1FKTA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
total genus 19
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fktA00
1PINA 1JNTA 2KO7A 1FD9A 3KABA 5HW6A 2F4EA 3ODKA 4GIVA 2LJ4A 4ODMA 2LGOA 3NRKA 3UI5A 2XP4A 1FKBA 4NNRA 1FKHA 4C02B 1J6YA 4DZ3A 4MGVA 1J4HA 4LAXA 3O5KA 4FN2A 2IF4A 3CGNA 2JZVA 4IPXA 3KAFA 2KGJA 1BKFA 2XP9A 1D7JA 2Y78A 1FKJA 2RUDA 2ZQTA 3LUOA 4IQCA 4JFKA 4QT3A 2PPNA 4U86A 5HWCA 3RFWA 2LPVA 4DROA 2KE0A 4JFIA 1FAPA 1FKKA 1ZK6A 2ZQVA 2RUQA 2VN1A 3O5JA 2F21A 2KR7A 1FKIA 3UQIA 2XP6A 4W9OA 1W26A 1QPFA 3FAPA 1T11A 4TX0A 2RURA 2XP3A 2ZR6A 1ZCNA 4DT4A 4MSPA 4DH0A 2M1IA 1D6OA 2PV3A 4DRIA 3IKDA 1R9HA 1HXVA 3IHZA 3I6CA 3UF8A 5HW7A 2OFNA 4ITZA 4ODQA 1FKTA 4DRQA 1FKSA 2MLYA 4TNSA 1QZ2A 3O5MA 5HUAA 3PRBA 2PV2A 1M5YA 1FKRA 2FAPA 2PV1A 1NMWA 1L1PA 3JYMA 1JVWA 2M08A 1Q1CA 4ODOA 1EQ3A 4BF8A 1C9HA 4W9PA 5HW8A 1FKFA 2K8IA 2ZR5A 3UI4A 3WH0A 3UQBA 1Q6HA 2MF9A 4G2PA 4JFMA 5GPGA 4ODNA 1ROUA 1KT1A 4G50A 4JFJA 5I98A 5J6EA 2KI3A 4TW8A 4LAWA 2XP7A 4IQ2A 4TW6A 5BXJA 1TCOC 2ZR4A 2VCDA 1A7XA 2XP8A 3JYJA 3KADA 5DIUA 4J4NA 1FKDA 3O5PA 3O5RA 3RGCA 2RUCA 3IKGA 4DRKA 4DZ2A 3CGMA 2DG3A 4JYSA 4R0XA 3O5OA 1KT0A 4GGQA 3UQAA 3KAHA 1ROTA 2KFWA 2MNTA 2PBCA 3JXVA 5DITA 2Q5AA 4QT2A 4ODPA 3B7XA 4N19A 3PA7A 1F8AB 3IK8A 4U85A 3MDYB 4DRPA 2ZQSA 2XP5A 3KAIA 1YW5A 4W9QA 3TCZA 2N87A 1QPLA 5HTGA 3NTPA 2MLZA 1FKLA 1D7IA 3O5IA 2M2AA 3EY6A 5HKGA 3KCEA 1B6CA 3O5QA 2UZ5A 4TW7A 4J4OA 5D75A 2L2SA 4LAYA 4TYOA 1NMVA 1FKGA 4QIBA 1YATA 2PPOA 4LAVA 1U79A 1J4RA 2F2DA 4DRMA 3O5FA 2ITKA 4ODKA 1BL4A 4U84A 2DG9A 3TC5A 2PPPA 3VAWA 2AWGA 3KZ7A 5DIVA 1PBKA 1EYMA 1N1AA 3O5EA 3O5DA 2D9FA 1Q6UA 4ODRA 3NI6A 3OOBA 1D7HA 2RSEA 1P5QA 3O5GA 4DRHA 1J4IA 1NSGA 2LKNA 4ODLA 2MPHA 3KACA 1FJDA 4DRJA 2XPBA 5HWBA 1F40A 1Q6IA 2XPAA 5HT1A 4O2TA 3UI6A 2RQSA 2ZQUA 3O5LA 4JFLA 3H9RB 3KAGA 4DIPA 3GPKA 3PRDA 2FKEA 1JNSA 4FAPA 5B8IC 4DRNA 1Y0OA 2MLXA 3TDBA 2DG4A
chains in the Genus database with same CATH superfamily
1PINA 1JNTA 1FFQA 4GIVA 4ODMA 5HBFA 1FKBA 1NH6A 3BMBA 4DWSB 1NWSA 4DZ3A 2JZVA 1W9VA 4WK9A 3UQBA 2XP9A 1D7JA 4IQCA 3ARXA 2LPVA 4P8VA 1WNOA 4JFIA 1ZK6A 3G6LA 2ETNA 3FXYA 1FKIA 1XRVA 3UQIA 1W26A 1QPFA 3B8SA 1JNDA 1E9LA 4URIA 1CTNA 2DSZA 1ZBCA 3IHZA 3I6CA 4MNLA 4ODQA 1E15A 4TNSA 1KFWA 3ARPA 4P8XA 1E6NA 1FKRA 1LJYA 2DSVA 2M08A 3AROA 5DF0A 3WKZA 2DT0A 1OWQA 3WH0A 3WIJA 5J6EA 1ROUA 1KT1A 4JFJA 4ZPVR 3WD3A 2KI3A 4IQ2A 5BXJA 1TCOC 2ZR4A 2VCDA 4ZPWR 4DZ2A 2A3BA 4DRKA 4JYSA 4R0XA 1K9TA 1KT0A 2PBCA 2KFWA 2WM0A 5DITA 4QT2A 4ODPA 3PA7A 4L72B 4MAVA 3IK8A 1JCHB 4U85A 4DRPA 2ZQSA 3KAIA 1YW5A 4UDMA 4W9QA 3TCZA 1NWUA 2WLZA 2M2AA 3PRAA 3KCEA 3ARZA 4TYOA 3BXWA 4QIBA 1YATA 1E44A 1J4RA 2ESCA 4DRMA 3TC5A 4WJXA 1X6LA 1IX5A 5DO2A 1N1AA 1E6ZA 3ALGA 4IT4A 3NI6A 4DWSA 5GQBA 1H0IA 2DSUA 3G6MA 1GRJA 4MNKA 3CHFA 1NSGA 3CHCA 4IT6A 2XPBA 2DSWA 1HJXA 1F40A 1HKJA 1Q6IA 2XPAA 5HT1A 1LQ0A 4O2TA 2O92A 2ZQUA 3H9RB 2FKEA 5HWCA 2LJ4A 2LGOA 3UI5A 2XP4A 3ARUA 4MGVA 3WQWA 3O5KA 4FN2A 3KAFA 3WD4A 1BKFA 2Y78A 3B9AA 1FKJA 4QT3A 4U86A 4WKFA 1EHNA 3RFWA 2KE0A 1FKKA 2ZQVA 2G41A 3O5JA 2EULA 2F21A 1ITXA 2KR7A 4DT4A 4DRIA 3ARVA 2QF8A 1R9HA 4ZPTR 2OFNA 2PN0A 4ITZA 4DRQA 2MLYA 5HUAA 1FFRA 1M5YA 1NMWA 1L1PA 3JYMA 1C9HA 1Q6HA 2MF9A 4ODNA 1W1VA 3QOKA 4ML4A 1UR8A 4P8UA 1NWTA 3O5PA 3RGCA 3IKGA 1HJVA 1O6IA 3O5OA 2A3EA 1LL6A 3JXVA 2Q5AA 4N19A 1H0GA 2XP5A 4WKHA 3W4RA 2N87A 3B9DA 5HTGA 3NTPA 4ZS6A 4Z2KA 1FKLA 1D7IA 4DWSD 5HKGA 3O5QA 2UZ5A 2YBUA 4LAYA 4LAVA 2ITKA 3WL1A 4U84A 3VAWA 1HKKA 3KZ7A 1PBKA 1LL7A 3CHDA 2WLYA 1E6PA 3OOBA 3WD0A 2RSEA 1P5QA 4Z2GA 4ODLA 1LG1A 1RD6A 5HWBA 2YBTA 4LGXA 2RQSA 5JH8A 3O5LA 4JFLA 3GPKA 1W1TA 1VF8A 5B8IC 4DH0A 3UI4A 3NRKA 2KO7A 3B9EA 1FD9A 1EDQA 4Z2LA 1FKHA 1HJWA 1J4HA 4LAXA 1ZU8A 3CGNA 3RM4A 2KGJA 2ZQTA 2PPNA 3ARRA 1GOIA 1LL4A 4HBEA 3AQUA 3AS0A 2XP6A 4W9OA 3FAPA 2ZR6A 1GPFA 4MSPA 2M1IA 1D6OA 2PV3A 3IKDA 1X6NA 5HW7A 1EIBA 2OLHA 1FKSA 3ARSA 3AS1A 1QZ2A 3O5MA 4XAKA 2PV2A 1LG2A 4Z2HA 4W5UA 2PV1A 2G8ZA 3CHEA 4W9PA 1FKFA 2IUZA 2FDMA 3PR9A 5I98A 4TW8A 1ZL1A 2XP7A 2XP8A 1A7XA 3JYJA 5DIUA 1FKDA 3O5RA 4MNJA 2RUCA 3ARWA 4MNMA 3CGMA 2B31A 2DG3A 1W9PA 3UQAA 1W1YA 2MNTA 1ZBKA 1ZBVA 4KQZA 1F8AB 3WL0A 3GTYX 3ALFA 1QPLA 1JNEA 1TFVA 3O5IA 3ARQA 4TW7A 3ARYA 2L2SA 1OGBA 1NMVA 1FKGA 1U79A 2F2DA 3O5FA 4ODKA 3ARTA 2DG9A 2DT3A 2AWGA 2AOSA 1EYMA 5GPRA 4ODRA 1ZBWA 1WB0A 4DRHA 1OGGA 2DPEA 3KACA 4Z2IA 1FJDA 1WAWA 3KAGA 1JNSA 4L3NA 2A3CA 4FAPA 1Y0OA 4DROA 1NWRA 2DG4A 3TDBA 5HW6A 3KABA 1HKMA 2F4EA 3ODKA 1W9UA 2PI6A 4Q22A 4NNRA 4C02B 1J6YA 1ZB5A 3WQVA 4KR0B 2IF4A 4IPXA 3AS3A 2P4VA 3LUOA 4MTVA 2RUDA 4JFKA 4WIWA 4S3KA 1FAPA 1D2KA 2RUQA 2VN1A 4MPKA 4S3JA 1T11A 4TX0A 2RURA 2XP3A 1ZCNA 1HXVA 3UF8A 1FKTA 4QZVB 1SR0A 4HARA 4NZCA 3PRBA 3GU0A 4Q7NA 2FAPA 1JVWA 1Q1CA 4ODOA 1EQ3A 3RMEA 4WKAA 3FY1A 4BF8A 5HW8A 2ZR5A 2K8IA 5DEZA 5GPGA 4JFMA 4G2PA 4G50A 2F23A 2WK2A 4LAWA 4TW6A 3KADA 4J4NA 1UR9A 3WD2A 4GGQA 4Z2JA 3KAHA 1ROTA 1W1PA 3B7XA 3MDYB 1SYTA 2MLZA 3EY6A 1B6CA 4J4OA 5D75A 2DT2A 3CH9A 2PPOA 4HBOA 1E6RA 1BL4A 1XHGA 2PPPA 4R5EA 5DIVA 2O9OA 3RM8A 3O5EA 3O5DA 2D9FA 1Q6UA 4P8WA 3RM9A 4DWSC 4NSBA 3EIPA 1D7HA 3O5GA 3OA5A 1J4IA 1GUVA 2B5UB 2LKNA 2MPHA 4DRJA 4AY1A 1HKIA 3AS2A 3WD1A 3UI6A 3CZ8A 4DIPA 3PRDA 4PTMA 4DRNA 2A3AA 2DT1A 2MLXA
chains in the Genus database with same CATH topology
1PINA 1JNTA 1FFQA 4GIVA 4ODMA 5HBFA 1FKBA 1NH6A 4DWSB 1NWSA 4DZ3A 2JZVA 1W9VA 4WK9A 3UQBA 2XP9A 1D7JA 4IQCA 3ARXA 2LPVA 4P8VA 1WNOA 4JFIA 1ZK6A 3G6LA 3FXYA 1FKIA 1XRVA 3UQIA 1W26A 1QPFA 3B8SA 1JNDA 1E9LA 4URIA 1CTNA 2DSZA 1ZBCA 3IHZA 3I6CA 4MNLA 4ODQA 1E15A 4TNSA 1KFWA 3ARPA 4P8XA 1E6NA 1FKRA 1LJYA 2DSVA 2M08A 3AROA 5DF0A 3WKZA 2DT0A 1OWQA 3WH0A 3WIJA 5J6EA 1ROUA 1KT1A 4JFJA 4ZPVR 3WD3A 2KI3A 4IQ2A 5BXJA 1TCOC 2ZR4A 2VCDA 4ZPWR 4DZ2A 2A3BA 4DRKA 4JYSA 4R0XA 1K9TA 1KT0A 2PBCA 2KFWA 2WM0A 5DITA 4QT2A 4ODPA 3PA7A 4L72B 4MAVA 3IK8A 4U85A 4DRPA 2ZQSA 3KAIA 1YW5A 4W9QA 3TCZA 1NWUA 2WLZA 2M2AA 3PRAA 3KCEA 3ARZA 4TYOA 3BXWA 4QIBA 1YATA 1J4RA 2ESCA 4DRMA 3TC5A 4WJXA 1X6LA 1IX5A 5DO2A 1N1AA 1E6ZA 3ALGA 4IT4A 3NI6A 4DWSA 5GQBA 1H0IA 2DSUA 3G6MA 4MNKA 3CHFA 1NSGA 3CHCA 4IT6A 2XPBA 2DSWA 1HJXA 1F40A 1HKJA 1Q6IA 2XPAA 5HT1A 1LQ0A 4O2TA 2O92A 2ZQUA 3H9RB 2FKEA 5HWCA 2LJ4A 2LGOA 3UI5A 2XP4A 3ARUA 4MGVA 3WQWA 3O5KA 4FN2A 3KAFA 3WD4A 1BKFA 2Y78A 3B9AA 1FKJA 4QT3A 4U86A 4WKFA 1EHNA 3RFWA 2KE0A 1FKKA 2ZQVA 2G41A 3O5JA 2F21A 1ITXA 2KR7A 4DT4A 4DRIA 3ARVA 2QF8A 1R9HA 4ZPTR 2OFNA 4ITZA 4DRQA 2MLYA 5HUAA 1FFRA 1M5YA 1NMWA 1L1PA 3JYMA 1C9HA 1Q6HA 2MF9A 4ODNA 1W1VA 3QOKA 4ML4A 1UR8A 4P8UA 1NWTA 3O5PA 3RGCA 3IKGA 1HJVA 1O6IA 3O5OA 2A3EA 1LL6A 3JXVA 2Q5AA 4N19A 1H0GA 2XP5A 4WKHA 3W4RA 2N87A 3B9DA 5HTGA 3NTPA 4ZS6A 4Z2KA 1FKLA 1D7IA 4DWSD 5HKGA 3O5QA 2UZ5A 2YBUA 4LAYA 4LAVA 2ITKA 3WL1A 4U84A 3VAWA 1HKKA 3KZ7A 1PBKA 1LL7A 3CHDA 2WLYA 1E6PA 3OOBA 3WD0A 2RSEA 1P5QA 4Z2GA 4ODLA 1LG1A 1RD6A 5HWBA 2YBTA 4LGXA 2RQSA 5JH8A 3O5LA 4JFLA 3GPKA 1W1TA 1VF8A 5B8IC 4DH0A 3UI4A 3NRKA 2KO7A 3B9EA 1FD9A 1EDQA 4Z2LA 1FKHA 1HJWA 1J4HA 4LAXA 1ZU8A 3CGNA 3RM4A 2KGJA 2ZQTA 2PPNA 3ARRA 1GOIA 1LL4A 4HBEA 3AQUA 3AS0A 2XP6A 4W9OA 3FAPA 2ZR6A 1GPFA 4MSPA 2M1IA 1D6OA 2PV3A 3IKDA 1X6NA 5HW7A 1EIBA 2OLHA 1FKSA 3ARSA 3AS1A 1QZ2A 3O5MA 4XAKA 2PV2A 1LG2A 4Z2HA 4W5UA 2PV1A 2G8ZA 3CHEA 4W9PA 1FKFA 2IUZA 2FDMA 3PR9A 5I98A 4TW8A 1ZL1A 2XP7A 2XP8A 1A7XA 3JYJA 5DIUA 1FKDA 3O5RA 4MNJA 2RUCA 3ARWA 4MNMA 3CGMA 2B31A 2DG3A 1W9PA 3UQAA 1W1YA 2MNTA 1ZBKA 1ZBVA 4KQZA 1F8AB 3WL0A 3ALFA 1QPLA 1JNEA 1TFVA 3O5IA 3ARQA 4TW7A 3ARYA 2L2SA 1OGBA 1NMVA 1FKGA 1U79A 2F2DA 3O5FA 4ODKA 3ARTA 2DG9A 2DT3A 2AWGA 2AOSA 1EYMA 5GPRA 4ODRA 1ZBWA 1WB0A 4DRHA 1OGGA 2DPEA 3KACA 4Z2IA 1FJDA 1WAWA 3KAGA 1JNSA 4L3NA 2A3CA 4FAPA 1Y0OA 4DROA 1NWRA 2DG4A 3TDBA 5HW6A 3KABA 1HKMA 2F4EA 3ODKA 1W9UA 2PI6A 4Q22A 4NNRA 4C02B 1J6YA 1ZB5A 3WQVA 4KR0B 2IF4A 4IPXA 3AS3A 3LUOA 4MTVA 2RUDA 4JFKA 4WIWA 4S3KA 1FAPA 1D2KA 2RUQA 2VN1A 4MPKA 4S3JA 1T11A 4TX0A 2RURA 2XP3A 1ZCNA 1HXVA 3UF8A 1FKTA 4QZVB 1SR0A 4HARA 4NZCA 3PRBA 4Q7NA 2FAPA 1JVWA 1Q1CA 4ODOA 1EQ3A 3RMEA 4WKAA 3FY1A 4BF8A 5HW8A 2ZR5A 2K8IA 5DEZA 5GPGA 4JFMA 4G2PA 4G50A 2WK2A 4LAWA 4TW6A 3KADA 4J4NA 1UR9A 3WD2A 4GGQA 4Z2JA 3KAHA 1ROTA 1W1PA 3B7XA 3MDYB 1SYTA 2MLZA 3EY6A 1B6CA 4J4OA 5D75A 2DT2A 3CH9A 2PPOA 4HBOA 1E6RA 1BL4A 1XHGA 2PPPA 4R5EA 5DIVA 2O9OA 3RM8A 3O5EA 3O5DA 2D9FA 1Q6UA 4P8WA 3RM9A 4DWSC 4NSBA 1D7HA 3O5GA 3OA5A 1J4IA 1GUVA 2LKNA 2MPHA 4DRJA 4AY1A 1HKIA 3AS2A 3WD1A 3UI6A 3CZ8A 4DIPA 3PRDA 4PTMA 4DRNA 2A3AA 2DT1A 2MLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  1JNT A;  2KO7 A;  1FD9 A;  3KAB A;  5HW6 A;  2F4E A;  3ODK A;  4GIV A;  2LJ4 A;  4ODM A;  2LGO A;  3NRK A;  3UI5 A;  2XP4 A;  1FKB A;  4NNR A;  1FKH A;  4C02 B;  1J6Y A;  4DZ3 A;  4MGV A;  1J4H A;  4LAX A;  3O5K A;  4FN2 A;  2IF4 A;  3CGN A;  2JZV A;  4IPX A;  3KAF A;  2KGJ A;  1BKF A;  2XP9 A;  1D7J A;  2Y78 A;  1FKJ A;  2RUD A;  2ZQT A;  3LUO A;  4IQC A;  4JFK A;  4QT3 A;  2PPN A;  4U86 A;  5HWC A;  3RFW A;  2LPV A;  4DRO A;  2KE0 A;  4JFI A;  1FAP A;  1FKK A;  1ZK6 A;  2ZQV A;  2RUQ A;  2VN1 A;  3O5J A;  2F21 A;  2KR7 A;  1FKI A;  3UQI A;  2XP6 A;  4W9O A;  1W26 A;  1QPF A;  3FAP A;  1T11 A;  4TX0 A;  2RUR A;  2XP3 A;  2ZR6 A;  1ZCN A;  4DT4 A;  4MSP A;  4DH0 A;  2M1I A;  1D6O A;  2PV3 A;  4DRI A;  3IKD A;  1R9H A;  1HXV A;  3IHZ A;  3I6C A;  3UF8 A;  5HW7 A;  2OFN A;  4ITZ A;  4ODQ A;  1FKT A;  4DRQ A;  1FKS A;  2MLY A;  4TNS A;  1QZ2 A;  3O5M A;  5HUA A;  3PRB A;  2PV2 A;  1M5Y A;  1FKR A;  2FAP A;  2PV1 A;  1NMW A;  1L1P A;  3JYM A;  1JVW A;  2M08 A;  1Q1C A;  4ODO A;  1EQ3 A;  4BF8 A;  1C9H A;  4W9P A;  5HW8 A;  1FKF A;  2K8I A;  2ZR5 A;  3UI4 A;  3WH0 A;  3UQB A;  1Q6H A;  2MF9 A;  4G2P A;  4JFM A;  5GPG A;  4ODN A;  1ROU A;  1KT1 A;  4G50 A;  4JFJ A;  5I98 A;  5J6E A;  2KI3 A;  4TW8 A;  4LAW A;  2XP7 A;  4IQ2 A;  4TW6 A;  5BXJ A;  1TCO C;  2ZR4 A;  2VCD A;  1A7X A;  2XP8 A;  3JYJ A;  3KAD A;  5DIU A;  4J4N A;  1FKD A;  3O5P A;  3O5R A;  3RGC A;  2RUC A;  3IKG A;  4DRK A;  4DZ2 A;  3CGM A;  2DG3 A;  4JYS A;  4R0X A;  3O5O A;  1KT0 A;  4GGQ A;  3UQA A;  3KAH A;  1ROT A;  2KFW A;  2MNT A;  2PBC A;  3JXV A;  5DIT A;  2Q5A A;  4QT2 A;  4ODP A;  3B7X A;  4N19 A;  3PA7 A;  1F8A B;  3IK8 A;  4U85 A;  3MDY B;  4DRP A;  2ZQS A;  2XP5 A;  3KAI A;  1YW5 A;  4W9Q A;  3TCZ A;  2N87 A;  1QPL A;  5HTG A;  3NTP A;  2MLZ A;  1FKL A;  1D7I A;  3O5I A;  2M2A A;  3EY6 A;  5HKG A;  3KCE A;  1B6C A;  3O5Q A;  2UZ5 A;  4TW7 A;  4J4O A;  5D75 A;  2L2S A;  4LAY A;  4TYO A;  1NMV A;  1FKG A;  4QIB A;  1YAT A;  2PPO A;  4LAV A;  1U79 A;  1J4R A;  2F2D A;  4DRM A;  3O5F A;  2ITK A;  4ODK A;  1BL4 A;  4U84 A;  2DG9 A;  3TC5 A;  2PPP A;  3VAW A;  2AWG A;  3KZ7 A;  5DIV A;  1PBK A;  1EYM A;  1N1A A;  3O5E A;  3O5D A;  2D9F A;  1Q6U A;  4ODR A;  3NI6 A;  3OOB A;  1D7H A;  2RSE A;  1P5Q A;  3O5G A;  4DRH A;  1J4I A;  1NSG A;  2LKN A;  4ODL A;  2MPH A;  3KAC A;  1FJD A;  4DRJ A;  2XPB A;  5HWB A;  1F40 A;  1Q6I A;  2XPA A;  5HT1 A;  4O2T A;  3UI6 A;  2RQS A;  2ZQU A;  3O5L A;  4JFL A;  3H9R B;  3KAG A;  4DIP A;  3GPK A;  3PRD A;  2FKE A;  1JNS A;  4FAP A;  5B8I C;  4DRN A;  1Y0O A;  2MLX A;  3TDB A;  2DG4 A; 
#chains in the Genus database with same CATH topology
 1PIN A;  1JNT A;  1FFQ A;  4GIV A;  4ODM A;  5HBF A;  1FKB A;  1NH6 A;  3BMB A;  4DWS B;  1NWS A;  4DZ3 A;  2JZV A;  1W9V A;  4WK9 A;  3UQB A;  2XP9 A;  1D7J A;  4IQC A;  3ARX A;  2LPV A;  4P8V A;  1WNO A;  4JFI A;  1ZK6 A;  3G6L A;  2ETN A;  3FXY A;  1FKI A;  1XRV A;  3UQI A;  1W26 A;  1QPF A;  3B8S A;  1JND A;  1E9L A;  4URI A;  1CTN A;  2DSZ A;  1ZBC A;  3IHZ A;  3I6C A;  4MNL A;  4ODQ A;  1E15 A;  4TNS A;  1KFW A;  3ARP A;  4P8X A;  1E6N A;  1FKR A;  1LJY A;  2DSV A;  2M08 A;  3ARO A;  5DF0 A;  3WKZ A;  2DT0 A;  1OWQ A;  3WH0 A;  3WIJ A;  5J6E A;  1ROU A;  1KT1 A;  4JFJ A;  4ZPV R;  3WD3 A;  2KI3 A;  4IQ2 A;  5BXJ A;  1TCO C;  2ZR4 A;  2VCD A;  4ZPW R;  4DZ2 A;  2A3B A;  4DRK A;  4JYS A;  4R0X A;  1K9T A;  1KT0 A;  2PBC A;  2KFW A;  2WM0 A;  5DIT A;  4QT2 A;  4ODP A;  3PA7 A;  4L72 B;  4MAV A;  3IK8 A;  1JCH B;  4U85 A;  4DRP A;  2ZQS A;  3KAI A;  1YW5 A;  4UDM A;  4W9Q A;  3TCZ A;  1NWU A;  2WLZ A;  2M2A A;  3PRA A;  3KCE A;  3ARZ A;  4TYO A;  3BXW A;  4QIB A;  1YAT A;  1E44 A;  1J4R A;  2ESC A;  4DRM A;  3TC5 A;  4WJX A;  1X6L A;  1IX5 A;  5DO2 A;  1N1A A;  1E6Z A;  3ALG A;  4IT4 A;  3NI6 A;  4DWS A;  5GQB A;  1H0I A;  2DSU A;  3G6M A;  1GRJ A;  4MNK A;  3CHF A;  1NSG A;  3CHC A;  4IT6 A;  2XPB A;  2DSW A;  1HJX A;  1F40 A;  1HKJ A;  1Q6I A;  2XPA A;  5HT1 A;  1LQ0 A;  4O2T A;  2O92 A;  2ZQU A;  3H9R B;  2FKE A;  5HWC A;  2LJ4 A;  2LGO A;  3UI5 A;  2XP4 A;  3ARU A;  4MGV A;  3WQW A;  3O5K A;  4FN2 A;  3KAF A;  3WD4 A;  1BKF A;  2Y78 A;  3B9A A;  1FKJ A;  4QT3 A;  4U86 A;  4WKF A;  1EHN A;  3RFW A;  2KE0 A;  1FKK A;  2ZQV A;  2G41 A;  3O5J A;  2EUL A;  2F21 A;  1ITX A;  2KR7 A;  4DT4 A;  4DRI A;  3ARV A;  2QF8 A;  1R9H A;  4ZPT R;  2OFN A;  2PN0 A;  4ITZ A;  4DRQ A;  2MLY A;  5HUA A;  1FFR A;  1M5Y A;  1NMW A;  1L1P A;  3JYM A;  1C9H A;  1Q6H A;  2MF9 A;  4ODN A;  1W1V A;  3QOK A;  4ML4 A;  1UR8 A;  4P8U A;  1NWT A;  3O5P A;  3RGC A;  3IKG A;  1HJV A;  1O6I A;  3O5O A;  2A3E A;  1LL6 A;  3JXV A;  2Q5A A;  4N19 A;  1H0G A;  2XP5 A;  4WKH A;  3W4R A;  2N87 A;  3B9D A;  5HTG A;  3NTP A;  4ZS6 A;  4Z2K A;  1FKL A;  1D7I A;  4DWS D;  5HKG A;  3O5Q A;  2UZ5 A;  2YBU A;  4LAY A;  4LAV A;  2ITK A;  3WL1 A;  4U84 A;  3VAW A;  1HKK A;  3KZ7 A;  1PBK A;  1LL7 A;  3CHD A;  2WLY A;  1E6P A;  3OOB A;  3WD0 A;  2RSE A;  1P5Q A;  4Z2G A;  4ODL A;  1LG1 A;  1RD6 A;  5HWB A;  2YBT A;  4LGX A;  2RQS A;  5JH8 A;  3O5L A;  4JFL A;  3GPK A;  1W1T A;  1VF8 A;  5B8I C;  4DH0 A;  3UI4 A;  3NRK A;  2KO7 A;  3B9E A;  1FD9 A;  1EDQ A;  4Z2L A;  1FKH A;  1HJW A;  1J4H A;  4LAX A;  1ZU8 A;  3CGN A;  3RM4 A;  2KGJ A;  2ZQT A;  2PPN A;  3ARR A;  1GOI A;  1LL4 A;  4HBE A;  3AQU A;  3AS0 A;  2XP6 A;  4W9O A;  3FAP A;  2ZR6 A;  1GPF A;  4MSP A;  2M1I A;  1D6O A;  2PV3 A;  3IKD A;  1X6N A;  5HW7 A;  1EIB A;  2OLH A;  1FKS A;  3ARS A;  3AS1 A;  1QZ2 A;  3O5M A;  4XAK A;  2PV2 A;  1LG2 A;  4Z2H A;  4W5U A;  2PV1 A;  2G8Z A;  3CHE A;  4W9P A;  1FKF A;  2IUZ A;  2FDM A;  3PR9 A;  5I98 A;  4TW8 A;  1ZL1 A;  2XP7 A;  2XP8 A;  1A7X A;  3JYJ A;  5DIU A;  1FKD A;  3O5R A;  4MNJ A;  2RUC A;  3ARW A;  4MNM A;  3CGM A;  2B31 A;  2DG3 A;  1W9P A;  3UQA A;  1W1Y A;  2MNT A;  1ZBK A;  1ZBV A;  4KQZ A;  1F8A B;  3WL0 A;  3GTY X;  3ALF A;  1QPL A;  1JNE A;  1TFV A;  3O5I A;  3ARQ A;  4TW7 A;  3ARY A;  2L2S A;  1OGB A;  1NMV A;  1FKG A;  1U79 A;  2F2D A;  3O5F A;  4ODK A;  3ART A;  2DG9 A;  2DT3 A;  2AWG A;  2AOS A;  1EYM A;  5GPR A;  4ODR A;  1ZBW A;  1WB0 A;  4DRH A;  1OGG A;  2DPE A;  3KAC A;  4Z2I A;  1FJD A;  1WAW A;  3KAG A;  1JNS A;  4L3N A;  2A3C A;  4FAP A;  1Y0O A;  4DRO A;  1NWR A;  2DG4 A;  3TDB A;  5HW6 A;  3KAB A;  1HKM A;  2F4E A;  3ODK A;  1W9U A;  2PI6 A;  4Q22 A;  4NNR A;  4C02 B;  1J6Y A;  1ZB5 A;  3WQV A;  4KR0 B;  2IF4 A;  4IPX A;  3AS3 A;  2P4V A;  3LUO A;  4MTV A;  2RUD A;  4JFK A;  4WIW A;  4S3K A;  1FAP A;  1D2K A;  2RUQ A;  2VN1 A;  4MPK A;  4S3J A;  1T11 A;  4TX0 A;  2RUR A;  2XP3 A;  1ZCN A;  1HXV A;  3UF8 A;  1FKT A;  4QZV B;  1SR0 A;  4HAR A;  4NZC A;  3PRB A;  3GU0 A;  4Q7N A;  2FAP A;  1JVW A;  1Q1C A;  4ODO A;  1EQ3 A;  3RME A;  4WKA A;  3FY1 A;  4BF8 A;  5HW8 A;  2ZR5 A;  2K8I A;  5DEZ A;  5GPG A;  4JFM A;  4G2P A;  4G50 A;  2F23 A;  2WK2 A;  4LAW A;  4TW6 A;  3KAD A;  4J4N A;  1UR9 A;  3WD2 A;  4GGQ A;  4Z2J A;  3KAH A;  1ROT A;  1W1P A;  3B7X A;  3MDY B;  1SYT A;  2MLZ A;  3EY6 A;  1B6C A;  4J4O A;  5D75 A;  2DT2 A;  3CH9 A;  2PPO A;  4HBO A;  1E6R A;  1BL4 A;  1XHG A;  2PPP A;  4R5E A;  5DIV A;  2O9O A;  3RM8 A;  3O5E A;  3O5D A;  2D9F A;  1Q6U A;  4P8W A;  3RM9 A;  4DWS C;  4NSB A;  3EIP A;  1D7H A;  3O5G A;  3OA5 A;  1J4I A;  1GUV A;  2B5U B;  2LKN A;  2MPH A;  4DRJ A;  4AY1 A;  1HKI A;  3AS2 A;  3WD1 A;  3UI6 A;  3CZ8 A;  4DIP A;  3PRD A;  4PTM A;  4DRN A;  2A3A A;  2DT1 A;  2MLX A; 
#chains in the Genus database with same CATH homology
 1PIN A;  1JNT A;  1FFQ A;  4GIV A;  4ODM A;  5HBF A;  1FKB A;  1NH6 A;  4DWS B;  1NWS A;  4DZ3 A;  2JZV A;  1W9V A;  4WK9 A;  3UQB A;  2XP9 A;  1D7J A;  4IQC A;  3ARX A;  2LPV A;  4P8V A;  1WNO A;  4JFI A;  1ZK6 A;  3G6L A;  3FXY A;  1FKI A;  1XRV A;  3UQI A;  1W26 A;  1QPF A;  3B8S A;  1JND A;  1E9L A;  4URI A;  1CTN A;  2DSZ A;  1ZBC A;  3IHZ A;  3I6C A;  4MNL A;  4ODQ A;  1E15 A;  4TNS A;  1KFW A;  3ARP A;  4P8X A;  1E6N A;  1FKR A;  1LJY A;  2DSV A;  2M08 A;  3ARO A;  5DF0 A;  3WKZ A;  2DT0 A;  1OWQ A;  3WH0 A;  3WIJ A;  5J6E A;  1ROU A;  1KT1 A;  4JFJ A;  4ZPV R;  3WD3 A;  2KI3 A;  4IQ2 A;  5BXJ A;  1TCO C;  2ZR4 A;  2VCD A;  4ZPW R;  4DZ2 A;  2A3B A;  4DRK A;  4JYS A;  4R0X A;  1K9T A;  1KT0 A;  2PBC A;  2KFW A;  2WM0 A;  5DIT A;  4QT2 A;  4ODP A;  3PA7 A;  4L72 B;  4MAV A;  3IK8 A;  4U85 A;  4DRP A;  2ZQS A;  3KAI A;  1YW5 A;  4W9Q A;  3TCZ A;  1NWU A;  2WLZ A;  2M2A A;  3PRA A;  3KCE A;  3ARZ A;  4TYO A;  3BXW A;  4QIB A;  1YAT A;  1J4R A;  2ESC A;  4DRM A;  3TC5 A;  4WJX A;  1X6L A;  1IX5 A;  5DO2 A;  1N1A A;  1E6Z A;  3ALG A;  4IT4 A;  3NI6 A;  4DWS A;  5GQB A;  1H0I A;  2DSU A;  3G6M A;  4MNK A;  3CHF A;  1NSG A;  3CHC A;  4IT6 A;  2XPB A;  2DSW A;  1HJX A;  1F40 A;  1HKJ A;  1Q6I A;  2XPA A;  5HT1 A;  1LQ0 A;  4O2T A;  2O92 A;  2ZQU A;  3H9R B;  2FKE A;  5HWC A;  2LJ4 A;  2LGO A;  3UI5 A;  2XP4 A;  3ARU A;  4MGV A;  3WQW A;  3O5K A;  4FN2 A;  3KAF A;  3WD4 A;  1BKF A;  2Y78 A;  3B9A A;  1FKJ A;  4QT3 A;  4U86 A;  4WKF A;  1EHN A;  3RFW A;  2KE0 A;  1FKK A;  2ZQV A;  2G41 A;  3O5J A;  2F21 A;  1ITX A;  2KR7 A;  4DT4 A;  4DRI A;  3ARV A;  2QF8 A;  1R9H A;  4ZPT R;  2OFN A;  4ITZ A;  4DRQ A;  2MLY A;  5HUA A;  1FFR A;  1M5Y A;  1NMW A;  1L1P A;  3JYM A;  1C9H A;  1Q6H A;  2MF9 A;  4ODN A;  1W1V A;  3QOK A;  4ML4 A;  1UR8 A;  4P8U A;  1NWT A;  3O5P A;  3RGC A;  3IKG A;  1HJV A;  1O6I A;  3O5O A;  2A3E A;  1LL6 A;  3JXV A;  2Q5A A;  4N19 A;  1H0G A;  2XP5 A;  4WKH A;  3W4R A;  2N87 A;  3B9D A;  5HTG A;  3NTP A;  4ZS6 A;  4Z2K A;  1FKL A;  1D7I A;  4DWS D;  5HKG A;  3O5Q A;  2UZ5 A;  2YBU A;  4LAY A;  4LAV A;  2ITK A;  3WL1 A;  4U84 A;  3VAW A;  1HKK A;  3KZ7 A;  1PBK A;  1LL7 A;  3CHD A;  2WLY A;  1E6P A;  3OOB A;  3WD0 A;  2RSE A;  1P5Q A;  4Z2G A;  4ODL A;  1LG1 A;  1RD6 A;  5HWB A;  2YBT A;  4LGX A;  2RQS A;  5JH8 A;  3O5L A;  4JFL A;  3GPK A;  1W1T A;  1VF8 A;  5B8I C;  4DH0 A;  3UI4 A;  3NRK A;  2KO7 A;  3B9E A;  1FD9 A;  1EDQ A;  4Z2L A;  1FKH A;  1HJW A;  1J4H A;  4LAX A;  1ZU8 A;  3CGN A;  3RM4 A;  2KGJ A;  2ZQT A;  2PPN A;  3ARR A;  1GOI A;  1LL4 A;  4HBE A;  3AQU A;  3AS0 A;  2XP6 A;  4W9O A;  3FAP A;  2ZR6 A;  1GPF A;  4MSP A;  2M1I A;  1D6O A;  2PV3 A;  3IKD A;  1X6N A;  5HW7 A;  1EIB A;  2OLH A;  1FKS A;  3ARS A;  3AS1 A;  1QZ2 A;  3O5M A;  4XAK A;  2PV2 A;  1LG2 A;  4Z2H A;  4W5U A;  2PV1 A;  2G8Z A;  3CHE A;  4W9P A;  1FKF A;  2IUZ A;  2FDM A;  3PR9 A;  5I98 A;  4TW8 A;  1ZL1 A;  2XP7 A;  2XP8 A;  1A7X A;  3JYJ A;  5DIU A;  1FKD A;  3O5R A;  4MNJ A;  2RUC A;  3ARW A;  4MNM A;  3CGM A;  2B31 A;  2DG3 A;  1W9P A;  3UQA A;  1W1Y A;  2MNT A;  1ZBK A;  1ZBV A;  4KQZ A;  1F8A B;  3WL0 A;  3ALF A;  1QPL A;  1JNE A;  1TFV A;  3O5I A;  3ARQ A;  4TW7 A;  3ARY A;  2L2S A;  1OGB A;  1NMV A;  1FKG A;  1U79 A;  2F2D A;  3O5F A;  4ODK A;  3ART A;  2DG9 A;  2DT3 A;  2AWG A;  2AOS A;  1EYM A;  5GPR A;  4ODR A;  1ZBW A;  1WB0 A;  4DRH A;  1OGG A;  2DPE A;  3KAC A;  4Z2I A;  1FJD A;  1WAW A;  3KAG A;  1JNS A;  4L3N A;  2A3C A;  4FAP A;  1Y0O A;  4DRO A;  1NWR A;  2DG4 A;  3TDB A;  5HW6 A;  3KAB A;  1HKM A;  2F4E A;  3ODK A;  1W9U A;  2PI6 A;  4Q22 A;  4NNR A;  4C02 B;  1J6Y A;  1ZB5 A;  3WQV A;  4KR0 B;  2IF4 A;  4IPX A;  3AS3 A;  3LUO A;  4MTV A;  2RUD A;  4JFK A;  4WIW A;  4S3K A;  1FAP A;  1D2K A;  2RUQ A;  2VN1 A;  4MPK A;  4S3J A;  1T11 A;  4TX0 A;  2RUR A;  2XP3 A;  1ZCN A;  1HXV A;  3UF8 A;  1FKT A;  4QZV B;  1SR0 A;  4HAR A;  4NZC A;  3PRB A;  4Q7N A;  2FAP A;  1JVW A;  1Q1C A;  4ODO A;  1EQ3 A;  3RME A;  4WKA A;  3FY1 A;  4BF8 A;  5HW8 A;  2ZR5 A;  2K8I A;  5DEZ A;  5GPG A;  4JFM A;  4G2P A;  4G50 A;  2WK2 A;  4LAW A;  4TW6 A;  3KAD A;  4J4N A;  1UR9 A;  3WD2 A;  4GGQ A;  4Z2J A;  3KAH A;  1ROT A;  1W1P A;  3B7X A;  3MDY B;  1SYT A;  2MLZ A;  3EY6 A;  1B6C A;  4J4O A;  5D75 A;  2DT2 A;  3CH9 A;  2PPO A;  4HBO A;  1E6R A;  1BL4 A;  1XHG A;  2PPP A;  4R5E A;  5DIV A;  2O9O A;  3RM8 A;  3O5E A;  3O5D A;  2D9F A;  1Q6U A;  4P8W A;  3RM9 A;  4DWS C;  4NSB A;  1D7H A;  3O5G A;  3OA5 A;  1J4I A;  1GUV A;  2LKN A;  2MPH A;  4DRJ A;  4AY1 A;  1HKI A;  3AS2 A;  3WD1 A;  3UI6 A;  3CZ8 A;  4DIP A;  3PRD A;  4PTM A;  4DRN A;  2A3A A;  2DT1 A;  2MLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...