4TW6A

The fk1 domain of fkbp51 in complex with ifit1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw6A00
3KABA 4DRMA 1JVWA 4DZ3A 4ODRA 1F8AB 1NMVA 5DITA 3VAWA 4C02B 3PRDA 4JFJA 4J4NA 1J6YA 1EQ3A 2PV2A 3IHZA 3TCZA 3PA7A 4FAPA 2ZQVA 3KACA 2M08A 4W9QA 3O5PA 2XPBA 3CGMA 4GIVA 2PV1A 1FKGA 2KE0A 1C9HA 2MLZA 4W9PA 5GPGA 2ZR5A 2RUCA 1Q6HA 3IK8A 2XP9A 3MDYB 1FKDA 3NTPA 4MSPA 3PRBA 1BKFA 2LPVA 2XP7A 3LUOA 2PPPA 3O5MA 3ODKA 1P5QA 2DG9A 3TC5A 2IF4A 4DRIA 4U84A 2PV3A 1JNTA 2XP6A 2ZQTA 1FKSA 3KAGA 2D9FA 3RGCA 3WH0A 4BF8A 4DRPA 4JYSA 4FN2A 3O5FA 2FKEA 4O2TA 4TW6A 5BXJA 2L2SA 4MGVA 1FKTA 1YW5A 2DG3A 4DRHA 3KAHA 2ZR4A 1R9HA 1KT1A 4JFLA 4TW7A 2MPHA 1HXVA 1T11A 4ODKA 3JYJA 5HWCA 5HKGA 3O5DA 1Y0OA 2LKNA 3KADA 3RFWA 2DG4A 2XP5A 1W26A 3IKDA 2KGJA 2XP4A 4DROA 4R0XA 3O5JA 4DRKA 2UZ5A 3JXVA 1FKJA 4W9OA 4JFMA 1D7JA 1A7XA 1QPFA 4ODOA 4QT2A 2XP8A 1D7IA 2RUDA 4QT3A 3KCEA 1KT0A 2KI3A 2LGOA 2LJ4A 2VN1A 3JYMA 4IQCA 1FKBA 1NMWA 2MNTA 4LAVA 1EYMA 2KO7A 2XP3A 2ZR6A 3KAIA 1BL4A 2RURA 1D7HA 4U85A 5HUAA 2OFNA 3UI5A 1FJDA 5HW6A 4TNSA 2RSEA 4LAYA 4G50A 3O5RA 4U86A 1Q6IA 5I98A 2JZVA 4IQ2A 5HTGA 4GGQA 2M2AA 3NI6A 3GPKA 1JNSA 3I6CA 4G2PA 1FD9A 4J4OA 3O5GA 5B8IC 4ODPA 4DRJA 3H9RB 1B6CA 2PPNA 5HWBA 4ODNA 1YATA 2F21A 2Y78A 4NNRA 4ODQA 1M5YA 3B7XA 2PBCA 4TX0A 1FKFA 1ROTA 3O5IA 5HW8A 2KR7A 2Q5AA 3CGNA 1J4HA 1ZCNA 3UQBA 4IPXA 4LAWA 1FKHA 3O5QA 4DZ2A 2F4EA 2MLXA 2AWGA 1U79A 3KAFA 3UQIA 1ROUA 2VCDA 4DRNA 3IKGA 2K8IA 2MLYA 2ITKA 2N87A 1PBKA 1FKKA 2XPAA 3O5OA 4ODLA 2ZQSA 1D6OA 4N19A 2F2DA 4DIPA 1TCOC 3O5KA 2ZQUA 3TDBA 2KFWA 1QPLA 1QZ2A 2RQSA 4TW8A 4DH0A 3NRKA 4DRQA 3UI6A 5DIUA 4TYOA 3O5EA 1ZK6A 1NSGA 4LAXA 4ODMA 5HW7A 2M1IA 1PINA 3UF8A 4JFKA 1J4IA 1Q1CA 3KZ7A 1L1PA 1N1AA 3O5LA 1F40A 2RUQA 1J4RA 3UQAA 2MF9A 4DT4A 2PPOA 1FKLA 4JFIA 3EY6A 1FAPA 4ITZA 1FKIA 5HT1A 4QIBA 5J6EA 1FKRA 2FAPA 5DIVA 5D75A 3UI4A 3OOBA 1Q6UA 3FAPA
chains in the Genus database with same CATH superfamily
1RD6A 3KABA 4ODRA 5DITA 3PRDA 2ESCA 4JFJA 2PV2A 3ARUA 3WL1A 4W9QA 2P4VA 1SR0A 2PI6A 2PV1A 2WM0A 4P8WA 3WD2A 2MLZA 4XAKA 3PRAA 3PRBA 3CH9A 4S3JA 1BKFA 2XP7A 3O5MA 3ODKA 1CTNA 5DF0A 1D2KA 3WH0A 2YBTA 4JYSA 3O5FA 4TW6A 4MTVA 2DG3A 4DRHA 3B9DA 4Q7NA 4JFLA 1EIBA 4TW7A 1E9LA 1VF8A 1Y0OA 1TFVA 4IT6A 1W9VA 4R5EA 4R0XA 4DRKA 3JXVA 1JNDA 2DT0A 4W9OA 3G6LA 1A7XA 4ODOA 2O92A 3ARPA 3B9EA 4HARA 1LL6A 2A3AA 2QF8A 3KCEA 1KT0A 4DWSB 1ZBVA 3RM8A 5GPRA 2RURA 2DSVA 4LAYA 4G50A 4U86A 1Q6IA 2IUZA 3GU0A 3GTYX 3I6CA 5B8IC 1HJXA 1XRVA 1YATA 4NNRA 1M5YA 1LQ0A 4Z2HA 1LG1A 1J4HA 1ZCNA 2G8ZA 1KFWA 1GUVA 2F4EA 2AWGA 1XHGA 1U79A 1ROUA 5GQBA 2VCDA 4DRNA 2B31A 2N87A 3O5OA 1ZBCA 3ALFA 3ALGA 3WQWA 1TCOC 1HJWA 1EDQA 1EHNA 1ZK6A 1NSGA 4LAXA 4ZS6A 3ARWA 1PINA 3KZ7A 1N1AA 1F40A 4DT4A 3FY1A 1FKLA 2FDMA 4ITZA 5HT1A 3ARXA 2FAPA 1W1PA 5DIVA 2WK2A 5D75A 3CHDA 3VAWA 1NMVA 3QOKA 1ZU8A 2M08A 2XPBA 3CGMA 1FKGA 1C9HA 1W9PA 3IK8A 3NTPA 2LPVA 3WQVA 1E6NA 1UR8A 4U84A 2ZQTA 3KAGA 2D9FA 1NWRA 1JCHB 4O2TA 2FKEA 1WNOA 4ML4A 5BXJA 4Z2IA 1FKTA 1YW5A 3KAHA 2A3EA 3G6MA 1FFQA 5HWCA 3O5DA 4DWSD 3KADA 4MNKA 2XP5A 3IKDA 2OLHA 2XP4A 3O5JA 1QPFA 3AS0A 2RUDA 3JYMA 3RM4A 1FKBA 1NMWA 2DSZA 2KO7A 2ZR6A 1HJVA 5HUAA 1FJDA 5HW6A 1OWQA 3CHEA 4IQ2A 4GGQA 3FXYA 1HKJA 1ZL1A 1GPFA 4J4OA 4DRJA 3H9RB 4WKFA 2PPNA 4ODNA 4MPKA 2PBCA 4TX0A 3CGNA 1E15A 4LAWA 3AQUA 3KAFA 3WKZA 4ZPVR 3WD4A 2MLYA 2ITKA 1PBKA 1FKKA 2XPAA 4ODLA 2F23A 4N19A 1GOIA 4DWSC 1K9TA 2F2DA 3O5KA 2ZQUA 3W4RA 3TDBA 2KFWA 1NWUA 3NRKA 4ODMA 4MNMA 5HW7A 1OGBA 3O5LA 1NH6A 2RUQA 1J4RA 2MF9A 4JFIA 4Z2LA 3EY6A 5J6EA 4AY1A 1E6RA 3ARSA 3UI4A 3OOBA 4DZ3A 2WLYA 4J4NA 3ARRA 3IHZA 4FAPA 3KACA 3BXWA 4GIVA 2KE0A 5GPGA 2ZR5A 1FKDA 3AROA 1O6IA 3LUOA 2PPPA 3WIJA 1WB0A 1HKIA 2DG9A 3TC5A 2IF4A 2PV3A 1JNTA 3RGCA 1FKSA 4BF8A 4FN2A 3WD1A 4MGVA 1W1YA 3AS3A 3CZ8A 4DWSA 1KT1A 1JNEA 2MPHA 4LGXA 1T11A 4ODKA 5HKGA 2O9OA 2DSUA 4WKAA 2LKNA 2A3CA 1H0GA 2KGJA 4DROA 5DEZA 4WK9A 2UZ5A 4QT2A 2XP8A 1D7IA 1LJYA 4IT4A 4QT3A 1SYTA 2WLZA 4LAVA 2VN1A 2MNTA 4QZVB 3ARYA 2XP3A 1E6ZA 3KAIA 3ARZA 1D7HA 4ZPTR 4MNJA 2OFNA 1LG2A 2RSEA 4WJXA 4P8UA 4W5UA 3O5RA 3AS2A 2JZVA 5I98A 3NI6A 4G2PA 3O5GA 4ODPA 4Z2GA 1B6CA 2Y78A 1W9UA 4ODQA 4L3NA 3B7XA 5HW8A 1ROTA 3O5IA 2KR7A 2Q5AA 4ZPWR 3CHCA 4IPXA 3RM9A 4DZ2A 1ZB5A 3IKGA 2K8IA 4WIWA 2DSWA 4MAVA 1LL7A 4KR0B 4NZCA 1ZBWA 1UR9A 1QPLA 1QZ2A 4DH0A 2A3BA 4DRQA 4TYOA 4MNLA 1HXVA 1J4IA 1Q1CA 3UQAA 2PPOA 1FKIA 3EIPA 3FAPA 4HBOA 4S3KA 1JVWA 4DRMA 1F8AB 1E44A 1OGGA 4C02B 1HKKA 1EQ3A 1J6YA 3TCZA 3PA7A 2ZQVA 3O5PA 4W9PA 3CHFA 2RUCA 1Q6HA 1W1VA 2XP9A 1HKMA 4MSPA 5JH8A 1WAWA 1W1TA 3PR9A 1P5QA 4DRIA 1LL4A 3OA5A 2XP6A 4DRPA 3B8SA 2B5UB 2L2SA 4KQZA 2ZR4A 3ARTA 1R9HA 4URIA 3JYJA 1X6LA 2DG4A 3RFWA 1W26A 3WL0A 1GRJA 1FKJA 2PN0A 1D7JA 4JFMA 1FFRA 3ARVA 4HBEA 1IX5A 2KI3A 2LGOA 2ETNA 2LJ4A 4IQCA 3ARQA 1EYMA 2G41A 1BL4A 3AS1A 4U85A 3UI5A 4TNSA 4NSBA 5HBFA 2AOSA 2DT1A 1E6PA 5HTGA 1JNSA 2M2AA 3GPKA 4PTMA 1FD9A 5HWBA 2F21A 4WKHA 1FKFA 3WD0A 3UQBA 5DO2A 1FKHA 3O5QA 1X6NA 4L72B 4P8XA 2MLXA 3UQIA 2DT3A 4P8VA 3B9AA 3RMEA 2ZQSA 1D6OA 3WD3A 4DIPA 4UDMA 2RQSA 4TW8A 3UI6A 5DIUA 4Z2JA 3O5EA 1ITXA 2EULA 4Q22A 2M1IA 3UF8A 1NWSA 4JFKA 1L1PA 2DPEA 1NWTA 1FAPA 4QIBA 3BMBA 1FKRA 2YBUA 1H0IA 1ZBKA 4Z2KA 2DT2A 1Q6UA 3MDYB
chains in the Genus database with same CATH topology
1RD6A 3KABA 4ODRA 5DITA 3PRDA 2ESCA 4JFJA 2PV2A 3ARUA 3WL1A 4W9QA 1SR0A 2PI6A 2PV1A 2WM0A 4P8WA 3WD2A 2MLZA 4XAKA 3PRAA 3PRBA 3CH9A 4S3JA 1BKFA 2XP7A 3O5MA 3ODKA 1CTNA 5DF0A 1D2KA 3WH0A 2YBTA 4JYSA 3O5FA 4TW6A 4MTVA 2DG3A 4DRHA 3B9DA 4Q7NA 4JFLA 1EIBA 4TW7A 1E9LA 1VF8A 1Y0OA 1TFVA 4IT6A 1W9VA 4R5EA 4R0XA 4DRKA 3JXVA 1JNDA 2DT0A 4W9OA 3G6LA 1A7XA 4ODOA 2O92A 3ARPA 3B9EA 4HARA 1LL6A 2A3AA 2QF8A 3KCEA 1KT0A 4DWSB 1ZBVA 3RM8A 5GPRA 2RURA 2DSVA 4LAYA 4G50A 4U86A 1Q6IA 2IUZA 3I6CA 5B8IC 1HJXA 1XRVA 1YATA 4NNRA 1M5YA 1LQ0A 4Z2HA 1LG1A 1J4HA 1ZCNA 2G8ZA 1KFWA 1GUVA 2F4EA 2AWGA 1XHGA 1U79A 1ROUA 5GQBA 2VCDA 4DRNA 2B31A 3O5OA 2N87A 1ZBCA 3ALFA 3ALGA 3WQWA 1TCOC 1HJWA 1EDQA 1EHNA 1ZK6A 1NSGA 4LAXA 4ZS6A 3ARWA 1PINA 3KZ7A 1N1AA 1F40A 4DT4A 3FY1A 1FKLA 2FDMA 4ITZA 5HT1A 3ARXA 2FAPA 1W1PA 5DIVA 2WK2A 5D75A 3CHDA 3VAWA 1NMVA 3QOKA 1ZU8A 2M08A 2XPBA 3CGMA 1FKGA 1C9HA 1W9PA 3IK8A 3NTPA 2LPVA 3WQVA 1E6NA 1UR8A 4U84A 2ZQTA 3KAGA 2D9FA 1NWRA 4O2TA 2FKEA 1WNOA 4ML4A 5BXJA 4Z2IA 1FKTA 1YW5A 3KAHA 2A3EA 3G6MA 1FFQA 5HWCA 3O5DA 4DWSD 3KADA 4MNKA 2XP5A 3IKDA 2OLHA 2XP4A 3O5JA 1QPFA 3AS0A 2RUDA 3JYMA 3RM4A 1FKBA 1NMWA 2DSZA 2KO7A 2ZR6A 1HJVA 5HUAA 1FJDA 5HW6A 1OWQA 3CHEA 4IQ2A 4GGQA 3FXYA 1HKJA 1ZL1A 1GPFA 4J4OA 4DRJA 3H9RB 4WKFA 2PPNA 4ODNA 4MPKA 2PBCA 4TX0A 3CGNA 1E15A 4LAWA 3AQUA 3KAFA 3WKZA 4ZPVR 3WD4A 2MLYA 2ITKA 1PBKA 1FKKA 2XPAA 4ODLA 4N19A 1GOIA 4DWSC 1K9TA 2F2DA 3O5KA 2ZQUA 3W4RA 3TDBA 2KFWA 1NWUA 3NRKA 4ODMA 4MNMA 5HW7A 1OGBA 3O5LA 1NH6A 2RUQA 1J4RA 2MF9A 4JFIA 4Z2LA 3EY6A 5J6EA 4AY1A 1E6RA 3ARSA 3UI4A 3OOBA 4DZ3A 2WLYA 4J4NA 3ARRA 3IHZA 4FAPA 3KACA 3BXWA 4GIVA 2KE0A 5GPGA 2ZR5A 1FKDA 3AROA 1O6IA 3LUOA 2PPPA 3WIJA 1WB0A 1HKIA 2DG9A 3TC5A 2IF4A 2PV3A 1JNTA 3RGCA 1FKSA 4BF8A 4FN2A 3WD1A 4MGVA 1W1YA 3AS3A 3CZ8A 4DWSA 1KT1A 1JNEA 2MPHA 4LGXA 1T11A 4ODKA 5HKGA 2O9OA 2DSUA 4WKAA 2LKNA 2A3CA 1H0GA 2KGJA 4DROA 5DEZA 4WK9A 2UZ5A 4QT2A 2XP8A 1D7IA 1LJYA 4IT4A 4QT3A 1SYTA 2WLZA 4LAVA 2VN1A 2MNTA 4QZVB 3ARYA 2XP3A 1E6ZA 3KAIA 3ARZA 1D7HA 4ZPTR 4MNJA 2OFNA 1LG2A 2RSEA 4WJXA 4P8UA 4W5UA 3O5RA 3AS2A 2JZVA 5I98A 3NI6A 4G2PA 3O5GA 4ODPA 4Z2GA 1B6CA 2Y78A 1W9UA 4ODQA 4L3NA 3B7XA 5HW8A 1ROTA 3O5IA 2KR7A 2Q5AA 4ZPWR 3CHCA 4IPXA 3RM9A 4DZ2A 1ZB5A 3IKGA 2K8IA 4WIWA 2DSWA 4MAVA 1LL7A 4KR0B 4NZCA 1ZBWA 1UR9A 1QPLA 1QZ2A 4DH0A 2A3BA 4DRQA 4TYOA 4MNLA 1HXVA 1J4IA 1Q1CA 3UQAA 2PPOA 1FKIA 3FAPA 4HBOA 4S3KA 1JVWA 4DRMA 1F8AB 1OGGA 4C02B 1HKKA 1EQ3A 1J6YA 3TCZA 3PA7A 2ZQVA 3O5PA 4W9PA 3CHFA 2RUCA 1Q6HA 1W1VA 2XP9A 1HKMA 4MSPA 5JH8A 1WAWA 1W1TA 3PR9A 1P5QA 4DRIA 1LL4A 3OA5A 2XP6A 4DRPA 3B8SA 2L2SA 4KQZA 2ZR4A 3ARTA 1R9HA 4URIA 3JYJA 1X6LA 2DG4A 3RFWA 1W26A 3WL0A 1FKJA 4JFMA 1D7JA 1FFRA 3ARVA 4HBEA 1IX5A 2KI3A 2LGOA 2LJ4A 4IQCA 3ARQA 1EYMA 2G41A 1BL4A 3AS1A 4U85A 3UI5A 4TNSA 4NSBA 5HBFA 2AOSA 2DT1A 1E6PA 5HTGA 1JNSA 2M2AA 3GPKA 4PTMA 1FD9A 5HWBA 2F21A 4WKHA 1FKFA 3WD0A 3UQBA 5DO2A 1FKHA 3O5QA 1X6NA 4L72B 4P8XA 2MLXA 3UQIA 2DT3A 4P8VA 3B9AA 3RMEA 2ZQSA 1D6OA 3WD3A 4DIPA 2RQSA 4TW8A 3UI6A 5DIUA 4Z2JA 3O5EA 1ITXA 4Q22A 2M1IA 3UF8A 1NWSA 4JFKA 1L1PA 2DPEA 1NWTA 1FAPA 4QIBA 1FKRA 2YBUA 1H0IA 1ZBKA 4Z2KA 2DT2A 1Q6UA 3MDYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAB A;  4DRM A;  1JVW A;  4DZ3 A;  4ODR A;  1F8A B;  1NMV A;  5DIT A;  3VAW A;  4C02 B;  3PRD A;  4JFJ A;  4J4N A;  1J6Y A;  1EQ3 A;  2PV2 A;  3IHZ A;  3TCZ A;  3PA7 A;  4FAP A;  2ZQV A;  3KAC A;  2M08 A;  4W9Q A;  3O5P A;  2XPB A;  3CGM A;  4GIV A;  2PV1 A;  1FKG A;  2KE0 A;  1C9H A;  2MLZ A;  4W9P A;  5GPG A;  2ZR5 A;  2RUC A;  1Q6H A;  3IK8 A;  2XP9 A;  3MDY B;  1FKD A;  3NTP A;  4MSP A;  3PRB A;  1BKF A;  2LPV A;  2XP7 A;  3LUO A;  2PPP A;  3O5M A;  3ODK A;  1P5Q A;  2DG9 A;  3TC5 A;  2IF4 A;  4DRI A;  4U84 A;  2PV3 A;  1JNT A;  2XP6 A;  2ZQT A;  1FKS A;  3KAG A;  2D9F A;  3RGC A;  3WH0 A;  4BF8 A;  4DRP A;  4JYS A;  4FN2 A;  3O5F A;  2FKE A;  4O2T A;  4TW6 A;  5BXJ A;  2L2S A;  4MGV A;  1FKT A;  1YW5 A;  2DG3 A;  4DRH A;  3KAH A;  2ZR4 A;  1R9H A;  1KT1 A;  4JFL A;  4TW7 A;  2MPH A;  1HXV A;  1T11 A;  4ODK A;  3JYJ A;  5HWC A;  5HKG A;  3O5D A;  1Y0O A;  2LKN A;  3KAD A;  3RFW A;  2DG4 A;  2XP5 A;  1W26 A;  3IKD A;  2KGJ A;  2XP4 A;  4DRO A;  4R0X A;  3O5J A;  4DRK A;  2UZ5 A;  3JXV A;  1FKJ A;  4W9O A;  4JFM A;  1D7J A;  1A7X A;  1QPF A;  4ODO A;  4QT2 A;  2XP8 A;  1D7I A;  2RUD A;  4QT3 A;  3KCE A;  1KT0 A;  2KI3 A;  2LGO A;  2LJ4 A;  2VN1 A;  3JYM A;  4IQC A;  1FKB A;  1NMW A;  2MNT A;  4LAV A;  1EYM A;  2KO7 A;  2XP3 A;  2ZR6 A;  3KAI A;  1BL4 A;  2RUR A;  1D7H A;  4U85 A;  5HUA A;  2OFN A;  3UI5 A;  1FJD A;  5HW6 A;  4TNS A;  2RSE A;  4LAY A;  4G50 A;  3O5R A;  4U86 A;  1Q6I A;  5I98 A;  2JZV A;  4IQ2 A;  5HTG A;  4GGQ A;  2M2A A;  3NI6 A;  3GPK A;  1JNS A;  3I6C A;  4G2P A;  1FD9 A;  4J4O A;  3O5G A;  5B8I C;  4ODP A;  4DRJ A;  3H9R B;  1B6C A;  2PPN A;  5HWB A;  4ODN A;  1YAT A;  2F21 A;  2Y78 A;  4NNR A;  4ODQ A;  1M5Y A;  3B7X A;  2PBC A;  4TX0 A;  1FKF A;  1ROT A;  3O5I A;  5HW8 A;  2KR7 A;  2Q5A A;  3CGN A;  1J4H A;  1ZCN A;  3UQB A;  4IPX A;  4LAW A;  1FKH A;  3O5Q A;  4DZ2 A;  2F4E A;  2MLX A;  2AWG A;  1U79 A;  3KAF A;  3UQI A;  1ROU A;  2VCD A;  4DRN A;  3IKG A;  2K8I A;  2MLY A;  2ITK A;  2N87 A;  1PBK A;  1FKK A;  2XPA A;  3O5O A;  4ODL A;  2ZQS A;  1D6O A;  4N19 A;  2F2D A;  4DIP A;  1TCO C;  3O5K A;  2ZQU A;  3TDB A;  2KFW A;  1QPL A;  1QZ2 A;  2RQS A;  4TW8 A;  4DH0 A;  3NRK A;  4DRQ A;  3UI6 A;  5DIU A;  4TYO A;  3O5E A;  1ZK6 A;  1NSG A;  4LAX A;  4ODM A;  5HW7 A;  2M1I A;  1PIN A;  3UF8 A;  4JFK A;  1J4I A;  1Q1C A;  3KZ7 A;  1L1P A;  1N1A A;  3O5L A;  1F40 A;  2RUQ A;  1J4R A;  3UQA A;  2MF9 A;  4DT4 A;  2PPO A;  1FKL A;  4JFI A;  3EY6 A;  1FAP A;  4ITZ A;  1FKI A;  5HT1 A;  4QIB A;  5J6E A;  1FKR A;  2FAP A;  5DIV A;  5D75 A;  3UI4 A;  3OOB A;  1Q6U A;  3FAP A; 
#chains in the Genus database with same CATH topology
 1RD6 A;  3KAB A;  4ODR A;  5DIT A;  3PRD A;  2ESC A;  4JFJ A;  2PV2 A;  3ARU A;  3WL1 A;  4W9Q A;  2P4V A;  1SR0 A;  2PI6 A;  2PV1 A;  2WM0 A;  4P8W A;  3WD2 A;  2MLZ A;  4XAK A;  3PRA A;  3PRB A;  3CH9 A;  4S3J A;  1BKF A;  2XP7 A;  3O5M A;  3ODK A;  1CTN A;  5DF0 A;  1D2K A;  3WH0 A;  2YBT A;  4JYS A;  3O5F A;  4TW6 A;  4MTV A;  2DG3 A;  4DRH A;  3B9D A;  4Q7N A;  4JFL A;  1EIB A;  4TW7 A;  1E9L A;  1VF8 A;  1Y0O A;  1TFV A;  4IT6 A;  1W9V A;  4R5E A;  4R0X A;  4DRK A;  3JXV A;  1JND A;  2DT0 A;  4W9O A;  3G6L A;  1A7X A;  4ODO A;  2O92 A;  3ARP A;  3B9E A;  4HAR A;  1LL6 A;  2A3A A;  2QF8 A;  3KCE A;  1KT0 A;  4DWS B;  1ZBV A;  3RM8 A;  5GPR A;  2RUR A;  2DSV A;  4LAY A;  4G50 A;  4U86 A;  1Q6I A;  2IUZ A;  3GU0 A;  3GTY X;  3I6C A;  5B8I C;  1HJX A;  1XRV A;  1YAT A;  4NNR A;  1M5Y A;  1LQ0 A;  4Z2H A;  1LG1 A;  1J4H A;  1ZCN A;  2G8Z A;  1KFW A;  1GUV A;  2F4E A;  2AWG A;  1XHG A;  1U79 A;  1ROU A;  5GQB A;  2VCD A;  4DRN A;  2B31 A;  2N87 A;  3O5O A;  1ZBC A;  3ALF A;  3ALG A;  3WQW A;  1TCO C;  1HJW A;  1EDQ A;  1EHN A;  1ZK6 A;  1NSG A;  4LAX A;  4ZS6 A;  3ARW A;  1PIN A;  3KZ7 A;  1N1A A;  1F40 A;  4DT4 A;  3FY1 A;  1FKL A;  2FDM A;  4ITZ A;  5HT1 A;  3ARX A;  2FAP A;  1W1P A;  5DIV A;  2WK2 A;  5D75 A;  3CHD A;  3VAW A;  1NMV A;  3QOK A;  1ZU8 A;  2M08 A;  2XPB A;  3CGM A;  1FKG A;  1C9H A;  1W9P A;  3IK8 A;  3NTP A;  2LPV A;  3WQV A;  1E6N A;  1UR8 A;  4U84 A;  2ZQT A;  3KAG A;  2D9F A;  1NWR A;  1JCH B;  4O2T A;  2FKE A;  1WNO A;  4ML4 A;  5BXJ A;  4Z2I A;  1FKT A;  1YW5 A;  3KAH A;  2A3E A;  3G6M A;  1FFQ A;  5HWC A;  3O5D A;  4DWS D;  3KAD A;  4MNK A;  2XP5 A;  3IKD A;  2OLH A;  2XP4 A;  3O5J A;  1QPF A;  3AS0 A;  2RUD A;  3JYM A;  3RM4 A;  1FKB A;  1NMW A;  2DSZ A;  2KO7 A;  2ZR6 A;  1HJV A;  5HUA A;  1FJD A;  5HW6 A;  1OWQ A;  3CHE A;  4IQ2 A;  4GGQ A;  3FXY A;  1HKJ A;  1ZL1 A;  1GPF A;  4J4O A;  4DRJ A;  3H9R B;  4WKF A;  2PPN A;  4ODN A;  4MPK A;  2PBC A;  4TX0 A;  3CGN A;  1E15 A;  4LAW A;  3AQU A;  3KAF A;  3WKZ A;  4ZPV R;  3WD4 A;  2MLY A;  2ITK A;  1PBK A;  1FKK A;  2XPA A;  4ODL A;  2F23 A;  4N19 A;  1GOI A;  4DWS C;  1K9T A;  2F2D A;  3O5K A;  2ZQU A;  3W4R A;  3TDB A;  2KFW A;  1NWU A;  3NRK A;  4ODM A;  4MNM A;  5HW7 A;  1OGB A;  3O5L A;  1NH6 A;  2RUQ A;  1J4R A;  2MF9 A;  4JFI A;  4Z2L A;  3EY6 A;  5J6E A;  4AY1 A;  1E6R A;  3ARS A;  3UI4 A;  3OOB A;  4DZ3 A;  2WLY A;  4J4N A;  3ARR A;  3IHZ A;  4FAP A;  3KAC A;  3BXW A;  4GIV A;  2KE0 A;  5GPG A;  2ZR5 A;  1FKD A;  3ARO A;  1O6I A;  3LUO A;  2PPP A;  3WIJ A;  1WB0 A;  1HKI A;  2DG9 A;  3TC5 A;  2IF4 A;  2PV3 A;  1JNT A;  3RGC A;  1FKS A;  4BF8 A;  4FN2 A;  3WD1 A;  4MGV A;  1W1Y A;  3AS3 A;  3CZ8 A;  4DWS A;  1KT1 A;  1JNE A;  2MPH A;  4LGX A;  1T11 A;  4ODK A;  5HKG A;  2O9O A;  2DSU A;  4WKA A;  2LKN A;  2A3C A;  1H0G A;  2KGJ A;  4DRO A;  5DEZ A;  4WK9 A;  2UZ5 A;  4QT2 A;  2XP8 A;  1D7I A;  1LJY A;  4IT4 A;  4QT3 A;  1SYT A;  2WLZ A;  4LAV A;  2VN1 A;  2MNT A;  4QZV B;  3ARY A;  2XP3 A;  1E6Z A;  3KAI A;  3ARZ A;  1D7H A;  4ZPT R;  4MNJ A;  2OFN A;  1LG2 A;  2RSE A;  4WJX A;  4P8U A;  4W5U A;  3O5R A;  3AS2 A;  2JZV A;  5I98 A;  3NI6 A;  4G2P A;  3O5G A;  4ODP A;  4Z2G A;  1B6C A;  2Y78 A;  1W9U A;  4ODQ A;  4L3N A;  3B7X A;  5HW8 A;  1ROT A;  3O5I A;  2KR7 A;  2Q5A A;  4ZPW R;  3CHC A;  4IPX A;  3RM9 A;  4DZ2 A;  1ZB5 A;  3IKG A;  2K8I A;  4WIW A;  2DSW A;  4MAV A;  1LL7 A;  4KR0 B;  4NZC A;  1ZBW A;  1UR9 A;  1QPL A;  1QZ2 A;  4DH0 A;  2A3B A;  4DRQ A;  4TYO A;  4MNL A;  1HXV A;  1J4I A;  1Q1C A;  3UQA A;  2PPO A;  1FKI A;  3EIP A;  3FAP A;  4HBO A;  4S3K A;  1JVW A;  4DRM A;  1F8A B;  1E44 A;  1OGG A;  4C02 B;  1HKK A;  1EQ3 A;  1J6Y A;  3TCZ A;  3PA7 A;  2ZQV A;  3O5P A;  4W9P A;  3CHF A;  2RUC A;  1Q6H A;  1W1V A;  2XP9 A;  1HKM A;  4MSP A;  5JH8 A;  1WAW A;  1W1T A;  3PR9 A;  1P5Q A;  4DRI A;  1LL4 A;  3OA5 A;  2XP6 A;  4DRP A;  3B8S A;  2B5U B;  2L2S A;  4KQZ A;  2ZR4 A;  3ART A;  1R9H A;  4URI A;  3JYJ A;  1X6L A;  2DG4 A;  3RFW A;  1W26 A;  3WL0 A;  1GRJ A;  1FKJ A;  2PN0 A;  1D7J A;  4JFM A;  1FFR A;  3ARV A;  4HBE A;  1IX5 A;  2KI3 A;  2LGO A;  2ETN A;  2LJ4 A;  4IQC A;  3ARQ A;  1EYM A;  2G41 A;  1BL4 A;  3AS1 A;  4U85 A;  3UI5 A;  4TNS A;  4NSB A;  5HBF A;  2AOS A;  2DT1 A;  1E6P A;  5HTG A;  1JNS A;  2M2A A;  3GPK A;  4PTM A;  1FD9 A;  5HWB A;  2F21 A;  4WKH A;  1FKF A;  3WD0 A;  3UQB A;  5DO2 A;  1FKH A;  3O5Q A;  1X6N A;  4L72 B;  4P8X A;  2MLX A;  3UQI A;  2DT3 A;  4P8V A;  3B9A A;  3RME A;  2ZQS A;  1D6O A;  3WD3 A;  4DIP A;  4UDM A;  2RQS A;  4TW8 A;  3UI6 A;  5DIU A;  4Z2J A;  3O5E A;  1ITX A;  2EUL A;  4Q22 A;  2M1I A;  3UF8 A;  1NWS A;  4JFK A;  1L1P A;  2DPE A;  1NWT A;  1FAP A;  4QIB A;  3BMB A;  1FKR A;  2YBU A;  1H0I A;  1ZBK A;  4Z2K A;  2DT2 A;  1Q6U A;  3MDY B; 
#chains in the Genus database with same CATH homology
 1RD6 A;  3KAB A;  4ODR A;  5DIT A;  3PRD A;  2ESC A;  4JFJ A;  2PV2 A;  3ARU A;  3WL1 A;  4W9Q A;  1SR0 A;  2PI6 A;  2PV1 A;  2WM0 A;  4P8W A;  3WD2 A;  2MLZ A;  4XAK A;  3PRA A;  3PRB A;  3CH9 A;  4S3J A;  1BKF A;  2XP7 A;  3O5M A;  3ODK A;  1CTN A;  5DF0 A;  1D2K A;  3WH0 A;  2YBT A;  4JYS A;  3O5F A;  4TW6 A;  4MTV A;  2DG3 A;  4DRH A;  3B9D A;  4Q7N A;  4JFL A;  1EIB A;  4TW7 A;  1E9L A;  1VF8 A;  1Y0O A;  1TFV A;  4IT6 A;  1W9V A;  4R5E A;  4R0X A;  4DRK A;  3JXV A;  1JND A;  2DT0 A;  4W9O A;  3G6L A;  1A7X A;  4ODO A;  2O92 A;  3ARP A;  3B9E A;  4HAR A;  1LL6 A;  2A3A A;  2QF8 A;  3KCE A;  1KT0 A;  4DWS B;  1ZBV A;  3RM8 A;  5GPR A;  2RUR A;  2DSV A;  4LAY A;  4G50 A;  4U86 A;  1Q6I A;  2IUZ A;  3I6C A;  5B8I C;  1HJX A;  1XRV A;  1YAT A;  4NNR A;  1M5Y A;  1LQ0 A;  4Z2H A;  1LG1 A;  1J4H A;  1ZCN A;  2G8Z A;  1KFW A;  1GUV A;  2F4E A;  2AWG A;  1XHG A;  1U79 A;  1ROU A;  5GQB A;  2VCD A;  4DRN A;  2B31 A;  3O5O A;  2N87 A;  1ZBC A;  3ALF A;  3ALG A;  3WQW A;  1TCO C;  1HJW A;  1EDQ A;  1EHN A;  1ZK6 A;  1NSG A;  4LAX A;  4ZS6 A;  3ARW A;  1PIN A;  3KZ7 A;  1N1A A;  1F40 A;  4DT4 A;  3FY1 A;  1FKL A;  2FDM A;  4ITZ A;  5HT1 A;  3ARX A;  2FAP A;  1W1P A;  5DIV A;  2WK2 A;  5D75 A;  3CHD A;  3VAW A;  1NMV A;  3QOK A;  1ZU8 A;  2M08 A;  2XPB A;  3CGM A;  1FKG A;  1C9H A;  1W9P A;  3IK8 A;  3NTP A;  2LPV A;  3WQV A;  1E6N A;  1UR8 A;  4U84 A;  2ZQT A;  3KAG A;  2D9F A;  1NWR A;  4O2T A;  2FKE A;  1WNO A;  4ML4 A;  5BXJ A;  4Z2I A;  1FKT A;  1YW5 A;  3KAH A;  2A3E A;  3G6M A;  1FFQ A;  5HWC A;  3O5D A;  4DWS D;  3KAD A;  4MNK A;  2XP5 A;  3IKD A;  2OLH A;  2XP4 A;  3O5J A;  1QPF A;  3AS0 A;  2RUD A;  3JYM A;  3RM4 A;  1FKB A;  1NMW A;  2DSZ A;  2KO7 A;  2ZR6 A;  1HJV A;  5HUA A;  1FJD A;  5HW6 A;  1OWQ A;  3CHE A;  4IQ2 A;  4GGQ A;  3FXY A;  1HKJ A;  1ZL1 A;  1GPF A;  4J4O A;  4DRJ A;  3H9R B;  4WKF A;  2PPN A;  4ODN A;  4MPK A;  2PBC A;  4TX0 A;  3CGN A;  1E15 A;  4LAW A;  3AQU A;  3KAF A;  3WKZ A;  4ZPV R;  3WD4 A;  2MLY A;  2ITK A;  1PBK A;  1FKK A;  2XPA A;  4ODL A;  4N19 A;  1GOI A;  4DWS C;  1K9T A;  2F2D A;  3O5K A;  2ZQU A;  3W4R A;  3TDB A;  2KFW A;  1NWU A;  3NRK A;  4ODM A;  4MNM A;  5HW7 A;  1OGB A;  3O5L A;  1NH6 A;  2RUQ A;  1J4R A;  2MF9 A;  4JFI A;  4Z2L A;  3EY6 A;  5J6E A;  4AY1 A;  1E6R A;  3ARS A;  3UI4 A;  3OOB A;  4DZ3 A;  2WLY A;  4J4N A;  3ARR A;  3IHZ A;  4FAP A;  3KAC A;  3BXW A;  4GIV A;  2KE0 A;  5GPG A;  2ZR5 A;  1FKD A;  3ARO A;  1O6I A;  3LUO A;  2PPP A;  3WIJ A;  1WB0 A;  1HKI A;  2DG9 A;  3TC5 A;  2IF4 A;  2PV3 A;  1JNT A;  3RGC A;  1FKS A;  4BF8 A;  4FN2 A;  3WD1 A;  4MGV A;  1W1Y A;  3AS3 A;  3CZ8 A;  4DWS A;  1KT1 A;  1JNE A;  2MPH A;  4LGX A;  1T11 A;  4ODK A;  5HKG A;  2O9O A;  2DSU A;  4WKA A;  2LKN A;  2A3C A;  1H0G A;  2KGJ A;  4DRO A;  5DEZ A;  4WK9 A;  2UZ5 A;  4QT2 A;  2XP8 A;  1D7I A;  1LJY A;  4IT4 A;  4QT3 A;  1SYT A;  2WLZ A;  4LAV A;  2VN1 A;  2MNT A;  4QZV B;  3ARY A;  2XP3 A;  1E6Z A;  3KAI A;  3ARZ A;  1D7H A;  4ZPT R;  4MNJ A;  2OFN A;  1LG2 A;  2RSE A;  4WJX A;  4P8U A;  4W5U A;  3O5R A;  3AS2 A;  2JZV A;  5I98 A;  3NI6 A;  4G2P A;  3O5G A;  4ODP A;  4Z2G A;  1B6C A;  2Y78 A;  1W9U A;  4ODQ A;  4L3N A;  3B7X A;  5HW8 A;  1ROT A;  3O5I A;  2KR7 A;  2Q5A A;  4ZPW R;  3CHC A;  4IPX A;  3RM9 A;  4DZ2 A;  1ZB5 A;  3IKG A;  2K8I A;  4WIW A;  2DSW A;  4MAV A;  1LL7 A;  4KR0 B;  4NZC A;  1ZBW A;  1UR9 A;  1QPL A;  1QZ2 A;  4DH0 A;  2A3B A;  4DRQ A;  4TYO A;  4MNL A;  1HXV A;  1J4I A;  1Q1C A;  3UQA A;  2PPO A;  1FKI A;  3FAP A;  4HBO A;  4S3K A;  1JVW A;  4DRM A;  1F8A B;  1OGG A;  4C02 B;  1HKK A;  1EQ3 A;  1J6Y A;  3TCZ A;  3PA7 A;  2ZQV A;  3O5P A;  4W9P A;  3CHF A;  2RUC A;  1Q6H A;  1W1V A;  2XP9 A;  1HKM A;  4MSP A;  5JH8 A;  1WAW A;  1W1T A;  3PR9 A;  1P5Q A;  4DRI A;  1LL4 A;  3OA5 A;  2XP6 A;  4DRP A;  3B8S A;  2L2S A;  4KQZ A;  2ZR4 A;  3ART A;  1R9H A;  4URI A;  3JYJ A;  1X6L A;  2DG4 A;  3RFW A;  1W26 A;  3WL0 A;  1FKJ A;  4JFM A;  1D7J A;  1FFR A;  3ARV A;  4HBE A;  1IX5 A;  2KI3 A;  2LGO A;  2LJ4 A;  4IQC A;  3ARQ A;  1EYM A;  2G41 A;  1BL4 A;  3AS1 A;  4U85 A;  3UI5 A;  4TNS A;  4NSB A;  5HBF A;  2AOS A;  2DT1 A;  1E6P A;  5HTG A;  1JNS A;  2M2A A;  3GPK A;  4PTM A;  1FD9 A;  5HWB A;  2F21 A;  4WKH A;  1FKF A;  3WD0 A;  3UQB A;  5DO2 A;  1FKH A;  3O5Q A;  1X6N A;  4L72 B;  4P8X A;  2MLX A;  3UQI A;  2DT3 A;  4P8V A;  3B9A A;  3RME A;  2ZQS A;  1D6O A;  3WD3 A;  4DIP A;  2RQS A;  4TW8 A;  3UI6 A;  5DIU A;  4Z2J A;  3O5E A;  1ITX A;  4Q22 A;  2M1I A;  3UF8 A;  1NWS A;  4JFK A;  1L1P A;  2DPE A;  1NWT A;  1FAP A;  4QIB A;  1FKR A;  2YBU A;  1H0I A;  1ZBK A;  4Z2K A;  2DT2 A;  1Q6U A;  3MDY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...