4TW6A

The fk1 domain of fkbp51 in complex with ifit1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw6A00
3O5LA 3CGNA 1NMVA 5BXJA 1TCOC 4W9OA 2XP6A 2L2SA 2Y78A 1NMWA 1BL4A 2ITKA 1FKHA 2MPHA 3PRDA 4JYSA 4QT3A 2AWGA 5HW8A 3H9RB 1C9HA 3JXVA 5GPGA 4DRHA 2ZQVA 1R9HA 2XP8A 1PINA 2PV1A 5HKGA 4J4NA 1FKRA 4GIVA 3IHZA 3O5DA 3ODKA 2M08A 1ZCNA 2DG4A 4ODRA 3KZ7A 4LAWA 4TW8A 5HUAA 2RUCA 1ROUA 4IQ2A 2KO7A 5B8IC 1N1AA 3O5KA 4MGVA 1FKSA 3EY6A 1Y0OA 2F21A 2N87A 1YW5A 3NI6A 4W9QA 3LUOA 2ZR6A 1D7HA 4ODOA 4DRKA 2XP7A 4TW7A 3UQAA 1A7XA 3PRBA 3UQIA 2JZVA 4LAXA 2KI3A 1Q1CA 1FAPA 2ZQTA 2KGJA 4ODPA 2XP4A 1B6CA 3OOBA 3JYMA 5HT1A 4QT2A 4ODQA 2KR7A 3O5OA 1FKTA 3KAHA 4TW6A 1ZK6A 1FKGA 3RGCA 4DRQA 4FAPA 2XPBA 3O5RA 5D75A 5HWCA 4FN2A 4IPXA 2VN1A 3O5EA 4DZ3A 1F40A 1FJDA 4DH0A 4N19A 2DG3A 3PA7A 4DRJA 3B7XA 4DRMA 1FKDA 1M5YA 4ODLA 2F4EA 2PPPA 4J4OA 4LAVA 4IQCA 3IK8A 1J4RA 2IF4A 1J4HA 4TX0A 3KAIA 2LJ4A 3O5PA 5HW7A 3KAGA 3CGMA 3TDBA 2DG9A 4JFLA 1FD9A 1FKLA 1NSGA 3FAPA 3NRKA 1QPFA 3O5MA 4ITZA 5HWBA 2F2DA 4TNSA 5HW6A 3GPKA 1FKKA 4DT4A 1EQ3A 2MLXA 4JFKA 3UI5A 2OFNA 5DIVA 2PPNA 4JFJA 1Q6IA 1KT0A 2LPVA 2UZ5A 3KADA 1PBKA 2XP3A 3IKGA 4R0XA 4NNRA 1T11A 3UF8A 3VAWA 4DRNA 1Q6UA 2PV3A 2RSEA 2RUQA 3JYJA 2FAPA 4DRPA 4G50A 1F8AB 2ZQSA 3UQBA 2RURA 2LKNA 1D7IA 1YATA 1Q6HA 2M2AA 2ZR4A 4U84A 1FKIA 3IKDA 1ROTA 2ZR5A 2MNTA 3TC5A 1FKBA 4U85A 3TCZA 4W9PA 3MDYB 2FKEA 3WH0A 4QIBA 1W26A 2MLYA 3O5FA 4O2TA 5DIUA 3KABA 1L1PA 2M1IA 4G2PA 2PPOA 4GGQA 4ODNA 4U86A 1J4IA 3KCEA 1FKJA 1D6OA 3UI6A 2VCDA 2ZQUA 2D9FA 3O5QA 2PBCA 4JFMA 3RFWA 4DIPA 2KFWA 2RUDA 4DRIA 4TYOA 1QZ2A 2LGOA 1HXVA 2K8IA 4ODKA 4MSPA 1P5QA 3UI4A 1JNTA 1BKFA 3O5GA 4C02B 2MF9A 2PV2A 2XP5A 4LAYA 5I98A 1J6YA 3O5JA 1JNSA 4JFIA 1U79A 1EYMA 2KE0A 3KAFA 4DZ2A 2XP9A 3NTPA 5HTGA 4BF8A 5J6EA 4ODMA 3KACA 3I6CA 3O5IA 2RQSA 1D7JA 2XPAA 2MLZA 1FKFA 5DITA 2Q5AA 1KT1A 4DROA 1JVWA 1QPLA
chains in the Genus database with same CATH superfamily
3CGNA 1NWTA 4W9OA 1VF8A 2L2SA 2Y78A 3PRDA 1BL4A 4JYSA 2EULA 1HJWA 3WL1A 2ZQVA 1W9VA 4Z2KA 1PINA 5GQBA 2PV1A 3B9EA 2B31A 1NH6A 3AROA 5HUAA 2XPAA 1ROUA 2KO7A 4MGVA 1FKSA 2F21A 1YW5A 3LUOA 1OGGA 3UQIA 2A3CA 4DWSD 2KI3A 3CHFA 3W4RA 2KGJA 1B6CA 4HBOA 3PRAA 1TFVA 1KFWA 3O5OA 4TW6A 1FKGA 4R5EA 1SYTA 3BXWA 2ESCA 4FN2A 3O5EA 1ZBVA 5HBFA 4N19A 3WD4A 4WKFA 4MNLA 2PPPA 4IQCA 3ARSA 1JCHB 2DG9A 4JFLA 3AS0A 4URIA 1W1YA 1W1PA 2O92A 2PN0A 1EQ3A 3UI5A 2DSVA 1KT0A 2UZ5A 3KADA 2A3EA 4MAVA 4NNRA 3UF8A 2PV3A 2RSEA 2RUQA 2FAPA 4DRPA 4G50A 1F8AB 2ZQSA 3AS1A 1D7IA 2ZR4A 4ZPVR 5DF0A 1SR0A 4U85A 4W9PA 3MDYB 1IX5A 1LJYA 3WH0A 4QIBA 5DIUA 3ARXA 2M1IA 2PPOA 4Q22A 4DWSC 4U86A 4JFMA 2D9FA 3RFWA 1O6IA 1X6LA 4WK9A 4MSPA 2YBUA 1P5QA 4C02B 3CHEA 2MF9A 1J6YA 4LAYA 4UDMA 3WQWA 1NWSA 1FKFA 2Q5AA 1JVWA 3AQUA 3O5LA 4WKAA 4Z2IA 3ALGA 1EDQA 2MPHA 1NWRA 5HW8A 2DSWA 3JXVA 4DRHA 1LL4A 1E6RA 2B5UB 2WLYA 1WNOA 3ARYA 5DO2A 4GIVA 3IHZA 3ODKA 2M08A 3KZ7A 2A3BA 4IQ2A 2DSZA 5GPRA 1HKIA 5B8IC 2N87A 3NI6A 3CHCA 1D7HA 3WD3A 1A7XA 1EIBA 3G6MA 4PTMA 1FAPA 3BMBA 1E6ZA 2XP4A 3ARTA 5HT1A 4QT2A 4ODQA 1OGBA 1HJXA 2VN1A 1D2KA 2DG3A 3G6LA 4DRJA 3B7XA 4DRMA 1FKDA 4ODLA 2F4EA 1J4RA 5HW7A 1J4HA 3KAIA 3O5PA 3CGMA 1HKJA 4WKHA 1GRJA 1RD6A 1NSGA 1ZU8A 2WLZA 1XRVA 4ITZA 4TNSA 2A3AA 3GPKA 4KR0B 4DT4A 2MLXA 1ZBCA 5DIVA 4JFJA 1Q6IA 3IKGA 4ZPWR 1NWUA 1Q6UA 3JYJA 3RMEA 2O9OA 2RURA 3WD2A 1YATA 2M2AA 3FXYA 4U84A 5JH8A 3IKDA 1ROTA 2MNTA 4S3JA 3ARPA 1CTNA 2FKEA 2MLYA 3KABA 1HKKA 1L1PA 4GGQA 1J4IA 3KCEA 1D6OA 3UI6A 1E6PA 2VCDA 2PBCA 4XAKA 2DT0A 1HXVA 2K8IA 1JNTA 4S3KA 4DZ2A 2XP9A 4BF8A 1X6NA 3I6CA 3O5IA 1D7JA 4DROA 1TCOC 3GTYX 4WJXA 2XP6A 1JNDA 1NMWA 2ITKA 1FKHA 4W5UA 2AWGA 5GPGA 1R9HA 2XP8A 3RM4A 1LL6A 4J4NA 4ODRA 1ITXA 2RUCA 1LG2A 3CHDA 3O5KA 1K9TA 1H0GA 3PRBA 2DT3A 1Q1CA 3WD1A 3B9DA 2ZQTA 4ODPA 4HARA 4MTVA 3JYMA 2KR7A 1UR9A 1FKTA 3KAHA 3WL0A 3WIJA 4DRQA 3RGCA 2YBTA 4Z2GA 2XPBA 5D75A 1E9LA 3GU0A 5HWCA 4DZ3A 1FJDA 3PA7A 2WM0A 3CH9A 1ZL1A 4J4OA 3IK8A 2IF4A 1HKMA 2LJ4A 2OLHA 2DT1A 4DWSA 1FKLA 3FAPA 2AOSA 2F2DA 1FKKA 4JFKA 2OFNA 1FFRA 1GOIA 4R0XA 3FY1A 2ETNA 3WD0A 3B9AA 1W1TA 1W9PA 3ARQA 1FKIA 3ARRA 3TC5A 1E15A 3TCZA 4KQZA 1W26A 3O5FA 4G2PA 1WAWA 4ODNA 2WK2A 1FKJA 2ZQUA 1FFQA 4DIPA 1ZB5A 3OA5A 3ARVA 3AS3A 4DRIA 4MNKA 4TYOA 1QZ2A 2LGOA 1GPFA 4MPKA 3UI4A 2FDMA 3WQVA 5I98A 2PV2A 2XP5A 1JNSA 1U79A 1EYMA 3ARUA 5J6EA 4ODMA 3KACA 2RQSA 5DITA 1KT1A 1QPLA 2DSUA 1NMVA 1HJVA 5BXJA 1JNEA 4HBEA 1ZBWA 1EHNA 4QT3A 3H9RB 1C9HA 2IUZA 4Z2HA 5HKGA 1FKRA 3O5DA 2F23A 4TW8A 1ZCNA 2DG4A 4LAWA 3RM9A 4AY1A 1N1AA 4WIWA 1E6NA 1XHGA 1Y0OA 3EY6A 4W9QA 3EIPA 2ZR6A 4ODOA 4DRKA 2XP7A 4TW7A 3ARZA 3UQAA 2JZVA 4LAXA 4MNJA 1WB0A 4P8XA 3OOBA 1LL7A 4MNMA 1ZK6A 4FAPA 3O5RA 4IPXA 2PI6A 1F40A 4DH0A 2DT2A 1M5YA 1W1VA 4LAVA 4TX0A 3ARWA 5DEZA 3KAGA 1LG1A 1OWQA 4P8UA 3TDBA 1FD9A 1UR8A 3QOKA 4ZPTR 3O5MA 3NRKA 1QPFA 5HWBA 5HW6A 4IT6A 4IT4A 1E44A 1H0IA 2PPNA 2LPVA 1PBKA 2XP3A 4DWSB 1T11A 3VAWA 4DRNA 4ZS6A 3UQBA 2LKNA 1GUVA 4NSBA 4ML4A 4NZCA 1Q6HA 4L3NA 1ZBKA 2ZR5A 4Z2LA 1FKBA 2P4VA 3RM8A 4Z2JA 4O2TA 1W9UA 4Q7NA 3ALFA 3O5QA 3CZ8A 2KFWA 4P8VA 2RUDA 1LQ0A 2G8ZA 4ODKA 4P8WA 1BKFA 3O5GA 3O5JA 4JFIA 2G41A 2KE0A 3KAFA 4QZVB 3NTPA 3PR9A 5HTGA 3WKZA 4L72B 3AS2A 3B8SA 2MLZA 2DPEA 4LGXA 2QF8A
chains in the Genus database with same CATH topology
3CGNA 1NWTA 4W9OA 1VF8A 2L2SA 2Y78A 3PRDA 1BL4A 4JYSA 1HJWA 3WL1A 2ZQVA 1W9VA 4Z2KA 1PINA 5GQBA 2PV1A 3B9EA 2B31A 1NH6A 3AROA 5HUAA 2XPAA 1ROUA 2KO7A 4MGVA 1FKSA 2F21A 1YW5A 3LUOA 1OGGA 3UQIA 2A3CA 4DWSD 2KI3A 3CHFA 3W4RA 2KGJA 1B6CA 4HBOA 3PRAA 1TFVA 1KFWA 3O5OA 4TW6A 1FKGA 4R5EA 1SYTA 3BXWA 2ESCA 4FN2A 3O5EA 1ZBVA 5HBFA 4N19A 3WD4A 4WKFA 4MNLA 2PPPA 4IQCA 3ARSA 2DG9A 4JFLA 3AS0A 4URIA 1W1YA 1W1PA 2O92A 1EQ3A 3UI5A 2DSVA 1KT0A 2UZ5A 3KADA 2A3EA 4MAVA 4NNRA 3UF8A 2PV3A 2RSEA 2RUQA 2FAPA 4DRPA 4G50A 1F8AB 2ZQSA 3AS1A 1D7IA 2ZR4A 4ZPVR 5DF0A 1SR0A 4U85A 4W9PA 3MDYB 1IX5A 1LJYA 3WH0A 4QIBA 5DIUA 3ARXA 2M1IA 2PPOA 4Q22A 4DWSC 4U86A 4JFMA 2D9FA 3RFWA 1O6IA 1X6LA 4WK9A 4MSPA 2YBUA 1P5QA 4C02B 3CHEA 2MF9A 1J6YA 4LAYA 3WQWA 1NWSA 1FKFA 2Q5AA 1JVWA 3AQUA 3O5LA 4WKAA 4Z2IA 3ALGA 1EDQA 2MPHA 1NWRA 5HW8A 2DSWA 3JXVA 4DRHA 1LL4A 1E6RA 2WLYA 1WNOA 3ARYA 5DO2A 4GIVA 3IHZA 3ODKA 2M08A 3KZ7A 2A3BA 4IQ2A 2DSZA 5GPRA 1HKIA 5B8IC 2N87A 3NI6A 3CHCA 1D7HA 3WD3A 1A7XA 1EIBA 3G6MA 4PTMA 1FAPA 1E6ZA 2XP4A 3ARTA 5HT1A 4QT2A 4ODQA 1OGBA 1HJXA 2VN1A 1D2KA 2DG3A 3G6LA 4DRJA 3B7XA 4DRMA 1FKDA 4ODLA 2F4EA 1J4RA 5HW7A 1J4HA 3KAIA 3O5PA 3CGMA 1HKJA 4WKHA 1RD6A 1NSGA 1ZU8A 2WLZA 1XRVA 4ITZA 4TNSA 2A3AA 3GPKA 4KR0B 4DT4A 2MLXA 1ZBCA 5DIVA 4JFJA 1Q6IA 3IKGA 4ZPWR 1NWUA 1Q6UA 3JYJA 3RMEA 2O9OA 2RURA 3WD2A 1YATA 2M2AA 3FXYA 4U84A 5JH8A 3IKDA 1ROTA 2MNTA 4S3JA 3ARPA 1CTNA 2FKEA 2MLYA 3KABA 1HKKA 1L1PA 4GGQA 1J4IA 3KCEA 1D6OA 3UI6A 1E6PA 2VCDA 2PBCA 4XAKA 2DT0A 1HXVA 2K8IA 1JNTA 4S3KA 4DZ2A 2XP9A 4BF8A 1X6NA 3I6CA 3O5IA 1D7JA 4DROA 1TCOC 4WJXA 2XP6A 1JNDA 1NMWA 2ITKA 1FKHA 4W5UA 2AWGA 5GPGA 1R9HA 2XP8A 3RM4A 1LL6A 4J4NA 4ODRA 1ITXA 2RUCA 1LG2A 3CHDA 3O5KA 1K9TA 1H0GA 3PRBA 2DT3A 1Q1CA 3WD1A 3B9DA 2ZQTA 4ODPA 4HARA 4MTVA 3JYMA 2KR7A 1UR9A 1FKTA 3KAHA 3WL0A 3WIJA 4DRQA 3RGCA 2YBTA 4Z2GA 2XPBA 5D75A 1E9LA 5HWCA 4DZ3A 1FJDA 3PA7A 2WM0A 3CH9A 1ZL1A 4J4OA 3IK8A 2IF4A 1HKMA 2LJ4A 2OLHA 2DT1A 4DWSA 1FKLA 3FAPA 2AOSA 2F2DA 1FKKA 4JFKA 2OFNA 1FFRA 1GOIA 4R0XA 3FY1A 3WD0A 3B9AA 1W1TA 1W9PA 3ARQA 1FKIA 3ARRA 3TC5A 1E15A 3TCZA 4KQZA 1W26A 3O5FA 4G2PA 1WAWA 4ODNA 2WK2A 1FKJA 2ZQUA 1FFQA 4DIPA 1ZB5A 3OA5A 3ARVA 3AS3A 4DRIA 4MNKA 4TYOA 1QZ2A 2LGOA 1GPFA 4MPKA 3UI4A 2FDMA 3WQVA 5I98A 2PV2A 2XP5A 1JNSA 1U79A 1EYMA 3ARUA 5J6EA 4ODMA 3KACA 2RQSA 5DITA 1KT1A 1QPLA 2DSUA 1NMVA 1HJVA 5BXJA 1JNEA 4HBEA 1ZBWA 1EHNA 4QT3A 3H9RB 1C9HA 2IUZA 4Z2HA 5HKGA 1FKRA 3O5DA 4TW8A 1ZCNA 2DG4A 4LAWA 3RM9A 4AY1A 1N1AA 4WIWA 1E6NA 1XHGA 1Y0OA 3EY6A 4W9QA 2ZR6A 4ODOA 4DRKA 2XP7A 4TW7A 3ARZA 3UQAA 2JZVA 4LAXA 4MNJA 1WB0A 4P8XA 3OOBA 1LL7A 4MNMA 1ZK6A 4FAPA 3O5RA 4IPXA 2PI6A 1F40A 4DH0A 2DT2A 1M5YA 1W1VA 4LAVA 4TX0A 3ARWA 5DEZA 3KAGA 1LG1A 1OWQA 4P8UA 3TDBA 1FD9A 1UR8A 3QOKA 4ZPTR 3O5MA 3NRKA 1QPFA 5HWBA 5HW6A 4IT6A 4IT4A 1H0IA 2PPNA 2LPVA 1PBKA 2XP3A 4DWSB 1T11A 3VAWA 4DRNA 4ZS6A 3UQBA 2LKNA 1GUVA 4NSBA 4ML4A 4NZCA 1Q6HA 4L3NA 1ZBKA 2ZR5A 4Z2LA 1FKBA 3RM8A 4Z2JA 4O2TA 1W9UA 4Q7NA 3ALFA 3O5QA 3CZ8A 2KFWA 4P8VA 2RUDA 1LQ0A 2G8ZA 4ODKA 4P8WA 1BKFA 3O5GA 3O5JA 4JFIA 2G41A 2KE0A 3KAFA 4QZVB 3NTPA 3PR9A 5HTGA 3WKZA 4L72B 3AS2A 3B8SA 2MLZA 2DPEA 4LGXA 2QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5L A;  3CGN A;  1NMV A;  5BXJ A;  1TCO C;  4W9O A;  2XP6 A;  2L2S A;  2Y78 A;  1NMW A;  1BL4 A;  2ITK A;  1FKH A;  2MPH A;  3PRD A;  4JYS A;  4QT3 A;  2AWG A;  5HW8 A;  3H9R B;  1C9H A;  3JXV A;  5GPG A;  4DRH A;  2ZQV A;  1R9H A;  2XP8 A;  1PIN A;  2PV1 A;  5HKG A;  4J4N A;  1FKR A;  4GIV A;  3IHZ A;  3O5D A;  3ODK A;  2M08 A;  1ZCN A;  2DG4 A;  4ODR A;  3KZ7 A;  4LAW A;  4TW8 A;  5HUA A;  2RUC A;  1ROU A;  4IQ2 A;  2KO7 A;  5B8I C;  1N1A A;  3O5K A;  4MGV A;  1FKS A;  3EY6 A;  1Y0O A;  2F21 A;  2N87 A;  1YW5 A;  3NI6 A;  4W9Q A;  3LUO A;  2ZR6 A;  1D7H A;  4ODO A;  4DRK A;  2XP7 A;  4TW7 A;  3UQA A;  1A7X A;  3PRB A;  3UQI A;  2JZV A;  4LAX A;  2KI3 A;  1Q1C A;  1FAP A;  2ZQT A;  2KGJ A;  4ODP A;  2XP4 A;  1B6C A;  3OOB A;  3JYM A;  5HT1 A;  4QT2 A;  4ODQ A;  2KR7 A;  3O5O A;  1FKT A;  3KAH A;  4TW6 A;  1ZK6 A;  1FKG A;  3RGC A;  4DRQ A;  4FAP A;  2XPB A;  3O5R A;  5D75 A;  5HWC A;  4FN2 A;  4IPX A;  2VN1 A;  3O5E A;  4DZ3 A;  1F40 A;  1FJD A;  4DH0 A;  4N19 A;  2DG3 A;  3PA7 A;  4DRJ A;  3B7X A;  4DRM A;  1FKD A;  1M5Y A;  4ODL A;  2F4E A;  2PPP A;  4J4O A;  4LAV A;  4IQC A;  3IK8 A;  1J4R A;  2IF4 A;  1J4H A;  4TX0 A;  3KAI A;  2LJ4 A;  3O5P A;  5HW7 A;  3KAG A;  3CGM A;  3TDB A;  2DG9 A;  4JFL A;  1FD9 A;  1FKL A;  1NSG A;  3FAP A;  3NRK A;  1QPF A;  3O5M A;  4ITZ A;  5HWB A;  2F2D A;  4TNS A;  5HW6 A;  3GPK A;  1FKK A;  4DT4 A;  1EQ3 A;  2MLX A;  4JFK A;  3UI5 A;  2OFN A;  5DIV A;  2PPN A;  4JFJ A;  1Q6I A;  1KT0 A;  2LPV A;  2UZ5 A;  3KAD A;  1PBK A;  2XP3 A;  3IKG A;  4R0X A;  4NNR A;  1T11 A;  3UF8 A;  3VAW A;  4DRN A;  1Q6U A;  2PV3 A;  2RSE A;  2RUQ A;  3JYJ A;  2FAP A;  4DRP A;  4G50 A;  1F8A B;  2ZQS A;  3UQB A;  2RUR A;  2LKN A;  1D7I A;  1YAT A;  1Q6H A;  2M2A A;  2ZR4 A;  4U84 A;  1FKI A;  3IKD A;  1ROT A;  2ZR5 A;  2MNT A;  3TC5 A;  1FKB A;  4U85 A;  3TCZ A;  4W9P A;  3MDY B;  2FKE A;  3WH0 A;  4QIB A;  1W26 A;  2MLY A;  3O5F A;  4O2T A;  5DIU A;  3KAB A;  1L1P A;  2M1I A;  4G2P A;  2PPO A;  4GGQ A;  4ODN A;  4U86 A;  1J4I A;  3KCE A;  1FKJ A;  1D6O A;  3UI6 A;  2VCD A;  2ZQU A;  2D9F A;  3O5Q A;  2PBC A;  4JFM A;  3RFW A;  4DIP A;  2KFW A;  2RUD A;  4DRI A;  4TYO A;  1QZ2 A;  2LGO A;  1HXV A;  2K8I A;  4ODK A;  4MSP A;  1P5Q A;  3UI4 A;  1JNT A;  1BKF A;  3O5G A;  4C02 B;  2MF9 A;  2PV2 A;  2XP5 A;  4LAY A;  5I98 A;  1J6Y A;  3O5J A;  1JNS A;  4JFI A;  1U79 A;  1EYM A;  2KE0 A;  3KAF A;  4DZ2 A;  2XP9 A;  3NTP A;  5HTG A;  4BF8 A;  5J6E A;  4ODM A;  3KAC A;  3I6C A;  3O5I A;  2RQS A;  1D7J A;  2XPA A;  2MLZ A;  1FKF A;  5DIT A;  2Q5A A;  1KT1 A;  4DRO A;  1JVW A;  1QPL A; 
#chains in the Genus database with same CATH topology
 3CGN A;  1NWT A;  4W9O A;  1VF8 A;  2L2S A;  2Y78 A;  3PRD A;  1BL4 A;  4JYS A;  2EUL A;  1HJW A;  3WL1 A;  2ZQV A;  1W9V A;  4Z2K A;  1PIN A;  5GQB A;  2PV1 A;  3B9E A;  2B31 A;  1NH6 A;  3ARO A;  5HUA A;  2XPA A;  1ROU A;  2KO7 A;  4MGV A;  1FKS A;  2F21 A;  1YW5 A;  3LUO A;  1OGG A;  3UQI A;  2A3C A;  4DWS D;  2KI3 A;  3CHF A;  3W4R A;  2KGJ A;  1B6C A;  4HBO A;  3PRA A;  1TFV A;  1KFW A;  3O5O A;  4TW6 A;  1FKG A;  4R5E A;  1SYT A;  3BXW A;  2ESC A;  4FN2 A;  3O5E A;  1ZBV A;  5HBF A;  4N19 A;  3WD4 A;  4WKF A;  4MNL A;  2PPP A;  4IQC A;  3ARS A;  1JCH B;  2DG9 A;  4JFL A;  3AS0 A;  4URI A;  1W1Y A;  1W1P A;  2O92 A;  2PN0 A;  1EQ3 A;  3UI5 A;  2DSV A;  1KT0 A;  2UZ5 A;  3KAD A;  2A3E A;  4MAV A;  4NNR A;  3UF8 A;  2PV3 A;  2RSE A;  2RUQ A;  2FAP A;  4DRP A;  4G50 A;  1F8A B;  2ZQS A;  3AS1 A;  1D7I A;  2ZR4 A;  4ZPV R;  5DF0 A;  1SR0 A;  4U85 A;  4W9P A;  3MDY B;  1IX5 A;  1LJY A;  3WH0 A;  4QIB A;  5DIU A;  3ARX A;  2M1I A;  2PPO A;  4Q22 A;  4DWS C;  4U86 A;  4JFM A;  2D9F A;  3RFW A;  1O6I A;  1X6L A;  4WK9 A;  4MSP A;  2YBU A;  1P5Q A;  4C02 B;  3CHE A;  2MF9 A;  1J6Y A;  4LAY A;  4UDM A;  3WQW A;  1NWS A;  1FKF A;  2Q5A A;  1JVW A;  3AQU A;  3O5L A;  4WKA A;  4Z2I A;  3ALG A;  1EDQ A;  2MPH A;  1NWR A;  5HW8 A;  2DSW A;  3JXV A;  4DRH A;  1LL4 A;  1E6R A;  2B5U B;  2WLY A;  1WNO A;  3ARY A;  5DO2 A;  4GIV A;  3IHZ A;  3ODK A;  2M08 A;  3KZ7 A;  2A3B A;  4IQ2 A;  2DSZ A;  5GPR A;  1HKI A;  5B8I C;  2N87 A;  3NI6 A;  3CHC A;  1D7H A;  3WD3 A;  1A7X A;  1EIB A;  3G6M A;  4PTM A;  1FAP A;  3BMB A;  1E6Z A;  2XP4 A;  3ART A;  5HT1 A;  4QT2 A;  4ODQ A;  1OGB A;  1HJX A;  2VN1 A;  1D2K A;  2DG3 A;  3G6L A;  4DRJ A;  3B7X A;  4DRM A;  1FKD A;  4ODL A;  2F4E A;  1J4R A;  5HW7 A;  1J4H A;  3KAI A;  3O5P A;  3CGM A;  1HKJ A;  4WKH A;  1GRJ A;  1RD6 A;  1NSG A;  1ZU8 A;  2WLZ A;  1XRV A;  4ITZ A;  4TNS A;  2A3A A;  3GPK A;  4KR0 B;  4DT4 A;  2MLX A;  1ZBC A;  5DIV A;  4JFJ A;  1Q6I A;  3IKG A;  4ZPW R;  1NWU A;  1Q6U A;  3JYJ A;  3RME A;  2O9O A;  2RUR A;  3WD2 A;  1YAT A;  2M2A A;  3FXY A;  4U84 A;  5JH8 A;  3IKD A;  1ROT A;  2MNT A;  4S3J A;  3ARP A;  1CTN A;  2FKE A;  2MLY A;  3KAB A;  1HKK A;  1L1P A;  4GGQ A;  1J4I A;  3KCE A;  1D6O A;  3UI6 A;  1E6P A;  2VCD A;  2PBC A;  4XAK A;  2DT0 A;  1HXV A;  2K8I A;  1JNT A;  4S3K A;  4DZ2 A;  2XP9 A;  4BF8 A;  1X6N A;  3I6C A;  3O5I A;  1D7J A;  4DRO A;  1TCO C;  3GTY X;  4WJX A;  2XP6 A;  1JND A;  1NMW A;  2ITK A;  1FKH A;  4W5U A;  2AWG A;  5GPG A;  1R9H A;  2XP8 A;  3RM4 A;  1LL6 A;  4J4N A;  4ODR A;  1ITX A;  2RUC A;  1LG2 A;  3CHD A;  3O5K A;  1K9T A;  1H0G A;  3PRB A;  2DT3 A;  1Q1C A;  3WD1 A;  3B9D A;  2ZQT A;  4ODP A;  4HAR A;  4MTV A;  3JYM A;  2KR7 A;  1UR9 A;  1FKT A;  3KAH A;  3WL0 A;  3WIJ A;  4DRQ A;  3RGC A;  2YBT A;  4Z2G A;  2XPB A;  5D75 A;  1E9L A;  3GU0 A;  5HWC A;  4DZ3 A;  1FJD A;  3PA7 A;  2WM0 A;  3CH9 A;  1ZL1 A;  4J4O A;  3IK8 A;  2IF4 A;  1HKM A;  2LJ4 A;  2OLH A;  2DT1 A;  4DWS A;  1FKL A;  3FAP A;  2AOS A;  2F2D A;  1FKK A;  4JFK A;  2OFN A;  1FFR A;  1GOI A;  4R0X A;  3FY1 A;  2ETN A;  3WD0 A;  3B9A A;  1W1T A;  1W9P A;  3ARQ A;  1FKI A;  3ARR A;  3TC5 A;  1E15 A;  3TCZ A;  4KQZ A;  1W26 A;  3O5F A;  4G2P A;  1WAW A;  4ODN A;  2WK2 A;  1FKJ A;  2ZQU A;  1FFQ A;  4DIP A;  1ZB5 A;  3OA5 A;  3ARV A;  3AS3 A;  4DRI A;  4MNK A;  4TYO A;  1QZ2 A;  2LGO A;  1GPF A;  4MPK A;  3UI4 A;  2FDM A;  3WQV A;  5I98 A;  2PV2 A;  2XP5 A;  1JNS A;  1U79 A;  1EYM A;  3ARU A;  5J6E A;  4ODM A;  3KAC A;  2RQS A;  5DIT A;  1KT1 A;  1QPL A;  2DSU A;  1NMV A;  1HJV A;  5BXJ A;  1JNE A;  4HBE A;  1ZBW A;  1EHN A;  4QT3 A;  3H9R B;  1C9H A;  2IUZ A;  4Z2H A;  5HKG A;  1FKR A;  3O5D A;  2F23 A;  4TW8 A;  1ZCN A;  2DG4 A;  4LAW A;  3RM9 A;  4AY1 A;  1N1A A;  4WIW A;  1E6N A;  1XHG A;  1Y0O A;  3EY6 A;  4W9Q A;  3EIP A;  2ZR6 A;  4ODO A;  4DRK A;  2XP7 A;  4TW7 A;  3ARZ A;  3UQA A;  2JZV A;  4LAX A;  4MNJ A;  1WB0 A;  4P8X A;  3OOB A;  1LL7 A;  4MNM A;  1ZK6 A;  4FAP A;  3O5R A;  4IPX A;  2PI6 A;  1F40 A;  4DH0 A;  2DT2 A;  1M5Y A;  1W1V A;  4LAV A;  4TX0 A;  3ARW A;  5DEZ A;  3KAG A;  1LG1 A;  1OWQ A;  4P8U A;  3TDB A;  1FD9 A;  1UR8 A;  3QOK A;  4ZPT R;  3O5M A;  3NRK A;  1QPF A;  5HWB A;  5HW6 A;  4IT6 A;  4IT4 A;  1E44 A;  1H0I A;  2PPN A;  2LPV A;  1PBK A;  2XP3 A;  4DWS B;  1T11 A;  3VAW A;  4DRN A;  4ZS6 A;  3UQB A;  2LKN A;  1GUV A;  4NSB A;  4ML4 A;  4NZC A;  1Q6H A;  4L3N A;  1ZBK A;  2ZR5 A;  4Z2L A;  1FKB A;  2P4V A;  3RM8 A;  4Z2J A;  4O2T A;  1W9U A;  4Q7N A;  3ALF A;  3O5Q A;  3CZ8 A;  2KFW A;  4P8V A;  2RUD A;  1LQ0 A;  2G8Z A;  4ODK A;  4P8W A;  1BKF A;  3O5G A;  3O5J A;  4JFI A;  2G41 A;  2KE0 A;  3KAF A;  4QZV B;  3NTP A;  3PR9 A;  5HTG A;  3WKZ A;  4L72 B;  3AS2 A;  3B8S A;  2MLZ A;  2DPE A;  4LGX A;  2QF8 A; 
#chains in the Genus database with same CATH homology
 3CGN A;  1NWT A;  4W9O A;  1VF8 A;  2L2S A;  2Y78 A;  3PRD A;  1BL4 A;  4JYS A;  1HJW A;  3WL1 A;  2ZQV A;  1W9V A;  4Z2K A;  1PIN A;  5GQB A;  2PV1 A;  3B9E A;  2B31 A;  1NH6 A;  3ARO A;  5HUA A;  2XPA A;  1ROU A;  2KO7 A;  4MGV A;  1FKS A;  2F21 A;  1YW5 A;  3LUO A;  1OGG A;  3UQI A;  2A3C A;  4DWS D;  2KI3 A;  3CHF A;  3W4R A;  2KGJ A;  1B6C A;  4HBO A;  3PRA A;  1TFV A;  1KFW A;  3O5O A;  4TW6 A;  1FKG A;  4R5E A;  1SYT A;  3BXW A;  2ESC A;  4FN2 A;  3O5E A;  1ZBV A;  5HBF A;  4N19 A;  3WD4 A;  4WKF A;  4MNL A;  2PPP A;  4IQC A;  3ARS A;  2DG9 A;  4JFL A;  3AS0 A;  4URI A;  1W1Y A;  1W1P A;  2O92 A;  1EQ3 A;  3UI5 A;  2DSV A;  1KT0 A;  2UZ5 A;  3KAD A;  2A3E A;  4MAV A;  4NNR A;  3UF8 A;  2PV3 A;  2RSE A;  2RUQ A;  2FAP A;  4DRP A;  4G50 A;  1F8A B;  2ZQS A;  3AS1 A;  1D7I A;  2ZR4 A;  4ZPV R;  5DF0 A;  1SR0 A;  4U85 A;  4W9P A;  3MDY B;  1IX5 A;  1LJY A;  3WH0 A;  4QIB A;  5DIU A;  3ARX A;  2M1I A;  2PPO A;  4Q22 A;  4DWS C;  4U86 A;  4JFM A;  2D9F A;  3RFW A;  1O6I A;  1X6L A;  4WK9 A;  4MSP A;  2YBU A;  1P5Q A;  4C02 B;  3CHE A;  2MF9 A;  1J6Y A;  4LAY A;  3WQW A;  1NWS A;  1FKF A;  2Q5A A;  1JVW A;  3AQU A;  3O5L A;  4WKA A;  4Z2I A;  3ALG A;  1EDQ A;  2MPH A;  1NWR A;  5HW8 A;  2DSW A;  3JXV A;  4DRH A;  1LL4 A;  1E6R A;  2WLY A;  1WNO A;  3ARY A;  5DO2 A;  4GIV A;  3IHZ A;  3ODK A;  2M08 A;  3KZ7 A;  2A3B A;  4IQ2 A;  2DSZ A;  5GPR A;  1HKI A;  5B8I C;  2N87 A;  3NI6 A;  3CHC A;  1D7H A;  3WD3 A;  1A7X A;  1EIB A;  3G6M A;  4PTM A;  1FAP A;  1E6Z A;  2XP4 A;  3ART A;  5HT1 A;  4QT2 A;  4ODQ A;  1OGB A;  1HJX A;  2VN1 A;  1D2K A;  2DG3 A;  3G6L A;  4DRJ A;  3B7X A;  4DRM A;  1FKD A;  4ODL A;  2F4E A;  1J4R A;  5HW7 A;  1J4H A;  3KAI A;  3O5P A;  3CGM A;  1HKJ A;  4WKH A;  1RD6 A;  1NSG A;  1ZU8 A;  2WLZ A;  1XRV A;  4ITZ A;  4TNS A;  2A3A A;  3GPK A;  4KR0 B;  4DT4 A;  2MLX A;  1ZBC A;  5DIV A;  4JFJ A;  1Q6I A;  3IKG A;  4ZPW R;  1NWU A;  1Q6U A;  3JYJ A;  3RME A;  2O9O A;  2RUR A;  3WD2 A;  1YAT A;  2M2A A;  3FXY A;  4U84 A;  5JH8 A;  3IKD A;  1ROT A;  2MNT A;  4S3J A;  3ARP A;  1CTN A;  2FKE A;  2MLY A;  3KAB A;  1HKK A;  1L1P A;  4GGQ A;  1J4I A;  3KCE A;  1D6O A;  3UI6 A;  1E6P A;  2VCD A;  2PBC A;  4XAK A;  2DT0 A;  1HXV A;  2K8I A;  1JNT A;  4S3K A;  4DZ2 A;  2XP9 A;  4BF8 A;  1X6N A;  3I6C A;  3O5I A;  1D7J A;  4DRO A;  1TCO C;  4WJX A;  2XP6 A;  1JND A;  1NMW A;  2ITK A;  1FKH A;  4W5U A;  2AWG A;  5GPG A;  1R9H A;  2XP8 A;  3RM4 A;  1LL6 A;  4J4N A;  4ODR A;  1ITX A;  2RUC A;  1LG2 A;  3CHD A;  3O5K A;  1K9T A;  1H0G A;  3PRB A;  2DT3 A;  1Q1C A;  3WD1 A;  3B9D A;  2ZQT A;  4ODP A;  4HAR A;  4MTV A;  3JYM A;  2KR7 A;  1UR9 A;  1FKT A;  3KAH A;  3WL0 A;  3WIJ A;  4DRQ A;  3RGC A;  2YBT A;  4Z2G A;  2XPB A;  5D75 A;  1E9L A;  5HWC A;  4DZ3 A;  1FJD A;  3PA7 A;  2WM0 A;  3CH9 A;  1ZL1 A;  4J4O A;  3IK8 A;  2IF4 A;  1HKM A;  2LJ4 A;  2OLH A;  2DT1 A;  4DWS A;  1FKL A;  3FAP A;  2AOS A;  2F2D A;  1FKK A;  4JFK A;  2OFN A;  1FFR A;  1GOI A;  4R0X A;  3FY1 A;  3WD0 A;  3B9A A;  1W1T A;  1W9P A;  3ARQ A;  1FKI A;  3ARR A;  3TC5 A;  1E15 A;  3TCZ A;  4KQZ A;  1W26 A;  3O5F A;  4G2P A;  1WAW A;  4ODN A;  2WK2 A;  1FKJ A;  2ZQU A;  1FFQ A;  4DIP A;  1ZB5 A;  3OA5 A;  3ARV A;  3AS3 A;  4DRI A;  4MNK A;  4TYO A;  1QZ2 A;  2LGO A;  1GPF A;  4MPK A;  3UI4 A;  2FDM A;  3WQV A;  5I98 A;  2PV2 A;  2XP5 A;  1JNS A;  1U79 A;  1EYM A;  3ARU A;  5J6E A;  4ODM A;  3KAC A;  2RQS A;  5DIT A;  1KT1 A;  1QPL A;  2DSU A;  1NMV A;  1HJV A;  5BXJ A;  1JNE A;  4HBE A;  1ZBW A;  1EHN A;  4QT3 A;  3H9R B;  1C9H A;  2IUZ A;  4Z2H A;  5HKG A;  1FKR A;  3O5D A;  4TW8 A;  1ZCN A;  2DG4 A;  4LAW A;  3RM9 A;  4AY1 A;  1N1A A;  4WIW A;  1E6N A;  1XHG A;  1Y0O A;  3EY6 A;  4W9Q A;  2ZR6 A;  4ODO A;  4DRK A;  2XP7 A;  4TW7 A;  3ARZ A;  3UQA A;  2JZV A;  4LAX A;  4MNJ A;  1WB0 A;  4P8X A;  3OOB A;  1LL7 A;  4MNM A;  1ZK6 A;  4FAP A;  3O5R A;  4IPX A;  2PI6 A;  1F40 A;  4DH0 A;  2DT2 A;  1M5Y A;  1W1V A;  4LAV A;  4TX0 A;  3ARW A;  5DEZ A;  3KAG A;  1LG1 A;  1OWQ A;  4P8U A;  3TDB A;  1FD9 A;  1UR8 A;  3QOK A;  4ZPT R;  3O5M A;  3NRK A;  1QPF A;  5HWB A;  5HW6 A;  4IT6 A;  4IT4 A;  1H0I A;  2PPN A;  2LPV A;  1PBK A;  2XP3 A;  4DWS B;  1T11 A;  3VAW A;  4DRN A;  4ZS6 A;  3UQB A;  2LKN A;  1GUV A;  4NSB A;  4ML4 A;  4NZC A;  1Q6H A;  4L3N A;  1ZBK A;  2ZR5 A;  4Z2L A;  1FKB A;  3RM8 A;  4Z2J A;  4O2T A;  1W9U A;  4Q7N A;  3ALF A;  3O5Q A;  3CZ8 A;  2KFW A;  4P8V A;  2RUD A;  1LQ0 A;  2G8Z A;  4ODK A;  4P8W A;  1BKF A;  3O5G A;  3O5J A;  4JFI A;  2G41 A;  2KE0 A;  3KAF A;  4QZV B;  3NTP A;  3PR9 A;  5HTG A;  3WKZ A;  4L72 B;  3AS2 A;  3B8S A;  2MLZ A;  2DPE A;  4LGX A;  2QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...