1XRVA

Crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the novel secretory signalling protein from Porcine (SPP-40) at 2.1A resolution.
rcsb
molecule tags Signaling protein
molecule keywords signal processing protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xrvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xrvA01
1DWHM 1UWQA 1NWUA 4RE3A 2FHBA 2CCRA 2J62A 2ZXAA 1ZBKA 4W84A 4P8XA 2CPUA 1G9HA 1LL7A 4L4OA 1GHRA 2GK1A 1VRXA 1XD0A 4PBGA 1FP9A 3ECQA 2Y2WA 3GXDA 3MKKA 4OUEA 3SURA 1VJSA 3A47A 2CKSA 2VX7A 1CECA 3VMPA 2ZUMA 2BY0A 1QNRA 5IHRA 2J79A 1R7OA 3B9EA 1DWGM 4LYRA 3GBDA 3AIBA 4IM4A 1IZJA 1LG1A 4GINA 4E8CA 1ITCA 1PIGA 1AQMA 4LYQA 3WMBA 1J11A 1JNDA 4WKFA 2EJ1A 2JEPA 3RPMA 1E70M 4ACZA 3L2MA 5JH8A 2XIIA 1BYAA 1E6ZA 3PHAA 2YJQA 4AD0A 4UOJA 4UFLA 2O9RA 2DPEA 1BVNP 3ARQA 1B3XA 2WSPA 4D6FA 1PX3A 1XHGA 1H09A 1JDCA 1GZJA 1V6WA 1US3A 4JZ5A 1E1EA 5DO8A 3ARXA 3WY1A 1V6XA 1E15A 1WDPA 1JXJA 3CTTA 3EDDA 1B30A 3IJ9A 3ZR6A 1O7AA 1CGWA 3HN3A 1SYTA 1EDTA 4JKKA 2CESA 5HNNA 3N15A 4YHEA 1AQHA 4IUGA 3VO0A 3AHYA 4AD5A 1LWJA 4AZBA 3BSHA 3SUSA 1RD6A 5D8ZA 1KXQA 1NWSA 2WHKA 1GORA 1X1NA 1H5VA 3L2LA 1MWOA 4H7VA 1H11A 5A8QA 4M1RA 1HJVA 1CGYA 4W93A 4MJ4A 3RCNA 4TX8A 3VPLA 5A6JA 4ZE4A 5M5DA 5BXSA 2YDRA 1LJYA 3THDA 4AZHA 1OGGA 1EO5A 3SCOA 1VEOA 1D2KA 1G5AA 3OGRA 1RH9A 4CD6A 4KMQA 5CSYA 4H8VA 1PJ9A 3SCSA 1JYNA 1BYBA 3FAWA 4XX6A 2W63A 2GDVA 1WZMA 5A6BD 1I75A 3GDBA 4H8HA 5BYWA 1QNPA 3MV11 1C92A 4JHOA 5DFAA 4W5ZA 2YBTA 1OD8A 3VGEA 1J0ZA 4JL1A 5E09A 1V3IA 3TTSA 1UR8A 1EOKA 3L4YA 5EFFA 3AI0A 1CXEA 2XFRA 2V5DA 3U7VA 3WENA 3GXFA 2VX5A 4QFUA 2GFTA 1JFHA 1MFUA 4P8WA 5I77A 1UWRA 4Q22A 4W85A 4QAWA 2QF8A 3BCFA 1TA3B 3IK2A 4UQDA 3VD9A 4DUXA 2VQTA 1TUXA 1OGBA 2VO5A 2VZSA 5ABFA 3F5JA 3VU2A 4AD3A 4KRUA 3OZOA 3CLWA 5CZKA 3ARTA 3UETA 2J75A 2YLAA 1WZKA 3WNKA 1H1NA 5D4YA 3K4AA 2J8GA 3AYRA 1E72M 1KGUA 4TVUA 2WPGA 4D6DA 3WH9A 4CGTA 3OBAA 2EBNA 2J7GA 2YA2A 3N17A 4V2XA 2X0HA 5GNYA 2WWDA 3WDIA 3WQ4A 2J7BA 1E3ZA 5E6ZA 2EPKX 3N1AA 3PZTA 3WEZA 1WDRA 3J7HA 2TAAA 7A3HA 3CMGA 4UFHA 3LMYA 5CPQA 3VGDA 1QW9A 3APGA 3OGVA 4JL2A 1F4HA 2CBUA 1EA9C 1WE5A 2Y8VA 3N13A 4P7QA 3NSNA 3PZ9A 2WZIA 1BFNA 4F79A 1GQKA 1GOMA 1W9DM 3VDBA 1VBRA 2XM2A 3GZAA 3CZ8A 2WC4A 1UH4A 1WAWA 1V3MA 2NT1A 1W3KA 4DUVA 1L0PA 1UOKA 2XVLA 2OYLA 1QOXA 3A4XA 5A2BA 4NRSA 1J9YA 1F4AA 3ZSSA 3HMCA 3T0AA 2PC8A 3UCQA 3K8KA 2BY3A 1E6PA 1CXIA 1KR1A 4QCFA 1UKTA 1UA7A 1X6LA 3IJ7A 2NT0A 2YA0A 1ZU8A 1O6IA 7TAAA 4UQBA 1X6NA 1XRVA 3QR3A 2ZWZA 3VIMA 1DTUA 2J47A 3KE0A 1QI4A 4PTMA 1LQ0A 2F61A 4Z2IA 5GNZA 5FOOA 4GI9A 3VD7A 1XH0A 1BAGA 1CGUA 2CITA 4B3KA 1E6RA 4FLSA 1MQRA 1H2JA 3WL1A 3RIKA 1KBKA 2OSYA 3NCOA 2WMHA 1UYQA 4M80A 4PMNA 4UFKA 4QP0A 3ZT6A 2VQUA 1GOOA 1E6QM 2Y5EA 3VGHA 3MUZ1 1ITXA 4MTVA 2G41A 4CD4A 5A6BA 5I23A 1ZBVA 5ABHA 3UG5A 1H3GA 2VOTA 3AHTA 1JZ4A 3F4VA 3ZIZA 3T0DA 3PTMA 4GI6A 2C8NA 2Q8XA 2QV4A 2O9OA 3W37A 2WHJA 3WH6A 3GH4A 5CGTA 1WNOA 1VEPA 4DWSD 2V3FA 5A69A 1MQQA 4W88A 1KXTA 4B9YA 2DIEA 1UD2A 5FL0A 1W1YA 2YL5A 3TA9A 4LX4A 1B3YA 1EIBA 1JZ8A 2FH6A 5HOSA 6A3HA 1CLXA 5GQBA 4HU0A 2PI6A 5KEZA 2X09A 5HXMA 1C90A 1HJQA 4M81A 3AMLA 3SCVA 5AC4A 3AIWA 4Z2LA 1GUVA 3WNPA 1XD1A 4PRWA 2JALA 3WUBA 1PPIA 4CU7A 1HIZA 2W61A 3W6MA 1UWIA 3PN8A 3ARVA 1US2A 1E4NA 1E6XM 4ZXOA 2VR5A 3W29A 1BPLB 3CZLA 4M29A 2YBUA 5ECUA 3VIHA 1HJXA 3ZJ8A 3BAIA 3WEOA 1BYDA 4V27A 4TTUA 2IXVA 5CSUA 2EPNA 1NOFA 1TVNA 3WH7A 3AMDA 2DH2A 2D3NA 1QW8A 4UQ9A 3RJYA 1B90A 3AHXA 1KQZA 5C8BB 2XJ7A 4PSPA 2CHOA 1S46A 3AMGA 4GXPA 1QNOA 1UD8A 1NOUA 1CGTA 2VI0A 4HZ7A 3VIJA 3ZOAA 5A6LA 3F5KA 1BG9A 1W1TA 1HN1A 1MXDA 4C7GA 1GHSA 3CZGA 2F2HA 1SFSA 3NUKA 1J0IA 3GXMA 1GW1A 1CYGA 2WHMA 4HOWA 5FKYA 4WSKA 3VIFA 1ISYA 5IFTA 4OJYA 2W91A 4GZJA 3SUWA 2DSZA 3EYPA 1JF6A 3AFBA 1BYCA 4GPNA 5F7UA 4AIOA 1UR0A 4JHZA 4CCEA 1GOWA 4MNLA 4D6JA 3MU7A 1HL8A 4HA4A 2EO7A 3QHOA 4OZOA 4MB5A 3WNLA 3ZO9A 3WIJA 4H04A 5IXEA 3CMJA 1NH6A 5A6SA 3AOFA 2QPUA 4HZ6A 1D3CA 1ECEA 1FHDA 1I1XA 1KWKA 3VOCA 2DSKA 3PZOA 2RGMA 2D1ZA 1QPKA 5A2CA 1BGGA 1XSIA 2XVKA 3B8SA 3RM4A 3BH4A 1J0JA 1V0MA 5HPOA 2WBKA 1QI2A 5D8WA 1Q6EA 4DWSB 2J7HA 3WFLA 4F9DA 1U30A 5A3HA 4BF7A 1JNEA 2CBJA 3TTYA 1UH3A 4ZE5A 3AROA 4S3KA 3AXXA 4TVDA 4PTXA 3VTRA 1GOIA 2ZX9A 1TCMA 1JL8A 2BHYA 4HPHA 1U33A 3QHMA 3POCA 4GO8A 4UCFA 1GCYA 3CUIA 3VDAA 2E9LA 4HMEA 3GNRA 3KL5A 1VBUA 3VD3A 1FHLA 4GZIA 1EXPA 1OIMA 3WF0A 1UKOA 3WQVA 4J3SA 3CH9A 2QPSA 1JG9A 3WF3A 5E70A 3SCNA 1KXHA 3N04A 2W62A 5E9AA 1CZ1A 1MW3A 4LXFA 4M24A 2HISA 4CD7A 4C7DA 4AYSA 4NRRA 3A6OA 3HU7A 4FMVA 4D1IA 3VKKA 2PB1A 3GH7A 1VJZA 2EQDA 3AZRA 1V08A 2ZIDA 3A3HA 5BXRA 4MJ2A 2DSUA 4ML4A 2A3EA 1RP8A 2D0FA 4XUYA 4MAVA 1B9ZA 1Y7VA 5IDIA 3UR7A 1KFWA 4BZYA 3BXWA 3WL0A 2VX6A 3MO4A 2DSVA 1WKYA 1KR0A 3GBEA 2J25A 1DWJM 3RILA 4W5UA 5EBAA 2VCCA 1WZLA 1WDQA 6TAAA 2GUYA 1E3XA 4MNJA 1B0IA 1M01A 4E4PA 1W1VA 1UKQA 4WJXA 2WVVB 5DT7A 1HNYA 2VCAA 4AD1A 3M46A 1E0WA 4AD4A 3VGBA 3W6LA 1CGVA 2ZXBA 2GJXB 2X8RA 1JYWA 3W53A 2V3GA 3B9AA 2DGAA 4OKDA 1CNVA 3G6MA 1V0KA 3D5HA 1HJUA 4TVCA 3BC9A 4HU8A 1L8NA 3GM8A 3W38A 4B16A 1LL4A 2G8ZA 3PZMA 5A8NA 4CU6A 4PCTA 4PYSA 2BXYA 1JAEA 3NIYA 5DMYA 4UOZA 3AXIA 5JIPA 2EPLX 4HP5A 4WF7A 1UG6A 5A6MA 1TA3A 1FFRA 3L4XA 4BQ3A 1H49A 1B3WA 1JYXA 1XV8A 3WH8A 3CHCA 3FHQA 1R87A 1BLIA 2W67A 3MANA 3T2OA 4PMOA 2GDUA 1J0HA 2WHLA 3FW6A 4UFMA 1MXGA 3IJ8A 3WDJA 1CIUA 5ABEA 1J0KA 2MANA 1OT2A 5E0CA 2DQXA 1FH7A 3UEQA 1OT1A 2DSWA 3K46A 4RE2A 2J77A 4BCEA 1WO2A 3WD1A 3OG2A 1GOQA 3W82A 1ZJBA 5EFDA 3WNOA 2VJXA 2C0HA 5CPTA 1QVBA 3VIGA 1ESWA 3U5UA 4W8BA 3PTKA 1CDGA 5DF0A 1FFQA 1EHNA 4ACYA 3ARRA 5I78A 2J4GA 4UFJA 1VIWA 3K1DA 1UD3A 3QHNA 5LA0A 3NSMA 4Z2GA 1MVYA 4DWSC 3EBVA 2WMGA 1HKIA 1JXKA 2JFEX 5AYIA 3WQ6A 5D9OA 4Q7NA 3VIPA 1BTCA 3N11A 1G0CA 3AICA 1FH8A 4V28A 1C8XA 3IAPA 3TOPA 5A6KA 2D23A 1BF2A 1E0VA 1M53A 4OBRA 1XCWA 4AISA 2ZUVA 2CBIA 2VR4A 1CEOA 1GJUA 2ZUUA 4J3TA 1KCLA 4JFSA 1WPCA 2DT0A 2FH8A 2JIEA 4KGLA 3EMCA 4IPNB 1HL9A 5C70A 3N12A 3ZJKA 5ABGA 4D6CA 5JBEA 1JGIA 3BMWA 2E40A 7CGTA 4BQ4A 3OA5A 3OLDA 4BQ5A 4CU8A 4MNKA 4AZIA 1IZKA 2QMJA 3DYOA 4X0VA 2Z1SA 3BSGA 4GI8A 3EDJA 3KZSA 1TVPA 2XG9A 3WKZA 3WQ8A 2VX4A 3RMEA 4QLKA 4U2ZA 1MW1A 2JF6A 3SCRA 2D0HA 1BHGA 1CGXA 1HKKA 4HOZA 1QI5A 2NW0A 4J3WA 1HJSA 2VVSA 3W0KA 2FGZA 5FL1A 4W89A 5A8MA 1HVXA 4P8UA 4D6HA 2BNJA 1TG7A 3EDKA 2V3EA 2OYKA 2OWWA 2Y4SA 2OSWA 1FA2A 4QDMA 4B9ZA 3CPUA 2VMFA 3GNPA 3UERA 1ISWA 3AIEA 1JZ7A 3B9DA 1Q4NX 3AIQA 3T2QA 3G6LA 4AZGA 1KQYA 2D3LA 2ZUWA 4PEEA 1E1FA 2CHNA 3SCPA 4P8VA 4F66A 1K6AA 3U57A 4CN6A 1C7TA 2W66A 3AHZA 2ZUTA 3WBAA 1UQZA 5A94A 1NARA 1E56A 4PMQA 2EPMX 1B1YA 1ISVA 2NSXA 1V0NA 1WCGA 3AYSA 3L4TA 3VD5A 5KZ6A 4NSBA 5ABFB 1NP2A 1JIBA 4FK9A 2XIBA 3UR8A 3WDRA 4GKLA 2QLYA 2WC3A 3CIVA 4PMDA 2OSXA 3O9NA 1H41A 1QHPA 2WCAA 4PCSA 3FY1A 2YDSA 1BSIA 3BAJA 3K8LA 2O92A 3KWXA 1UKSA 2VL4A 2XUCA 5CXPA 3WD0A 4MB1A 1V3KA 2C7FA 1WDSA 5BRPA 2ZWYA 3TP4A 2G3JA 3U7BA 3DHPA 1OCQA 4TXEA 4JFVA 4UQAA 3AZSA 1PX8A 1GONA 3NYDA 3CZJA 5CLTA 3MMDA 1QHZA 2XWEA 5BXTA 4PMUA 4A4AA 3WELA 3EDFA 1W9UA 3VX0A 1UWTA 2BHUA 4ZXLA 8A3HA 3MMWA 3FNDA 1ISXA 4TX6A 1SR0A 3OLGA 4UQEA 3SUVA 1UH2A 5A1AA 2PWEA 2YL9A 2PBOA 2YA1A 4LYPA 2OWXA 3OGSA 1VFOA 4MB4A 4WK9A 1E55A 3AS2A 1UQYA 4DWSA 4NZCA 3MV01 2CETA 3T09A 1V6UA 5GPRA 1W9PA 3D3AA 4XZBA 3ZJ6A 2UY5A 3T08A 2J7FA 2X05A 4OIFA 3VUPA 1UWSA 1VENA 4A3HA 1IV8A 3VD4A 2WCGA 2WM0A 1ODZA 2JIWA 3ALFA 2E3ZA 3LPOA 1TFVA 1W2VA 3A4WA 3II1A 4EK7A 3BAXA 3AQUA 3WD4A 3W4RA 4U2YA 5EB8A 4PMRA 1GPFA 1EQCA 3S2CA 1C8YA 1CXKA 2WB5A 1XSKA 3BGAA 3SCUA 2UY2A 3ZQ9A 4TTGA 1UD5A 1YQ2A 4HZ8A 1FP8A 2AAAA 2IUZA 5A2AA 4AZ6A 1V3LA 1U2YA 5CLWA 3RO8A 4AMCA 2ZX8A 3WFZA 1BVZA 1KGWA 4IPLA 3M07A 3VIKA 4MPKA 3DYMA 1V6YA 1LG2A 3ARUA 3DHUA 3FAXA 1B3ZA 5IHSA 4YHGA 3FXYA 3CGTA 4ZFMA 3NJ3A 1HX0A 1VAHA 1SMDA 3L4WA 1TZ7A 3L4VA 5CQ1A 2E4TA 4JCLA 3W28A 4CD8A 1DWIM 2VNCA 1JF5A 1RPKA 2Y24A 5BWFA 2XWDA 5BCAA 2BVTA 4M56A 4CUCA 1E71M 2VRJA 2XSAA 1JDDA 4AD2A 2EPOA 2J8FA 1XC6A 1C8QA 1N82A 1MW2A 4QCEA 4EKJA 1NM9A 1UZ1A 3WUFA 1HVQA 4FLOA 2YL8A 3O2LA 2DT3A 2YL6A 1JD9A 2DIJA 2ZOXA 2ZXDA 5FIPA 2ZXQA 1K9EA 4J3XA 3WQ5A 4PUEA 1EHAA 1CXHA 2BS9A 2WAGA 3I3EA 1V3JA 2OYMA 3RJXA 3ZMRA 1K9DA 1QNSA 4PN2A 3KEHA 1LF1A 2JEQA 2QHAA 1KCKA 1JYVA 1TMQA 4N0RA 1NP0A 1GOKA 1LLOA 4HA3A 2BY1A 1E6SM 2XGIA 4AY1A 2YIHA 3T0BA 1VFMA 3WDHA 1V03A 2AOSA 3AMCA 4M82A 1DWAM 2CBVA 1GVIA 1M04A 1SMAA 4WKAA 3VX1A 4NI3A 1HJWA 5D9MA 3UESA 2WMIB 4U33A 4J7RA 4HOXA 1VB9A 3ARWA 5BROA 3WSUA 3WD3A 3CZKA 4HPGA 1E5NA 3AIVA 2ZX5A 2WLZA 3CUHA 1KBBA 1CTNA 1OGSA 1NWRA 4BQ2A 3W81A 2D22A 1J12A 5I2UA 2F8QA 1PIFA 3THCA 5I0DA 4K68A 1PZ2A 1XYZA 5LA2A 2CXGA 4AEEA 2XVGA 4HMDA 2DH3A 3MUY1 1JZ5A 4D71A 3EMQA 3ARYA 2EEXA 4GIAA 3CHFA 4AZCB 1KB3A 2DDXA 2V3DA 2GJRA 1EH9A 3WNMA 1W3HA 1G94A 2WMFA 1W32A 1QNQA 5BRQA 3ARPA 4URIA 4Z2HA 3PZQA 4B15A 4PUDA 1B3VA 1K9FA 3I3DA 2VVNA 2AMGA 3SCTA 2PF0A 1PBGA 1JI1A 2YKKA 3LPGA 1A47A 3SEPA 3PZNA 3U5YA 4P7NA 4W7VA 4WKHA 1CBGA 1R86A 5I6SA 2WKLA 3BAYA 3W24A 3BAKA 1J10A 1H4PA 1VFUA 2B31A 4AC1X 1V0LA 1UKPA 2XVPA 5LA1A 1DHKA 2X2YA 3AIUA 4UR9A 3JUGA 1EDQA 3VNYA 1GQLA 1QBAA 2G3IA 4OBSA 1BQCA 1OB0A 1OM0A 3MSDA 3ARSA 4W7WA 1AQ0A 3GXIA 1V02E 4XB3A 1W91A 4AZ5A 4PMXA 3WDQA 1H0GA 2O9TA 5GNXA 1DEDA 4D1JA 4IISA 3ZT7A 3VM7A 4E2OA 3VIOA 2D0GA 4X9YA 5BXPA 2ESCA 1Q6DA 1E4IA 4UOQA 1LL6A 2VRQA 3MUIA 3AISA 1TR1A 4H8UA 1GNXA 2BVYA 4MNMA 4P7OA 2Z1KA 4R27A 1UZ4A 4OOUA 3A4AA 1GQJA 3ZJ7A 1EOMA 1HKMA 3F5LA 1MQPA 5M17A 8CGTA 2D2OA 1JDAA 4CD5A 3NDZA 3WBEA 2WMKA 2O9PA 4UTFA 2XHYA 1XGZA 1JZ2A 1UUQA 1YHTA 2YOCA 3GYCA 3POHA 2J7EA 4J3UA 2WLYA 1C93A 5AYBA 3IANA 2DEPA 4CN1A 2CKRA 2JF7A 3VGGA 1D7FA 4C7FA 3SIMA 1XH2A 4MAZA 4EANA 4ZEPA 1OWQA 4NF7A 2J7DA 3OIHA 4UNIA 4TOQA 4PMVA 3SCWA 2BVDA 2BXZA 3EDEA 3O6AA 5JIWA 4RE4A 3WDPP 4AZCA 1E73M 1HF6A 5LYRA 5HBFA 1NWTA 1W2PA 4GO9A 2WC7A 1Q6FA 3VDHA 9CGTA 3SCQA 4KGJA 3WMCA 3DYPA 1XCXA 3AXHA 3M7SA 2VURA 3SUUA 2E8ZA 3AS3A 1FOBA 4E8DA 2W92A 3WEMA 1V3HA 2DT2A 2WWCA 2XPKA 4U3AA 3UG4A 4WSJA 1XH1A 1R7AA 3CBWA 1TE1A 2PWFA 3CUGA 2GK1B 2GJPA 1DP0A 4EE9A 1OD0A 2FGLA 2J78A 3AZTA 3M6DA 3BMVA 1UR4A 3L4UA 3RDKA 3EMZA 2E0PA 3KL0A 1NOWA 1J0YA 1R8LA 5CG0A 3SUTA 2WSKA 4AIEA 2A3AA 1MW0A 2ZUNA 1GQIA 3WUGA 3LPFA 5CPSA 3QGVA 2UY3A 3OZPA 4JKMA 3PZGA 3MS8A 2XSBA 1FH9A 4UZSA 2WMJA 3RM8A 3DECA 2E9BA 1ZBWA 4AEFA 1Q6CA 3E1F1 2WXDM 2DT1A 1QHOA 3WF2A 1WB0A 5E0FA 4KWUA 3VM5A 3WMSA 3W26A 4HTYA 4J3VA 5A95A 4U5KA 5EMYA 2E8YA 1QBBA 3AHVA 1Q6GA 4JIEA 3W27A 2X1IA 2YDQA 4J27A 5JBDA 2WKGA 2BFGA 1W9XA 4D6IA 4MDPA 1CPUA 1OSEA 2VZUA 4QLLA 3CZEA 3T2PA 3AMKA 4AXNA 1LWHA 4L4PA 5M03A 1BG4A 4D72A 1W3LA 1GVYA 3WF4A 1DWFM 1A3HA 3VVGA 1MFVA 5A8OA 3CUFA 1JZ6A 1EO7A 1WP6A 4Y7EA 3UG3A 1C3FA 4PMZA 3VDCA 1JFXA 3GNOA 1CENA 2J74A 1UWUA 4M8UA 2QMKA 4CCDA 1KWGA 4JKLA 1W1PA 2IXUA 2VC9A 3MSGA 4CVUA 1PZ3A 4OOZA 2V5CA 1B2YA 3W25A 4U5IA 5I24A 1ZS2A 1J18A 2WVSA 4KRTA 3ARZA 3MUAA 1ODUA 2WVUA 3MMUA 3CHEA 1HXJA 3CHDA 5CJ5A 2VRKA 2JE8A 1UR2A 3VNZA 4TUFA 3VMNA 1ZBCA 2PWGA 4DM1A 4F8XA 3PZIA 2OLHA 5AC5A 2FHCA 3PTQA 4Z2JA 1MYRA 4ATWA 3WH5A 4N42A 4Z2KA 3VMOA 2OWCA 2CNCA 1UD6A 1GJWA 4MDOA 2PWHA 4FF5A 2VTFA 4AWEA 4EAMA 4ACZB 2G3MA 4AW7A 5CGMA 4AIUA 1C91A 1UR1A 4BA0A 2XFYA 1ZJAA 4H2CA 3VIIA 1QI0A 2WVTA 3WN6A 1WZAA 2ZUSA 4LQ1A 3I3BA 2WANA 4UZUA 4W8LA 2W4XA 1EQPA 1E5JA 5HDRA 2G3NA 2XM1A 2GJXA 1V6VA 2X0YA 3NSXA 4D6GA 4UQCA 1CXLA 2G4FA 2E9MA 1ISZA 4CCCA 2GVYA 1PAMA 3PZUA 1J01A 2CYGA 3WQWA 1P6WA 3NDYA 4WIWA 2WVVA 1E9LA 1HT6A 4PTWA 4JAWA 3FHAA 1E4LA 1EDGA 4ZENA 4JFTA 4D6EA 2WW5A 1QI3A 2CEQA 1H0IA 4GQRA 2BY2A 2ZE0A 4CVWA 2UY4A 5A6AA 2PBGA 6CGTA 3KL3A 2ZX7A 3LPPA 3N9KA 4RL3A 1HKJA 4F9JA 1E4MM 5FD0A 4XZWA 4JCMA 4ATLA 2WNWA 4LPCA 2ZICA 3AS1A 2Y8KA 2VZVA 4PSRA 1VEMA 2VCBA 5D9NA 1UHVA 2CERA 1JZ3A 1E43A 3HJEA 3N18A 5FCZA 4GZEA 3BLPX 1W3JA 3VILA 1KGXA 4LGXA 1V02A 3TTOA 2YLLA 1M7XA 4FLQA 2FDMA 1E40A 1HP5A 4QLJA 2CIPA 1B31A 1OIFA 4HMCA 4P7RA 2RGLA 5DEZA 1JD7A 4W8AA 4R5EA 4YPJA 3WF1A 4UFIA 4PTVA 1G1YA 4AZ7A 2A3CA 3VGFA 4DM2A 1UA3A 3QOMA 2A3BA 1R85A 2A3HA 4WLCA 3ZM8A 1AVAA 2V38A 2XFFA 1CLVA 5A8PA 5JBFA 4B3LA 1UD4A 3VINA 3RM9A 1ZB5A 5HPCA 1UR9A 3GH5A 2PWDA 2XGBA 1W9VA 4W87A 4H41A 3OB8A 4W86A 2BV9A 4A3YA 3PZVA 1JAKA 5AY7A 4X0NA 4CKQA 3K8MA 5I79A 5I3DA 5JUVA 1XYFA 2D20A 2J7CA 5DT5A 3DC0A 3ZR5A 3S6TA 3QOKA 5I5RA 3WNNA 1E0XA 5C71A 3AJ7A 4HA1A 3BAWA 4CN4A 4U3CA 2XVNA 2UWFA 1EGZA 2WCSA 2XTKA 1AMYA 1E6NA 4BS0A 1G01A 3TONA 3ZSTA 3IAQA 3FN9A 3ZT5A 3AS0A 1IT0A 1PX4A 2VZTA 3OLEA 5TD4A 5M3WA 3L4ZA 1OINA 3CUJA 1C7SA 2WZEA 2VZOA 1CWYA 4ATDA 3TTQA 1VFFA 4J28A 2WBGA 1M03A 2ZX6A 4U31A 3BCDA 4S3JA 1KXVA 3GTNA 5D9PA 1XSJA 2WYSA 1PEZA 4PMYA 4P7LA 3WUEA 1JI2A 1RP9A 3PBGA 5E6YA 2XYLA 2VT0A 3OLIA 4MB3A 4KH2A 1HP4A 2GSJA 1K9TA 1ZL1A 2EXOA 2WK2A 2FHFA 4W7UA 4JFUA 4GQQA 1W9BM 2D24A 4MADA 1Z32X 2HVMA 1CXFA 1BGAA 2BHZA 4JFWA 3AIRA 4FLRA 5IFPA 2WZHA 4XV0A 3K4DA 4DUWA 1NQ6A 1VF8A 4YN5A 2VUYA 3ALGA 2W5FA 3BLKA 2WMIA 3CO4A 3WD2A 1I1WA 1OBAA
chains in the Genus database with same CATH superfamily
1UWQA 3M44A 1M9HA 1NWUA 1VCVA 3U2EA 4O4WA 1XDJA 3PPFA 1XLIA 3A22A 1XDLA 4K7VA 4JIIX 1VRXA 3HTWA 4HCLA 3GXDA 3O6DA 3O06A 4L56A 3A47A 4GYFA 4O18A 4HJWA 4IWWA 4H9MA 1LT8A 4UMAA 2PU1A 3W7OA 1OX4B 1R7OA 1DWGM 1DJNA 3M5VA 4LYRA 1K4HA 2IQTA 4DWDA 1IZJA 2LJ4A 1LG1A 4GINA 4XIAA 3QC3A 1P6CA 3H6OA 2P1FA 3XISA 4O1AA 1NMVA 4WKFA 2HPIA 3SRFA 2PP3A 5JH8A 2XIIA 3H54A 4GIVA 1BYAA 1YTKA 2CLLA 5F4WA 3APTA 5REQA 5T9CE 4GYKA 4XBSA 2DPEA 4MKNA 1ZCCA 4IMAA 3WK3A 4PB3A 4GLEA 4ZB5A 3IUHA 1DE6A 3TC5A 3R94A 2AQVA 1FTXA 5IBXC 1JDCA 3A3WA 3COTA 2QJMA 5DO8A 3UA4A 3C2YA 1V6XA 3W7KA 2P50A 1JXJA 4DLFA 1UMYA 4H9ZA 3LERA 3W3OA 3KLKA 4EX4A 4AX7A 2ZA1A 3NZ1A 4YHEA 1AQHA 4IUGA 3PA7A 3SY1A 5BXJA 4XO6A 5D8ZA 1NWSA 1KFKA 4NZFA 3CJPA 3K30A 3P5ZA 1TV2A 1MWOA 1FKLA 5A8QA 4TQTA 4W93A 5A6JA 1MXSA 3AWNA 1RPXA 3SCOA 1VEOA 3EWXA 1G5AA 3PTDA 4K1WA 4GNVA 3CQIA 5CSYA 4H8VA 4JY8A 1UB3A 1JYNA 1X97A 1J2WA 3UJ2A 4XX6A 2W63A 4H8HA 5BYWA 4REQA 2PD5A 5DFAA 2YBTA 4X9SA 3HOJA 2PRMA 4ILSA 4E4FA 1EOKA 5CZ0A 3DN5A 3PK7A 3EX6A 1EWDA 3GW3A 1W31A 1UUMA 1XJBA 2HZGA 3H2CA 2P10A 2V6AA 4P8WA 4Q22A 3BCFA 3ZLHA 4UQDA 3CB8A 1FJDA 1H7WA 3S5YA 4S23A 4DUXA 1HGYA 3H7RA 1MI3A 1IHIA 2VQTA 1ZAHA 2VZSA 5ABFA 3GE7A 2PDLA 3M1ZA 1YADA 4KRUA 3TLLA 5CZKA 3UETA 2YLAA 1H1NA 5D4YA 2J8GA 3PR9A 2PTDA 3IRSA 1ZZMA 2QUVA 3WH9A 4TW8A 2ZQUA 3GTHA 1OFAA 1TTIA 4CGTA 4ZQPA 2YA2A 5GNYA 4HPXA 2WWDA 1DIOA 3KTXA 4BJHA 4J1OA 3WQ4A 2EPKX 3N1AA 4TX9A 3G22A 3INPA 1V5XA 2Y89A 1A7XA 3J7HA 4PL1A 3T6CA 2TAAA 3WLPA 2BZNA 3CMGA 3DH7A 5K2ZA 4C6DA 2NX1A 2ACQA 2XIJA 4FNUA 1EA9C 1DIEA 2Y8VA 3N13A 4Z1AA 1W8SA 3NSNA 2OOGA 3S2JA 3B8VA 1TPH1 3RLUA 5CC5A 1QOQA 2VFHA 3MO7A 2PCQA 2X1UA 1IXNA 2XM2A 3GZAA 4H00A 1WAWA 4HSNA 1Q65A 1SJDA 5L6UA 1W3KA 4DJFC 1PTGA 2VP8A 4PCFA 3STCA 2XPBA 1L0PA 3CL7A 1T0OA 1Q66A 1FWJC 2G50A 3C0SA 2OYLA 3FAPA 3QY8A 2QCCA 5G1YA 1J9YA 3ZSSA 3LCFA 2PC8A 3UCQA 3L66A 1SO5A 1UWAA 4MYAA 1JPDX 2X7VA 3IJ7A 2QIWA 2NT0A 4KEZA 1X6NA 2MNTA 3NAVA 4X63A 3KZPA 1A50A 2VR2A 3ZS4A 4YVVA 5FOOA 3VD7A 3WBXA 4H1ZA 2CITA 4I6KA 1QJWA 2DIKA 4FLSA 2YBVA 1F2JA 4AWUA 5HJXA 4GJ1A 4ZPVR 3RIKA 1DIDA 2HVNA 5HW7A 1UYQA 3PUEA 2XINA 4TU1A 4PMNA 4UFKA 3H7UA 1OFPA 1G7UA 3UY7A 5AECA 1ZJIA 1E6QM 2Y5EA 3HGRA 4K8GA 4MTVA 4UTMA 4CD4A 3KBSA 5CBJA 1SVDA 4GUGA 4JQ1A 1Q2SA 4A05A 3AHTA 3VZXA 3M0ZA 2IKIA 1XPYA 4FF7A 2C8NA 5FAJA 3H70A 3UI4A 2QV4A 3W37A 3MPGA 2WHJA 3O5LA 1SO3A 4FNQA 1VPXA 5A69A 3L23A 3TKFA 1MQQA 3GAKA 4W88A 4DXVA 4B9YA 2D73A 3KVMA 3G3MA 4IMGA 1A5CA 3TJ4A 3UBPC 1R2SA 1Q7QA 3TA9A 3BGGA 1B3YA 4IQLA 3W74A 2IQDA 3W1UA 2XIOA 2FH6A 1XS2A 5BRBA 4PB5A 4DVOA 1CLXA 3RAOA 1KV8A 2AQOA 2QUNA 4M81A 3UNDA 3AIWA 4ORIA 2GQ3A 1L6GA 4F0KA 1YXCA 4HT3A 4PH6A 3WFAA 2BXVA 4IIHA 4PRWA 3NL6A 1FCQA 1ADDA 4JFIA 1UWIA 4LF2A 3M6YA 1US2A 1E6XM 4FXFA 3LTSA 5AHMA 3U4AA 3CGNA 1QPLA 3EKZA 4FEZA 2YBUA 5J04A 4RPQA 1YMYA 4MMWA 2ALDA 2Y61A 3BAIA 1I9CB 3WEOA 3PVFA 1YXYA 5CSUA 2RURA 4UTWA 2XISA 2ZRVA 1TVNA 3P8JA 5BNKA 3WJYA 4NIRA 2QJGA 3AHXA 4V1YA 4GXPA 1NOUA 4LNCA 3LCLA 2WV8A 4HZ7A 4OHQA 5F4XA 4CNPA 3QFEA 2VFGA 3G2GA 3NUKA 3L9CA 1J0IA 3S83A 2H6RA 2ZCGA 3CUZA 5IFTA 3GB6A 4M6VA 4P61A 3AALA 3SUWA 3EYPA 3G77A 4G56A 1BYCA 3HGJA 4GPNA 1DQUA 2I5IA 4CCEA 4D6JA 3H7VA 3E2VA 1LRNA 3R4IA 3QRHA 1VR6A 1FDYA 1NH6A 3GHTA 4XBJA 4ZFCA 2DZWA 3AOFA 2WSYA 2M08A 1FHDA 3BJSA 1I1XA 1JUKA 4M7TA 2ZR4A 1XBXA 1QPKA 5A2CA 3C0LA 1CW2A 2XVKA 4G7FA 5CPNA 5D8WA 1Q6EA 4DWSB 4WZHA 3VA8A 3BARA 4BI6A 3SFWA 4ZE5A 4DBDA 4S3KA 1XM3A 2ZX9A 3W7JA 3OPSA 1FD9A 7ODCA 1TCMA 4MKSA 4AY8A 1JL8A 1TIMA 2W9MA 2BHYA 5DLCA 2WNNA 3B0UX 3AAMA 2Z2BA 3HFTA 3O5MA 4GO8A 1GCYA 3CUIA 4OGZA 2OQHA 4CQCA 2E9LA 1VBUA 4JDBA 1J5TA 3W07A 1NFPA 2ATSA 3WF0A 1UKOA 3BLOA 2QPSA 4NZ4A 3ONBA 4NNAA 5E70A 2E5CA 2R82A 2W62A 1YPXA 5E9AA 1CZ1A 1IEXA 2NUYA 1LM1A 5LNVA 2HISA 2CZVA 4XD6A 1SFLA 1M41A 4D1IA 3VKKA 2C91A 1QDSA 1VJZA 4C6JA 1BTMA 1YPIA 3HG3A 3N6HA 4ML4A 5HNRA 2VD8A 5K4XA 4ZO6A 1LQ2A 3WL0A 4EPBC 2PPGA 3HQ1A 2PWVA 3MO4A 1WKYA 5D05A 4L1GA 1KR0A 1W5PA 3CQHA 2YCLB 5HQMA 2ASHA 1BWKA 3EPNA 4F40A 2LLEA 2AL1A 3RILA 2VCCA 5DRIA 1R3QA 6TAAA 1E3XA 1M01A 3MP5A 3UNTA 2GYIA 3OIXA 2VCAA 2XIMA 5D2XA 4XTIA 3GLCA 1H1ZA 1E0WA 3BO9A 4Q8TA 4FR6A 1WOBA 2ZDRA 1CGVA 3W6LA 1R30A 3EIPA 4RZ6A 3M47A 3P3BA 2V5JA 1CNVA 5U4NA 3D5HA 3GFYA 1XIDA 3I68A 3OBEA 3BC9A 5C54A 4KW2A 1WDDA 4QEHA 1LL4A 5A8NA 1W1IE 3H4WA 3C2RA 2EPLX 4WF7A 5LIUX 1TA3A 3L4XA 1B3WA 3CEUA 3KAOA 3CHCA 1OYBA 3FHQA 1FWAC 5B7ZA 3S6DA 3UR5A 3LZ3A 2RUDA 4UFMA 4BWLA 3WDJA 3UY8A 1J0KA 1IGWA 1WV2A 5E0CA 4J35A 4MSPA 5AYXA 1EXBA 3HPSA 2DSWA 1O1ZA 1REQB 4EF9A 3RG6A 3O3RA 2J77A 2IW0A 1GOQA 4XAZA 5EFDA 1KFLA 3L0KA 2QGHA 3RU6A 1QVBA 1T7LA 3VIGA 3OTRA 3TMLA 3N29A 4JTIA 3PTKA 5DF0A 2Q8LA 4ACYA 3ARRA 5I78A 4UFJA 2AWGA 5GPGA 3W75A 2F6UA 5LA0A 1FWEC 4PL2A 1W1ZA 1ME9A 3NQ2A 3E0VA 3BSMA 2PDNA 2JFEX 1KFCA 3PBVA 5D9OA 3R89A 3KOXA 1BTCA 4NU7A 1TZZA 1G0CA 3NPXA 1W6TA 2VC5A 3IAPA 3TOPA 3CTLA 1O66A 3S4TA 1BF2A 1E0VA 1TV4A 3RRAA 1M53A 4OBRA 1XCWA 2PTZA 5F2MA 1CEOA 1QATA 4JFSA 3BPWA 3EMCA 2C14A 3TQKA 5ECVA 4L6HA 2FFCA 7CGTA 3W7CA 4BQ4A 2QW5A 3B40A 4X0VA 3CWHA 1FKBA 3LLDA 3EDJA 2XG9A 4U28A 4MFDA 1QK2A 1C8VA 4S39A 1MW1A 2JF6A 3C4UA 1CGXA 1GEHA 1QI5A 3E0WA 2PDYA 3RMJA 3B8DA 3MC5A 2NQ5A 1ME8A 1DJYA 4Q8VA 3R79A 4D6HA 3UJRA 1X98A 3IKDA 3ITTA 3T9PA 3C86A 1FHVA 2Y4SA 1FA2A 1NJJA 5E0KA 4B9ZA 3CAWA 3F2CA 2VMFA 3UERA 3VABA 4MJMA 3BW4A 3ANVA 3C56A 1Q4NX 1S5NA 3GUGA 1A5BA 1WA3A 1KQYA 2ZUWA 4PEEA 3GR8A 4C1LA 1KNWA 4Q8NA 4F66A 3QQ0A 4GIYA 1IR2A 5C9UA 4FNTA 1ISVA 3MJYA 4OV9A 1KFEA 5ABFB 2OTDA 2QLYA 2WC3A 6REQA 3EZ4A 3O9NA 3SW6A 2FTWA 4TNSA 3FY1A 3K8LA 2O92A 5I3GA 1MNZA 1UKSA 3WD0A 3LRKA 4F2BA 4TIMA 5KZEA 4X60A 2L5HA 1Y5VA 2G3JA 3O6CA 1HO1A 3U7BA 3DHPA 1SFJA 1OCQA 4DJDA 4DUOA 3QPYA 5GJNA 1GONA 2EF9A 2ZZ6A 4PULA 3O16A 4A4AA 3A9BA 5I7GA 4O1DA 4G2PA 3DFHA 1ISXA 2DG9A 3OLGA 5A1AA 1TV3A 3WQEA 3NZRA 4BK9A 2YA1A 4I9TA 2YCEA 3OGSA 4WK9A 3LHVA 5FJIA 4DWSA 2PF8A 5EKYA 5FJRA 3LM7A 3KBNA 3D3AA 1EBGA 2VN1A 3TA6A 3WCZA 4KEUA 3UYIA 1UWSA 4A3HA 3VD4A 2CLEA 2QIIA 2WCGA 2JIWA 3DU0A 3OZMA 1NFGA 5TNVA 1W2VA 2PGRA 3A4WA 3C61A 3P2VA 5BMWA 1TPVA 3MZ2A 1Q5MA 2Y0FA 2P0OA 1P4CA 4JY9A 3RCMA 1OX4A 1GPFA 2R91A 1BXBA 3QZ6A 2OG9A 3LQLA 4PGLA 4ZO7A 4YMZA 2WNQA 2WB5A 4QTGA 2CLMA 3FEQA 3BGAA 2REQA 2Y7GA 1V8EA 1UD5A 2B7NA 4NNRA 2IUZA 2D2JA 1Y8BA 3WO8A 1A3WA 2VKZG 3JS3A 5BOEA 5CLWA 2HRWA 2ZX8A 3WFZA 1BVZA 4IT1A 1L2UA 4NG3A 1WBJA 2X30A 1PCKA 3DYMA 1LG2A 3PAJA 3FCPA 1X7IA 1B6CA 4O4VA 4YHGA 5AKQA 3MP4A 4ZFMA 1OF8A 3Q58A 1HX0A 4LBSA 1TZ7A 5D30A 1D6OA 1TWSA 4GY1A 1UCWA 4JCLA 4OBTA 4GFIA 1ZUAX 5FEPA 1IIHA 5K4ZA 1JR1A 1LOLA 2XWDA 3IK8A 3EA3A 3GTYX 2DZTA 1JDDA 4AD2A 4AF0B 2J8FA 4H9TA 1C8QA 1SJCA 1F8IA 4QCEA 1A4MA 3VUSA 1UZ1A 5CEWA 2FFIA 3ISIX 3O2LA 3OW1A 3TYAA 3T0TA 3EWYA 2YL6A 4NVTA 1TKKA 5FIPA 2ZTJA 4GHRA 1EHAA 4TV5A 5I09A 1V3JA 2ISDA 3W7LA 3KEHA 5FJPA 1LF1A 1IGSA 4L80A 2VGFA 4FR1A 3TC3A 4S3CA 4HA3A 4AY1A 2YIHA 1G67A 3T0BA 4OE7A 3WDHA 2Q3RA 2AOSA 4Q4RA 3FXGA 4ODPA 3QMRA 1M04A 1SMAA 4J5NA 3UESA 1UBPC 4U33A 5EMJA 4Y2WA 4G7EA 4J7RA 5CZTA 3B04A 4N19A 3ARWA 4A35A 1RA0A 1CT5A 5SWUA 3KHDA 3FJ4A 4IGHA 2YFNA 3AIVA 3TAKA 2Z6IA 2WLZA 1EJXC 5F4SA 5AHIA 4YCOA 5CZSA 3R10A 3BE7A 4UTUA 1J12A 3UQIA 5I2UA 4G7EB 1PIFA 4PR4A 2I16A 1XYZA 4XISA 1Z48A 2CXGA 4IICA 2DZBA 2XVGA 4YYFA 2FQIA 4D71A 2AAMA 2C1HA 1QWGA 2V63A 1PBKA 3RR4A 3T07A 1KFBA 2GJRA 1W3HA 1X1OA 2JGQA 1W32A 2WMFA 1QNQA 3TNOA 4URIA 5DELA 4B15A 3W83A 5IDZA 3I3DA 1VCFA 2VVNA 1HL2A 4NY2A 3MBDA 1JI1A 2DFAA 2VCDA 3M5XA 3DIPA 1A47A 3PZNA 4P7NA 4W7VA 1DHPA 4WKHA 1FY6A 1SJAA 1R86A 3P67A 2WKLA 3BAYA 5K9XA 3W24A 1V0LA 4XZIA 4JQAA 5AVNA 3AIUA 4UR9A 2V8ZA 4HCDA 3JUGA 1TELA 3H21A 2C71A 4WGHA 2G3IA 1OB0A 1OM0A 4E4UA 3B0PA 4W7WA 1UROA 5EA9A 3WMLA 3LV5A 3R12A 1FKGA 1XKJA 3SB0A 1DEDA 4XZ9A 5BXPA 2PTXA 1YE6A 2ESCA 4O1EA 4QITA 3BICA 3NOEA 4BF9A 3S2NA 4G50A 2DUZA 4J4OA 3JZUA 1IWAA 3TDFA 4MNMA 1W8GA 4R27A 4OOUA 1R9HA 2CHRA 4PUKA 3F5LA 1HKMA 2DZXA 1JCXA 3FJLA 5M17A 4I7WA 4DRIA 3VOJA 4CD5A 2WMKA 4QT3A 4R7OA 1TJ1A 2XPAA 4UUIA 4NX0A 2YYUA 3F2DA 2KI3A 5E1QA 3GYCA 5IBXA 3GXTA 4YWIA 2WLYA 3KP1A 5AYBA 1XKYA 1FKTA 3U6WA 4CN1A 2CKRA 1S2CA 3LOTA 4M5PA 4WOZA 2ZQTA 3SIMA 4ZEPA 1OWQA 4NF7A 4PE8A 4FXRA 4UNIA 3LENA 1BVWA 3SCWA 5JIWA 4RE4A 3GNXA 3I6RA 1FKFA 3UWUA 2Q6ZA 3H2EA 4O17A 4GMEA 5G4HC 2QR6A 1SM9A 3VDHA 3V1PA 3DYPA 3M7SA 2FZNA 3NR0A 5DBTA 3OQ8A 2P88A 4PFHA 2W92A 2PDQA 4DRMA 2QAFA 3DFQA 2P8CA 3GHUA 4GXMA 4WSJA 1KW1A 2PWFA 1O5RA 1QU4A 2POTA 1M6JA 1OD0A 3GQYA 1TPC1 4O11A 3LU2A 4NILA 2OODA 3M6DA 2HV5A 4CEXC 3BMVA 1ALDA 3MCNA 2BASA 4S3BA 3HM7A 1NOWA 1L9WA 2WSKA 2A3AA 1OHLA 2A7RA 3EKLA 3W7PA 2F4EA 3OZPA 5XIAA 2YX0A 1O1HA 3PZGA 1D7HA 2WMJA 3V0SA 3DECA 4JFKA 3URAA 2DT1A 1GWJA 4KWUA 2NQJA 3SI9A 3T81A 4A6GA 1RBOB 2MLYA 2R9RA 2E8YA 1C29A 1Q45A 2A85A 1Q6GA 2HK1A 1EC9A 1KCXA 3G3DA 3UYCA 5D2YA 1RLDA 5U7SA 5LXEA 4HB7A 1W9XA 1POKA 4MDPA 3CAQA 4O13A 3VCRA 3T2PA 4ZR8A 1EA0A 4D72A 2JZVA 3OQEA 4CNNA 1DBTA 5A8OA 2IPJA 3CUFA 3Q94A 3TN5A 4O10A 1XLHA 5EMMA 4B2DD 3CIXA 1CENA 1UMLA 2I14A 3MSGA 2PGWA 2NQZA 2UZ9A 1EQ3A 3TXZA 1B2YA 2O56A 1J18A 1ECQA 4ERIA 4UB9A 2QCLA 2WVUA 1ODUA 3MUAA 2DY3A 4PRRA 4N4PA 1WOAA 1MUMA 3UZJA 3VMNA 1F3WA 4OFCA 2PGEA 4FAPA 2QEZA 4F8XA 2INZA 5AC5A 2W27A 1MYRA 1JRBA 2CLFA 5LIYX 5J8LA 2OWCA 4EAMA 2G3MA 3EB2A 4AW7A 3H26A 3N14A 3UW6A 3G1VA 1SO4A 3BL3A 1FWNA 1ZJAA 4YS1A 1QI0A 4GQBA 5FF0A 4IP5A 3KTSA 5EU9A 2ZUSA 4C1NB 3RX4A 4ZQRA 1LOQA 1Z44A 4QJ5B 3T8QA 2GJXA 3NSXA 5AHNA 1W54A 3BLDA 3LXAA 2VEIA 4AYGA 3G8EA 3NDYA 4WIWA 3V3WA 4LC6A 4JAWA 4CNUA 4Y9PA 1E4LA 2YB4A 1XIEA 2A5HA 2TSYA 4JFTA 1LT7A 4D6EA 1VFHA 3WLNA 3NZPA 1H0IA 3IIXA 2E6FA 3S6OA 4H3DA 4GQRA 5FF3A 4DI8A 2ZE0A 4WDWA 1RALA 6XIAA 4LYKA 2HMCA 4ODRA 1Z8AA 3B4YA 3S9IA 2MLZA 2YFOA 1N7KA 3IGXA 1MRQA 1IX5A 3KS5A 4EXAA 4F9JA 1SW3A 1E4MM 4RX0A 4XZWA 4JCMA 2AL2B 4F4RA 4NX5A 2WNWA 1QFEA 2ZICA 4K3ZA 2RFGA 2VZVA 2ISVA 3BCJA 1VEMA 2DZSA 2XZ9A 2ZRXA 1E43A 1N8WA 1YEYA 3PJUA 3N18A 3EEZA 4GZEA 1W3JA 1KGXA 1V02A 3LDVA 1HFBA 3V1HA 5H91A 3H2AA 3TTOA 4K1GA 1E40A 4DN1A 5AZ1A 2CIPA 1B31A 2RGLA 3L65A 4A22A 4W8AA 3T44A 1OCNA 3GVVA 4PTVA 4MUZA 1A53A 4QDPA 1X1ZA 2A3BA 1IWBA 1UIOA 2A3HA 3VNJA 1J6OA 2J88A 5JBFA 1KFJA 2PWDA 3JZEA 2XGBA 4W87A 1F3XA 3PZVA 4ZTXA 3U9IA 3UWEA 3E49A 3RU8X 2HS8A 1AL7A 4UTWC 4MWAC 4O19A 3HG2A 3TCSA 3ZR5A 1XYMA 3S6TA 3KDOA 3IVTA 1VD6A 5G2IA 3BURA 1T40A 3VZYA 1EGZA 2C18A 2XTKA 3W1TA 2A6LA 4BS0A 5PTDA 2OZTA 4US6A 5C9ZA 4A3RA 3VKJA 5D2WA 1O5QA 5M3WA 1OINA 3CUJA 1AA1B 4DF0A 4N9DA 4MWAB 3GNDA 4HHHA 2NVAA 3BCDA 4C6MA 2WYSA 4XIMA 4L72B 3QKEA 1YDYA 2XYLA 3OJGA 4L61A 1I0DA 2V68A 4KH2A 2ZQ0A 2ACSA 3PJTA 2PDBA 2PLJA 3TH6A 1ZLPA 1ZL1A 4R9OA 4MVAA 3V5OA 4JFUA 1ONWA 4GQQA 4XK2A 1Z32X 4R0XA 1BGAA 2BDQA 4WGXA 3SGUA 4JFWA 3AIRA 4FLRA 3LXBA 3DFSA 1N1AA 4DUWA 1VF8A 4XZHA 2W5FA 1QASA 1QPNA 2OOFA 2ACUA 2CCRA 2J62A 4CQAA 4W84A 4P8XA 3VC6A 4DROA 3K1GA 1LL7A 1QUMA 3CIWA 2PP0A 3CAKA 3LD5A 4L4OA 4H83A 2GK1A 3Q65A 4WQ6A 1XD0A 3ZWSA 1IEIA 4C6PA 5CH9A 4OUEA 3FYPA 3SURA 3U48A 2CKSA 2RSEA 2VX7A 2Z29A 2W6RA 2YDAA 2YZ5A 3A21A 2N87A 4ZZ9A 1QNRA 5IHRA 3GSMA 3GBDA 4TYOA 1NSJA 5FF7A 1K1DA 2RQSA 4O12A 5T26A 3KBWA 1KT1A 3I4EA 3GC4A 3N6JA 4LANA 3MQTA 4M0XA 3I7RA 2F7FA 3OVQA 4LYQA 1L6YA 2SFPA 1JNDA 2JEPA 3A23A 3W22A 3L2MA 4I90A 4NYUA 4DXKA 1IEQA 4IQEA 2O9RA 3QYSA 3TYUA 1DQWA 3O63A 1B3XA 2YB1A 3FJNA 1GTHA 4D6FA 1XHGA 3UXAA 3D47A 1GZJA 5CZJA 3TJLA 3G1XA 1REQA 3LTPA 3RR1A 4F48A 3EOUA 1E15A 1WXZA 2V2DA 4I9MA 4ENLA 3M5YA 3PC0A 3IJ9A 3RXZA 4Y9AA 1CGWA 1SYTA 3IARA 2CESA 3TMQA 1SSDA 5C7HA 4DZIA 4UTHA 1RD6A 4QE5A 1SZFA 1MMFA 5FJUA 2PDGA 3L2LA 1VGAA 4H7VA 1H11A 1HJVA 1U1UA 1AJ0A 4DY1A 4TX8A 3VPLA 4ZE4A 5M5DA 5BXSA 3NI6A 3O07A 4UIOA 1AK5A 1RH9A 1TPUA 4JN8A 1R6WA 3BMBA 4KMQA 5DIVA 3R43A 1XDMA 1BYBA 1JUEA 3BK0A 1TJ2A 1JDFA 1I75A 1QNPA 1FKDA 2QNEA 1OD8A 1KTNA 3NQMA 3T40A 3O5GA 5HMDA 1UR8A 4ZOEA 2KX9A 2EHHA 3R8RA 2EPHA 4EVZA 1CXEA 3FDKA 2JKEA 3GS6A 3U7VA 2VX5A 5HTGA 1LTDA 3OHMB 3F4CA 1P7TB 4I8YA 1IXQA 2JKPA 5A6TC 3S2MA 5EY5A 3EPOA 3MDWA 4RJEA 4I5XA 3SO7A 2EG8A 3VD9A 4W9QA 1TUXA 2NUXA 3U4FA 3F5JA 2PUZA 3RHGA 1W56A 3T0CA 3ARTA 2YXXA 3WNKA 1AW2A 3VAWA 3AYRA 1E72M 1XIFA 1OCJA 1TPEA 2WPGA 4ZB0A 3MJMA 2EBNA 3N17A 1M68A 1E3ZA 4GUJA 4POCA 4JTRA 2PMQA 2I5GA 4IX0A 3WEZA 4GACA 5JXQA 4UFHA 3LMYA 1M1BA 1PB0A 3TR9A 1NVMA 3LSBA 3OEXA 3AUOA 1MEWA 4ICCX 3APGA 3OGVA 2DUXA 3GU1A 1TQJA 3ORWA 2IKGA 2ZZ3A 1I2PA 3CPRA 4XSMA 4GGBA 2OFNA 1HKWA 1TREA 2C1GA 1BFNA 4F79A 4J4KA 3VDBA 3LA4A 3NWRA 1VBRA 3NO1A 1H62A 3MWCA 2VGBA 5EBUA 3P0WA 4ADTA 1V3MA 4XKMA 4QSFA 2Q5AA 2ANUA 3DI0A 1UOKA 4KIRA 2XVLA 1QOXA 3A4XA 1F4AA 1LP6A 5DMLA 1UUOA 3HMCA 3K8KA 2ABAA 5G1MA 1RJQA 1KR1A 4QCFA 4R85A 1UA7A 3C8NA 4L7ZA 4Y96A 2YA0A 1ZU8A 1ITQA 2P53A 1XF0A 2HS6A 3QR3A 2ZWZA 3VIMA 2J47A 4WXYA 3KADA 2AKMA 2BOFX 5FACA 1BRLB 2A4AA 3M0JA 3BOLA 3TYEA 5GNZA 4GI9A 2D9FA 4YCPA 2R94A 2M2AA 1E6RA 4DJDD 1QTWA 3NTYA 5LIXX 1DPMA 1PIIA 4JEQA 1H2JA 3KWSA 3TLQA 3WLLA 4KCWA 4M80A 3HG5A 4QP0A 4IL0A 3VGHA 2XIQA 3MUZ1 3W86A 2GLKA 3SADA 2G41A 1RCQA 2FVMA 3EWBX 5I23A 3HPZA 5AHFA 1H3GA 1JZ4A 3ZIZA 4H9YA 3VI2A 3NM3A 2VGIA 1EP1A 1R38A 5CGTA 1VEPA 1H7OA 4DWSD 1EUAA 5AOUA 1IR1A 3GC5A 4GVHA 3DERA 3FJ6A 1KXTA 2DIEA 3QW4B 4O57A 4HIBA 1PYFA 5FL0A 1KT0A 4WHBA 1W1B1 4IFOA 2E28A 1XLKA 3L67A 3L68A 4LX4A 2B5UB 1ZCOA 4GX9A 4ADSA 3IJQA 3EOSA 3VE9A 1NMWA 4XBKA 2NXIA 5HOSA 5LHEA 2C15A 2YW4A 4BHYA 3S9YA 2PI6A 1AJ2A 1KLZA 1OFDA 4OUIA 2ONEA 4JQ3A 2PDHA 5HXMA 1C90A 3S46A 1P6BA 1GT8A 3SCVA 3B97A 3MYOA 3ABXA 1GUVA 3N4FA 3W6YA 1O94A 4Q8OA 4M19A 2ITKA 1TWWA 1XRFA 3WUBA 1HIZA 2G96A 2VEPA 3ATZA 3ARVA 2VFEA 3WLOA 3W29A 2AKZA 3U2CA 5REQB 1ZGDA 4AEOA 4KWOA 4FNRA 5ECUA 4Y8FA 3ZJ8A 4FOKA 4JR5A 2VD9A 5HUOA 3S8HA 1QZ2A 3VE7A 2WM1A 2VHLA 3M0MA 3WH7A 3AMDA 2DH2A 2D3NA 2RUSA 1XLGA 2PDXA 4ZQNA 4FALA 1TUFA 1S5TA 5CSRA 2HWGA 4JIHA 5HATA 4WDUA 5HUAA 2XJ7A 4PSPA 3KCOA 1S46A 1QNOA 4B3ZA 3VCCA 5TAOA 1YTEA 3T4WA 1GHSA 3GR4A 1GZGA 1NIUA 1RVGA 2PRLA 2D2HA 4DAFA 1BQGA 1CYGA 3EWWA 1P1XA 2PLKA 4HOWA 5FKYA 1ISYA 2DSZA 4X3ZA 1L8PA 1JF6A 3AFBA 3N4EA 5F7UA 1R9ZA 3C2VA 1FX6A 1UR0A 4LAKA 3TN3A 1GOWA 4MNLA 1JCYA 3WQPA 4HA4A 2IS7A 1DE5A 4O8RA 4R33A 4FIRA 2DJLA 3WNLA 3ZO9A 2PWUA 5CJNA 5A6SA 1D3CA 1ECEA 1OEPA 1I6NA 2GWGA 3PZOA 4KETA 2RGMA 1Q6OA 2D1ZA 1XSIA 4W9OA 3B8SA 3RM4A 1S5MA 3BH4A 3TW6A 4DJEC 2GDQA 3GRIA 5HPOA 1FKJA 1W0MA 4G2DA 5C0QA 3MT1A 2O4MA 4FX6M 3ZFHA 4F9DA 3GW0A 4E3TA 4BF7A 3PRAA 1JNEA 2CBJA 2OKOA 2ETNA 1JNSA 3AXXA 4FOJA 2G3FA 1LBLA 4IUOA 3VTRA 1GOIA 5B8IC 1EYEA 4QE1A 1U33A 2FMNA 4UCFA 3EA1A 3O5QA 4US5D 3W1NA 8XIMA 3KL5A 1DJWA 4OT7A 2EKCA 1VIZA 4YU1A 3WQVA 3CH9A 1A5KC 3SCNA 3KAIA 3CASA 1MW3A 1UASA 1R9YA 3W73A 4LRSA 2I9UA 5F2LA 3MY9A 4CD7A 4AYSA 3HV9A 1OABA 3HU7A 4E0CA 3LCWA 3BOFA 3GH7A 2EQDA 1V08A 5MHBA 4G1NA 4MZYA 3A3HA 5BXRA 3RF9A 3HA1A 4MJ2A 5DMMA 4JICA 2D0FA 1FWSA 5G5IA 4BZYA 1TIWA 4XD4A 4F2UA 2F2KA 2TYSA 1FCBA 2X1RA 4JGDA 1SFTA 4JOMA 4NI8A 4W5UA 1EJVC 1K6WA 1WZLA 4KFPA 1WDQA 3VFLA 3EXSA 3SECA 2Y5JA 1B0IA 5D03A 2FPVA 4E4PA 4WJXA 5DT7A 4XZMX 3QXBA 3VNDA 3M46A 4AD4A 4GVFA 3AJXA 3VGBA 1LRQA 2ZXBA 2X8RA 2HNEA 4C90A 1LCOA 1JYWA 2Z1BA 1TR9A 4OKDA 3G6MA 4DT4A 2V81A 3E0FA 4HU8A 4DJDC 2QVHA 2G8ZA 3DBPA 1H5YA 5FJOA 4N4QA 4PCTA 4PYSA 1JAEA 1KM2A 1YTDA 5HW6A 4RE0A 3NIYA 4PUWA 4UOZA 1K7EA 4KIEA 1IZCA 5JIPA 4HP5A 3IVSA 4PMJA 1NFBA 5A6MA 3BLIA 2J27A 2H9AA 3QLLA 3CV2A 4BQ3A 2XDFA 1GYLA 3WH8A 1VYPX 1BLIA 1GG1A 2W67A 4S3AA 3AUJA 2INFA 1J0HA 4ZCWA 1MXGA 2Z1VA 4NASA 4LAWA 5B80A 1Q8JA 1OT2A 1DJHA 2RDXA 1FH7A 2QCHA 3UEQA 3K46A 5G2HA 4U85A 4IMEA 4RE2A 3M4HA 4BCEA 3BLLA 3DHDA 3OG2A 1ZJBA 3H4XA 3WNOA 1TJPA 3VFCA 3WQCA 4Y8EA 5CGQA 4O28A 1FCUA 5J5RA 5HR7A 3HQNA 4TW6A 4J3ZA 1CDGA 4O15A 2YCJA 3UD6A 1EHNA 1FFQA 1VIWA 1U1HA 3K1DA 1UD3A 3EY6A 3HGSA 2I9EA 3NSMA 1UZDA 3TYBA 3GIPA 4Q7NA 3CQ0A 3AICA 2R14A 3PANA 5A6KA 1F7BA 5EGRA 4QE4A 1XPGA 4BY3A 3QYQA 3B4UA 4AISA 1GJUA 5JMUA 1WBHA 2TPSA 2ZUUA 4J3TA 1WPCA 2DT0A 5C70A 3DDMA 1S5VA 3W85A 3ZJKA 4D6CA 1EX1A 4YTUA 1D7IA 3BMWA 4C5YA 3H23A 1FKSA 3OA5A 3H4GA 3OODA 3VKAA 4LFYA 4MNKA 4AZIA 4UCGA 1JRCA 4GI8A 1ZJHA 2VX4A 4U2ZA 1Q1CA 4QLKA 4R34A 4B4HA 5MF5A 3I7QA 3SCRA 3MMTA 1GRJA 4HPNA 1VP5A 4YJ5A 1BHGA 4HOZA 2NW0A 2FGBA 2FGZA 5FL1A 1K8CA 1RQHA 2X16A 5A8MA 5DCEA 1QW7A 1J2BA 4P8UA 3UWYA 2BNJA 1VLWA 3EDKA 3NPVA 1QRQA 4B5UA 4I8DA 2EULA 4UXDA 4QDMA 4ZO8A 4DIAA 3W02A 1T8QA 2XGZA 3PBWA 1ISWA 4FO4A 3R8HA 3B3DA 4GIRA 1F8AB 4DJFA 3EX4A 1XYCA 1H7RA 4ZSUA 3T2QA 3G6LA 2QVNA 2D3LA 2NZLA 3EWUA 5CC3A 5TBOA 4P8VA 5JU6A 4CN6A 1C7TA 3GK0A 2W66A 4Q8WA 1XQKA 3AHZA 1TPFA 2NLYA 5A94A 2R8WA 1NARA 4PMQA 2EPMX 5DN1A 2NSXA 3T55A 4AIBA 3VD5A 4C6QA 4NSBA 5AFDA 4O0QA 1RJPA 1FQ0A 1NP2A 3R5EA 3UR8A 4LU0A 4PMDA 4S3GA 5FESA 4F2TA 1H41A 4RZBA 3NQGA 3QPEA 3EOOA 4QR6A 3UT0A 2YDSA 1B57A 1EB3A 5T91A 3L7RA 1QO5A 3P7YA 5BRPA 2AL2A 1IEVA 4Q4MA 5DCBA 2DZAA 4JFVA 3S1XA 4REQB 4K37A 3S1VA 5TIMA 4OWGA 3NYDA 3CZJA 3R6IA 4XAYA 1PSCA 4GK8A 3WELA 3ZVHA 1D3HA 4BF5A 3ITLA 1W9UA 4G6CA 3VX0A 3E2QA 4H4IA 4Z42C 3MMWA 2E5DA 3ITGA 4BEUA 4TX6A 3B7XA 1UH2A 4RNIA 2PWEA 4JS3A 1TV7A 2NUWA 2YZRA 4O14A 4AUBA 6REQB 2ZA3A 3KRSA 1BKHA 3QTGA 4YWSA 1VFOA 4MB4A 2NWSA 1E55A 3KVJA 4NZCA 1JCLA 1V6UA 3O5RA 3CV1A 2DG4A 5FI8A 1NF7A 3WJSA 5EMUA 2XSXA 1I2OA 2HBXA 2J7FA 2X05A 3SR7A 3WQGA 3R11A 1RBLA 2GZXA 1ODZA 3LBOA 2UZ5A 4O54A 2E3ZA 5F1UA 5T8GA 2FJUB 5HQEA 4JFLA 4EK7A 2AGKA 3O6YX 4XQ6A 3WD4A 4EP8C 5C7VA 4PCNA 4U2YA 4LW7A 4PMRA 2YGYA 5DIUA 4H6QA 2Y62A 4E2VA 1CXKA 1UC4A 4XAPA 1XSKA 3FSTA 4M7SA 1YRRA 2VUNA 1YQ2A 1A5OC 1FP8A 5A2AA 1RBAA 3AU2A 4JYEA 5D2VA 2RDTA 1U2YA 3RO8A 3WLHA 5BOOA 4GCXA 1KRBC 3W2NA 3VIKA 4MPKA 4QIBA 2GJNA 4EACA 3FAXA 5H8UA 4LH8A 3V5FA 3IKGA 2QJHA 2XU2A 2PPPA 5IHSA 3UZXA 3CGTA 1YX1A 3WLTA 1SMDA 2VEKA 3LS9A 4DQWA 4PEKA 1DWIM 4ERAA 2CWNA 3M0YA 1F05A 2PD9A 1RPKA 5BWFA 4F0LA 3DGBA 1H7XA 4M56A 3O5DA 4CUCA 1AH3A 1E71M 2XSAA 4LVDA 4FS9A 4BI5A 1XBVA 4FX8A 3EXTA 2NXGA 1KKOA 3QZEA 4LS0A 3C0JA 1C9WA 3KRZA 5DXYA 5DXXA 2QGYA 1AQFA 2NVCA 1K9EA 3WQ5A 2WKJA 4PUEA 3OOBA 2HBVA 2JEQA 2GVLA 2QHAA 3GYEA 1JYVA 1TMQA 4GY0A 4N0RA 2HXTA 2DW7A 2BY1A 2J24A 2XGIA 1FVPA 2FB3A 2ZFAA 4KEMA 4L65A 1DWAM 3RNDA 1YNQA 3WLJA 5D9MA 2WMIB 2AQWA 1VFTA 5EYWA 1KTCA 3FA4A 1OZQA 1WXYA 4O8AA 3WD3A 5JQ9A 4C6CA 4PTNA 4HPGA 1E5NA 3TW9A 3LQGA 2J6XA 3CUHA 1KBBA 4Z1YA 1CTNA 5J6EA 2ZC8A 2E6DA 2HXUA 3IIZA 2D22A 4L4MA 4GCAA 1P7TA 3E0LA 4LRTA 1LROA 1LUCA 2FDSA 3B05A 1JZ5A 3QY6A 2GVGA 1EJUC 3ARYA 2EEXA 3WK1A 4GIAA 3PWGA 5DBUA 2DDXA 1ICPA 1ZHAA 2V3DA 2Q02A 2C0AA 1WUFA 5HWCA 8XIAA 3U2OA 4JIPA 3UG8A 3NL3A 4PUDA 3KLLA 4O1FA 1ROUA 1PBGA 4C5ZA 2YKKA 3LPGA 2I5QA 1HUVA 5D04C 4XTDA 1QT1A 5MKGB 1M5WA 3CM4A 4H9XA 6ENLA 1E51A 1GYNA 2OEJA 3GXPA 3E96A 1H4PA 4MYXA 4MGGA 4AC1X 3SIZA 1DHKA 2X2YA 4HNNA 3KVKA 3HV8A 2WPBA 1SW7A 4LUIA 1OFQA 1BQCA 1IEWA 1R46A 1AQ0A 1F74A 1KC7A 4HNLA 3WDQA 1V51A 2O9TA 5GNXA 2PPOA 4E2OA 2J13A 1EP2A 2D0GA 3HG4A 3CHVA 3KTCA 1Q6DA 2BVWA 1MRAA 3UCCA 1E4IA 1U5JA 2ISFA 3QN3A 4HMNA 4UOQA 4YNGA 2VRQA 3MUIA 1TR1A 1EPVA 4B91A 1GNXA 2BVYA 3OG3A 1UZ4A 4EOUA 1GQJA 3ZJ7A 3WX7A 3LYEA 2F6KA 3U3HA 8CGTA 1JDAA 1OJXA 3NDZA 4UTFA 3W7HA 4QROA 2E6AA 3CT7A 1SSGA 3POHA 4J3UA 3P93A 4MF4A 3SSJA 4NHVA 2JF7A 1W1A1 4HNTA 2PV3A 5M2FX 4E2BA 4PMVA 1FKIA 4ECLA 1JQXA 3PNZA 2C19A 1UP2A 3O6AA 4UTIA 1M5YA 3GVWA 1OFBA 2IPGA 2WNZA 4JFJA 2ZR5A 5HBFA 5LSMA 1K7XA 1Q6FA 3WMCA 2WQDA 4EXBA 4MUPA 2RAGA 3FIGA 2VURA 3ZWTA 3SUUA 2C6QA 2J66A 1TZ9A 3PSVA 1P0KA 2DT2A 4U3AA 3E9AA 1R7AA 5KTLA 1N55A 2CLKA 3CUGA 2GK1B 4EE9A 2FGLA 2OMAA 3TNBA 1JQVA 2J78A 3AZTA 5I06A 4LCQA 3BW3A 1ROTA 1FWHC 2E0PA 3KL0A 1J0YA 1IXPA 4HSOA 1RA5A 4AIEA 3TFCA 4QNWA 2ZUNA 3M0HA 2EKGA 2Z6JA 3C0QA 4JIRA 2Y63A 3LPFA 1XYBA 3R25A 3E74A 4JKMA 3T7VA 2X41A 3MS8A 3DESA 3G1SA 3RM8A 2CZDA 4KERA 4AEFA 2Z24A 1PZ1A 3WF2A 4OV4A 5BU6A 1HO4A 4C02B 2DUAA 5CJMA 2ZVRA 2BOGX 4HTYA 2NQHA 4J3VA 1H60A 3S47A 5A95A 5D38A 4JYFA 1RD5A 3C3NA 1QBBA 4WY0F 1U22A 1PXGA 4JIEA 3F7JA 2QCEA 1G4EA 3NFUA 1FBAA 2YDQA 5JBDA 2BFGA 2PDFA 4CNTA 4MWAA 4D6IA 2ZR6A 3N2CA 3B8TA 4C65A 1OSEA 4DJED 3NM1A 5DANA 1E1CA 5I03A 1KO0A 2Z4GA 3STFA 1A5MC 5M03A 4GJJA 3K5XA 1L1PA 1W3LA 3W7RA 1FAPA 1A3HA 2XP8A 3HQOA 3VXGA 2WJZA 3N2XA 3MUCA 1J79A 3UG3A 1C3FA 3XIMA 2H3DA 2J9XA 4GUFA 3VDCA 1JFXA 1PVNA 3GNOA 1S1RA 2QMKA 4JKLA 3KHJA 2OLSA 2V5CA 4AVNA 1KM1A 3CK5A 4DXXA 2QCDA 4U5IA 1QPFA 5CAKA 4H6EA 2KGJA 1Y5XA 2VELA 1ME7A 2PDWA 2WVSA 6XIMA 4UMBA 1R3WA 3G0UA 4A3QA 1ZAJA 3BZJA 3MMUA 3A12A 2ZA2A 5F1VA 3CHDA 1Y5WA 2VRKA 2R1LA 1Z9AA 1A4LA 3ZLFA 3QV9A 4V33A 1GKRA 1PKMA 1TPB1 5FJTA 2PWGA 4E38A 4EIVA 4E5TA 1A5NC 3FKRA 2O7QA 4TO8A 3L0GA 3CT2A 3WH5A 3APYA 3VMOA 2CNCA 2V5BA 1BEUA 4WY0B 4FIQA 5K7JA 3V4BA 2J9YA 2GGEA 3DX5A 4GVIA 3VAVA 4QHRA 4XAGA 1ZP4A 1ZQ5A 3KACA 3VIIA 5HULA 3SFKA 4RDVA 4NZ3A 4O50A 2Y85A 3PS7A 1KM6A 4UZUA 3V5CA 2RHGA 1XFCA 2E9MA 4KWWA 1ISZA 4CCCA 3PZUA 2CYGA 1P6WA 2F2DA 5C6MA 2WVVA 1HT6A 3TC6A 5G4WA 1OG0A 1EDGA 3DGRA 1LWIA 4C1NA 3M64A 3JVAA 4PFMA 1QI3A 2X2GA 2BY2A 1U79A 3DFPA 2XH4A 4N02A 2UY4A 5CCZA 4I7VA 6CGTA 4AAJA 3KL3A 3P80A 3QVQA 3LPPA 1U5VA 1UP0A 4M1BA 1R9XA 1PDYA 5FD0A 1Z69A 2QJIA 4ATLA 4ALDA 4LPCA 2MLXA 3AS1A 2VCBA 1DJZA 1X96A 7XIMA 3TOYA 3W2JA 1DXEA 5FCZA 1OZMA 1EGMA 2ZQSA 3UVIA 4LGXA 2BG5A 1SQ7A 4FLQA 2FDMA 4QLJA 5HQLA 1VLIA 1XLJA 1ZFJA 4IIDA 3KRUA 4PZVA 3GTXA 5DEZA 3KAHA 1JD7A 3O1NA 4R5EA 4MWAD 4YPJA 3STPA 2OGYA 4KQZA 3W1QA 2A3CA 3GG0A 5CBBA 4DM2A 1V77A 4WLCA 1AVAA 2QV5A 2V38A 5HMSA 2G4JA 4BF8A 2XFFA 5A8PA 4TW7A 3ABSA 3GVGA 4CQ9A 3H2MA 4OTKA 2CLIA 2CLOA 1ZB5A 4L6DA 3NVDA 5L9FA 3GH5A 4O1BA 2CC0A 2GGJA 3OB8A 3KBVA 5HJLA 4JN6A 1F6PA 4A3YA 4S3FA 4XZNX 2DQWA 4QS5A 4X0NA 4Q7IA 5I79A 5JUVA 1XYFA 1LRTA 3CLMA 4NAEB 1IQ8A 5I5RA 1TE6A 4DF2A 4DIPA 4D8AA 2AMXA 3UP8A 1ELSA 4N2YA 1AMYA 5H8PA 3E02A 1C9HA 1E6NA 3F03K 3KDNA 3TONA 2GVEA 3FN9A 1TQXA 3ZT5A 4PBFA 4WEVX 1XCFA 2PZ0A 1ML1A 3EOLA 3L4ZA 4NQ1A 1GGOA 4AMAA 1C7SA 2VZOA 2A2IA 2KR7A 2BB0A 4LS2A 1J8VA 2XP5A 3QV7A 2WBGA 4GA8A 3REQA 1JNTA 2K8IA 1U1JA 3FV9A 4S3JA 4AG0A 3LN3A 4PMYA 4LUYA 4JTAA 3VKDA 3NURA 1RP9A 3BG5A 2I57A 1GTEA 4FSAA 1VFSA 5FEWA 5E6YA 3WLMA 1PUDA 3OLIA 4C1KA 4MB3A 1K03A 2GSJA 2JK2A 3EKGA 3S5ZA 2WK2A 4W7UA 2H8ZA 4B5SA 3KX6A 4ZOBA 3CYJA 4F0SA 4ODMA 1P0EA 2HVMA 1CXFA 2BHZA 1LLWA 3HFYA 4NZ1A 4GQ0A 1KLYA 1RLCL 2WZHA 5IFPA 4HN4A 1MZRA 1NQ6A 2VUYA 5AC8A 3BLKA 1IF2A 2WMIA 4EPEC 1OBAA 1FKHA 1FWDC 1OFOA 4PODA 2FHBA 4RXGA 1G7VA 1ZBKA 1VBJA 2CPUA 2VOMA 1G9HA 2OB3A 2XFWA 3RYSA 4FN2A 1NELA 3GPKA 2Y2WA 2E7FA 4RW3A 5AVHA 4JNMA 3VNMA 3EPMA 1X8FA 1CECA 2BY0A 2PA6A 2J79A 2O7SA 3B9EA 4LUTA 4IM4A 4GABA 1ITCA 1PIGA 1DQXA 5EMLA 3ICJA 5FSDC 2FLIA 3WMBA 5LGXA 1J11A 3CAVA 2XH0A 4ACZA 1E6ZA 3BLEA 1AW1A 3LCHA 1PHQA 4UOJA 3R0DA 3TROA 3CC1A 3GIQA 1HG3A 3N25A 5KINA 3PPGA 1E0TA 2P8BA 2WSPA 4IPIA 4E3VA 2M1IA 2DJXA 4AHPA 1V6WA 4JZ5A 1E1EA 2FZBA 1EYMA 2FZ9A 4LUSA 3ARXA 3MVIA 4W9TA 3WY1A 3W2MA 4LJ3A 3SRDA 2JBMA 1EDTA 4JKKA 4PBEA 1H1YA 1PV8A 2PODA 3VO0A 4FXSA 1XLLA 1LWJA 4JX6A 3W00A 4AHQA 3ABQA 3QJAA 3OP2A 1GORA 1DJQA 1X1NA 1H5VA 4KFOA 2Y7EA 3KXQA 4RR4A 2OFJA 3RCNA 1T99A 1EJSC 3FVMA 2YDRA 4AZHA 2IQ0A 1OGGA 1EO5A 3UGVA 2NSOA 2OELA 4CD6A 3QSTA 1P1MA 1PJ9A 4WJEA 3N4AA 2VC7A 2GDVA 5A6BD 2EJAA 2PDCA 3GDBA 3M0KA 4WDTA 3MV11 4ZVJA 1KRMA 3LLXA 3OYZA 2X40A 1V3IA 3TTSA 3H2OA 3L4YA 3AI0A 5HNUA 1TRIA 2Z28A 2XFRA 3R7MA 2V5DA 4MWAE 3ANYA 3Q45A 1NDZA 1SPQA 1JFHA 2TODA 1MFUA 3ZR4A 2C3ZA 5I77A 1UWRA 4W85A 5TQLA 4QAWA 1TA3B 3IK2A 1W5MA 4H7CA 1SO6A 5C9XA 2HVOA 3NQAA 1RZMA 2VO5A 1HXVA 1EJWC 4BI7A 1H63A 3VU2A 4AX6A 3IGSA 3E3HA 3OZOA 1WZKA 3K4AA 3FSUA 1EJ7L 1US0A 4M6PA 2QCFA 4D6DA 3OBAA 1PWLA 4A21A 4V2XA 2X0HA 2MNRA 3B9NA 2J7BA 3UXKA 3PZTA 4NJIA 2FVKA 1EC8A 1EX5A 1JUBA 1LLZA 3THAA 4HGXA 2GGHA 5CPQA 3VGDA 4H8NA 1QW9A 4LVAA 2OZ3A 3S1WA 1F4HA 2CBUA 2WOQA 1B4KA 3BMXA 4TV6A 4P7QA 1AODA 3BTNA 2Y78A 2UV8G 3KVLA 4J9JA 1UBSA 3F1QA 4GY7A 3QMTA 3WJWA 4DAIA 4C6LA 4M3PA 3CZ8A 2WC4A 4UTJA 3BDKA 4IMFA 3HQPA 4HNUA 2NT1A 2FAPA 3S5NA 2Q8ZA 2F84A 4I3GA 3QQWA 3GO2A 3QV8A 3EWZA 4RZ4A 4XZLX 5A2BA 4NRSA 2I7GA 2ICSA 4KR0B 1E6PA 1CXIA 1GVEA 1F6KA 1UKTA 1ZTVA 4ZPWR 1WAUA 3IIOA 4JTJA 4Y6GA 3TN6A 7TAAA 3IV8A 4LB3A 3S42A 3IRDA 3S1UA 1DTUA 3KE0A 4AF0A 1QI4A 2ZBTA 4DZ5A 3N3TA 4PTMA 3NQEA 1LQ0A 2F61A 4D9PA 3TWBA 4IFRA 4QS6A 4B3KA 1TRDA 1L6WA 1MQRA 1ONRA 4X2PA 2G37A 3O5FA 1KBKA 4RNHA 1AD1A 2QUMA 3NCOA 2WMHA 2OO6A 3CYVA 3QM3A 3GU2A 1Y0EA 3GTFA 3ZT6A 3NQCA 2VQUA 1GOOA 4Z1DA 4EF8A 4FP1A 5A6BA 1ZBVA 3RK8A 3DFYA 3HO8A 3SGGA 5ABHA 3UG5A 2PDMA 1ICSA 3F4VA 1V6TA 3PTMA 3I7SA 3S2LA 3V75A 3UPBA 4GI6A 1GPWA 4AWTA 4RCXA 2Q8XA 4QJ1A 2O9OA 1XRTA 4QGCA 4CEUC 1K02A 2QCNA 2GL5A 2IMRA 1AFSA 2Z2UA 5IOBA 4CLMA 1WNOA 2V3FA 3W1LA 4KKXA 4JQ4A 4US5A 3B06A 1JPHA 1B5TA 3ES7A 1UD2A 3O7UA 4DYKA 1W1YA 4Q8PA 4M6UA 2YL5A 1OVDA 3IHZA 3P60A 5DY3A 1EIBA 4DZHA 3QC0A 3MYPA 1VRDA 1YDVA 3DFNA 2RUQA 1Q6HA 4IX2A 1XUUA 5H6HA 1VHNA 1GYMA 2Q09A 1HJQA 3JYMA 1YDOA 3AMLA 2A79A 5AC4A 3C6CA 2P3ZA 4L5ZA 1XD1A 4YL2A 5HMEA 2JALA 1EP3A 3MB9A 3W9ZA 2ZRUA 4CU7A 4G5DA 1RAKA 3PN8A 2V5KA 4IXXA 4ZXOA 1W37A 3CZLA 5LZLA 4QRNA 6ALDA 3FX4A 5MKGA 3CPGA 1TTPA 4PRTA 3GDRA 4WUIA 4KWVA 4IT6A 1PKLA 3VIHA 4DZ2A 4KRZA 4WJ8A 4GUHA 1WXJA 3BGJA 3DAQA 4I6VA 2EPNA 4F3HA 5FF2A 3UWZA 1NOFA 4F0HA 2FPYA 2P5NA 4UNKA 4UQ9A 3RJYA 4LUJA 1OYAA 4DNMA 3PRBA 1KQZA 3W84A 3RLGA 5CBIA 2CHOA 3AMGA 5RUBA 3CH0A 4FI4A 1UD8A 1N2VA 2H8XA 1MO0A 5I00A 3GG8A 3VNLA 1BG9A 1MXDA 4C7GA 4DO4A 3KAFA 5C9RA 4TR9A 3TSDA 1E9IA 2F2HA 1SFSA 2O0TA 1GW1A 5HT1A 1S2WA 3LGGA 1VBHA 5HA7A 4OJYA 4GZJA 4QT2A 1MEHA 3TU9A 4G1KA 1FWCC 1YDNA 4FNPA 2PRHA 3EAUA 3KM8A 1IT7A 3MU7A 1SJBA 2EO7A 3QHOA 1WX0A 1OC6A 1RK5A 4MB5A 2IPWA 4FNSA 3CEPA 4H04A 5IXEA 3CMJA 2V67A 3M7WA 1FKWA 3GG1A 1VJIA 3VOCA 2Y1HA 2DSKA 1BGGA 3F4WA 4DNHA 1J0JA 3PR2A 7REQA 2WBKA 4N9CA 1EFZA 3NRKA 1EPXA 3NZGA 4Q33A 5LIKX 1U30A 1M3UA 5A3HA 2P3EA 3C8FA 2D2GA 3TTYA 3PRDA 4UTTA 2LPVA 4UR7A 3HGOA 3AROA 2NQ9A 1SGJA 4QG6A 1AH4A 1YNYA 5JH1A 4N9EA 3G24A 3TX9A 2PC4A 2WJFA 2OX1A 4NT0A 1XLAA 4IF2A 4HPHA 1TPDA 1TVLA 4HYVA 1WKFA 3L5MA 5AYYA 3GNRA 3VD3A 3TYCA 4GZIA 1EXPA 4NJGA 1JG9A 3ME3A 2VXNA 5CPOA 1KXHA 5FF4A 5HK4A 1B3OA 4LXFA 4HK6A 1PDZA 4C7DA 3CNYA 1JCTA 1Q7ZA 4Y9OA 5CPLA 1YATA 3PFMA 4FMVA 3QV6A 5GJPA 3AZRA 4ICNA 3TZFA 4MIMA 3MKCA 1J6YA 1OK6A 2DSUA 1Q6IA 2R1PA 3ENLA 4HVXA 4MAVA 3G0XA 1B9ZA 4FPSA 4IHCA 4NJHA 2E1DA 1KFWA 3BXWA 1J4IA 4MM1A 1Q85A 4HN8A 4RNJA 1JPKA 2J25A 1R3RA 4JIQA 5EBAA 3TQVA 4HK7A 4MNJA 1W1VA 1UKQA 2WVVB 3UI5A 3GX9A 2F9RA 1QMLA 4PTDA 2HE8A 3W53A 2V3GA 3B9AA 2EGZA 2DGAA 3G1DA 1FXQA 1HJUA 4TVCA 2XH2A 4BEQA 4LCRA 2Y6ZA 4LVGA 1L8NA 3E6EA 1RVKA 4B16A 3E5PA 1TCDA 3BV7A 2ATMA 2WJEA 2BXYA 3PULA 2OU4A 5DO2A 3QPZA 2Z25A 3GDKA 3QW3A 3BOXA 4DELA 1FFRA 3PUGA 2ZZ1A 1JYXA 1KTBA 1OX6A 1Q3NA 1PS9A 2RDWA 3LHUA 2PZNA 3LM3A 1R87A 1JCJA 5HAOA 4R9XA 1TO3A 4PMOA 1OC5A 4FB7A 3B9OA 2ACRA 5HWMA 3IJ8A 3DG6A 1XIMA 4N6FA 5ABEA 2MANA 4IJCA 5M1TA 1XLFA 4FHAA 1EF3A 3FGCA 1F3EA 4ZBCA 3IJLA 4QIUA 2QKFA 1OFRA 1OQFA 4HQVA 4LV4A 3U5UA 4O16A 1GG0A 3W7IA 4AVFA 3QHNA 4GIEA 1MVYA 4LVFA 2WMGA 1GEQA 3QZAA 1XLMA 1JXKA 3V16A 1GK8A 2RJHA 2V82A 3RLHA 3N11A 3LSCA 3TYDA 2WZMA 3TAOA 1GVRA 4V28A 1C8XA 1NSGA 2D23A 3B03A 2ZUVA 2CBIA 1DL3A 4LBRA 4W4QA 2H90A 3KS6A 4B5TA 2FH8A 5CC6A 2JIEA 3N12A 5ABGA 4ODQA 1TV5A 5JBEA 4NNCA 1JGIA 4O53A 4RK8A 4IMCA 4IXHA 3OLDA 8RUCA 5D37A 1PKYA 2QMJA 3DZ1A 3DYOA 2RUCA 2Z1SA 4LAUA 4K2SA 3BSGA 4EWND 3KZSA 1TVPA 4ADUA 3UXIA 3RMEA 1J93A 3NO5A 4UTLA 2VVSA 1UJQA 2ZDSA 4Z0JA 4W89A 3MDUA 2ZVIA 2HCVA 1HVXA 1TG7A 4HJFA 3EB4A 2H3BA 4C60A 2OWWA 1Z41A 2OSWA 3TUUA 5TF0A 4PC8A 1RV8A 2FKEA 3CPUA 3OU8A 3TSMA 3GNPA 3N9RA 1G4SA 3B9DA 3DC8A 3IV3A 3AIQA 4KWSA 5D09A 2E5BA 3RGTA 4AZGA 2OEKA