4TW6A

The fk1 domain of fkbp51 in complex with ifit1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Selective inhibitors of the FK506-binding protein 51 by induced fit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4tw6A00
2RUDA 2ZQVA 2KO7A 2ZR5A 2KFWA 5DIUA 4JYSA 1FKBA 1FKLA 4DT4A 1B6CA 3PRDA 1FKRA 2KE0A 5HW7A 1KT1A 2XP6A 2MF9A 4DRIA 3UF8A 4QIBA 4DZ2A 1KT0A 2MLXA 2ZR6A 3PA7A 3MDYB 4JFIA 3O5EA 1QPLA 3UQIA 4FAPA 1NMVA 2JZVA 1N1AA 2XP7A 2MNTA 4ODLA 1W26A 2PBCA 4U86A 3O5OA 5HWBA 3UI4A 1BL4A 3FAPA 1JNSA 1ROUA 1YW5A 2ZR4A 2MPHA 1D7JA 2XPAA 1JVWA 4TNSA 3UQAA 4JFMA 3KACA 1J4RA 3O5FA 4LAYA 4W9OA 3RFWA 2F4EA 1Q6UA 1Q6HA 2XP3A 2XP4A 3O5MA 2ZQSA 3GPKA 1NSGA 4LAVA 4QT2A 4R0XA 1QPFA 5HT1A 3WH0A 1J4HA 2MLZA 2RQSA 2PPNA 2FKEA 5J6EA 1FD9A 2VN1A 1FAPA 4IPXA 3CGMA 2ZQTA 2PV3A 4LAWA 4ODPA 3O5PA 1L1PA 2VCDA 4DRPA 2N87A 5DITA 4ODQA 5HUAA 1R9HA 2M1IA 4GIVA 4IQCA 3RGCA 2LGOA 4G50A 4G2PA 3O5LA 1T11A 3NRKA 1Y0OA 1BKFA 2LJ4A 2PPPA 4NNRA 3LUOA 3H9RB 3UI5A 4J4OA 2MLYA 3IKDA 2OFNA 2ITKA 3B7XA 4TW8A 2KI3A 3JXVA 2FAPA 2PV2A 3TC5A 2AWGA 3I6CA 1FKKA 4TYOA 3IHZA 3O5QA 3KADA 4DRJA 1HXVA 2PV1A 1FKIA 1J4IA 4W9QA 5HW6A 1PBKA 2LKNA 5HTGA 1F8AB 2DG9A 5B8IC 5D75A 3NI6A 4JFLA 1ZCNA 3UQBA 1NMWA 1FKDA 1JNTA 3O5JA 4DH0A 2K8IA 1D6OA 4DRKA 2RURA 2DG4A 3JYMA 1Q1CA 2XP8A 4TW6A 4DRMA 5HKGA 1PINA 1J6YA 1ZK6A 2Q5AA 4U85A 1FKGA 1FKJA 3TDBA 3CGNA 3TCZA 4IQ2A 4DRNA 2IF4A 2RSEA 3OOBA 2RUCA 4ITZA 1D7IA 4U84A 2D9FA 4J4NA 3O5KA 4ODMA 4DRQA 5I98A 1EQ3A 3KAIA 4DZ3A 3VAWA 4FN2A 4ODOA 3PRBA 3IKGA 5DIVA 1EYMA 1YATA 4GGQA 2M08A 4ODNA 1FJDA 3NTPA 2PPOA 4DIPA 3KAGA 4ODKA 1FKTA 2DG3A 2LPVA 2ZQUA 4MSPA 2XPBA 4W9PA 4DROA 4JFJA 3KCEA 4N19A 3O5GA 4BF8A 4O2TA 4C02B 5HWCA 4ODRA 2M2AA 1FKSA 1C9HA 1U79A 1P5QA 2RUQA 4QT3A 4DRHA 2XP9A 4TX0A 2Y78A 4JFKA 3IK8A 1F40A 3KAHA 2F2DA 3KZ7A 3ODKA 4LAXA 3UI6A 2UZ5A 3O5RA 1A7XA 2F21A 3O5IA 1M5YA 1TCOC 5GPGA 3KAFA 2KR7A 2XP5A 5BXJA 3EY6A 1FKHA 1QZ2A 2KGJA 3O5DA 3JYJA 4TW7A 2L2SA 1D7HA 4MGVA 5HW8A 1Q6IA 3KABA 1ROTA 1FKFA
chains in the Genus database with same CATH superfamily
2ZR5A 2KFWA 1NWSA 4JYSA 1FKBA 4IT4A 2DT1A 3B9AA 2IUZA 2KE0A 5HW7A 3UF8A 4QIBA 3BMBA 2ESCA 2A3EA 2PN0A 2ZR6A 4Z2JA 4JFIA 3O5EA 1HKJA 3UQIA 2JZVA 4DWSD 4WKAA 1E15A 3WIJA 1E6RA 2O9OA 3O5OA 5HWBA 3UI4A 1BL4A 1JNSA 2B31A 2ZR4A 3ARXA 5GQBA 3O5MA 1X6NA 4QZVB 3ARUA 3WL0A 2VN1A 1FAPA 2ZQTA 2PV3A 1IX5A 1L1PA 4DRPA 2DSWA 2N87A 4DWSA 1R9HA 2M1IA 3EIPA 4G50A 1BKFA 2ETNA 1W1VA 1O6IA 3H9RB 3UI5A 2A3AA 2O92A 1JNDA 4MNLA 2DSZA 3ARSA 1NH6A 1FKKA 3I6CA 3O5QA 3KADA 1J4IA 5B8IC 1HKMA 1ZCNA 4S3KA 4DH0A 2K8IA 3AS1A 4Z2HA 3OA5A 4DRKA 2RURA 1ITXA 2XP8A 4TW6A 4DRMA 1ZK6A 3CHFA 2RUCA 4DRQA 3KAIA 4DWSB 3B9DA 3PRBA 2M08A 2XPBA 4JFJA 4N19A 4C02B 4Z2IA 4UDMA 2M2AA 3ARRA 2RUQA 2Y78A 4HARA 3W4RA 1NWTA 4LAXA 1RD6A 3O5RA 1HJWA 4S3JA 1W9VA 3KAFA 3CHEA 1HKKA 2FDMA 1D7HA 3KABA 1ROTA 1E6ZA 2YBUA 2B5UB 1LG1A 2A3CA 3QOKA 1B6CA 2MF9A 3RM4A 1ZBWA 1EIBA 2MNTA 1W26A 1UR9A 1W9UA 4U86A 1JNEA 2G8ZA 1YW5A 1FFQA 1X6LA 2MPHA 1D7JA 2XPAA 1JVWA 3UQAA 1ZBCA 3KACA 1CTNA 4LAYA 4MNKA 3RFWA 2F4EA 1Q6UA 2XP3A 4ZPWR 3GPKA 1NSGA 4QT2A 5HT1A 1QPFA 1HKIA 1HJVA 3WQWA 2PPNA 3RM9A 4LAWA 3CGMA 4ODPA 4PTMA 2VCDA 2OLHA 3AS0A 4NZCA 4GIVA 3RGCA 3O5LA 1Y0OA 3CHCA 2LJ4A 3ALGA 3LUOA 4ZPTR 1H0IA 1TFVA 2OFNA 4NSBA 2ITKA 3ARTA 3B7XA 1LG2A 3PR9A 3IHZA 1HXVA 3GTYX 1NWRA 2F23A 3ARYA 5HTGA 1UR8A 1F8AB 4ZS6A 1W1YA 1NMWA 2WM0A 1D6OA 4L72B 4Z2KA 3AS3A 3FY1A 4U85A 4P8VA 3TDBA 3TCZA 4IQ2A 4P8XA 2WK2A 4ITZA 2DSUA 4U84A 1E6NA 5I98A 2EULA 1NWUA 3VAWA 2P4VA 4FN2A 4ODOA 2A3BA 5DF0A 3IKGA 5DIVA 4ODNA 3ALFA 4DIPA 4ODKA 1FFRA 3KCEA 1FKSA 1U79A 4DRHA 4QT3A 4TX0A 3RMEA 1ZBKA 3IK8A 4MAVA 1OGGA 3KZ7A 3UI6A 4P8WA 3ARWA 3RM8A 5BXJA 3EY6A 3G6LA 3O5DA 3WD3A 2L2SA 3GU0A 4MGVA 2RUDA 2ZQVA 2KO7A 3ARPA 1SYTA 5DIUA 3CH9A 1FKLA 2WLZA 1KT1A 2XP6A 4DRIA 4Z2GA 1KT0A 3PA7A 3MDYB 3CHDA 1QPLA 4FAPA 1N1AA 4ODLA 4URIA 1GPFA 3FAPA 1ROUA 4TNSA 4JFMA 1HJXA 3PRAA 2DT2A 1WNOA 1Q6HA 2XP4A 4MPKA 4Q7NA 3WH0A 1WAWA 2MLZA 2RQSA 1GRJA 2FKEA 5J6EA 1FD9A 4L3NA 1JCHB 1H0GA 4R5EA 4ODQA 5HUAA 2PI6A 1EDQA 4MNJA 4NNRA 4W5UA 5DEZA 1D2KA 3AQUA 1VF8A 3ARZA 2PV2A 3WD4A 4ZPVR 5HW6A 1PBKA 2LKNA 2WLYA 2DG9A 5D75A 3NI6A 4JFLA 1FKDA 1K9TA 1Q1CA 3WQVA 1J6YA 4HBOA 2Q5AA 1E9LA 1FKGA 1FKJA 3CGNA 2IF4A 2RSEA 3OOBA 5DO2A 4AY1A 4HBEA 4WJXA 4J4NA 3O5KA 4ODMA 1EQ3A 1EHNA 4IT6A 4Q22A 3CZ8A 1EYMA 1FJDA 3ARVA 2LPVA 4W9PA 4MSPA 4DROA 4MNMA 4KQZA 3B8SA 3WD2A 4BF8A 4O2TA 5HWCA 2QF8A 1P5QA 3AROA 1F40A 3KAHA 2F2DA 3ODKA 1GOIA 1A7XA 3WL1A 2F21A 4XAKA 2KR7A 4WK9A 4TW7A 2KGJA 3TC5A 5HW8A 1Q6IA 1FKFA 3O5JA 2G41A 4DT4A 4MTVA 3PRDA 1FKRA 5JH8A 3WD1A 1ZU8A 4DZ2A 2MLXA 1LL7A 1NMVA 2XP7A 1ZB5A 2PBCA 3G6MA 1LL4A 2DT0A 1J4RA 3O5FA 4W9OA 2AOSA 1W1PA 2ZQSA 4LAVA 4R0XA 1J4HA 1ZBVA 4WKHA 3BXWA 4IPXA 3O5PA 5DITA 3ARQA 5GPRA 4KR0B 4IQCA 2LGOA 1OWQA 4G2PA 1T11A 3NRKA 2PPPA 1ZL1A 4J4OA 2MLYA 3IKDA 4P8UA 1LQ0A 4TW8A 2KI3A 3JXVA 2FAPA 2AWGA 4TYOA 4DRJA 2YBTA 2DSVA 2PV1A 1FKIA 4W9QA 3WKZA 3FXYA 3UQBA 2DPEA 1JNTA 3WD0A 1OGBA 2DG4A 5HKGA 1PINA 1E44A 1WB0A 5HBFA 2DT3A 3AS2A 4DRNA 4LGXA 1GUVA 1LJYA 1D7IA 1E6PA 1XRVA 2D9FA 4DZ3A 4WKFA 1YATA 4GGQA 1LL6A 3NTPA 2PPOA 3KAGA 1FKTA 1SR0A 2DG3A 2ZQUA 3B9EA 3O5GA 4DWSC 4ODRA 4ML4A 1C9HA 2XP9A 4WIWA 4JFKA 1W1TA 1KFWA 2UZ5A 3O5IA 1M5YA 1TCOC 5GPGA 2XP5A 1FKHA 1QZ2A 1W9PA 4Z2LA 3JYJA 1XHGA 3JYMA
chains in the Genus database with same CATH topology
2ZR5A 2KFWA 1NWSA 4JYSA 1FKBA 4IT4A 2DT1A 3B9AA 2IUZA 2KE0A 5HW7A 3UF8A 4QIBA 2ESCA 2A3EA 2ZR6A 4Z2JA 4JFIA 3O5EA 1HKJA 3UQIA 2JZVA 4DWSD 4WKAA 1E15A 3WIJA 1E6RA 2O9OA 3O5OA 5HWBA 3UI4A 1BL4A 1JNSA 2B31A 2ZR4A 3ARXA 5GQBA 3O5MA 1X6NA 4QZVB 3ARUA 3WL0A 2VN1A 1FAPA 2ZQTA 2PV3A 1IX5A 1L1PA 4DRPA 2DSWA 2N87A 4DWSA 1R9HA 2M1IA 4G50A 1BKFA 1W1VA 1O6IA 3H9RB 3UI5A 2A3AA 2O92A 1JNDA 4MNLA 2DSZA 3ARSA 1NH6A 1FKKA 3I6CA 3O5QA 3KADA 1J4IA 5B8IC 1HKMA 1ZCNA 4S3KA 4DH0A 2K8IA 3AS1A 4Z2HA 3OA5A 4DRKA 2RURA 1ITXA 2XP8A 4TW6A 4DRMA 1ZK6A 3CHFA 2RUCA 4DRQA 3KAIA 4DWSB 3B9DA 3PRBA 2M08A 2XPBA 4JFJA 4N19A 4C02B 4Z2IA 2M2AA 3ARRA 2RUQA 2Y78A 4HARA 3W4RA 1NWTA 4LAXA 1RD6A 3O5RA 1HJWA 4S3JA 1W9VA 3KAFA 3CHEA 1HKKA 2FDMA 1D7HA 3KABA 1ROTA 1E6ZA 2YBUA 1LG1A 2A3CA 3QOKA 1B6CA 2MF9A 3RM4A 1ZBWA 1EIBA 2MNTA 1W26A 1UR9A 1W9UA 4U86A 1JNEA 2G8ZA 1YW5A 1FFQA 1X6LA 2MPHA 1D7JA 2XPAA 1JVWA 3UQAA 1ZBCA 3KACA 1CTNA 4LAYA 4MNKA 3RFWA 2F4EA 1Q6UA 2XP3A 4ZPWR 3GPKA 1NSGA 4QT2A 5HT1A 1QPFA 1HKIA 1HJVA 3WQWA 2PPNA 3RM9A 4LAWA 3CGMA 4ODPA 4PTMA 2VCDA 2OLHA 3AS0A 4NZCA 4GIVA 3RGCA 3O5LA 1Y0OA 3CHCA 2LJ4A 3ALGA 3LUOA 4ZPTR 1H0IA 1TFVA 2OFNA 4NSBA 2ITKA 3ARTA 3B7XA 1LG2A 3PR9A 3IHZA 1HXVA 1NWRA 3ARYA 5HTGA 1UR8A 1F8AB 4ZS6A 1W1YA 1NMWA 2WM0A 1D6OA 4L72B 4Z2KA 3AS3A 3FY1A 4U85A 4P8VA 3TDBA 3TCZA 4IQ2A 4P8XA 2WK2A 4ITZA 2DSUA 4U84A 1E6NA 5I98A 1NWUA 3VAWA 4FN2A 4ODOA 2A3BA 5DF0A 3IKGA 5DIVA 4ODNA 3ALFA 4DIPA 4ODKA 1FFRA 3KCEA 1FKSA 1U79A 4DRHA 4QT3A 4TX0A 3RMEA 1ZBKA 3IK8A 4MAVA 1OGGA 3KZ7A 3UI6A 4P8WA 3ARWA 3RM8A 5BXJA 3EY6A 3G6LA 3O5DA 3WD3A 2L2SA 4MGVA 2RUDA 2ZQVA 2KO7A 3ARPA 1SYTA 5DIUA 3CH9A 1FKLA 2WLZA 1KT1A 2XP6A 4DRIA 4Z2GA 1KT0A 3PA7A 3MDYB 3CHDA 1QPLA 4FAPA 1N1AA 4ODLA 4URIA 1GPFA 3FAPA 1ROUA 4TNSA 4JFMA 1HJXA 3PRAA 2DT2A 1WNOA 1Q6HA 2XP4A 4MPKA 4Q7NA 3WH0A 1WAWA 2MLZA 2RQSA 2FKEA 5J6EA 1FD9A 4L3NA 1H0GA 4R5EA 4ODQA 5HUAA 2PI6A 1EDQA 4MNJA 4NNRA 4W5UA 5DEZA 1D2KA 3AQUA 1VF8A 3ARZA 2PV2A 3WD4A 4ZPVR 5HW6A 1PBKA 2LKNA 2WLYA 2DG9A 5D75A 3NI6A 4JFLA 1FKDA 1K9TA 1Q1CA 3WQVA 1J6YA 4HBOA 2Q5AA 1E9LA 1FKGA 1FKJA 3CGNA 2IF4A 2RSEA 3OOBA 5DO2A 4AY1A 4HBEA 4WJXA 4J4NA 3O5KA 4ODMA 1EQ3A 1EHNA 4IT6A 4Q22A 3CZ8A 1EYMA 1FJDA 3ARVA 2LPVA 4W9PA 4MSPA 4DROA 4MNMA 4KQZA 3B8SA 3WD2A 4BF8A 4O2TA 5HWCA 2QF8A 1P5QA 3AROA 1F40A 3KAHA 2F2DA 3ODKA 1GOIA 1A7XA 3WL1A 2F21A 4XAKA 2KR7A 4WK9A 4TW7A 2KGJA 3TC5A 5HW8A 1Q6IA 3O5JA 1FKFA 2G41A 4DT4A 4MTVA 3PRDA 1FKRA 5JH8A 3WD1A 1ZU8A 4DZ2A 2MLXA 1LL7A 1NMVA 2XP7A 1ZB5A 2PBCA 3G6MA 1LL4A 2DT0A 1J4RA 3O5FA 4W9OA 2AOSA 1W1PA 2ZQSA 4LAVA 4R0XA 1J4HA 1ZBVA 4WKHA 3BXWA 4IPXA 3O5PA 5DITA 3ARQA 5GPRA 4KR0B 4IQCA 2LGOA 1OWQA 4G2PA 1T11A 3NRKA 2PPPA 1ZL1A 4J4OA 2MLYA 3IKDA 4P8UA 1LQ0A 4TW8A 2KI3A 3JXVA 2FAPA 2AWGA 4TYOA 4DRJA 2YBTA 2DSVA 2PV1A 1FKIA 4W9QA 3WKZA 3FXYA 3UQBA 2DPEA 1JNTA 3WD0A 1OGBA 2DG4A 5HKGA 1PINA 1WB0A 5HBFA 2DT3A 3AS2A 4DRNA 4LGXA 1GUVA 1LJYA 1D7IA 1E6PA 1XRVA 2D9FA 4DZ3A 4WKFA 1YATA 4GGQA 1LL6A 3NTPA 2PPOA 3KAGA 1FKTA 1SR0A 2DG3A 2ZQUA 3B9EA 3O5GA 4DWSC 4ODRA 4ML4A 1C9HA 2XP9A 4WIWA 4JFKA 1W1TA 1KFWA 2UZ5A 3O5IA 1M5YA 1TCOC 5GPGA 2XP5A 1FKHA 1QZ2A 1W9PA 4Z2LA 3JYJA 1XHGA 3JYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUD A;  2ZQV A;  2KO7 A;  2ZR5 A;  2KFW A;  5DIU A;  4JYS A;  1FKB A;  1FKL A;  4DT4 A;  1B6C A;  3PRD A;  1FKR A;  2KE0 A;  5HW7 A;  1KT1 A;  2XP6 A;  2MF9 A;  4DRI A;  3UF8 A;  4QIB A;  4DZ2 A;  1KT0 A;  2MLX A;  2ZR6 A;  3PA7 A;  3MDY B;  4JFI A;  3O5E A;  1QPL A;  3UQI A;  4FAP A;  1NMV A;  2JZV A;  1N1A A;  2XP7 A;  2MNT A;  4ODL A;  1W26 A;  2PBC A;  4U86 A;  3O5O A;  5HWB A;  3UI4 A;  1BL4 A;  3FAP A;  1JNS A;  1ROU A;  1YW5 A;  2ZR4 A;  2MPH A;  1D7J A;  2XPA A;  1JVW A;  4TNS A;  3UQA A;  4JFM A;  3KAC A;  1J4R A;  3O5F A;  4LAY A;  4W9O A;  3RFW A;  2F4E A;  1Q6U A;  1Q6H A;  2XP3 A;  2XP4 A;  3O5M A;  2ZQS A;  3GPK A;  1NSG A;  4LAV A;  4QT2 A;  4R0X A;  1QPF A;  5HT1 A;  3WH0 A;  1J4H A;  2MLZ A;  2RQS A;  2PPN A;  2FKE A;  5J6E A;  1FD9 A;  2VN1 A;  1FAP A;  4IPX A;  3CGM A;  2ZQT A;  2PV3 A;  4LAW A;  4ODP A;  3O5P A;  1L1P A;  2VCD A;  4DRP A;  2N87 A;  5DIT A;  4ODQ A;  5HUA A;  1R9H A;  2M1I A;  4GIV A;  4IQC A;  3RGC A;  2LGO A;  4G50 A;  4G2P A;  3O5L A;  1T11 A;  3NRK A;  1Y0O A;  1BKF A;  2LJ4 A;  2PPP A;  4NNR A;  3LUO A;  3H9R B;  3UI5 A;  4J4O A;  2MLY A;  3IKD A;  2OFN A;  2ITK A;  3B7X A;  4TW8 A;  2KI3 A;  3JXV A;  2FAP A;  2PV2 A;  3TC5 A;  2AWG A;  3I6C A;  1FKK A;  4TYO A;  3IHZ A;  3O5Q A;  3KAD A;  4DRJ A;  1HXV A;  2PV1 A;  1FKI A;  1J4I A;  4W9Q A;  5HW6 A;  1PBK A;  2LKN A;  5HTG A;  1F8A B;  2DG9 A;  5B8I C;  5D75 A;  3NI6 A;  4JFL A;  1ZCN A;  3UQB A;  1NMW A;  1FKD A;  1JNT A;  3O5J A;  4DH0 A;  2K8I A;  1D6O A;  4DRK A;  2RUR A;  2DG4 A;  3JYM A;  1Q1C A;  2XP8 A;  4TW6 A;  4DRM A;  5HKG A;  1PIN A;  1J6Y A;  1ZK6 A;  2Q5A A;  4U85 A;  1FKG A;  1FKJ A;  3TDB A;  3CGN A;  3TCZ A;  4IQ2 A;  4DRN A;  2IF4 A;  2RSE A;  3OOB A;  2RUC A;  4ITZ A;  1D7I A;  4U84 A;  2D9F A;  4J4N A;  3O5K A;  4ODM A;  4DRQ A;  5I98 A;  1EQ3 A;  3KAI A;  4DZ3 A;  3VAW A;  4FN2 A;  4ODO A;  3PRB A;  3IKG A;  5DIV A;  1EYM A;  1YAT A;  4GGQ A;  2M08 A;  4ODN A;  1FJD A;  3NTP A;  2PPO A;  4DIP A;  3KAG A;  4ODK A;  1FKT A;  2DG3 A;  2LPV A;  2ZQU A;  4MSP A;  2XPB A;  4W9P A;  4DRO A;  4JFJ A;  3KCE A;  4N19 A;  3O5G A;  4BF8 A;  4O2T A;  4C02 B;  5HWC A;  4ODR A;  2M2A A;  1FKS A;  1C9H A;  1U79 A;  1P5Q A;  2RUQ A;  4QT3 A;  4DRH A;  2XP9 A;  4TX0 A;  2Y78 A;  4JFK A;  3IK8 A;  1F40 A;  3KAH A;  2F2D A;  3KZ7 A;  3ODK A;  4LAX A;  3UI6 A;  2UZ5 A;  3O5R A;  1A7X A;  2F21 A;  3O5I A;  1M5Y A;  1TCO C;  5GPG A;  3KAF A;  2KR7 A;  2XP5 A;  5BXJ A;  3EY6 A;  1FKH A;  1QZ2 A;  2KGJ A;  3O5D A;  3JYJ A;  4TW7 A;  2L2S A;  1D7H A;  4MGV A;  5HW8 A;  1Q6I A;  3KAB A;  1ROT A;  1FKF A; 
#chains in the Genus database with same CATH topology
 2ZR5 A;  2KFW A;  1NWS A;  4JYS A;  1FKB A;  4IT4 A;  2DT1 A;  3B9A A;  2IUZ A;  2KE0 A;  5HW7 A;  3UF8 A;  4QIB A;  3BMB A;  2ESC A;  2A3E A;  2PN0 A;  2ZR6 A;  4Z2J A;  4JFI A;  3O5E A;  1HKJ A;  3UQI A;  2JZV A;  4DWS D;  4WKA A;  1E15 A;  3WIJ A;  1E6R A;  2O9O A;  3O5O A;  5HWB A;  3UI4 A;  1BL4 A;  1JNS A;  2B31 A;  2ZR4 A;  3ARX A;  5GQB A;  3O5M A;  1X6N A;  4QZV B;  3ARU A;  3WL0 A;  2VN1 A;  1FAP A;  2ZQT A;  2PV3 A;  1IX5 A;  1L1P A;  4DRP A;  2DSW A;  2N87 A;  4DWS A;  1R9H A;  2M1I A;  3EIP A;  4G50 A;  1BKF A;  2ETN A;  1W1V A;  1O6I A;  3H9R B;  3UI5 A;  2A3A A;  2O92 A;  1JND A;  4MNL A;  2DSZ A;  3ARS A;  1NH6 A;  1FKK A;  3I6C A;  3O5Q A;  3KAD A;  1J4I A;  5B8I C;  1HKM A;  1ZCN A;  4S3K A;  4DH0 A;  2K8I A;  3AS1 A;  4Z2H A;  3OA5 A;  4DRK A;  2RUR A;  1ITX A;  2XP8 A;  4TW6 A;  4DRM A;  1ZK6 A;  3CHF A;  2RUC A;  4DRQ A;  3KAI A;  4DWS B;  3B9D A;  3PRB A;  2M08 A;  2XPB A;  4JFJ A;  4N19 A;  4C02 B;  4Z2I A;  4UDM A;  2M2A A;  3ARR A;  2RUQ A;  2Y78 A;  4HAR A;  3W4R A;  1NWT A;  4LAX A;  1RD6 A;  3O5R A;  1HJW A;  4S3J A;  1W9V A;  3KAF A;  3CHE A;  1HKK A;  2FDM A;  1D7H A;  3KAB A;  1ROT A;  1E6Z A;  2YBU A;  2B5U B;  1LG1 A;  2A3C A;  3QOK A;  1B6C A;  2MF9 A;  3RM4 A;  1ZBW A;  1EIB A;  2MNT A;  1W26 A;  1UR9 A;  1W9U A;  4U86 A;  1JNE A;  2G8Z A;  1YW5 A;  1FFQ A;  1X6L A;  2MPH A;  1D7J A;  2XPA A;  1JVW A;  3UQA A;  1ZBC A;  3KAC A;  1CTN A;  4LAY A;  4MNK A;  3RFW A;  2F4E A;  1Q6U A;  2XP3 A;  4ZPW R;  3GPK A;  1NSG A;  4QT2 A;  5HT1 A;  1QPF A;  1HKI A;  1HJV A;  3WQW A;  2PPN A;  3RM9 A;  4LAW A;  3CGM A;  4ODP A;  4PTM A;  2VCD A;  2OLH A;  3AS0 A;  4NZC A;  4GIV A;  3RGC A;  3O5L A;  1Y0O A;  3CHC A;  2LJ4 A;  3ALG A;  3LUO A;  4ZPT R;  1H0I A;  1TFV A;  2OFN A;  4NSB A;  2ITK A;  3ART A;  3B7X A;  1LG2 A;  3PR9 A;  3IHZ A;  1HXV A;  3GTY X;  1NWR A;  2F23 A;  3ARY A;  5HTG A;  1UR8 A;  1F8A B;  4ZS6 A;  1W1Y A;  1NMW A;  2WM0 A;  1D6O A;  4L72 B;  4Z2K A;  3AS3 A;  3FY1 A;  4U85 A;  4P8V A;  3TDB A;  3TCZ A;  4IQ2 A;  4P8X A;  2WK2 A;  4ITZ A;  2DSU A;  4U84 A;  1E6N A;  5I98 A;  2EUL A;  1NWU A;  3VAW A;  2P4V A;  4FN2 A;  4ODO A;  2A3B A;  5DF0 A;  3IKG A;  5DIV A;  4ODN A;  3ALF A;  4DIP A;  4ODK A;  1FFR A;  3KCE A;  1FKS A;  1U79 A;  4DRH A;  4QT3 A;  4TX0 A;  3RME A;  1ZBK A;  3IK8 A;  4MAV A;  1OGG A;  3KZ7 A;  3UI6 A;  4P8W A;  3ARW A;  3RM8 A;  5BXJ A;  3EY6 A;  3G6L A;  3O5D A;  3WD3 A;  2L2S A;  3GU0 A;  4MGV A;  2RUD A;  2ZQV A;  2KO7 A;  3ARP A;  1SYT A;  5DIU A;  3CH9 A;  1FKL A;  2WLZ A;  1KT1 A;  2XP6 A;  4DRI A;  4Z2G A;  1KT0 A;  3PA7 A;  3MDY B;  3CHD A;  1QPL A;  4FAP A;  1N1A A;  4ODL A;  4URI A;  1GPF A;  3FAP A;  1ROU A;  4TNS A;  4JFM A;  1HJX A;  3PRA A;  2DT2 A;  1WNO A;  1Q6H A;  2XP4 A;  4MPK A;  4Q7N A;  3WH0 A;  1WAW A;  2MLZ A;  2RQS A;  1GRJ A;  2FKE A;  5J6E A;  1FD9 A;  4L3N A;  1JCH B;  1H0G A;  4R5E A;  4ODQ A;  5HUA A;  2PI6 A;  1EDQ A;  4MNJ A;  4NNR A;  4W5U A;  5DEZ A;  1D2K A;  3AQU A;  1VF8 A;  3ARZ A;  2PV2 A;  3WD4 A;  4ZPV R;  5HW6 A;  1PBK A;  2LKN A;  2WLY A;  2DG9 A;  5D75 A;  3NI6 A;  4JFL A;  1FKD A;  1K9T A;  1Q1C A;  3WQV A;  1J6Y A;  4HBO A;  2Q5A A;  1E9L A;  1FKG A;  1FKJ A;  3CGN A;  2IF4 A;  2RSE A;  3OOB A;  5DO2 A;  4AY1 A;  4HBE A;  4WJX A;  4J4N A;  3O5K A;  4ODM A;  1EQ3 A;  1EHN A;  4IT6 A;  4Q22 A;  3CZ8 A;  1EYM A;  1FJD A;  3ARV A;  2LPV A;  4W9P A;  4MSP A;  4DRO A;  4MNM A;  4KQZ A;  3B8S A;  3WD2 A;  4BF8 A;  4O2T A;  5HWC A;  2QF8 A;  1P5Q A;  3ARO A;  1F40 A;  3KAH A;  2F2D A;  3ODK A;  1GOI A;  1A7X A;  3WL1 A;  2F21 A;  4XAK A;  2KR7 A;  4WK9 A;  4TW7 A;  2KGJ A;  3TC5 A;  5HW8 A;  1Q6I A;  1FKF A;  3O5J A;  2G41 A;  4DT4 A;  4MTV A;  3PRD A;  1FKR A;  5JH8 A;  3WD1 A;  1ZU8 A;  4DZ2 A;  2MLX A;  1LL7 A;  1NMV A;  2XP7 A;  1ZB5 A;  2PBC A;  3G6M A;  1LL4 A;  2DT0 A;  1J4R A;  3O5F A;  4W9O A;  2AOS A;  1W1P A;  2ZQS A;  4LAV A;  4R0X A;  1J4H A;  1ZBV A;  4WKH A;  3BXW A;  4IPX A;  3O5P A;  5DIT A;  3ARQ A;  5GPR A;  4KR0 B;  4IQC A;  2LGO A;  1OWQ A;  4G2P A;  1T11 A;  3NRK A;  2PPP A;  1ZL1 A;  4J4O A;  2MLY A;  3IKD A;  4P8U A;  1LQ0 A;  4TW8 A;  2KI3 A;  3JXV A;  2FAP A;  2AWG A;  4TYO A;  4DRJ A;  2YBT A;  2DSV A;  2PV1 A;  1FKI A;  4W9Q A;  3WKZ A;  3FXY A;  3UQB A;  2DPE A;  1JNT A;  3WD0 A;  1OGB A;  2DG4 A;  5HKG A;  1PIN A;  1E44 A;  1WB0 A;  5HBF A;  2DT3 A;  3AS2 A;  4DRN A;  4LGX A;  1GUV A;  1LJY A;  1D7I A;  1E6P A;  1XRV A;  2D9F A;  4DZ3 A;  4WKF A;  1YAT A;  4GGQ A;  1LL6 A;  3NTP A;  2PPO A;  3KAG A;  1FKT A;  1SR0 A;  2DG3 A;  2ZQU A;  3B9E A;  3O5G A;  4DWS C;  4ODR A;  4ML4 A;  1C9H A;  2XP9 A;  4WIW A;  4JFK A;  1W1T A;  1KFW A;  2UZ5 A;  3O5I A;  1M5Y A;  1TCO C;  5GPG A;  2XP5 A;  1FKH A;  1QZ2 A;  1W9P A;  4Z2L A;  3JYJ A;  1XHG A;  3JYM A; 
#chains in the Genus database with same CATH homology
 2ZR5 A;  2KFW A;  1NWS A;  4JYS A;  1FKB A;  4IT4 A;  2DT1 A;  3B9A A;  2IUZ A;  2KE0 A;  5HW7 A;  3UF8 A;  4QIB A;  2ESC A;  2A3E A;  2ZR6 A;  4Z2J A;  4JFI A;  3O5E A;  1HKJ A;  3UQI A;  2JZV A;  4DWS D;  4WKA A;  1E15 A;  3WIJ A;  1E6R A;  2O9O A;  3O5O A;  5HWB A;  3UI4 A;  1BL4 A;  1JNS A;  2B31 A;  2ZR4 A;  3ARX A;  5GQB A;  3O5M A;  1X6N A;  4QZV B;  3ARU A;  3WL0 A;  2VN1 A;  1FAP A;  2ZQT A;  2PV3 A;  1IX5 A;  1L1P A;  4DRP A;  2DSW A;  2N87 A;  4DWS A;  1R9H A;  2M1I A;  4G50 A;  1BKF A;  1W1V A;  1O6I A;  3H9R B;  3UI5 A;  2A3A A;  2O92 A;  1JND A;  4MNL A;  2DSZ A;  3ARS A;  1NH6 A;  1FKK A;  3I6C A;  3O5Q A;  3KAD A;  1J4I A;  5B8I C;  1HKM A;  1ZCN A;  4S3K A;  4DH0 A;  2K8I A;  3AS1 A;  4Z2H A;  3OA5 A;  4DRK A;  2RUR A;  1ITX A;  2XP8 A;  4TW6 A;  4DRM A;  1ZK6 A;  3CHF A;  2RUC A;  4DRQ A;  3KAI A;  4DWS B;  3B9D A;  3PRB A;  2M08 A;  2XPB A;  4JFJ A;  4N19 A;  4C02 B;  4Z2I A;  2M2A A;  3ARR A;  2RUQ A;  2Y78 A;  4HAR A;  3W4R A;  1NWT A;  4LAX A;  1RD6 A;  3O5R A;  1HJW A;  4S3J A;  1W9V A;  3KAF A;  3CHE A;  1HKK A;  2FDM A;  1D7H A;  3KAB A;  1ROT A;  1E6Z A;  2YBU A;  1LG1 A;  2A3C A;  3QOK A;  1B6C A;  2MF9 A;  3RM4 A;  1ZBW A;  1EIB A;  2MNT A;  1W26 A;  1UR9 A;  1W9U A;  4U86 A;  1JNE A;  2G8Z A;  1YW5 A;  1FFQ A;  1X6L A;  2MPH A;  1D7J A;  2XPA A;  1JVW A;  3UQA A;  1ZBC A;  3KAC A;  1CTN A;  4LAY A;  4MNK A;  3RFW A;  2F4E A;  1Q6U A;  2XP3 A;  4ZPW R;  3GPK A;  1NSG A;  4QT2 A;  5HT1 A;  1QPF A;  1HKI A;  1HJV A;  3WQW A;  2PPN A;  3RM9 A;  4LAW A;  3CGM A;  4ODP A;  4PTM A;  2VCD A;  2OLH A;  3AS0 A;  4NZC A;  4GIV A;  3RGC A;  3O5L A;  1Y0O A;  3CHC A;  2LJ4 A;  3ALG A;  3LUO A;  4ZPT R;  1H0I A;  1TFV A;  2OFN A;  4NSB A;  2ITK A;  3ART A;  3B7X A;  1LG2 A;  3PR9 A;  3IHZ A;  1HXV A;  1NWR A;  3ARY A;  5HTG A;  1UR8 A;  1F8A B;  4ZS6 A;  1W1Y A;  1NMW A;  2WM0 A;  1D6O A;  4L72 B;  4Z2K A;  3AS3 A;  3FY1 A;  4U85 A;  4P8V A;  3TDB A;  3TCZ A;  4IQ2 A;  4P8X A;  2WK2 A;  4ITZ A;  2DSU A;  4U84 A;  1E6N A;  5I98 A;  1NWU A;  3VAW A;  4FN2 A;  4ODO A;  2A3B A;  5DF0 A;  3IKG A;  5DIV A;  4ODN A;  3ALF A;  4DIP A;  4ODK A;  1FFR A;  3KCE A;  1FKS A;  1U79 A;  4DRH A;  4QT3 A;  4TX0 A;  3RME A;  1ZBK A;  3IK8 A;  4MAV A;  1OGG A;  3KZ7 A;  3UI6 A;  4P8W A;  3ARW A;  3RM8 A;  5BXJ A;  3EY6 A;  3G6L A;  3O5D A;  3WD3 A;  2L2S A;  4MGV A;  2RUD A;  2ZQV A;  2KO7 A;  3ARP A;  1SYT A;  5DIU A;  3CH9 A;  1FKL A;  2WLZ A;  1KT1 A;  2XP6 A;  4DRI A;  4Z2G A;  1KT0 A;  3PA7 A;  3MDY B;  3CHD A;  1QPL A;  4FAP A;  1N1A A;  4ODL A;  4URI A;  1GPF A;  3FAP A;  1ROU A;  4TNS A;  4JFM A;  1HJX A;  3PRA A;  2DT2 A;  1WNO A;  1Q6H A;  2XP4 A;  4MPK A;  4Q7N A;  3WH0 A;  1WAW A;  2MLZ A;  2RQS A;  2FKE A;  5J6E A;  1FD9 A;  4L3N A;  1H0G A;  4R5E A;  4ODQ A;  5HUA A;  2PI6 A;  1EDQ A;  4MNJ A;  4NNR A;  4W5U A;  5DEZ A;  1D2K A;  3AQU A;  1VF8 A;  3ARZ A;  2PV2 A;  3WD4 A;  4ZPV R;  5HW6 A;  1PBK A;  2LKN A;  2WLY A;  2DG9 A;  5D75 A;  3NI6 A;  4JFL A;  1FKD A;  1K9T A;  1Q1C A;  3WQV A;  1J6Y A;  4HBO A;  2Q5A A;  1E9L A;  1FKG A;  1FKJ A;  3CGN A;  2IF4 A;  2RSE A;  3OOB A;  5DO2 A;  4AY1 A;  4HBE A;  4WJX A;  4J4N A;  3O5K A;  4ODM A;  1EQ3 A;  1EHN A;  4IT6 A;  4Q22 A;  3CZ8 A;  1EYM A;  1FJD A;  3ARV A;  2LPV A;  4W9P A;  4MSP A;  4DRO A;  4MNM A;  4KQZ A;  3B8S A;  3WD2 A;  4BF8 A;  4O2T A;  5HWC A;  2QF8 A;  1P5Q A;  3ARO A;  1F40 A;  3KAH A;  2F2D A;  3ODK A;  1GOI A;  1A7X A;  3WL1 A;  2F21 A;  4XAK A;  2KR7 A;  4WK9 A;  4TW7 A;  2KGJ A;  3TC5 A;  5HW8 A;  1Q6I A;  3O5J A;  1FKF A;  2G41 A;  4DT4 A;  4MTV A;  3PRD A;  1FKR A;  5JH8 A;  3WD1 A;  1ZU8 A;  4DZ2 A;  2MLX A;  1LL7 A;  1NMV A;  2XP7 A;  1ZB5 A;  2PBC A;  3G6M A;  1LL4 A;  2DT0 A;  1J4R A;  3O5F A;  4W9O A;  2AOS A;  1W1P A;  2ZQS A;  4LAV A;  4R0X A;  1J4H A;  1ZBV A;  4WKH A;  3BXW A;  4IPX A;  3O5P A;  5DIT A;  3ARQ A;  5GPR A;  4KR0 B;  4IQC A;  2LGO A;  1OWQ A;  4G2P A;  1T11 A;  3NRK A;  2PPP A;  1ZL1 A;  4J4O A;  2MLY A;  3IKD A;  4P8U A;  1LQ0 A;  4TW8 A;  2KI3 A;  3JXV A;  2FAP A;  2AWG A;  4TYO A;  4DRJ A;  2YBT A;  2DSV A;  2PV1 A;  1FKI A;  4W9Q A;  3WKZ A;  3FXY A;  3UQB A;  2DPE A;  1JNT A;  3WD0 A;  1OGB A;  2DG4 A;  5HKG A;  1PIN A;  1WB0 A;  5HBF A;  2DT3 A;  3AS2 A;  4DRN A;  4LGX A;  1GUV A;  1LJY A;  1D7I A;  1E6P A;  1XRV A;  2D9F A;  4DZ3 A;  4WKF A;  1YAT A;  4GGQ A;  1LL6 A;  3NTP A;  2PPO A;  3KAG A;  1FKT A;  1SR0 A;  2DG3 A;  2ZQU A;  3B9E A;  3O5G A;  4DWS C;  4ODR A;  4ML4 A;  1C9H A;  2XP9 A;  4WIW A;  4JFK A;  1W1T A;  1KFW A;  2UZ5 A;  3O5I A;  1M5Y A;  1TCO C;  5GPG A;  2XP5 A;  1FKH A;  1QZ2 A;  1W9P A;  4Z2L A;  3JYJ A;  1XHG A;  3JYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...