1XRVA

Crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGPQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGQEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGKSFTLASSKTDVGAPVSGPGIPGQFTKEKGILAYYEICDFLQGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords signal processing protein
publication title Crystal Structure of the novel secretory signalling protein from Porcine (SPP-40) at 2.1A resolution.
rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2004-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1xrvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xrvA01
1MFUA 4D1JA 2YBTA 4W93A 4WF7A 3WH7A 2BNJA 3AZTA 2BXYA 4CGTA 3NUKA 5KEZA 1V6UA 3W38A 4W8AA 3WUEA 4B3LA 3N15A 4Z2IA 2ZXAA 5EFFA 3IAPA 4MPKA 4J3SA 1RD6A 1QNRA 1PX8A 5ABEA 1V03A 3GNPA 4U5KA 2D0HA 4JL1A 3QOMA 3AICA 4OJYA 1ZB5A 1TZ7A 3AOFA 3RIKA 5A2BA 5I79A 2OYMA 4OOZA 1V02E 2X8RA 5M3WA 1W1TA 4PMNA 1UWUA 3CZ8A 4LPCA 1HF6A 2JEQA 4CD8A 3TTQA 1WZKA 1XSIA 2PC8A 4UFIA 1QHZA 2W92A 4TVCA 3UETA 1CENA 3BAXA 4JFTA 2GSJA 2C7FA 5A2CA 3BLPX 2WZHA 3I3EA 4CCEA 2VT0A 3CHEA 2QPUA 1JD9A 2VX6A 1JZ3A 2BS9A 1D2KA 2FHFA 4RL3A 4X0NA 3L4TA 2GUYA 4LGXA 1JZ8A 1UZ1A 4EE9A 3OBAA 4YPJA 4P8VA 3II1A 5HXMA 3RJYA 5DO8A 3PZQA 1UD5A 4RE3A 1LG1A 2DSVA 2VMFA 3DYPA 2VNCA 3PZGA 1JYXA 2DGAA 2YL6A 1E4IA 4GPNA 5C71A 1CBGA 1C8YA 4BQ4A 1HT6A 2X1IA 3M6DA 4UOZA 5AY7A 3BC9A 1NP0A 3UEQA 2EPNA 5BXPA 1C93A 1EO7A 3RJXA 1JYWA 3O9NA 1NM9A 4AZCA 4U31A 1XD0A 4PTWA 3WD4A 4MDPA 1DWHM 5A1AA 2CETA 5A6BA 3VGDA 3F5JA 4MTVA 2WMJA 2WSPA 1JDDA 4UR9A 1TFVA 3WKZA 1LG2A 2YA0A 3WELA 4ACZA 3WDIA 3NDYA 1U33A 5JIWA 2Y8VA 3VD3A 4MNKA 1UQYA 2EQDA 3GBDA 3MKKA 4J7RA 1UWQA 4X9YA 1F4AA 3W4RA 4P8WA 3NIYA 3KE0A 4UFKA 5M5DA 3PN8A 1OM0A 4Z2GA 2BHZA 4M1RA 1FA2A 2XFYA 1HKJA 2WC3A 4DM2A 2CXGA 4KRTA 3ZJ6A 2VX5A 4JFWA 5CG0A 4W7UA 1W9VA 4PTVA 4CN4A 2XSAA 2EJ1A 2JF7A 1WP6A 4XV0A 4BF7A 1WB0A 2CIPA 2ZXDA 3ARXA 3OZPA 1XH1A 4W7VA 4TVDA 3VOCA 1H3GA 2OLHA 4AZCB 4P7QA 5LA1A 3W28A 1E6NA 3VGHA 3ZJ7A 2ZX8A 2YL9A 3MV01 1CTNA 2WMIA 3K1DA 1CGWA 4NRRA 1IZKA 2E4TA 4H41A 1V0NA 1I1XA 4ACZB 5KZ6A 1J0ZA 3KL5A 4HA3A 1CGVA 3VM7A 1GOQA 1EO5A 1PX4A 2BY2A 5JUVA 1EQPA 4CD7A 1DWAM 3NDZA 1H09A 1ZS2A 2WYSA 4WJXA 1JFXA 1NH6A 1XHGA 3A4WA 3GNOA 3WQ4A 4P7RA 5C8BB 1AQMA 4B3KA 4B15A 3WUGA 5LA0A 1CXIA 1JG9A 2J78A 4OBSA 4CUCA 2EPLX 3M07A 2WCSA 2VX4A 2CITA 3SCWA 4AD2A 1OD8A 3WSUA 3OIHA 2OSWA 1CNVA 3DECA 3J7HA 5DMYA 2WCGA 1D3CA 4W5UA 1GQKA 4AIEA 3NSXA 1G9HA 2E0PA 1JGIA 2C0HA 4HZ7A 2WHLA 2WB5A 2WMIB 3PBGA 4P7LA 3CPUA 3AHYA 2AMGA 3QGVA 1QHOA 2O9TA 1BTCA 3EBVA 4ZFMA 1ISWA 3OG2A 2EEXA 1WZLA 1TR1A 4MB1A 1J01A 3GXMA 1SMDA 4D6HA 2X0HA 3W29A 4EAMA 3AROA 3SIMA 5I24A 4GI8A 1ITXA 1MXGA 2D1ZA 4ATWA 1NARA 3FW6A 1BFNA 2GDUA 1K9TA 4W86A 3RM4A 1QW9A 1XYFA 1JXKA 4E8CA 1AVAA 3S2CA 4C7DA 3VD4A 3A6OA 2J62A 5A8QA 2UY4A 1EGZA 1RP9A 3GTNA 3UCQA 3AXXA 1HL9A 1CXLA 3AS2A 1MVYA 2VZUA 7A3HA 8CGTA 1KWKA 4R27A 3BXWA 4BQ3A 3AMDA 2J7FA 3WBAA 1W9PA 3BAJA 2W61A 5I3DA 1H0IA 1LWHA 2BHYA 2ZUWA 4MB3A 3SCSA 3EDKA 1KXHA 2D2OA 1EOMA 3WMSA 1W9DM 3AQUA 5CSYA 5GNYA 3MUY1 3QHNA 3CUIA 2XFFA 4PTMA 1DWFM 1M04A 1DWJM 4OKDA 4H04A 3ARYA 1Y7VA 4CD4A 3AYSA 4F8XA 4CU7A 1TCMA 3WH5A 1UR9A 4IPNB 1UD6A 3D3AA 2HISA 1ZBWA 3SUSA 2FHBA 2FH8A 2W4XA 4WKHA 1BYBA 4MB5A 4TX6A 2BVYA 4J3WA 5GNXA 1JI1A 4P8XA 2ZXQA 3WNLA 2WLYA 3CUHA 4KMQA 5D9MA 5CJ5A 1DTUA 3MO4A 2PWEA 4ZXLA 4UCFA 3SCQA 8A3HA 2D20A 1JAEA 3VILA 5ABGA 1UKQA 3VIHA 1E4MM 4JKLA 3VNYA 5F7UA 2QHAA 1J0JA 1V6YA 1NP2A 4J28A 1W9UA 1R87A 1K9EA 2DT3A 1KCKA 1C7TA 3N13A 4PUEA 1W3HA 1SYTA 3BCFA 4PMUA 1EQCA 4ZXOA 1JD7A 2XVLA 1PIGA 4W87A 3GYCA 3KZSA 4JFUA 2VCAA 3PHAA 4UZUA 4EK7A 1CWYA 4GZJA 1CECA 3FN9A 4FMVA 2F61A 3N11A 3D5HA 3ZM8A 3EMCA 3W81A 4M80A 3AIEA 1FH8A 2WVSA 2Y24A 1WDRA 4W88A 2CYGA 3UR8A 3RM9A 4HTYA 2WVTA 4M29A 2EXOA 1PIFA 1MYRA 2NT1A 4W85A 4ZENA 1VBRA 4NZCA 1Z32X 4U5IA 2NT0A 2ZE0A 1CYGA 2VX7A 3MMDA 3MMUA 1BYAA 1V3IA 5A94A 4ZE5A 1E6ZA 4U2ZA 3WMCA 1QI5A 2Y2WA 2ESCA 4Q22A 3JUGA 2G3NA 2DH2A 3HMCA 3TTOA 3PZTA 1CGXA 3VVGA 4NF7A 2J75A 3WEMA 3DHPA 3EYPA 3MV11 1B3XA 3OGVA 1C92A 2WC4A 2WKLA 2RGMA 1ZL1A 3ZMRA 3S6TA 1OIFA 4PMQA 2WC7A 3W26A 1BGGA 5IDIA 2FHCA 3MS8A 3GXDA 4CVWA 1UR4A 1C8XA 4WSJA 3ZT6A 1MFVA 2B31A 3VIFA 1ITCA 3VIPA 3ARQA 1ZBCA 4P8UA 1R7OA 1U30A 2WWDA 2VZVA 3PZIA 5IHRA 3VDBA 2Y4SA 4KGJA 2X09A 3AFBA 3PZVA 4JFVA 4LYPA 1G5AA 2E3ZA 5CSUA 1B3YA 5EFDA 4TOQA 4DWSA 1Q6DA 1P6WA 4D71A 1ZBVA 1RH9A 4AD0A 1ZJAA 1EA9C 2C8NA 1HKMA 1JFHA 3ZT5A 3VO0A 3ZT7A 3PTMA 5M17A 3TOPA 4KWUA 4UQ9A 4W7WA 3WQ6A 5A6LA 1OWQA 4BQ5A 3BAYA 1GNXA 1PEZA 5A6BD 4L4OA 3DHUA 1VRXA 1IZJA 4M56A 3K4AA 1CLVA 1E43A 1J12A 3CMJA 3TTSA 4PMZA 3G6MA 5DF0A 4PRWA 4Y7EA 2A3CA 3FXYA 4XUYA 1TUXA 4PMRA 3EDEA 4UTFA 2J79A 3BAKA 2O9RA 1AQ0A 4JAWA 5HPOA 1I1WA 2XVPA 1CEOA 1XH0A 3CHFA 2UY3A 4ACYA 3VIGA 2YLLA 3LPGA 1US2A 1QBBA 1MXDA 2XM2A 5E0FA 3ZR5A 1W1PA 3G6LA 3K4DA 3FAXA 2Y5EA 4NSBA 2XWDA 2WAGA 1IV8A 2WHMA 5I5RA 4DWSB 3MSGA 5HOSA 4GIAA 3WDHA 3HN3A 4H8UA 2GJRA 1ISYA 2JIWA 3SCUA 1G1YA 4AD4A 2WVVA 1QI0A 1KBBA 4JHOA 4AW7A 4UNIA 4PN2A 1B0IA 5GQBA 3M46A 4D6GA 1K6AA 3WD2A 5CXPA 4M81A 2WANA 1BPLB 4W89A 5BYWA 2XWEA 2XVKA 3BCDA 4PSRA 2DSWA 2X0YA 3OLIA 2WKGA 2WBKA 1CGUA 1CIUA 2YJQA 2O92A 1WDPA 3BH4A 4OZOA 1ESWA 3GH7A 3ALGA 1CGYA 3VD7A 2WHJA 5DEZA 2ZUSA 3WQWA 3M7SA 3WL1A 3W37A 4IPLA 1WPCA 5E9AA 3WDRA 4EKJA 4J27A 4MB4A 1ISXA 3T09A 4GI6A 3AHVA 1I75A 4AZ6A 3ARSA 4ML4A 4AEFA 5BXSA 2E40A 1OD0A 1E0WA 1OIMA 1JNDA 5ABHA 1VFUA 4U33A 1V08A 1UKTA 2DSZA 1U2YA 3IK2A 1EDTA 1VFMA 1VJSA 2G41A 1CXEA 2YDRA 3T08A 3ARWA 4FLOA 1GPFA 4A3HA 1NWTA 2XVGA 1NWUA 4TXEA 1XYZA 2YOCA 4N42A 3B8SA 2WWCA 2YBUA 3SUUA 2X2YA 4TTUA 2WVVB 5IXEA 2JF6A 1SR0A 3MUAA 3AMLA 3RO8A 3TP4A 1Q6GA 5IHSA 4GQQA 4CVUA 3AIUA 1C7SA 1CLXA 4AZ5A 1B2YA 2DT2A 2UY2A 4PMOA 4F66A 3L2LA 4HMCA 3I3DA 5C70A 4HOXA 4IISA 1GQIA 2UY5A 2A3AA 2VTFA 2J47A 2XUCA 2F8QA 1JYVA 2FH6A 3GM8A 1H1NA 1XCXA 2WHKA 3VGGA 1J10A 2WM0A 2BHUA 1JZ7A 1UH4A 3FAWA 3ZJ8A 5JBFA 4UOJA 3WEOA 3VKKA 3CUJA 1US3A 4U3CA 4J3VA 2GK1B 3WNMA 4F9DA 3N18A 2PWDA 3SCNA 2XSBA 4V28A 4ATDA 5BCAA 4GI9A 1GJUA 2RGLA 3CH9A 1EOKA 3QR3A 3O2LA 2J7GA 2XJ7A 4CCDA 3WY1A 3ZR6A 1X1NA 2D0FA 2D3NA 4W5ZA 2Q8XA 4AIOA 1UR2A 1UWRA 1X6LA 1GVIA 3BAWA 4ZEPA 2ZICA 1E6PA 1JL8A 2OYLA 2ZUTA 2ZX5A 4Z2LA 3U57A 3DYOA 4FLRA 1QHPA 4H2CA 3CZJA 2NSXA 4JL2A 5AC4A 2EO7A 5BRQA 1QI3A 1E55A 4A4AA 3ECQA 1GOMA 4NI3A 2VZTA 3WF2A 2IXUA 5I0DA 4K68A 1JNEA 5CGTA 3OLDA 9CGTA 1UOKA 2J7HA 1KQYA 2BY0A 4MNMA 3U7BA 1O6IA 4GO8A 4M8UA 4CU6A 1M53A 1QOXA 3WL0A 1BVNP 1MQQA 1EIBA 4AC1X 1SFSA 4D6IA 3WF3A 4AZBA 3VM5A 1E4NA 3SCOA 4GZIA 3MUZ1 5FL1A 4MDOA 4X0VA 4KGLA 2VJXA 1E71M 3VPLA 1G94A 3GXFA 3K8MA 2CKRA 1JIBA 1E1FA 3CZEA 3CHDA 1UYQA 1BLIA 1R7AA 3WF1A 1DHKA 5A6JA 3UESA 3VDAA 1LWJA 3CO4A 3VIJA 1DWGM 3VIKA 3AYRA 4D6DA 3W6MA 4W8LA 3EMQA 4JIEA 2VRJA 4J3XA 1FHLA 3AZRA 1Q6CA 2VOTA 2VZSA 3ZSSA 4AZIA 3RDKA 5ABFB 3CMGA 3CHCA 3EDFA 2YDSA 3N17A 4E4PA 3U5YA 1UWIA 2ZIDA 2F2HA 1UKSA 3AXIA 4HPGA 3CUGA 5M03A 1FH7A 1WDQA 2WK2A 3ARRA 4UQCA 1XSJA 2WPGA 3AZSA 3OZOA 3PTKA 3POHA 4LYRA 2ZOXA 3SCTA 1NQ6A 1PPIA 1XCWA 2J8FA 3WUFA 3WEZA 3GDBA 1QBAA 2OSYA 2PBOA 1OBAA 2CBIA 1PAMA 3BSGA 1QW8A 1QI2A 6CGTA 1E5NA 5HNNA 2G8ZA 2VRKA 3L4VA 1Q6EA 3OLGA 3THCA 2V5DA 2DIEA 5CLWA 1GW1A 3LMYA 3CZLA 7TAAA 2BXZA 1OB0A 2E9BA 1KCLA 4BS0A 1E56A 5FKYA 3ZJKA 4PCSA 4JCLA 2O9PA 3UR7A 1E15A 1FFRA 2XGIA 1KXQA 2YL5A 3ZQ9A 4UFHA 4HZ8A 2XG9A 4GZEA 2WMHA 2WSKA 3LPPA 4QCFA 1MW3A 3ARVA 5CLTA 4YHEA 3ALFA 1WDSA 7CGTA 1HP5A 4FLQA 2PI6A 3FHAA 1E40A 2A3HA 3IAQA 2ZX7A 3T0BA 2VVNA 4PMXA 3SEPA 1NWRA 1KR0A 3CZGA 2E9MA 1GHSA 4DUWA 3PZMA 1JZ2A 3SCVA 4EANA 4NRSA 1BYDA 1E4LA 2ZUUA 1EDQA 3RMEA 4DWSD 2EPOA 4GXPA 1UG6A 2VL4A 2Y8KA 3L4YA 5CGMA 1ZJBA 2FGLA 4CD6A 3APGA 3N1AA 4MNLA 2MANA 2YIHA 2YL8A 4E2OA 4H8VA 1W3JA 2VURA 1M01A 3VIMA 2JFEX 2WXDM 2GVYA 4HOZA 5A8OA 2W63A 4HA1A 4WSKA 1H49A 1V0KA 1OT2A 2VCBA 4Z2HA 3VUPA 2W62A 4HU8A 4HU0A 1OINA 2WZIA 1B9ZA 5A3HA 2UWFA 5AYBA 3VGFA 4WK9A 1EDGA 5A6AA 5A2AA 1BF2A 3RPMA 3WDPP 2QMJA 3VINA 1UWSA 3L4UA 3F5LA 1GJWA 3VX1A 3T2QA 1KR1A 1CXHA 1E6XM 2BVDA 1HKIA 1C90A 5E6YA 4IM4A 4HZ6A 5DFAA 4H8HA 2W67A 1BG4A 1JZ4A 3L4WA 1XH2A 2YA2A 5EBAA 1X6NA 4S3JA 1F4HA 3WFLA 3FY1A 3QOKA 2BFGA 2DQXA 4TUFA 2CNCA 3MSDA 3IJ7A 4GINA 1E6RA 1HJWA 4DUVA 6TAAA 1M7XA 1E3XA 2WMKA 1FFQA 1GOOA 3DYMA 2ZUVA 3KEHA 1R8LA 1G01A 2O9OA 1WNOA 5A8MA 4HA4A 4MAZA 2V5CA 4J3TA 1CPUA 1HVQA 4B9YA 3THDA 1PBGA 4PSPA 4D6EA 3EDJA 2QMKA 3F4VA 4FK9A 2V3EA 3UG4A 5A6SA 1UKPA 3WNPA 4ZE4A 4V2XA 4L4PA 1FH9A 4CU8A 3A4AA 3AHXA 1MWOA 2WMFA 4KRUA 3ZOAA 1HKKA 3F5KA 2WCAA 2ZXBA 2CBVA 1AMYA 3VTRA 3MMWA 4XB3A 2NW0A 2XTKA 1XSKA 5E09A 1UD4A 2W66A 5EB8A 4AY1A 4BZYA 3AHTA 1E3ZA 4A3YA 1QPKA 1WO2A 1HJVA 1B3WA 1OT1A 1UR1A 2G3JA 3IJ8A 1GQJA 4HPHA 2DH3A 1B30A 4CD5A 1NOUA 1OCQA 1VEOA 3W53A 1TE1A 1XV8A 1V6XA 1XRVA 3VMPA 4ATLA 5JH8A 3E1F1 3L4XA 1OGBA 3WD3A 3WD0A 3L2MA 4M24A 1CGTA 1HNYA 2Z1KA 1H5VA 4QDMA 2V3FA 1MW1A 4AISA 4B9ZA 1JDAA 3HJEA 4AIUA 1UWTA 4Z2KA 1DWIM 5FIPA 1KXVA 1LL4A 2J8GA 3WNOA 3A47A 2DPEA 2IUZA 5A69A 2FGZA 4LXFA 1QI4A 3OLEA 1KWGA 4F9JA 1W2VA 1QNQA 3AI0A 1E9LA 1GQLA 1UZ4A 2JEPA 2ZWYA 5I77A 4BQ2A 3CTTA 1MW0A 3AIQA 1V3JA 1HXJA 5E0CA 1K9DA 1K9FA 1UD3A 4PMYA 4UZSA 4HMDA 4BA0A 1TVNA 5A6KA 3FHQA 4D1IA 1HN1A 3VDCA 5A95A 3QHMA 1MW2A 2J7EA 1W32A 3MANA 1N82A 2XVNA 5BWFA 3AMCA 2CPUA 3VNZA 5TD4A 1A3HA 1BHGA 4PYSA 2D0GA 3K46A 2QV4A 1OSEA 4OUEA 2OYKA 3WF0A 3UG5A 1E70M 1E6SM 5JBEA 5E70A 1KB3A 3W27A 1LJYA 2DIJA 1KQZA 4PMDA 2WMGA 4UQEA 2BVTA 4KH2A 1E72M 1VFOA 2DSKA 4D6FA 1LL6A 3WENA 2XIBA 5I23A 3AS1A 3GH5A 2VUYA 4DWSC 3SUWA 1V6WA 3VMNA 4AXNA 5FD0A 2OWWA 5IFPA 1HJQA 2XM1A 4AZ7A 4E8DA 1JZ5A 3WN6A 5HDRA 3VDHA 2G3IA 1HJUA 1H0GA 2GK1A 4D6JA 1VFFA 1GVYA 3RCNA 5D9NA 3TONA 2PBGA 2YDQA 3U5UA 4HMEA 2J7DA 1BGAA 3BMVA 5HPCA 2XPKA 4IUGA 3TTYA 2TAAA 1A47A 4C7GA 2EBNA 2JIEA 3CGTA 3GBEA 5HBFA 3B9EA 2AAAA 1B3ZA 3AIBA 4W8BA 1J0YA 3SCPA 5FL0A 3UERA 1XGZA 3CBWA 1W3KA 4M82A 1EHNA 5LA2A 3UG3A 1KGXA 2VQUA 1KBKA 2XIIA 4DUXA 1FP9A 2E9LA 1G0CA 2J7BA 3VD9A 1GUVA 1C91A 2VO5A 5D8ZA 3GH4A 3W24A 4DM1A 5I6SA 1NOWA 1GHRA 4BCEA 3T2OA 1DP0A 2WLZA 4FLSA 4QLLA 5IFTA 2WZEA 5A6MA 2XYLA 2ZWZA 2GFTA 5AYIA 3VU2A 5DT5A 2GJXA 5E6ZA 3DC0A 4JHZA 5CQ1A 3WBEA 2CBJA 4XZBA 1FP8A 1UUQA 2FDMA 3BGAA 4RE2A 4URIA 2D23A 5DT7A 4PCTA 3WQVA 3WH9A 2GJPA 1HX0A 4MJ4A 4JFSA 5BROA 3WNKA 4WKAA 1PZ2A 3GXIA 4OBRA 1VF8A 1JI2A 1ZBKA 1H2JA 4MAVA 1V0LA 2VR4A 1KXTA 2BY1A 3NCOA 5BXRA 4OIFA 4PMVA 4WLCA 5ABFA 3PZOA 2W5FA 1RP8A 5D8WA 1KFWA 1TMQA 4OOUA 2CERA 4AD1A 2D3LA 1BQCA 4UFMA 1L0PA 4H7VA 5D4YA 3GZAA 3T0AA 2DT1A 2GJXB 3I3BA 1JF5A 3CUFA 4QLKA 4UOQA 2GDVA 2A3BA 1HL8A 4P7NA 5LYRA 1E0VA 2VVSA 3AMGA 3BLKA 2ZX6A 2Z1SA 3AJ7A 3FNDA 3WMBA 3NSNA 1Q6FA 1PZ3A 1WCGA 5I2UA 1EH9A 4UFLA 1OGGA 1VENA 5I78A 3VGEA 4AZGA 1CXFA 1V3KA 1E6QM 3VX0A 3ARZA 1WE5A 4AD5A 4TVUA 2CCRA 2D24A 4AZHA 1VB9A 3WD1A 1PX3A 1HJSA 1YHTA 3ZSTA 4WIWA 1TG7A 1H41A 1J11A 1QNSA 1YQ2A 2VQTA 3VIOA 3VD5A 1VEMA 3AISA 3NYDA 3OA5A 3ARPA 1W9BM 1J18A 2PWHA 3MU7A 5BRPA 1FOBA 1KGUA 3SUTA 3K8KA 1S46A 3ARUA 1JXJA 5CPSA 1JDCA 1TA3A 2CBUA 3HU7A 3ZIZA 1HVXA 4MADA 4CKQA 4QP0A 1B1YA 1M03A 5A8PA 4U2YA 4JKMA 5D9OA 1GOIA 3WIJA 3VIIA 4JKKA 3B9AA 1NWSA 3O6AA 1WZAA 4XZWA 4WKFA 1LQ0A 1JAKA 3MUIA 4AEEA 2V3DA 4S3KA 4UQBA 3AS0A 3RM8A 1C3FA 3QHOA 2A3EA 2WW5A 3WQ5A 2E8ZA 1GOKA 3N04A 2DEPA 1MQRA 4F79A 4GO9A 2IXVA 3NSMA 2PWFA 3OB8A 1V6VA 3AXHA 4XX6A 1RPKA 1J0HA 1E73M 5A8NA 2CEQA 3BMWA 1JF6A 3KWXA 2WBGA 3POCA 4MJ2A 4AD3A 1B31A 4MNJA 1QNOA 2BY3A 1GORA 3VMOA 5AC5A 1JZ6A 4YHGA 3EMZA 1WZMA 1W1YA 2W91A 5FOOA 4LX4A 1V3LA 3OGSA 1TA3B 3U7VA 4P7OA 1WKYA 5FCZA 2XHYA 1ZU8A 3W25A 4U3AA 3OGRA 3T0DA 3PZ9A 1ODZA 2VC9A 2DT0A 4QFUA 3NJ3A 2PB1A 2YKKA 2J4GA 2E8YA 1DEDA 1VAHA 1VBUA 2VZOA 3GNRA 3IJ9A 4B16A 1H4PA 1UKOA 2J25A 4RE4A 5CZKA 4UQDA 4Z2JA 1W9XA 2G4FA 2PF0A 1J0IA 3WNNA 1EHAA 2CHOA 2EPMX 3AS3A 1Q4NX 3WDQA 2XFRA 1TVPA 2QF8A 2DDXA 5BXTA 1IT0A 1GZJA 3PZNA 1UR0A 2VR5A 5GPRA 1V0MA 3SCRA 1UA7A 4GQRA 4AWEA 4AYSA 3WQ8A 3AMKA 1UR8A 2YA1A 1OGSA 1V3HA 1W91A 3T2PA 1WAWA 4QAWA 2J74A 1PJ9A 1AQHA 1ISZA 1UD2A 1EXPA 1B90A 1LF1A 1BVZA 4QLJA 5JIPA 4GKLA 1JYNA 1UH2A 1W2PA 3WH8A 2D22A 4W84A 3RILA 2DSUA 2WNWA 1HP4A 3WH6A 1R86A 1XC6A 4JZ5A 5D9PA 4QCEA 4TTGA 2OWXA 3W6LA 3BAIA 1BYCA 1UH3A 3VGBA 1LLOA 1UHVA 1J0KA 2QLYA 3WUBA 1KGWA 1O7AA 4TX8A 3SURA 1CZ1A 4HOWA 4PTXA 2J7CA 1W3LA 1J9YA 2CHNA 6A3HA 2BV9A 2WVUA 3W82A 3ARTA 3A3HA 1VEPA 2CKSA 3AIVA 2V3GA 3LPOA 1E1EA 1UQZA 4CN1A 4AMCA 5GNZA 2ZX9A 3B9DA 4UFJA 3AHZA 4PUDA 1ISVA 2X05A 2VCCA 1QNPA 4LQ1A 1C8QA 1GONA 5JBDA 2EPKX 3WDJA 1XD1A 1V02A 2PWGA 1CXKA 1VJZA 2XGBA 1V3MA 1W1VA 3KL3A 2JE8A 4JCMA 1HJXA 1FHDA 3CIVA 4FF5A 1ECEA 5CPTA 4UQAA 1VIWA 2HVMA 4YN5A 1BSIA 3SUVA 2JALA 3TA9A 3N9KA 1B3VA 1D7FA 4D72A 3AIRA 1CDGA 3BSHA 5ECUA 3L4ZA 1LL7A 4LYQA 4PBGA 5CPQA 2J77A 3WFZA 1ODUA 1R85A 2ZUNA 1BAGA 3AIWA 3KL0A 1MQPA 3LPFA 2V38A 3W0KA 2ZUMA 4N0RA 1E0XA 2CESA 5EMYA 3N12A 3ZO9A 2AOSA 1L8NA 1NOFA 1SMAA 2OSXA 3CZKA 3PTQA 4J3UA 2OWCA 4CN6A 3A4XA 1GCYA 4V27A 4CCCA 3K8LA 3IANA 3WF4A 2VI0A 4Q7NA 2G3MA 4HP5A 1GOWA 1E5JA 1H11A 1UA3A 4D6CA 4R5EA 1UD8A 2QPSA 3PZUA 1QVBA 1HIZA 4C7FA 4PEEA 2YLAA 1BG9A 2VRQA 3CLWA 3EDDA
chains in the Genus database with same CATH superfamily
5DN1A 1RBAA 4W93A 4WF7A 2PF8A 3AWNA 2BNJA 2BXYA 3NUKA 1V6UA 3W38A 4W8AA 4B3LA 2XFWA 4Q8UA 4V33A 1UBPC 3SGGA 2INZA 1GK8A 4MPKA 3IAPA 3BJFA 4J3SA 2YW4A 3E2RA 2NWSA 1Q1CA 1VP5A 5JU6A 3E0LA 4ITZA 4FOKA 2D0HA 3QOMA 4OJYA 1ZB5A 3RIKA 3P6LA 3PWAA 3TAOA 5CZJA 3T05A 4L65A 1YXYA 3UBPC 1J96A 1L6SA 4LPCA 3HPAA 1HF6A 4FX8A 1FUYA 3EWBX 3S8HA 3MVTA 3ZS4A 1YATA 4ODOA 1OYCA 1AH3A 1MXSA 1P0EA 1R3QA 3MQTA 2W92A 3NI6A 4IQEA 4Q8VA 1CENA 1FKLA 3BAXA 3UXDA 4JFTA 5B8IC 1KC7A 5A2CA 2WZHA 3I3EA 4CCEA 3MYOA 1JZ3A 3H26A 3NQDA 2GUYA 4LGXA 3LSCA 3MUXA 1JZ8A 4EE9A 2P10A 1RCOB 5K4XA 4AFYA 4P8VA 3II1A 3N2MA 5LGZA 1CW2A 1EX1A 1TYGA 1LUCB 2GQAA 2AMXA 1LG1A 3SY8A 3PZGA 4Y90A 1FCVA 3VOJA 1HG3A 2ACUA 4JYSA 2BGQA 1C8YA 4BQ4A 4UOZA 3T0CA 1H63A 1NP0A 1IWAA 3S1GA 4AZCA 2DU2A 4LBUA 3W2MA 5DBTA 3WO8A 3WD4A 4MDPA 1DWHM 1KFJA 2FMNA 4X9SA 3VNKA 5D32A 5A6BA 1TJRA 2DUAA 4FIRA 2X1SA 1RY0A 1I2RA 2YA0A 3F4CA 4ACZA 2C1IA 3RU6A 4O10A 2E28A 4KR0B 2Y8VA 2FLIA 4J7RA 1UWQA 1KNWA 1F4AA 3UGVA 3W4RA 1TV4A 1W5OA 2ZQ0A 2HXUA 3BZGA 4HGXA 3ZJ6A 2BG5A 2V2CA 1FKBA 4AX7A 3P7YA 5CG0A 3REQA 1VJIA 1KM0A 2FPTA 1Q4WA 5I07A 1VBGA 4ZO7A 1FKTA 3DFNA 1KBJA 4XV0A 4IT4A 3EZ4A 3A5VA 2FDSA 1FDJA 1XH1A 3RFAA 1P5BA 4P7QA 3R2GA 4IMGA 3ZJ7A 5EMKA 3MV01 1CTNA 2WMIA 3FKRA 3K1DA 4MY1A 4BEUA 1CGWA 1V0NA 1SSGA 1E44A 1KFBA 5KZ6A 1JCTA 1GRJA 1EO5A 4L61A 4DLFA 3VOIA 2DZSA 1KRAC 3EKGA 2KR7A 4CD7A 3NDZA 1OC7A 1Q6IA 2WYSA 1JFXA 1QXLA 4F2TA 4A2SA 1F40A 3GNOA 4L1WA 5C8BB 3IGXA 2DV0A 1RCQA 1RA0A 2CLPA 1JG9A 2WM1A 4LV9A 4JX5A 3FGCA 3R58A 4LOCA 1X1ZA 3M07A 2VX4A 2CITA 4IP4A 4AD2A 4F40A 4MWAD 3CEPA 1OD8A 4DYEA 3WSUA 1RD5A 3OIHA 3WLOA 3HGSA 3DECA 5ECVA 3UA3A 1A50A 3PG9A 3N2CA 3T9PA 1GQKA 3F4WA 2DVUA 1G9HA 1Z3NA 4ZQMA 2HQAA 1F61A 2QPXA 2C0HA 2WHLA 2WB5A 3SGUA 3PBGA 3WG6A 4P7LA 3LRLA 1PYMA 4ZFMA 3SRDA 1OF8A 1ISWA 4S3CA 1N2VA 1TR1A 2HS8A 4RXFA 3GXMA 4D6HA 3WH0A 3FIGA 2J66A 2DG3A 2TYSA 3UF9A 2D1ZA 4ATWA 7ODCA 3O15A 2XIJA 2AL2B 3N4EA 4CNPA 2NQZA 1YMYA 1FKHA 1DQXA 1Z7AA 3VE9A 1XISA 3JVAA 4IH3A 1RP9A 2XN2A 4UMAA 3GTNA 3UCQA 2E5CA 4ZFCA 4IX0A 4OU1A 5G1MA 3WBAA 1J4RA 1W9PA 1H0IA 2P53A 1EWEA 3SCSA 3PJUA 4C6NA 3C3UA 3EDKA 3WMSA 1W9DM 5CSYA 2WJEA 2DG4A 3HV9A 3QHNA 5AZ1A 2HBXA 1DWFM 2Z25A 3ARYA 2X42A 3AYSA 2PMQA 4IFKA 4NYYA 4HNCA 2E77A 4NJKA 4BF8A 4IPNB 3VABA 2HISA 1A5LC 3UXAA 2FHBA 2NUXA 2W4XA 2P1FA 1AD4A 3QLDA 3CAVA 1KFLA 3O0FA 3CUHA 4LVDA 5D9MA 4AH7A 5KTLA 1DTUA 1X8FA 3MO4A 2PWEA 3AYTA 4ZXLA 4MSSA 4UCFA 4IPJA 5FACA 1WUEA 2H6RA 4LAYA 3QSTA 4JKLA 1J0JA 4DWDA 1W9UA 1R87A 2DT3A 4L56A 1C7TA 4GY1A 3N13A 5DO2A 4MHBA 3CYVA 1VYSX 1EJVC 1RPXA 3I10A 1PIGA 3Q4DA 4WVXA 3LX9A 3B9OA 3PHAA 3FN9A 1W3IA 4F0MA 3N11A 3D5HA 1H1YA 4IIBA 4M80A 3AIEA 1A5OC 1NAL1 1Q45A 4O54A 1FH8A 2WVSA 4WDXA 2CYGA 3T78A 3UR8A 3RM9A 3W02A 8XIMA 3IJDA 4WRHA 2VEMA 3QMTA 4FNSA 4LUTA 3NGJA 4JYEA 3IACA 4M29A 4N4PA 2NT1A 3IGSA 3TDFA 3GIPA 2Y6ZA 4IQLA 1AQFA 1E6ZA 3N9SA 2FAPA 3W1LA 1EP3A 2AQWA 3ABOA 2Y2WA 3IGHX 1E1CB 3KX6A 5AC7A 5FSEC 1LBLA 3PZTA 3TJIA 2Y62A 3QTGA 3TLLA 1WX0A 1GVFA 3CT7A 3DHPA 5T9BG 3MW7A 3NO1A 1N8FA 1FWAC 2WKLA 3PFMA 3EA3A 3T07A 2ZYFA 4ROPA 2PUZA 5JH1A 2D2HA 1OIFA 4HVXA 4PMQA 2WC7A 3W26A 3GR4A 5IDIA 3TROA 1UC4A 1TWSA 2R14A 3E0VA 2YCJA 1RQBA 1U1HA 3PZIA 1UIOA 2Y4SA 4KGJA 2WJZA 2X09A 1WBJA 1K8XA 1KM1A 1S1PA 3PAJA 1P0BA 1Q6DA 1P6WA 4B2DD 4D71A 4ZQRA 3VCRA 3WJSA 1ZBVA 4AD0A 1ZHAA 1ZJAA 1HKMA 4MF4A 4EP8C 3VO0A 3ZT7A 2OQHA 5M17A 3UF8A 1L2QA 1R9HA 1GNXA 1H51A 1PEZA 4L4OA 3NYZA 2VKZG 1CLVA 3ORWA 1J12A 2C79A 3CMJA 2QCGA 4IXXA 3FYYA 4Q33A 2V5BA 1EKOA 4XUYA 4PMRA 3H23A 1R3VA 1YDYA 4UTFA 1YEYA 2J79A 3U3HA 1KA9F 2R6OA 3LK6A 2O9RA 1AQ0A 2BODX 3QXBA 4NP7A 2XN1A 1SFLA 2CZ5A 3STGA 1I1WA 2XVPA 3TYAA 1EGMA 3GTFA 3VIGA 1ZQ5A 2R24A 1PTGA 3LPGA 1US2A 4RZBA 1S2UA 4LY4A 1FWBC 1KW1A 2Y89A 3G6LA 2ZRYA 3FAXA 2Y5EA 1YDVA 1YBQB 3PR2A 2WHMA 4GIAA 3IVUA 3WDHA 3AWOA 2ZVRA 1G1YA 5LSMA 4AW7A 5HINA 4UNIA 3M0MA 1VPYA 3S1UA 2EKCA 5CXPA 4ERGA 2F2KA 2XVKA 3BVJA 4UUIA 3OVGA 1CIUA 1TX2A 3IWPA 3BH4A 1CGYA 2CWXA 2EHHA 5DEZA 4N4QA 3E9AA 4DBSA 1WPCA 4MJZA 5LNUA 4JY8A 3T09A 2QGHA 4AEFA 3BLLA 3ITYA 5BXSA 2E40A 4EPDC 1OIMA 1X39A 3LZ5A 5ABHA 3UNDA 3DCPA 4U33A 3IK2A 1VFMA 1DJGA 2G41A 2M2AA 3PNUA 3V75A 1U1JA 5FJOA 4A3HA 7PTDA 1EL3A 4TXEA 4N42A 4E2BA 3SUUA 3UVIA 2Q02A 4IGNA 2YFOA 4TTUA 1FWCC 2V9DA 5HNRA 1L1PA 4LAKA 4OV9A 1SR0A 4HHPA 4N02A 4LRSA 4DHGA 4TW8A 3IIPA 1C7SA 3OU8A 1B2YA 4WQ6A 1UZDA 1F74A 5J6EA 4NASA 3N34A 3S1XA 1L6FA 5I3FA 1BKSA 3KUMA 4HMCA 4KEVA 4KCVA 1MZRA 5FA5A 2UY5A 2EJAA 2J47A 4GMEA 2G5WA 2WHKA 1XCXA 5EA9A 4DIPA 4IUOA 1J10A 3W1MA 4XD3A 3CQKA 2YXOA 3WJWA 2B7NA 3WNMA 1YPIA 4HCDA 4QT3A 1DJQA 4GCXA 3TCSA 4GI9A 1ONEA 3KDOA 3CH9A 1EOKA 3SB0A 2RDWA 2NV1A 2XJ7A 3WY1A 3CC1A 1FKFA 2D0FA 1UCWA 1P0KA 4QEEA 4AIOA 3U2ZA 4NIRA 1X6LA 4PGLA 2PD5A 3UZJA 2OYLA 3KBMA 3OPSA 3PM6A 2ZX5A 3DENA 2KFWA 3O5EA 2E09A 3CIXA 3M16A 4FLRA 4H2CA 3CZJA 1JCJA 2FYMA 2ADAA 4Z42C 1L2UA 4IMFA 3WF2A 5IDZA 4K68A 4N9BA 3W2NA 4H19A 5MF5A 2V68A 1OC6A 1KQYA 3DI1A 5FEXA 3TW6A 3W74A 2CC0A 1TJ1A 4MNMA 4PUNA 4GO8A 5J04A 1QOXA 3WL0A 1BVNP 1MQQA 4ZO8A 3QPZA 2MNTA 5D02A 1SFSA 3W73A 4AZBA 2GQ3A 4I6VA 2C15A 4BI6A 3NPXA 4GZIA 5FL1A 4WXYA 1DJIA 1OQFA 3MY9A 3R8RA 3EXSA 1E71M 5XIMA 1D3GA 3GIQA 3IKDA 1JIBA 1N55A 2C18A 1BF6A 1UYQA 3CGMA 1R7AA 5A6JA 2QW5A 4HQVA 5RUBA 1LWJA 3M7WA 4BI5A 2F2DA 2B0MA 5HWJA 3TCZA 1DWGM 2CLEA 5I02A 4WGXA 3W6MA 1GKQA 4LCSA 2C16A 4UTJA 4RUBA 3G18A 2VZSA 4D8AA 3EDFA 5XINA 1AH0A 2YDSA 4E4PA 2VFGA 4YCPA 2ZIDA 4OTKA 4AAJA 3AXIA 4TW6A 2NXIA 4HPGA 3V5CA 4UQCA 3ARRA 2WPGA 3AZSA 3OZOA 1XLGA 3LUTA 3WZ0E 2ZQUA 1M7JA 1X6UA 2HMCA 5LIWX 2OSYA 1EJWC 2NLIA 2FTYA 2E25A 4EPEC 3QV9A 3RG6A 3BSGA 3MZ2A 6CGTA 3VKDA 1GYMA 1J6YA 3IIZA 1XIIA 5DCEA 4E2VA 2V5DA 2DIEA 3U8GA 1GW1A 5K9CA 1BRLA 5G4WA 1EF3A 2VFIA 1LORA 1KCLA 3UXLA 4DZIA 4Q8MA 2O9PA 3GO2A 1E15A 1FFRA 1ELSA 3BTNA 5CJMA 3FJ4A 1GZGA 2AAMA 1J6PA 4HZ8A 1IXNA 3MP3A 1HZYA 3GG8A 1I4NA 3KAOA 3UWQA 3ONBA 1K7EA 2WSKA 1MW3A 3FYOA 4AG0A 1HP5A 1TPC1 1OK4A 3GHSA 4ERIA 4WCJA 3CZGA 1R9ZA 3PZMA 3S6OA 3M4HA 5AECA 3RN6A 4Q6XA 2ZUUA 4DWSD 1J93A 4IL0A 4IPXA 2UZ9A 2VL4A 4G56A 2Y8KA 4H2HA 3TSDA 3APGA 1F7BA 4LANA 1VPXA 3QZEA 4RZ4A 1UWAA 3KW3A 4L7ZA 4GC4A 2ABBA 3W9ZA 1VBJA 2R8WA 1V0KA 5L9FA 5T26A 1E1CA 2NX1A 2WZIA 1B9ZA 3O0KA 1OFEA 2VOMA 2ZR6A 3BMBA 4DRNA 1LRQA 1O68A 1T6MA 1OCNA 3LXCA 1LQAA 3KAGA 4Z0JA 3O3RA 1GJWA 3VX1A 3WLRA 2XDFA 1G4TA 5CZTA 2BVDA 3V4BA 4EIVA 2WO5A 5J5RA 1P1MA 3C2EA 2VP8A 3MBDA 1BG4A 2XP7A 4HNLA 1A4LA 1ZP4A 2PU0A 1X6NA 4S3JA 1F4HA 3WFLA 3FY1A 2DQXA 1XIGA 3MSDA 3KTSA 3EIPA 4O12A 1M7XA 3O6YX 5C7VA 2C91A 3IUHA 3JRKA 3KEHA 3FA3A 2FPYA 1Y5VA 3W7JA 4BI7A 1YYAA 2YYTA 3F7JA 1WNOA 3W87A 2YZRA 4JIIX 3NQ7A 1LQ2A 3TYBA 2V5CA 1CPUA 2P0OA 4O50A 4QJ5B 2WSYA 3HQPA 2ISSA 2WNNA 3O5LA 2Z27A 3F4VA 3GG1A 2V3EA 5C0QA 1XLBA 3IIVA 8XIAA 3QM3A 1VFHA 3C2VA 3WNPA 3R12A 1VCFA 5BMXA 1FH9A 2VDGA 2Z2BA 4QNWA 4WGHA 5AB3A 1VYRA 4UB9A 2O55A 4Z08A 3F5KA 1AMYA 4RKAA 4NAFA 3VTRA 4C90A 4WX2A 2J9YA 1XSKA 1LT7A 1SJAA 4YTQA 4H83A 2W66A 3VCCA 4AY1A 4JY9A 3O5OA 3MCMA 3G1AA 4IJBA 1IIHA 3IPWA 1YBQA 5HATA 3S2JA 1TCOC 2RURA 3DOPA 5FAJA 4AY8A 1GQJA 4CD5A 1V6XA 1VCVA 1XLAA 3L4XA 3HQ1A 4EVZA 3L2MA 3WD3A 4M24A 4QDMA 2V3FA 4B90A 3G1YA 1NY1A 2YCLB 4O0QA 3HJEA 4Z2KA 1X98A 1PS9A 5FIPA 3PJXA 2ZZ1A 4QIBA 1KXVA 1A5KC 2V8ZA 1REQB 1GT8A 4PA8A 2IUZA 4JTUA 4F9JA 5C6MA 1QNQA 5LNSA 4S38A 2JEPA 2PZNA 3HOJA 1XX1A 2ZWYA 3F2CA 1EQ3A 4BQ2A 1HXJA 5E0CA 3G1VA 3MJMA 1K9FA 1UD3A 2J9ZA 3GR8A 4BA0A 5A6KA 3R94A 4JQ1A 6ENLA 3HGRA 5A95A 3QHMA 1MW2A 3R13A 2CWNA 2F6UA 1XBXA 5DIUA 3C2OA 1R47A 3RPTA 1A3HA 2IW0A 2D0GA 3GAYA 2OEMA 2DVTA 1OSEA 2OYKA 1K1DA 4FAMA 3UG5A 4JFLA 5JBEA 1XQLA 3AC0A 4GUJA 4IT1A 1K7FA 2Z28A 3UG8A 3KAFA 2WMGA 3FA4A 4AHOA 2BVTA 3DFHA 2X16A 4DRQA 1E72M 3QRHA 1BKHA 4D6FA 1QPLA 3UZYA 4ZMGA 2A7RA 2J27A 5HW7A 5I23A 5C7HA 3AS1A 2PP3A 2ALDA 2EG6A 3KS5A 3M5VA 3ISIX 5FJIA 5IFPA 3OOBA 1F8IA 2W79A 1HKVA 1ZAJA 5KZEA 4QJ3B 1NMWA 1HJQA 2XM1A 4E8DA 2WQPA 1HJUA 2FZ8A 4DNMA 4JIPA 3RCNA 2VHLA 1XLMA 2PV2A 1S2AA 3CWHA 2YDQA 4YIWA 5CAKA 5CBJA 2J7DA 3O6DA 2R9RA 5REQA 3N2BA 2EBNA 5BW6A 3GBEA 1XYAA 4GQBA 1DXIA 2HNEA 4JNYA 1TRIA 2VGGA 3AAMA 2Y88A 3O5JA 2PP0A 3ITLA 1D9EA 3DG7A 3O16A 3G1HA 2X7VA 3TDBA 4JTTA 2E9LA 3UWVA 1ZLPA 1HKWA 1C91A 2VO5A 5D8ZA 3GH4A 5I6SA 3C0JA 1VZWA 2FB3A 3UQNA 1DP0A 4U86A 3GVWA 5IFTA 1ENUA 5IBXC 2ZWZA 1TWIA 1W1ZA 5AYIA 2TPSA 2GJXA 2Y7GA 3I68A 3P62A 1HL2A 3BK0A 5CQ1A 4ALDA 4QSFA 4FX7A 5DT7A 1EP1A 2PDBA 3DERA 2W3ZA 3U4FA 3W83A 2NVAA 1YNYA 3PPGA 1XYMA 4KCTA 2ISDA 1BL4A 4OBRA 3LCWA 2VFDA 3UZXA 3HPFA 4JN8A 5LXEA 4B5TA 3PB0A 4MYXA 3UWUA 5HMFA 5AYXA 5BXRA 1RR2A 4OIFA 4J40A 4WLCA 4LH8A 3A64A 2BOFX 2XSXA 3PRAA 4PH6A 2KAUC 1KM3A 4QQUA 4FHAA 1KFWA 5ENLA 1BD0A 2CERA 3MC5A 3KCLA 2D3LA 3TW9A 3KRZA 4QJ4B 2RKXA 5T9CE 4IFOA 4FO4A 3TYUA 3T0AA 2DT1A 1SZRA 4LY8A 1DIKA 4TX0A 1AG1O 5LYRA 4JEQA 3AMGA 2I17A 2Z1SA 3AJ7A 2X7WA 2JGQA 4E3VA 1SZEA 2OEJA 2CHRA 4PBEA 1EH9A 3RAOA 3YPIA 1OGGA 4PE8A 1OFBA 4R7WA 1CXFA 4NZ5A 3PBVA 2QGYA 2G4JA 1F2JA 4BR1A 3ARZA 1WE5A 4TVUA 2D24A 3MCOA 3GG7A 1VB9A 1VGAA 1PX3A 5DMMA 4J5NA 4WIWA 4TIMA 2ZA1A 3PWIA 1J11A 3DBPA 3VDGA 3VIOA 4IHCA 4TNSA 3N4AA 4C91A 1XPGA 3THQA 1BTMA 3ARPA 1W9BM 3UVAA 4H6QA 2C1HA 5LHFA 2XPBA 1FOBA 3K8KA 1S46A 3S0CA 1TTPA 4ZOEA 5CSSA 3C86A 1UASA 3SRHA 4MADA 2QJJA 1B1YA 4H9VA 4JKMA 3OA3A 3B9AA 4LWWA 3QKEA 4WKFA 3UFYA 2GYIA 4L3NA 2YX0A 4ERAA 4UQBA 3AS0A 4W9OA 5T8GA 2A3EA 1YNQA 1H7NA 4YJ5A 3C8NA 1AJ0A 3N04A 4MIMA 4A35A 3QV7A 3W72A 3H12A 1BWLA 4JQAA 3LA4A 2JZVA 4M51A 4F4RA 4M7SA 3AXHA 4XX6A 1RPKA 2CEQA 2WBGA 1XG4A 4A8NA 4U84A 3OOQA 4RV8A 1GORA 2DUZA 2GWGA 4YHGA 3EMZA 4XZNX 5AZ0A 4HJWA 4YVXA 4MYAA 4UTLA 1ZP3A 4KBXA 6XIAA 5HR6A 4MLJA 4H8NA 2ZFAA 1RALA 1WDWA 2NX3A 3TN6A 3TV8A 3N6JA 3KVJA 3QMRA 1O66A 3NJ3A 2E8YA 2J24A 1TV8A 4DJEA 3IJ9A 1H4PA 3M0KA 3L68A 4ZTXA 2MLXA 1JGMA 3BLDA 2P8BA 3FXGA 1TUFA 4CNUA 4Z2JA 2PF0A 1CB2A 1T0OA 4WY0B 1Q4NX 4ADTA 4B4HA 3H7RA 2QF8A 4JFMA 1TWWA 3DKJA 1UMYA 2F23A 2WKJA 3AUJA 2QNEA 4XVEA 3VZYA 2HSAA 2NQ5A 2Y1HA 3SCRA 3EOLA 1E9YB 3NNTA 4DELA 4L1GA 2Y78A 2RUDA 3GE7A 1UR8A 2CLMA 4NG3A 3T2PA 4AY7A 2OTDA 4QAWA 4A21A 3ATYA 1ISZA 3GVQA 1EXPA 1NEYA 1BVZA 3TQPA 2DZTA 4GKLA 3L5AA 4XIAA 4L5ZA 3TIMA 4ZTYA 3RLGA 3WH8A 1DVJA 1IHIA 4RR4A 1HP4A 1OF6A 3LGEA 1SVDA 1XC6A 3QC3A 4RLIA 3SQSA 3CNYA 1J4HA 4QDWA 4QCEA 3W70A 2OWXA 4BEQA 1LLOA 5CC7A 1UHVA 2XP8A 5B80A 1T96A 1YADA 3MZNA 1OK6A 1ZCOA 4DXKA 4HOWA 1W3LA 2JKAA 1IEWA 6A3HA 2WVUA 4JTQA 3TU9A 3D3FA 1E1EA 1SO6A 1UQZA 3WX7A 5GNZA 3B9DA 1DL3A 3EWWA 4BWLA 3LV6A 4MWAB 1GONA 1DOSA 1W8SA 2HCVA 6XIMA 4RXGA 3WDJA 4A2RA 5JBDA 4R85A 1JCNA 4ZL1A 3ITOA 1OZMA 1V3MA 2OFNA 3KL3A 1FHDA 4R0XA 3CIVA 1MI3A 4UQAA 5B7ZA 1TQJA 2H9AA 2PDFA 2Q3OA 3SUVA 4HU3A 2F6XA 3N9KA 1D7FA 2HBVA 1CDGA 3BSHA 5ECUA 3U48A 2E67A 3SY5A 1JUBA 4JFKA 3C2FA 3DC8A 2C3ZA 3MKVA 1W1A1 2OU4A 1J79A 2ZUNA 3KL0A 3AIWA 3N6HA 3LPFA 2XP5A 2VGFA 1FBAA 1K70A 3A22A 4EXBA 3N12A 2AOSA 1NOFA 2INEA 1SMAA 3IEBA 2Z0IA 1OY0A 1MUWA 3QKZA 2G37A 3K8LA 3WF4A 4Q7NA 1VRDA 1TV7A 4CQ9A 1H11A 4NAEB 3NQCA 3PPCA 2ETNA 1Y65A 1QVBA 4MM1A 2OEKA 3O5KA 2OT0A 1GTHA 1DJNA 4Z1BA 2VRQA 3TK7A 1SU5A 3MDUA 4D1JA 3V35A 4S2CA 2C0AA 4O57A 4Y9PA 3WH7A 3AZTA 3GHUA 5F2GA 5G4EA 3CO8A 1PHWA 3UJEA 5EFFA 3VKAA 4DXVA 3ZXWA 3SN4A 4AF0B 3TR2A 1QOQA 1QNRA 2F6KA 2PDGA 3WBYA 1V03A 4U5KA 3DI0A 4JL1A 3KRUA 1MEIA 3LENA 3LMZA 3AOFA 4L4MA 2A21A 1VHCA 2ABAA 4JX6A 1W1TA 4PMNA 3TAKA 3CZ8A 2RDXA 3A21A 4CD8A 3TTQA 1FAPA 1ITUA 1WZKA 1LP6A 2ZZ6A 4B4FA 2IKHA 2R1PA 1P5QA 5FESA 3E2VA 4J2MA 2GQ9A 4O4WA 1ICSA 6REQB 2O7QA 1K4HA 1KKRA 1JPMA 1QMLA 3HG2A 2QPUA 1J2BA 1JD9A 1FVPA 2X30A 3KCEA 1T8QA 1D2KA 2M08A 4O17A 4R3UA 2DORA 3IV3A 1UZ1A 3E2QA 3UZWA 5DO8A 1P6CA 3HQNA 2DSVA 2DGAA 1O1HA 3GVVA 1CBGA 5A6TC 2HNHA 3M6DA 3O7UA 3AXKA 3UEQA 1FWWA 1ROTA 2EPNA 4JD4A 3USZA 1DE6A 3DH7A 1JYWA 2PODA 4CQBA 4WHBA 3UZZA 3GVRA 3JYMA 5I3JA 3ELFA 1DBTA 2OVLA 2CETA 3VGDA 4MTVA 2EPHA 1MRAA 3KTCA 2KI3A 3PRDA 1IXOA 1WAUA 1O60A 1JDDA 4CNNA 1UMLA 4FXSA 4UR9A 3F1QA 2Z2UA 5CGQA 5FF0A 3A13A 1EUAA 5GVJA 3HO8A 4L6HA 2EQDA 3MKKA 3USBA 4PUJA 4P8WA 1ONXA 4GUHA 2QUMA 5M5DA 3PN8A 1OM0A 4GUIA 4Z2GA 4DRPA 2BHZA 2XFYA 3B0PA 2WC3A 3A9BA 4DPPA 4UR8A 3UY7A 4WDWA 4PB3A 3W7QA 4JFWA 2KO7A 1MZHA 3EX4A 1ML1A 2ZKMX 2PZ0A 2I5GA 2PTDA 4GCAA 1EXBA 3FEQA 1WP6A 1NDZA 1PV8A 1FWDC 5E9XA 4KFPA 1WB0A 2ZXDA 3OZPA 4W7VA 1TO3A 4TVDA 5F4XA 3UCCA 3VOCA 4J4OA 5BOEA 3IGUA 3B9NA 4XBKA 1OX4A 1ZNNA 3C4UA 5K3VA 2QF7A 2KGJA 4DI8A 4HSNA 4CEUC 2DZVA 3XISA 1J0ZA 2QDDA 2XP4A 3GG0A 4ZSUA 4C6DA 4XAPA 5BZAA 3LCGA 1EQPA 4CNSA 3PR9A 4GOAA 3VYLA 1P1XA 1H09A 1Q66A 4TO8A 5F2IA 4LAXA 1W8GA 1FCUA 1NH6A 2AQVA 3GC5A 3A4WA 3WQ4A 4P7RA 4YMZA 2FGBA 3WLNA 1RVKA 4B3KA 5DBUA 3WQPA 3WUGA 1EYMA 1ZALA 5D2YA 4CUCA 1D7IA 3ZFHA 4ES4A 2WCSA 3SCWA 1JUEA 4N7QA 2WJFA 3K30A 1V4YA 4XO6A 4U4MA 2ZBTA 1TV5A 1NMVA 2E0PA 2WZTA 3NGFA 2KX9A 3CAQA 3AHYA 1KCXA 1BTCA 3OG2A 2XIOA 3R25A 4Q8OA 4MB1A 1J01A 2BBFA 5AOUA 5I24A 4GI8A 1VLIA 1ITXA 3BANA 3BWWA 3LHTA 1PCKA 1DJWA 2GDUA 1K9TA 5TBOA 3RM4A 5HWCA 1XYFA 4E8CA 1AVAA 3S2CA 2UY4A 1DXEA 1HL9A 2PGWA 1W3TA 4JTGA 4XTDA 3GXTA 3AS2A 1MVYA 1JR1A 1KWKA 4XSMA 4BQ3A 3W7IA 3AMDA 2J7FA 3RO6A 1WOBA 5I3DA 3BAJA 3LB0A 5BXJA 4ZB0A 3NEHA 3TYCA 4MB3A 1Q2RA 1EOMA 2ATMA 5DXYA 3AQUA 1W3NA 3TQVA 3SSJA 2ODOA 1GKRA 2GOUA 5D09A 3MUY1 3CUIA 4PTMA 1DWJM 1Q3NA 1OYBA 3TXVA 1XIDA 3TMLA 4PEKA 2VDIA 3BOXA 5D38A 3OW1A 1VBHA 1UD6A 3SUSA 2SFPA 2FH8A 4WKHA 4AHQA 3EKLA 3EPMA 4MB5A 2BVYA 4J3WA 3R8GA 4P8XA 1K4GA 5C54A 3V0TA 2WLYA 4KMQA 5CJ5A 1JCMP 1TPUA 1QOPA 3GUGA 3RLUA 3U6WA 8A3HA 2P0IA 5HWBA 1JAEA 1J6OA 4GFSA 3VNYA 3EWZA 3GXNA 5F7UA 4J28A 1V6YA 1NP2A 3GNNA 1K9EA 1KCKA 3PUOA 4PUEA 1SYTA 3BCFA 4W9TA 4ZXOA 4QZVB 5CC6A 2X1TA 1KT0A 4GD0A 1LOQA 1S38A 4W87A 3GYCA 4JFUA 3L12A 4HT3A 4A8LA 4IGHA 4GZJA 4LVFA 5DCDA 1D8CA 3DFPA 4GI4A 2PSNA 3EMCA 3W81A 4RW3A 2DY3A 4GJ1A 1JULA 4HZMA 2CLIA 4QAIA 3TH6A 3GHRA 4L64A 3GNXA 4J3ZA 1QUMA 1PIFA 1I2PA 1VBRA 4ONVA 4NZCA 1Z32X 2VEGA 4KERA 4U5IA 1R3SA 4FNPA 2VX7A 3MMDA 4DBDA 1XKYA 3D6NA 1Y0OA 3QF0A 4LF2A 3KAIA 2XISA 3WMCA 4GG9A 2E6YA 4Q22A 1NFBA 4HHMA 3KHJA 3V36A 1D6OA 4NNBA 5DRIA 3HTWA 5IOBA 1AW5A 4NF7A 1WXZA 4IG2B 1MUCA 3RHGA 3WYZA 1C92A 2WC4A 2RGMA 1ZL1A 1PKLA 4C5YA 1RY8A 2NQHA 4K7YA 1PKMA 3S6TA 4IP5A 3U2OA 2PU1A 3RFWA 4UTIA 1UR4A 2TODA 3QBUA 3ZT6A 4LBSA 3ARQA 5IHRA 1U30A 3VDBA 2JKEA 4XK2A 3KM8A 4KWSA 3U2CA 3PZVA 4JFVA 2ZDRA 4NNCA 1ME8A 2E3ZA 1P4CA 1B3YA 1OJXA 3MUCA 3T81A 2PDJA 1EEPA 2F38A 4MUZA 5CSRA 1ADDA 1TIMA 4DF0A 2QV5A 1JFHA 3ZT5A 3W76A 3CLMA 4O1DA 1OC5A 2OX4A 3SECA 1W1B1 5A6LA 1OWQA 4A8RA 2A3LA 3M0ZA 3L0KA 5G2HA 5A6BD 4N9CA 3NEVA 1IZJA 3O5QA 4REQA 4ZODA 3TTSA 1HTIA 2R91A 3W7KA 1W54A 4PRWA 1OZQA 5C9UA 5CH9A 5FF4A 1M41A 5CKSA 1YTEA 2FFCA 4QDPA 3MHUA 2OR2A 2V2DA 3LQGA 1S2CA 1GJPA 3BG5A 5DITA 4Y9NA 4LUJA 3R79A 2YW3A 1KTNA 4ACYA 1ADOA 1DPMA 1TX0A 4CNOA 3GC4A 2P4VA 3NZQA 2IPFA 4MSPA 4V1XA 2XM2A 5JMUA 1ZY9A 3NXLA 4XSLA 1XGEA 3K4DA 3BARA 4NSBA 2XWDA 1SFJA 4HSHA 4DWSB 3DG3A 1JVNA 1QAPA 4EACA 1LCOA 5IBXA 4F3HA 1QI0A 3W75A 1XIBA 2HROA 4JTKA 2PE4A 3MI6A 3APTA 3PSVA 1K6AA 2AGTA 3W7EA 1CX9A 3N73A 4IPPA 2I56A 3BCDA 1VLWA 2DSWA 2WKGA 3A12A 1IYXA 1QO5A 1WDPA 4MKNA 2Q6ZA 4GNVA 7TIMA 3AU6A 3VD7A 3TYEA 3FA5A 3MJYA 5I03A 3WQWA 4IPLA 2D2GA 3RLHA 2I5QA 5E9AA 4YCOA 1ISXA 4ZPVR 3AHVA 1I75A 2IPGA 2LPVA 4KS0A 4ML4A 3WQEA 4PUMA 3HPXA 1OD0A 2Q09A 1VFUA 4HJFA 1Y5WA 2HJPA 1EDTA 2YDRA 3LYEA 3H22A 3ARWA 1NWTA 3QQWA 2PPPA 1X38A 2XVGA 2PFHA 2YOCA 3B8SA 2YBUA 2QR6A 4FR6A 2WVVB 5IXEA 2JF6A 1VIZA 4ZB5A 1UPMB 3RO8A 2VN1A 1EYWA 5IHSA 4CVUA 1A5CA 3DUGA 4LRTA 3HGOA 2OKTA 3LD5A 1TVLA 3L0NA 2DT2A 5D2VA 2F84A 1OABA 3RX2A 1LM1A 3TQ0A 2UY2A 3NPVA 3RRAA 3GLCA 5BRBA 4LVBA 3C5QA 4HN4A 3I3DA 5C70A 1GQIA 3JS3A 5D05A 2VTFA 2F8QA 2YXGA 8TIMA 5HQLA 2LLEA 2YCIX 4AWSA 2GWNA 2V5LA 4E8GA 4MZ1A 1UH4A 2Z00A 4NJIA 4UOJA 3VKKA 3CUJA 2YPIA 4F9DA 4G7EB 2XSBA 2ZR4A 1SPQA 3QEZA 4JIQA 3ABQA 4F0SA 1VR6A 3UA4A 3M0IA 1GJUA 2RGLA 4JBRA 3QR3A 2L2SA 3SADA 4CCDA 2JBMA 2D3NA 4INFA 4Z1AA 1UWRA 4ZEPA 1GVIA 2ZICA 3UPMA 5HJYA 5IM51 5H91A 1JL8A 2ZUTA 3NQ2A 3S9IA 5EMUA 3U57A 3DYOA 2ASHA 1SJCA 1J5SA 4IIHA 3IK8A 1HQTA 3B0XA 2NSXA 4JIRA 4JL2A 5AC4A 2EO7A 3ECQA 3GDKA 1GOMA 2VZTA 3VA8A 5I3IA 3UJ2A 2C71A 1B4KA 1QR7A 2FQIA 3EWYA 3OLDA 3P5YA 1B57A 3GPKA 4JTSA 5FJTA 3F4DA 3TFXA 3PFRA 1UUMA 1XFCA 3PBMA 3TCEA 2NV2A 4Z1YA 2BY0A 3U7BA 3GKFA 1O6IA 4M8UA 4QISA 4WSHA 1OCJA 3EWCA 4XKYB 4AC1X 2POTA 1W6TA 1E4NA 4X2PA 1A3WA 4DRIA 3PA7A 4ZSTA 4JICA 4MDOA 3KLKA 3AJXA 4JTHA 2CKRA 4ICNA 1R3TA 1A53A 3UR2A 5LZLA 1E1FA 3S9ZA 5GJMA 1DHKA 1ONWA 3UESA 4DZAA 3VIJA 3H2CA 4IQCA 4ZA0A 3AYRA 5D04C 5KITA 4O1BA 4W8LA 1SFTA 1QTWA 4JIEA 4LAUA 3VKJA 2VRJA 3AZRA 1XC4A 2ICSA 1Q6CA 2VEKA 1Z9AA 3C6CA 3CMGA 4FAPA 3ITVA 2DW7A 1VFTA 2Q8LA 3TX9A 1UWIA 3WLHA 3RK8A 4PODA 1ZFJA 5HUPA 1I2NA 2IKGA 2WK2A 2BTMA 3OHMB 4GVFA 1FWRA 4QS6A 2YXXA 4LYRA 3GFZA 2QJMA 2ZOXA 1XCWA 3ZR4A 2J8FA 1HO1A 1QBAA 2PBOA 4C6OA 4IIDA 4DY1A 5SWUA 1PAMA 1G7VA 1QW8A 1QI2A 1E5NA 3WJZA 1L8PA 2VRKA 3LTPA 1HGWA 5DY3A 2C13A 3THCA 4Y8EA 5CLWA 3CZLA 3C52A 3KRBA 3QY7A 1OB0A 3HFYA 5BWAA 3PRBA 3STCA 1E56A 2DZWA 5FKYA 4PCSA 3UR7A 2P76A 2ZR5A 5MHBA 5JH2A 2YL5A 2J9XA 1TMLA 3KCOA 4UFHA 4TQTA 2W9MA 2Z29A 3B7XA 2WMHA 1S2WA 3DEQA 1XCFA 5CLTA 3NO3A 1WDSA 4DLMA 3GU1A 2IF4A 4V15A 4O13A 3T0BA 2VVNA 4G7FA 4K3ZA 4PMXA 4PZVA 2OKOA 3O07A 1KR0A 2E9MA 4DUWA 3IUIA 3PS7A 3W86A 4H7CA 5LIXX 4WDUA 1O4UA 3OYZA 4RX0A 1EGVA 2RAGA 5I06A 3RMEA 3IUDA 1UG6A 5CGMA 1ZJBA 2FGLA 1KM6A 4MNLA 4E2OA 1XP3A 3D0CA 4U28A 2ZRXA 2QUTA 1W3JA 5D2TA 3G1FA 3VIMA 2JFEX 2FZDA 4HK5A 4IZGA 5A8OA 4WSKA 1Q85A 1F3TA 4GC3A 3JYJA 3OIXA 3VUPA 4EPBC 4GE8A 1OINA 1QFEA 1TV2A 1KCZA 3TE9A 1J2WA 1Q7QA 1R3RA 4EXAA 5AYBA 1AFSA 3VGFA 4WK9A 1EDGA 5AVNA 3B40A 5HQEA 5A2AA 3WDPP 5KINA 1M65A 2QMJA 3WLKX 2DVXA 3VINA 3L4UA 1TSIA 4IGSA 1N1AA 4O1AA 4S2BA 3R10A 4ILSA 1CXHA 1C90A 1BKFA 3TWBA 4AMAA 5DFAA 3Q67A 4H8HA 2W67A 3Q58A 4HU4A 1U5JA 4IIFA 3NG3A 3P81A 3CS2A 3QOKA 2BOEX 2BFGA 1Z44A 4TUFA 2REQB 3G2GA 2QJHA 4K1WA 4DUVA 6TAAA 3SY1A 2WMKA 5AHEA 1GOOA 3R43A 5HMEA 1Y0EA 3ZVHB 1R8LA 1G01A 5A8MA 3M5ZA 4HA4A 5EYWA 4E5TA 5C9XA 3N29A 3GWQA 1PBGA 4NY2A 4FK9A 5A6SA 1FKGA 4M6VA 3L66A 3SI9A 4V2XA 4Y9OA 3WQCA 3A4AA 3AHXA 1MWOA 3Q65A 2Q01A 4KRUA 4HYWA 3ZOAA 1HKKA 5D2XA 2WCAA 2CBVA 3G8RA 2ZZ7A 3MMWA 1UD4A 5AVHA 4NZ4A 1Y8BA 2X2GA 2FVKA 3AHTA 4A3YA 3N2OA 3DKLA 4ODPA 1HJVA 2Y61A 3IJ8A 1HUVA 5FEWA 1B30A 1GGOA 1VEOA 3W53A 4JNMA 4ZPWR 4Q6JA 5JH8A 3BL3A 4GUGA 1HNYA 2XH4A 1SW3A 1MW1A 5G4HC 4IMAA 2QJNA 1PWLA 1JDAA 4S1FA 2QDHA 4AIUA 3RGTA 3Q45A 3MP4A 2QQ6A 4E4UA 3GFXA 3WNOA 3IIXA 5CZ0A 4NZFA 1KWGA 3B8UA 1UROA 3TOYA 2VDHA 1GQLA 1UZ4A 3LEPA 5EU9A 4FNTA 1EBGA 3AIQA 4HD5A 1W17A 5I98A 4PMYA 4UZSA 1E0TA 1A5SA 4NYUA 4D1IA 4C6MA 4HN8A 3DIPA 4C60A 2PLMA 3URNA 3WLIA 1W32A 4QTGA 1JVWA 4LS2A 4G2DA 2HK0A 3JZEA 3LHUA 2CPUA 3VNZA 5EMLA 4UTHA 5TD4A 4PYSA 2PS2A 2QCLA 4HA0A 4N2YA 1EFZA 1PBKA 4AX6A 2DIJA 4PMDA 1ADSA 5CPOA 2Q71A 2KE0A 1VFOA 4GXMA 4UIOA 3LCIA 2X41A 3C3NA 3GYEA 3SUWA 1TB3A 1IZCA 2AWGA 5C9RA 5FF7A 3GU0A 3HF3A 1PDZA 4EX4A 3TZFA 3EOOA 4AZ7A 4RNFA 5FJPA 2C19A 1H0GA 4IT6A 3PP7A 3UPBA 5CPMA 2PBGA 1GQNA 5HA7A 5HPCA 1DHPA 3DFTA 5HJXA 3DFOA 3NQVA 3THUA 3B9EA 1IR2A 1O95A 3CT2A 4GACA 1GVQA 3BCJA 3SCPA 5FL0A 4H1ZA 4FB7A 3W1AA 4M82A 2QYGA 2OMAA 3L67A 3H54A 5LA2A 9RUBA 1Q63A 1KGXA 3EX6A 4LFYA 2VQUA 2QJGA 4JYDA 3NFUA 4KWOA 2DZUA 4DUXA 1XYBA 2J7BA 2GVJA 3VD9A 3MSYA 1UP2A 3T2OA 4IFRA 2IQ0A 3W1NA 2WLZA 1FJDA 4GY7A 5A6MA 3BW4A 4WR3A 4JOMA 2HE8A 3VU2A 3C8FA 1Z89A 4H9ZA 2M1IA 1FKSA 4XZBA 5HW8A 4B5UA 1YDNA 2YCEA 1I0BA 1IWPA 1PZ1A 1FP8A 1DIDA 1WDDA 4XD5A 2FDMA 2BGSA 1SO5A 2ZA2A 4LBRA 4RE2A 4RNJA 2GJPA 4MFDA 1US0A 1T11A 4MJ4A 2CZEA 4J35A 4GBUA 1PZ2A 3GXIA 1MNZA 1R38A 4IGMA 1JI2A 1ZBKA 1SZNA 1S1RA 4MAVA 1V0LA 4ECLA 4ZZ9A 3THAA 3JR2A 1QNVA 4MGGA 2HTMA 1TRDA 4FP1A 4PMVA 4LAWA 3PZOA 1JQVA 1OVDA 2W5FA 1RP8A 3N2XA 2OQYA 1NIUA 4AD1A 1I45A 4K7VA 4ZO6A 5HW6A 1H7RA 4UFMA 5GJNA 1KRBC 1UP3A 4ORIA 3PANA 1SSDA 3HM7A 1VPQA 3G1SA 4M5PA 3MPGA 2GDVA 4LUYA 1E0VA 4QS5A 2HVNA 2L5HA 1P7TB 2VFEA 4DH0A 1Q6FA 4JTJA 1S5TA 3OYXA 4XKMA 2IS7A 3NQMA 2Q5AA 5C55A 4QE1A 2I9UA 3W22A 4AZGA 4I5UA 4I9JA 5LKYA 1UBSA 2CZVA 1YX1A 3LERA 3VX0A 1D7KA 3BSMA 4AZHA 3WD1A 3NTYA 5GJPA 3PK7A 1TG7A 2IPWA 1JDFA 3NDOA 3OVQA 1BWVA 3CL6A 2PDIA 3V5FA 1G4EA 1T99A 4UNKA 2E6DA 1WKDA 3AYVA 3QV6A 3UI4A 4DBUA 1HVXA 1VYPX 3JW7A 3CQIA 3QW4B 3P84A 3R0DA 1ONRA 3NL5A 4H9UA 4JKKA 3LS9A 4ZR8A 3BLFA 4OT7A 3H24A 4XZWA 1EBHA 4NJJA 5K7JA 4I8DA 2GJLA 2F21A 4S3KA 2V3DA 4X3ZA 2PGEA 3RM8A 4GQGA 3LTYA 4RW5A 2GLKA 2W0UA 2WW5A 4LYKA 2E8ZA 3QC0A 1UUOA 2DEPA 4D8LA 1W37A 3CV1A 4UMCA 4GO9A 4OECA 3OB8A 3E0FA 1V6VA 2IKIA 4O11A 1BXCA 4MJ2A 4AD3A 3LU2A 1V51A 1R3WA 1UJPA 3BOFA 1XIHA 3LY0A 1A7XA 5AC5A 1WZMA 1W1YA 5BU6A 3W7LA 3MYPA 4C6LA 1TA3B 4GX8A 3U7VA 4TV5A 2REQA 1XICA 4GNJA 3W25A 4S3EA 3MB9A 3C0SA 2MF9A 3EA2A 5EL1A 1Q7ZA 3RPDA 4QFUA 2PB1A 3KXQA 3DGBA 4FNRA 3P5ZA 3LNMA 1DEDA 3S2LA 3GNRA 2O56A 3P67A 4X2RA 2J25A 3ABZA 4LNCA 4C6QA 3TC3A 1FHUA 2POZA 3PAOA 2G4FA 2XH0A 3WNNA 3EEZA 4R7JA 4HNTA 2EPMX 2QCDB 2ACRA 3QH2A 2DDXA 4KEMA 1KBIA 2Y85A 1EJXC 1GZJA 2R1KA 5G1TA 1V77A 2Z1XA 2C1GA 2YB1A 3T4WA 3UWYA 2Y63A 1W91A 2QKFA 3UGRA 1OYAA 2J74A 4HSOA 3BPWA 3EXRA 1KRCC 3UXKA 2Y8UA 5C2CA 1NF0A 1YE6A 2OB3A 2VELA 1W2PA 2D22A 3RILA 3BE7A 3ME3A 3WH6A 2WJDA 4DJFC 1RZMA 4XIMA 5D9PA 3NL2A 4H9TA 4FR1A 4C6FA 1FHVA 3CHVA 2RDTA 3LHWA 3H21A 4ZQCA 4UC5A 4LW7A 2QLYA 1EPVA 3G1DA 1KGWA 4GUFA 1O7AA 3HV8A 4TX8A 3W84A 3TR9A 3SURA 2BGNE 4LUSB 4F2UA 2J7CA 2PDKA 4PBFA 1J9YA 3K5XA 4DF1A 3MCNA 3HJZA 5HR7A 3W82A 3ARTA 1DIEA 2OOGA 2VEPA 1VEPA 1EEXA 2CKSA 2GGIA 3AIVA 3B04A 1IEIA 4CN1A 4PCNA 2ZX9A 3KVLA 4DJEC 2PV3A 1WBHA 3B8VA 2PDLA 3ITTA 4F0LA 5CPNA 1R0MA 3CQ0A 4RV3A 2XGBA 4Q4KA 1D7HA 3CIWA 1YPFA 2HPIA 1T8XA 1ECEA 2IPJA 5CPTA 2NXGA 3U2EA 4YN5A 3TSBA 2CZDA 5AC8A 3CUZA 4PBGA 4QM1A 2J77A 3WFZA 1ODUA 3PG8A 1R5YA 2B4GA 4G5DA 3NQGA 1XL9A 5DCBA 4N0RA 1C9WA 1YE4A 1E0XA 2CESA 5EMYA 1L8NA 3MHGA 4MWAE 2OSXA 4DX3A 1U79A 2Z2AA 1EB3A 3E12A 3PTQA 4J3UA 2OWCA 4V27A 2XU2A 4O16A 4CCCA 2G3MA 1GOWA 3GDTA 1E5JA 5CC5A 1B3OA 1UA3A 2ON3A 5F1UA 3EGJA 2VFHA 3SZ8A 4R5EA 3M6YA 1UD8A 3ABSA 3WLQA 4F0HA 5TQLA 1HIZA 4PEEA 1POKA 2YLAA 5BOOA 4N9EA 5DANA 6PTDA 3M43A 3T6CA 4XAKA 3SIZA 1FDZA 1MFUA 1TPB1 4RDWA 1OHLA 2PTYA 1WQ5A 2PC4A 5KEZA 1E51A 3WUEA 3GDRA 5AHLA 3KBWA 2BB0A 3N15A 2NXHA 3B0UX 3NZ1A 1FWNA 4BWLC 1LUCA 3HGJA 4KQZA 5ABEA 1Q6LA 2DJXA 3GNPA 2QZRA 1YRRA 3AICA 1V02E 2X8RA 5M3WA 3GU2A 4W9PA 2XH7A 3S42A 1O12A 4K39A 3CPGA 3DBNA 1GVSA 1RJPA 1BSLA 4WOQA 1HXVA 1XSIA 1XLJA 1XBVA 2PC8A 4TVCA 3SRFA 3UETA 4AXKA 4LC6A 4XVDA 4AQLA 3VZZA 2GSJA 4TMCA 4FSAA 4Q8TA 1FKJA 2VX6A 2H90A 2K8IA 2RUQA 1WV2A 2BS9A 3S2MA 2FHFA 1AA1B 1U83A 4B92A 2ZCGA 3OBAA 3E0WA 1IWBA 3KBSA 4JTRA 3L5LA 1JCLA 4RE3A 1JJKA 4H9MA 2J88A 3DYPA 2VNCA 1JYXA 1SQ7A 1CI1A 3PBWA 2A0NA 1CB7B 3IJLA 1S5WA 1OCBA 4HPXA 2X1IA 1TKKA 3H53A 1MNSA 4XQ6A 2NUWA 1EO7A 3I6RA 3MBFA 1F6YA 1W5QA 3B8DA 3RJXA 4ASTA 3O9NA 4IX2A 1NM9A 1QPRA 2DZPA 1LDCA 1RJRA 3HB9A 4U31A 1XD0A 3W88A 4FNUA 4K38A 5FF3A 3A5FA 2OQLA 4IMEA 2F4EA 1DJHA 3S83A 4B5WA 2UBPC 2AKMA 2WMJA 1UB3A 1TFVA 3WKZA 3NQ8A 3T4CA 1TPWA 2GQ8A 3V18A 3WDIA 4GKTA 2W27A 3KADA 3NDYA 3QSRA 4AIBA 1U33A 4MNKA 1UQYA 3GBDA 1QO2A 3KCJA 4X9YA 4UFKA 2KZHA 1HKJA 3STEA 1IGSA 4DM2A 1XI3A 2CXGA 4K6AA 2CW6A 5C5YA 3EX1A 4NJGA 2WSQA 5HWMA 3F2BA 4W7UA 1YIXA 3LNPA 2XSAA 3ITGA 2JF7A 3GUWA 3UZ5A 4BF7A 1F07A 1RCXB 4KFOA 2A79A 3ARXA 3OVPA 2MNRA 4IQJA 2I16A 1B4EA 4XBJA 4QITA 1H3GA 3GQYA 4QXIA 2OLHA 4AZCB 3QR0A 4O14A 2MPHA 3DDMA 1FWIC 3CTLA 1E6NA 3S5SA 1FKDA 3NZGA 3VGHA 3ANUA 2YL9A 1YLVA 4NRRA 1IZKA 4RDZA 2E4TA 3PJTA 1DQWA 4DJED 4R33A 4ACZB 3P2VA 1CGVA 3W1UA 2RHGA 3NZPA 1XRFA 4Y2WA 1V7AA 4QBXA 2OODA 4DJDC 4IL2A 4PR4A 2BY2A 4OQVA 1C9DA 5EGRA 3QPYA 1XLDA 1XYCA 2AL2A 1M7PA 3DFSA 1ZS2A 3CJPA 4WJXA 3UI5A 2J8TA 1JRCA 4IQDA 4TU1A 2PPNA 1AQMA 1V8EA 2B7QA 2RH9A 3REQB 5G2IA 4B15A 5LA0A 1M1BA 4RDVA 1CXIA 3LLFA 1QWKA 2ZTKA 3P74A 1XLIA 2Z1BA 4H6EA 1ZRQA 1VQTA 4L9YA 2OSWA 1CNVA 1KFCA 3VKCA 5DMYA 2WCGA 1RLDA 4MFEA 2GGGA 4W5UA 4AIEA 3NSXA 3QR1A 4FOJA 1U1UA 1JCYA 2WMIB 3CM4A 3QGVA 3EBVA 5M1TA 1WZLA 2FFIA 4I9AA 2OGYA 1A0DA 3W7GA 1AZ1A 1IEXA 1SMDA 3ZLGA 2X0HA 3W29A 3AROA 3SIMA 3V1PA 2FZNA 1NARA 1LOSA 1BFNA 1TJ0A 1H7XA 4W86A 5C9ZA 1FQ0A 2HK1A 4PMJA 4GHRA 1N8IA 1GVRA 3M64A 1F8MA 5LHEA 4C7DA 4M6UA 3HZ3A 2J62A 2RDUA 5A8QA 1MRQA 4JR5A 3AXXA 3QN3A 1XDLA 3BG3A 3FGCB 3H2NA 2H3BA 1CXLA 2C6QA 3GX9A 4R27A 1FKRA 4L9ZA 2W61A 1LWHA 1UW9A 4JQ3A 2ZUWA 3W2JA 2WNZA 4S3BA 4LB3A 3DHFA 4DAFA 1J8VA 4OWGA 4O18A 1F73A 1J5TA 2TRSA 4F0KA 1YPXA 2XIMA 1DJYA 1EC7A 1PKYA 2XFFA 3FJ6A 3QMSA 4NT0A 2PRMA 1M04A 4O1EA 3SGZA 1OG6A 1OFDA 4CU7A 1XBZA 1TCMA 1XIFA 2P8CA 4AHPA 1X7FA 3M0JA 2V67A 5F4SA 4E0CA 2G97A 4TYOA 5E93A 4X22A 4TX6A 1QJWA 2ALRA 1P0NA 3B06A 1X96A 3WNLA 3VNLA 1LYXA 1ZSXA 4DBWA 2PDXA 3TTEA 4QT2A 3WQOA 1R46A 2A7PA 2FIQA 5ABGA 3VIHA 5DXXA 3UWWA 1SUXA 3DG6A 4FXJA 3PBUA 4XBSA 3FSUA 3UPWA 1KD0A 4NNRA 4PMUA 1KT1A 4Q8PA 4E6MA 1JD7A 1MMFA 2XVLA 9XIMA 1FCBA 1GVEA 2G50A 1F9CA 3KZSA 3LHVA 3ATZA 4UBPC 4UZUA 4Q4SA 3T55A 4IFKB 1XW8A 3KBJA 3QFWA 1WDRA 4W88A 3ANVA 3ENLA 4G8TA 3CH0A 3SN1A 3GVGA 3P8IA 3S1VA 2EXOA 4W85A 4ZENA 4PUUA 3KACA 2NT0A 2ZE0A 3GC2A 3R4IA 3WLPA 4ODQA 1R2TA 4JDBA 1GG0A 1BYAA 1V3IA 5F4WA 2Z6JA 1M6JA 4YXGA 5BMWA 4OFCA 3WJYA 1AJZA 4GX9A 4XTIA 1CCWB 2QUVA 3TTOA 2D73A 3VVGA 1ICPA 1T7LA 4JHMA 2J75A 3MV11 3BMXA 1O5KA 3HMJG 3DHDA 1B3XA 2HWGA 1FRBA 3OGVA 1M7OA 2Y0FA 3EB4A 2MLZA 2XZ7A 3ZMRA 3M0LA 4A05A 1DTNA 2QVHA 2OX1A 3MS8A 4JTFA 3GXDA 4ZB2A 4CVWA 2PDCA 4K1GA 3G8EA 2CLHA 3W1XA 2B31A 1Q8AA 3VIFA 4DRJA 4ZGYA 1ZBCA 4P8UA 2WWDA 2VYOA 3NQEA 4WY0F 3ID7A 5J5DA 3OEXA 4AWTA 4O0ZA 4L6OA 4L1XA 1XLKA 4LUTB 4FS9A 1G5AA 2ACQA 4DJDD 4GIEA 3WLSA 4XZ9A 4AC7C 4FPSA 3TJXA 5HUOA 1JEZA 3C61A 2R94A 1W5PA 1NFPA 1H60A 3TN4A 3E02A 2UZ5A 1B9BA 2QAPA 3COTA 4BJHA 3VZXA 4LUIA 1TPEA 3WQ6A 3BAYA 5IRPA 4MLRA 4B5NA 3C0QA 1VRXA 4C6PA 1E43A 3WBXA 3H70A 1V79A 5C2GA 3G1XA 4FN2A 3NQAA 3G6MA 5DF0A 4WJEA 1C29A 3FVMA 3GRIA 4MG4A 4J4NA 2ZRVA 1IIGA 4JAWA 5HPOA 3R89A 4OHQA 1CEOA 1XH0A 3JU2A 1EF2A 1A4MA 3WCZA 2YLLA 1G6CA 4C5ZA 4QGCA 1MXDA 3UXIA 5E0FA 4DBEA 1RQHA 1W1PA 4UWMA 1TQXA 1XJBA 1IV8A 2P3EA 4JTDA 5C9WA 3HBLA 3HN3A 4UR7A 4H8UA 5CC3A 2GJRA 1ISYA 3LLDA 3SCUA 1H5YA 3QQ0A 3VFCA 4PN2A 4GFIA 2H3DA 5GQBA 1XRSA 3W00A 4W4QA 1BPLB 3E5PA 4PSRA 4LVGA 2X0YA 5FEZA 3CGNA 2WBKA 1NU5A 1JCXA 2YJQA 2O92A 1TZZA 4OZOA 1ESWA 3GH7A 3FFSA 3WL1A 1ME9A 4PCFA 3A23A 4J27A 3NVDA 3IJ6A 3BUVA 4AZ6A 3R8HA 1E0WA 1OX6A 3RCYA 2ZZ3A 3HPSA 1VJSA 2EGZA 1CXEA 3T8LA 1R3YA 3PWGA 2WWCA 4LCRA 3DU0A 3UNTA 1GYLA 1DXFA 3SQLA 5CBBA 1Q6GA 3BW2A 4DZ2A 4I7WA 2V82A 3MO7A 3LUOA 1YXDA 3BURA 1FX6A 4LB4A 1SJBA 4F66A 5AC6A 3VAWA 2R1NA 4HOXA 4IISA 3OHIA 1Q6HA 3XINA 1SZGA 3GTYX 2A7NA 1VH7A 2XUCA 3RXZA 1A5NC 1TV3A 2GSEA 2FH6A 3VGGA 2WM0A 2HRWA 5TAOA 2R1LA 3FAWA 4IIGA 4QE4A 1FWTA 3WEOA 3WLLA 2G95A 3H2MA 1US3A 2GK1B 3OTRA 4V28A 3VFLA 5BCAA 4ZQOA 4G1NA 3O2LA 4C02B 3B05A 3R5EA 1PTAA 1WKEA 4P2VA 3ZR6A 2DW6A 1X1NA 1X97A 4W5ZA 4I5XA 4Q7IA 3VXGA 3NRKA 1XFBA 3GS6A 3TJLA 2PBCA 4P5UA 4PFHA 1E6PA 2YBVA 2PRLA 3B8WA 1QU4A 4FZIA 4DUOA 2CLKA 1ZCNA 1OEPA 4NZ3A 4ORMA 4A4AA 1E55A 4KCWA 1OFRA 1RK6A 2YZ5A 4NI3A 4DZ5A 2IXUA 4GH3A 2OZ3A 3VOGA 1JNEA 4Z17A 5CGTA 1QT1A 9CGTA 2E1DA 3NTPA 1UOKA 4NL1A 3VC6A 3GW3A 1SGJA 1W31A 3B97A 2MUCA 4JTCA 1PHQA 3L9CA 1EIBA 3UY8A 3WF3A 2JK2A 5KZMA 4XD4A 2I9EA 3SCOA 3MUZ1 4X0VA 1W5MA 3VOFA 2OFJA 3VPLA 1G94A 3WMLA 4D8ZA 3K8MA 2NLYA 1BLIA 3CWNA 3WF1A 3MI3A 1EIXA 3TYDA 1Z48A 1LROA 2P5NA 2BOGX 4D6DA 3S1WA