1FKTA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 19
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fktA00
1J4HA 4JFJA 4ODMA 2KI3A 4LAXA 2XP5A 4ITZA 4JFLA 2AWGA 1FAPA 3OOBA 3JYJA 1Y0OA 4U84A 4DRPA 5BXJA 5HW8A 2RUCA 2OFNA 4GIVA 4DH0A 1YW5A 3O5LA 1FKLA 1JNTA 3CGNA 3UI6A 1Q6UA 4G2PA 1ROUA 2XP3A 1W26A 2LPVA 2DG3A 3IHZA 4DRIA 4DRNA 1QZ2A 2KO7A 1F8AB 4U86A 3O5RA 2RQSA 1FKSA 5D75A 2LJ4A 3VAWA 2N87A 3O5MA 2FAPA 2RURA 2KR7A 1T11A 4ODKA 4DRKA 4JYSA 2XP6A 3UI4A 4JFKA 4DROA 2F21A 1YATA 3WH0A 1Q1CA 1FKTA 5DITA 2XPAA 4DRQA 4LAVA 1FKGA 3O5DA 2PBCA 1FKDA 2L2SA 3NTPA 2ZQSA 3UQIA 3KZ7A 3TC5A 2MLYA 3KADA 1BL4A 2F2DA 5B8IC 3JXVA 2PV2A 5HWBA 2ZQTA 3PA7A 3NRKA 4ODOA 3CGMA 1PINA 1ZCNA 3KACA 4BF8A 4TW6A 1F40A 2MLXA 5HKGA 4IQ2A 1QPLA 1KT0A 3KAFA 3FAPA 2LGOA 2XP9A 4W9QA 3KABA 2XPBA 1EYMA 1N1AA 1Q6IA 3TDBA 1FKJA 2DG4A 3O5FA 1JNSA 3PRBA 3TCZA 4J4OA 1NSGA 4G50A 4DIPA 4MGVA 3RGCA 4FAPA 1ROTA 4QT3A 2XP4A 4ODQA 3RFWA 1M5YA 1J4IA 2KFWA 1FD9A 3PRDA 3UI5A 3UQAA 1D7HA 2VN1A 3IK8A 1FKKA 3O5KA 3UQBA 4W9PA 1J6YA 2ZQUA 4TNSA 1PBKA 4ODNA 4DRJA 4TW7A 2ZQVA 4N19A 2XP7A 2ITKA 4J4NA 1ZK6A 5HUAA 3B7XA 2XP8A 3O5IA 4MSPA 1L1PA 4ODPA 4QT2A 3I6CA 2MNTA 5GPGA 3IKDA 2ZR4A 2PV1A 3MDYB 4JFMA 5J6EA 1BKFA 2JZVA 3O5GA 2RUDA 4R0XA 5HWCA 1C9HA 1HXVA 2MPHA 1TCOC 4NNRA 1EQ3A 3O5JA 2Y78A 3H9RB 4LAWA 2PPOA 3KAGA 5HT1A 5HW7A 2FKEA 1P5QA 4U85A 1KT1A 1D7JA 1Q6HA 3EY6A 3O5EA 4TX0A 1FKIA 4LAYA 4FN2A 4DZ3A 2PPPA 3O5OA 3O5QA 5DIUA 2K8IA 2UZ5A 1U79A 1FKHA 2ZR6A 4JFIA 5HTGA 1FKRA 2M1IA 3O5PA 2RSEA 2F4EA 4TW8A 5HW6A 2Q5AA 4DRMA 1QPFA 2MF9A 5DIVA 1FJDA 2PPNA 3IKGA 2ZR5A 4GGQA 4ODRA 1NMWA 2RUQA 4IQCA 1D6OA 4DZ2A 2M2AA 1B6CA 2D9FA 3KCEA 4W9OA 3UF8A 2KE0A 2LKNA 2IF4A 2DG9A 3ODKA 4IPXA 4DT4A 5I98A 3KAIA 1A7XA 3KAHA 2KGJA 1J4RA 1NMVA 3LUOA 2MLZA 4O2TA 4ODLA 4QIBA 1D7IA 1FKBA 2VCDA 1R9HA 2PV3A 4TYOA 4C02B 1JVWA 3JYMA 1FKFA 2M08A 3NI6A 4DRHA 3GPKA
chains in the Genus database with same CATH superfamily
4ODMA 4JFLA 2AWGA 3OOBA 5DF0A 3PRAA 1O6IA 4GIVA 4KR0B 1OGGA 3CGNA 3BXWA 1ROUA 2LPVA 1H0IA 1F8AB 3O5RA 2RQSA 1X6LA 2RURA 5DEZA 2A3BA 3WL0A 4ODKA 1YATA 3WH0A 1Q1CA 4MNMA 3GTYX 4XAKA 2XPAA 2WLYA 1LL4A 2IUZA 3O5DA 3OA5A 1FKDA 2L2SA 3KADA 1E6RA 5B8IC 4WJXA 3ARRA 4ODOA 3CGMA 1ZCNA 3KACA 2DSZA 3WD2A 1JCHB 1QPLA 3KAFA 3ARYA 4W9QA 3W4RA 1N1AA 3TDBA 1FKJA 3O5FA 5JH8A 1IX5A 2WLZA 4J4OA 4WKAA 3FY1A 1ROTA 4QT3A 3WQWA 3ARQA 3AS0A 1FKKA 4W9PA 1J6YA 1SR0A 4ODNA 4DRJA 2ZQVA 4N19A 2ITKA 4ZPWR 3O5IA 1E15A 2B5UB 3ARPA 4QT2A 4W5UA 2MNTA 5GPGA 2ZR4A 3GU0A 2PV1A 4JFMA 1C9HA 3AS3A 1LG1A 4MNJA 2PPOA 3KAGA 2DT1A 5HW7A 4WK9A 4IT6A 1KFWA 1D7JA 2A3CA 2AOSA 2PN0A 5DIUA 2K8IA 1U79A 5HTGA 1ZB5A 2RSEA 1ZU8A 1XHGA 2Q5AA 1E9LA 2YBTA 1QPFA 5DIVA 3CHCA 3IKGA 2FDMA 1LJYA 3CH9A 4HBEA 1D6OA 2DSVA 4W9OA 2D9FA 2KE0A 2LKNA 2IF4A 2DG9A 3CHEA 3UI5A 1J4RA 1NMVA 2DSWA 4O2TA 4ODLA 1TFVA 3ARWA 4TYOA 4C02B 3JYMA 1FKFA 3NI6A 4Q7NA 3RMEA 4JFJA 1OWQA 4ITZA 4DRPA 5DO2A 2RUCA 4ZPTR 1Q6UA 1WB0A 1W26A 3RM8A 4S3JA 4DRNA 1QZ2A 5D75A 1UR8A 3ARTA 2N87A 2FAPA 2KR7A 4JYSA 2XP6A 4JFKA 4DROA 4MTVA 3WD3A 4KQZA 3EIPA 1W1PA 4LAVA 4MPKA 2PBCA 3KZ7A 1W9PA 2F2DA 3JXVA 5HWBA 2ZQTA 3PA7A 4DWSA 1FFRA 1F40A 3WQVA 1NWSA 3FAPA 2LGOA 1D2KA 4Z2IA 2XPBA 1NH6A 4LGXA 2DG4A 3G6LA 1JNSA 3PRBA 2O92A 1NSGA 3WD0A 4FAPA 1NWTA 4ODQA 3RFWA 1X6NA 1M5YA 1J4IA 3PRDA 3UQAA 1LL6A 2ZQUA 1PBKA 3WKZA 1ZBVA 3B7XA 4MSPA 1L1PA 3I6CA 4P8UA 3B9EA 3IKDA 3MDYB 4R0XA 2RUDA 2O9OA 2MPHA 2QF8A 4Z2HA 1OGBA 4U85A 1FKIA 3ARVA 4FN2A 3O5QA 1JNEA 3WD1A 1FKRA 5HW6A 1FJDA 2PPNA 3RM4A 2ZR5A 1K9TA 2RUQA 3B9DA 2WM0A 3KCEA 4URIA 2PI6A 1HJXA 4IPXA 3KAIA 4R5EA 1HKKA 2DSUA 4ZS6A 1FKBA 2PV3A 1JVWA 4DIPA 4DRHA 3GPKA 3O5KA 1J4HA 1EDQA 1E44A 1GOIA 2KI3A 3CZ8A 4U84A 1FAPA 2G8ZA 1E6NA 1Y0OA 5HW8A 1YW5A 3UI6A 1JNTA 4G2PA 2DG3A 5GPRA 3WL1A 4U86A 1FKSA 2ESCA 2LJ4A 3CHFA 4WKHA 3VAWA 4QZVB 4Z2KA 1SYTA 1FKTA 3WIJA 2ZQSA 3UQIA 2MLYA 1BL4A 4NSBA 2PV2A 3NRKA 1ZBCA 1PINA 1ZBKA 2MLXA 4IQ2A 1KT0A 1NWRA 1RD6A 1GRJA 2WK2A 3KABA 4HBOA 1EYMA 1Q6IA 2P4VA 3CHDA 4MGVA 3RGCA 2G41A 4P8XA 4TNSA 3RM9A 2B31A 4DWSB 3B8SA 4J4NA 2XP8A 3PR9A 1HKJA 1GUVA 4L3NA 3ARUA 1BKFA 4Z2LA 4ML4A 1TCOC 3BMBA 3O5JA 2Y78A 1UR9A 1E6ZA 4LAWA 1KT1A 3O5EA 1LL7A 3O5OA 4P8WA 2ZR6A 4JFIA 2M1IA 3O5PA 2F4EA 4TW8A 4DRMA 1VF8A 1FFQA 1NMWA 4DWSC 2M2AA 1B6CA 3UF8A 4ZPVR 3ALFA 3ODKA 5HBFA 2F23A 4L72B 3LUOA 3KAHA 1HJWA 1XRVA 1D7IA 1LG2A 1HJVA 4DZ2A 4PTMA 1JNDA 4MNKA 1W1TA 4LAXA 2XP5A 3JYJA 3AS2A 2DPEA 5BXJA 2A3EA 2OFNA 4DH0A 3O5LA 1FKLA 2XP3A 4Q22A 3IHZA 1W1VA 2ETNA 4DRIA 2KO7A 4Z2JA 3O5MA 2DT2A 1T11A 4DRKA 3UI4A 2F21A 3AROA 1H0GA 4P8VA 5DITA 4DRQA 3AS1A 1FKGA 3NTPA 1WNOA 3TC5A 4MAVA 1LQ0A 4MNLA 4DWSD 4BF8A 1HKMA 4TW6A 5HKGA 4UDMA 2DT0A 2DT3A 2XP9A 4IT4A 4WIWA 3TCZA 4HARA 4G50A 1ZBWA 2XP4A 3ARSA 2KFWA 1FD9A 4AY1A 1D7HA 2VN1A 3IK8A 3UQBA 1W9UA 4TW7A 3AQUA 1W1YA 2XP7A 5HUAA 1ZK6A 4ODPA 2EULA 2YBUA 2A3AA 5J6EA 5GQBA 3ARZA 2JZVA 3O5GA 5HWCA 1HXVA 1EQ3A 4NNRA 3H9RB 4S3KA 4WKFA 5HT1A 3WD4A 2FKEA 3ARXA 1P5QA 1Q6HA 3EY6A 4TX0A 4LAYA 1EHNA 4DZ3A 2PPPA 1GPFA 2OLHA 1FKHA 2UZ5A 1WAWA 2MF9A 1W9VA 1HKIA 1ZL1A 4GGQA 4ODRA 4IQCA 4NZCA 4Z2GA 1NWUA 5I98A 4DT4A 3G6MA 1A7XA 2KGJA 1E6PA 2MLZA 4QIBA 3FXYA 3ALGA 1CTNA 3QOKA 1ITXA 2VCDA 1R9HA 3B9AA 2M08A 1EIBA
chains in the Genus database with same CATH topology
4ODMA 4JFLA 2AWGA 3OOBA 5DF0A 3PRAA 1O6IA 4GIVA 4KR0B 1OGGA 3CGNA 3BXWA 1ROUA 2LPVA 1H0IA 1F8AB 3O5RA 2RQSA 1X6LA 2RURA 5DEZA 2A3BA 3WL0A 4ODKA 1YATA 3WH0A 1Q1CA 4MNMA 4XAKA 2XPAA 2WLYA 1LL4A 2IUZA 3O5DA 3OA5A 1FKDA 2L2SA 3KADA 1E6RA 5B8IC 4WJXA 3ARRA 4ODOA 3CGMA 1ZCNA 3KACA 2DSZA 3WD2A 1QPLA 3KAFA 3ARYA 4W9QA 3W4RA 1N1AA 3TDBA 1FKJA 3O5FA 5JH8A 1IX5A 2WLZA 4J4OA 4WKAA 3FY1A 1ROTA 4QT3A 3WQWA 3ARQA 3AS0A 1FKKA 4W9PA 1J6YA 1SR0A 4ODNA 4DRJA 2ZQVA 4N19A 2ITKA 4ZPWR 3O5IA 1E15A 3ARPA 4QT2A 4W5UA 2MNTA 5GPGA 2ZR4A 2PV1A 4JFMA 1C9HA 3AS3A 1LG1A 4MNJA 2PPOA 3KAGA 2DT1A 5HW7A 4WK9A 4IT6A 1KFWA 1D7JA 2A3CA 2AOSA 5DIUA 2K8IA 1U79A 5HTGA 1ZB5A 2RSEA 1ZU8A 1XHGA 2Q5AA 1E9LA 2YBTA 1QPFA 5DIVA 3CHCA 3IKGA 2FDMA 1LJYA 3CH9A 4HBEA 1D6OA 2DSVA 4W9OA 2D9FA 2KE0A 2LKNA 2IF4A 2DG9A 3CHEA 3UI5A 1J4RA 1NMVA 2DSWA 4O2TA 4ODLA 1TFVA 3ARWA 4TYOA 4C02B 3JYMA 1FKFA 3NI6A 4Q7NA 3RMEA 4JFJA 1OWQA 4ITZA 4DRPA 5DO2A 2RUCA 4ZPTR 1Q6UA 1WB0A 1W26A 3RM8A 4S3JA 4DRNA 1QZ2A 5D75A 1UR8A 3ARTA 2N87A 2FAPA 2KR7A 4JYSA 2XP6A 4JFKA 4DROA 4MTVA 3WD3A 4KQZA 1W1PA 4LAVA 4MPKA 2PBCA 3KZ7A 1W9PA 2F2DA 3JXVA 5HWBA 2ZQTA 3PA7A 4DWSA 1FFRA 1F40A 3WQVA 1NWSA 3FAPA 2LGOA 1D2KA 4Z2IA 2XPBA 1NH6A 4LGXA 2DG4A 3G6LA 1JNSA 3PRBA 2O92A 1NSGA 3WD0A 4FAPA 1NWTA 4ODQA 3RFWA 1X6NA 1M5YA 1J4IA 3PRDA 3UQAA 1LL6A 2ZQUA 1PBKA 3WKZA 1ZBVA 3B7XA 4MSPA 1L1PA 3I6CA 4P8UA 3B9EA 3IKDA 3MDYB 4R0XA 2RUDA 2O9OA 2MPHA 2QF8A 4Z2HA 1OGBA 4U85A 1FKIA 3ARVA 4FN2A 3O5QA 1JNEA 3WD1A 1FKRA 5HW6A 1FJDA 2PPNA 3RM4A 2ZR5A 1K9TA 2RUQA 3B9DA 2WM0A 3KCEA 4URIA 2PI6A 1HJXA 4IPXA 3KAIA 4R5EA 1HKKA 2DSUA 4ZS6A 1FKBA 2PV3A 1JVWA 4DIPA 4DRHA 3O5KA 3GPKA 1J4HA 1EDQA 1GOIA 2KI3A 3CZ8A 4U84A 1FAPA 2G8ZA 1E6NA 1Y0OA 5HW8A 1YW5A 3UI6A 1JNTA 4G2PA 2DG3A 5GPRA 3WL1A 4U86A 1FKSA 2ESCA 2LJ4A 3CHFA 4WKHA 3VAWA 4QZVB 4Z2KA 1SYTA 1FKTA 3WIJA 2ZQSA 3UQIA 2MLYA 1BL4A 4NSBA 2PV2A 3NRKA 1ZBCA 1PINA 1ZBKA 2MLXA 4IQ2A 1KT0A 1NWRA 1RD6A 2WK2A 3KABA 4HBOA 1EYMA 1Q6IA 3CHDA 4MGVA 3RGCA 2G41A 4P8XA 4TNSA 3RM9A 2B31A 4DWSB 3B8SA 4J4NA 2XP8A 3PR9A 1HKJA 1GUVA 4L3NA 3ARUA 1BKFA 4Z2LA 4ML4A 1TCOC 3O5JA 2Y78A 1UR9A 1E6ZA 4LAWA 1KT1A 3O5EA 1LL7A 3O5OA 4P8WA 2ZR6A 4JFIA 2M1IA 3O5PA 2F4EA 4TW8A 4DRMA 1VF8A 1FFQA 1NMWA 4DWSC 2M2AA 1B6CA 3UF8A 4ZPVR 3ALFA 3ODKA 5HBFA 4L72B 3LUOA 3KAHA 1HJWA 1XRVA 1D7IA 1LG2A 1HJVA 4DZ2A 4PTMA 1JNDA 4MNKA 1W1TA 4LAXA 2XP5A 3JYJA 3AS2A 2DPEA 5BXJA 2A3EA 2OFNA 4DH0A 3O5LA 1FKLA 2XP3A 4Q22A 3IHZA 1W1VA 4DRIA 2KO7A 4Z2JA 3O5MA 2DT2A 1T11A 4DRKA 3UI4A 2F21A 3AROA 1H0GA 4P8VA 5DITA 4DRQA 3AS1A 1FKGA 3NTPA 1WNOA 3TC5A 4MAVA 1LQ0A 4MNLA 4DWSD 4BF8A 1HKMA 4TW6A 5HKGA 2DT0A 2DT3A 2XP9A 4IT4A 4WIWA 3TCZA 4HARA 4G50A 1ZBWA 2XP4A 3ARSA 2KFWA 1FD9A 4AY1A 1D7HA 2VN1A 3IK8A 3UQBA 1W9UA 4TW7A 3AQUA 1W1YA 2XP7A 5HUAA 1ZK6A 4ODPA 2YBUA 2A3AA 5J6EA 5GQBA 3ARZA 2JZVA 3O5GA 5HWCA 1HXVA 1EQ3A 4NNRA 3H9RB 4S3KA 4WKFA 5HT1A 3WD4A 2FKEA 3ARXA 1P5QA 1Q6HA 3EY6A 4TX0A 4LAYA 1EHNA 4DZ3A 2PPPA 1GPFA 2OLHA 1FKHA 2UZ5A 1WAWA 2MF9A 1W9VA 1HKIA 1ZL1A 4GGQA 4ODRA 4IQCA 4NZCA 4Z2GA 1NWUA 5I98A 4DT4A 3G6MA 1A7XA 2KGJA 1E6PA 2MLZA 4QIBA 3FXYA 3ALGA 1CTNA 3QOKA 1ITXA 2VCDA 1R9HA 3B9AA 2M08A 1EIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4H A;  4JFJ A;  4ODM A;  2KI3 A;  4LAX A;  2XP5 A;  4ITZ A;  4JFL A;  2AWG A;  1FAP A;  3OOB A;  3JYJ A;  1Y0O A;  4U84 A;  4DRP A;  5BXJ A;  5HW8 A;  2RUC A;  2OFN A;  4GIV A;  4DH0 A;  1YW5 A;  3O5L A;  1FKL A;  1JNT A;  3CGN A;  3UI6 A;  1Q6U A;  4G2P A;  1ROU A;  2XP3 A;  1W26 A;  2LPV A;  2DG3 A;  3IHZ A;  4DRI A;  4DRN A;  1QZ2 A;  2KO7 A;  1F8A B;  4U86 A;  3O5R A;  2RQS A;  1FKS A;  5D75 A;  2LJ4 A;  3VAW A;  2N87 A;  3O5M A;  2FAP A;  2RUR A;  2KR7 A;  1T11 A;  4ODK A;  4DRK A;  4JYS A;  2XP6 A;  3UI4 A;  4JFK A;  4DRO A;  2F21 A;  1YAT A;  3WH0 A;  1Q1C A;  1FKT A;  5DIT A;  2XPA A;  4DRQ A;  4LAV A;  1FKG A;  3O5D A;  2PBC A;  1FKD A;  2L2S A;  3NTP A;  2ZQS A;  3UQI A;  3KZ7 A;  3TC5 A;  2MLY A;  3KAD A;  1BL4 A;  2F2D A;  5B8I C;  3JXV A;  2PV2 A;  5HWB A;  2ZQT A;  3PA7 A;  3NRK A;  4ODO A;  3CGM A;  1PIN A;  1ZCN A;  3KAC A;  4BF8 A;  4TW6 A;  1F40 A;  2MLX A;  5HKG A;  4IQ2 A;  1QPL A;  1KT0 A;  3KAF A;  3FAP A;  2LGO A;  2XP9 A;  4W9Q A;  3KAB A;  2XPB A;  1EYM A;  1N1A A;  1Q6I A;  3TDB A;  1FKJ A;  2DG4 A;  3O5F A;  1JNS A;  3PRB A;  3TCZ A;  4J4O A;  1NSG A;  4G50 A;  4DIP A;  4MGV A;  3RGC A;  4FAP A;  1ROT A;  4QT3 A;  2XP4 A;  4ODQ A;  3RFW A;  1M5Y A;  1J4I A;  2KFW A;  1FD9 A;  3PRD A;  3UI5 A;  3UQA A;  1D7H A;  2VN1 A;  3IK8 A;  1FKK A;  3O5K A;  3UQB A;  4W9P A;  1J6Y A;  2ZQU A;  4TNS A;  1PBK A;  4ODN A;  4DRJ A;  4TW7 A;  2ZQV A;  4N19 A;  2XP7 A;  2ITK A;  4J4N A;  1ZK6 A;  5HUA A;  3B7X A;  2XP8 A;  3O5I A;  4MSP A;  1L1P A;  4ODP A;  4QT2 A;  3I6C A;  2MNT A;  5GPG A;  3IKD A;  2ZR4 A;  2PV1 A;  3MDY B;  4JFM A;  5J6E A;  1BKF A;  2JZV A;  3O5G A;  2RUD A;  4R0X A;  5HWC A;  1C9H A;  1HXV A;  2MPH A;  1TCO C;  4NNR A;  1EQ3 A;  3O5J A;  2Y78 A;  3H9R B;  4LAW A;  2PPO A;  3KAG A;  5HT1 A;  5HW7 A;  2FKE A;  1P5Q A;  4U85 A;  1KT1 A;  1D7J A;  1Q6H A;  3EY6 A;  3O5E A;  4TX0 A;  1FKI A;  4LAY A;  4FN2 A;  4DZ3 A;  2PPP A;  3O5O A;  3O5Q A;  5DIU A;  2K8I A;  2UZ5 A;  1U79 A;  1FKH A;  2ZR6 A;  4JFI A;  5HTG A;  1FKR A;  2M1I A;  3O5P A;  2RSE A;  2F4E A;  4TW8 A;  5HW6 A;  2Q5A A;  4DRM A;  1QPF A;  2MF9 A;  5DIV A;  1FJD A;  2PPN A;  3IKG A;  2ZR5 A;  4GGQ A;  4ODR A;  1NMW A;  2RUQ A;  4IQC A;  1D6O A;  4DZ2 A;  2M2A A;  1B6C A;  2D9F A;  3KCE A;  4W9O A;  3UF8 A;  2KE0 A;  2LKN A;  2IF4 A;  2DG9 A;  3ODK A;  4IPX A;  4DT4 A;  5I98 A;  3KAI A;  1A7X A;  3KAH A;  2KGJ A;  1J4R A;  1NMV A;  3LUO A;  2MLZ A;  4O2T A;  4ODL A;  4QIB A;  1D7I A;  1FKB A;  2VCD A;  1R9H A;  2PV3 A;  4TYO A;  4C02 B;  1JVW A;  3JYM A;  1FKF A;  2M08 A;  3NI6 A;  4DRH A;  3GPK A; 
#chains in the Genus database with same CATH topology
 4ODM A;  4JFL A;  2AWG A;  3OOB A;  5DF0 A;  3PRA A;  1O6I A;  4GIV A;  4KR0 B;  1OGG A;  3CGN A;  3BXW A;  1ROU A;  2LPV A;  1H0I A;  1F8A B;  3O5R A;  2RQS A;  1X6L A;  2RUR A;  5DEZ A;  2A3B A;  3WL0 A;  4ODK A;  1YAT A;  3WH0 A;  1Q1C A;  4MNM A;  3GTY X;  4XAK A;  2XPA A;  2WLY A;  1LL4 A;  2IUZ A;  3O5D A;  3OA5 A;  1FKD A;  2L2S A;  3KAD A;  1E6R A;  5B8I C;  4WJX A;  3ARR A;  4ODO A;  3CGM A;  1ZCN A;  3KAC A;  2DSZ A;  3WD2 A;  1JCH B;  1QPL A;  3KAF A;  3ARY A;  4W9Q A;  3W4R A;  1N1A A;  3TDB A;  1FKJ A;  3O5F A;  5JH8 A;  1IX5 A;  2WLZ A;  4J4O A;  4WKA A;  3FY1 A;  1ROT A;  4QT3 A;  3WQW A;  3ARQ A;  3AS0 A;  1FKK A;  4W9P A;  1J6Y A;  1SR0 A;  4ODN A;  4DRJ A;  2ZQV A;  4N19 A;  2ITK A;  4ZPW R;  3O5I A;  1E15 A;  2B5U B;  3ARP A;  4QT2 A;  4W5U A;  2MNT A;  5GPG A;  2ZR4 A;  3GU0 A;  2PV1 A;  4JFM A;  1C9H A;  3AS3 A;  1LG1 A;  4MNJ A;  2PPO A;  3KAG A;  2DT1 A;  5HW7 A;  4WK9 A;  4IT6 A;  1KFW A;  1D7J A;  2A3C A;  2AOS A;  2PN0 A;  5DIU A;  2K8I A;  1U79 A;  5HTG A;  1ZB5 A;  2RSE A;  1ZU8 A;  1XHG A;  2Q5A A;  1E9L A;  2YBT A;  1QPF A;  5DIV A;  3CHC A;  3IKG A;  2FDM A;  1LJY A;  3CH9 A;  4HBE A;  1D6O A;  2DSV A;  4W9O A;  2D9F A;  2KE0 A;  2LKN A;  2IF4 A;  2DG9 A;  3CHE A;  3UI5 A;  1J4R A;  1NMV A;  2DSW A;  4O2T A;  4ODL A;  1TFV A;  3ARW A;  4TYO A;  4C02 B;  3JYM A;  1FKF A;  3NI6 A;  4Q7N A;  3RME A;  4JFJ A;  1OWQ A;  4ITZ A;  4DRP A;  5DO2 A;  2RUC A;  4ZPT R;  1Q6U A;  1WB0 A;  1W26 A;  3RM8 A;  4S3J A;  4DRN A;  1QZ2 A;  5D75 A;  1UR8 A;  3ART A;  2N87 A;  2FAP A;  2KR7 A;  4JYS A;  2XP6 A;  4JFK A;  4DRO A;  4MTV A;  3WD3 A;  4KQZ A;  3EIP A;  1W1P A;  4LAV A;  4MPK A;  2PBC A;  3KZ7 A;  1W9P A;  2F2D A;  3JXV A;  5HWB A;  2ZQT A;  3PA7 A;  4DWS A;  1FFR A;  1F40 A;  3WQV A;  1NWS A;  3FAP A;  2LGO A;  1D2K A;  4Z2I A;  2XPB A;  1NH6 A;  4LGX A;  2DG4 A;  3G6L A;  1JNS A;  3PRB A;  2O92 A;  1NSG A;  3WD0 A;  4FAP A;  1NWT A;  4ODQ A;  3RFW A;  1X6N A;  1M5Y A;  1J4I A;  3PRD A;  3UQA A;  1LL6 A;  2ZQU A;  1PBK A;  3WKZ A;  1ZBV A;  3B7X A;  4MSP A;  1L1P A;  3I6C A;  4P8U A;  3B9E A;  3IKD A;  3MDY B;  4R0X A;  2RUD A;  2O9O A;  2MPH A;  2QF8 A;  4Z2H A;  1OGB A;  4U85 A;  1FKI A;  3ARV A;  4FN2 A;  3O5Q A;  1JNE A;  3WD1 A;  1FKR A;  5HW6 A;  1FJD A;  2PPN A;  3RM4 A;  2ZR5 A;  1K9T A;  2RUQ A;  3B9D A;  2WM0 A;  3KCE A;  4URI A;  2PI6 A;  1HJX A;  4IPX A;  3KAI A;  4R5E A;  1HKK A;  2DSU A;  4ZS6 A;  1FKB A;  2PV3 A;  1JVW A;  4DIP A;  4DRH A;  3GPK A;  3O5K A;  1J4H A;  1EDQ A;  1E44 A;  1GOI A;  2KI3 A;  3CZ8 A;  4U84 A;  1FAP A;  2G8Z A;  1E6N A;  1Y0O A;  5HW8 A;  1YW5 A;  3UI6 A;  1JNT A;  4G2P A;  2DG3 A;  5GPR A;  3WL1 A;  4U86 A;  1FKS A;  2ESC A;  2LJ4 A;  3CHF A;  4WKH A;  3VAW A;  4QZV B;  4Z2K A;  1SYT A;  1FKT A;  3WIJ A;  2ZQS A;  3UQI A;  2MLY A;  1BL4 A;  4NSB A;  2PV2 A;  3NRK A;  1ZBC A;  1PIN A;  1ZBK A;  2MLX A;  4IQ2 A;  1KT0 A;  1NWR A;  1RD6 A;  1GRJ A;  2WK2 A;  3KAB A;  4HBO A;  1EYM A;  1Q6I A;  2P4V A;  3CHD A;  4MGV A;  3RGC A;  2G41 A;  4P8X A;  4TNS A;  3RM9 A;  2B31 A;  4DWS B;  3B8S A;  4J4N A;  2XP8 A;  3PR9 A;  1HKJ A;  1GUV A;  4L3N A;  3ARU A;  1BKF A;  4Z2L A;  4ML4 A;  1TCO C;  3BMB A;  3O5J A;  2Y78 A;  1UR9 A;  1E6Z A;  4LAW A;  1KT1 A;  3O5E A;  1LL7 A;  3O5O A;  4P8W A;  2ZR6 A;  4JFI A;  2M1I A;  3O5P A;  2F4E A;  4TW8 A;  4DRM A;  1VF8 A;  1FFQ A;  1NMW A;  4DWS C;  2M2A A;  1B6C A;  3UF8 A;  4ZPV R;  3ALF A;  3ODK A;  5HBF A;  2F23 A;  4L72 B;  3LUO A;  3KAH A;  1HJW A;  1XRV A;  1D7I A;  1LG2 A;  1HJV A;  4DZ2 A;  4PTM A;  1JND A;  4MNK A;  1W1T A;  4LAX A;  2XP5 A;  3JYJ A;  3AS2 A;  2DPE A;  5BXJ A;  2A3E A;  2OFN A;  4DH0 A;  3O5L A;  1FKL A;  2XP3 A;  4Q22 A;  3IHZ A;  1W1V A;  2ETN A;  4DRI A;  2KO7 A;  4Z2J A;  3O5M A;  2DT2 A;  1T11 A;  4DRK A;  3UI4 A;  2F21 A;  3ARO A;  1H0G A;  4P8V A;  5DIT A;  4DRQ A;  3AS1 A;  1FKG A;  3NTP A;  1WNO A;  3TC5 A;  4MAV A;  1LQ0 A;  4MNL A;  4DWS D;  4BF8 A;  1HKM A;  4TW6 A;  5HKG A;  4UDM A;  2DT0 A;  2DT3 A;  2XP9 A;  4IT4 A;  4WIW A;  3TCZ A;  4HAR A;  4G50 A;  1ZBW A;  2XP4 A;  3ARS A;  2KFW A;  1FD9 A;  4AY1 A;  1D7H A;  2VN1 A;  3IK8 A;  3UQB A;  1W9U A;  4TW7 A;  3AQU A;  1W1Y A;  2XP7 A;  5HUA A;  1ZK6 A;  4ODP A;  2EUL A;  2YBU A;  2A3A A;  5J6E A;  5GQB A;  3ARZ A;  2JZV A;  3O5G A;  5HWC A;  1HXV A;  1EQ3 A;  4NNR A;  3H9R B;  4S3K A;  4WKF A;  5HT1 A;  3WD4 A;  2FKE A;  3ARX A;  1P5Q A;  1Q6H A;  3EY6 A;  4TX0 A;  4LAY A;  1EHN A;  4DZ3 A;  2PPP A;  1GPF A;  2OLH A;  1FKH A;  2UZ5 A;  1WAW A;  2MF9 A;  1W9V A;  1HKI A;  1ZL1 A;  4GGQ A;  4ODR A;  4IQC A;  4NZC A;  4Z2G A;  1NWU A;  5I98 A;  4DT4 A;  3G6M A;  1A7X A;  2KGJ A;  1E6P A;  2MLZ A;  4QIB A;  3FXY A;  3ALG A;  1CTN A;  3QOK A;  1ITX A;  2VCD A;  1R9H A;  3B9A A;  2M08 A;  1EIB A; 
#chains in the Genus database with same CATH homology
 4ODM A;  4JFL A;  2AWG A;  3OOB A;  5DF0 A;  3PRA A;  1O6I A;  4GIV A;  4KR0 B;  1OGG A;  3CGN A;  3BXW A;  1ROU A;  2LPV A;  1H0I A;  1F8A B;  3O5R A;  2RQS A;  1X6L A;  2RUR A;  5DEZ A;  2A3B A;  3WL0 A;  4ODK A;  1YAT A;  3WH0 A;  1Q1C A;  4MNM A;  4XAK A;  2XPA A;  2WLY A;  1LL4 A;  2IUZ A;  3O5D A;  3OA5 A;  1FKD A;  2L2S A;  3KAD A;  1E6R A;  5B8I C;  4WJX A;  3ARR A;  4ODO A;  3CGM A;  1ZCN A;  3KAC A;  2DSZ A;  3WD2 A;  1QPL A;  3KAF A;  3ARY A;  4W9Q A;  3W4R A;  1N1A A;  3TDB A;  1FKJ A;  3O5F A;  5JH8 A;  1IX5 A;  2WLZ A;  4J4O A;  4WKA A;  3FY1 A;  1ROT A;  4QT3 A;  3WQW A;  3ARQ A;  3AS0 A;  1FKK A;  4W9P A;  1J6Y A;  1SR0 A;  4ODN A;  4DRJ A;  2ZQV A;  4N19 A;  2ITK A;  4ZPW R;  3O5I A;  1E15 A;  3ARP A;  4QT2 A;  4W5U A;  2MNT A;  5GPG A;  2ZR4 A;  2PV1 A;  4JFM A;  1C9H A;  3AS3 A;  1LG1 A;  4MNJ A;  2PPO A;  3KAG A;  2DT1 A;  5HW7 A;  4WK9 A;  4IT6 A;  1KFW A;  1D7J A;  2A3C A;  2AOS A;  5DIU A;  2K8I A;  1U79 A;  5HTG A;  1ZB5 A;  2RSE A;  1ZU8 A;  1XHG A;  2Q5A A;  1E9L A;  2YBT A;  1QPF A;  5DIV A;  3CHC A;  3IKG A;  2FDM A;  1LJY A;  3CH9 A;  4HBE A;  1D6O A;  2DSV A;  4W9O A;  2D9F A;  2KE0 A;  2LKN A;  2IF4 A;  2DG9 A;  3CHE A;  3UI5 A;  1J4R A;  1NMV A;  2DSW A;  4O2T A;  4ODL A;  1TFV A;  3ARW A;  4TYO A;  4C02 B;  3JYM A;  1FKF A;  3NI6 A;  4Q7N A;  3RME A;  4JFJ A;  1OWQ A;  4ITZ A;  4DRP A;  5DO2 A;  2RUC A;  4ZPT R;  1Q6U A;  1WB0 A;  1W26 A;  3RM8 A;  4S3J A;  4DRN A;  1QZ2 A;  5D75 A;  1UR8 A;  3ART A;  2N87 A;  2FAP A;  2KR7 A;  4JYS A;  2XP6 A;  4JFK A;  4DRO A;  4MTV A;  3WD3 A;  4KQZ A;  1W1P A;  4LAV A;  4MPK A;  2PBC A;  3KZ7 A;  1W9P A;  2F2D A;  3JXV A;  5HWB A;  2ZQT A;  3PA7 A;  4DWS A;  1FFR A;  1F40 A;  3WQV A;  1NWS A;  3FAP A;  2LGO A;  1D2K A;  4Z2I A;  2XPB A;  1NH6 A;  4LGX A;  2DG4 A;  3G6L A;  1JNS A;  3PRB A;  2O92 A;  1NSG A;  3WD0 A;  4FAP A;  1NWT A;  4ODQ A;  3RFW A;  1X6N A;  1M5Y A;  1J4I A;  3PRD A;  3UQA A;  1LL6 A;  2ZQU A;  1PBK A;  3WKZ A;  1ZBV A;  3B7X A;  4MSP A;  1L1P A;  3I6C A;  4P8U A;  3B9E A;  3IKD A;  3MDY B;  4R0X A;  2RUD A;  2O9O A;  2MPH A;  2QF8 A;  4Z2H A;  1OGB A;  4U85 A;  1FKI A;  3ARV A;  4FN2 A;  3O5Q A;  1JNE A;  3WD1 A;  1FKR A;  5HW6 A;  1FJD A;  2PPN A;  3RM4 A;  2ZR5 A;  1K9T A;  2RUQ A;  3B9D A;  2WM0 A;  3KCE A;  4URI A;  2PI6 A;  1HJX A;  4IPX A;  3KAI A;  4R5E A;  1HKK A;  2DSU A;  4ZS6 A;  1FKB A;  2PV3 A;  1JVW A;  4DIP A;  4DRH A;  3O5K A;  3GPK A;  1J4H A;  1EDQ A;  1GOI A;  2KI3 A;  3CZ8 A;  4U84 A;  1FAP A;  2G8Z A;  1E6N A;  1Y0O A;  5HW8 A;  1YW5 A;  3UI6 A;  1JNT A;  4G2P A;  2DG3 A;  5GPR A;  3WL1 A;  4U86 A;  1FKS A;  2ESC A;  2LJ4 A;  3CHF A;  4WKH A;  3VAW A;  4QZV B;  4Z2K A;  1SYT A;  1FKT A;  3WIJ A;  2ZQS A;  3UQI A;  2MLY A;  1BL4 A;  4NSB A;  2PV2 A;  3NRK A;  1ZBC A;  1PIN A;  1ZBK A;  2MLX A;  4IQ2 A;  1KT0 A;  1NWR A;  1RD6 A;  2WK2 A;  3KAB A;  4HBO A;  1EYM A;  1Q6I A;  3CHD A;  4MGV A;  3RGC A;  2G41 A;  4P8X A;  4TNS A;  3RM9 A;  2B31 A;  4DWS B;  3B8S A;  4J4N A;  2XP8 A;  3PR9 A;  1HKJ A;  1GUV A;  4L3N A;  3ARU A;  1BKF A;  4Z2L A;  4ML4 A;  1TCO C;  3O5J A;  2Y78 A;  1UR9 A;  1E6Z A;  4LAW A;  1KT1 A;  3O5E A;  1LL7 A;  3O5O A;  4P8W A;  2ZR6 A;  4JFI A;  2M1I A;  3O5P A;  2F4E A;  4TW8 A;  4DRM A;  1VF8 A;  1FFQ A;  1NMW A;  4DWS C;  2M2A A;  1B6C A;  3UF8 A;  4ZPV R;  3ALF A;  3ODK A;  5HBF A;  4L72 B;  3LUO A;  3KAH A;  1HJW A;  1XRV A;  1D7I A;  1LG2 A;  1HJV A;  4DZ2 A;  4PTM A;  1JND A;  4MNK A;  1W1T A;  4LAX A;  2XP5 A;  3JYJ A;  3AS2 A;  2DPE A;  5BXJ A;  2A3E A;  2OFN A;  4DH0 A;  3O5L A;  1FKL A;  2XP3 A;  4Q22 A;  3IHZ A;  1W1V A;  4DRI A;  2KO7 A;  4Z2J A;  3O5M A;  2DT2 A;  1T11 A;  4DRK A;  3UI4 A;  2F21 A;  3ARO A;  1H0G A;  4P8V A;  5DIT A;  4DRQ A;  3AS1 A;  1FKG A;  3NTP A;  1WNO A;  3TC5 A;  4MAV A;  1LQ0 A;  4MNL A;  4DWS D;  4BF8 A;  1HKM A;  4TW6 A;  5HKG A;  2DT0 A;  2DT3 A;  2XP9 A;  4IT4 A;  4WIW A;  3TCZ A;  4HAR A;  4G50 A;  1ZBW A;  2XP4 A;  3ARS A;  2KFW A;  1FD9 A;  4AY1 A;  1D7H A;  2VN1 A;  3IK8 A;  3UQB A;  1W9U A;  4TW7 A;  3AQU A;  1W1Y A;  2XP7 A;  5HUA A;  1ZK6 A;  4ODP A;  2YBU A;  2A3A A;  5J6E A;  5GQB A;  3ARZ A;  2JZV A;  3O5G A;  5HWC A;  1HXV A;  1EQ3 A;  4NNR A;  3H9R B;  4S3K A;  4WKF A;  5HT1 A;  3WD4 A;  2FKE A;  3ARX A;  1P5Q A;  1Q6H A;  3EY6 A;  4TX0 A;  4LAY A;  1EHN A;  4DZ3 A;  2PPP A;  1GPF A;  2OLH A;  1FKH A;  2UZ5 A;  1WAW A;  2MF9 A;  1W9V A;  1HKI A;  1ZL1 A;  4GGQ A;  4ODR A;  4IQC A;  4NZC A;  4Z2G A;  1NWU A;  5I98 A;  4DT4 A;  3G6M A;  1A7X A;  2KGJ A;  1E6P A;  2MLZ A;  4QIB A;  3FXY A;  3ALG A;  1CTN A;  3QOK A;  1ITX A;  2VCD A;  1R9H A;  3B9A A;  2M08 A;  1EIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...