4TW6A

The fk1 domain of fkbp51 in complex with ifit1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw6A00
3MDYB 2FKEA 1FKSA 3O5OA 3O5QA 4MGVA 3NTPA 1QPFA 2KI3A 3PRBA 2ITKA 2XPBA 2M1IA 2DG3A 3IHZA 4JFKA 4W9PA 2OFNA 3PRDA 1KT1A 3O5MA 1FKTA 1NMWA 1PINA 1ZK6A 3H9RB 3IKDA 2MLYA 3CGMA 5HUAA 1BKFA 4TNSA 2RURA 1J4IA 1NMVA 4O2TA 1Y0OA 1M5YA 2XP9A 2KO7A 2ZQUA 4QT3A 3RFWA 1A7XA 2KE0A 1TCOC 5J6EA 5D75A 1D7HA 2MLXA 4TX0A 1FKHA 1FKIA 4DT4A 1D7IA 1ROTA 2PPNA 5B8IC 4DIPA 2AWGA 3JYMA 4DRNA 3TDBA 1FKFA 5HTGA 1C9HA 2K8IA 2RSEA 4N19A 3KAGA 2ZQVA 4JFMA 4TW7A 4TW6A 2RUCA 2DG9A 3UI4A 3KADA 3WH0A 2MPHA 3O5EA 2MF9A 1FKDA 3O5FA 2F4EA 1F8AB 3O5KA 3KACA 3OOBA 4J4OA 4DZ3A 1QPLA 2M2AA 3JYJA 4W9OA 5DIUA 4FAPA 1FKBA 2XP4A 1BL4A 3O5LA 1FKRA 2UZ5A 2ZR5A 1FKLA 3KAHA 4GIVA 1FKKA 1ROUA 4ODKA 3RGCA 3VAWA 2MLZA 2XP8A 3FAPA 1EQ3A 5HW7A 4MSPA 2XP3A 3KAFA 2Y78A 3NRKA 2PPPA 2F21A 2L2SA 3GPKA 1FD9A 1R9HA 2LJ4A 2PV1A 3I6CA 2JZVA 3IK8A 4TW8A 4ODLA 4R0XA 4DROA 2XP6A 1D7JA 5I98A 1FKGA 2ZQTA 3O5JA 1KT0A 4DRQA 2PBCA 4C02B 4DRPA 1Q6HA 5DIVA 2VN1A 3LUOA 4DRHA 4U84A 1D6OA 4JFLA 1W26A 2KGJA 5BXJA 4JFJA 2RQSA 1F40A 3NI6A 4DRJA 2PV3A 5GPGA 2M08A 3KABA 4J4NA 1N1AA 2RUQA 3EY6A 3UI6A 1L1PA 2KR7A 4QT2A 2PPOA 4TYOA 1ZCNA 5HT1A 1YATA 4FN2A 2XP5A 4U85A 1QZ2A 4ODOA 3KAIA 1JVWA 1FKJA 4LAVA 1HXVA 2MNTA 4G50A 3ODKA 1Q1CA 5HWBA 4IQ2A 4BF8A 2D9FA 2ZR6A 1NSGA 1YW5A 4ITZA 5HWCA 1J4RA 4QIBA 3O5RA 3PA7A 1FAPA 1J6YA 4DRMA 4NNRA 4JFIA 4LAXA 3UQIA 3UQAA 3O5DA 4IPXA 1J4HA 3O5IA 4DZ2A 3CGNA 4DH0A 5HKGA 3TCZA 1Q6IA 5HW8A 3B7XA 2PV2A 2XP7A 3UI5A 4LAYA 3O5PA 3UF8A 2KFWA 2LPVA 1PBKA 2Q5AA 2IF4A 4GGQA 4DRIA 5HW6A 4ODQA 2XPAA 5DITA 2LGOA 2N87A 1U79A 4U86A 4W9QA 2FAPA 2ZR4A 1T11A 4ODPA 2DG4A 3TC5A 3JXVA 3IKGA 4DRKA 4ODRA 2RUDA 1FJDA 3UQBA 2ZQSA 4ODNA 1P5QA 2F2DA 2VCDA 4JYSA 3KZ7A 3O5GA 4LAWA 4ODMA 4G2PA 1B6CA 2LKNA 4IQCA 1EYMA 3KCEA 1JNTA 1JNSA 1Q6UA
chains in the Genus database with same CATH superfamily
2FKEA 3WD2A 1EQ3A 2KI3A 2DG3A 1HJWA 3ARXA 1KFWA 4JFKA 4HBOA 2DT2A 1GUVA 3GTYX 1VF8A 3AQUA 3WD4A 3ALFA 1OGGA 2DPEA 4DWSA 5D75A 3CH9A 1D7HA 2MLXA 3B8SA 1WB0A 4QZVB 4DT4A 1D7IA 5B8IC 5HTGA 2K8IA 2RSEA 4N19A 2ZQVA 4MTVA 3ARQA 4TW6A 3UI4A 3ALGA 4WKHA 4Z2IA 1JNDA 2F4EA 2WM0A 3OOBA 4J4OA 4DZ3A 3JYJA 1RD6A 2XP4A 1BL4A 1FKLA 1SYTA 1E6RA 4MSPA 2XP3A 4ML4A 1K9TA 4Q22A 3NRKA 1E44A 1FD9A 4R0XA 3CHFA 1KT0A 4DRQA 2PBCA 1ITXA 4C02B 4DRPA 1EHNA 2VN1A 1HKJA 2KGJA 2ESCA 1GRJA 4DRJA 4LGXA 4J4NA 3KABA 1N1AA 2KR7A 1GOIA 1XHGA 1ZCNA 2XP5A 4ODOA 3ARRA 1JVWA 5HWBA 4BF8A 1X6LA 1J4RA 3O5RA 1ZBVA 3G6MA 4IPXA 1J4HA 3WD3A 5DO2A 1LL7A 1ZB5A 1LL4A 5HKGA 4P8WA 1GPFA 3B7XA 2PV2A 2XP7A 3UI5A 3RMEA 2DT3A 2KFWA 4GGQA 2B5UB 5HW6A 2LGOA 4IT4A 4WJXA 1W9PA 3CHDA 4U86A 4W9QA 1FFQA 3TC5A 3JXVA 4UDMA 3AS2A 4DRKA 1NH6A 1FJDA 3UQBA 4Q7NA 3KZ7A 4ODMA 1B6CA 3KCEA 1JNTA 1Q6UA 3ARTA 3MDYB 1JCHB 1QPFA 4Z2HA 3PRDA 5HBFA 1KT1A 3O5MA 1ZL1A 5GQBA 2RURA 1O6IA 2FDMA 3WL1A 1M5YA 1EIBA 1TCOC 3B9DA 1FKHA 1ROTA 1WAWA 3CHEA 4MNJA 3WD0A 2AWGA 3JYMA 4DRNA 3TDBA 2A3BA 4TW7A 2RUCA 4MNKA 4HARA 1CTNA 1W1TA 4MPKA 2MF9A 4Z2JA 3O5KA 1NWTA 1ZBKA 2A3EA 1QPLA 4FAPA 5DIUA 1FKBA 1E9LA 2G41A 2UZ5A 4GIVA 1W1VA 2ZR5A 3KAHA 1ROUA 2WLYA 2MLZA 2XP8A 3FAPA 1HKKA 2DSWA 4HBEA 1JNEA 4R5EA 2Y78A 2DT0A 2F23A 3GPKA 3I6CA 1R9HA 2LJ4A 1FFRA 1IX5A 2XP6A 1D7JA 3CHCA 5I98A 3WKZA 1FKGA 4IT6A 4L3NA 4DWSC 5DIVA 3LUOA 4DRHA 3BXWA 3RM8A 3UI6A 1L1PA 4QT2A 4TYOA 5J6EA 1YATA 4FN2A 3WL0A 3KAIA 1FKJA 1HXVA 3GU0A 2DSVA 2ZR6A 1E6PA 3WIJA 5HWCA 4XAKA 1FAPA 1J6YA 3UQIA 3O5IA 4DZ2A 1ZBCA 2YBUA 1LG2A 3PRAA 4DRIA 1PBKA 2Q5AA 2IF4A 4Z2KA 5DITA 1T11A 1LL6A 5JH8A 3AS0A 2ETNA 4ODNA 1TFVA 1EYMA 1W9VA 4S3KA 3O5OA 1FKSA 4MGVA 2IUZA 3OA5A 2M1IA 4W9PA 2OFNA 3ARVA 3IKDA 1ZK6A 3H9RB 1BKFA 2G8ZA 3WQVA 2KO7A 3B9AA 1A7XA 5DEZA 1H0GA 3ARYA 4TX0A 4MAVA 4NZCA 1E15A 3FY1A 3W4RA 4WKAA 4WK9A 4P8UA 3PR9A 2DG9A 2DSZA 4W5UA 1FKDA 3O5FA 3KACA 4W9OA 4P8VA 3O5LA 1FKRA 1LQ0A 4Z2GA 2O92A 3RGCA 3VAWA 1H0IA 5HW7A 2PPPA 2F21A 2L2SA 2ZQTA 2PN0A 4L72B 1X6NA 1W1YA 2AOSA 3CZ8A 4KQZA 4JFLA 2WK2A 1W26A 5BXJA 2RQSA 4PTMA 1F40A 3NI6A 1E6NA 2PV3A 5GPGA 5DF0A 2M08A 2RUQA 4AY1A 2PPOA 5HT1A 1QZ2A 2A3CA 4LAVA 4G50A 2A3AA 3ODKA 4IQ2A 2D9FA 1NSGA 1WNOA 4ITZA 2PI6A 3PA7A 3RM9A 5GPRA 4NNRA 4JFIA 3UQAA 3O5DA 2QF8A 1LG1A 4ZPTR 3RM4A 1OGBA 1D2KA 4DWSB 4LAYA 4ZS6A 3O5PA 1NWUA 3UF8A 4ODQA 1U79A 3AS1A 2FAPA 2ZR4A 4ODPA 2DG4A 3IKGA 3G6LA 2B31A 1P5QA 2F2DA 2VCDA 3EIPA 3O5GA 4G2PA 2LKNA 1SR0A 4IQCA 3O5QA 3NTPA 1ZBWA 4P8XA 3PRBA 2ITKA 2XPBA 3QOKA 3IHZA 2DT1A 4MNLA 1FKTA 1NMWA 1PINA 5HUAA 2MLYA 3CGMA 4TNSA 1J4IA 1NMVA 1HJXA 4O2TA 1Y0OA 4WKFA 2XP9A 2ZQUA 4QT3A 3RFWA 4ZPWR 2KE0A 3AROA 2DSUA 3ARSA 1FKIA 2PPNA 4KR0B 2YBTA 3ARUA 4DIPA 1W9UA 1FKFA 3ARZA 3B9EA 1C9HA 4ZPVR 3KAGA 4JFMA 3KADA 2O9OA 3WH0A 4NSBA 2MPHA 3O5EA 1F8AB 2M2AA 1XRVA 4WIWA 1UR8A 1FKKA 4ODKA 3KAFA 2WLZA 3IK8A 5HW8A 4URIA 2PV1A 2JZVA 4TW8A 4ODLA 4DROA 1LJYA 3O5JA 1ZU8A 1Q6HA 4U84A 1D6OA 3AS3A 4JFJA 3FXYA 4MNMA 1NWRA 1HJVA 3EY6A 4U85A 3ARWA 3BMBA 1HKMA 2MNTA 3ARPA 1Q1CA 1YW5A 4QIBA 3WQWA 4Z2LA 4DRMA 4LAXA 1OWQA 3CGNA 2OLHA 4DH0A 3TCZA 1Q6IA 2EULA 2P4VA 2LPVA 4DWSD 1EDQA 2XPAA 2N87A 4S3JA 1HKIA 4ODRA 2RUDA 1E6ZA 2ZQSA 4JYSA 4LAWA 1W1PA 1NWSA 1JNSA 1UR9A 3WD1A
chains in the Genus database with same CATH topology
2FKEA 3WD2A 1EQ3A 2KI3A 2DG3A 1HJWA 3ARXA 1KFWA 4JFKA 4HBOA 2DT2A 1GUVA 1VF8A 3AQUA 3WD4A 3ALFA 1OGGA 2DPEA 4DWSA 5D75A 3CH9A 1D7HA 2MLXA 3B8SA 1WB0A 4QZVB 4DT4A 1D7IA 5B8IC 5HTGA 2K8IA 2RSEA 4N19A 2ZQVA 4MTVA 3ARQA 4TW6A 3UI4A 3ALGA 4WKHA 4Z2IA 1JNDA 2F4EA 2WM0A 3OOBA 4J4OA 4DZ3A 3JYJA 1RD6A 2XP4A 1BL4A 1FKLA 1SYTA 1E6RA 4MSPA 2XP3A 4ML4A 1K9TA 4Q22A 3NRKA 1FD9A 4R0XA 3CHFA 1KT0A 4DRQA 2PBCA 1ITXA 4C02B 4DRPA 1EHNA 2VN1A 1HKJA 2KGJA 2ESCA 4DRJA 4LGXA 4J4NA 3KABA 1N1AA 2KR7A 1GOIA 1XHGA 1ZCNA 2XP5A 4ODOA 3ARRA 1JVWA 5HWBA 4BF8A 1X6LA 1J4RA 3O5RA 1ZBVA 3G6MA 4IPXA 1J4HA 3WD3A 5DO2A 1LL7A 1ZB5A 1LL4A 5HKGA 4P8WA 1GPFA 3B7XA 2PV2A 2XP7A 3UI5A 3RMEA 2DT3A 2KFWA 4GGQA 5HW6A 2LGOA 4IT4A 4WJXA 1W9PA 3CHDA 4U86A 4W9QA 1FFQA 3TC5A 3JXVA 3AS2A 4DRKA 1NH6A 1FJDA 3UQBA 4Q7NA 3KZ7A 4ODMA 1B6CA 3KCEA 1JNTA 1Q6UA 3ARTA 3MDYB 1QPFA 4Z2HA 3PRDA 5HBFA 1KT1A 3O5MA 1ZL1A 5GQBA 2RURA 1O6IA 2FDMA 3WL1A 1M5YA 1EIBA 1TCOC 3B9DA 1FKHA 1ROTA 1WAWA 3CHEA 4MNJA 3WD0A 2AWGA 3JYMA 4DRNA 3TDBA 2A3BA 4TW7A 2RUCA 4MNKA 4HARA 1CTNA 1W1TA 4MPKA 2MF9A 4Z2JA 3O5KA 1NWTA 1ZBKA 2A3EA 1QPLA 4FAPA 5DIUA 1FKBA 1E9LA 2G41A 2UZ5A 4GIVA 1W1VA 2ZR5A 3KAHA 1ROUA 2WLYA 2MLZA 2XP8A 3FAPA 1HKKA 2DSWA 4HBEA 1JNEA 4R5EA 2Y78A 2DT0A 3GPKA 3I6CA 1R9HA 2LJ4A 1FFRA 1IX5A 2XP6A 1D7JA 3CHCA 5I98A 3WKZA 1FKGA 4IT6A 4L3NA 4DWSC 5DIVA 3LUOA 4DRHA 3BXWA 3RM8A 3UI6A 1L1PA 4QT2A 4TYOA 5J6EA 1YATA 4FN2A 3WL0A 3KAIA 1FKJA 1HXVA 2DSVA 2ZR6A 1E6PA 3WIJA 5HWCA 4XAKA 1FAPA 1J6YA 3UQIA 3O5IA 4DZ2A 1ZBCA 2YBUA 1LG2A 3PRAA 4DRIA 1PBKA 2Q5AA 2IF4A 4Z2KA 5DITA 1T11A 1LL6A 5JH8A 3AS0A 4ODNA 1TFVA 1EYMA 1W9VA 4S3KA 3O5OA 1FKSA 4MGVA 2IUZA 3OA5A 2M1IA 4W9PA 2OFNA 3ARVA 3IKDA 1ZK6A 3H9RB 1BKFA 2G8ZA 3WQVA 2KO7A 3B9AA 1A7XA 5DEZA 1H0GA 3ARYA 4TX0A 4MAVA 4NZCA 1E15A 3FY1A 3W4RA 4WKAA 4WK9A 4P8UA 3PR9A 2DG9A 2DSZA 4W5UA 1FKDA 3O5FA 3KACA 4W9OA 4P8VA 3O5LA 1FKRA 1LQ0A 4Z2GA 2O92A 3RGCA 3VAWA 1H0IA 5HW7A 2PPPA 2F21A 2L2SA 2ZQTA 4L72B 1X6NA 1W1YA 2AOSA 3CZ8A 4KQZA 4JFLA 2WK2A 1W26A 5BXJA 2RQSA 4PTMA 1F40A 3NI6A 1E6NA 2PV3A 5GPGA 5DF0A 2M08A 2RUQA 4AY1A 2PPOA 5HT1A 1QZ2A 2A3CA 4LAVA 4G50A 2A3AA 3ODKA 4IQ2A 2D9FA 1NSGA 1WNOA 4ITZA 2PI6A 3PA7A 3RM9A 5GPRA 4NNRA 4JFIA 3UQAA 3O5DA 2QF8A 1LG1A 4ZPTR 3RM4A 1OGBA 1D2KA 4DWSB 4LAYA 4ZS6A 3O5PA 1NWUA 3UF8A 4ODQA 1U79A 3AS1A 2FAPA 2ZR4A 4ODPA 2DG4A 3IKGA 3G6LA 2B31A 1P5QA 2F2DA 2VCDA 3O5GA 4G2PA 2LKNA 1SR0A 4IQCA 3O5QA 3NTPA 1ZBWA 4P8XA 3PRBA 2ITKA 2XPBA 3QOKA 3IHZA 2DT1A 4MNLA 1FKTA 1NMWA 1PINA 5HUAA 2MLYA 3CGMA 4TNSA 1J4IA 1NMVA 1HJXA 4O2TA 1Y0OA 4WKFA 2XP9A 2ZQUA 4QT3A 3RFWA 4ZPWR 2KE0A 3AROA 2DSUA 3ARSA 1FKIA 2PPNA 4KR0B 2YBTA 3ARUA 4DIPA 1W9UA 1FKFA 3ARZA 3B9EA 1C9HA 4ZPVR 3KAGA 4JFMA 3KADA 2O9OA 3WH0A 4NSBA 2MPHA 3O5EA 1F8AB 2M2AA 1XRVA 4WIWA 1UR8A 1FKKA 4ODKA 3KAFA 2WLZA 3IK8A 5HW8A 4URIA 2PV1A 2JZVA 4TW8A 4ODLA 4DROA 1LJYA 3O5JA 1ZU8A 1Q6HA 4U84A 1D6OA 3AS3A 4JFJA 3FXYA 4MNMA 1NWRA 1HJVA 3EY6A 4U85A 3ARWA 1HKMA 2MNTA 3ARPA 1Q1CA 1YW5A 4QIBA 3WQWA 4Z2LA 4DRMA 4LAXA 1OWQA 3CGNA 2OLHA 4DH0A 3TCZA 1Q6IA 2LPVA 4DWSD 1EDQA 2XPAA 2N87A 4S3JA 1HKIA 4ODRA 2RUDA 1E6ZA 2ZQSA 4JYSA 4LAWA 1W1PA 1NWSA 1JNSA 1UR9A 3WD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDY B;  2FKE A;  1FKS A;  3O5O A;  3O5Q A;  4MGV A;  3NTP A;  1QPF A;  2KI3 A;  3PRB A;  2ITK A;  2XPB A;  2M1I A;  2DG3 A;  3IHZ A;  4JFK A;  4W9P A;  2OFN A;  3PRD A;  1KT1 A;  3O5M A;  1FKT A;  1NMW A;  1PIN A;  1ZK6 A;  3H9R B;  3IKD A;  2MLY A;  3CGM A;  5HUA A;  1BKF A;  4TNS A;  2RUR A;  1J4I A;  1NMV A;  4O2T A;  1Y0O A;  1M5Y A;  2XP9 A;  2KO7 A;  2ZQU A;  4QT3 A;  3RFW A;  1A7X A;  2KE0 A;  1TCO C;  5J6E A;  5D75 A;  1D7H A;  2MLX A;  4TX0 A;  1FKH A;  1FKI A;  4DT4 A;  1D7I A;  1ROT A;  2PPN A;  5B8I C;  4DIP A;  2AWG A;  3JYM A;  4DRN A;  3TDB A;  1FKF A;  5HTG A;  1C9H A;  2K8I A;  2RSE A;  4N19 A;  3KAG A;  2ZQV A;  4JFM A;  4TW7 A;  4TW6 A;  2RUC A;  2DG9 A;  3UI4 A;  3KAD A;  3WH0 A;  2MPH A;  3O5E A;  2MF9 A;  1FKD A;  3O5F A;  2F4E A;  1F8A B;  3O5K A;  3KAC A;  3OOB A;  4J4O A;  4DZ3 A;  1QPL A;  2M2A A;  3JYJ A;  4W9O A;  5DIU A;  4FAP A;  1FKB A;  2XP4 A;  1BL4 A;  3O5L A;  1FKR A;  2UZ5 A;  2ZR5 A;  1FKL A;  3KAH A;  4GIV A;  1FKK A;  1ROU A;  4ODK A;  3RGC A;  3VAW A;  2MLZ A;  2XP8 A;  3FAP A;  1EQ3 A;  5HW7 A;  4MSP A;  2XP3 A;  3KAF A;  2Y78 A;  3NRK A;  2PPP A;  2F21 A;  2L2S A;  3GPK A;  1FD9 A;  1R9H A;  2LJ4 A;  2PV1 A;  3I6C A;  2JZV A;  3IK8 A;  4TW8 A;  4ODL A;  4R0X A;  4DRO A;  2XP6 A;  1D7J A;  5I98 A;  1FKG A;  2ZQT A;  3O5J A;  1KT0 A;  4DRQ A;  2PBC A;  4C02 B;  4DRP A;  1Q6H A;  5DIV A;  2VN1 A;  3LUO A;  4DRH A;  4U84 A;  1D6O A;  4JFL A;  1W26 A;  2KGJ A;  5BXJ A;  4JFJ A;  2RQS A;  1F40 A;  3NI6 A;  4DRJ A;  2PV3 A;  5GPG A;  2M08 A;  3KAB A;  4J4N A;  1N1A A;  2RUQ A;  3EY6 A;  3UI6 A;  1L1P A;  2KR7 A;  4QT2 A;  2PPO A;  4TYO A;  1ZCN A;  5HT1 A;  1YAT A;  4FN2 A;  2XP5 A;  4U85 A;  1QZ2 A;  4ODO A;  3KAI A;  1JVW A;  1FKJ A;  4LAV A;  1HXV A;  2MNT A;  4G50 A;  3ODK A;  1Q1C A;  5HWB A;  4IQ2 A;  4BF8 A;  2D9F A;  2ZR6 A;  1NSG A;  1YW5 A;  4ITZ A;  5HWC A;  1J4R A;  4QIB A;  3O5R A;  3PA7 A;  1FAP A;  1J6Y A;  4DRM A;  4NNR A;  4JFI A;  4LAX A;  3UQI A;  3UQA A;  3O5D A;  4IPX A;  1J4H A;  3O5I A;  4DZ2 A;  3CGN A;  4DH0 A;  5HKG A;  3TCZ A;  1Q6I A;  5HW8 A;  3B7X A;  2PV2 A;  2XP7 A;  3UI5 A;  4LAY A;  3O5P A;  3UF8 A;  2KFW A;  2LPV A;  1PBK A;  2Q5A A;  2IF4 A;  4GGQ A;  4DRI A;  5HW6 A;  4ODQ A;  2XPA A;  5DIT A;  2LGO A;  2N87 A;  1U79 A;  4U86 A;  4W9Q A;  2FAP A;  2ZR4 A;  1T11 A;  4ODP A;  2DG4 A;  3TC5 A;  3JXV A;  3IKG A;  4DRK A;  4ODR A;  2RUD A;  1FJD A;  3UQB A;  2ZQS A;  4ODN A;  1P5Q A;  2F2D A;  2VCD A;  4JYS A;  3KZ7 A;  3O5G A;  4LAW A;  4ODM A;  4G2P A;  1B6C A;  2LKN A;  4IQC A;  1EYM A;  3KCE A;  1JNT A;  1JNS A;  1Q6U A; 
#chains in the Genus database with same CATH topology
 2FKE A;  3WD2 A;  1EQ3 A;  2KI3 A;  2DG3 A;  1HJW A;  3ARX A;  1KFW A;  4JFK A;  4HBO A;  2DT2 A;  1GUV A;  3GTY X;  1VF8 A;  3AQU A;  3WD4 A;  3ALF A;  1OGG A;  2DPE A;  4DWS A;  5D75 A;  3CH9 A;  1D7H A;  2MLX A;  3B8S A;  1WB0 A;  4QZV B;  4DT4 A;  1D7I A;  5B8I C;  5HTG A;  2K8I A;  2RSE A;  4N19 A;  2ZQV A;  4MTV A;  3ARQ A;  4TW6 A;  3UI4 A;  3ALG A;  4WKH A;  4Z2I A;  1JND A;  2F4E A;  2WM0 A;  3OOB A;  4J4O A;  4DZ3 A;  3JYJ A;  1RD6 A;  2XP4 A;  1BL4 A;  1FKL A;  1SYT A;  1E6R A;  4MSP A;  2XP3 A;  4ML4 A;  1K9T A;  4Q22 A;  3NRK A;  1E44 A;  1FD9 A;  4R0X A;  3CHF A;  1KT0 A;  4DRQ A;  2PBC A;  1ITX A;  4C02 B;  4DRP A;  1EHN A;  2VN1 A;  1HKJ A;  2KGJ A;  2ESC A;  1GRJ A;  4DRJ A;  4LGX A;  4J4N A;  3KAB A;  1N1A A;  2KR7 A;  1GOI A;  1XHG A;  1ZCN A;  2XP5 A;  4ODO A;  3ARR A;  1JVW A;  5HWB A;  4BF8 A;  1X6L A;  1J4R A;  3O5R A;  1ZBV A;  3G6M A;  4IPX A;  1J4H A;  3WD3 A;  5DO2 A;  1LL7 A;  1ZB5 A;  1LL4 A;  5HKG A;  4P8W A;  1GPF A;  3B7X A;  2PV2 A;  2XP7 A;  3UI5 A;  3RME A;  2DT3 A;  2KFW A;  4GGQ A;  2B5U B;  5HW6 A;  2LGO A;  4IT4 A;  4WJX A;  1W9P A;  3CHD A;  4U86 A;  4W9Q A;  1FFQ A;  3TC5 A;  3JXV A;  4UDM A;  3AS2 A;  4DRK A;  1NH6 A;  1FJD A;  3UQB A;  4Q7N A;  3KZ7 A;  4ODM A;  1B6C A;  3KCE A;  1JNT A;  1Q6U A;  3ART A;  3MDY B;  1JCH B;  1QPF A;  4Z2H A;  3PRD A;  5HBF A;  1KT1 A;  3O5M A;  1ZL1 A;  5GQB A;  2RUR A;  1O6I A;  2FDM A;  3WL1 A;  1M5Y A;  1EIB A;  1TCO C;  3B9D A;  1FKH A;  1ROT A;  1WAW A;  3CHE A;  4MNJ A;  3WD0 A;  2AWG A;  3JYM A;  4DRN A;  3TDB A;  2A3B A;  4TW7 A;  2RUC A;  4MNK A;  4HAR A;  1CTN A;  1W1T A;  4MPK A;  2MF9 A;  4Z2J A;  3O5K A;  1NWT A;  1ZBK A;  2A3E A;  1QPL A;  4FAP A;  5DIU A;  1FKB A;  1E9L A;  2G41 A;  2UZ5 A;  4GIV A;  1W1V A;  2ZR5 A;  3KAH A;  1ROU A;  2WLY A;  2MLZ A;  2XP8 A;  3FAP A;  1HKK A;  2DSW A;  4HBE A;  1JNE A;  4R5E A;  2Y78 A;  2DT0 A;  2F23 A;  3GPK A;  3I6C A;  1R9H A;  2LJ4 A;  1FFR A;  1IX5 A;  2XP6 A;  1D7J A;  3CHC A;  5I98 A;  3WKZ A;  1FKG A;  4IT6 A;  4L3N A;  4DWS C;  5DIV A;  3LUO A;  4DRH A;  3BXW A;  3RM8 A;  3UI6 A;  1L1P A;  4QT2 A;  4TYO A;  5J6E A;  1YAT A;  4FN2 A;  3WL0 A;  3KAI A;  1FKJ A;  1HXV A;  3GU0 A;  2DSV A;  2ZR6 A;  1E6P A;  3WIJ A;  5HWC A;  4XAK A;  1FAP A;  1J6Y A;  3UQI A;  3O5I A;  4DZ2 A;  1ZBC A;  2YBU A;  1LG2 A;  3PRA A;  4DRI A;  1PBK A;  2Q5A A;  2IF4 A;  4Z2K A;  5DIT A;  1T11 A;  1LL6 A;  5JH8 A;  3AS0 A;  2ETN A;  4ODN A;  1TFV A;  1EYM A;  1W9V A;  4S3K A;  3O5O A;  1FKS A;  4MGV A;  2IUZ A;  3OA5 A;  2M1I A;  4W9P A;  2OFN A;  3ARV A;  3IKD A;  1ZK6 A;  3H9R B;  1BKF A;  2G8Z A;  3WQV A;  2KO7 A;  3B9A A;  1A7X A;  5DEZ A;  1H0G A;  3ARY A;  4TX0 A;  4MAV A;  4NZC A;  1E15 A;  3FY1 A;  3W4R A;  4WKA A;  4WK9 A;  4P8U A;  3PR9 A;  2DG9 A;  2DSZ A;  4W5U A;  1FKD A;  3O5F A;  3KAC A;  4W9O A;  4P8V A;  3O5L A;  1FKR A;  1LQ0 A;  4Z2G A;  2O92 A;  3RGC A;  3VAW A;  1H0I A;  5HW7 A;  2PPP A;  2F21 A;  2L2S A;  2ZQT A;  2PN0 A;  4L72 B;  1X6N A;  1W1Y A;  2AOS A;  3CZ8 A;  4KQZ A;  4JFL A;  2WK2 A;  1W26 A;  5BXJ A;  2RQS A;  4PTM A;  1F40 A;  3NI6 A;  1E6N A;  2PV3 A;  5GPG A;  5DF0 A;  2M08 A;  2RUQ A;  4AY1 A;  2PPO A;  5HT1 A;  1QZ2 A;  2A3C A;  4LAV A;  4G50 A;  2A3A A;  3ODK A;  4IQ2 A;  2D9F A;  1NSG A;  1WNO A;  4ITZ A;  2PI6 A;  3PA7 A;  3RM9 A;  5GPR A;  4NNR A;  4JFI A;  3UQA A;  3O5D A;  2QF8 A;  1LG1 A;  4ZPT R;  3RM4 A;  1OGB A;  1D2K A;  4DWS B;  4LAY A;  4ZS6 A;  3O5P A;  1NWU A;  3UF8 A;  4ODQ A;  1U79 A;  3AS1 A;  2FAP A;  2ZR4 A;  4ODP A;  2DG4 A;  3IKG A;  3G6L A;  2B31 A;  1P5Q A;  2F2D A;  2VCD A;  3EIP A;  3O5G A;  4G2P A;  2LKN A;  1SR0 A;  4IQC A;  3O5Q A;  3NTP A;  1ZBW A;  4P8X A;  3PRB A;  2ITK A;  2XPB A;  3QOK A;  3IHZ A;  2DT1 A;  4MNL A;  1FKT A;  1NMW A;  1PIN A;  5HUA A;  2MLY A;  3CGM A;  4TNS A;  1J4I A;  1NMV A;  1HJX A;  4O2T A;  1Y0O A;  4WKF A;  2XP9 A;  2ZQU A;  4QT3 A;  3RFW A;  4ZPW R;  2KE0 A;  3ARO A;  2DSU A;  3ARS A;  1FKI A;  2PPN A;  4KR0 B;  2YBT A;  3ARU A;  4DIP A;  1W9U A;  1FKF A;  3ARZ A;  3B9E A;  1C9H A;  4ZPV R;  3KAG A;  4JFM A;  3KAD A;  2O9O A;  3WH0 A;  4NSB A;  2MPH A;  3O5E A;  1F8A B;  2M2A A;  1XRV A;  4WIW A;  1UR8 A;  1FKK A;  4ODK A;  3KAF A;  2WLZ A;  3IK8 A;  5HW8 A;  4URI A;  2PV1 A;  2JZV A;  4TW8 A;  4ODL A;  4DRO A;  1LJY A;  3O5J A;  1ZU8 A;  1Q6H A;  4U84 A;  1D6O A;  3AS3 A;  4JFJ A;  3FXY A;  4MNM A;  1NWR A;  1HJV A;  3EY6 A;  4U85 A;  3ARW A;  3BMB A;  1HKM A;  2MNT A;  3ARP A;  1Q1C A;  1YW5 A;  4QIB A;  3WQW A;  4Z2L A;  4DRM A;  4LAX A;  1OWQ A;  3CGN A;  2OLH A;  4DH0 A;  3TCZ A;  1Q6I A;  2EUL A;  2P4V A;  2LPV A;  4DWS D;  1EDQ A;  2XPA A;  2N87 A;  4S3J A;  1HKI A;  4ODR A;  2RUD A;  1E6Z A;  2ZQS A;  4JYS A;  4LAW A;  1W1P A;  1NWS A;  1JNS A;  1UR9 A;  3WD1 A; 
#chains in the Genus database with same CATH homology
 2FKE A;  3WD2 A;  1EQ3 A;  2KI3 A;  2DG3 A;  1HJW A;  3ARX A;  1KFW A;  4JFK A;  4HBO A;  2DT2 A;  1GUV A;  1VF8 A;  3AQU A;  3WD4 A;  3ALF A;  1OGG A;  2DPE A;  4DWS A;  5D75 A;  3CH9 A;  1D7H A;  2MLX A;  3B8S A;  1WB0 A;  4QZV B;  4DT4 A;  1D7I A;  5B8I C;  5HTG A;  2K8I A;  2RSE A;  4N19 A;  2ZQV A;  4MTV A;  3ARQ A;  4TW6 A;  3UI4 A;  3ALG A;  4WKH A;  4Z2I A;  1JND A;  2F4E A;  2WM0 A;  3OOB A;  4J4O A;  4DZ3 A;  3JYJ A;  1RD6 A;  2XP4 A;  1BL4 A;  1FKL A;  1SYT A;  1E6R A;  4MSP A;  2XP3 A;  4ML4 A;  1K9T A;  4Q22 A;  3NRK A;  1FD9 A;  4R0X A;  3CHF A;  1KT0 A;  4DRQ A;  2PBC A;  1ITX A;  4C02 B;  4DRP A;  1EHN A;  2VN1 A;  1HKJ A;  2KGJ A;  2ESC A;  4DRJ A;  4LGX A;  4J4N A;  3KAB A;  1N1A A;  2KR7 A;  1GOI A;  1XHG A;  1ZCN A;  2XP5 A;  4ODO A;  3ARR A;  1JVW A;  5HWB A;  4BF8 A;  1X6L A;  1J4R A;  3O5R A;  1ZBV A;  3G6M A;  4IPX A;  1J4H A;  3WD3 A;  5DO2 A;  1LL7 A;  1ZB5 A;  1LL4 A;  5HKG A;  4P8W A;  1GPF A;  3B7X A;  2PV2 A;  2XP7 A;  3UI5 A;  3RME A;  2DT3 A;  2KFW A;  4GGQ A;  5HW6 A;  2LGO A;  4IT4 A;  4WJX A;  1W9P A;  3CHD A;  4U86 A;  4W9Q A;  1FFQ A;  3TC5 A;  3JXV A;  3AS2 A;  4DRK A;  1NH6 A;  1FJD A;  3UQB A;  4Q7N A;  3KZ7 A;  4ODM A;  1B6C A;  3KCE A;  1JNT A;  1Q6U A;  3ART A;  3MDY B;  1QPF A;  4Z2H A;  3PRD A;  5HBF A;  1KT1 A;  3O5M A;  1ZL1 A;  5GQB A;  2RUR A;  1O6I A;  2FDM A;  3WL1 A;  1M5Y A;  1EIB A;  1TCO C;  3B9D A;  1FKH A;  1ROT A;  1WAW A;  3CHE A;  4MNJ A;  3WD0 A;  2AWG A;  3JYM A;  4DRN A;  3TDB A;  2A3B A;  4TW7 A;  2RUC A;  4MNK A;  4HAR A;  1CTN A;  1W1T A;  4MPK A;  2MF9 A;  4Z2J A;  3O5K A;  1NWT A;  1ZBK A;  2A3E A;  1QPL A;  4FAP A;  5DIU A;  1FKB A;  1E9L A;  2G41 A;  2UZ5 A;  4GIV A;  1W1V A;  2ZR5 A;  3KAH A;  1ROU A;  2WLY A;  2MLZ A;  2XP8 A;  3FAP A;  1HKK A;  2DSW A;  4HBE A;  1JNE A;  4R5E A;  2Y78 A;  2DT0 A;  3GPK A;  3I6C A;  1R9H A;  2LJ4 A;  1FFR A;  1IX5 A;  2XP6 A;  1D7J A;  3CHC A;  5I98 A;  3WKZ A;  1FKG A;  4IT6 A;  4L3N A;  4DWS C;  5DIV A;  3LUO A;  4DRH A;  3BXW A;  3RM8 A;  3UI6 A;  1L1P A;  4QT2 A;  4TYO A;  5J6E A;  1YAT A;  4FN2 A;  3WL0 A;  3KAI A;  1FKJ A;  1HXV A;  2DSV A;  2ZR6 A;  1E6P A;  3WIJ A;  5HWC A;  4XAK A;  1FAP A;  1J6Y A;  3UQI A;  3O5I A;  4DZ2 A;  1ZBC A;  2YBU A;  1LG2 A;  3PRA A;  4DRI A;  1PBK A;  2Q5A A;  2IF4 A;  4Z2K A;  5DIT A;  1T11 A;  1LL6 A;  5JH8 A;  3AS0 A;  4ODN A;  1TFV A;  1EYM A;  1W9V A;  4S3K A;  3O5O A;  1FKS A;  4MGV A;  2IUZ A;  3OA5 A;  2M1I A;  4W9P A;  2OFN A;  3ARV A;  3IKD A;  1ZK6 A;  3H9R B;  1BKF A;  2G8Z A;  3WQV A;  2KO7 A;  3B9A A;  1A7X A;  5DEZ A;  1H0G A;  3ARY A;  4TX0 A;  4MAV A;  4NZC A;  1E15 A;  3FY1 A;  3W4R A;  4WKA A;  4WK9 A;  4P8U A;  3PR9 A;  2DG9 A;  2DSZ A;  4W5U A;  1FKD A;  3O5F A;  3KAC A;  4W9O A;  4P8V A;  3O5L A;  1FKR A;  1LQ0 A;  4Z2G A;  2O92 A;  3RGC A;  3VAW A;  1H0I A;  5HW7 A;  2PPP A;  2F21 A;  2L2S A;  2ZQT A;  4L72 B;  1X6N A;  1W1Y A;  2AOS A;  3CZ8 A;  4KQZ A;  4JFL A;  2WK2 A;  1W26 A;  5BXJ A;  2RQS A;  4PTM A;  1F40 A;  3NI6 A;  1E6N A;  2PV3 A;  5GPG A;  5DF0 A;  2M08 A;  2RUQ A;  4AY1 A;  2PPO A;  5HT1 A;  1QZ2 A;  2A3C A;  4LAV A;  4G50 A;  2A3A A;  3ODK A;  4IQ2 A;  2D9F A;  1NSG A;  1WNO A;  4ITZ A;  2PI6 A;  3PA7 A;  3RM9 A;  5GPR A;  4NNR A;  4JFI A;  3UQA A;  3O5D A;  2QF8 A;  1LG1 A;  4ZPT R;  3RM4 A;  1OGB A;  1D2K A;  4DWS B;  4LAY A;  4ZS6 A;  3O5P A;  1NWU A;  3UF8 A;  4ODQ A;  1U79 A;  3AS1 A;  2FAP A;  2ZR4 A;  4ODP A;  2DG4 A;  3IKG A;  3G6L A;  2B31 A;  1P5Q A;  2F2D A;  2VCD A;  3O5G A;  4G2P A;  2LKN A;  1SR0 A;  4IQC A;  3O5Q A;  3NTP A;  1ZBW A;  4P8X A;  3PRB A;  2ITK A;  2XPB A;  3QOK A;  3IHZ A;  2DT1 A;  4MNL A;  1FKT A;  1NMW A;  1PIN A;  5HUA A;  2MLY A;  3CGM A;  4TNS A;  1J4I A;  1NMV A;  1HJX A;  4O2T A;  1Y0O A;  4WKF A;  2XP9 A;  2ZQU A;  4QT3 A;  3RFW A;  4ZPW R;  2KE0 A;  3ARO A;  2DSU A;  3ARS A;  1FKI A;  2PPN A;  4KR0 B;  2YBT A;  3ARU A;  4DIP A;  1W9U A;  1FKF A;  3ARZ A;  3B9E A;  1C9H A;  4ZPV R;  3KAG A;  4JFM A;  3KAD A;  2O9O A;  3WH0 A;  4NSB A;  2MPH A;  3O5E A;  1F8A B;  2M2A A;  1XRV A;  4WIW A;  1UR8 A;  1FKK A;  4ODK A;  3KAF A;  2WLZ A;  3IK8 A;  5HW8 A;  4URI A;  2PV1 A;  2JZV A;  4TW8 A;  4ODL A;  4DRO A;  1LJY A;  3O5J A;  1ZU8 A;  1Q6H A;  4U84 A;  1D6O A;  3AS3 A;  4JFJ A;  3FXY A;  4MNM A;  1NWR A;  1HJV A;  3EY6 A;  4U85 A;  3ARW A;  1HKM A;  2MNT A;  3ARP A;  1Q1C A;  1YW5 A;  4QIB A;  3WQW A;  4Z2L A;  4DRM A;  4LAX A;  1OWQ A;  3CGN A;  2OLH A;  4DH0 A;  3TCZ A;  1Q6I A;  2LPV A;  4DWS D;  1EDQ A;  2XPA A;  2N87 A;  4S3J A;  1HKI A;  4ODR A;  2RUD A;  1E6Z A;  2ZQS A;  4JYS A;  4LAW A;  1W1P A;  1NWS A;  1JNS A;  1UR9 A;  3WD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...