4JFIA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound 1-[(9s,13r,13ar)-1,3-dimethoxy-8-oxo-5,8,9,10,11,12,13,13a-octahydro-6h-9,13-epiminoazocino[2,1-a]isoquinolin-14-yl]-2-(3,4,5-trimethoxyphenyl)ethane-1,2-dione
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 35
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfiA00
3PRDA 1B6CA 2ZQVA 2PPPA 2MF9A 1J4HA 2LJ4A 4O2TA 4ODKA 4TW6A 2DG9A 3IKGA 3PA7A 4TNSA 5GPGA 3UI5A 3VAWA 5J6EA 3OOBA 4U85A 3TDBA 4G50A 5HKGA 1FKHA 3KAFA 4ODNA 1KT0A 1FKTA 3O5GA 4BF8A 1L1PA 2DG3A 3RGCA 4DRHA 1JNTA 4JYSA 4GGQA 1NMWA 4LAYA 1C9HA 4ODLA 1FKLA 3UQIA 3O5PA 4ODRA 4ITZA 2LPVA 2FAPA 5B8IC 2F4EA 4QT3A 4LAWA 2M08A 4J4OA 3UI4A 2ZQSA 4LAXA 1F8AB 2PPNA 2ZR5A 3MDYB 1Q6UA 2MNTA 2XP7A 2XP5A 3TCZA 1FKBA 3UI6A 1W26A 3NI6A 2ZQUA 1FKSA 4DZ3A 5HW7A 2OFNA 1FKJA 2F21A 1J4IA 1EYMA 2KI3A 1FKGA 4LAVA 4DRMA 3UQAA 1A7XA 1R9HA 3LUOA 4ODQA 4FAPA 1KT1A 2UZ5A 4GIVA 1QPFA 2PV1A 4G2PA 4DRIA 3EY6A 4JFLA 1YW5A 1Q6IA 5HWCA 4JFKA 2XPBA 3KAHA 2DG4A 3H9RB 3ODKA 4U84A 3IHZA 4DRNA 1ROTA 4IQCA 2XP3A 3GPKA 4N19A 2RUDA 2MLXA 2RUQA 3KAIA 1J4RA 2MPHA 1BKFA 1M5YA 2KFWA 2RSEA 2XP6A 3FAPA 3B7XA 3JXVA 5DIVA 4W9QA 2ITKA 2XP8A 4QT2A 2ZQTA 4R0XA 2ZR4A 2JZVA 4DRPA 1ROUA 2PV3A 2XP9A 2PPOA 3CGNA 4NNRA 5HWBA 2RURA 3KABA 1U79A 4C02B 4DIPA 4FN2A 1N1AA 4DRQA 1FKDA 4TW8A 1FKRA 3TC5A 1J6YA 1Q6HA 3UQBA 3O5QA 1FKIA 4DH0A 3IKDA 4TYOA 3O5IA 2M1IA 1NSGA 3O5DA 4ODOA 5HT1A 2AWGA 4JFJA 1BL4A 2LGOA 3O5MA 1D7HA 3JYMA 2ZR6A 4JFMA 5HUAA 1JNSA 3KCEA 1Q1CA 4JFIA 4J4NA 5HW6A 2FKEA 4U86A 1F40A 1Y0OA 3KACA 2RUCA 2PBCA 4W9PA 3O5KA 2KE0A 4DRJA 5D75A 4IPXA 4DRKA 2Q5AA 1FJDA 1PINA 5BXJA 1FKKA 3O5EA 3O5OA 4MGVA 2M2AA 1FAPA 1ZK6A 4IQ2A 5HW8A 2VN1A 1TCOC 1PBKA 3O5RA 2XP4A 3O5FA 4DROA 2D9FA 3O5JA 4DT4A 2F2DA 5HTGA 2IF4A 1T11A 5DITA 3UF8A 1D7IA 3KZ7A 3JYJA 4ODPA 1D7JA 1NMVA 2VCDA 5I98A 1P5QA 3PRBA 1FD9A 1JVWA 4TW7A 2MLZA 3KAGA 3NTPA 2LKNA 3RFWA 3IK8A 3KADA 4W9OA 4QIBA 1FKFA 2K8IA 1QZ2A 1EQ3A 2KGJA 4ODMA 3WH0A 3CGMA 4DZ2A 1YATA 2KO7A 2KR7A 2Y78A 2N87A 2PV2A 3I6CA 3O5LA 4MSPA 4TX0A 1QPLA 2L2SA 2RQSA 2XPAA 5DIUA 2MLYA 1D6OA 1HXVA 1ZCNA 3NRKA
chains in the Genus database with same CATH superfamily
4TW6A 1B6CA 2ZQVA 2PPPA 1J4HA 4ODKA 3BMBA 2DG9A 4TNSA 3UI5A 3TDBA 1ZBVA 4G50A 4DRHA 3RGCA 1JNTA 1ZU8A 4GGQA 3UQIA 4LAYA 4ODLA 2QF8A 4ODRA 2FAPA 2DT0A 4W5UA 5GPRA 4LAWA 3GTYX 1WB0A 4Z2LA 3MDYB 2MNTA 3B9EA 4S3KA 4P8UA 1FKGA 1R9HA 4LGXA 2PV1A 2YBTA 4JFLA 1YW5A 2A3BA 2P4VA 4P8VA 4IQCA 2XP3A 2MLXA 3ARVA 1BKFA 2KFWA 3FY1A 3FAPA 3B7XA 4W9QA 2ITKA 2ZR4A 2JZVA 4MNKA 4MTVA 2XP9A 3AS2A 3CGNA 4NNRA 4Z2GA 2RURA 3KABA 4KR0B 4C02B 1N1AA 1Q6HA 3O5QA 1FKIA 3WQVA 3IKDA 3RMEA 2WLYA 1XHGA 2FDMA 2YBUA 3GU0A 2M1IA 1NSGA 2DSUA 3WL1A 2LGOA 4WK9A 3KACA 4HARA 5DO2A 3B8SA 3O5KA 2KE0A 1PINA 3O5EA 3O5OA 3WD0A 4IQ2A 4DROA 1PBKA 1H0GA 5HTGA 1ZL1A 3CHFA 1T11A 4WJXA 1LQ0A 1ZBWA 1D2KA 2O9OA 5GQBA 2VCDA 3ARYA 3PRBA 3WKZA 3KAGA 3RFWA 4ML4A 2KGJA 4IT4A 1E6PA 2N87A 2XPAA 3QOKA 3WL0A 1CTNA 1UR9A 2MF9A 2IUZA 1X6NA 5GPGA 1HJWA 1SYTA 3WD2A 4P8WA 5HKGA 1LJYA 3KAFA 4ODNA 4DWSD 1FKTA 3O5GA 4BF8A 2DG3A 1ZBCA 1C9HA 3O5PA 2F23A 2LPVA 2F4EA 4QT3A 2M08A 4LAXA 4ZS6A 2ZR5A 3UI6A 1Q6UA 2XP7A 3TCZA 2XP5A 3ARPA 1NWUA 1FKSA 1HKIA 5HW7A 2OFNA 4LAVA 3RM8A 2WK2A 3CHEA 1E9LA 4GIVA 2A3AA 3EY6A 1EHNA 4JFKA 2XPBA 3KAHA 4U84A 3ARSA 4WKHA 1ROTA 3B9AA 4N19A 1E6RA 2RUDA 1SR0A 2RUQA 1VF8A 2ETNA 1HKJA 2RSEA 3JXVA 2XP8A 4KQZA 1OGGA 1O6IA 1GRJA 2G8ZA 2DPEA 1LL6A 1W9PA 2AWGA 1BL4A 3WD3A 1D7HA 3JYMA 3KCEA 3ARWA 4J4NA 2WLZA 4U86A 2RUCA 3ALGA 1JNDA 1NH6A 4W9PA 4IPXA 1FKKA 1EDQA 4MGVA 4UDMA 2M2AA 3AS3A 3CZ8A 3G6LA 3O5RA 1ITXA 1TCOC 2XP4A 2D9FA 4ZPVR 4AY1A 2IF4A 4WKAA 1D7IA 1HJXA 3KZ7A 4MNLA 3JYJA 3AQUA 1NMVA 1FFQA 5I98A 1JVWA 4TW7A 2MLZA 4W9OA 1FKFA 2K8IA 3CGMA 3I6CA 2KR7A 5HW6A 1HJVA 2PV2A 2RQSA 3AROA 2MLYA 1D6OA 4L3NA 3NRKA 3PRDA 2LJ4A 1GUVA 2OLHA 3W4RA 4DWSC 5JH8A 2A3CA 3VAWA 4NSBA 3WD1A 4U85A 4ZPWR 2DSVA 1H0IA 1ZB5A 3B9DA 4P8XA 3RM4A 1E15A 1NMWA 1WNOA 4ITZA 2EULA 3G6MA 2B5UB 4J4OA 3UI4A 4NZCA 1F8AB 1GPFA 2PPNA 1FKBA 2DSWA 3NI6A 4DZ3A 2ESCA 1XRVA 4Z2HA 1FKJA 2F21A 1W1YA 4ODQA 4PTMA 3RM9A 1QPFA 4G2PA 4DRIA 3AS0A 1NWTA 4QZVB 1Q6IA 4IT6A 3ODKA 2B31A 3GPKA 3AS1A 1WAWA 4Z2JA 3KAIA 1J4RA 2MPHA 1M5YA 3PRAA 1FFRA 1JCHB 4QT2A 2ZQTA 1HKMA 1ROUA 3WQWA 5DF0A 2PPOA 1U79A 4Z2KA 4FN2A 4DRQA 4URIA 3TC5A 4L72B 1NWSA 1IX5A 3O5DA 4ODOA 5HT1A 4JFJA 2O92A 4JFMA 5HUAA 2ZR6A 2PI6A 1JNSA 1Q1CA 4JFIA 1F40A 1EIBA 1K9TA 2PBCA 2DT2A 1W1TA 4DRJA 5D75A 4DRKA 2Q5AA 5BXJA 5HW8A 1JNEA 1ZBKA 2VN1A 2A3EA 3WD4A 3O5FA 1HKKA 1OGBA 2F2DA 3ARQA 1TFVA 4DT4A 2PN0A 3CHDA 4S3JA 5DEZA 1D7JA 4WIWA 3ARRA 2LKNA 3KADA 3WH0A 1YATA 2KO7A 5HWCA 3O5LA 4TX0A 2L2SA 1HXVA 1W1VA 2G41A 1UR8A 3PR9A 4O2TA 3IKGA 3PA7A 4HBOA 3OOBA 1FKHA 3CH9A 1KT0A 5HBFA 4DWSA 1L1PA 4Z2IA 4JYSA 1NWRA 1FKLA 1RD6A 5B8IC 4MNJA 2ZQSA 1LG2A 1W9UA 1W26A 3OA5A 1OWQA 2ZQUA 3EIPA 4MAVA 2KI3A 1J4IA 1EYMA 4DRMA 3UQAA 1A7XA 3LUOA 4FAPA 1KT1A 2UZ5A 3ARXA 2DT3A 2DG4A 3H9RB 3IHZA 4DRNA 1GOIA 1LL7A 2XP6A 1E6NA 3ARUA 5DIVA 4ZPTR 4R0XA 4DRPA 2PV3A 5HWBA 4DIPA 1FKDA 4TW8A 1FKRA 3WIJA 1J6YA 4MPKA 3UQBA 4DH0A 4TYOA 3O5IA 1W9VA 3ALFA 4WKFA 3FXYA 3O5MA 1LL4A 4Q22A 2FKEA 1Y0OA 1E6ZA 2DT1A 2WM0A 3BXWA 4DWSB 1FJDA 1X6LA 1E44A 1FAPA 1ZK6A 4MNMA 3O5JA 4R5EA 5DITA 3UF8A 4Q7NA 3ARZA 4ODPA 1W1PA 3CHCA 1P5QA 4HBEA 1FD9A 3NTPA 3IK8A 3ARTA 4QIBA 4XAKA 1QZ2A 1LG1A 1EQ3A 4ODMA 4DZ2A 2Y78A 4MSPA 2DSZA 5DIUA 5J6EA 1KFWA 1QPLA 2AOSA 1ZCNA
chains in the Genus database with same CATH topology
4TW6A 1B6CA 2ZQVA 2PPPA 1J4HA 4ODKA 2DG9A 4TNSA 3UI5A 3TDBA 1ZBVA 4G50A 4DRHA 3RGCA 1JNTA 1ZU8A 4GGQA 3UQIA 4LAYA 4ODLA 2QF8A 4ODRA 2FAPA 2DT0A 4W5UA 5GPRA 4LAWA 1WB0A 4Z2LA 3MDYB 2MNTA 3B9EA 4S3KA 4P8UA 1FKGA 1R9HA 4LGXA 2PV1A 2YBTA 4JFLA 1YW5A 2A3BA 4P8VA 4IQCA 2XP3A 2MLXA 3ARVA 1BKFA 2KFWA 3FY1A 3FAPA 3B7XA 4W9QA 2ITKA 2ZR4A 2JZVA 4MNKA 4MTVA 2XP9A 3AS2A 3CGNA 4NNRA 4Z2GA 2RURA 3KABA 4KR0B 4C02B 1N1AA 1Q6HA 3O5QA 1FKIA 3WQVA 3IKDA 3RMEA 2WLYA 1XHGA 2FDMA 2YBUA 2M1IA 1NSGA 2DSUA 3WL1A 2LGOA 4WK9A 3KACA 4HARA 5DO2A 3B8SA 3O5KA 2KE0A 1PINA 3O5EA 3O5OA 3WD0A 4IQ2A 4DROA 1PBKA 1H0GA 5HTGA 1ZL1A 3CHFA 1T11A 4WJXA 1LQ0A 1ZBWA 1D2KA 2O9OA 5GQBA 2VCDA 3ARYA 3PRBA 3WKZA 3KAGA 3RFWA 4ML4A 2KGJA 4IT4A 1E6PA 2N87A 2XPAA 3QOKA 3WL0A 1CTNA 1UR9A 2MF9A 2IUZA 1X6NA 5GPGA 1HJWA 1SYTA 3WD2A 4P8WA 5HKGA 1LJYA 3KAFA 4ODNA 4DWSD 1FKTA 3O5GA 4BF8A 2DG3A 1ZBCA 1C9HA 3O5PA 2LPVA 2F4EA 4QT3A 2M08A 4LAXA 4ZS6A 2ZR5A 3UI6A 1Q6UA 2XP7A 3TCZA 2XP5A 3ARPA 1NWUA 1FKSA 1HKIA 5HW7A 2OFNA 4LAVA 3RM8A 2WK2A 3CHEA 1E9LA 4GIVA 2A3AA 3EY6A 1EHNA 4JFKA 2XPBA 3KAHA 4U84A 3ARSA 4WKHA 1ROTA 3B9AA 4N19A 1E6RA 2RUDA 1SR0A 2RUQA 1VF8A 1HKJA 2RSEA 3JXVA 2XP8A 4KQZA 1OGGA 1O6IA 2G8ZA 2DPEA 1LL6A 1W9PA 2AWGA 1BL4A 3WD3A 1D7HA 3JYMA 3KCEA 3ARWA 4J4NA 2WLZA 4U86A 2RUCA 3ALGA 1JNDA 1NH6A 4W9PA 4IPXA 1FKKA 1EDQA 4MGVA 2M2AA 3AS3A 3CZ8A 3G6LA 3O5RA 1ITXA 1TCOC 2XP4A 2D9FA 4ZPVR 4AY1A 2IF4A 4WKAA 1D7IA 1HJXA 3KZ7A 4MNLA 3JYJA 3AQUA 1NMVA 1FFQA 5I98A 1JVWA 4TW7A 2MLZA 4W9OA 1FKFA 2K8IA 3CGMA 3I6CA 2KR7A 5HW6A 1HJVA 2PV2A 2RQSA 3AROA 2MLYA 1D6OA 4L3NA 3NRKA 3PRDA 2LJ4A 1GUVA 2OLHA 3W4RA 4DWSC 5JH8A 2A3CA 3VAWA 4NSBA 3WD1A 4U85A 4ZPWR 2DSVA 1H0IA 1ZB5A 3B9DA 4P8XA 3RM4A 1E15A 1NMWA 1WNOA 4ITZA 3G6MA 4J4OA 3UI4A 4NZCA 1F8AB 1GPFA 2PPNA 1FKBA 2DSWA 3NI6A 4DZ3A 2ESCA 1XRVA 4Z2HA 1FKJA 2F21A 1W1YA 4ODQA 4PTMA 3RM9A 1QPFA 4G2PA 4DRIA 3AS0A 1NWTA 4QZVB 1Q6IA 4IT6A 3ODKA 2B31A 3GPKA 3AS1A 1WAWA 4Z2JA 3KAIA 1J4RA 2MPHA 1M5YA 3PRAA 1FFRA 4QT2A 2ZQTA 1HKMA 1ROUA 3WQWA 5DF0A 2PPOA 1U79A 4Z2KA 4FN2A 4DRQA 4URIA 3TC5A 4L72B 1NWSA 1IX5A 3O5DA 4ODOA 5HT1A 4JFJA 4JFMA 2O92A 5HUAA 2ZR6A 2PI6A 1JNSA 1Q1CA 4JFIA 1F40A 1EIBA 1K9TA 2PBCA 2DT2A 1W1TA 4DRJA 5D75A 4DRKA 2Q5AA 5BXJA 5HW8A 1JNEA 1ZBKA 2VN1A 2A3EA 3WD4A 3O5FA 1HKKA 1OGBA 2F2DA 3ARQA 1TFVA 4DT4A 3CHDA 4S3JA 5DEZA 1D7JA 4WIWA 3ARRA 2LKNA 3KADA 3WH0A 1YATA 2KO7A 5HWCA 3O5LA 4TX0A 2L2SA 1HXVA 1W1VA 2G41A 1UR8A 3PR9A 4O2TA 3IKGA 3PA7A 4HBOA 3OOBA 1FKHA 3CH9A 1KT0A 5HBFA 4DWSA 1L1PA 4Z2IA 4JYSA 1NWRA 1FKLA 1RD6A 5B8IC 4MNJA 2ZQSA 1LG2A 1W9UA 1W26A 3OA5A 1OWQA 2ZQUA 4MAVA 2KI3A 1J4IA 1EYMA 4DRMA 3UQAA 1A7XA 3LUOA 4FAPA 1KT1A 2UZ5A 3ARXA 2DT3A 2DG4A 3H9RB 3IHZA 4DRNA 1GOIA 1LL7A 2XP6A 1E6NA 3ARUA 5DIVA 4ZPTR 4R0XA 4DRPA 2PV3A 5HWBA 4DIPA 1FKDA 4TW8A 1FKRA 3WIJA 1J6YA 4MPKA 3UQBA 4DH0A 4TYOA 3O5IA 1W9VA 3ALFA 4WKFA 3FXYA 3O5MA 1LL4A 4Q22A 2FKEA 1Y0OA 1E6ZA 2DT1A 2WM0A 3BXWA 4DWSB 1FJDA 1X6LA 1FAPA 1ZK6A 4MNMA 3O5JA 4R5EA 5DITA 3UF8A 4Q7NA 3ARZA 4ODPA 1W1PA 3CHCA 1P5QA 4HBEA 1FD9A 3NTPA 3IK8A 3ARTA 4QIBA 4XAKA 1QZ2A 1LG1A 1EQ3A 4ODMA 4DZ2A 2Y78A 4MSPA 2DSZA 5DIUA 5J6EA 1KFWA 1QPLA 2AOSA 1ZCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRD A;  1B6C A;  2ZQV A;  2PPP A;  2MF9 A;  1J4H A;  2LJ4 A;  4O2T A;  4ODK A;  4TW6 A;  2DG9 A;  3IKG A;  3PA7 A;  4TNS A;  5GPG A;  3UI5 A;  3VAW A;  5J6E A;  3OOB A;  4U85 A;  3TDB A;  4G50 A;  5HKG A;  1FKH A;  3KAF A;  4ODN A;  1KT0 A;  1FKT A;  3O5G A;  4BF8 A;  1L1P A;  2DG3 A;  3RGC A;  4DRH A;  1JNT A;  4JYS A;  4GGQ A;  1NMW A;  4LAY A;  1C9H A;  4ODL A;  1FKL A;  3UQI A;  3O5P A;  4ODR A;  4ITZ A;  2LPV A;  2FAP A;  5B8I C;  2F4E A;  4QT3 A;  4LAW A;  2M08 A;  4J4O A;  3UI4 A;  2ZQS A;  4LAX A;  1F8A B;  2PPN A;  2ZR5 A;  3MDY B;  1Q6U A;  2MNT A;  2XP7 A;  2XP5 A;  3TCZ A;  1FKB A;  3UI6 A;  1W26 A;  3NI6 A;  2ZQU A;  1FKS A;  4DZ3 A;  5HW7 A;  2OFN A;  1FKJ A;  2F21 A;  1J4I A;  1EYM A;  2KI3 A;  1FKG A;  4LAV A;  4DRM A;  3UQA A;  1A7X A;  1R9H A;  3LUO A;  4ODQ A;  4FAP A;  1KT1 A;  2UZ5 A;  4GIV A;  1QPF A;  2PV1 A;  4G2P A;  4DRI A;  3EY6 A;  4JFL A;  1YW5 A;  1Q6I A;  5HWC A;  4JFK A;  2XPB A;  3KAH A;  2DG4 A;  3H9R B;  3ODK A;  4U84 A;  3IHZ A;  4DRN A;  1ROT A;  4IQC A;  2XP3 A;  3GPK A;  4N19 A;  2RUD A;  2MLX A;  2RUQ A;  3KAI A;  1J4R A;  2MPH A;  1BKF A;  1M5Y A;  2KFW A;  2RSE A;  2XP6 A;  3FAP A;  3B7X A;  3JXV A;  5DIV A;  4W9Q A;  2ITK A;  2XP8 A;  4QT2 A;  2ZQT A;  4R0X A;  2ZR4 A;  2JZV A;  4DRP A;  1ROU A;  2PV3 A;  2XP9 A;  2PPO A;  3CGN A;  4NNR A;  5HWB A;  2RUR A;  3KAB A;  1U79 A;  4C02 B;  4DIP A;  4FN2 A;  1N1A A;  4DRQ A;  1FKD A;  4TW8 A;  1FKR A;  3TC5 A;  1J6Y A;  1Q6H A;  3UQB A;  3O5Q A;  1FKI A;  4DH0 A;  3IKD A;  4TYO A;  3O5I A;  2M1I A;  1NSG A;  3O5D A;  4ODO A;  5HT1 A;  2AWG A;  4JFJ A;  1BL4 A;  2LGO A;  3O5M A;  1D7H A;  3JYM A;  2ZR6 A;  4JFM A;  5HUA A;  1JNS A;  3KCE A;  1Q1C A;  4JFI A;  4J4N A;  5HW6 A;  2FKE A;  4U86 A;  1F40 A;  1Y0O A;  3KAC A;  2RUC A;  2PBC A;  4W9P A;  3O5K A;  2KE0 A;  4DRJ A;  5D75 A;  4IPX A;  4DRK A;  2Q5A A;  1FJD A;  1PIN A;  5BXJ A;  1FKK A;  3O5E A;  3O5O A;  4MGV A;  2M2A A;  1FAP A;  1ZK6 A;  4IQ2 A;  5HW8 A;  2VN1 A;  1TCO C;  1PBK A;  3O5R A;  2XP4 A;  3O5F A;  4DRO A;  2D9F A;  3O5J A;  4DT4 A;  2F2D A;  5HTG A;  2IF4 A;  1T11 A;  5DIT A;  3UF8 A;  1D7I A;  3KZ7 A;  3JYJ A;  4ODP A;  1D7J A;  1NMV A;  2VCD A;  5I98 A;  1P5Q A;  3PRB A;  1FD9 A;  1JVW A;  4TW7 A;  2MLZ A;  3KAG A;  3NTP A;  2LKN A;  3RFW A;  3IK8 A;  3KAD A;  4W9O A;  4QIB A;  1FKF A;  2K8I A;  1QZ2 A;  1EQ3 A;  2KGJ A;  4ODM A;  3WH0 A;  3CGM A;  4DZ2 A;  1YAT A;  2KO7 A;  2KR7 A;  2Y78 A;  2N87 A;  2PV2 A;  3I6C A;  3O5L A;  4MSP A;  4TX0 A;  1QPL A;  2L2S A;  2RQS A;  2XPA A;  5DIU A;  2MLY A;  1D6O A;  1HXV A;  1ZCN A;  3NRK A; 
#chains in the Genus database with same CATH topology
 4TW6 A;  1B6C A;  2ZQV A;  2PPP A;  1J4H A;  4ODK A;  3BMB A;  2DG9 A;  4TNS A;  3UI5 A;  3TDB A;  1ZBV A;  4G50 A;  4DRH A;  3RGC A;  1JNT A;  1ZU8 A;  4GGQ A;  3UQI A;  4LAY A;  4ODL A;  2QF8 A;  4ODR A;  2FAP A;  2DT0 A;  4W5U A;  5GPR A;  4LAW A;  3GTY X;  1WB0 A;  4Z2L A;  3MDY B;  2MNT A;  3B9E A;  4S3K A;  4P8U A;  1FKG A;  1R9H A;  4LGX A;  2PV1 A;  2YBT A;  4JFL A;  1YW5 A;  2A3B A;  2P4V A;  4P8V A;  4IQC A;  2XP3 A;  2MLX A;  3ARV A;  1BKF A;  2KFW A;  3FY1 A;  3FAP A;  3B7X A;  4W9Q A;  2ITK A;  2ZR4 A;  2JZV A;  4MNK A;  4MTV A;  2XP9 A;  3AS2 A;  3CGN A;  4NNR A;  4Z2G A;  2RUR A;  3KAB A;  4KR0 B;  4C02 B;  1N1A A;  1Q6H A;  3O5Q A;  1FKI A;  3WQV A;  3IKD A;  3RME A;  2WLY A;  1XHG A;  2FDM A;  2YBU A;  3GU0 A;  2M1I A;  1NSG A;  2DSU A;  3WL1 A;  2LGO A;  4WK9 A;  3KAC A;  4HAR A;  5DO2 A;  3B8S A;  3O5K A;  2KE0 A;  1PIN A;  3O5E A;  3O5O A;  3WD0 A;  4IQ2 A;  4DRO A;  1PBK A;  1H0G A;  5HTG A;  1ZL1 A;  3CHF A;  1T11 A;  4WJX A;  1LQ0 A;  1ZBW A;  1D2K A;  2O9O A;  5GQB A;  2VCD A;  3ARY A;  3PRB A;  3WKZ A;  3KAG A;  3RFW A;  4ML4 A;  2KGJ A;  4IT4 A;  1E6P A;  2N87 A;  2XPA A;  3QOK A;  3WL0 A;  1CTN A;  1UR9 A;  2MF9 A;  2IUZ A;  1X6N A;  5GPG A;  1HJW A;  1SYT A;  3WD2 A;  4P8W A;  5HKG A;  1LJY A;  3KAF A;  4ODN A;  4DWS D;  1FKT A;  3O5G A;  4BF8 A;  2DG3 A;  1ZBC A;  1C9H A;  3O5P A;  2F23 A;  2LPV A;  2F4E A;  4QT3 A;  2M08 A;  4LAX A;  4ZS6 A;  2ZR5 A;  3UI6 A;  1Q6U A;  2XP7 A;  3TCZ A;  2XP5 A;  3ARP A;  1NWU A;  1FKS A;  1HKI A;  5HW7 A;  2OFN A;  4LAV A;  3RM8 A;  2WK2 A;  3CHE A;  1E9L A;  4GIV A;  2A3A A;  3EY6 A;  1EHN A;  4JFK A;  2XPB A;  3KAH A;  4U84 A;  3ARS A;  4WKH A;  1ROT A;  3B9A A;  4N19 A;  1E6R A;  2RUD A;  1SR0 A;  2RUQ A;  1VF8 A;  2ETN A;  1HKJ A;  2RSE A;  3JXV A;  2XP8 A;  4KQZ A;  1OGG A;  1O6I A;  1GRJ A;  2G8Z A;  2DPE A;  1LL6 A;  1W9P A;  2AWG A;  1BL4 A;  3WD3 A;  1D7H A;  3JYM A;  3KCE A;  3ARW A;  4J4N A;  2WLZ A;  4U86 A;  2RUC A;  3ALG A;  1JND A;  1NH6 A;  4W9P A;  4IPX A;  1FKK A;  1EDQ A;  4MGV A;  4UDM A;  2M2A A;  3AS3 A;  3CZ8 A;  3G6L A;  3O5R A;  1ITX A;  1TCO C;  2XP4 A;  2D9F A;  4ZPV R;  4AY1 A;  2IF4 A;  4WKA A;  1D7I A;  1HJX A;  3KZ7 A;  4MNL A;  3JYJ A;  3AQU A;  1NMV A;  1FFQ A;  5I98 A;  1JVW A;  4TW7 A;  2MLZ A;  4W9O A;  1FKF A;  2K8I A;  3CGM A;  3I6C A;  2KR7 A;  5HW6 A;  1HJV A;  2PV2 A;  2RQS A;  3ARO A;  2MLY A;  1D6O A;  4L3N A;  3NRK A;  3PRD A;  2LJ4 A;  1GUV A;  2OLH A;  3W4R A;  4DWS C;  5JH8 A;  2A3C A;  3VAW A;  4NSB A;  3WD1 A;  4U85 A;  4ZPW R;  2DSV A;  1H0I A;  1ZB5 A;  3B9D A;  4P8X A;  3RM4 A;  1E15 A;  1NMW A;  1WNO A;  4ITZ A;  2EUL A;  3G6M A;  2B5U B;  4J4O A;  3UI4 A;  4NZC A;  1F8A B;  1GPF A;  2PPN A;  1FKB A;  2DSW A;  3NI6 A;  4DZ3 A;  2ESC A;  1XRV A;  4Z2H A;  1FKJ A;  2F21 A;  1W1Y A;  4ODQ A;  4PTM A;  3RM9 A;  1QPF A;  4G2P A;  4DRI A;  3AS0 A;  1NWT A;  4QZV B;  1Q6I A;  4IT6 A;  3ODK A;  2B31 A;  3GPK A;  3AS1 A;  1WAW A;  4Z2J A;  3KAI A;  1J4R A;  2MPH A;  1M5Y A;  3PRA A;  1FFR A;  1JCH B;  4QT2 A;  2ZQT A;  1HKM A;  1ROU A;  3WQW A;  5DF0 A;  2PPO A;  1U79 A;  4Z2K A;  4FN2 A;  4DRQ A;  4URI A;  3TC5 A;  4L72 B;  1NWS A;  1IX5 A;  3O5D A;  4ODO A;  5HT1 A;  4JFJ A;  2O92 A;  4JFM A;  5HUA A;  2ZR6 A;  2PI6 A;  1JNS A;  1Q1C A;  4JFI A;  1F40 A;  1EIB A;  1K9T A;  2PBC A;  2DT2 A;  1W1T A;  4DRJ A;  5D75 A;  4DRK A;  2Q5A A;  5BXJ A;  5HW8 A;  1JNE A;  1ZBK A;  2VN1 A;  2A3E A;  3WD4 A;  3O5F A;  1HKK A;  1OGB A;  2F2D A;  3ARQ A;  1TFV A;  4DT4 A;  2PN0 A;  3CHD A;  4S3J A;  5DEZ A;  1D7J A;  4WIW A;  3ARR A;  2LKN A;  3KAD A;  3WH0 A;  1YAT A;  2KO7 A;  5HWC A;  3O5L A;  4TX0 A;  2L2S A;  1HXV A;  1W1V A;  2G41 A;  1UR8 A;  3PR9 A;  4O2T A;  3IKG A;  3PA7 A;  4HBO A;  3OOB A;  1FKH A;  3CH9 A;  1KT0 A;  5HBF A;  4DWS A;  1L1P A;  4Z2I A;  4JYS A;  1NWR A;  1FKL A;  1RD6 A;  5B8I C;  4MNJ A;  2ZQS A;  1LG2 A;  1W9U A;  1W26 A;  3OA5 A;  1OWQ A;  2ZQU A;  3EIP A;  4MAV A;  2KI3 A;  1J4I A;  1EYM A;  4DRM A;  3UQA A;  1A7X A;  3LUO A;  4FAP A;  1KT1 A;  2UZ5 A;  3ARX A;  2DT3 A;  2DG4 A;  3H9R B;  3IHZ A;  4DRN A;  1GOI A;  1LL7 A;  2XP6 A;  1E6N A;  3ARU A;  5DIV A;  4ZPT R;  4R0X A;  4DRP A;  2PV3 A;  5HWB A;  4DIP A;  1FKD A;  4TW8 A;  1FKR A;  3WIJ A;  1J6Y A;  4MPK A;  3UQB A;  4DH0 A;  4TYO A;  3O5I A;  1W9V A;  3ALF A;  4WKF A;  3FXY A;  3O5M A;  1LL4 A;  4Q22 A;  2FKE A;  1Y0O A;  1E6Z A;  2DT1 A;  2WM0 A;  3BXW A;  4DWS B;  1FJD A;  1X6L A;  1E44 A;  1FAP A;  1ZK6 A;  4MNM A;  3O5J A;  4R5E A;  5DIT A;  3UF8 A;  4Q7N A;  3ARZ A;  4ODP A;  1W1P A;  3CHC A;  1P5Q A;  4HBE A;  1FD9 A;  3NTP A;  3IK8 A;  3ART A;  4QIB A;  4XAK A;  1QZ2 A;  1LG1 A;  1EQ3 A;  4ODM A;  4DZ2 A;  2Y78 A;  4MSP A;  2DSZ A;  5DIU A;  5J6E A;  1KFW A;  1QPL A;  2AOS A;  1ZCN A; 
#chains in the Genus database with same CATH homology
 4TW6 A;  1B6C A;  2ZQV A;  2PPP A;  1J4H A;  4ODK A;  2DG9 A;  4TNS A;  3UI5 A;  3TDB A;  1ZBV A;  4G50 A;  4DRH A;  3RGC A;  1JNT A;  1ZU8 A;  4GGQ A;  3UQI A;  4LAY A;  4ODL A;  2QF8 A;  4ODR A;  2FAP A;  2DT0 A;  4W5U A;  5GPR A;  4LAW A;  1WB0 A;  4Z2L A;  3MDY B;  2MNT A;  3B9E A;  4S3K A;  4P8U A;  1FKG A;  1R9H A;  4LGX A;  2PV1 A;  2YBT A;  4JFL A;  1YW5 A;  2A3B A;  4P8V A;  4IQC A;  2XP3 A;  2MLX A;  3ARV A;  1BKF A;  2KFW A;  3FY1 A;  3FAP A;  3B7X A;  4W9Q A;  2ITK A;  2ZR4 A;  2JZV A;  4MNK A;  4MTV A;  2XP9 A;  3AS2 A;  3CGN A;  4NNR A;  4Z2G A;  2RUR A;  3KAB A;  4KR0 B;  4C02 B;  1N1A A;  1Q6H A;  3O5Q A;  1FKI A;  3WQV A;  3IKD A;  3RME A;  2WLY A;  1XHG A;  2FDM A;  2YBU A;  2M1I A;  1NSG A;  2DSU A;  3WL1 A;  2LGO A;  4WK9 A;  3KAC A;  4HAR A;  5DO2 A;  3B8S A;  3O5K A;  2KE0 A;  1PIN A;  3O5E A;  3O5O A;  3WD0 A;  4IQ2 A;  4DRO A;  1PBK A;  1H0G A;  5HTG A;  1ZL1 A;  3CHF A;  1T11 A;  4WJX A;  1LQ0 A;  1ZBW A;  1D2K A;  2O9O A;  5GQB A;  2VCD A;  3ARY A;  3PRB A;  3WKZ A;  3KAG A;  3RFW A;  4ML4 A;  2KGJ A;  4IT4 A;  1E6P A;  2N87 A;  2XPA A;  3QOK A;  3WL0 A;  1CTN A;  1UR9 A;  2MF9 A;  2IUZ A;  1X6N A;  5GPG A;  1HJW A;  1SYT A;  3WD2 A;  4P8W A;  5HKG A;  1LJY A;  3KAF A;  4ODN A;  4DWS D;  1FKT A;  3O5G A;  4BF8 A;  2DG3 A;  1ZBC A;  1C9H A;  3O5P A;  2LPV A;  2F4E A;  4QT3 A;  2M08 A;  4LAX A;  4ZS6 A;  2ZR5 A;  3UI6 A;  1Q6U A;  2XP7 A;  3TCZ A;  2XP5 A;  3ARP A;  1NWU A;  1FKS A;  1HKI A;  5HW7 A;  2OFN A;  4LAV A;  3RM8 A;  2WK2 A;  3CHE A;  1E9L A;  4GIV A;  2A3A A;  3EY6 A;  1EHN A;  4JFK A;  2XPB A;  3KAH A;  4U84 A;  3ARS A;  4WKH A;  1ROT A;  3B9A A;  4N19 A;  1E6R A;  2RUD A;  1SR0 A;  2RUQ A;  1VF8 A;  1HKJ A;  2RSE A;  3JXV A;  2XP8 A;  4KQZ A;  1OGG A;  1O6I A;  2G8Z A;  2DPE A;  1LL6 A;  1W9P A;  2AWG A;  1BL4 A;  3WD3 A;  1D7H A;  3JYM A;  3KCE A;  3ARW A;  4J4N A;  2WLZ A;  4U86 A;  2RUC A;  3ALG A;  1JND A;  1NH6 A;  4W9P A;  4IPX A;  1FKK A;  1EDQ A;  4MGV A;  2M2A A;  3AS3 A;  3CZ8 A;  3G6L A;  3O5R A;  1ITX A;  1TCO C;  2XP4 A;  2D9F A;  4ZPV R;  4AY1 A;  2IF4 A;  4WKA A;  1D7I A;  1HJX A;  3KZ7 A;  4MNL A;  3JYJ A;  3AQU A;  1NMV A;  1FFQ A;  5I98 A;  1JVW A;  4TW7 A;  2MLZ A;  4W9O A;  1FKF A;  2K8I A;  3CGM A;  3I6C A;  2KR7 A;  5HW6 A;  1HJV A;  2PV2 A;  2RQS A;  3ARO A;  2MLY A;  1D6O A;  4L3N A;  3NRK A;  3PRD A;  2LJ4 A;  1GUV A;  2OLH A;  3W4R A;  4DWS C;  5JH8 A;  2A3C A;  3VAW A;  4NSB A;  3WD1 A;  4U85 A;  4ZPW R;  2DSV A;  1H0I A;  1ZB5 A;  3B9D A;  4P8X A;  3RM4 A;  1E15 A;  1NMW A;  1WNO A;  4ITZ A;  3G6M A;  4J4O A;  3UI4 A;  4NZC A;  1F8A B;  1GPF A;  2PPN A;  1FKB A;  2DSW A;  3NI6 A;  4DZ3 A;  2ESC A;  1XRV A;  4Z2H A;  1FKJ A;  2F21 A;  1W1Y A;  4ODQ A;  4PTM A;  3RM9 A;  1QPF A;  4G2P A;  4DRI A;  3AS0 A;  1NWT A;  4QZV B;  1Q6I A;  4IT6 A;  3ODK A;  2B31 A;  3GPK A;  3AS1 A;  1WAW A;  4Z2J A;  3KAI A;  1J4R A;  2MPH A;  1M5Y A;  3PRA A;  1FFR A;  4QT2 A;  2ZQT A;  1HKM A;  1ROU A;  3WQW A;  5DF0 A;  2PPO A;  1U79 A;  4Z2K A;  4FN2 A;  4DRQ A;  4URI A;  3TC5 A;  4L72 B;  1NWS A;  1IX5 A;  3O5D A;  4ODO A;  5HT1 A;  4JFJ A;  4JFM A;  2O92 A;  5HUA A;  2ZR6 A;  2PI6 A;  1JNS A;  1Q1C A;  4JFI A;  1F40 A;  1EIB A;  1K9T A;  2PBC A;  2DT2 A;  1W1T A;  4DRJ A;  5D75 A;  4DRK A;  2Q5A A;  5BXJ A;  5HW8 A;  1JNE A;  1ZBK A;  2VN1 A;  2A3E A;  3WD4 A;  3O5F A;  1HKK A;  1OGB A;  2F2D A;  3ARQ A;  1TFV A;  4DT4 A;  3CHD A;  4S3J A;  5DEZ A;  1D7J A;  4WIW A;  3ARR A;  2LKN A;  3KAD A;  3WH0 A;  1YAT A;  2KO7 A;  5HWC A;  3O5L A;  4TX0 A;  2L2S A;  1HXV A;  1W1V A;  2G41 A;  1UR8 A;  3PR9 A;  4O2T A;  3IKG A;  3PA7 A;  4HBO A;  3OOB A;  1FKH A;  3CH9 A;  1KT0 A;  5HBF A;  4DWS A;  1L1P A;  4Z2I A;  4JYS A;  1NWR A;  1FKL A;  1RD6 A;  5B8I C;  4MNJ A;  2ZQS A;  1LG2 A;  1W9U A;  1W26 A;  3OA5 A;  1OWQ A;  2ZQU A;  4MAV A;  2KI3 A;  1J4I A;  1EYM A;  4DRM A;  3UQA A;  1A7X A;  3LUO A;  4FAP A;  1KT1 A;  2UZ5 A;  3ARX A;  2DT3 A;  2DG4 A;  3H9R B;  3IHZ A;  4DRN A;  1GOI A;  1LL7 A;  2XP6 A;  1E6N A;  3ARU A;  5DIV A;  4ZPT R;  4R0X A;  4DRP A;  2PV3 A;  5HWB A;  4DIP A;  1FKD A;  4TW8 A;  1FKR A;  3WIJ A;  1J6Y A;  4MPK A;  3UQB A;  4DH0 A;  4TYO A;  3O5I A;  1W9V A;  3ALF A;  4WKF A;  3FXY A;  3O5M A;  1LL4 A;  4Q22 A;  2FKE A;  1Y0O A;  1E6Z A;  2DT1 A;  2WM0 A;  3BXW A;  4DWS B;  1FJD A;  1X6L A;  1FAP A;  1ZK6 A;  4MNM A;  3O5J A;  4R5E A;  5DIT A;  3UF8 A;  4Q7N A;  3ARZ A;  4ODP A;  1W1P A;  3CHC A;  1P5Q A;  4HBE A;  1FD9 A;  3NTP A;  3IK8 A;  3ART A;  4QIB A;  4XAK A;  1QZ2 A;  1LG1 A;  1EQ3 A;  4ODM A;  4DZ2 A;  2Y78 A;  4MSP A;  2DSZ A;  5DIU A;  5J6E A;  1KFW A;  1QPL A;  2AOS A;  1ZCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...