXA 3WDJA 1LZOA 2HXTA 1NOUA 1GTHA 4C6LA 4AW7A 3SQLA 4DT4A 3ITCA 1EDGA 3BANA 4HA4A 3LM3A 3W7DA 4DXKA 3W7LA 4UOQA 3PC0A 4DYJA 2DSZA 5I07A 1SW0A 3KVJA 5JH1A 2QUUA 4EACA 1C92A 1EYWA 2ZUWA 3LRMA 4KKXA 3CUIA 3WELA 5AB3A 2NXHA 1V5XA 4D6IA 1S38A 1F74A 4KIRA 5AYYA 1DL3A 3NURA 3CUFA 3GPKA 2NW0A 1MQQA 2PDYA 3B05A 5A8PA 4ENLA 5IDZA 3GBDA 5J5DA 4ADUA 3I4EA 3OHIA 2DZBA 2P3EA 1OZMA 4JL2A 2Y63A 1XD0A 1KV8A 3TJLA 1ZZMA 3KL5A 2HJPA 1VEOA 3T07A 3OB8A 1EQ3A 5BXTA 2YL5A 2H6RA 4JTQA 4IG2A 4PCNA 4FR6A 3G1XA 1VRXA 3QHMA 4DHGA 1ITUA 4OQVA 4DJDC 2QPSA 1IEVA 4HMNA 1MW0A 5HR7A 4FEZA 3XIMA 1O95A 2W67A 5EFDA 4TW6A 4IFKB 4D6FA 4GQRA 2EULA 3PWGA 3S9YA 2R82A 5BRBA 4M82A 3WH6A 1OFOA 3S6OA 3MMDA 1HJXA 2XJ7A 3NUKA 4JKKA 4S3EA 3L4UA 3W01A 4ERAA 1RLCL 3AZRA 1U79A 3EPOA 3O5QA 1UASA 3A24A 2DVTA 2DG9A 4R9OA 4MJZA 3SDOA 4DWSC 5D30A 1TRIA 1HKVA 3W7GA 3ZVHB 2XFWA 4LAXA 1E6RA 2L2SA 3PZGA 4G50A 3PFMA 4DJEC 3QMTA 3PFRA 2QJMA 2XIJA 1SJDA 4Z1AA 4HN8A 3W6MA 3ZWSA 2NX3A 2EJ1A 4JY8A 4UFJA 2A3AA 1JUKA 2FZDA 4W8BA 2BODX 2QJJA 4X0VA 4B2DD 3NZGA 4QIUA 1BVNP 4NJIA 2NUXA 3LLXA 1TV5A 1W5NA 2ZX6A 3NQAA 1K8XA 4AX6A 5C9ZA 4X9YA 3TN6A 3MSRA 4LF1A 3PR9A 4HKPA 2OQYA 4PMJA 4NU7A 1QI0A 1KW1A 3OLGA 4HYWA 2HRWA 2CETA 2YA0A 5HINA 4CVWA 4FXRA 5BXSA 3IK2A 2VC6A 2ZXBA 1TE6A 3P61A 3N14A 1JGIA 4AVNA 4AD4A 4S39A 4QCEA 1J5TA 5A6JA 1KM5A 4JZ5A 3TFXA 1YBQB 2NSOA 3H21A 3B3DA 2HS6A 3MMUA 4Y9NA 4AVFA 1J18A 4JFVA 4NVTA 2UY5A 4NZ4A 4LAMA 4MVAA 4E8GA 4DYEA 3U7BA 3SADA 3MJMA 2OFNA 1Y8BA 1BG4A 1UR0A 4G7FA 4MM1A 3VE9A 4HTBA 5D09A 4DJFC 2W79A 4MB1A 5G4EA 5EFFA 1NOWA 2X16A 4OTKA 2WHLA 4KWUA 4EKJA 4LS1A 2GGEA 1EJXC 1DJIA 1WB0A 2IXUA 5EKYA 4UR7A 4PEEA 3OHMB 3GS6A 4Q7BA 4LAYA 1FXPA 5B8IC 4UTMA 2ZQUA 1EP3A 3SZ8A 2HROA 2EPNA 4Q8OA 2EPLX 3M0HA 1TJ1A 1FRBA 4NSBA 3E49A 4KW2A 1EF2A 1T40A 3MZNA 1R2TA 1TUFA 1JDEA 3ZLFA 1R30A 3MBDA 8CGTA 1FUYA 3EDDA 3ITYA 4JFKA 3M4HA 1Q13A 1TMQA 3M16A 1NFBA 3AUJA 1VJSA 1R85A 3C3UA 3VMOA 4HGXA 4JIEA 1XIEA 3N19B 3IVTA 1P1XA 1NQ6A 1EQPA 1KFEA 1T7LA 3Q45A 2NV9A 4AWEA 4W9QA 2J77A 3VXGA 3EMZA 3THQA 1C8YA 4NAEA 2NZLA 3BDKA 3A9IA 3N2TA 1YPFA 2P8CA 2BWGA 3OLEA 3R6IA 1KRMA 2H3DA 3GWQA 4QJ3B 4V33A 5F2IA 3TH6A 1DJZA 5FJJA 3QC3A 3T44A 1NFPA 1BLIA 1GRJA 1ODUA 2NQ9A 4O10A 1DPMA 2FTWA 1QXLA 3EDEA 3ZS4A 1HX0A 2PWEA 2LJ4A 4POCA 4DRIA 4IQCA 4BQ2A 3RILA 4FOUA 3GH7A 4M56A 1IE7C 4Q8NA 3NAVA 1E4MM 3RCYA 4P7LA 4LGXA 1QNPA 1YW1A 2CBUA 3HFYA 4JBRA 3GU9A 1P1MA 1WDWA 2VD8A 3GKFA 4M6UA 1UR4A 3FVDA 5LNRA 3EB2A 3TZFA 4ZQCA 4CN1A 2J78A 3SFWA 3KWSA 4B91A 1U22A 1XYMA 4Z17A 4IPXA 3T42A 3S5NA 2PLKA 2MUCA 2MLXA 1EPVA 2YIHA 3BSGA 1H51A 3NQBA 1RK5A 1BQCA 2XDFA 4WHBA 5DRCA 3BICA 1G4PA 1G1YA 1X1OA 3WK1A 4AWUA 4HNCA 5FJTA 1EQCA 1JYXA 1IHIA 3R4IA 1ENUA 4DRMA 3UR5A 3MV11 4FXSA 4OWGA 2PI6A 5BWFA 2GQAA 3TSDA 1VFUA 2UY3A 4A3YA 4ZXOA 5IRPA 3DH7A 3NYZA 4PC8A 1UQZA 5L9FA 2VGBA 4GGHA 4PBGA 1KBIA 4N4QA 1FKXA 1OK6A 2WK2A 3WMBA 3W84A 5A95A 1R3WA 1G4SA 3M9YA 1SR0A 1XV8A 4DWSB 2GZXA 2CXGA 2X30A 3AIVA 4LB4A 3FYOA 4RKAA 4PGLA 2G37A 2OELA 4O0QA 2A3LA 3LEPA 1VBUA 3WNOA 4M7TA 3WBAA 1W9DM 2ZC8A 3A3XA 4HPHA 4OVXA 1W91A 4LUJA 5A8NA 2KFWA 4K1WA 3SUSA 1EDQA 1F05A 2WHJA 3V5OA 4WKFA 3H7UA 1VZWA 4PMRA 5E0CA 2VEKA 3LCXA 5HUAA 2WVTA 3QBUA 3ZVHA 3B9OA 4LAUA 3TMLA 5FAGA 1BXBA 3SFKA 1J4HA 3EWXA 1BWVA 2D3LA 1KBKA 3G0XA 4GISA 3KRZA 2IPGA 4AIUA 1GJUA 3OO2A 1XPGA 1ADOA 3QHOA 2YBTA 2PTDA 3GHTA 3CZEA 3HN3A 1FWNA 5LIUX 1EFZA 1Q2RA 1PKMA 1TCDA 4U10A 1XRTA 2RDXA 3NTPA 1XLJA 1GVFA 4B15A 3LSBA 4IMFA 1AK5A 1JVWA 4GIAA 2YXGA 2RGMA 2YL6A 1JIBA 3OBKA 5GJMA 4GX9A 2PLMA 5CCZA 1O5QA 4KETA 3KEHA 1ZUAX 5HA7A 2ZX8A 1ZY9A 5LA2A 3GD6A 1J5SA 3ONCA 3PTQA 1MFUA 1CBGA 4QCFA 4F0RA 2CZDA 2FPVA 4LVBA 1X96A 4GYFA 1LWJA 3VD3A 4Q7IA 1E6PA 1GQNA 1WAWA 1RVKA 1AZ2A 1KB3A 2DUAA 4YHGA 4Z1BA 3G2GA 3WQ6A 3N11A 3S4TA 3GXNA 2E5BA 5E0KA 4C02B 2VX7A 3H2FA 3WJXA 1E44A 3AS3A 1EXPA 4NIRA 1PIGA 4DBEA 5C9XA 1WXJA 3QW4B 4K38A 1FKLA 1OB0A 3CH0A 4RJEA 2ETNA 4AZCB 4JFTA 1QHOA 3EWZA 2FVKA 3MMTA 4PCTA 1J4RA 4QLKA 1YMYA 1QK2A 4O1CA 4AZ5A 1NH6A 3CAQA 4MWAC 2GVYA 1RALA 3RMJA 2J7DA 1BGGA 2HMCA 3CHEA 3AC0A 4MIMA 4QS6A 2BXZA 2C91A 3IV8A 2LGOA 3W71A 1YATA 5F4SA 2IKHA 3G8EA 5CPQA 4HK5A 4IP5A 2ZX9A 4FOJA 4Q8PA 1L1PA 3H24A 3RFAA 3VIFA 5LGXA 2YCEA 2PBCA 1VRDA 4QDWA 4DRQA 4AMAA 2LKNA 3LTYA 4UFIA 2QAFA 2VCDA 2EHHA 1GCYA 1T0OA 2XVKA 4QP0A 4HZ8A 2V3FA 5ABEA 1POJA 6A3HA 2FJKA 1GQKA 4U4MA 1UZDA 4GACA 5IBXA 3M0JA 2CLLA 3ES7A 4P7NA 5FF0A 1ZBKA 3LXCA 1CTNA 1VFOA 4ORIA 1BYDA 4QNEA 2ABAA 1TTIA 4GMEA 4I7WA 3WUBA 2VOMA 1NDVA 3W2KA 3TC5A 1QOPA 1HQTA 3T2QA 4RDVA 4UDMA 3ZJ8A 1MRQA 2E6FA 3BG9A 3N4FA 4HMEA 1XR2A 1P0EA 4UBPC 3G1FA 4XTIA 2ZZ5A 1XYZA 3KBVA 3NO1A 2A3HA 3W2MA 2HSAA 1TREA 3OYXA 3P8JA 2BGQA 3AIQA 1LBMA 4G7EB 3KZSA 1IR1A 3N25A 1IT7A 4XAKA 3W1NA 1FVPA 3K4AA 1CLXA 1XS2A 4LS0A 5A6BA 1FHVA 3ZWTA 3MPGA 4M29A 3W28A 4BY3A 5AOUA 1UWAA 3DU0A 4WF7A 2J47A 4GXWA 5K7JA 2NXGA 2VRKA 2Y7EA 1FWIC 1NAL1 1OFRA 1MZRA 5D32A 3EIPA 4CNPA 3KTXA 3IJ8A 4NZJA 3KVMA 2H9AA 2X1UA 3EXSA 2F4EA 1VLWA 4F0SA 3SY5A 1JZ2A 3IGXA 2VN1A 1MWOA 1H0IA 1I8JA 2PPNA 2DT1A 3KAGA 4REQB 4DJDA 3G8RA 4NX5A 3DX5A 4QBXA 5A6KA 5JBDA 4ZTXA 5H8PA 5LA1A 3UZJA 3HQOA 1JCMP 1PPIA 1FWRA 4G1KA 3PY2A 5CZJA 1XGZA 4GYJA 3UZYA 4ZMGA 2QKFA 1UZHA 5D37A 3FIGA 1FWGC 4XV0A 2F2DA 3W1MA 3UW6A 1Z6KA 3OBAA 3NQFA 6TAAA 4ZO7A 1E43A 4DWSA 3O15A 1XIMA 3VCCA 4B5VA 2LLEA 4X2RA 1E51A 3VA8A 1J96A 4CD7A 1ELSA 1S2AA 4LC8A 1IT8A 2QIWA 1XUUA 4H9ZA 3BSHA 4ADTA 3LM7A 4DJEA 4MG4A 4ZQMA 5XIAA 1EX5A 2B7PA 1K6WA 2XG9A 3KP0A 3S8HA 3RM8A 5C8BB 4H9MA 1D3GA 3TAOA 4GVGA 3WMCA 4F66A 1XDMA 1I2NA 4PZVA 2WZIA 2VP8A 4DLFA 3VIJA 1EC9A 5FJUA 1W31A 5D05A 1ISVA 1FCQA 4PYSA 5LNSA 1EC7A 1RAKA 2EPKX 3WQOA 3WBEA 3BLPX 5BMWA 2WXDM 3M5ZA 3QZ6A 4US5A 4LUTA 4GUGA 4XISA 3WJSA 3ITTA 4YTTA 3TROA 1VIWA 4V1XA 3CWOX 1CDGA 3LRLA 5ABGA 3EEGA 5LHEA 5I00A 1TJRA 5I3FA 2XSBA 3C6CA 1O4UA 1XQLA 1E1FA 1MNSA 2CC0A 5HWNA 1BWKA 4LCRA 4YTSA 4DJFA 3W7PA 3AXMA 1U2YA 2ISSA 4ZQNA 2FH8A 1XBZA 2FFIA 3ITXA 1UP3A 2J79A 1IIHA 3CM4A 4OE7A 1OGGA 4A8LA 4IPLA 1P6WA 3NGJA 2PU0A 1CB7B 3WF3A 1HKKA 3HU7A 4ZO8A 2WAGA 3PJTA 2X0HA 4D6DA 5LZLA 5HNUA 3WQ5A 3LGGA 2R14A 2N87A 3MANA 3J7HA 4ZPTR 1EBGA 4GO9A 3TSBA 4MWAB 1JJKA 3CUZA 5BRPA 1HJWA 2R94A 4OBRA 4Z42C 5I3HA 3F4VA 1MEHA 3F4NA 4UQ9A 4R7WA 2XH7A 1SO5A 5C5YA 1PYFA 1ZALA 4GE8A 1E6ZA 3USZA 4RNIA 1BGAA 1OIMA 3C3NA 8XIMA 1LORA 3LUTA 5TAOA 1ITQA 1AW5A 3MUAA 4M5PA 4QG8A 2FAPA 3LPGA 5TD4A 2A7NA 3ZJ7A 3TYAA 3CASA 1ML1A 1TE1A 2QXWA 2MF9A 1KM4A 2R91A 2D22A 4GQBA 2ZE3A 4D1JA 3DFYA 3WD0A 2V5JA 2ZRZA 3TJXA 3GVRA 4WXYA 2CESA 4LUYA 3LI1A 1OZQA 1RVGA 5M17A 2UZ5A 5A2CA 1PZ1A 3HA1A 1DJXA 1NMWA 1YYAA 1VC4A 1OF6A 3F2DA 1X7FA 1SR9A 3EX2A 3L2LA 3KHJA 1OVDA 4XD4A 3L21A 1H41A 1K77A 3W0KA 4C7DA 1H7OA 1GHRA 3NRKA 2BX7A 4HK6A 4PTXA 2DIEA 4Q32A 4FI4A 2C13A 4DO6A 5EMMA 3G5EA 4XO6A 4E4FA 1KT1A 3O5RA 4QJ1A 1Q6IA 1I6NA 3LCWA 4LYQA 4H41A 1Z48A 4ICNA 3U9IA 2JFEX 1A4MA 4L9XA 4RDYA 4S1FA 3L2MA 3QXBA 1OG0A 3CTLA 4ZBCA 3VD7A 4A3QA 2R1KA 3V1HA 3FX4A 1E72M 4XZBA 1BYBA 2Q8XA 1U30A 1JRBA 4G7EA 1YEYA 2V9DA 2VR2A 1A5CA 1UWRA 2BNJA 3O63A 3B9NA 1NWSA 1E3ZA 4YYFA 3UCDA 1BSIA 3VIGA 1B3ZA 5AYZA 3ID7A 3N4EA 4D1IA 3ARUA 3BV4A 5D9MA 2X42A 1LWIA 2WM1A 3EKZA 1SMDA 3M46A 4JTTA 3JVAA 1V79A 3V0SA 5HKGA 4JX5A 1JZ6A 2PP1A 4NZ5A 1JDFA 4C91A 3G1HA 3VKBA 2PODA 1L8PA 4REQA 3G22A 2DH3A 2CYGA 2PTZA 4C90A 3JYJA 2D69A 1W1PA 1F3EA 1WDDA 1Q3NA 3OGVA 5C2XA 4WUIA 2D3NA 2EXOA 3QV9A 3DFQA 4W87A 1W5OA 4AUBA 4EXAA 4B9YA 4FALA 2DQWA 4IQEA 3L66A 3GXPA 1FH9A 1FWJC 2A6LA 5JXQA 3WMLA 3R58A 4KF1A 4NZ1A 3CT2A 1J6OA 3TCEA 3FA3A 4FF7A 4AD0A 2JEPA 4S3CA 2MLZA 3BW2A 1PL9A 3ME3A 4YTRA 5A5WA 1JQVA 4CD6A 3H70A 3WD3A 4QDMA 4UOZA 1V3MA 4Z1DA 4H8HA 2GVGA 1NARA 4QISA 3GR7A 3C2OA 3OQ8A 1AMKA 3CAVA 4Y8EA 4Q7NA 3A3HA 1RQBA 4IWWA 3S1XA 1N2VA 1VFFA 2X2GA 3GDBA 2E09A 1V08A 4ZOCA 4R7JA 4F79A 5I2UA 2XYLA 5I3DA 3EEZA 2WZHA 3LU2A 3N9KA 1WXZA 2PV2A 1I60A 2Y8VA 2QT3A 1X1ZA 3PVFA 3V5CA 4ALDA 4L4OA 3HJZA 4R85A 4CQCA 2P5NA 5HUPA 3ABSA 4LBRA 3S47A 2Z1WA 3OU8A 4LAVA 3UQNA 4N6FA 3S5SA 1E4IA 1RUSA 3KDOA 1CGXA 1VHCA 1S2CA 3GKAA 3KOZA 4MOZA 1KBBA 1PCWA 4HYVA 4BZYA 1TO3A 2D0GA 5F4WA 5CGTA 1TPFA 4O8AA 3KZPA 4IUOA 2Y78A 3CAKA 4FXFA 4OJYA 4QE5A 3HO8A 2CXEA 1S5WA 4TVCA 3W4RA 1UWSA 1SO6A 5CPOA 5CAHA 2WSYA 4J3ZA 1VBHA 4N42A 1J2BA 1VGAA 4ITZA 3VDCA 4IT6A 1JCXA 4MGGA 1B6CA 1N8IA 4K8HA 4UIOA 1NDWA 4O12A 2UY2A 3SUWA 4H9VA 3UJFA 2W3ZA 1T99A 3NWRA 4MWAA 3YPIA 7TAAA 1WUFA 2WM0A 3NQ6A 1JI2A 4RDWA 1XM3A 1GORA 1E4NA 3UPWA 1UPMB 2PWUA 2YB4A 1MXDA 1VENA 1R3TA 4DUWA 3L4ZA 4LNYA 4IXXA 1OJXA 3LBCA 3H9RB 2INEA 3DECA 3OG3A 3KCLA 5I24A 1ZP4A 4S2CA 1FHLA 4PB3A 3O5IA 1F2JA 3E38A 2GVJA 4QIBA 1RSCA 5KINA 3W1PA 2ZZ2A 3BUVA 3WQVA 2BV9A 1SMAA 3M5VA 4TX8A 1H7PA 4TW7A 4JIRA 3FXYA 1RBLA 1DTNA 4ZS6A 2IQTA 4FLSA 1XYLA 3AZSA 1ISWA 1V3JA 4D2JA 1F8MA 3ZSTA 1S1RA 2WKGA 4B3ZA 1LCOA 2JKAA 1KV5A 5M2FX 5IXEA 3TLQA 1NFGA 2VQUA 1KFKA 3GYCA 4MLRA 5M1TA 1OT1A 3A4XA 1PX8A 1HO4A 4HMCA 3SCSA 3UEQA 1E6XM 1QPLA 2PF0A 2Z2UA 4MNLA 2CLKA 3K4DA 4XZWA 1UJPA 5CPNA 1F3XA 4HU3A 2Z7GA 4R34A 5C7VA 1TV7A 2XIOA 3W7HA 1FWEC 3ZM8A 1BWLA 3TW7A 4GD0A 1R7AA 3R12A 3B9DA 2TODA 4HQVA 1KKRA 2QDDA 4PUWA 3RX2A 1TFVA 2OVLA 3HQNA 4B4FA 5AC8A 2QCCA 3N18A 5M5DA 1J12A 1DIOA 3DKJA 1HTIA 1OY0A 1IV8A 3G3MA 3W70A 3GVQA 4JKLA 2NT0A 4YWIA 1W9BM 2Q5AA 1F6YA 2G5WA 4M1RA 2VMFA 4JD4A 1B4KA 4LANA 1U5HA 2BVYA 3GIYA 2ZQVA 3QR1A 4ZB5A 1IZJA 3NPUA 2WJDA 1L9WA 3COTA 3QF0A 3BGJA 4KFPA 2FPTA 2RUDA 3RRXA 2Z25A 2QUNA 1QTWA 3LMYA 3UG3A 4FNSA 5DY3A 3WFLA 5CG0A 3QQ1A 2PSNA 4JTDA 3MDWA 3PPGA 1NIUA 1R3QA 2WBKA 3T78A 2DH2A 5LHFA 4GVHA 3GDRA 2Y62A 4RK8A 4D6CA 5D02A 3EWDA 3ZR4A 3LTSA 4C6KA 4O11A 4KEVA 3NJ3A 3W26A 5FIPA 3A13A 2A3EA 1NF7A 4UUIA 3UP8A 1AD4A 3BMWA 4MUZA 2DT0A 3O5KA 3TTQA 4LC6A 3L0GA 3HB9A 4DO5A 3KX6A 4XO7A 2D24A 4WCJA 4K7VA 4PEKA 4J3UA 1FKBA 4HK7A 2XU2A 1XLAA 4JIQA 1V4YA 2WHKA 4TYOA 2PV3A 1ME7A 1Q65A 2Z1BA 1BPLB 2Z6IA 3KOYA 2YCJA 2E7FA 4XKYB 2D2OA 4TO8A 2IPWA 4GX8A 3WH0A 4H8VA 4H6RA 2OYMA 4Q8WA 1NDZA 3N34A 4JQ3A 4IX2A 3T0TA 4ODNA 5HWBA 3GUGA 3KLKA 4L6HA 1M6JA 3ATZA 1UKTA 3M6DA 2Y4SA 3SIMA 3WMSA 5BXPA 4F0LA 1WKEA 3N9SA 5K3VA 4RPPA 1WKDA 4WY0B 3NDYA 3KFTA 5HMFA 1ADSA 3UCCA 5HOSA 2PE4A 3NSNA 2PD9A 3VAVA 2PDCA 2VWSA 1A47A 1V3LA 4F2TA 4HYRA 2Y24A 3SBFA 3C2FA 4UXDA 1LP6A 2ZCGA 1W8SA 4AMCA 2DSKA 3WLJA 2ZADA 2JGYA 4WXZA 1SZGA 4PCFA 1TTQA 1S3TC 4XZMX 2DVUA 2BS9A 3W22A 1KLZA 5AFDA 3GAYA 3H54A 4ODRA 1KXHA 3FJ6A 2Y7FA 4WDWA 1IQ8A 3POCA 4AY1A 4FX7A 3HZ3A 4Q4KA 2I16A 1QR7A 1JRCA 3OZYA 1OGBA 1FDYA 5A8GA 3LHWA 1OFDA 4NQ1A 1G0CA 4FLRA 4LV9A 5C6MA 3IRDA 3T0BA 1JCTA 1K8ZA 2GL5A 2YDRA 2WO5A 3ABRA 1N1AA 3OOQA 1FHUA 3KCEA 2WB5A 2Z2BA 2IPFA 2QUMA 3I7RA 1EO5A 3UI6A 3EDFA 2XUCA 3RPMA 4FZIA 3KACA 4S3AA 2ZUSA 3D47A 4CCZA 5FF7A 4WJXA 3W25A 9CGTA 3TEVA 1XSKA 1E70M 4Y7EA 3QM3A 1FJDA 2OWXA 4CQ9A 5AZ0A 3CB3A 4DXVA 3EDJA 3QH2A 1CGVA 2BGNE 2Z1KA 3SCOA 4DRSA 4JNMA 3PBYA 3LS9A 2P76A 3UD6A 1Q4NX 1XBYA 4O2TA 2V69A 3W1LA 1DQUA 4AF0B 1HNYA 2PDMA 4AISA 4L64A 3F5KA 3VD4A 3TN3A 3NEVA 4PBFA 3CAWA 4ZQOA 3U57A 4Y8FA 4J27A 1P0DA 2BDQA 2Y7DA 1H63A 1UWUA 5E9XA 3KAIA 2XGBA 2C3ZA 2AL1A 4J2MA 4N02A 3TV8A 2BMBA 1GYNA 4LBSA 3FAXA 2YA1A 2XFFA 3HG4A 1NP2A 4Z0JA 3A23A 1TQXA 3RHGA 9XIMA 5CEWA 3NO5A 1JR1A 4YTQA 4ILSA 1O1ZA 4E8DA 2VX5A 3EA1A 2ZYFA 3V3WA 3W7JA 4HJFA 4EXBA 3SM0A 3UXDA 4O1AA 4HNLA 2W0UA 1V6YA 3TP4A 3VOGA 1BD0A 2ZUNA 1B9BA 1FWTA 3RJXA 3AROA 2PS2A 1KCKA 1KM1A 1F73A 4DO4A 4LQ1A 2CIPA 1AQ0A 3ATYA 1MRAA 5DMMA 4F2UA 1TQJA 4XAGA 4UB9A 4AYSA 1Q66A 3Q4DA 2XM2A 1JEZA 2LPVA 4A3HA 5BRQA 2C7FA 2J66A 2F6XA 2CPUA 4E3VA 4MHBA 3SJNA 1Q1CA 3U4FA 4WRHA 4LVGA 3FN9A 1Z41A 2DZTA 3H55A 3MQTA 1K03A 4K8GA 1FKFA 3P67A 1W3JA 5D75A 1QO2A 1EH9A 4PMUA 3QY6A 2QJHA 2X0YA 4C6CA 3QOMA 3L68A 4NILA 3O5FA 2DY3A 2YSWA 1UWIA 3C52A 4YXGA 3VKDA 2WVSA 1UJQA 4AH7A 3ARZA 3WFZA 2I57A 2FZ9A 4JNYA 1IXQA 3TTYA 5GQBA 2G0WA 5AC7A 4Y9OA 4JTFA 5T26A 3KHDA 1FKRA 4O52A 2Z27A 2O4MA 1GK8A 3NQVA 1ZB5A 1E5JA 2BXVA 4HHMA 1YW5A 3DBNA 3WEMA 1OX6A 2FZBA 1B57A 3Q94A 1XH2A 1V02E 4AIBA 1R38A 2OFJA 1M9HA 1LBLA 3KVKA 1CXIA 4J4NA 1EZWA 1V6XA 3TU9A 1OGSA 2ZA1A 3DHUA 3GBEA 2C71A 2Z00A 2PAJA 4H7ZA 2VT0A 3N2OA 4QT2A 1H1NA 3W7OA 3NEHA 4OFCA 3CQKA 4AIOA 3GC4A 1XYBA 3W53A 4GXPA 3T0AA 2PWHA 1PYMA 2PRMA 4XKMA 2DPEA 3ALGA 3BMVA 1UH2A 1O6IA 3VAWA 3W1XA 2HBXA 1Z8AA 1GG0A 1PKNA 3BCJA 2GK1B 3N6JA 1HL9A 1MDRA 2QYGA 4XKYA 3S5OA 3GYEA 1PZ0A 3N04A 3QFEA 1XICA 3E9AA 2DU2A 2JQXA 1BYAA 3OGRA 4M0XA 1BRLB 2WKLA 1UIPA 4IH3A 4DBUA 4Q4QA 2CITA 1OX4B 3M5XA 5I79A 2B4GA 1HXVA 6CGTA 3VUPA 3MS8A 3WZ0E 3ERPA 3GO2A 4GBUA 4JCLA 1UUMA 3DFOA 2PGEA 4HJWA 4H6KA 3WSUA 1IIGA 4B5TA 3GR8A 1GEHA 4FOKA 3QSTA 2KI3A 3W7RA 1SSGA 1MQPA 3HG2A 1RP9A 4J35A 3ARVA 1V6TA 4H6EA 2HE8A 1KNWA 1XIGA 3AU6A 4INFA 3CZJA 4ZODA 1X6UA 3HM7A 4NXKA 2WWDA 3W00A 3E0IA 1QFEA 1TRDA 3ISIX 1W54A 1W9XA 4IXHA 2JALA 3UF8A 2VFHA 4YIWA 1PEZA 2ATSA 4A8NA 3E2VA 5D9NA 3VZXA 1PDYA 1K1DA 1TIWA 2E9BA 4PH6A 1S5VA 1SGJA 1ZAHA 4EPKA 5IHSA 3W81A 3M0ZA 4TTGA 3FYPA 3IKDA 1H11A 3INPA 4C6MA 3ZT6A 1FKIA 3LPOA 3W7KA 4HN4A 4ZE4A 1JQXA 1A5AA 1GKRA 3CV1A 1UMYA 3E0VA 3DG7A 2XIIA 1JZ7A 3O0FA 3R0UA 3LD5A 1TTJA 4LTSA 1WPCA 2WQDA 1DJQA 1XISA 1XW8A 1HL8A 1O66A 3VD5A 1JDAA 4F40A 4K68A 3E96A 4ZR8A 4HZ6A 2NV2A 4UTIA 4H19A 5GNYA 1LYXA 4AF0A 4NRRA 2D0HA 4ICCX 2NQ5A 2NT1A 1ISYA 3PAOA 4L4MA 2AMXA 3CMGA 1FWWA 1QMLA 2XH0A 3STGA 1I2OA 1VHNA 4U31A 4CNOA 3W73A 3MHUA 3AIUA 1ZJHA 2HNHA 1V8EA 4EAMA 2D0FA 1EGMA 3QHNA 2X0SA 1A80A 3PNZA 5LXXA 5LGZA 3STEA 1R3RA 5C9RA 3BE7A 3RM4A 1MW2A 1TKKA 2ZE0A 5IHRA 2F84A