4TW6A

The fk1 domain of fkbp51 in complex with ifit1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw6A00
1F8AB 5D75A 4LAXA 1FKTA 4TW7A 3WH0A 3PRBA 3IHZA 1B6CA 3KAFA 5I98A 1D7IA 3UQIA 3O5FA 3NTPA 2UZ5A 2XP8A 2XPBA 3KAHA 3KAGA 4ODPA 1T11A 4DIPA 1TCOC 3LUOA 2M2AA 1QPLA 2MF9A 4JFMA 5GPGA 1R9HA 1JVWA 3UI4A 2XP7A 2PV2A 4ODOA 4DH0A 4QT3A 5HTGA 1J4HA 2LPVA 1FKRA 1KT1A 4W9QA 3TCZA 2XP6A 2MLYA 3NRKA 3OOBA 3KACA 2ZR6A 2N87A 4R0XA 3IKGA 4TYOA 2ZQSA 4DZ2A 4DRMA 1FKIA 2PPPA 1L1PA 1W26A 3CGMA 2MLZA 3VAWA 2XP5A 2ZQUA 3B7XA 2MNTA 4DZ3A 2F2DA 3IK8A 3RFWA 2F21A 3UF8A 4LAVA 1BL4A 1QZ2A 3O5EA 4DRKA 3CGNA 2AWGA 1M5YA 2KE0A 3RGCA 3KZ7A 1U79A 4ODMA 1D6OA 2LKNA 2XP3A 3TC5A 2JZVA 4BF8A 1FKGA 2K8IA 5HW7A 4ODKA 2LJ4A 4LAYA 3MDYB 4DT4A 4J4OA 4ODRA 5HW6A 4DRIA 1NMVA 3UQAA 3O5JA 3KABA 3IKDA 4J4NA 1FKJA 4TNSA 1C9HA 5DIUA 4U86A 2RUDA 1ROUA 2PPOA 2KR7A 4GIVA 4ITZA 2VCDA 1FKFA 1Q6IA 4JFKA 3O5GA 4QIBA 2ZQTA 2PV3A 2RUQA 3O5KA 4N19A 5HT1A 1F40A 4MGVA 5HUAA 1FKKA 2KO7A 2MPHA 1FKBA 4IQ2A 3H9RB 4JFJA 1P5QA 4DROA 3EY6A 1BKFA 2KGJA 2XP4A 2ITKA 2PPNA 2ZR5A 1A7XA 1J4IA 4TW8A 5HKGA 4FN2A 4DRNA 3O5MA 4U85A 2D9FA 1D7HA 3O5IA 3KCEA 4C02B 3JXVA 1Q6UA 4IPXA 5HW8A 2KI3A 2RSEA 2KFWA 2M08A 4JYSA 5HWCA 5J6EA 1PBKA 4NNRA 1FAPA 1FKDA 2PV1A 2RURA 4LAWA 2DG9A 1FKLA 5DIVA 5HWBA 2DG4A 2IF4A 3KAIA 2ZR4A 4DRHA 1YW5A 2MLXA 1JNTA 1N1AA 3O5OA 3PA7A 4G2PA 1Y0OA 5DITA 4FAPA 4W9PA 2F4EA 1NSGA 3UI6A 4IQCA 3UQBA 4MSPA 2VN1A 4ODNA 3O5DA 1HXVA 1FD9A 2FKEA 3NI6A 1J6YA 2L2SA 3O5RA 4JFLA 4G50A 1ZCNA 4GGQA 2LGOA 4DRJA 4TX0A 3JYMA 1EYMA 3TDBA 1D7JA 1FJDA 3PRDA 4JFIA 4O2TA 5B8IC 4W9OA 2FAPA 4TW6A 1QPFA 3UI5A 4U84A 1Q6HA 3O5LA 3KADA 3O5PA 1KT0A 1JNSA 4ODLA 2ZQVA 1EQ3A 1PINA 3ODKA 2RQSA 5BXJA 1ZK6A 2Q5AA 4ODQA 2RUCA 3O5QA 4DRQA 1J4RA 2M1IA 3I6CA 1FKHA 3JYJA 1NMWA 2DG3A 1FKSA 1ROTA 2XP9A 2XPAA 2Y78A 3GPKA 1Q1CA 3FAPA 4QT2A 4DRPA 2PBCA 1YATA 2OFNA
chains in the Genus database with same CATH superfamily
4URIA 3IHZA 1E6RA 1NWUA 2UZ5A 3KAGA 4Z2HA 4DIPA 1TCOC 2M2AA 1QPLA 2MF9A 4JFMA 4L72B 5GPGA 3RM9A 1W9UA 4Q22A 1RD6A 3ARQA 4W9QA 1FKRA 2XP6A 2A3EA 2N87A 3CZ8A 4TYOA 1L1PA 3ARVA 3CGMA 2XP5A 3B8SA 3B7XA 3WD3A 4DZ3A 2F2DA 3IK8A 3CHEA 3WL1A 4HBEA 3O5EA 4XAKA 4DRKA 4P8UA 1E44A 1U79A 2JZVA 1FKGA 2K8IA 2LJ4A 4J4OA 5HW6A 4DRIA 1FKJA 1C9HA 3ARWA 4U86A 2RUDA 1ROUA 1Q6IA 1ZBKA 3ARRA 1FKKA 2KO7A 3ARUA 2QF8A 1FKBA 2OLHA 3ARPA 4DWSB 2XP4A 1VF8A 1JCHB 2EULA 3AQUA 4HARA 1D7HA 3O5IA 4DWSA 4IPXA 2RSEA 2M08A 5HWCA 3B9EA 1FFQA 4UDMA 1FKLA 5DIVA 2WLZA 4Q7NA 2MLXA 4G2PA 4W9PA 2F4EA 3GU0A 3UI6A 4IQCA 3FY1A 3NI6A 1W1YA 1O6IA 4JFLA 1W1VA 1ZCNA 3ARXA 4DRJA 2DT1A 3WD0A 1NWSA 4O2TA 4KQZA 5B8IC 2DPEA 2IUZA 2FAPA 2DSUA 1XRVA 1Q6HA 4R5EA 3ODKA 2RQSA 3BMBA 1ZK6A 1W1TA 2RUCA 3WD2A 1J4RA 4MAVA 2F23A 3CHCA 3RMEA 1NMWA 2XP9A 1SYTA 4MNKA 4S3JA 1HKKA 1LJYA 1WNOA 1E9LA 1F8AB 5D75A 4TW7A 3WH0A 1LG1A 1NWTA 3KAFA 4MTVA 1D7IA 3UQIA 3O5FA 2XP8A 2XPBA 3KAHA 4ODPA 3LUOA 1R9HA 4P8WA 2PV2A 4ODOA 5HTGA 1KT1A 3NRKA 4WK9A 1HKJA 3WL0A 4R0XA 2ZQSA 4DRMA 1FKIA 2PPPA 5HBFA 1OGGA 1W26A 4DWSC 2ZQUA 1NWRA 1GRJA 3RFWA 1BL4A 2KE0A 3KZ7A 4ODMA 1D6OA 2LKNA 3TC5A 4ODKA 3B9AA 1H0IA 4Z2JA 1W1PA 3O5JA 1HKMA 3KABA 4J4NA 4TNSA 2VCDA 4WJXA 2ZQTA 2RUQA 2O9OA 5HUAA 1IX5A 4TW8A 1E6NA 2PPNA 2ETNA 1E6ZA 1HKIA 3KCEA 4C02B 2DSWA 4IT4A 2KI3A 4P8XA 2KFWA 4JYSA 1PBKA 1FKDA 2PV1A 1OGBA 1ZBCA 2IF4A 5DO2A 1LG2A 4MNLA 1YW5A 1JNTA 3ARTA 1NSGA 3AS3A 1EDQA 4ODNA 1HXVA 4HBOA 1GPFA 2L2SA 4NZCA 4MPKA 4GGQA 2DT0A 1EYMA 1D7JA 2P4VA 5DF0A 4TW6A 3KADA 3ALFA 1JNSA 5GQBA 2Q5AA 4ODQA 1ZBVA 3O5QA 2M1IA 1FKHA 2YBTA 4WKAA 1Q1CA 4QT2A 4MNJA 2PBCA 4Z2KA 1B6CA 5I98A 3BXWA 3NTPA 4WKFA 3AS2A 4QZVB 2XP7A 4DH0A 1FFRA 2LPVA 3PR9A 4KR0B 3TCZA 2MLYA 4L3NA 4DZ2A 1OWQA 1X6LA 3WKZA 3VAWA 2MLZA 1UR8A 4NSBA 1QZ2A 3CGNA 1M5YA 2YBUA 2XP3A 5DEZA 4BF8A 1LL4A 5HW7A 1LL6A 3RM8A 4DT4A 3CHFA 4ODRA 1NMVA 3UQAA 3IKDA 3ARYA 2PPOA 4GIVA 2DSZA 1XHGA 3O5GA 2PV3A 1NH6A 3G6MA 1F40A 5GPRA 4JFJA 1P5QA 4DROA 1BKFA 2KGJA 5JH8A 2ITKA 2ZR5A 4ML4A 5HKGA 1KFWA 4FN2A 3O5MA 2DT3A 5HW8A 1ZBWA 4NNRA 1FAPA 2G8ZA 4DWSD 4LAWA 2DG4A 1HJXA 2ZR4A 4DRHA 1ITXA 3UQBA 2VN1A 2DSVA 1GOIA 2FKEA 1W9VA 3JYMA 3WD4A 4W9OA 1QPFA 3GTYX 3UI5A 4U84A 3ALGA 3O5LA 4IT6A 1EQ3A 5BXJA 2WLYA 3AS0A 3EIPA 4DRQA 3I6CA 1FKSA 1ROTA 1HJVA 1WAWA 4W5UA 2A3AA 1E15A 1LL7A 4ZPTR 1CTNA 4LAXA 1FKTA 1WB0A 3PRBA 4P8VA 1H0GA 1T11A 1HJWA 1JVWA 3UI4A 2WK2A 3WQVA 4QT3A 1J4HA 3G6LA 3OOBA 3KACA 2ZR6A 1SR0A 3IKGA 3AROA 1UR9A 1EIBA 4ZS6A 2FDMA 2MNTA 2O92A 3ARSA 3UF8A 2F21A 4LAVA 2AWGA 4MNMA 3RGCA 2PN0A 1W9PA 4LAYA 3MDYB 3FXYA 1JNEA 2B5UB 5DIUA 2KR7A 4ITZA 1FKFA 3WQWA 4JFKA 1JNDA 3CH9A 4QIBA 4N19A 3O5KA 5HT1A 4PTMA 1K9TA 4MGVA 2MPHA 1ZU8A 2A3BA 4IQ2A 3H9RB 3W4RA 3EY6A 2AOSA 2DT2A 1A7XA 1J4IA 4DRNA 4U85A 3PRAA 2D9FA 2G41A 3JXVA 1Q6UA 5J6EA 2ESCA 3RM4A 2RURA 3WD1A 1GUVA 2DG9A 4S3KA 3KAIA 5HWBA 3O5OA 1N1AA 4WKHA 3PA7A 5DITA 4FAPA 1Y0OA 4Z2LA 1TFVA 3ARZA 4MSPA 3O5DA 1X6NA 1FD9A 1J6YA 3O5RA 4G50A 1ZL1A 4ZPVR 2LGOA 2A3CA 4TX0A 3TDBA 1E6PA 3WIJA 1LQ0A 4Z2IA 1FJDA 3PRDA 4JFIA 4AY1A 2B31A 4Z2GA 3QOKA 3B9DA 4ZPWR 2PI6A 3O5PA 1KT0A 4ODLA 2ZQVA 1PINA 2WM0A 3OA5A 1D2KA 4LGXA 3JYJA 2DG3A 2XPAA 4WIWA 1EHNA 2Y78A 3GPKA 1ZB5A 3CHDA 3FAPA 4DRPA 1YATA 3AS1A 2OFNA
chains in the Genus database with same CATH topology
4URIA 3IHZA 1E6RA 1NWUA 2UZ5A 3KAGA 4Z2HA 4DIPA 1TCOC 2M2AA 1QPLA 2MF9A 4JFMA 4L72B 5GPGA 3RM9A 1W9UA 4Q22A 1RD6A 3ARQA 4W9QA 1FKRA 2XP6A 2A3EA 2N87A 3CZ8A 4TYOA 1L1PA 3ARVA 3CGMA 2XP5A 3B8SA 3B7XA 3WD3A 4DZ3A 2F2DA 3IK8A 3CHEA 3WL1A 4HBEA 3O5EA 4XAKA 4DRKA 4P8UA 1U79A 2JZVA 1FKGA 2K8IA 2LJ4A 4J4OA 5HW6A 4DRIA 1FKJA 1C9HA 3ARWA 4U86A 2RUDA 1ROUA 1Q6IA 1ZBKA 3ARRA 1FKKA 2KO7A 3ARUA 2QF8A 1FKBA 2OLHA 3ARPA 4DWSB 1VF8A 2XP4A 3AQUA 4HARA 1D7HA 3O5IA 4DWSA 4IPXA 2RSEA 2M08A 5HWCA 3B9EA 1FFQA 1FKLA 5DIVA 2WLZA 4Q7NA 2MLXA 4G2PA 4W9PA 2F4EA 3UI6A 4IQCA 3FY1A 3NI6A 1W1YA 1O6IA 4JFLA 1W1VA 1ZCNA 3ARXA 4DRJA 2DT1A 3WD0A 1NWSA 4O2TA 4KQZA 5B8IC 2DPEA 2IUZA 2FAPA 2DSUA 1XRVA 1Q6HA 4R5EA 3ODKA 2RQSA 1ZK6A 1W1TA 2RUCA 3WD2A 1J4RA 4MAVA 3CHCA 3RMEA 1NMWA 2XP9A 1SYTA 4MNKA 4S3JA 1HKKA 1LJYA 1WNOA 1E9LA 1F8AB 5D75A 4TW7A 3WH0A 1LG1A 1NWTA 3KAFA 4MTVA 1D7IA 3UQIA 3O5FA 2XP8A 2XPBA 3KAHA 4ODPA 3LUOA 1R9HA 4P8WA 2PV2A 4ODOA 5HTGA 1KT1A 3NRKA 4WK9A 1HKJA 3WL0A 4R0XA 2ZQSA 4DRMA 1FKIA 2PPPA 5HBFA 1OGGA 1W26A 4DWSC 2ZQUA 1NWRA 3RFWA 1BL4A 2KE0A 3KZ7A 4ODMA 1D6OA 2LKNA 3TC5A 4ODKA 3B9AA 1H0IA 4Z2JA 1W1PA 3O5JA 1HKMA 3KABA 4J4NA 4TNSA 2VCDA 4WJXA 2ZQTA 2RUQA 2O9OA 5HUAA 1IX5A 4TW8A 1E6NA 2PPNA 1E6ZA 1HKIA 3KCEA 4C02B 2DSWA 4IT4A 2KI3A 4P8XA 2KFWA 4JYSA 1PBKA 1FKDA 2PV1A 1OGBA 1ZBCA 2IF4A 5DO2A 1LG2A 4MNLA 1YW5A 1JNTA 3ARTA 1NSGA 3AS3A 1EDQA 4ODNA 1HXVA 4HBOA 1GPFA 2L2SA 4NZCA 4MPKA 4GGQA 2DT0A 1EYMA 1D7JA 5DF0A 4TW6A 3KADA 3ALFA 1JNSA 5GQBA 2Q5AA 4ODQA 1ZBVA 3O5QA 2M1IA 1FKHA 2YBTA 4WKAA 1Q1CA 4QT2A 4MNJA 2PBCA 4Z2KA 1B6CA 5I98A 3BXWA 3NTPA 4WKFA 3AS2A 4QZVB 2XP7A 4DH0A 1FFRA 2LPVA 3PR9A 4KR0B 3TCZA 2MLYA 4L3NA 4DZ2A 1OWQA 1X6LA 3WKZA 3VAWA 2MLZA 1UR8A 4NSBA 1QZ2A 3CGNA 1M5YA 2YBUA 2XP3A 5DEZA 4BF8A 1LL4A 5HW7A 1LL6A 3RM8A 4DT4A 3CHFA 4ODRA 1NMVA 3UQAA 3IKDA 3ARYA 2PPOA 4GIVA 2DSZA 1XHGA 3O5GA 2PV3A 1NH6A 3G6MA 1F40A 5GPRA 4JFJA 1P5QA 4DROA 1BKFA 2KGJA 5JH8A 2ITKA 2ZR5A 4ML4A 5HKGA 1KFWA 4FN2A 3O5MA 2DT3A 5HW8A 1ZBWA 4NNRA 1FAPA 2G8ZA 4DWSD 4LAWA 2DG4A 1HJXA 2ZR4A 4DRHA 1ITXA 3UQBA 2VN1A 2DSVA 1GOIA 2FKEA 1W9VA 3JYMA 3WD4A 4W9OA 1QPFA 3UI5A 4U84A 3ALGA 3O5LA 4IT6A 1EQ3A 5BXJA 2WLYA 3AS0A 4DRQA 3I6CA 1FKSA 1ROTA 1HJVA 1WAWA 4W5UA 2A3AA 1E15A 1LL7A 4ZPTR 1CTNA 4LAXA 1FKTA 1WB0A 3PRBA 4P8VA 1H0GA 1T11A 1HJWA 1JVWA 3UI4A 2WK2A 3WQVA 4QT3A 1J4HA 3G6LA 3OOBA 3KACA 2ZR6A 1SR0A 3IKGA 3AROA 1UR9A 1EIBA 4ZS6A 2FDMA 2MNTA 2O92A 3ARSA 3UF8A 2F21A 4LAVA 2AWGA 4MNMA 3RGCA 1W9PA 4LAYA 3MDYB 3FXYA 1JNEA 5DIUA 2KR7A 4ITZA 1FKFA 3WQWA 4JFKA 1JNDA 3CH9A 4QIBA 4N19A 3O5KA 5HT1A 4PTMA 1K9TA 4MGVA 2MPHA 1ZU8A 2A3BA 4IQ2A 3H9RB 3W4RA 3EY6A 2AOSA 2DT2A 1A7XA 1J4IA 4DRNA 4U85A 3PRAA 2D9FA 2G41A 3JXVA 1Q6UA 5J6EA 2ESCA 3RM4A 2RURA 3WD1A 1GUVA 2DG9A 4S3KA 3KAIA 5HWBA 3O5OA 1N1AA 4WKHA 3PA7A 5DITA 4FAPA 1Y0OA 4Z2LA 1TFVA 3ARZA 4MSPA 3O5DA 1X6NA 1FD9A 1J6YA 3O5RA 4G50A 1ZL1A 4ZPVR 2LGOA 2A3CA 4TX0A 3TDBA 1E6PA 3WIJA 1LQ0A 4Z2IA 1FJDA 3PRDA 4JFIA 4AY1A 2B31A 4Z2GA 3QOKA 3B9DA 4ZPWR 2PI6A 3O5PA 1KT0A 4ODLA 2ZQVA 1PINA 2WM0A 3OA5A 1D2KA 4LGXA 3JYJA 2DG3A 2XPAA 4WIWA 1EHNA 2Y78A 3GPKA 1ZB5A 3CHDA 3FAPA 4DRPA 1YATA 3AS1A 2OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  5D75 A;  4LAX A;  1FKT A;  4TW7 A;  3WH0 A;  3PRB A;  3IHZ A;  1B6C A;  3KAF A;  5I98 A;  1D7I A;  3UQI A;  3O5F A;  3NTP A;  2UZ5 A;  2XP8 A;  2XPB A;  3KAH A;  3KAG A;  4ODP A;  1T11 A;  4DIP A;  1TCO C;  3LUO A;  2M2A A;  1QPL A;  2MF9 A;  4JFM A;  5GPG A;  1R9H A;  1JVW A;  3UI4 A;  2XP7 A;  2PV2 A;  4ODO A;  4DH0 A;  4QT3 A;  5HTG A;  1J4H A;  2LPV A;  1FKR A;  1KT1 A;  4W9Q A;  3TCZ A;  2XP6 A;  2MLY A;  3NRK A;  3OOB A;  3KAC A;  2ZR6 A;  2N87 A;  4R0X A;  3IKG A;  4TYO A;  2ZQS A;  4DZ2 A;  4DRM A;  1FKI A;  2PPP A;  1L1P A;  1W26 A;  3CGM A;  2MLZ A;  3VAW A;  2XP5 A;  2ZQU A;  3B7X A;  2MNT A;  4DZ3 A;  2F2D A;  3IK8 A;  3RFW A;  2F21 A;  3UF8 A;  4LAV A;  1BL4 A;  1QZ2 A;  3O5E A;  4DRK A;  3CGN A;  2AWG A;  1M5Y A;  2KE0 A;  3RGC A;  3KZ7 A;  1U79 A;  4ODM A;  1D6O A;  2LKN A;  2XP3 A;  3TC5 A;  2JZV A;  4BF8 A;  1FKG A;  2K8I A;  5HW7 A;  4ODK A;  2LJ4 A;  4LAY A;  3MDY B;  4DT4 A;  4J4O A;  4ODR A;  5HW6 A;  4DRI A;  1NMV A;  3UQA A;  3O5J A;  3KAB A;  3IKD A;  4J4N A;  1FKJ A;  4TNS A;  1C9H A;  5DIU A;  4U86 A;  2RUD A;  1ROU A;  2PPO A;  2KR7 A;  4GIV A;  4ITZ A;  2VCD A;  1FKF A;  1Q6I A;  4JFK A;  3O5G A;  4QIB A;  2ZQT A;  2PV3 A;  2RUQ A;  3O5K A;  4N19 A;  5HT1 A;  1F40 A;  4MGV A;  5HUA A;  1FKK A;  2KO7 A;  2MPH A;  1FKB A;  4IQ2 A;  3H9R B;  4JFJ A;  1P5Q A;  4DRO A;  3EY6 A;  1BKF A;  2KGJ A;  2XP4 A;  2ITK A;  2PPN A;  2ZR5 A;  1A7X A;  1J4I A;  4TW8 A;  5HKG A;  4FN2 A;  4DRN A;  3O5M A;  4U85 A;  2D9F A;  1D7H A;  3O5I A;  3KCE A;  4C02 B;  3JXV A;  1Q6U A;  4IPX A;  5HW8 A;  2KI3 A;  2RSE A;  2KFW A;  2M08 A;  4JYS A;  5HWC A;  5J6E A;  1PBK A;  4NNR A;  1FAP A;  1FKD A;  2PV1 A;  2RUR A;  4LAW A;  2DG9 A;  1FKL A;  5DIV A;  5HWB A;  2DG4 A;  2IF4 A;  3KAI A;  2ZR4 A;  4DRH A;  1YW5 A;  2MLX A;  1JNT A;  1N1A A;  3O5O A;  3PA7 A;  4G2P A;  1Y0O A;  5DIT A;  4FAP A;  4W9P A;  2F4E A;  1NSG A;  3UI6 A;  4IQC A;  3UQB A;  4MSP A;  2VN1 A;  4ODN A;  3O5D A;  1HXV A;  1FD9 A;  2FKE A;  3NI6 A;  1J6Y A;  2L2S A;  3O5R A;  4JFL A;  4G50 A;  1ZCN A;  4GGQ A;  2LGO A;  4DRJ A;  4TX0 A;  3JYM A;  1EYM A;  3TDB A;  1D7J A;  1FJD A;  3PRD A;  4JFI A;  4O2T A;  5B8I C;  4W9O A;  2FAP A;  4TW6 A;  1QPF A;  3UI5 A;  4U84 A;  1Q6H A;  3O5L A;  3KAD A;  3O5P A;  1KT0 A;  1JNS A;  4ODL A;  2ZQV A;  1EQ3 A;  1PIN A;  3ODK A;  2RQS A;  5BXJ A;  1ZK6 A;  2Q5A A;  4ODQ A;  2RUC A;  3O5Q A;  4DRQ A;  1J4R A;  2M1I A;  3I6C A;  1FKH A;  3JYJ A;  1NMW A;  2DG3 A;  1FKS A;  1ROT A;  2XP9 A;  2XPA A;  2Y78 A;  3GPK A;  1Q1C A;  3FAP A;  4QT2 A;  4DRP A;  2PBC A;  1YAT A;  2OFN A; 
#chains in the Genus database with same CATH topology
 4URI A;  3IHZ A;  1E6R A;  1NWU A;  2UZ5 A;  3KAG A;  4Z2H A;  4DIP A;  1TCO C;  2M2A A;  1QPL A;  2MF9 A;  4JFM A;  4L72 B;  5GPG A;  3RM9 A;  1W9U A;  4Q22 A;  1RD6 A;  3ARQ A;  4W9Q A;  1FKR A;  2XP6 A;  2A3E A;  2N87 A;  3CZ8 A;  4TYO A;  1L1P A;  3ARV A;  3CGM A;  2XP5 A;  3B8S A;  3B7X A;  3WD3 A;  4DZ3 A;  2F2D A;  3IK8 A;  3CHE A;  3WL1 A;  4HBE A;  3O5E A;  4XAK A;  4DRK A;  4P8U A;  1E44 A;  1U79 A;  2JZV A;  1FKG A;  2K8I A;  2LJ4 A;  4J4O A;  5HW6 A;  4DRI A;  1FKJ A;  1C9H A;  3ARW A;  4U86 A;  2RUD A;  1ROU A;  1Q6I A;  1ZBK A;  3ARR A;  1FKK A;  2KO7 A;  3ARU A;  2QF8 A;  1FKB A;  2OLH A;  3ARP A;  4DWS B;  2XP4 A;  1VF8 A;  1JCH B;  2EUL A;  3AQU A;  4HAR A;  1D7H A;  3O5I A;  4DWS A;  4IPX A;  2RSE A;  2M08 A;  5HWC A;  3B9E A;  1FFQ A;  4UDM A;  1FKL A;  5DIV A;  2WLZ A;  4Q7N A;  2MLX A;  4G2P A;  4W9P A;  2F4E A;  3GU0 A;  3UI6 A;  4IQC A;  3FY1 A;  3NI6 A;  1W1Y A;  1O6I A;  4JFL A;  1W1V A;  1ZCN A;  3ARX A;  4DRJ A;  2DT1 A;  3WD0 A;  1NWS A;  4O2T A;  4KQZ A;  5B8I C;  2DPE A;  2IUZ A;  2FAP A;  2DSU A;  1XRV A;  1Q6H A;  4R5E A;  3ODK A;  2RQS A;  3BMB A;  1ZK6 A;  1W1T A;  2RUC A;  3WD2 A;  1J4R A;  4MAV A;  2F23 A;  3CHC A;  3RME A;  1NMW A;  2XP9 A;  1SYT A;  4MNK A;  4S3J A;  1HKK A;  1LJY A;  1WNO A;  1E9L A;  1F8A B;  5D75 A;  4TW7 A;  3WH0 A;  1LG1 A;  1NWT A;  3KAF A;  4MTV A;  1D7I A;  3UQI A;  3O5F A;  2XP8 A;  2XPB A;  3KAH A;  4ODP A;  3LUO A;  1R9H A;  4P8W A;  2PV2 A;  4ODO A;  5HTG A;  1KT1 A;  3NRK A;  4WK9 A;  1HKJ A;  3WL0 A;  4R0X A;  2ZQS A;  4DRM A;  1FKI A;  2PPP A;  5HBF A;  1OGG A;  1W26 A;  4DWS C;  2ZQU A;  1NWR A;  1GRJ A;  3RFW A;  1BL4 A;  2KE0 A;  3KZ7 A;  4ODM A;  1D6O A;  2LKN A;  3TC5 A;  4ODK A;  3B9A A;  1H0I A;  4Z2J A;  1W1P A;  3O5J A;  1HKM A;  3KAB A;  4J4N A;  4TNS A;  2VCD A;  4WJX A;  2ZQT A;  2RUQ A;  2O9O A;  5HUA A;  1IX5 A;  4TW8 A;  1E6N A;  2PPN A;  2ETN A;  1E6Z A;  1HKI A;  3KCE A;  4C02 B;  2DSW A;  4IT4 A;  2KI3 A;  4P8X A;  2KFW A;  4JYS A;  1PBK A;  1FKD A;  2PV1 A;  1OGB A;  1ZBC A;  2IF4 A;  5DO2 A;  1LG2 A;  4MNL A;  1YW5 A;  1JNT A;  3ART A;  1NSG A;  3AS3 A;  1EDQ A;  4ODN A;  1HXV A;  4HBO A;  1GPF A;  2L2S A;  4NZC A;  4MPK A;  4GGQ A;  2DT0 A;  1EYM A;  1D7J A;  2P4V A;  5DF0 A;  4TW6 A;  3KAD A;  3ALF A;  1JNS A;  5GQB A;  2Q5A A;  4ODQ A;  1ZBV A;  3O5Q A;  2M1I A;  1FKH A;  2YBT A;  4WKA A;  1Q1C A;  4QT2 A;  4MNJ A;  2PBC A;  4Z2K A;  1B6C A;  5I98 A;  3BXW A;  3NTP A;  4WKF A;  3AS2 A;  4QZV B;  2XP7 A;  4DH0 A;  1FFR A;  2LPV A;  3PR9 A;  4KR0 B;  3TCZ A;  2MLY A;  4L3N A;  4DZ2 A;  1OWQ A;  1X6L A;  3WKZ A;  3VAW A;  2MLZ A;  1UR8 A;  4NSB A;  1QZ2 A;  3CGN A;  1M5Y A;  2YBU A;  2XP3 A;  5DEZ A;  4BF8 A;  1LL4 A;  5HW7 A;  1LL6 A;  3RM8 A;  4DT4 A;  3CHF A;  4ODR A;  1NMV A;  3UQA A;  3IKD A;  3ARY A;  2PPO A;  4GIV A;  2DSZ A;  1XHG A;  3O5G A;  2PV3 A;  1NH6 A;  3G6M A;  1F40 A;  5GPR A;  4JFJ A;  1P5Q A;  4DRO A;  1BKF A;  2KGJ A;  5JH8 A;  2ITK A;  2ZR5 A;  4ML4 A;  5HKG A;  1KFW A;  4FN2 A;  3O5M A;  2DT3 A;  5HW8 A;  1ZBW A;  4NNR A;  1FAP A;  2G8Z A;  4DWS D;  4LAW A;  2DG4 A;  1HJX A;  2ZR4 A;  4DRH A;  1ITX A;  3UQB A;  2VN1 A;  2DSV A;  1GOI A;  2FKE A;  1W9V A;  3JYM A;  3WD4 A;  4W9O A;  1QPF A;  3GTY X;  3UI5 A;  4U84 A;  3ALG A;  3O5L A;  4IT6 A;  1EQ3 A;  5BXJ A;  2WLY A;  3AS0 A;  3EIP A;  4DRQ A;  3I6C A;  1FKS A;  1ROT A;  1HJV A;  1WAW A;  4W5U A;  2A3A A;  1E15 A;  1LL7 A;  4ZPT R;  1CTN A;  4LAX A;  1FKT A;  1WB0 A;  3PRB A;  4P8V A;  1H0G A;  1T11 A;  1HJW A;  1JVW A;  3UI4 A;  2WK2 A;  3WQV A;  4QT3 A;  1J4H A;  3G6L A;  3OOB A;  3KAC A;  2ZR6 A;  1SR0 A;  3IKG A;  3ARO A;  1UR9 A;  1EIB A;  4ZS6 A;  2FDM A;  2MNT A;  2O92 A;  3ARS A;  3UF8 A;  2F21 A;  4LAV A;  2AWG A;  4MNM A;  3RGC A;  2PN0 A;  1W9P A;  4LAY A;  3MDY B;  3FXY A;  1JNE A;  2B5U B;  5DIU A;  2KR7 A;  4ITZ A;  1FKF A;  3WQW A;  4JFK A;  1JND A;  3CH9 A;  4QIB A;  4N19 A;  3O5K A;  5HT1 A;  4PTM A;  1K9T A;  4MGV A;  2MPH A;  1ZU8 A;  2A3B A;  4IQ2 A;  3H9R B;  3W4R A;  3EY6 A;  2AOS A;  2DT2 A;  1A7X A;  1J4I A;  4DRN A;  4U85 A;  3PRA A;  2D9F A;  2G41 A;  3JXV A;  1Q6U A;  5J6E A;  2ESC A;  3RM4 A;  2RUR A;  3WD1 A;  1GUV A;  2DG9 A;  4S3K A;  3KAI A;  5HWB A;  3O5O A;  1N1A A;  4WKH A;  3PA7 A;  5DIT A;  4FAP A;  1Y0O A;  4Z2L A;  1TFV A;  3ARZ A;  4MSP A;  3O5D A;  1X6N A;  1FD9 A;  1J6Y A;  3O5R A;  4G50 A;  1ZL1 A;  4ZPV R;  2LGO A;  2A3C A;  4TX0 A;  3TDB A;  1E6P A;  3WIJ A;  1LQ0 A;  4Z2I A;  1FJD A;  3PRD A;  4JFI A;  4AY1 A;  2B31 A;  4Z2G A;  3QOK A;  3B9D A;  4ZPW R;  2PI6 A;  3O5P A;  1KT0 A;  4ODL A;  2ZQV A;  1PIN A;  2WM0 A;  3OA5 A;  1D2K A;  4LGX A;  3JYJ A;  2DG3 A;  2XPA A;  4WIW A;  1EHN A;  2Y78 A;  3GPK A;  1ZB5 A;  3CHD A;  3FAP A;  4DRP A;  1YAT A;  3AS1 A;  2OFN A; 
#chains in the Genus database with same CATH homology
 4URI A;  3IHZ A;  1E6R A;  1NWU A;  2UZ5 A;  3KAG A;  4Z2H A;  4DIP A;  1TCO C;  2M2A A;  1QPL A;  2MF9 A;  4JFM A;  4L72 B;  5GPG A;  3RM9 A;  1W9U A;  4Q22 A;  1RD6 A;  3ARQ A;  4W9Q A;  1FKR A;  2XP6 A;  2A3E A;  2N87 A;  3CZ8 A;  4TYO A;  1L1P A;  3ARV A;  3CGM A;  2XP5 A;  3B8S A;  3B7X A;  3WD3 A;  4DZ3 A;  2F2D A;  3IK8 A;  3CHE A;  3WL1 A;  4HBE A;  3O5E A;  4XAK A;  4DRK A;  4P8U A;  1U79 A;  2JZV A;  1FKG A;  2K8I A;  2LJ4 A;  4J4O A;  5HW6 A;  4DRI A;  1FKJ A;  1C9H A;  3ARW A;  4U86 A;  2RUD A;  1ROU A;  1Q6I A;  1ZBK A;  3ARR A;  1FKK A;  2KO7 A;  3ARU A;  2QF8 A;  1FKB A;  2OLH A;  3ARP A;  4DWS B;  1VF8 A;  2XP4 A;  3AQU A;  4HAR A;  1D7H A;  3O5I A;  4DWS A;  4IPX A;  2RSE A;  2M08 A;  5HWC A;  3B9E A;  1FFQ A;  1FKL A;  5DIV A;  2WLZ A;  4Q7N A;  2MLX A;  4G2P A;  4W9P A;  2F4E A;  3UI6 A;  4IQC A;  3FY1 A;  3NI6 A;  1W1Y A;  1O6I A;  4JFL A;  1W1V A;  1ZCN A;  3ARX A;  4DRJ A;  2DT1 A;  3WD0 A;  1NWS A;  4O2T A;  4KQZ A;  5B8I C;  2DPE A;  2IUZ A;  2FAP A;  2DSU A;  1XRV A;  1Q6H A;  4R5E A;  3ODK A;  2RQS A;  1ZK6 A;  1W1T A;  2RUC A;  3WD2 A;  1J4R A;  4MAV A;  3CHC A;  3RME A;  1NMW A;  2XP9 A;  1SYT A;  4MNK A;  4S3J A;  1HKK A;  1LJY A;  1WNO A;  1E9L A;  1F8A B;  5D75 A;  4TW7 A;  3WH0 A;  1LG1 A;  1NWT A;  3KAF A;  4MTV A;  1D7I A;  3UQI A;  3O5F A;  2XP8 A;  2XPB A;  3KAH A;  4ODP A;  3LUO A;  1R9H A;  4P8W A;  2PV2 A;  4ODO A;  5HTG A;  1KT1 A;  3NRK A;  4WK9 A;  1HKJ A;  3WL0 A;  4R0X A;  2ZQS A;  4DRM A;  1FKI A;  2PPP A;  5HBF A;  1OGG A;  1W26 A;  4DWS C;  2ZQU A;  1NWR A;  3RFW A;  1BL4 A;  2KE0 A;  3KZ7 A;  4ODM A;  1D6O A;  2LKN A;  3TC5 A;  4ODK A;  3B9A A;  1H0I A;  4Z2J A;  1W1P A;  3O5J A;  1HKM A;  3KAB A;  4J4N A;  4TNS A;  2VCD A;  4WJX A;  2ZQT A;  2RUQ A;  2O9O A;  5HUA A;  1IX5 A;  4TW8 A;  1E6N A;  2PPN A;  1E6Z A;  1HKI A;  3KCE A;  4C02 B;  2DSW A;  4IT4 A;  2KI3 A;  4P8X A;  2KFW A;  4JYS A;  1PBK A;  1FKD A;  2PV1 A;  1OGB A;  1ZBC A;  2IF4 A;  5DO2 A;  1LG2 A;  4MNL A;  1YW5 A;  1JNT A;  3ART A;  1NSG A;  3AS3 A;  1EDQ A;  4ODN A;  1HXV A;  4HBO A;  1GPF A;  2L2S A;  4NZC A;  4MPK A;  4GGQ A;  2DT0 A;  1EYM A;  1D7J A;  5DF0 A;  4TW6 A;  3KAD A;  3ALF A;  1JNS A;  5GQB A;  2Q5A A;  4ODQ A;  1ZBV A;  3O5Q A;  2M1I A;  1FKH A;  2YBT A;  4WKA A;  1Q1C A;  4QT2 A;  4MNJ A;  2PBC A;  4Z2K A;  1B6C A;  5I98 A;  3BXW A;  3NTP A;  4WKF A;  3AS2 A;  4QZV B;  2XP7 A;  4DH0 A;  1FFR A;  2LPV A;  3PR9 A;  4KR0 B;  3TCZ A;  2MLY A;  4L3N A;  4DZ2 A;  1OWQ A;  1X6L A;  3WKZ A;  3VAW A;  2MLZ A;  1UR8 A;  4NSB A;  1QZ2 A;  3CGN A;  1M5Y A;  2YBU A;  2XP3 A;  5DEZ A;  4BF8 A;  1LL4 A;  5HW7 A;  1LL6 A;  3RM8 A;  4DT4 A;  3CHF A;  4ODR A;  1NMV A;  3UQA A;  3IKD A;  3ARY A;  2PPO A;  4GIV A;  2DSZ A;  1XHG A;  3O5G A;  2PV3 A;  1NH6 A;  3G6M A;  1F40 A;  5GPR A;  4JFJ A;  1P5Q A;  4DRO A;  1BKF A;  2KGJ A;  5JH8 A;  2ITK A;  2ZR5 A;  4ML4 A;  5HKG A;  1KFW A;  4FN2 A;  3O5M A;  2DT3 A;  5HW8 A;  1ZBW A;  4NNR A;  1FAP A;  2G8Z A;  4DWS D;  4LAW A;  2DG4 A;  1HJX A;  2ZR4 A;  4DRH A;  1ITX A;  3UQB A;  2VN1 A;  2DSV A;  1GOI A;  2FKE A;  1W9V A;  3JYM A;  3WD4 A;  4W9O A;  1QPF A;  3UI5 A;  4U84 A;  3ALG A;  3O5L A;  4IT6 A;  1EQ3 A;  5BXJ A;  2WLY A;  3AS0 A;  4DRQ A;  3I6C A;  1FKS A;  1ROT A;  1HJV A;  1WAW A;  4W5U A;  2A3A A;  1E15 A;  1LL7 A;  4ZPT R;  1CTN A;  4LAX A;  1FKT A;  1WB0 A;  3PRB A;  4P8V A;  1H0G A;  1T11 A;  1HJW A;  1JVW A;  3UI4 A;  2WK2 A;  3WQV A;  4QT3 A;  1J4H A;  3G6L A;  3OOB A;  3KAC A;  2ZR6 A;  1SR0 A;  3IKG A;  3ARO A;  1UR9 A;  1EIB A;  4ZS6 A;  2FDM A;  2MNT A;  2O92 A;  3ARS A;  3UF8 A;  2F21 A;  4LAV A;  2AWG A;  4MNM A;  3RGC A;  1W9P A;  4LAY A;  3MDY B;  3FXY A;  1JNE A;  5DIU A;  2KR7 A;  4ITZ A;  1FKF A;  3WQW A;  4JFK A;  1JND A;  3CH9 A;  4QIB A;  4N19 A;  3O5K A;  5HT1 A;  4PTM A;  1K9T A;  4MGV A;  2MPH A;  1ZU8 A;  2A3B A;  4IQ2 A;  3H9R B;  3W4R A;  3EY6 A;  2AOS A;  2DT2 A;  1A7X A;  1J4I A;  4DRN A;  4U85 A;  3PRA A;  2D9F A;  2G41 A;  3JXV A;  1Q6U A;  5J6E A;  2ESC A;  3RM4 A;  2RUR A;  3WD1 A;  1GUV A;  2DG9 A;  4S3K A;  3KAI A;  5HWB A;  3O5O A;  1N1A A;  4WKH A;  3PA7 A;  5DIT A;  4FAP A;  1Y0O A;  4Z2L A;  1TFV A;  3ARZ A;  4MSP A;  3O5D A;  1X6N A;  1FD9 A;  1J6Y A;  3O5R A;  4G50 A;  1ZL1 A;  4ZPV R;  2LGO A;  2A3C A;  4TX0 A;  3TDB A;  1E6P A;  3WIJ A;  1LQ0 A;  4Z2I A;  1FJD A;  3PRD A;  4JFI A;  4AY1 A;  2B31 A;  4Z2G A;  3QOK A;  3B9D A;  4ZPW R;  2PI6 A;  3O5P A;  1KT0 A;  4ODL A;  2ZQV A;  1PIN A;  2WM0 A;  3OA5 A;  1D2K A;  4LGX A;  3JYJ A;  2DG3 A;  2XPA A;  4WIW A;  1EHN A;  2Y78 A;  3GPK A;  1ZB5 A;  3CHD A;  3FAP A;  4DRP A;  1YAT A;  3AS1 A;  2OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...