4JFIA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound 1-[(9s,13r,13ar)-1,3-dimethoxy-8-oxo-5,8,9,10,11,12,13,13a-octahydro-6h-9,13-epiminoazocino[2,1-a]isoquinolin-14-yl]-2-(3,4,5-trimethoxyphenyl)ethane-1,2-dione
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfiA00
5HWBA 4J4NA 2FKEA 2ZR4A 4DIPA 4JFMA 1Q1CA 1Q6UA 2KGJA 1ROTA 3O5LA 4LAWA 2D9FA 5HWCA 2DG3A 2DG4A 2KE0A 4TW8A 2Q5AA 2ITKA 3I6CA 4ODKA 4O2TA 1L1PA 1BL4A 1YW5A 3O5PA 3TCZA 4DRJA 3TDBA 2ZQTA 1FKFA 3RGCA 4ODOA 5B8IC 1Y0OA 3O5RA 3UI4A 2AWGA 5HW6A 3UI5A 2PV1A 1ROUA 1PBKA 1W26A 1JNTA 2MPHA 3GPKA 1KT0A 2ZR6A 2F2DA 3KAFA 2MLYA 2LPVA 3UQAA 4ODLA 4W9OA 1EYMA 1QPFA 3TC5A 4U86A 1FKKA 2F4EA 4G50A 1FD9A 4LAVA 2XP9A 3NRKA 3O5KA 2XP8A 5GPGA 3NI6A 1FKBA 2MLXA 2PPNA 4TW6A 3IKGA 4FN2A 2KFWA 4IQCA 4FAPA 4JFJA 1U79A 5HUAA 4J4OA 2M08A 4JFLA 4LAYA 2RUQA 4DRMA 1QZ2A 2ZQSA 3PA7A 4JYSA 1FKHA 3KZ7A 1Q6HA 1J6YA 1NMWA 3PRDA 4NNRA 5HT1A 5BXJA 4DZ2A 3WH0A 1D7HA 2L2SA 2ZQUA 1D6OA 2M2AA 2Y78A 3KAGA 1A7XA 5HW8A 4IQ2A 1J4HA 1B6CA 2ZR5A 2JZVA 3KAHA 1FKRA 1C9HA 3KCEA 2MF9A 4LAXA 1D7JA 1FKTA 2XPAA 4GIVA 4TNSA 1J4RA 2RUCA 5D75A 4DT4A 4TX0A 3RFWA 4QIBA 3O5DA 2LJ4A 4U84A 3UF8A 2KI3A 4MSPA 3O5FA 3VAWA 2XP4A 4GGQA 2ZQVA 1ZK6A 4ODRA 3IHZA 1F40A 4QT3A 1D7IA 4N19A 4W9QA 5HKGA 3B7XA 3O5OA 4R0XA 4MGVA 1KT1A 3KADA 4DRIA 3JYMA 4C02B 1J4IA 2MNTA 1YATA 4ODPA 4DRQA 3O5IA 2IF4A 3UI6A 1TCOC 1FKDA 2N87A 2PPOA 2RQSA 3JXVA 3PRBA 1N1AA 4ODMA 1NMVA 4DRKA 1FKLA 3KACA 1P5QA 2KR7A 3CGNA 4DZ3A 5HTGA 5J6EA 3H9RB 4ITZA 1FKJA 2OFNA 2PPPA 3O5GA 3ODKA 4ODNA 1ZCNA 2KO7A 1HXVA 5DIVA 4ODQA 4G2PA 2XP3A 2XP7A 3JYJA 5I98A 1R9HA 1M5YA 2M1IA 1FKSA 3KAIA 2K8IA 3NTPA 4BF8A 5HW7A 5DIUA 3O5EA 1BKFA 2F21A 1FJDA 1JVWA 1EQ3A 3O5QA 4QT2A 5DITA 4JFKA 1F8AB 2DG9A 4W9PA 2VCDA 4DROA 4DRHA 3O5JA 1FKIA 2RUDA 4DRNA 4DRPA 2UZ5A 2RSEA 4TYOA 1NSGA 3IK8A 4U85A 3MDYB 3IKDA 3KABA 3FAPA 2MLZA 1Q6IA 2XPBA 1JNSA 1PINA 2PV2A 1T11A 3CGMA 3EY6A 2LKNA 3UQBA 3O5MA 3LUOA 2PBCA 2LGOA 2FAPA 2VN1A 4JFIA 3UQIA 1FAPA 2XP5A 1FKGA 4IPXA 4DH0A 2XP6A 4TW7A 2RURA 2PV3A 3OOBA 1QPLA
chains in the Genus database with same CATH superfamily
4ZS6A 1OGGA 3PR9A 4DIPA 4JFMA 1E15A 1ROTA 1TFVA 2DG3A 2DG4A 4TW8A 4O2TA 3ARUA 1YW5A 5B8IC 5JH8A 2ZQTA 3RGCA 4ODOA 4URIA 4WJXA 3O5RA 2AWGA 3UI5A 3WIJA 2ETNA 1FFQA 4W9OA 1EYMA 3AS0A 4U86A 2F4EA 2XP9A 2XP8A 4TW6A 4MNJA 1NWUA 2KFWA 4P8XA 4S3JA 1ZL1A 3ARRA 1E44A 4JFLA 3PA7A 2ZQSA 4DWSD 4R5EA 1D2KA 1NWSA 4IQ2A 1FKRA 1WNOA 2WLYA 2MF9A 2B5UB 1D7JA 1FKTA 1ZBVA 4GIVA 4L3NA 1JNEA 4DT4A 4QIBA 3O5DA 3VAWA 4GGQA 4MPKA 3WD1A 1SYTA 1D7IA 4N19A 4DWSB 1W9UA 4R0XA 1HJXA 3ARQA 4ODPA 3RM8A 3JXVA 3PRAA 4ODMA 3CH9A 1WB0A 3KACA 2KR7A 2OFNA 3B8SA 3B9EA 4ODNA 3ODKA 2A3BA 2KO7A 1E6ZA 4G2PA 1M5YA 3KAIA 4BF8A 2YBTA 5HW7A 5DIUA 1EIBA 1JVWA 3O5QA 5HBFA 3ARZA 4DROA 3O5JA 1FKIA 2RUDA 3G6MA 2RSEA 4U85A 3IK8A 3ARSA 3FAPA 1Q6IA 1JNSA 1PINA 1HKKA 2VN1A 5DEZA 4JFIA 4PTMA 2RURA 2PV3A 3OOBA 3RMEA 3BMBA 4KR0B 5HWBA 2DSWA 4HARA 4J4NA 3ARTA 2FKEA 1ZBCA 3WD2A 1UR8A 2KGJA 4DWSC 2KE0A 2Q5AA 4ODKA 4MNMA 4DRJA 1LL6A 1FKFA 1HKIA 3ARXA 1JNDA 4DWSA 1W26A 1GOIA 1ZB5A 2ZR6A 2F2DA 4ODLA 1W1VA 1QPFA 1FKKA 4G50A 3AROA 4Q22A 5GPGA 1FKBA 2MLXA 2PPNA 4JFJA 4S3KA 2RUQA 4DRMA 3CHDA 2DT3A 1J6YA 2WM0A 4P8UA 4DZ2A 1D7HA 2M2AA 2Y78A 1CTNA 2B31A 1J4HA 2JZVA 2QF8A 3WD4A 1C9HA 2RUCA 4MNLA 4ZPTR 4KQZA 1X6NA 1NWTA 4ODRA 1KT1A 3KADA 1YATA 4DRQA 4P8VA 4W5UA 3O5IA 2IF4A 3FY1A 1FKDA 4L72B 1N1AA 1P5QA 3CGNA 4ITZA 3O5GA 2PPPA 1OGBA 4Z2LA 1NWRA 3JYJA 3ARPA 4WKHA 3O5EA 1EQ3A 1K9TA 2EULA 4MNKA 4DRPA 1ZBWA 3ALGA 4Q7NA 4WKFA 3KABA 4ZPWR 3WQVA 3CGMA 3EY6A 3O5MA 2LGOA 3QOKA 3RM4A 2DSUA 2DSVA 2XP5A 2XP6A 1HKJA 1OWQA 3W4RA 1W1PA 1EHNA 2FDMA 4HBOA 2A3EA 4LAWA 1Q1CA 2D9FA 5HWCA 3AS3A 3I6CA 1BL4A 3TCZA 3TDBA 2DT1A 2AOSA 2PV1A 1ROUA 1LL4A 1JNTA 1W9VA 5GQBA 3KAFA 3UQAA 1LG2A 4LAVA 4MAVA 1NH6A 4Z2HA 4IQCA 3OA5A 4NZCA 4FAPA 1KFWA 1U79A 4J4OA 5DF0A 4LAYA 5HUAA 1LG1A 4Z2IA 1FKHA 3KZ7A 1Q6HA 1NMWA 5HT1A 1E9LA 3WH0A 3B9DA 4AY1A 3KAGA 1A7XA 4IT6A 5HW8A 2ZR5A 1B6CA 4WK9A 3KAHA 3KCEA 1W1TA 1E6PA 4LAXA 2G8ZA 1LL7A 1J4RA 2A3CA 4TX0A 2PN0A 2LJ4A 2KI3A 3BXWA 3RM9A 3WD3A 4Z2KA 3IHZA 1FFRA 1X6LA 2DT0A 4W9QA 3B7XA 3O5OA 3ALFA 3JYMA 4C02B 1JCHB 3ARYA 1H0GA 1XHGA 2RQSA 2N87A 4ZPVR 1SR0A 1NMVA 4DRKA 5J6EA 4DZ3A 1W1YA 1FKJA 4HBEA 2XP3A 2XP7A 3CHFA 3WKZA 3CHEA 1O6IA 1ITXA 3WD0A 1FJDA 4IT4A 4QT2A 5DITA 1LQ0A 4DRHA 2VCDA 1ZBKA 3FXYA 1GPFA 2UZ5A 4TYOA 1NSGA 3MDYB 3GU0A 2MLZA 2XPBA 1T11A 3UQBA 3LUOA 4IPXA 1HKMA 4TW7A 2WLZA 1QPLA 1F40A 2ZR4A 2F23A 2O92A 1Q6UA 3O5LA 1L1PA 2ITKA 4UDMA 3O5PA 1HJVA 1Y0OA 4QZVB 3UI4A 5HW6A 4ML4A 1PBKA 1IX5A 2PI6A 1HJWA 2MPHA 2IUZA 2O9OA 1KT0A 3GPKA 2MLYA 2LPVA 3TC5A 1FD9A 3NRKA 3O5KA 3AQUA 3NI6A 1EDQA 2OLHA 3IKGA 4FN2A 1E6NA 2M08A 2DSZA 3GTYX 3ARWA 3CZ8A 1QZ2A 3AS1A 4WIWA 3PRDA 4NNRA 5BXJA 2L2SA 2WK2A 2ZQUA 1D6OA 1W9PA 4P8WA 5GPRA 3AS2A 3EIPA 2G41A 3WL0A 4WKAA 2XPAA 4TNSA 2DPEA 5D75A 3RFWA 4LGXA 4U84A 3UF8A 4MSPA 3ARVA 3O5FA 1LJYA 2XP4A 2ZQVA 1ZK6A 1GRJA 1XRVA 2ESCA 2P4VA 4QT3A 1E6RA 5HKGA 4MGVA 2DT2A 4DRIA 1J4IA 2MNTA 3B9AA 3UI6A 1TCOC 1H0IA 1ZU8A 2PPOA 3PRBA 1FKLA 5HTGA 3H9RB 1WAWA 1ZCNA 3WL1A 1HXVA 5DIVA 3WQWA 4ODQA 2A3AA 4MTVA 5I98A 1R9HA 1GUVA 2M1IA 1FKSA 3NTPA 2K8IA 4Z2JA 1BKFA 1RD6A 2F21A 5DO2A 4Z2GA 4JFKA 1F8AB 2DG9A 4W9PA 1VF8A 1UR9A 4DRNA 3IKDA 2YBUA 2PV2A 3CHCA 2LKNA 2PBCA 4XAKA 2FAPA 3UQIA 4NSBA 1FAPA 3G6LA 1FKGA 4DH0A 4JYSA
chains in the Genus database with same CATH topology
4ZS6A 1OGGA 3PR9A 4DIPA 4JFMA 1E15A 1ROTA 1TFVA 2DG3A 2DG4A 4TW8A 4O2TA 3ARUA 1YW5A 5B8IC 5JH8A 2ZQTA 3RGCA 4ODOA 4URIA 4WJXA 3O5RA 2AWGA 3UI5A 3WIJA 1FFQA 4W9OA 1EYMA 3AS0A 4U86A 2F4EA 2XP9A 2XP8A 4TW6A 4MNJA 1NWUA 2KFWA 4P8XA 4S3JA 1ZL1A 3ARRA 4JFLA 3PA7A 2ZQSA 4DWSD 4R5EA 1D2KA 1NWSA 4IQ2A 1FKRA 1WNOA 2WLYA 2MF9A 1D7JA 1FKTA 1ZBVA 4GIVA 4L3NA 1JNEA 4DT4A 4QIBA 3O5DA 3VAWA 4GGQA 4MPKA 3WD1A 1SYTA 1D7IA 4N19A 4DWSB 1W9UA 4R0XA 1HJXA 3ARQA 4ODPA 3RM8A 3JXVA 3PRAA 4ODMA 3CH9A 1WB0A 3KACA 2KR7A 2OFNA 3B8SA 3B9EA 4ODNA 3ODKA 2A3BA 2KO7A 1E6ZA 4G2PA 1M5YA 3KAIA 4BF8A 2YBTA 5HW7A 5DIUA 1EIBA 1JVWA 3O5QA 5HBFA 3ARZA 4DROA 3O5JA 1FKIA 2RUDA 3G6MA 2RSEA 4U85A 3IK8A 3ARSA 3FAPA 1Q6IA 1JNSA 1PINA 1HKKA 2VN1A 5DEZA 4JFIA 4PTMA 2RURA 2PV3A 3OOBA 3RMEA 4KR0B 5HWBA 2DSWA 4HARA 4J4NA 3ARTA 2FKEA 1ZBCA 3WD2A 1UR8A 2KGJA 4DWSC 2KE0A 2Q5AA 4ODKA 4MNMA 4DRJA 1LL6A 1FKFA 1HKIA 3ARXA 1JNDA 4DWSA 1W26A 1GOIA 1ZB5A 2ZR6A 2F2DA 4ODLA 1W1VA 1QPFA 1FKKA 4G50A 3AROA 4Q22A 5GPGA 1FKBA 2MLXA 2PPNA 4JFJA 4S3KA 2RUQA 4DRMA 3CHDA 2DT3A 1J6YA 2WM0A 4P8UA 4DZ2A 1D7HA 2M2AA 2Y78A 1CTNA 2B31A 1J4HA 2JZVA 2QF8A 3WD4A 1C9HA 2RUCA 4MNLA 4ZPTR 4KQZA 1X6NA 1NWTA 4ODRA 1KT1A 3KADA 1YATA 4DRQA 4P8VA 4W5UA 3O5IA 2IF4A 3FY1A 1FKDA 4L72B 1N1AA 1P5QA 3CGNA 4ITZA 3O5GA 2PPPA 1OGBA 4Z2LA 1NWRA 3JYJA 3ARPA 4WKHA 3O5EA 1EQ3A 1K9TA 4MNKA 4DRPA 1ZBWA 3ALGA 4Q7NA 4WKFA 3KABA 4ZPWR 3WQVA 3CGMA 3EY6A 3O5MA 2LGOA 3QOKA 3RM4A 2DSUA 2DSVA 2XP5A 2XP6A 1HKJA 1OWQA 3W4RA 1W1PA 1EHNA 2FDMA 4HBOA 2A3EA 4LAWA 1Q1CA 2D9FA 5HWCA 3AS3A 3I6CA 1BL4A 3TCZA 3TDBA 2DT1A 2AOSA 2PV1A 1ROUA 1LL4A 1JNTA 1W9VA 5GQBA 3KAFA 3UQAA 1LG2A 4LAVA 4MAVA 1NH6A 4Z2HA 4IQCA 3OA5A 4NZCA 4FAPA 1KFWA 1U79A 4J4OA 5DF0A 4LAYA 5HUAA 1LG1A 4Z2IA 1FKHA 3KZ7A 1Q6HA 1NMWA 5HT1A 1E9LA 3WH0A 3B9DA 4AY1A 3KAGA 1A7XA 4IT6A 5HW8A 2ZR5A 1B6CA 4WK9A 3KAHA 3KCEA 1W1TA 1E6PA 4LAXA 2G8ZA 1LL7A 1J4RA 2A3CA 4TX0A 2LJ4A 2KI3A 3BXWA 3RM9A 3WD3A 4Z2KA 3IHZA 1FFRA 1X6LA 2DT0A 4W9QA 3B7XA 3O5OA 3ALFA 3JYMA 4C02B 3ARYA 1H0GA 1XHGA 2RQSA 2N87A 4ZPVR 1SR0A 1NMVA 4DRKA 5J6EA 4DZ3A 1W1YA 1FKJA 4HBEA 2XP3A 2XP7A 3CHFA 3WKZA 3CHEA 1O6IA 1ITXA 3WD0A 1FJDA 4IT4A 4QT2A 5DITA 1LQ0A 4DRHA 2VCDA 1ZBKA 3FXYA 1GPFA 2UZ5A 4TYOA 1NSGA 3MDYB 2MLZA 2XPBA 1T11A 3UQBA 3LUOA 4IPXA 1HKMA 4TW7A 2WLZA 1QPLA 1F40A 2ZR4A 2O92A 1Q6UA 3O5LA 1L1PA 2ITKA 3O5PA 1HJVA 1Y0OA 4QZVB 3UI4A 5HW6A 4ML4A 1PBKA 1IX5A 2PI6A 1HJWA 2MPHA 2IUZA 2O9OA 1KT0A 3GPKA 2MLYA 2LPVA 3TC5A 1FD9A 3NRKA 3O5KA 3AQUA 3NI6A 1EDQA 2OLHA 3IKGA 4FN2A 1E6NA 2M08A 2DSZA 3ARWA 3CZ8A 1QZ2A 3AS1A 4WIWA 3PRDA 4NNRA 5BXJA 2L2SA 2WK2A 2ZQUA 1D6OA 1W9PA 4P8WA 5GPRA 3AS2A 2G41A 3WL0A 4WKAA 2XPAA 4TNSA 2DPEA 5D75A 3RFWA 4LGXA 4U84A 3UF8A 4MSPA 3ARVA 3O5FA 1LJYA 2XP4A 2ZQVA 1ZK6A 1XRVA 2ESCA 4QT3A 1E6RA 5HKGA 4MGVA 2DT2A 4DRIA 1J4IA 2MNTA 3B9AA 3UI6A 1TCOC 1H0IA 1ZU8A 2PPOA 3PRBA 1FKLA 5HTGA 3H9RB 1WAWA 1ZCNA 3WL1A 1HXVA 5DIVA 3WQWA 4ODQA 2A3AA 4MTVA 5I98A 1R9HA 3NTPA 1GUVA 1FKSA 2M1IA 2K8IA 4Z2JA 1BKFA 1RD6A 2F21A 5DO2A 4Z2GA 4JFKA 1F8AB 2DG9A 4W9PA 1VF8A 1UR9A 4DRNA 3IKDA 2YBUA 2PV2A 3CHCA 2LKNA 2PBCA 4XAKA 2FAPA 3UQIA 4NSBA 1FAPA 3G6LA 1FKGA 4DH0A 4JYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWB A;  4J4N A;  2FKE A;  2ZR4 A;  4DIP A;  4JFM A;  1Q1C A;  1Q6U A;  2KGJ A;  1ROT A;  3O5L A;  4LAW A;  2D9F A;  5HWC A;  2DG3 A;  2DG4 A;  2KE0 A;  4TW8 A;  2Q5A A;  2ITK A;  3I6C A;  4ODK A;  4O2T A;  1L1P A;  1BL4 A;  1YW5 A;  3O5P A;  3TCZ A;  4DRJ A;  3TDB A;  2ZQT A;  1FKF A;  3RGC A;  4ODO A;  5B8I C;  1Y0O A;  3O5R A;  3UI4 A;  2AWG A;  5HW6 A;  3UI5 A;  2PV1 A;  1ROU A;  1PBK A;  1W26 A;  1JNT A;  2MPH A;  3GPK A;  1KT0 A;  2ZR6 A;  2F2D A;  3KAF A;  2MLY A;  2LPV A;  3UQA A;  4ODL A;  4W9O A;  1EYM A;  1QPF A;  3TC5 A;  4U86 A;  1FKK A;  2F4E A;  4G50 A;  1FD9 A;  4LAV A;  2XP9 A;  3NRK A;  3O5K A;  2XP8 A;  5GPG A;  3NI6 A;  1FKB A;  2MLX A;  2PPN A;  4TW6 A;  3IKG A;  4FN2 A;  2KFW A;  4IQC A;  4FAP A;  4JFJ A;  1U79 A;  5HUA A;  4J4O A;  2M08 A;  4JFL A;  4LAY A;  2RUQ A;  4DRM A;  1QZ2 A;  2ZQS A;  3PA7 A;  4JYS A;  1FKH A;  3KZ7 A;  1Q6H A;  1J6Y A;  1NMW A;  3PRD A;  4NNR A;  5HT1 A;  5BXJ A;  4DZ2 A;  3WH0 A;  1D7H A;  2L2S A;  2ZQU A;  1D6O A;  2M2A A;  2Y78 A;  3KAG A;  1A7X A;  5HW8 A;  4IQ2 A;  1J4H A;  1B6C A;  2ZR5 A;  2JZV A;  3KAH A;  1FKR A;  1C9H A;  3KCE A;  2MF9 A;  4LAX A;  1D7J A;  1FKT A;  2XPA A;  4GIV A;  4TNS A;  1J4R A;  2RUC A;  5D75 A;  4DT4 A;  4TX0 A;  3RFW A;  4QIB A;  3O5D A;  2LJ4 A;  4U84 A;  3UF8 A;  2KI3 A;  4MSP A;  3O5F A;  3VAW A;  2XP4 A;  4GGQ A;  2ZQV A;  1ZK6 A;  4ODR A;  3IHZ A;  1F40 A;  4QT3 A;  1D7I A;  4N19 A;  4W9Q A;  5HKG A;  3B7X A;  3O5O A;  4R0X A;  4MGV A;  1KT1 A;  3KAD A;  4DRI A;  3JYM A;  4C02 B;  1J4I A;  2MNT A;  1YAT A;  4ODP A;  4DRQ A;  3O5I A;  2IF4 A;  3UI6 A;  1TCO C;  1FKD A;  2N87 A;  2PPO A;  2RQS A;  3JXV A;  3PRB A;  1N1A A;  4ODM A;  1NMV A;  4DRK A;  1FKL A;  3KAC A;  1P5Q A;  2KR7 A;  3CGN A;  4DZ3 A;  5HTG A;  5J6E A;  3H9R B;  4ITZ A;  1FKJ A;  2OFN A;  2PPP A;  3O5G A;  3ODK A;  4ODN A;  1ZCN A;  2KO7 A;  1HXV A;  5DIV A;  4ODQ A;  4G2P A;  2XP3 A;  2XP7 A;  3JYJ A;  5I98 A;  1R9H A;  1M5Y A;  2M1I A;  1FKS A;  3KAI A;  2K8I A;  3NTP A;  4BF8 A;  5HW7 A;  5DIU A;  3O5E A;  1BKF A;  2F21 A;  1FJD A;  1JVW A;  1EQ3 A;  3O5Q A;  4QT2 A;  5DIT A;  4JFK A;  1F8A B;  2DG9 A;  4W9P A;  2VCD A;  4DRO A;  4DRH A;  3O5J A;  1FKI A;  2RUD A;  4DRN A;  4DRP A;  2UZ5 A;  2RSE A;  4TYO A;  1NSG A;  3IK8 A;  4U85 A;  3MDY B;  3IKD A;  3KAB A;  3FAP A;  2MLZ A;  1Q6I A;  2XPB A;  1JNS A;  1PIN A;  2PV2 A;  1T11 A;  3CGM A;  3EY6 A;  2LKN A;  3UQB A;  3O5M A;  3LUO A;  2PBC A;  2LGO A;  2FAP A;  2VN1 A;  4JFI A;  3UQI A;  1FAP A;  2XP5 A;  1FKG A;  4IPX A;  4DH0 A;  2XP6 A;  4TW7 A;  2RUR A;  2PV3 A;  3OOB A;  1QPL A; 
#chains in the Genus database with same CATH topology
 4ZS6 A;  1OGG A;  3PR9 A;  4DIP A;  4JFM A;  1E15 A;  1ROT A;  1TFV A;  2DG3 A;  2DG4 A;  4TW8 A;  4O2T A;  3ARU A;  1YW5 A;  5B8I C;  5JH8 A;  2ZQT A;  3RGC A;  4ODO A;  4URI A;  4WJX A;  3O5R A;  2AWG A;  3UI5 A;  3WIJ A;  2ETN A;  1FFQ A;  4W9O A;  1EYM A;  3AS0 A;  4U86 A;  2F4E A;  2XP9 A;  2XP8 A;  4TW6 A;  4MNJ A;  1NWU A;  2KFW A;  4P8X A;  4S3J A;  1ZL1 A;  3ARR A;  1E44 A;  4JFL A;  3PA7 A;  2ZQS A;  4DWS D;  4R5E A;  1D2K A;  1NWS A;  4IQ2 A;  1FKR A;  1WNO A;  2WLY A;  2MF9 A;  2B5U B;  1D7J A;  1FKT A;  1ZBV A;  4GIV A;  4L3N A;  1JNE A;  4DT4 A;  4QIB A;  3O5D A;  3VAW A;  4GGQ A;  4MPK A;  3WD1 A;  1SYT A;  1D7I A;  4N19 A;  4DWS B;  1W9U A;  4R0X A;  1HJX A;  3ARQ A;  4ODP A;  3RM8 A;  3JXV A;  3PRA A;  4ODM A;  3CH9 A;  1WB0 A;  3KAC A;  2KR7 A;  2OFN A;  3B8S A;  3B9E A;  4ODN A;  3ODK A;  2A3B A;  2KO7 A;  1E6Z A;  4G2P A;  1M5Y A;  3KAI A;  4BF8 A;  2YBT A;  5HW7 A;  5DIU A;  1EIB A;  1JVW A;  3O5Q A;  5HBF A;  3ARZ A;  4DRO A;  3O5J A;  1FKI A;  2RUD A;  3G6M A;  2RSE A;  4U85 A;  3IK8 A;  3ARS A;  3FAP A;  1Q6I A;  1JNS A;  1PIN A;  1HKK A;  2VN1 A;  5DEZ A;  4JFI A;  4PTM A;  2RUR A;  2PV3 A;  3OOB A;  3RME A;  3BMB A;  4KR0 B;  5HWB A;  2DSW A;  4HAR A;  4J4N A;  3ART A;  2FKE A;  1ZBC A;  3WD2 A;  1UR8 A;  2KGJ A;  4DWS C;  2KE0 A;  2Q5A A;  4ODK A;  4MNM A;  4DRJ A;  1LL6 A;  1FKF A;  1HKI A;  3ARX A;  1JND A;  4DWS A;  1W26 A;  1GOI A;  1ZB5 A;  2ZR6 A;  2F2D A;  4ODL A;  1W1V A;  1QPF A;  1FKK A;  4G50 A;  3ARO A;  4Q22 A;  5GPG A;  1FKB A;  2MLX A;  2PPN A;  4JFJ A;  4S3K A;  2RUQ A;  4DRM A;  3CHD A;  2DT3 A;  1J6Y A;  2WM0 A;  4P8U A;  4DZ2 A;  1D7H A;  2M2A A;  2Y78 A;  1CTN A;  2B31 A;  1J4H A;  2JZV A;  2QF8 A;  3WD4 A;  1C9H A;  2RUC A;  4MNL A;  4ZPT R;  4KQZ A;  1X6N A;  1NWT A;  4ODR A;  1KT1 A;  3KAD A;  1YAT A;  4DRQ A;  4P8V A;  4W5U A;  3O5I A;  2IF4 A;  3FY1 A;  1FKD A;  4L72 B;  1N1A A;  1P5Q A;  3CGN A;  4ITZ A;  3O5G A;  2PPP A;  1OGB A;  4Z2L A;  1NWR A;  3JYJ A;  3ARP A;  4WKH A;  3O5E A;  1EQ3 A;  1K9T A;  2EUL A;  4MNK A;  4DRP A;  1ZBW A;  3ALG A;  4Q7N A;  4WKF A;  3KAB A;  4ZPW R;  3WQV A;  3CGM A;  3EY6 A;  3O5M A;  2LGO A;  3QOK A;  3RM4 A;  2DSU A;  2DSV A;  2XP5 A;  2XP6 A;  1HKJ A;  1OWQ A;  3W4R A;  1W1P A;  1EHN A;  2FDM A;  4HBO A;  2A3E A;  4LAW A;  1Q1C A;  2D9F A;  5HWC A;  3AS3 A;  3I6C A;  1BL4 A;  3TCZ A;  3TDB A;  2DT1 A;  2AOS A;  2PV1 A;  1ROU A;  1LL4 A;  1JNT A;  1W9V A;  5GQB A;  3KAF A;  3UQA A;  1LG2 A;  4LAV A;  4MAV A;  1NH6 A;  4Z2H A;  4IQC A;  3OA5 A;  4NZC A;  4FAP A;  1KFW A;  1U79 A;  4J4O A;  5DF0 A;  4LAY A;  5HUA A;  1LG1 A;  4Z2I A;  1FKH A;  3KZ7 A;  1Q6H A;  1NMW A;  5HT1 A;  1E9L A;  3WH0 A;  3B9D A;  4AY1 A;  3KAG A;  1A7X A;  4IT6 A;  5HW8 A;  2ZR5 A;  1B6C A;  4WK9 A;  3KAH A;  3KCE A;  1W1T A;  1E6P A;  4LAX A;  2G8Z A;  1LL7 A;  1J4R A;  2A3C A;  4TX0 A;  2PN0 A;  2LJ4 A;  2KI3 A;  3BXW A;  3RM9 A;  3WD3 A;  4Z2K A;  3IHZ A;  1FFR A;  1X6L A;  2DT0 A;  4W9Q A;  3B7X A;  3O5O A;  3ALF A;  3JYM A;  4C02 B;  1JCH B;  3ARY A;  1H0G A;  1XHG A;  2RQS A;  2N87 A;  4ZPV R;  1SR0 A;  1NMV A;  4DRK A;  5J6E A;  4DZ3 A;  1W1Y A;  1FKJ A;  4HBE A;  2XP3 A;  2XP7 A;  3CHF A;  3WKZ A;  3CHE A;  1O6I A;  1ITX A;  3WD0 A;  1FJD A;  4IT4 A;  4QT2 A;  5DIT A;  1LQ0 A;  4DRH A;  2VCD A;  1ZBK A;  3FXY A;  1GPF A;  2UZ5 A;  4TYO A;  1NSG A;  3MDY B;  3GU0 A;  2MLZ A;  2XPB A;  1T11 A;  3UQB A;  3LUO A;  4IPX A;  1HKM A;  4TW7 A;  2WLZ A;  1QPL A;  1F40 A;  2ZR4 A;  2F23 A;  2O92 A;  1Q6U A;  3O5L A;  1L1P A;  2ITK A;  4UDM A;  3O5P A;  1HJV A;  1Y0O A;  4QZV B;  3UI4 A;  5HW6 A;  4ML4 A;  1PBK A;  1IX5 A;  2PI6 A;  1HJW A;  2MPH A;  2IUZ A;  2O9O A;  1KT0 A;  3GPK A;  2MLY A;  2LPV A;  3TC5 A;  1FD9 A;  3NRK A;  3O5K A;  3AQU A;  3NI6 A;  1EDQ A;  2OLH A;  3IKG A;  4FN2 A;  1E6N A;  2M08 A;  2DSZ A;  3GTY X;  3ARW A;  3CZ8 A;  1QZ2 A;  3AS1 A;  4WIW A;  3PRD A;  4NNR A;  5BXJ A;  2L2S A;  2WK2 A;  2ZQU A;  1D6O A;  1W9P A;  4P8W A;  5GPR A;  3AS2 A;  3EIP A;  2G41 A;  3WL0 A;  4WKA A;  2XPA A;  4TNS A;  2DPE A;  5D75 A;  3RFW A;  4LGX A;  4U84 A;  3UF8 A;  4MSP A;  3ARV A;  3O5F A;  1LJY A;  2XP4 A;  2ZQV A;  1ZK6 A;  1GRJ A;  1XRV A;  2ESC A;  2P4V A;  4QT3 A;  1E6R A;  5HKG A;  4MGV A;  2DT2 A;  4DRI A;  1J4I A;  2MNT A;  3B9A A;  3UI6 A;  1TCO C;  1H0I A;  1ZU8 A;  2PPO A;  3PRB A;  1FKL A;  5HTG A;  3H9R B;  1WAW A;  1ZCN A;  3WL1 A;  1HXV A;  5DIV A;  3WQW A;  4ODQ A;  2A3A A;  4MTV A;  5I98 A;  1R9H A;  1GUV A;  2M1I A;  1FKS A;  3NTP A;  2K8I A;  4Z2J A;  1BKF A;  1RD6 A;  2F21 A;  5DO2 A;  4Z2G A;  4JFK A;  1F8A B;  2DG9 A;  4W9P A;  1VF8 A;  1UR9 A;  4DRN A;  3IKD A;  2YBU A;  2PV2 A;  3CHC A;  2LKN A;  2PBC A;  4XAK A;  2FAP A;  3UQI A;  4NSB A;  1FAP A;  3G6L A;  1FKG A;  4DH0 A;  4JYS A; 
#chains in the Genus database with same CATH homology
 4ZS6 A;  1OGG A;  3PR9 A;  4DIP A;  4JFM A;  1E15 A;  1ROT A;  1TFV A;  2DG3 A;  2DG4 A;  4TW8 A;  4O2T A;  3ARU A;  1YW5 A;  5B8I C;  5JH8 A;  2ZQT A;  3RGC A;  4ODO A;  4URI A;  4WJX A;  3O5R A;  2AWG A;  3UI5 A;  3WIJ A;  1FFQ A;  4W9O A;  1EYM A;  3AS0 A;  4U86 A;  2F4E A;  2XP9 A;  2XP8 A;  4TW6 A;  4MNJ A;  1NWU A;  2KFW A;  4P8X A;  4S3J A;  1ZL1 A;  3ARR A;  4JFL A;  3PA7 A;  2ZQS A;  4DWS D;  4R5E A;  1D2K A;  1NWS A;  4IQ2 A;  1FKR A;  1WNO A;  2WLY A;  2MF9 A;  1D7J A;  1FKT A;  1ZBV A;  4GIV A;  4L3N A;  1JNE A;  4DT4 A;  4QIB A;  3O5D A;  3VAW A;  4GGQ A;  4MPK A;  3WD1 A;  1SYT A;  1D7I A;  4N19 A;  4DWS B;  1W9U A;  4R0X A;  1HJX A;  3ARQ A;  4ODP A;  3RM8 A;  3JXV A;  3PRA A;  4ODM A;  3CH9 A;  1WB0 A;  3KAC A;  2KR7 A;  2OFN A;  3B8S A;  3B9E A;  4ODN A;  3ODK A;  2A3B A;  2KO7 A;  1E6Z A;  4G2P A;  1M5Y A;  3KAI A;  4BF8 A;  2YBT A;  5HW7 A;  5DIU A;  1EIB A;  1JVW A;  3O5Q A;  5HBF A;  3ARZ A;  4DRO A;  3O5J A;  1FKI A;  2RUD A;  3G6M A;  2RSE A;  4U85 A;  3IK8 A;  3ARS A;  3FAP A;  1Q6I A;  1JNS A;  1PIN A;  1HKK A;  2VN1 A;  5DEZ A;  4JFI A;  4PTM A;  2RUR A;  2PV3 A;  3OOB A;  3RME A;  4KR0 B;  5HWB A;  2DSW A;  4HAR A;  4J4N A;  3ART A;  2FKE A;  1ZBC A;  3WD2 A;  1UR8 A;  2KGJ A;  4DWS C;  2KE0 A;  2Q5A A;  4ODK A;  4MNM A;  4DRJ A;  1LL6 A;  1FKF A;  1HKI A;  3ARX A;  1JND A;  4DWS A;  1W26 A;  1GOI A;  1ZB5 A;  2ZR6 A;  2F2D A;  4ODL A;  1W1V A;  1QPF A;  1FKK A;  4G50 A;  3ARO A;  4Q22 A;  5GPG A;  1FKB A;  2MLX A;  2PPN A;  4JFJ A;  4S3K A;  2RUQ A;  4DRM A;  3CHD A;  2DT3 A;  1J6Y A;  2WM0 A;  4P8U A;  4DZ2 A;  1D7H A;  2M2A A;  2Y78 A;  1CTN A;  2B31 A;  1J4H A;  2JZV A;  2QF8 A;  3WD4 A;  1C9H A;  2RUC A;  4MNL A;  4ZPT R;  4KQZ A;  1X6N A;  1NWT A;  4ODR A;  1KT1 A;  3KAD A;  1YAT A;  4DRQ A;  4P8V A;  4W5U A;  3O5I A;  2IF4 A;  3FY1 A;  1FKD A;  4L72 B;  1N1A A;  1P5Q A;  3CGN A;  4ITZ A;  3O5G A;  2PPP A;  1OGB A;  4Z2L A;  1NWR A;  3JYJ A;  3ARP A;  4WKH A;  3O5E A;  1EQ3 A;  1K9T A;  4MNK A;  4DRP A;  1ZBW A;  3ALG A;  4Q7N A;  4WKF A;  3KAB A;  4ZPW R;  3WQV A;  3CGM A;  3EY6 A;  3O5M A;  2LGO A;  3QOK A;  3RM4 A;  2DSU A;  2DSV A;  2XP5 A;  2XP6 A;  1HKJ A;  1OWQ A;  3W4R A;  1W1P A;  1EHN A;  2FDM A;  4HBO A;  2A3E A;  4LAW A;  1Q1C A;  2D9F A;  5HWC A;  3AS3 A;  3I6C A;  1BL4 A;  3TCZ A;  3TDB A;  2DT1 A;  2AOS A;  2PV1 A;  1ROU A;  1LL4 A;  1JNT A;  1W9V A;  5GQB A;  3KAF A;  3UQA A;  1LG2 A;  4LAV A;  4MAV A;  1NH6 A;  4Z2H A;  4IQC A;  3OA5 A;  4NZC A;  4FAP A;  1KFW A;  1U79 A;  4J4O A;  5DF0 A;  4LAY A;  5HUA A;  1LG1 A;  4Z2I A;  1FKH A;  3KZ7 A;  1Q6H A;  1NMW A;  5HT1 A;  1E9L A;  3WH0 A;  3B9D A;  4AY1 A;  3KAG A;  1A7X A;  4IT6 A;  5HW8 A;  2ZR5 A;  1B6C A;  4WK9 A;  3KAH A;  3KCE A;  1W1T A;  1E6P A;  4LAX A;  2G8Z A;  1LL7 A;  1J4R A;  2A3C A;  4TX0 A;  2LJ4 A;  2KI3 A;  3BXW A;  3RM9 A;  3WD3 A;  4Z2K A;  3IHZ A;  1FFR A;  1X6L A;  2DT0 A;  4W9Q A;  3B7X A;  3O5O A;  3ALF A;  3JYM A;  4C02 B;  3ARY A;  1H0G A;  1XHG A;  2RQS A;  2N87 A;  4ZPV R;  1SR0 A;  1NMV A;  4DRK A;  5J6E A;  4DZ3 A;  1W1Y A;  1FKJ A;  4HBE A;  2XP3 A;  2XP7 A;  3CHF A;  3WKZ A;  3CHE A;  1O6I A;  1ITX A;  3WD0 A;  1FJD A;  4IT4 A;  4QT2 A;  5DIT A;  1LQ0 A;  4DRH A;  2VCD A;  1ZBK A;  3FXY A;  1GPF A;  2UZ5 A;  4TYO A;  1NSG A;  3MDY B;  2MLZ A;  2XPB A;  1T11 A;  3UQB A;  3LUO A;  4IPX A;  1HKM A;  4TW7 A;  2WLZ A;  1QPL A;  1F40 A;  2ZR4 A;  2O92 A;  1Q6U A;  3O5L A;  1L1P A;  2ITK A;  3O5P A;  1HJV A;  1Y0O A;  4QZV B;  3UI4 A;  5HW6 A;  4ML4 A;  1PBK A;  1IX5 A;  2PI6 A;  1HJW A;  2MPH A;  2IUZ A;  2O9O A;  1KT0 A;  3GPK A;  2MLY A;  2LPV A;  3TC5 A;  1FD9 A;  3NRK A;  3O5K A;  3AQU A;  3NI6 A;  1EDQ A;  2OLH A;  3IKG A;  4FN2 A;  1E6N A;  2M08 A;  2DSZ A;  3ARW A;  3CZ8 A;  1QZ2 A;  3AS1 A;  4WIW A;  3PRD A;  4NNR A;  5BXJ A;  2L2S A;  2WK2 A;  2ZQU A;  1D6O A;  1W9P A;  4P8W A;  5GPR A;  3AS2 A;  2G41 A;  3WL0 A;  4WKA A;  2XPA A;  4TNS A;  2DPE A;  5D75 A;  3RFW A;  4LGX A;  4U84 A;  3UF8 A;  4MSP A;  3ARV A;  3O5F A;  1LJY A;  2XP4 A;  2ZQV A;  1ZK6 A;  1XRV A;  2ESC A;  4QT3 A;  1E6R A;  5HKG A;  4MGV A;  2DT2 A;  4DRI A;  1J4I A;  2MNT A;  3B9A A;  3UI6 A;  1TCO C;  1H0I A;  1ZU8 A;  2PPO A;  3PRB A;  1FKL A;  5HTG A;  3H9R B;  1WAW A;  1ZCN A;  3WL1 A;  1HXV A;  5DIV A;  3WQW A;  4ODQ A;  2A3A A;  4MTV A;  5I98 A;  1R9H A;  3NTP A;  1GUV A;  1FKS A;  2M1I A;  2K8I A;  4Z2J A;  1BKF A;  1RD6 A;  2F21 A;  5DO2 A;  4Z2G A;  4JFK A;  1F8A B;  2DG9 A;  4W9P A;  1VF8 A;  1UR9 A;  4DRN A;  3IKD A;  2YBU A;  2PV2 A;  3CHC A;  2LKN A;  2PBC A;  4XAK A;  2FAP A;  3UQI A;  4NSB A;  1FAP A;  3G6L A;  1FKG A;  4DH0 A;  4JYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...