4JFIA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound 1-[(9s,13r,13ar)-1,3-dimethoxy-8-oxo-5,8,9,10,11,12,13,13a-octahydro-6h-9,13-epiminoazocino[2,1-a]isoquinolin-14-yl]-2-(3,4,5-trimethoxyphenyl)ethane-1,2-dione
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 35
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfiA00
1FKRA 1J4RA 1F8AB 3KAIA 1JNTA 3I6CA 4BF8A 2LPVA 4W9OA 2PPNA 2KO7A 3O5LA 1F40A 5GPGA 2XP8A 1Q6IA 3EY6A 2VN1A 3JXVA 1D7JA 1Q1CA 4JFIA 4QIBA 3TDBA 4TW7A 1J6YA 4W9PA 5J6EA 1QPLA 3KAFA 5HTGA 3O5IA 4DRKA 3O5KA 1NMWA 1Q6HA 2MF9A 2MLZA 2RSEA 4TW6A 2XP3A 2XP9A 2KE0A 3IKDA 3O5QA 5HW6A 3UQBA 4DIPA 4ODMA 2PV2A 2N87A 2Q5AA 2ITKA 4J4OA 1JNSA 5HT1A 3PRDA 5HUAA 1U79A 4O2TA 4LAVA 1KT1A 2AWGA 1NSGA 3WH0A 3KADA 2RUQA 3OOBA 3IKGA 2MLXA 4W9QA 1PINA 1R9HA 1TCOC 3O5OA 3UI5A 1D7HA 4TW8A 4LAYA 3O5RA 1B6CA 1NMVA 4ODOA 1EYMA 2ZR4A 1FKKA 4DROA 4JFLA 3O5EA 2XPAA 3CGNA 4ODNA 1ZK6A 2ZR6A 2ZQTA 3RGCA 4LAXA 4FAPA 2FAPA 4DRQA 5BXJA 2XPBA 3CGMA 2RQSA 4ODQA 4DZ2A 1ZCNA 3TCZA 1Y0OA 1YATA 4U85A 4LAWA 2XP5A 1ROTA 3O5MA 4JFJA 2RUCA 4ODKA 4DT4A 2XP6A 3JYJA 1J4IA 4TYOA 2PBCA 2DG4A 4QT3A 2LKNA 5D75A 3O5DA 1T11A 4G2PA 2XP4A 1FKSA 1FAPA 3H9RB 4G50A 4DRPA 2MNTA 3RFWA 2Y78A 4R0XA 4U84A 1C9HA 3O5JA 3KAGA 1FKIA 1FKDA 2KR7A 5DITA 1YW5A 1QPFA 4DRMA 2F21A 2PV3A 4ODLA 1FKJA 5HW7A 3KACA 4ODRA 3FAPA 3MDYB 3PRBA 3TC5A 3PA7A 4C02B 2FKEA 1FKBA 3KCEA 2LJ4A 4TNSA 4DRHA 2KFWA 3UF8A 2PPOA 2ZQUA 1KT0A 4DRIA 1FJDA 3JYMA 3O5GA 2D9FA 2UZ5A 5DIVA 3B7XA 1QZ2A 2DG3A 1A7XA 3VAWA 2JZVA 3UQAA 1HXVA 1BL4A 1FKTA 2KI3A 2VCDA 2LGOA 2IF4A 2M08A 4N19A 1ROUA 2M1IA 1JVWA 1FKFA 3LUOA 1L1PA 2F2DA 4DRJA 1W26A 2ZQVA 3NRKA 1FD9A 2MPHA 4IQCA 4DZ3A 2PPPA 3KABA 2OFNA 4ITZA 2L2SA 3ODKA 4FN2A 4IQ2A 3UI4A 1FKGA 4MSPA 3O5PA 1BKFA 3GPKA 1EQ3A 3KZ7A 1J4HA 2MLYA 4MGVA 1P5QA 4TX0A 3IHZA 2ZR5A 1D7IA 2XP7A 4JFMA 2PV1A 5HW8A 2RURA 1D6OA 2ZQSA 3KAHA 5DIUA 4DH0A 5B8IC 3NI6A 5HWCA 4J4NA 1N1AA 5HKGA 1M5YA 2KGJA 1Q6UA 3NTPA 5HWBA 5I98A 4GIVA 4JYSA 4NNRA 2DG9A 4DRNA 1PBKA 2RUDA 4GGQA 4ODPA 3UI6A 4IPXA 2F4EA 2K8IA 1FKLA 3IK8A 3UQIA 4JFKA 4U86A 2M2AA 3O5FA 1FKHA 4QT2A
chains in the Genus database with same CATH superfamily
1NWRA 1SR0A 1LG1A 3ARQA 3CHDA 3O5LA 2AOSA 5GPGA 1Q6IA 4P8UA 4MNMA 4UDMA 4TW7A 5J6EA 1WAWA 5HTGA 3O5IA 1HJXA 1NMWA 1Q6HA 2MF9A 4TW6A 4MPKA 3O5QA 4HBOA 2DSUA 3UQBA 5HW6A 1FFQA 2O9OA 1HJVA 2PV2A 4Q22A 4J4OA 1JNSA 3B8SA 1KT1A 1WNOA 2AWGA 2RUQA 1OGGA 3IKGA 3ARTA 2MLXA 1R9HA 3O5OA 3UI5A 4LAYA 1W1PA 4W5UA 4JFLA 3CH9A 3RGCA 4LAXA 4FAPA 2XPBA 1Y0OA 3RM9A 4LAWA 4JFJA 4DT4A 3G6MA 2LKNA 5DEZA 3O5DA 1T11A 2A3EA 2DT1A 1FKSA 4DRPA 2MNTA 2O92A 4Q7NA 1FKIA 3ARUA 4ZPTR 3KACA 3MDYB 3PRBA 1E6ZA 4C02B 1NWUA 3UF8A 2ZQUA 2DT0A 5DIVA 3B7XA 1QZ2A 3VAWA 1HXVA 1E6NA 4DWSB 3WD2A 1EDQA 1FKFA 1L1PA 3WL1A 4P8XA 4DZ3A 2MPHA 1W1TA 3AS2A 3KABA 2OFNA 4FN2A 3UI4A 4MSPA 3GPKA 3ARYA 4MGVA 3IHZA 2ZR5A 1D7IA 2PV1A 5DIUA 4DH0A 2ZQSA 5B8IC 5HWCA 4J4NA 2DSWA 2EULA 1M5YA 4WIWA 1H0GA 1OGBA 2DG9A 2PN0A 4NNRA 4DRNA 3OA5A 5DO2A 2F4EA 1W9UA 4U86A 2B5UB 4QT2A 1JNTA 3ARZA 2P4VA 1LL4A 2DSZA 2XP8A 3JXVA 3EY6A 2VN1A 3ARWA 4JFIA 4W9PA 3CZ8A 4DRKA 2MLZA 3WQVA 4DIPA 3B9AA 2Q5AA 1X6NA 4URIA 5HT1A 3PRDA 5HUAA 3WD0A 1LG2A 1NWTA 1HJWA 1E44A 2F23A 3W4RA 1TCOC 5DF0A 4ODOA 2ZQTA 2OLHA 5BXJA 3ALFA 3TCZA 4XAKA 4KQZA 4ODKA 1ZBKA 4S3KA 1J4IA 1D2KA 2PBCA 2DG4A 4G50A 3H9RB 3AROA 4Z2HA 2KR7A 1YW5A 3ARPA 4IT4A 2PV3A 4ODLA 1LJYA 4ODRA 4Z2IA 3PA7A 2LJ4A 4TNSA 2QF8A 1ZBCA 1SYTA 4WK9A 2M08A 4N19A 4ZPVR 1E6PA 3LUOA 2WK2A 3WKZA 2F2DA 4DWSA 4S3JA 1JNDA 1FD9A 4ZS6A 3FY1A 4IQ2A 1FKGA 3ALGA 1J4HA 2MLYA 3AS1A 4AY1A 2XP7A 3KAHA 1D6OA 3NI6A 3QOKA 5HWBA 5I98A 4JYSA 1E6RA 2RUDA 3IK8A 2K8IA 1FKLA 4JFKA 4L72B 2WM0A 4LGXA 1FKRA 1J4RA 1TFVA 3KAIA 4BF8A 4W9OA 2KO7A 4PTMA 4QIBA 1J6YA 3TDBA 1JNEA 3KAFA 3WIJA 2RSEA 3EIPA 2XP3A 2XP9A 1UR9A 2KE0A 3IKDA 4WKAA 1ZBWA 4ODMA 4KR0B 2N87A 2ITKA 2IUZA 2A3BA 1HKKA 1U79A 2DT3A 2WLZA 3WH0A 3KADA 1CTNA 4W9QA 3CHEA 4TW8A 1NMVA 3CHCA 4HARA 1RD6A 4MNKA 2XPAA 2ESCA 4ODNA 1ZK6A 4P8VA 2FAPA 4DRQA 4MNJA 5GQBA 1EIBA 4ODQA 2RQSA 3FXYA 1ZCNA 3AS3A 5HBFA 1YATA 1ROTA 3WQWA 3WD1A 1F40A 1KFWA 4TYOA 1E9LA 4MAVA 4QT3A 2XP4A 1XHGA 2Y78A 1HKIA 2DT2A 4R0XA 4ZPWR 3KAGA 5DITA 1QPFA 4DRMA 2F21A 5HW7A 2FKEA 1FKBA 3KCEA 4DRHA 1W9PA 1ZB5A 2KFWA 2YBUA 3PRAA 1FJDA 3O5GA 1A7XA 3UQAA 2JZVA 1JCHB 1BL4A 2KI3A 2LGOA 1ROUA 2M1IA 4DRJA 2ZQVA 1X6LA 4IQCA 3RMEA 3WD4A 2DPEA 1EHNA 2PPPA 4ITZA 3AS0A 2L2SA 3ODKA 5GPRA 1VF8A 3O5PA 3G6LA 3KZ7A 4QZVB 2G8ZA 3ARVA 1P5QA 4TX0A 3WL0A 2RURA 1O6IA 5JH8A 1N1AA 4NSBA 2KGJA 1Q6UA 1W9VA 4GIVA 4MNLA 4ODPA 3UI6A 1GUVA 4IPXA 2DSVA 3UQIA 3ARRA 3O5FA 1HKJA 1F8AB 1LL7A 3I6CA 2LPVA 4NZCA 1FFRA 1W1YA 2PPNA 3WD3A 4HBEA 1ZU8A 1WB0A 1OWQA 1D7JA 1Q1CA 4DWSD 1K9TA 2ETNA 1QPLA 3O5KA 3B9EA 4O2TA 4LAVA 1NSGA 2YBTA 4WKHA 3OOBA 1PINA 4R5EA 4Z2KA 1D7HA 3O5RA 1B6CA 1EYMA 2ZR4A 1FKKA 4DROA 3O5EA 3CGNA 2ZR6A 4ML4A 1ITXA 3CGMA 4DZ2A 4IT6A 4U85A 2XP5A 3O5MA 2RUCA 2B31A 2XP6A 3GTYX 3JYJA 3BXWA 4DWSC 3BMBA 3RM8A 5D75A 4G2PA 1FAPA 3RM4A 2WLYA 3RFWA 4U84A 1C9HA 3O5JA 1FKDA 1H0IA 1FKJA 3FAPA 3TC5A 1ZBVA 3PR9A 2PPOA 4DRIA 1KT0A 3CHFA 3JYMA 2D9FA 2UZ5A 2A3CA 3AQUA 2DG3A 1GPFA 4MTVA 3ARXA 1E15A 1ZL1A 1FKTA 2VCDA 1LL6A 2IF4A 2FDMA 4WJXA 1GOIA 1JVWA 4P8WA 1W26A 3NRKA 2G41A 1W1VA 2A3AA 3GU0A 1BKFA 2PI6A 3B9DA 1EQ3A 3ARSA 1GRJA 1NWSA 4JFMA 4L3NA 1NH6A 5HW8A 4Z2GA 1UR8A 5HKGA 4Z2JA 1HKMA 3NTPA 4Z2LA 1LQ0A 1PBKA 1IX5A 4GGQA 4WKFA 1XRVA 2M2AA 1FKHA
chains in the Genus database with same CATH topology
1NWRA 1SR0A 1LG1A 3ARQA 3CHDA 3O5LA 2AOSA 5GPGA 1Q6IA 4P8UA 4MNMA 4TW7A 5J6EA 1WAWA 5HTGA 3O5IA 1HJXA 1NMWA 1Q6HA 2MF9A 4TW6A 4MPKA 3O5QA 4HBOA 2DSUA 3UQBA 5HW6A 1FFQA 2O9OA 1HJVA 2PV2A 4Q22A 4J4OA 1JNSA 3B8SA 1KT1A 1WNOA 2AWGA 2RUQA 1OGGA 3IKGA 3ARTA 2MLXA 1R9HA 3O5OA 3UI5A 4LAYA 1W1PA 4W5UA 4JFLA 3CH9A 3RGCA 4LAXA 4FAPA 2XPBA 1Y0OA 3RM9A 4LAWA 4JFJA 4DT4A 3G6MA 2LKNA 5DEZA 3O5DA 1T11A 2A3EA 2DT1A 1FKSA 4DRPA 2MNTA 2O92A 4Q7NA 1FKIA 3ARUA 4ZPTR 3KACA 3MDYB 3PRBA 1E6ZA 4C02B 1NWUA 3UF8A 2ZQUA 2DT0A 5DIVA 3B7XA 1QZ2A 3VAWA 1HXVA 1E6NA 4DWSB 3WD2A 1EDQA 1FKFA 1L1PA 3WL1A 4P8XA 4DZ3A 2MPHA 1W1TA 3AS2A 3KABA 2OFNA 4FN2A 3UI4A 4MSPA 3GPKA 3ARYA 4MGVA 3IHZA 2ZR5A 1D7IA 2PV1A 5DIUA 4DH0A 2ZQSA 5B8IC 5HWCA 4J4NA 2DSWA 1M5YA 4WIWA 1H0GA 1OGBA 2DG9A 4NNRA 4DRNA 3OA5A 5DO2A 2F4EA 1W9UA 4U86A 4QT2A 1JNTA 3ARZA 1LL4A 2DSZA 2XP8A 3JXVA 3EY6A 2VN1A 3ARWA 4JFIA 4W9PA 3CZ8A 4DRKA 2MLZA 3WQVA 4DIPA 3B9AA 2Q5AA 1X6NA 4URIA 5HT1A 3PRDA 5HUAA 3WD0A 1LG2A 1NWTA 1HJWA 3W4RA 1TCOC 5DF0A 4ODOA 2ZQTA 2OLHA 5BXJA 3ALFA 3TCZA 4XAKA 4KQZA 4ODKA 1ZBKA 4S3KA 1J4IA 1D2KA 2PBCA 2DG4A 4G50A 3H9RB 3AROA 4Z2HA 2KR7A 1YW5A 3ARPA 4IT4A 2PV3A 4ODLA 1LJYA 4ODRA 4Z2IA 3PA7A 2LJ4A 4TNSA 2QF8A 1ZBCA 1SYTA 4WK9A 2M08A 4N19A 4ZPVR 1E6PA 3LUOA 2WK2A 3WKZA 2F2DA 4DWSA 4S3JA 1JNDA 1FD9A 4ZS6A 3FY1A 4IQ2A 1FKGA 3ALGA 1J4HA 2MLYA 3AS1A 4AY1A 2XP7A 3KAHA 1D6OA 3NI6A 3QOKA 5HWBA 5I98A 4JYSA 1E6RA 2RUDA 3IK8A 2K8IA 1FKLA 4JFKA 4L72B 2WM0A 4LGXA 1FKRA 1J4RA 1TFVA 3KAIA 4BF8A 4W9OA 2KO7A 4PTMA 4QIBA 1J6YA 3TDBA 1JNEA 3KAFA 3WIJA 2RSEA 2XP3A 2XP9A 1UR9A 2KE0A 3IKDA 4WKAA 1ZBWA 4ODMA 4KR0B 2N87A 2ITKA 2IUZA 2A3BA 1HKKA 1U79A 2DT3A 2WLZA 3WH0A 3KADA 1CTNA 4W9QA 3CHEA 4TW8A 1NMVA 3CHCA 4HARA 1RD6A 4MNKA 2XPAA 2ESCA 4ODNA 1ZK6A 4P8VA 2FAPA 4DRQA 4MNJA 5GQBA 1EIBA 4ODQA 2RQSA 3FXYA 1ZCNA 3AS3A 5HBFA 1YATA 1ROTA 3WQWA 3WD1A 1F40A 1KFWA 4TYOA 1E9LA 4MAVA 4QT3A 2XP4A 1XHGA 2Y78A 1HKIA 2DT2A 4R0XA 4ZPWR 3KAGA 5DITA 1QPFA 4DRMA 2F21A 5HW7A 2FKEA 1FKBA 3KCEA 4DRHA 1W9PA 1ZB5A 2KFWA 2YBUA 3PRAA 1FJDA 3O5GA 1A7XA 3UQAA 2JZVA 1BL4A 2KI3A 2LGOA 1ROUA 2M1IA 4DRJA 2ZQVA 1X6LA 4IQCA 3RMEA 3WD4A 2DPEA 1EHNA 2PPPA 4ITZA 3AS0A 2L2SA 3ODKA 5GPRA 1VF8A 3O5PA 3G6LA 3KZ7A 4QZVB 2G8ZA 3ARVA 1P5QA 4TX0A 3WL0A 2RURA 1O6IA 5JH8A 1N1AA 4NSBA 2KGJA 1Q6UA 1W9VA 4GIVA 4MNLA 4ODPA 3UI6A 1GUVA 4IPXA 2DSVA 3UQIA 3ARRA 3O5FA 1HKJA 1F8AB 1LL7A 3I6CA 2LPVA 4NZCA 1FFRA 1W1YA 2PPNA 3WD3A 4HBEA 1ZU8A 1WB0A 1OWQA 1D7JA 1Q1CA 4DWSD 1K9TA 1QPLA 3O5KA 3B9EA 4O2TA 4LAVA 1NSGA 2YBTA 4WKHA 3OOBA 1PINA 4R5EA 4Z2KA 1D7HA 3O5RA 1B6CA 1EYMA 2ZR4A 1FKKA 4DROA 3O5EA 3CGNA 2ZR6A 4ML4A 1ITXA 3CGMA 4DZ2A 4IT6A 4U85A 2XP5A 3O5MA 2RUCA 2B31A 2XP6A 3JYJA 4DWSC 3BXWA 3RM8A 5D75A 4G2PA 1FAPA 3RM4A 2WLYA 3RFWA 4U84A 1C9HA 3O5JA 1FKDA 1H0IA 1FKJA 3FAPA 3TC5A 1ZBVA 3PR9A 2PPOA 4DRIA 1KT0A 3CHFA 3JYMA 2D9FA 2UZ5A 2A3CA 3AQUA 2DG3A 1GPFA 4MTVA 3ARXA 1E15A 1ZL1A 1FKTA 2VCDA 1LL6A 2IF4A 2FDMA 4WJXA 1GOIA 1JVWA 4P8WA 1W26A 3NRKA 2G41A 1W1VA 2A3AA 1BKFA 2PI6A 3B9DA 1EQ3A 3ARSA 1NWSA 4JFMA 4L3NA 1NH6A 5HW8A 4Z2GA 1UR8A 5HKGA 4Z2JA 1HKMA 3NTPA 4Z2LA 1LQ0A 1PBKA 1IX5A 4GGQA 4WKFA 1XRVA 2M2AA 1FKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKR A;  1J4R A;  1F8A B;  3KAI A;  1JNT A;  3I6C A;  4BF8 A;  2LPV A;  4W9O A;  2PPN A;  2KO7 A;  3O5L A;  1F40 A;  5GPG A;  2XP8 A;  1Q6I A;  3EY6 A;  2VN1 A;  3JXV A;  1D7J A;  1Q1C A;  4JFI A;  4QIB A;  3TDB A;  4TW7 A;  1J6Y A;  4W9P A;  5J6E A;  1QPL A;  3KAF A;  5HTG A;  3O5I A;  4DRK A;  3O5K A;  1NMW A;  1Q6H A;  2MF9 A;  2MLZ A;  2RSE A;  4TW6 A;  2XP3 A;  2XP9 A;  2KE0 A;  3IKD A;  3O5Q A;  5HW6 A;  3UQB A;  4DIP A;  4ODM A;  2PV2 A;  2N87 A;  2Q5A A;  2ITK A;  4J4O A;  1JNS A;  5HT1 A;  3PRD A;  5HUA A;  1U79 A;  4O2T A;  4LAV A;  1KT1 A;  2AWG A;  1NSG A;  3WH0 A;  3KAD A;  2RUQ A;  3OOB A;  3IKG A;  2MLX A;  4W9Q A;  1PIN A;  1R9H A;  1TCO C;  3O5O A;  3UI5 A;  1D7H A;  4TW8 A;  4LAY A;  3O5R A;  1B6C A;  1NMV A;  4ODO A;  1EYM A;  2ZR4 A;  1FKK A;  4DRO A;  4JFL A;  3O5E A;  2XPA A;  3CGN A;  4ODN A;  1ZK6 A;  2ZR6 A;  2ZQT A;  3RGC A;  4LAX A;  4FAP A;  2FAP A;  4DRQ A;  5BXJ A;  2XPB A;  3CGM A;  2RQS A;  4ODQ A;  4DZ2 A;  1ZCN A;  3TCZ A;  1Y0O A;  1YAT A;  4U85 A;  4LAW A;  2XP5 A;  1ROT A;  3O5M A;  4JFJ A;  2RUC A;  4ODK A;  4DT4 A;  2XP6 A;  3JYJ A;  1J4I A;  4TYO A;  2PBC A;  2DG4 A;  4QT3 A;  2LKN A;  5D75 A;  3O5D A;  1T11 A;  4G2P A;  2XP4 A;  1FKS A;  1FAP A;  3H9R B;  4G50 A;  4DRP A;  2MNT A;  3RFW A;  2Y78 A;  4R0X A;  4U84 A;  1C9H A;  3O5J A;  3KAG A;  1FKI A;  1FKD A;  2KR7 A;  5DIT A;  1YW5 A;  1QPF A;  4DRM A;  2F21 A;  2PV3 A;  4ODL A;  1FKJ A;  5HW7 A;  3KAC A;  4ODR A;  3FAP A;  3MDY B;  3PRB A;  3TC5 A;  3PA7 A;  4C02 B;  2FKE A;  1FKB A;  3KCE A;  2LJ4 A;  4TNS A;  4DRH A;  2KFW A;  3UF8 A;  2PPO A;  2ZQU A;  1KT0 A;  4DRI A;  1FJD A;  3JYM A;  3O5G A;  2D9F A;  2UZ5 A;  5DIV A;  3B7X A;  1QZ2 A;  2DG3 A;  1A7X A;  3VAW A;  2JZV A;  3UQA A;  1HXV A;  1BL4 A;  1FKT A;  2KI3 A;  2VCD A;  2LGO A;  2IF4 A;  2M08 A;  4N19 A;  1ROU A;  2M1I A;  1JVW A;  1FKF A;  3LUO A;  1L1P A;  2F2D A;  4DRJ A;  1W26 A;  2ZQV A;  3NRK A;  1FD9 A;  2MPH A;  4IQC A;  4DZ3 A;  2PPP A;  3KAB A;  2OFN A;  4ITZ A;  2L2S A;  3ODK A;  4FN2 A;  4IQ2 A;  3UI4 A;  1FKG A;  4MSP A;  3O5P A;  1BKF A;  3GPK A;  1EQ3 A;  3KZ7 A;  1J4H A;  2MLY A;  4MGV A;  1P5Q A;  4TX0 A;  3IHZ A;  2ZR5 A;  1D7I A;  2XP7 A;  4JFM A;  2PV1 A;  5HW8 A;  2RUR A;  1D6O A;  2ZQS A;  3KAH A;  5DIU A;  4DH0 A;  5B8I C;  3NI6 A;  5HWC A;  4J4N A;  1N1A A;  5HKG A;  1M5Y A;  2KGJ A;  1Q6U A;  3NTP A;  5HWB A;  5I98 A;  4GIV A;  4JYS A;  4NNR A;  2DG9 A;  4DRN A;  1PBK A;  2RUD A;  4GGQ A;  4ODP A;  3UI6 A;  4IPX A;  2F4E A;  2K8I A;  1FKL A;  3IK8 A;  3UQI A;  4JFK A;  4U86 A;  2M2A A;  3O5F A;  1FKH A;  4QT2 A; 
#chains in the Genus database with same CATH topology
 1NWR A;  1SR0 A;  1LG1 A;  3ARQ A;  3CHD A;  3O5L A;  2AOS A;  5GPG A;  1Q6I A;  4P8U A;  4MNM A;  4UDM A;  4TW7 A;  5J6E A;  1WAW A;  5HTG A;  3O5I A;  1HJX A;  1NMW A;  1Q6H A;  2MF9 A;  4TW6 A;  4MPK A;  3O5Q A;  4HBO A;  2DSU A;  3UQB A;  5HW6 A;  1FFQ A;  2O9O A;  1HJV A;  2PV2 A;  4Q22 A;  4J4O A;  1JNS A;  3B8S A;  1KT1 A;  1WNO A;  2AWG A;  2RUQ A;  1OGG A;  3IKG A;  3ART A;  2MLX A;  1R9H A;  3O5O A;  3UI5 A;  4LAY A;  1W1P A;  4W5U A;  4JFL A;  3CH9 A;  3RGC A;  4LAX A;  4FAP A;  2XPB A;  1Y0O A;  3RM9 A;  4LAW A;  4JFJ A;  4DT4 A;  3G6M A;  2LKN A;  5DEZ A;  3O5D A;  1T11 A;  2A3E A;  2DT1 A;  1FKS A;  4DRP A;  2MNT A;  2O92 A;  4Q7N A;  1FKI A;  3ARU A;  4ZPT R;  3KAC A;  3MDY B;  3PRB A;  1E6Z A;  4C02 B;  1NWU A;  3UF8 A;  2ZQU A;  2DT0 A;  5DIV A;  3B7X A;  1QZ2 A;  3VAW A;  1HXV A;  1E6N A;  4DWS B;  3WD2 A;  1EDQ A;  1FKF A;  1L1P A;  3WL1 A;  4P8X A;  4DZ3 A;  2MPH A;  1W1T A;  3AS2 A;  3KAB A;  2OFN A;  4FN2 A;  3UI4 A;  4MSP A;  3GPK A;  3ARY A;  4MGV A;  3IHZ A;  2ZR5 A;  1D7I A;  2PV1 A;  5DIU A;  4DH0 A;  2ZQS A;  5B8I C;  5HWC A;  4J4N A;  2DSW A;  2EUL A;  1M5Y A;  4WIW A;  1H0G A;  1OGB A;  2DG9 A;  2PN0 A;  4NNR A;  4DRN A;  3OA5 A;  5DO2 A;  2F4E A;  1W9U A;  4U86 A;  2B5U B;  4QT2 A;  1JNT A;  3ARZ A;  2P4V A;  1LL4 A;  2DSZ A;  2XP8 A;  3JXV A;  3EY6 A;  2VN1 A;  3ARW A;  4JFI A;  4W9P A;  3CZ8 A;  4DRK A;  2MLZ A;  3WQV A;  4DIP A;  3B9A A;  2Q5A A;  1X6N A;  4URI A;  5HT1 A;  3PRD A;  5HUA A;  3WD0 A;  1LG2 A;  1NWT A;  1HJW A;  1E44 A;  2F23 A;  3W4R A;  1TCO C;  5DF0 A;  4ODO A;  2ZQT A;  2OLH A;  5BXJ A;  3ALF A;  3TCZ A;  4XAK A;  4KQZ A;  4ODK A;  1ZBK A;  4S3K A;  1J4I A;  1D2K A;  2PBC A;  2DG4 A;  4G50 A;  3H9R B;  3ARO A;  4Z2H A;  2KR7 A;  1YW5 A;  3ARP A;  4IT4 A;  2PV3 A;  4ODL A;  1LJY A;  4ODR A;  4Z2I A;  3PA7 A;  2LJ4 A;  4TNS A;  2QF8 A;  1ZBC A;  1SYT A;  4WK9 A;  2M08 A;  4N19 A;  4ZPV R;  1E6P A;  3LUO A;  2WK2 A;  3WKZ A;  2F2D A;  4DWS A;  4S3J A;  1JND A;  1FD9 A;  4ZS6 A;  3FY1 A;  4IQ2 A;  1FKG A;  3ALG A;  1J4H A;  2MLY A;  3AS1 A;  4AY1 A;  2XP7 A;  3KAH A;  1D6O A;  3NI6 A;  3QOK A;  5HWB A;  5I98 A;  4JYS A;  1E6R A;  2RUD A;  3IK8 A;  2K8I A;  1FKL A;  4JFK A;  4L72 B;  2WM0 A;  4LGX A;  1FKR A;  1J4R A;  1TFV A;  3KAI A;  4BF8 A;  4W9O A;  2KO7 A;  4PTM A;  4QIB A;  1J6Y A;  3TDB A;  1JNE A;  3KAF A;  3WIJ A;  2RSE A;  3EIP A;  2XP3 A;  2XP9 A;  1UR9 A;  2KE0 A;  3IKD A;  4WKA A;  1ZBW A;  4ODM A;  4KR0 B;  2N87 A;  2ITK A;  2IUZ A;  2A3B A;  1HKK A;  1U79 A;  2DT3 A;  2WLZ A;  3WH0 A;  3KAD A;  1CTN A;  4W9Q A;  3CHE A;  4TW8 A;  1NMV A;  3CHC A;  4HAR A;  1RD6 A;  4MNK A;  2XPA A;  2ESC A;  4ODN A;  1ZK6 A;  4P8V A;  2FAP A;  4DRQ A;  4MNJ A;  5GQB A;  1EIB A;  4ODQ A;  2RQS A;  3FXY A;  1ZCN A;  3AS3 A;  5HBF A;  1YAT A;  1ROT A;  3WQW A;  3WD1 A;  1F40 A;  1KFW A;  4TYO A;  1E9L A;  4MAV A;  4QT3 A;  2XP4 A;  1XHG A;  2Y78 A;  1HKI A;  2DT2 A;  4R0X A;  4ZPW R;  3KAG A;  5DIT A;  1QPF A;  4DRM A;  2F21 A;  5HW7 A;  2FKE A;  1FKB A;  3KCE A;  4DRH A;  1W9P A;  1ZB5 A;  2KFW A;  2YBU A;  3PRA A;  1FJD A;  3O5G A;  1A7X A;  3UQA A;  2JZV A;  1JCH B;  1BL4 A;  2KI3 A;  2LGO A;  1ROU A;  2M1I A;  4DRJ A;  2ZQV A;  1X6L A;  4IQC A;  3RME A;  3WD4 A;  2DPE A;  1EHN A;  2PPP A;  4ITZ A;  3AS0 A;  2L2S A;  3ODK A;  5GPR A;  1VF8 A;  3O5P A;  3G6L A;  3KZ7 A;  4QZV B;  2G8Z A;  3ARV A;  1P5Q A;  4TX0 A;  3WL0 A;  2RUR A;  1O6I A;  5JH8 A;  1N1A A;  4NSB A;  2KGJ A;  1Q6U A;  1W9V A;  4GIV A;  4MNL A;  4ODP A;  3UI6 A;  1GUV A;  4IPX A;  2DSV A;  3UQI A;  3ARR A;  3O5F A;  1HKJ A;  1F8A B;  1LL7 A;  3I6C A;  2LPV A;  4NZC A;  1FFR A;  1W1Y A;  2PPN A;  3WD3 A;  4HBE A;  1ZU8 A;  1WB0 A;  1OWQ A;  1D7J A;  1Q1C A;  4DWS D;  1K9T A;  2ETN A;  1QPL A;  3O5K A;  3B9E A;  4O2T A;  4LAV A;  1NSG A;  2YBT A;  4WKH A;  3OOB A;  1PIN A;  4R5E A;  4Z2K A;  1D7H A;  3O5R A;  1B6C A;  1EYM A;  2ZR4 A;  1FKK A;  4DRO A;  3O5E A;  3CGN A;  2ZR6 A;  4ML4 A;  1ITX A;  3CGM A;  4DZ2 A;  4IT6 A;  4U85 A;  2XP5 A;  3O5M A;  2RUC A;  2B31 A;  2XP6 A;  3GTY X;  3JYJ A;  3BXW A;  4DWS C;  3BMB A;  3RM8 A;  5D75 A;  4G2P A;  1FAP A;  3RM4 A;  2WLY A;  3RFW A;  4U84 A;  1C9H A;  3O5J A;  1FKD A;  1H0I A;  1FKJ A;  3FAP A;  3TC5 A;  1ZBV A;  3PR9 A;  2PPO A;  4DRI A;  1KT0 A;  3CHF A;  3JYM A;  2D9F A;  2UZ5 A;  2A3C A;  3AQU A;  2DG3 A;  1GPF A;  4MTV A;  3ARX A;  1E15 A;  1ZL1 A;  1FKT A;  2VCD A;  1LL6 A;  2IF4 A;  2FDM A;  4WJX A;  1GOI A;  1JVW A;  4P8W A;  1W26 A;  3NRK A;  2G41 A;  1W1V A;  2A3A A;  3GU0 A;  1BKF A;  2PI6 A;  3B9D A;  1EQ3 A;  3ARS A;  1GRJ A;  1NWS A;  4JFM A;  4L3N A;  1NH6 A;  5HW8 A;  4Z2G A;  1UR8 A;  5HKG A;  4Z2J A;  1HKM A;  3NTP A;  4Z2L A;  1LQ0 A;  1PBK A;  1IX5 A;  4GGQ A;  4WKF A;  1XRV A;  2M2A A;  1FKH A; 
#chains in the Genus database with same CATH homology
 1NWR A;  1SR0 A;  1LG1 A;  3ARQ A;  3CHD A;  3O5L A;  2AOS A;  5GPG A;  1Q6I A;  4P8U A;  4MNM A;  4TW7 A;  5J6E A;  1WAW A;  5HTG A;  3O5I A;  1HJX A;  1NMW A;  1Q6H A;  2MF9 A;  4TW6 A;  4MPK A;  3O5Q A;  4HBO A;  2DSU A;  3UQB A;  5HW6 A;  1FFQ A;  2O9O A;  1HJV A;  2PV2 A;  4Q22 A;  4J4O A;  1JNS A;  3B8S A;  1KT1 A;  1WNO A;  2AWG A;  2RUQ A;  1OGG A;  3IKG A;  3ART A;  2MLX A;  1R9H A;  3O5O A;  3UI5 A;  4LAY A;  1W1P A;  4W5U A;  4JFL A;  3CH9 A;  3RGC A;  4LAX A;  4FAP A;  2XPB A;  1Y0O A;  3RM9 A;  4LAW A;  4JFJ A;  4DT4 A;  3G6M A;  2LKN A;  5DEZ A;  3O5D A;  1T11 A;  2A3E A;  2DT1 A;  1FKS A;  4DRP A;  2MNT A;  2O92 A;  4Q7N A;  1FKI A;  3ARU A;  4ZPT R;  3KAC A;  3MDY B;  3PRB A;  1E6Z A;  4C02 B;  1NWU A;  3UF8 A;  2ZQU A;  2DT0 A;  5DIV A;  3B7X A;  1QZ2 A;  3VAW A;  1HXV A;  1E6N A;  4DWS B;  3WD2 A;  1EDQ A;  1FKF A;  1L1P A;  3WL1 A;  4P8X A;  4DZ3 A;  2MPH A;  1W1T A;  3AS2 A;  3KAB A;  2OFN A;  4FN2 A;  3UI4 A;  4MSP A;  3GPK A;  3ARY A;  4MGV A;  3IHZ A;  2ZR5 A;  1D7I A;  2PV1 A;  5DIU A;  4DH0 A;  2ZQS A;  5B8I C;  5HWC A;  4J4N A;  2DSW A;  1M5Y A;  4WIW A;  1H0G A;  1OGB A;  2DG9 A;  4NNR A;  4DRN A;  3OA5 A;  5DO2 A;  2F4E A;  1W9U A;  4U86 A;  4QT2 A;  1JNT A;  3ARZ A;  1LL4 A;  2DSZ A;  2XP8 A;  3JXV A;  3EY6 A;  2VN1 A;  3ARW A;  4JFI A;  4W9P A;  3CZ8 A;  4DRK A;  2MLZ A;  3WQV A;  4DIP A;  3B9A A;  2Q5A A;  1X6N A;  4URI A;  5HT1 A;  3PRD A;  5HUA A;  3WD0 A;  1LG2 A;  1NWT A;  1HJW A;  3W4R A;  1TCO C;  5DF0 A;  4ODO A;  2ZQT A;  2OLH A;  5BXJ A;  3ALF A;  3TCZ A;  4XAK A;  4KQZ A;  4ODK A;  1ZBK A;  4S3K A;  1J4I A;  1D2K A;  2PBC A;  2DG4 A;  4G50 A;  3H9R B;  3ARO A;  4Z2H A;  2KR7 A;  1YW5 A;  3ARP A;  4IT4 A;  2PV3 A;  4ODL A;  1LJY A;  4ODR A;  4Z2I A;  3PA7 A;  2LJ4 A;  4TNS A;  2QF8 A;  1ZBC A;  1SYT A;  4WK9 A;  2M08 A;  4N19 A;  4ZPV R;  1E6P A;  3LUO A;  2WK2 A;  3WKZ A;  2F2D A;  4DWS A;  4S3J A;  1JND A;  1FD9 A;  4ZS6 A;  3FY1 A;  4IQ2 A;  1FKG A;  3ALG A;  1J4H A;  2MLY A;  3AS1 A;  4AY1 A;  2XP7 A;  3KAH A;  1D6O A;  3NI6 A;  3QOK A;  5HWB A;  5I98 A;  4JYS A;  1E6R A;  2RUD A;  3IK8 A;  2K8I A;  1FKL A;  4JFK A;  4L72 B;  2WM0 A;  4LGX A;  1FKR A;  1J4R A;  1TFV A;  3KAI A;  4BF8 A;  4W9O A;  2KO7 A;  4PTM A;  4QIB A;  1J6Y A;  3TDB A;  1JNE A;  3KAF A;  3WIJ A;  2RSE A;  2XP3 A;  2XP9 A;  1UR9 A;  2KE0 A;  3IKD A;  4WKA A;  1ZBW A;  4ODM A;  4KR0 B;  2N87 A;  2ITK A;  2IUZ A;  2A3B A;  1HKK A;  1U79 A;  2DT3 A;  2WLZ A;  3WH0 A;  3KAD A;  1CTN A;  4W9Q A;  3CHE A;  4TW8 A;  1NMV A;  3CHC A;  4HAR A;  1RD6 A;  4MNK A;  2XPA A;  2ESC A;  4ODN A;  1ZK6 A;  4P8V A;  2FAP A;  4DRQ A;  4MNJ A;  5GQB A;  1EIB A;  4ODQ A;  2RQS A;  3FXY A;  1ZCN A;  3AS3 A;  5HBF A;  1YAT A;  1ROT A;  3WQW A;  3WD1 A;  1F40 A;  1KFW A;  4TYO A;  1E9L A;  4MAV A;  4QT3 A;  2XP4 A;  1XHG A;  2Y78 A;  1HKI A;  2DT2 A;  4R0X A;  4ZPW R;  3KAG A;  5DIT A;  1QPF A;  4DRM A;  2F21 A;  5HW7 A;  2FKE A;  1FKB A;  3KCE A;  4DRH A;  1W9P A;  1ZB5 A;  2KFW A;  2YBU A;  3PRA A;  1FJD A;  3O5G A;  1A7X A;  3UQA A;  2JZV A;  1BL4 A;  2KI3 A;  2LGO A;  1ROU A;  2M1I A;  4DRJ A;  2ZQV A;  1X6L A;  4IQC A;  3RME A;  3WD4 A;  2DPE A;  1EHN A;  2PPP A;  4ITZ A;  3AS0 A;  2L2S A;  3ODK A;  5GPR A;  1VF8 A;  3O5P A;  3G6L A;  3KZ7 A;  4QZV B;  2G8Z A;  3ARV A;  1P5Q A;  4TX0 A;  3WL0 A;  2RUR A;  1O6I A;  5JH8 A;  1N1A A;  4NSB A;  2KGJ A;  1Q6U A;  1W9V A;  4GIV A;  4MNL A;  4ODP A;  3UI6 A;  1GUV A;  4IPX A;  2DSV A;  3UQI A;  3ARR A;  3O5F A;  1HKJ A;  1F8A B;  1LL7 A;  3I6C A;  2LPV A;  4NZC A;  1FFR A;  1W1Y A;  2PPN A;  3WD3 A;  4HBE A;  1ZU8 A;  1WB0 A;  1OWQ A;  1D7J A;  1Q1C A;  4DWS D;  1K9T A;  1QPL A;  3O5K A;  3B9E A;  4O2T A;  4LAV A;  1NSG A;  2YBT A;  4WKH A;  3OOB A;  1PIN A;  4R5E A;  4Z2K A;  1D7H A;  3O5R A;  1B6C A;  1EYM A;  2ZR4 A;  1FKK A;  4DRO A;  3O5E A;  3CGN A;  2ZR6 A;  4ML4 A;  1ITX A;  3CGM A;  4DZ2 A;  4IT6 A;  4U85 A;  2XP5 A;  3O5M A;  2RUC A;  2B31 A;  2XP6 A;  3JYJ A;  4DWS C;  3BXW A;  3RM8 A;  5D75 A;  4G2P A;  1FAP A;  3RM4 A;  2WLY A;  3RFW A;  4U84 A;  1C9H A;  3O5J A;  1FKD A;  1H0I A;  1FKJ A;  3FAP A;  3TC5 A;  1ZBV A;  3PR9 A;  2PPO A;  4DRI A;  1KT0 A;  3CHF A;  3JYM A;  2D9F A;  2UZ5 A;  2A3C A;  3AQU A;  2DG3 A;  1GPF A;  4MTV A;  3ARX A;  1E15 A;  1ZL1 A;  1FKT A;  2VCD A;  1LL6 A;  2IF4 A;  2FDM A;  4WJX A;  1GOI A;  1JVW A;  4P8W A;  1W26 A;  3NRK A;  2G41 A;  1W1V A;  2A3A A;  1BKF A;  2PI6 A;  3B9D A;  1EQ3 A;  3ARS A;  1NWS A;  4JFM A;  4L3N A;  1NH6 A;  5HW8 A;  4Z2G A;  1UR8 A;  5HKG A;  4Z2J A;  1HKM A;  3NTP A;  4Z2L A;  1LQ0 A;  1PBK A;  1IX5 A;  4GGQ A;  4WKF A;  1XRV A;  2M2A A;  1FKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...