4JFIA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound 1-[(9s,13r,13ar)-1,3-dimethoxy-8-oxo-5,8,9,10,11,12,13,13a-octahydro-6h-9,13-epiminoazocino[2,1-a]isoquinolin-14-yl]-2-(3,4,5-trimethoxyphenyl)ethane-1,2-dione
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 35
structure length 127
sequence length 127
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfiA00
2ZR4A 3O5MA 2RQSA 3KAGA 3TCZA 3UQBA 1YATA 3H9RB 1ROTA 2F4EA 2RUDA 2XP5A 3ODKA 3I6CA 4TYOA 3WH0A 3O5LA 4W9QA 2PPNA 4U84A 2XPBA 1EYMA 1FKRA 4IQ2A 4ODMA 1Q6UA 4TW7A 2XP9A 4JYSA 4DRNA 4DRPA 3UQIA 1FAPA 4ODLA 4DRIA 3O5FA 4DROA 1B6CA 1NMVA 3B7XA 1C9HA 2DG3A 1R9HA 3JYMA 3KZ7A 4R0XA 4U86A 3IHZA 2M2AA 5J6EA 3PRDA 4IPXA 3UI5A 2ZR5A 4QT2A 1J4IA 4DZ2A 2KI3A 4DZ3A 3KACA 2LJ4A 2MLYA 3O5JA 4ODQA 1FKLA 3RGCA 2IF4A 3PA7A 1Q1CA 1JVWA 2MPHA 1A7XA 1Q6IA 1FJDA 5B8IC 1ZK6A 2ZR6A 2M1IA 2PBCA 2M08A 2PPOA 1T11A 3VAWA 2MNTA 5HWBA 1ROUA 4FAPA 5D75A 3O5EA 3NTPA 2JZVA 3NRKA 5HUAA 5DIUA 1N1AA 1YW5A 3TC5A 3UI6A 4O2TA 3UF8A 1JNTA 2LPVA 1ZCNA 3NI6A 4BF8A 4DIPA 4G2PA 4DRJA 2UZ5A 1M5YA 2VCDA 5HW7A 1FKKA 5GPGA 1F40A 5BXJA 4C02B 1FKDA 3JYJA 2DG4A 2PV3A 3JXVA 1PBKA 4G50A 1D7HA 1FKJA 4LAYA 2VN1A 2OFNA 4DT4A 4GGQA 3KADA 2PV1A 2ZQUA 4TW6A 2MLXA 4DRHA 2KE0A 2XP8A 3O5KA 4DRMA 1QZ2A 1FKFA 3O5PA 4JFLA 1FD9A 1QPFA 3UI4A 5I98A 4ODRA 1EQ3A 1J4RA 2LGOA 2XP6A 1P5QA 2L2SA 4QT3A 4GIVA 4DH0A 5DITA 4TX0A 1FKIA 3KAFA 3IK8A 2K8IA 1D6OA 2D9FA 4ODKA 1W26A 1TCOC 2ZQTA 4W9PA 1FKTA 2FKEA 2RURA 2MF9A 2XP4A 4DRKA 1U79A 2LKNA 4LAVA 5HWCA 5HW6A 2F21A 3PRBA 1J4HA 1JNSA 1KT1A 1FKBA 3O5IA 4IQCA 4W9OA 2MLZA 1FKGA 3RFWA 3O5GA 5HKGA 4ITZA 2N87A 4TW8A 2RSEA 4JFJA 3FAPA 2KFWA 5HT1A 1NSGA 3O5QA 1NMWA 2KGJA 3O5DA 3TDBA 2DG9A 1KT0A 2FAPA 2F2DA 4QIBA 3O5OA 5HTGA 4JFIA 3KAHA 5DIVA 1F8AB 2ITKA 4ODOA 4J4NA 1BL4A 3KCEA 1QPLA 4JFMA 2ZQVA 3KABA 1Y0OA 2XP3A 1BKFA 1Q6HA 3EY6A 1D7IA 4LAXA 1J6YA 2Q5AA 2Y78A 3IKDA 4DRQA 2AWGA 3CGMA 4FN2A 4JFKA 3UQAA 3O5RA 2RUQA 3IKGA 1D7JA 2KO7A 2PV2A 3LUOA 4ODPA 1FKSA 1PINA 2KR7A 3GPKA 2XPAA 4MGVA 4N19A 2ZQSA 4ODNA 3MDYB 4TNSA 4J4OA 2PPPA 4LAWA 2XP7A 4MSPA 3KAIA 4NNRA 5HW8A 3CGNA 1HXVA 4U85A 3OOBA 1L1PA 1FKHA 2RUCA
chains in the Genus database with same CATH superfamily
3EIPA 1ROTA 2RUDA 3I6CA 2OLHA 4U84A 2XPBA 1FKRA 4ODMA 1Q6UA 3RM9A 2YBUA 3UQIA 3ARRA 3B7XA 4U86A 1R9HA 3KZ7A 4IPXA 3G6LA 3B9EA 3KACA 3O5JA 2IF4A 1Q1CA 3PRAA 3RM8A 5B8IC 2ZR6A 1X6NA 1W1PA 1E15A 4FAPA 1W9VA 2JZVA 3NRKA 1E6PA 5HUAA 5DIUA 3ARYA 3UF8A 3W4RA 2LPVA 4BF8A 1OGBA 1M5YA 1LG2A 3BXWA 4DWSB 1HKJA 1D7HA 2P4VA 3WL0A 5DF0A 2OFNA 3GU0A 4GGQA 4DT4A 3B9AA 3KADA 4Z2LA 2ZQUA 2YBTA 3CZ8A 5HBFA 3O5KA 1FD9A 1QPFA 3WD0A 1E6NA 4DH0A 4MTVA 2D9FA 4NSBA 2ZQTA 4Q7NA 4W9PA 1FKTA 2FKEA 4IT6A 1E6RA 5DO2A 2LKNA 2O9OA 4L72B 2F21A 4HBOA 4WK9A 4IQCA 1FKBA 3O5IA 4P8VA 3WIJA 3O5GA 1WB0A 4KQZA 5HKGA 4ITZA 3FAPA 3WQWA 4HBEA 3O5QA 4QIBA 5HTGA 2WM0A 4L3NA 3AS1A 2ITKA 4J4NA 2QF8A 1BL4A 1JNDA 1BKFA 5DEZA 2PV2A 2KR7A 2DSUA 4ZS6A 2A3BA 3MDYB 2XP7A 3ARPA 3G6MA 4NNRA 3CGNA 1NWRA 2DT0A 4ZPWR 1FKHA 3O5MA 2XP5A 1LG1A 1CTNA 3O5LA 2PPNA 1EYMA 4IQ2A 4TW7A 4MNJA 3RM4A 4MNKA 1HJVA 1C9HA 2DG3A 5J6EA 3CHFA 4MPKA 4DZ3A 1W1TA 4HARA 3ARTA 1JVWA 2MPHA 1KFWA 1A7XA 4LGXA 1ZK6A 2PBCA 5HWBA 2PPOA 1T11A 2MNTA 2WLZA 1LJYA 4UDMA 3UI6A 4O2TA 3WKZA 1JNTA 3CHCA 4W5UA 1UR8A 3NI6A 4G2PA 4DRJA 4ZPVR 1ITXA 5BXJA 1FKDA 3JYJA 1O6IA 2PV3A 1XRVA 1GRJA 4DRHA 2G8ZA 3WD2A 1NH6A 1QZ2A 3AS0A 4ODRA 1EQ3A 2XP6A 1NWSA 2LGOA 5DITA 4TX0A 1W26A 2XP4A 4S3KA 4P8WA 1KT1A 4W9OA 3RFWA 3ARSA 2N87A 1ZBCA 2B5UB 2KFWA 4S3JA 2DG9A 1KT0A 2FAPA 5GPRA 2F2DA 1EDQA 3PR9A 3CHEA 1W1YA 5DIVA 4URIA 1QPLA 4JFMA 2ZQVA 3B9DA 1Y0OA 3EY6A 1D7IA 1J6YA 2Q5AA 3IKDA 4P8XA 4JFKA 3AS2A 2KO7A 3LUOA 1FKSA 1HJXA 1PINA 4MGVA 2XPAA 3WD3A 5HW8A 3RMEA 1OGGA 4U85A 4LAVA 1SYTA 2A3AA 3UQBA 1LL7A 1YATA 1UR9A 4TYOA 1W9UA 4W9QA 1GPFA 4DRNA 4DRPA 1E44A 3WL1A 4DRIA 3O5FA 1B6CA 1NMVA 4Z2JA 1NWTA 3QOKA 1E9LA 2M2AA 4WJXA 3UI5A 2ZR5A 4AY1A 4WKFA 4DZ2A 4ODQA 1Q6IA 1FJDA 1HKKA 2M1IA 4Z2HA 2M08A 1ROUA 2ETNA 5D75A 3O5EA 3NTPA 1YW5A 2A3EA 3GTYX 1TFVA 2VCDA 5GPGA 3ARWA 4C02B 2DG4A 1PBKA 4DWSD 4G50A 4LAYA 1WNOA 2MLXA 5JH8A 2F23A 4DRMA 1EIBA 3O5PA 4JFLA 3UI4A 5I98A 1VF8A 2L2SA 4QT3A 3KAFA 2K8IA 1TCOC 2EULA 3WQVA 2IUZA 1IX5A 2MF9A 4DRKA 1ZBVA 2O92A 3PRBA 1J4HA 1FKGA 2RSEA 4JFJA 4QZVB 4Q22A 1OWQA 1NSGA 1NMWA 1E6ZA 4MAVA 2B31A 3KAHA 3WD1A 4ML4A 3KABA 1JCHB 4WIWA 4LAXA 2PI6A 3AROA 4DRQA 4FN2A 2RUQA 3IKGA 1D7JA 1HKMA 3GPKA 4N19A 2AOSA 4TNSA 1D2KA 4LAWA 3KAIA 1HXVA 3AS3A 4IT4A 3OOBA 2RUCA 2ZR4A 2RQSA 3KAGA 3TCZA 5GQBA 3WD4A 3H9RB 2F4EA 2FDMA 3ODKA 3FY1A 3WH0A 1FFQA 2DSVA 3AQUA 4MNMA 4ZPTR 2XP9A 4JYSA 2DSWA 1FAPA 4ODLA 4DROA 4R0XA 3JYMA 3IHZA 1HJWA 3PRDA 3ARZA 4QT2A 3BMBA 1J4IA 2KI3A 2LJ4A 2MLYA 1W1VA 4NZCA 1FKLA 3RGCA 3PA7A 3B8SA 3VAWA 4WKHA 1HKIA 4P8UA 3ARXA 1N1AA 3TC5A 4PTMA 1JNEA 1RD6A 2ESCA 1ZBWA 1X6LA 1ZCNA 4MNLA 4DIPA 4Z2IA 2DPEA 2UZ5A 1F40A 5HW7A 1FKKA 2DT3A 1H0IA 1ZL1A 2G41A 3JXVA 1ZBKA 1FKJA 2VN1A 3ARVA 1W9PA 4Z2KA 3OA5A 2DT2A 1H0GA 2PV1A 1LL4A 4TW6A 2KE0A 3CHDA 2XP8A 1FKFA 2WLYA 1XHGA 2PN0A 1J4RA 2DSZA 1P5QA 4R5EA 4GIVA 1FKIA 3IK8A 4KR0B 3FXYA 1D6OA 4ODKA 2RURA 1U79A 2DT1A 5HWCA 5HW6A 3ARQA 3CH9A 1JNSA 4DWSA 4WKAA 2MLZA 2A3CA 4TW8A 5HT1A 3O5DA 1NWUA 2KGJA 3TDBA 1LL6A 1EHNA 2WK2A 3O5OA 1GOIA 4JFIA 4DWSC 1F8AB 4ODOA 3KCEA 1SR0A 2XP3A 1ZB5A 4XAKA 1Q6HA 1ZU8A 3ALFA 2Y78A 2AWGA 3CGMA 3UQAA 3O5RA 1K9TA 1FFRA 4ODPA 4Z2GA 1LQ0A 2ZQSA 4ODNA 1GUVA 2PPPA 4MSPA 1WAWA 3ARUA 3ALGA 1L1PA 4J4OA
chains in the Genus database with same CATH topology
1ROTA 2RUDA 3I6CA 2OLHA 4U84A 2XPBA 1FKRA 4ODMA 1Q6UA 3RM9A 2YBUA 3UQIA 3ARRA 3B7XA 4U86A 1R9HA 3KZ7A 4IPXA 3G6LA 3B9EA 3KACA 3O5JA 2IF4A 1Q1CA 3PRAA 3RM8A 5B8IC 2ZR6A 1X6NA 1W1PA 1E15A 4FAPA 1W9VA 2JZVA 3NRKA 1E6PA 5HUAA 5DIUA 3ARYA 3UF8A 3W4RA 2LPVA 4BF8A 1OGBA 1M5YA 1LG2A 3BXWA 4DWSB 1HKJA 1D7HA 3WL0A 5DF0A 2OFNA 4DT4A 4GGQA 3B9AA 3KADA 4Z2LA 2ZQUA 2YBTA 3CZ8A 5HBFA 3O5KA 1FD9A 1QPFA 3WD0A 1E6NA 4DH0A 4MTVA 2D9FA 4NSBA 2ZQTA 4Q7NA 4W9PA 1FKTA 2FKEA 4IT6A 1E6RA 5DO2A 2LKNA 2O9OA 4L72B 2F21A 4HBOA 4WK9A 4IQCA 1FKBA 3O5IA 4P8VA 3WIJA 3O5GA 1WB0A 4KQZA 5HKGA 4ITZA 3FAPA 3WQWA 4HBEA 3O5QA 4QIBA 5HTGA 2WM0A 4L3NA 3AS1A 2ITKA 4J4NA 2QF8A 1BL4A 1JNDA 1BKFA 5DEZA 2PV2A 2KR7A 2DSUA 4ZS6A 2A3BA 3MDYB 2XP7A 3ARPA 3G6MA 4NNRA 3CGNA 1NWRA 2DT0A 4ZPWR 1FKHA 3O5MA 2XP5A 1LG1A 1CTNA 3O5LA 2PPNA 1EYMA 4IQ2A 4TW7A 4MNJA 3RM4A 4MNKA 1HJVA 1C9HA 2DG3A 5J6EA 3CHFA 4MPKA 4DZ3A 1W1TA 4HARA 3ARTA 1JVWA 2MPHA 1KFWA 1A7XA 4LGXA 1ZK6A 2PBCA 5HWBA 2PPOA 1T11A 2MNTA 2WLZA 1LJYA 3UI6A 4O2TA 3WKZA 1JNTA 3CHCA 4W5UA 1UR8A 3NI6A 4G2PA 4DRJA 4ZPVR 1ITXA 5BXJA 1FKDA 3JYJA 1O6IA 2PV3A 1XRVA 4DRHA 2G8ZA 3WD2A 1NH6A 1QZ2A 3AS0A 4ODRA 1EQ3A 2XP6A 1NWSA 2LGOA 5DITA 4TX0A 1W26A 2XP4A 4S3KA 4P8WA 1KT1A 4W9OA 3RFWA 3ARSA 2N87A 1ZBCA 2KFWA 4S3JA 2DG9A 1KT0A 2FAPA 5GPRA 2F2DA 1EDQA 3PR9A 3CHEA 1W1YA 5DIVA 4URIA 1QPLA 4JFMA 2ZQVA 3B9DA 1Y0OA 3EY6A 1D7IA 1J6YA 2Q5AA 3IKDA 4P8XA 4JFKA 3AS2A 2KO7A 3LUOA 1FKSA 1HJXA 1PINA 4MGVA 2XPAA 3WD3A 5HW8A 3RMEA 1OGGA 4U85A 4LAVA 1SYTA 2A3AA 3UQBA 1LL7A 1YATA 1UR9A 4TYOA 1W9UA 4W9QA 1GPFA 4DRNA 4DRPA 3WL1A 4DRIA 3O5FA 1B6CA 1NMVA 4Z2JA 1NWTA 3QOKA 1E9LA 2M2AA 4WJXA 3UI5A 2ZR5A 4AY1A 4WKFA 4DZ2A 4ODQA 1Q6IA 1FJDA 1HKKA 2M1IA 4Z2HA 2M08A 1ROUA 5D75A 3O5EA 3NTPA 1YW5A 2A3EA 1TFVA 2VCDA 5GPGA 3ARWA 4C02B 2DG4A 1PBKA 4DWSD 4G50A 4LAYA 1WNOA 2MLXA 5JH8A 4DRMA 1EIBA 3O5PA 4JFLA 3UI4A 5I98A 1VF8A 2L2SA 4QT3A 3KAFA 2K8IA 1TCOC 3WQVA 2IUZA 1IX5A 2MF9A 4DRKA 1ZBVA 2O92A 3PRBA 1J4HA 1FKGA 2RSEA 4JFJA 4QZVB 4Q22A 1OWQA 1NSGA 1NMWA 1E6ZA 4MAVA 2B31A 3KAHA 3WD1A 4ML4A 3KABA 4WIWA 4LAXA 2PI6A 3AROA 4DRQA 4FN2A 2RUQA 3IKGA 1D7JA 1HKMA 3GPKA 4N19A 2AOSA 4TNSA 1D2KA 4LAWA 3KAIA 1HXVA 3AS3A 4IT4A 3OOBA 2RUCA 2ZR4A 2RQSA 3KAGA 3TCZA 5GQBA 3WD4A 3H9RB 2F4EA 2FDMA 3ODKA 3FY1A 3WH0A 1FFQA 2DSVA 3AQUA 4MNMA 4ZPTR 2XP9A 4JYSA 2DSWA 1FAPA 4ODLA 4DROA 4R0XA 3JYMA 3IHZA 1HJWA 3PRDA 3ARZA 4QT2A 1J4IA 2KI3A 2LJ4A 2MLYA 1W1VA 4NZCA 1FKLA 3RGCA 3PA7A 3B8SA 3VAWA 4WKHA 1HKIA 4P8UA 3ARXA 1N1AA 3TC5A 4PTMA 1JNEA 1RD6A 2ESCA 1ZBWA 1X6LA 1ZCNA 4MNLA 4DIPA 4Z2IA 2DPEA 2UZ5A 1F40A 5HW7A 1FKKA 2DT3A 1H0IA 1ZL1A 2G41A 3JXVA 1ZBKA 1FKJA 2VN1A 3ARVA 1W9PA 4Z2KA 3OA5A 2DT2A 1H0GA 2PV1A 1LL4A 4TW6A 2KE0A 3CHDA 2XP8A 1FKFA 2WLYA 1XHGA 1J4RA 2DSZA 1P5QA 4R5EA 4GIVA 1FKIA 3IK8A 4KR0B 3FXYA 1D6OA 4ODKA 2RURA 1U79A 2DT1A 5HWCA 5HW6A 3ARQA 3CH9A 1JNSA 4DWSA 4WKAA 2MLZA 2A3CA 4TW8A 5HT1A 3O5DA 1NWUA 2KGJA 3TDBA 1LL6A 1EHNA 2WK2A 3O5OA 1GOIA 4JFIA 4DWSC 1F8AB 4ODOA 3KCEA 1SR0A 2XP3A 1ZB5A 4XAKA 1Q6HA 1ZU8A 3ALFA 2Y78A 2AWGA 3CGMA 3UQAA 3O5RA 1K9TA 1FFRA 4ODPA 4Z2GA 1LQ0A 2ZQSA 4ODNA 1GUVA 2PPPA 4MSPA 1WAWA 3ARUA 3ALGA 1L1PA 4J4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR4 A;  3O5M A;  2RQS A;  3KAG A;  3TCZ A;  3UQB A;  1YAT A;  3H9R B;  1ROT A;  2F4E A;  2RUD A;  2XP5 A;  3ODK A;  3I6C A;  4TYO A;  3WH0 A;  3O5L A;  4W9Q A;  2PPN A;  4U84 A;  2XPB A;  1EYM A;  1FKR A;  4IQ2 A;  4ODM A;  1Q6U A;  4TW7 A;  2XP9 A;  4JYS A;  4DRN A;  4DRP A;  3UQI A;  1FAP A;  4ODL A;  4DRI A;  3O5F A;  4DRO A;  1B6C A;  1NMV A;  3B7X A;  1C9H A;  2DG3 A;  1R9H A;  3JYM A;  3KZ7 A;  4R0X A;  4U86 A;  3IHZ A;  2M2A A;  5J6E A;  3PRD A;  4IPX A;  3UI5 A;  2ZR5 A;  4QT2 A;  1J4I A;  4DZ2 A;  2KI3 A;  4DZ3 A;  3KAC A;  2LJ4 A;  2MLY A;  3O5J A;  4ODQ A;  1FKL A;  3RGC A;  2IF4 A;  3PA7 A;  1Q1C A;  1JVW A;  2MPH A;  1A7X A;  1Q6I A;  1FJD A;  5B8I C;  1ZK6 A;  2ZR6 A;  2M1I A;  2PBC A;  2M08 A;  2PPO A;  1T11 A;  3VAW A;  2MNT A;  5HWB A;  1ROU A;  4FAP A;  5D75 A;  3O5E A;  3NTP A;  2JZV A;  3NRK A;  5HUA A;  5DIU A;  1N1A A;  1YW5 A;  3TC5 A;  3UI6 A;  4O2T A;  3UF8 A;  1JNT A;  2LPV A;  1ZCN A;  3NI6 A;  4BF8 A;  4DIP A;  4G2P A;  4DRJ A;  2UZ5 A;  1M5Y A;  2VCD A;  5HW7 A;  1FKK A;  5GPG A;  1F40 A;  5BXJ A;  4C02 B;  1FKD A;  3JYJ A;  2DG4 A;  2PV3 A;  3JXV A;  1PBK A;  4G50 A;  1D7H A;  1FKJ A;  4LAY A;  2VN1 A;  2OFN A;  4DT4 A;  4GGQ A;  3KAD A;  2PV1 A;  2ZQU A;  4TW6 A;  2MLX A;  4DRH A;  2KE0 A;  2XP8 A;  3O5K A;  4DRM A;  1QZ2 A;  1FKF A;  3O5P A;  4JFL A;  1FD9 A;  1QPF A;  3UI4 A;  5I98 A;  4ODR A;  1EQ3 A;  1J4R A;  2LGO A;  2XP6 A;  1P5Q A;  2L2S A;  4QT3 A;  4GIV A;  4DH0 A;  5DIT A;  4TX0 A;  1FKI A;  3KAF A;  3IK8 A;  2K8I A;  1D6O A;  2D9F A;  4ODK A;  1W26 A;  1TCO C;  2ZQT A;  4W9P A;  1FKT A;  2FKE A;  2RUR A;  2MF9 A;  2XP4 A;  4DRK A;  1U79 A;  2LKN A;  4LAV A;  5HWC A;  5HW6 A;  2F21 A;  3PRB A;  1J4H A;  1JNS A;  1KT1 A;  1FKB A;  3O5I A;  4IQC A;  4W9O A;  2MLZ A;  1FKG A;  3RFW A;  3O5G A;  5HKG A;  4ITZ A;  2N87 A;  4TW8 A;  2RSE A;  4JFJ A;  3FAP A;  2KFW A;  5HT1 A;  1NSG A;  3O5Q A;  1NMW A;  2KGJ A;  3O5D A;  3TDB A;  2DG9 A;  1KT0 A;  2FAP A;  2F2D A;  4QIB A;  3O5O A;  5HTG A;  4JFI A;  3KAH A;  5DIV A;  1F8A B;  2ITK A;  4ODO A;  4J4N A;  1BL4 A;  3KCE A;  1QPL A;  4JFM A;  2ZQV A;  3KAB A;  1Y0O A;  2XP3 A;  1BKF A;  1Q6H A;  3EY6 A;  1D7I A;  4LAX A;  1J6Y A;  2Q5A A;  2Y78 A;  3IKD A;  4DRQ A;  2AWG A;  3CGM A;  4FN2 A;  4JFK A;  3UQA A;  3O5R A;  2RUQ A;  3IKG A;  1D7J A;  2KO7 A;  2PV2 A;  3LUO A;  4ODP A;  1FKS A;  1PIN A;  2KR7 A;  3GPK A;  2XPA A;  4MGV A;  4N19 A;  2ZQS A;  4ODN A;  3MDY B;  4TNS A;  4J4O A;  2PPP A;  4LAW A;  2XP7 A;  4MSP A;  3KAI A;  4NNR A;  5HW8 A;  3CGN A;  1HXV A;  4U85 A;  3OOB A;  1L1P A;  1FKH A;  2RUC A; 
#chains in the Genus database with same CATH topology
 3EIP A;  1ROT A;  2RUD A;  3I6C A;  2OLH A;  4U84 A;  2XPB A;  1FKR A;  4ODM A;  1Q6U A;  3RM9 A;  2YBU A;  3UQI A;  3ARR A;  3B7X A;  4U86 A;  1R9H A;  3KZ7 A;  4IPX A;  3G6L A;  3B9E A;  3KAC A;  3O5J A;  2IF4 A;  1Q1C A;  3PRA A;  3RM8 A;  5B8I C;  2ZR6 A;  1X6N A;  1W1P A;  1E15 A;  4FAP A;  1W9V A;  2JZV A;  3NRK A;  1E6P A;  5HUA A;  5DIU A;  3ARY A;  3UF8 A;  3W4R A;  2LPV A;  4BF8 A;  1OGB A;  1M5Y A;  1LG2 A;  3BXW A;  4DWS B;  1HKJ A;  1D7H A;  2P4V A;  3WL0 A;  5DF0 A;  2OFN A;  3GU0 A;  4GGQ A;  4DT4 A;  3B9A A;  3KAD A;  4Z2L A;  2ZQU A;  2YBT A;  3CZ8 A;  5HBF A;  3O5K A;  1FD9 A;  1QPF A;  3WD0 A;  1E6N A;  4DH0 A;  4MTV A;  2D9F A;  4NSB A;  2ZQT A;  4Q7N A;  4W9P A;  1FKT A;  2FKE A;  4IT6 A;  1E6R A;  5DO2 A;  2LKN A;  2O9O A;  4L72 B;  2F21 A;  4HBO A;  4WK9 A;  4IQC A;  1FKB A;  3O5I A;  4P8V A;  3WIJ A;  3O5G A;  1WB0 A;  4KQZ A;  5HKG A;  4ITZ A;  3FAP A;  3WQW A;  4HBE A;  3O5Q A;  4QIB A;  5HTG A;  2WM0 A;  4L3N A;  3AS1 A;  2ITK A;  4J4N A;  2QF8 A;  1BL4 A;  1JND A;  1BKF A;  5DEZ A;  2PV2 A;  2KR7 A;  2DSU A;  4ZS6 A;  2A3B A;  3MDY B;  2XP7 A;  3ARP A;  3G6M A;  4NNR A;  3CGN A;  1NWR A;  2DT0 A;  4ZPW R;  1FKH A;  3O5M A;  2XP5 A;  1LG1 A;  1CTN A;  3O5L A;  2PPN A;  1EYM A;  4IQ2 A;  4TW7 A;  4MNJ A;  3RM4 A;  4MNK A;  1HJV A;  1C9H A;  2DG3 A;  5J6E A;  3CHF A;  4MPK A;  4DZ3 A;  1W1T A;  4HAR A;  3ART A;  1JVW A;  2MPH A;  1KFW A;  1A7X A;  4LGX A;  1ZK6 A;  2PBC A;  5HWB A;  2PPO A;  1T11 A;  2MNT A;  2WLZ A;  1LJY A;  4UDM A;  3UI6 A;  4O2T A;  3WKZ A;  1JNT A;  3CHC A;  4W5U A;  1UR8 A;  3NI6 A;  4G2P A;  4DRJ A;  4ZPV R;  1ITX A;  5BXJ A;  1FKD A;  3JYJ A;  1O6I A;  2PV3 A;  1XRV A;  1GRJ A;  4DRH A;  2G8Z A;  3WD2 A;  1NH6 A;  1QZ2 A;  3AS0 A;  4ODR A;  1EQ3 A;  2XP6 A;  1NWS A;  2LGO A;  5DIT A;  4TX0 A;  1W26 A;  2XP4 A;  4S3K A;  4P8W A;  1KT1 A;  4W9O A;  3RFW A;  3ARS A;  2N87 A;  1ZBC A;  2B5U B;  2KFW A;  4S3J A;  2DG9 A;  1KT0 A;  2FAP A;  5GPR A;  2F2D A;  1EDQ A;  3PR9 A;  3CHE A;  1W1Y A;  5DIV A;  4URI A;  1QPL A;  4JFM A;  2ZQV A;  3B9D A;  1Y0O A;  3EY6 A;  1D7I A;  1J6Y A;  2Q5A A;  3IKD A;  4P8X A;  4JFK A;  3AS2 A;  2KO7 A;  3LUO A;  1FKS A;  1HJX A;  1PIN A;  4MGV A;  2XPA A;  3WD3 A;  5HW8 A;  3RME A;  1OGG A;  4U85 A;  4LAV A;  1SYT A;  2A3A A;  3UQB A;  1LL7 A;  1YAT A;  1UR9 A;  4TYO A;  1W9U A;  4W9Q A;  1GPF A;  4DRN A;  4DRP A;  1E44 A;  3WL1 A;  4DRI A;  3O5F A;  1B6C A;  1NMV A;  4Z2J A;  1NWT A;  3QOK A;  1E9L A;  2M2A A;  4WJX A;  3UI5 A;  2ZR5 A;  4AY1 A;  4WKF A;  4DZ2 A;  4ODQ A;  1Q6I A;  1FJD A;  1HKK A;  2M1I A;  4Z2H A;  2M08 A;  1ROU A;  2ETN A;  5D75 A;  3O5E A;  3NTP A;  1YW5 A;  2A3E A;  3GTY X;  1TFV A;  2VCD A;  5GPG A;  3ARW A;  4C02 B;  2DG4 A;  1PBK A;  4DWS D;  4G50 A;  4LAY A;  1WNO A;  2MLX A;  5JH8 A;  2F23 A;  4DRM A;  1EIB A;  3O5P A;  4JFL A;  3UI4 A;  5I98 A;  1VF8 A;  2L2S A;  4QT3 A;  3KAF A;  2K8I A;  1TCO C;  2EUL A;  3WQV A;  2IUZ A;  1IX5 A;  2MF9 A;  4DRK A;  1ZBV A;  2O92 A;  3PRB A;  1J4H A;  1FKG A;  2RSE A;  4JFJ A;  4QZV B;  4Q22 A;  1OWQ A;  1NSG A;  1NMW A;  1E6Z A;  4MAV A;  2B31 A;  3KAH A;  3WD1 A;  4ML4 A;  3KAB A;  1JCH B;  4WIW A;  4LAX A;  2PI6 A;  3ARO A;  4DRQ A;  4FN2 A;  2RUQ A;  3IKG A;  1D7J A;  1HKM A;  3GPK A;  4N19 A;  2AOS A;  4TNS A;  1D2K A;  4LAW A;  3KAI A;  1HXV A;  3AS3 A;  4IT4 A;  3OOB A;  2RUC A;  2ZR4 A;  2RQS A;  3KAG A;  3TCZ A;  5GQB A;  3WD4 A;  3H9R B;  2F4E A;  2FDM A;  3ODK A;  3FY1 A;  3WH0 A;  1FFQ A;  2DSV A;  3AQU A;  4MNM A;  4ZPT R;  2XP9 A;  4JYS A;  2DSW A;  1FAP A;  4ODL A;  4DRO A;  4R0X A;  3JYM A;  3IHZ A;  1HJW A;  3PRD A;  3ARZ A;  4QT2 A;  3BMB A;  1J4I A;  2KI3 A;  2LJ4 A;  2MLY A;  1W1V A;  4NZC A;  1FKL A;  3RGC A;  3PA7 A;  3B8S A;  3VAW A;  4WKH A;  1HKI A;  4P8U A;  3ARX A;  1N1A A;  3TC5 A;  4PTM A;  1JNE A;  1RD6 A;  2ESC A;  1ZBW A;  1X6L A;  1ZCN A;  4MNL A;  4DIP A;  4Z2I A;  2DPE A;  2UZ5 A;  1F40 A;  5HW7 A;  1FKK A;  2DT3 A;  1H0I A;  1ZL1 A;  2G41 A;  3JXV A;  1ZBK A;  1FKJ A;  2VN1 A;  3ARV A;  1W9P A;  4Z2K A;  3OA5 A;  2DT2 A;  1H0G A;  2PV1 A;  1LL4 A;  4TW6 A;  2KE0 A;  3CHD A;  2XP8 A;  1FKF A;  2WLY A;  1XHG A;  2PN0 A;  1J4R A;  2DSZ A;  1P5Q A;  4R5E A;  4GIV A;  1FKI A;  3IK8 A;  4KR0 B;  3FXY A;  1D6O A;  4ODK A;  2RUR A;  1U79 A;  2DT1 A;  5HWC A;  5HW6 A;  3ARQ A;  3CH9 A;  1JNS A;  4DWS A;  4WKA A;  2MLZ A;  2A3C A;  4TW8 A;  5HT1 A;  3O5D A;  1NWU A;  2KGJ A;  3TDB A;  1LL6 A;  1EHN A;  2WK2 A;  3O5O A;  1GOI A;  4JFI A;  4DWS C;  1F8A B;  4ODO A;  3KCE A;  1SR0 A;  2XP3 A;  1ZB5 A;  4XAK A;  1Q6H A;  1ZU8 A;  3ALF A;  2Y78 A;  2AWG A;  3CGM A;  3UQA A;  3O5R A;  1K9T A;  1FFR A;  4ODP A;  4Z2G A;  1LQ0 A;  2ZQS A;  4ODN A;  1GUV A;  2PPP A;  4MSP A;  1WAW A;  3ARU A;  3ALG A;  1L1P A;  4J4O A; 
#chains in the Genus database with same CATH homology
 1ROT A;  2RUD A;  3I6C A;  2OLH A;  4U84 A;  2XPB A;  1FKR A;  4ODM A;  1Q6U A;  3RM9 A;  2YBU A;  3UQI A;  3ARR A;  3B7X A;  4U86 A;  1R9H A;  3KZ7 A;  4IPX A;  3G6L A;  3B9E A;  3KAC A;  3O5J A;  2IF4 A;  1Q1C A;  3PRA A;  3RM8 A;  5B8I C;  2ZR6 A;  1X6N A;  1W1P A;  1E15 A;  4FAP A;  1W9V A;  2JZV A;  3NRK A;  1E6P A;  5HUA A;  5DIU A;  3ARY A;  3UF8 A;  3W4R A;  2LPV A;  4BF8 A;  1OGB A;  1M5Y A;  1LG2 A;  3BXW A;  4DWS B;  1HKJ A;  1D7H A;  3WL0 A;  5DF0 A;  2OFN A;  4DT4 A;  4GGQ A;  3B9A A;  3KAD A;  4Z2L A;  2ZQU A;  2YBT A;  3CZ8 A;  5HBF A;  3O5K A;  1FD9 A;  1QPF A;  3WD0 A;  1E6N A;  4DH0 A;  4MTV A;  2D9F A;  4NSB A;  2ZQT A;  4Q7N A;  4W9P A;  1FKT A;  2FKE A;  4IT6 A;  1E6R A;  5DO2 A;  2LKN A;  2O9O A;  4L72 B;  2F21 A;  4HBO A;  4WK9 A;  4IQC A;  1FKB A;  3O5I A;  4P8V A;  3WIJ A;  3O5G A;  1WB0 A;  4KQZ A;  5HKG A;  4ITZ A;  3FAP A;  3WQW A;  4HBE A;  3O5Q A;  4QIB A;  5HTG A;  2WM0 A;  4L3N A;  3AS1 A;  2ITK A;  4J4N A;  2QF8 A;  1BL4 A;  1JND A;  1BKF A;  5DEZ A;  2PV2 A;  2KR7 A;  2DSU A;  4ZS6 A;  2A3B A;  3MDY B;  2XP7 A;  3ARP A;  3G6M A;  4NNR A;  3CGN A;  1NWR A;  2DT0 A;  4ZPW R;  1FKH A;  3O5M A;  2XP5 A;  1LG1 A;  1CTN A;  3O5L A;  2PPN A;  1EYM A;  4IQ2 A;  4TW7 A;  4MNJ A;  3RM4 A;  4MNK A;  1HJV A;  1C9H A;  2DG3 A;  5J6E A;  3CHF A;  4MPK A;  4DZ3 A;  1W1T A;  4HAR A;  3ART A;  1JVW A;  2MPH A;  1KFW A;  1A7X A;  4LGX A;  1ZK6 A;  2PBC A;  5HWB A;  2PPO A;  1T11 A;  2MNT A;  2WLZ A;  1LJY A;  3UI6 A;  4O2T A;  3WKZ A;  1JNT A;  3CHC A;  4W5U A;  1UR8 A;  3NI6 A;  4G2P A;  4DRJ A;  4ZPV R;  1ITX A;  5BXJ A;  1FKD A;  3JYJ A;  1O6I A;  2PV3 A;  1XRV A;  4DRH A;  2G8Z A;  3WD2 A;  1NH6 A;  1QZ2 A;  3AS0 A;  4ODR A;  1EQ3 A;  2XP6 A;  1NWS A;  2LGO A;  5DIT A;  4TX0 A;  1W26 A;  2XP4 A;  4S3K A;  4P8W A;  1KT1 A;  4W9O A;  3RFW A;  3ARS A;  2N87 A;  1ZBC A;  2KFW A;  4S3J A;  2DG9 A;  1KT0 A;  2FAP A;  5GPR A;  2F2D A;  1EDQ A;  3PR9 A;  3CHE A;  1W1Y A;  5DIV A;  4URI A;  1QPL A;  4JFM A;  2ZQV A;  3B9D A;  1Y0O A;  3EY6 A;  1D7I A;  1J6Y A;  2Q5A A;  3IKD A;  4P8X A;  4JFK A;  3AS2 A;  2KO7 A;  3LUO A;  1FKS A;  1HJX A;  1PIN A;  4MGV A;  2XPA A;  3WD3 A;  5HW8 A;  3RME A;  1OGG A;  4U85 A;  4LAV A;  1SYT A;  2A3A A;  3UQB A;  1LL7 A;  1YAT A;  1UR9 A;  4TYO A;  1W9U A;  4W9Q A;  1GPF A;  4DRN A;  4DRP A;  3WL1 A;  4DRI A;  3O5F A;  1B6C A;  1NMV A;  4Z2J A;  1NWT A;  3QOK A;  1E9L A;  2M2A A;  4WJX A;  3UI5 A;  2ZR5 A;  4AY1 A;  4WKF A;  4DZ2 A;  4ODQ A;  1Q6I A;  1FJD A;  1HKK A;  2M1I A;  4Z2H A;  2M08 A;  1ROU A;  5D75 A;  3O5E A;  3NTP A;  1YW5 A;  2A3E A;  1TFV A;  2VCD A;  5GPG A;  3ARW A;  4C02 B;  2DG4 A;  1PBK A;  4DWS D;  4G50 A;  4LAY A;  1WNO A;  2MLX A;  5JH8 A;  4DRM A;  1EIB A;  3O5P A;  4JFL A;  3UI4 A;  5I98 A;  1VF8 A;  2L2S A;  4QT3 A;  3KAF A;  2K8I A;  1TCO C;  3WQV A;  2IUZ A;  1IX5 A;  2MF9 A;  4DRK A;  1ZBV A;  2O92 A;  3PRB A;  1J4H A;  1FKG A;  2RSE A;  4JFJ A;  4QZV B;  4Q22 A;  1OWQ A;  1NSG A;  1NMW A;  1E6Z A;  4MAV A;  2B31 A;  3KAH A;  3WD1 A;  4ML4 A;  3KAB A;  4WIW A;  4LAX A;  2PI6 A;  3ARO A;  4DRQ A;  4FN2 A;  2RUQ A;  3IKG A;  1D7J A;  1HKM A;  3GPK A;  4N19 A;  2AOS A;  4TNS A;  1D2K A;  4LAW A;  3KAI A;  1HXV A;  3AS3 A;  4IT4 A;  3OOB A;  2RUC A;  2ZR4 A;  2RQS A;  3KAG A;  3TCZ A;  5GQB A;  3WD4 A;  3H9R B;  2F4E A;  2FDM A;  3ODK A;  3FY1 A;  3WH0 A;  1FFQ A;  2DSV A;  3AQU A;  4MNM A;  4ZPT R;  2XP9 A;  4JYS A;  2DSW A;  1FAP A;  4ODL A;  4DRO A;  4R0X A;  3JYM A;  3IHZ A;  1HJW A;  3PRD A;  3ARZ A;  4QT2 A;  1J4I A;  2KI3 A;  2LJ4 A;  2MLY A;  1W1V A;  4NZC A;  1FKL A;  3RGC A;  3PA7 A;  3B8S A;  3VAW A;  4WKH A;  1HKI A;  4P8U A;  3ARX A;  1N1A A;  3TC5 A;  4PTM A;  1JNE A;  1RD6 A;  2ESC A;  1ZBW A;  1X6L A;  1ZCN A;  4MNL A;  4DIP A;  4Z2I A;  2DPE A;  2UZ5 A;  1F40 A;  5HW7 A;  1FKK A;  2DT3 A;  1H0I A;  1ZL1 A;  2G41 A;  3JXV A;  1ZBK A;  1FKJ A;  2VN1 A;  3ARV A;  1W9P A;  4Z2K A;  3OA5 A;  2DT2 A;  1H0G A;  2PV1 A;  1LL4 A;  4TW6 A;  2KE0 A;  3CHD A;  2XP8 A;  1FKF A;  2WLY A;  1XHG A;  1J4R A;  2DSZ A;  1P5Q A;  4R5E A;  4GIV A;  1FKI A;  3IK8 A;  4KR0 B;  3FXY A;  1D6O A;  4ODK A;  2RUR A;  1U79 A;  2DT1 A;  5HWC A;  5HW6 A;  3ARQ A;  3CH9 A;  1JNS A;  4DWS A;  4WKA A;  2MLZ A;  2A3C A;  4TW8 A;  5HT1 A;  3O5D A;  1NWU A;  2KGJ A;  3TDB A;  1LL6 A;  1EHN A;  2WK2 A;  3O5O A;  1GOI A;  4JFI A;  4DWS C;  1F8A B;  4ODO A;  3KCE A;  1SR0 A;  2XP3 A;  1ZB5 A;  4XAK A;  1Q6H A;  1ZU8 A;  3ALF A;  2Y78 A;  2AWG A;  3CGM A;  3UQA A;  3O5R A;  1K9T A;  1FFR A;  4ODP A;  4Z2G A;  1LQ0 A;  2ZQS A;  4ODN A;  1GUV A;  2PPP A;  4MSP A;  1WAW A;  3ARU A;  3ALG A;  1L1P A;  4J4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...