1FKTA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
total genus 19
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fktA00
2LKNA 2Y78A 2PPNA 5HT1A 2XP7A 1EYMA 3WH0A 1M5YA 2XP6A 2PPPA 1ROUA 1D6OA 3KABA 1YATA 2MF9A 1D7JA 2IF4A 4TNSA 1C9HA 3UI4A 1JNSA 2XPBA 2RSEA 3JXVA 1FKSA 4U86A 5GPGA 4MGVA 1QPLA 1FD9A 1B6CA 1FAPA 1FKLA 2D9FA 2FAPA 4R0XA 4TYOA 3TCZA 1KT1A 3CGMA 3IKDA 2RUQA 3JYJA 2XP3A 3KAGA 3MDYB 3RFWA 4J4NA 4U85A 4DRMA 1L1PA 1FKKA 1Q6HA 4JFKA 4TW7A 1FKTA 4FAPA 1QPFA 2MLXA 2UZ5A 2ZR6A 4JYSA 1NMVA 3UQBA 1FKBA 3I6CA 2KE0A 3KAHA 3TC5A 3O5LA 4W9OA 1J4RA 2PV1A 4JFLA 2K8IA 4LAYA 5HWBA 1Q1CA 1FKIA 1FJDA 3O5MA 1JNTA 3NI6A 4GIVA 1Y0OA 1NMWA 1F40A 2LPVA 4LAWA 4JFMA 4DZ3A 2DG9A 5HKGA 4ODRA 1EQ3A 3PA7A 2MPHA 1A7XA 4DZ2A 1T11A 5HTGA 1FKJA 4MSPA 2M2AA 1ZK6A 3KACA 2PBCA 1FKHA 3IHZA 4ODPA 4ODKA 4TW8A 2JZVA 2RUCA 1F8AB 4LAVA 3O5RA 2ZQSA 2ZQVA 3KAFA 2MLZA 4JFJA 4IQ2A 5I98A 4DT4A 4ITZA 2ZQUA 2PV3A 2OFNA 4QT2A 2AWGA 3B7XA 1ROTA 1ZCNA 3FAPA 3O5IA 2M08A 4ODLA 2KI3A 1FKFA 4DH0A 3GPKA 2KR7A 3NTPA 4JFIA 5B8IC 3KCEA 2L2SA 1PBKA 1Q6UA 1BL4A 5J6EA 3VAWA 2MNTA 3O5OA 4GGQA 1FKRA 4G2PA 4DRPA 2KFWA 4DROA 3PRBA 3UI6A 4ODNA 4DRJA 4DRNA 4QT3A 2Q5AA 4FN2A 2XPAA 5D75A 1KT0A 1NSGA 3CGNA 2RUDA 1BKFA 2FKEA 5HW6A 1Q6IA 2DG4A 3UF8A 3ODKA 3UQAA 3O5EA 1J4IA 2DG3A 2PPOA 2XP5A 2ZR5A 4U84A 3O5QA 4G50A 5DITA 5HW7A 4W9PA 3KZ7A 1FKDA 4NNRA 3UQIA 3OOBA 2F2DA 4ODQA 2XP8A 3O5PA 5HWCA 4BF8A 5BXJA 1N1AA 1YW5A 3JYMA 3KAIA 5DIVA 2ITKA 2F21A 4DRQA 4N19A 1D7IA 3IKGA 1R9HA 4LAXA 3LUOA 4ODOA 2XP9A 4TX0A 1QZ2A 2MLYA 4IQCA 2KGJA 3UI5A 3H9RB 1HXVA 1P5QA 3EY6A 4ODMA 4TW6A 1TCOC 1U79A 4IPXA 2LGOA 3PRDA 2VN1A 4W9QA 2ZQTA 1JVWA 2LJ4A 2N87A 3O5DA 1W26A 3O5JA 5DIUA 2ZR4A 3TDBA 2KO7A 2RQSA 4O2TA 2VCDA 5HW8A 1FKGA 3O5KA 3IK8A 4DRKA 5HUAA 2M1IA 1PINA 2F4EA 3O5GA 3RGCA 4DRHA 4DRIA 3KADA 1D7HA 3O5FA 4DIPA 2RURA 1J4HA 3NRKA 2XP4A 4J4OA 4C02B 1J6YA 2PV2A 4QIBA
chains in the Genus database with same CATH superfamily
3WQVA 4XAKA 1D6OA 3KABA 2MF9A 1C9HA 1GOIA 1JNSA 1HKIA 2DSZA 1X6NA 4HBEA 4R0XA 4TYOA 3TCZA 1KT1A 3CGMA 1ZBVA 2RUQA 3MDYB 5DF0A 4DWSC 2YBUA 3UQBA 1NMVA 1J4RA 1NWTA 3O5MA 1HKKA 3AQUA 4R5EA 1H0GA 5HKGA 1H0IA 1W1YA 1T11A 3ARPA 1FKJA 4PTMA 1ZK6A 1FKHA 2JZVA 2PI6A 3CHEA 2G41A 4JFJA 5I98A 4DT4A 4ITZA 1EIBA 4UDMA 2F23A 4WKFA 2DT2A 2AWGA 1ITXA 4MNMA 2KI3A 4JFIA 5DEZA 1W1TA 1PBKA 2DSUA 3RM4A 4Z2LA 5J6EA 3AS2A 3ARUA 2A3EA 4DRPA 1D2KA 4QT3A 1BKFA 4DWSD 3UF8A 2ZR5A 4G50A 2F2DA 2XP8A 3O5PA 4BF8A 2ITKA 3OA5A 4WKHA 4MNJA 4MNLA 3ALFA 4TX0A 3WD2A 1GRJA 4S3KA 3H9RB 3EY6A 2DSVA 1TCOC 4IPXA 3RMEA 1HJWA 3PRDA 4Q22A 2ZQTA 3O5DA 3TDBA 3BXWA 2M1IA 3O5GA 1XRVA 3KADA 2ETNA 1J4HA 2XP4A 3ALGA 4QIBA 2LKNA 1ZB5A 2XP7A 2WLZA 1M5YA 3PR9A 4L3NA 1D7JA 2IF4A 4TNSA 2XPBA 1E6NA 3ARTA 4Q7NA 1SR0A 1QPLA 1FKLA 2D9FA 3KAGA 2XP3A 3RFWA 4WKAA 1L1PA 4J4NA 3WQWA 4DRMA 3ARXA 4JFKA 4TW7A 1HXVA 2UZ5A 1FKBA 3O5LA 4W9OA 4HBOA 4ZPWR 4LGXA 4P8UA 1Q1CA 4IT4A 1JNEA 1FJDA 1JNTA 2WK2A 4LAWA 4DZ3A 1EQ3A 5DO2A 1NWRA 5HTGA 4MSPA 3WD0A 3KACA 4TW8A 4ODKA 3WD4A 3ARWA 1WB0A 1LL4A 4IQ2A 2QF8A 1W9UA 2FDMA 2YBTA 1GUVA 4QT2A 3B7XA 1ROTA 3FAPA 3O5IA 1ZBKA 1W9VA 4DH0A 3ARYA 3NTPA 2L2SA 1Q6UA 1BL4A 3CHFA 3VAWA 2MNTA 3O5OA 2KFWA 4ODNA 4DRJA 3B9EA 4URIA 1Q6IA 2DG4A 1J4IA 2PPOA 4WIWA 4U84A 1FFRA 4WJXA 4ODQA 5HWCA 5BXJA 1YW5A 3FXYA 4DRQA 3WL0A 4QZVB 4N19A 2XP9A 1KFWA 4TW6A 1U79A 2LGOA 5HBFA 2VN1A 2O92A 2N87A 2KO7A 2RQSA 3CHDA 4O2TA 1E6PA 2EULA 1FKGA 4WK9A 5HUAA 1PINA 4DRIA 1NWSA 1D7HA 3O5FA 4DWSB 3WIJA 3NRKA 1J6YA 1X6LA 2AOSA 2PPNA 1JNDA 1EYMA 3ARSA 1ROUA 1EHNA 1YATA 4Z2IA 3CH9A 5GPGA 3JXVA 1FKSA 4P8VA 1B6CA 1FAPA 1IX5A 2FAPA 3JYJA 4U85A 4MAVA 1LL6A 1Q6HA 4FAPA 1QPFA 2ZR6A 3I6CA 5GPRA 3TC5A 1LL7A 4JFLA 2K8IA 4LAYA 3ARQA 1FKIA 1GPFA 1OWQA 1ZBCA 1Y0OA 1NMWA 1F40A 2LPVA 2DG9A 1HJXA 4ODRA 4DZ2A 4Z2HA 4AY1A 1FFQA 2M2AA 3IHZA 1E6RA 3FY1A 1F8AB 2MLZA 2ZQUA 2PV3A 4ZS6A 3AS0A 1ZCNA 4ODLA 4IT6A 5B8IC 3PRAA 3GTYX 4Z2GA 4MNKA 1FKRA 4GGQA 1NWUA 4G2PA 4HARA 1LJYA 3UI6A 4DRNA 5JH8A 4FN2A 2XPAA 5D75A 1NSGA 1WNOA 2RUDA 2FKEA 5HW6A 4NZCA 3UQAA 2DG3A 1HJVA 2OLHA 2XP5A 4W9PA 4NNRA 3OOBA 1ZBWA 2A3BA 1K9TA 1N1AA 2ESCA 3JYMA 3KAIA 4MTVA 3WD3A 2F21A 1LG2A 4ML4A 3IKGA 4ODOA 4LAXA 2DSWA 4KR0B 4ODMA 2G8ZA 1XHGA 4L72B 1E44A 1JVWA 1ZL1A 3CZ8A 5DIUA 3O5JA 4ZPTR 2ZR4A 1VF8A 1TFVA 1W1PA 4NSBA 2VCDA 5HW8A 1RD6A 3IK8A 4DRKA 2F4EA 4DRHA 2RURA 4C02B 3RM8A 3AROA 2Y78A 5HT1A 4Z2KA 3WH0A 1UR8A 2XP6A 2PPPA 1SYTA 3BMBA 3UI4A 2RSEA 4U86A 4MGVA 1FD9A 3B9AA 2DT0A 3IKDA 1LG1A 1FKKA 3CHCA 1HKJA 2DT1A 1FKTA 1OGBA 2MLXA 4JYSA 2KE0A 3KAHA 2PV1A 4W5UA 5HWBA 3NI6A 4GIVA 4JFMA 4P8XA 3WD1A 2O9OA 2P4VA 3PA7A 2MPHA 1A7XA 1O6IA 3B8SA 2PBCA 4ODPA 3WL1A 1E15A 2RUCA 2WM0A 4LAVA 3O5RA 2ZQSA 2ZQVA 3KAFA 1HKMA 3G6MA 1EDQA 3ARRA 2OFNA 3ARZA 3G6LA 4S3JA 2B5UB 2M08A 1FKFA 3GPKA 2KR7A 3KCEA 4KQZA 3B9DA 1E6ZA 3QOKA 4DROA 3PRBA 3AS3A 2Q5AA 1UR9A 2DT3A 1KT0A 3CGNA 1E9LA 2IUZA 3WKZA 3ODKA 1W1VA 3O5EA 2DPEA 3O5QA 5DITA 4DWSA 5HW7A 3KZ7A 1FKDA 2B31A 3UQIA 5DIVA 1LQ0A 1WAWA 3GU0A 3W4RA 5GQBA 1D7IA 2WLYA 2PN0A 3AS1A 1R9HA 3LUOA 1QZ2A 2MLYA 4IQCA 2KGJA 3UI5A 1JCHB 1P5QA 3EIPA 1NH6A 4Z2JA 2A3AA 4W9QA 1CTNA 2LJ4A 1W26A 2A3CA 3O5KA 1ZU8A 3RM9A 3RGCA 3ARVA 4ZPVR 4P8WA 1W9PA 4DIPA 4MPKA 4J4OA 2PV2A 1OGGA
chains in the Genus database with same CATH topology
3WQVA 4XAKA 1D6OA 3KABA 2MF9A 1C9HA 1GOIA 1JNSA 1HKIA 2DSZA 1X6NA 4HBEA 4R0XA 4TYOA 3TCZA 1KT1A 3CGMA 1ZBVA 2RUQA 3MDYB 5DF0A 4DWSC 2YBUA 3UQBA 1NMVA 1J4RA 1NWTA 3O5MA 1HKKA 3AQUA 4R5EA 1H0GA 5HKGA 1H0IA 1W1YA 1T11A 3ARPA 1FKJA 4PTMA 1ZK6A 1FKHA 2JZVA 2PI6A 3CHEA 2G41A 4JFJA 5I98A 4DT4A 4ITZA 1EIBA 4WKFA 2DT2A 2AWGA 1ITXA 4MNMA 2KI3A 4JFIA 5DEZA 1W1TA 1PBKA 2DSUA 3RM4A 4Z2LA 5J6EA 3AS2A 3ARUA 2A3EA 4DRPA 1D2KA 4QT3A 1BKFA 4DWSD 3UF8A 2ZR5A 4G50A 2F2DA 2XP8A 3O5PA 4BF8A 2ITKA 3OA5A 4WKHA 4MNJA 4MNLA 3ALFA 4TX0A 3WD2A 4S3KA 3H9RB 3EY6A 2DSVA 1TCOC 4IPXA 3RMEA 1HJWA 3PRDA 4Q22A 2ZQTA 3O5DA 3TDBA 3BXWA 2M1IA 3O5GA 1XRVA 3KADA 1J4HA 2XP4A 3ALGA 4QIBA 2LKNA 1ZB5A 2XP7A 2WLZA 1M5YA 3PR9A 4L3NA 1D7JA 2IF4A 4TNSA 2XPBA 1E6NA 3ARTA 4Q7NA 1SR0A 1QPLA 1FKLA 2D9FA 3KAGA 2XP3A 3RFWA 4WKAA 1L1PA 4J4NA 3WQWA 4DRMA 3ARXA 4JFKA 4TW7A 1HXVA 2UZ5A 1FKBA 3O5LA 4W9OA 4HBOA 4ZPWR 4LGXA 4P8UA 1Q1CA 4IT4A 1JNEA 1FJDA 1JNTA 2WK2A 4LAWA 4DZ3A 1EQ3A 5DO2A 1NWRA 5HTGA 4MSPA 3WD0A 3KACA 4TW8A 4ODKA 3WD4A 3ARWA 1WB0A 1LL4A 4IQ2A 2QF8A 1W9UA 2FDMA 2YBTA 1GUVA 4QT2A 3B7XA 1ROTA 3FAPA 3O5IA 1ZBKA 1W9VA 4DH0A 3ARYA 3NTPA 2L2SA 1Q6UA 1BL4A 3CHFA 3VAWA 2MNTA 3O5OA 2KFWA 4ODNA 4DRJA 3B9EA 4URIA 1Q6IA 2DG4A 1J4IA 2PPOA 4WIWA 4U84A 1FFRA 4WJXA 4ODQA 5HWCA 5BXJA 1YW5A 3FXYA 4DRQA 3WL0A 4QZVB 4N19A 2XP9A 1KFWA 4TW6A 1U79A 2LGOA 5HBFA 2VN1A 2O92A 2N87A 2KO7A 2RQSA 3CHDA 4O2TA 1E6PA 1FKGA 4WK9A 5HUAA 1PINA 4DRIA 1NWSA 1D7HA 3O5FA 4DWSB 3WIJA 3NRKA 1J6YA 1X6LA 2AOSA 2PPNA 1JNDA 1EYMA 3ARSA 1ROUA 1EHNA 1YATA 4Z2IA 3CH9A 5GPGA 3JXVA 1FKSA 4P8VA 1B6CA 1FAPA 1IX5A 2FAPA 3JYJA 4U85A 4MAVA 1LL6A 1Q6HA 4FAPA 1QPFA 2ZR6A 3I6CA 5GPRA 3TC5A 1LL7A 4JFLA 2K8IA 4LAYA 3ARQA 1FKIA 1GPFA 1OWQA 1ZBCA 1Y0OA 1NMWA 1F40A 2LPVA 2DG9A 1HJXA 4ODRA 4DZ2A 4Z2HA 4AY1A 1FFQA 2M2AA 3IHZA 1E6RA 3FY1A 1F8AB 2MLZA 2ZQUA 2PV3A 4ZS6A 3AS0A 1ZCNA 4ODLA 4IT6A 5B8IC 3PRAA 4Z2GA 4MNKA 1FKRA 4GGQA 1NWUA 4G2PA 4HARA 1LJYA 3UI6A 4DRNA 5JH8A 4FN2A 2XPAA 5D75A 1NSGA 1WNOA 2RUDA 2FKEA 5HW6A 4NZCA 3UQAA 2DG3A 1HJVA 2OLHA 2XP5A 4W9PA 4NNRA 3OOBA 1ZBWA 2A3BA 1K9TA 1N1AA 2ESCA 3JYMA 3KAIA 4MTVA 3WD3A 2F21A 1LG2A 4ML4A 3IKGA 4ODOA 4LAXA 2DSWA 4KR0B 4ODMA 2G8ZA 1XHGA 4L72B 1JVWA 1ZL1A 3CZ8A 5DIUA 3O5JA 4ZPTR 2ZR4A 1VF8A 1TFVA 1W1PA 4NSBA 2VCDA 5HW8A 1RD6A 3IK8A 4DRKA 2F4EA 4DRHA 2RURA 4C02B 3RM8A 3AROA 2Y78A 5HT1A 4Z2KA 3WH0A 1UR8A 2XP6A 2PPPA 1SYTA 3UI4A 2RSEA 4U86A 4MGVA 1FD9A 3B9AA 2DT0A 3IKDA 1LG1A 1FKKA 3CHCA 1HKJA 2DT1A 1FKTA 1OGBA 2MLXA 4JYSA 2KE0A 3KAHA 2PV1A 4W5UA 5HWBA 3NI6A 4GIVA 4JFMA 4P8XA 3WD1A 2O9OA 3PA7A 2MPHA 1A7XA 1O6IA 3B8SA 2PBCA 4ODPA 3WL1A 1E15A 2RUCA 2WM0A 4LAVA 3O5RA 2ZQSA 2ZQVA 3KAFA 1HKMA 3G6MA 1EDQA 3ARRA 2OFNA 3ARZA 3G6LA 4S3JA 2M08A 1FKFA 3GPKA 2KR7A 3KCEA 4KQZA 3B9DA 1E6ZA 3QOKA 4DROA 3PRBA 3AS3A 2Q5AA 1UR9A 2DT3A 1KT0A 3CGNA 1E9LA 2IUZA 3WKZA 3ODKA 1W1VA 3O5EA 2DPEA 3O5QA 5DITA 4DWSA 5HW7A 3KZ7A 1FKDA 2B31A 3UQIA 5DIVA 1LQ0A 1WAWA 3W4RA 5GQBA 1D7IA 2WLYA 3AS1A 1R9HA 3LUOA 1QZ2A 2MLYA 4IQCA 2KGJA 3UI5A 1P5QA 1NH6A 4Z2JA 2A3AA 4W9QA 1CTNA 2LJ4A 1W26A 2A3CA 3O5KA 1ZU8A 3RM9A 3RGCA 3ARVA 4ZPVR 4P8WA 1W9PA 4DIPA 4MPKA 4J4OA 2PV2A 1OGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKN A;  2Y78 A;  2PPN A;  5HT1 A;  2XP7 A;  1EYM A;  3WH0 A;  1M5Y A;  2XP6 A;  2PPP A;  1ROU A;  1D6O A;  3KAB A;  1YAT A;  2MF9 A;  1D7J A;  2IF4 A;  4TNS A;  1C9H A;  3UI4 A;  1JNS A;  2XPB A;  2RSE A;  3JXV A;  1FKS A;  4U86 A;  5GPG A;  4MGV A;  1QPL A;  1FD9 A;  1B6C A;  1FAP A;  1FKL A;  2D9F A;  2FAP A;  4R0X A;  4TYO A;  3TCZ A;  1KT1 A;  3CGM A;  3IKD A;  2RUQ A;  3JYJ A;  2XP3 A;  3KAG A;  3MDY B;  3RFW A;  4J4N A;  4U85 A;  4DRM A;  1L1P A;  1FKK A;  1Q6H A;  4JFK A;  4TW7 A;  1FKT A;  4FAP A;  1QPF A;  2MLX A;  2UZ5 A;  2ZR6 A;  4JYS A;  1NMV A;  3UQB A;  1FKB A;  3I6C A;  2KE0 A;  3KAH A;  3TC5 A;  3O5L A;  4W9O A;  1J4R A;  2PV1 A;  4JFL A;  2K8I A;  4LAY A;  5HWB A;  1Q1C A;  1FKI A;  1FJD A;  3O5M A;  1JNT A;  3NI6 A;  4GIV A;  1Y0O A;  1NMW A;  1F40 A;  2LPV A;  4LAW A;  4JFM A;  4DZ3 A;  2DG9 A;  5HKG A;  4ODR A;  1EQ3 A;  3PA7 A;  2MPH A;  1A7X A;  4DZ2 A;  1T11 A;  5HTG A;  1FKJ A;  4MSP A;  2M2A A;  1ZK6 A;  3KAC A;  2PBC A;  1FKH A;  3IHZ A;  4ODP A;  4ODK A;  4TW8 A;  2JZV A;  2RUC A;  1F8A B;  4LAV A;  3O5R A;  2ZQS A;  2ZQV A;  3KAF A;  2MLZ A;  4JFJ A;  4IQ2 A;  5I98 A;  4DT4 A;  4ITZ A;  2ZQU A;  2PV3 A;  2OFN A;  4QT2 A;  2AWG A;  3B7X A;  1ROT A;  1ZCN A;  3FAP A;  3O5I A;  2M08 A;  4ODL A;  2KI3 A;  1FKF A;  4DH0 A;  3GPK A;  2KR7 A;  3NTP A;  4JFI A;  5B8I C;  3KCE A;  2L2S A;  1PBK A;  1Q6U A;  1BL4 A;  5J6E A;  3VAW A;  2MNT A;  3O5O A;  4GGQ A;  1FKR A;  4G2P A;  4DRP A;  2KFW A;  4DRO A;  3PRB A;  3UI6 A;  4ODN A;  4DRJ A;  4DRN A;  4QT3 A;  2Q5A A;  4FN2 A;  2XPA A;  5D75 A;  1KT0 A;  1NSG A;  3CGN A;  2RUD A;  1BKF A;  2FKE A;  5HW6 A;  1Q6I A;  2DG4 A;  3UF8 A;  3ODK A;  3UQA A;  3O5E A;  1J4I A;  2DG3 A;  2PPO A;  2XP5 A;  2ZR5 A;  4U84 A;  3O5Q A;  4G50 A;  5DIT A;  5HW7 A;  4W9P A;  3KZ7 A;  1FKD A;  4NNR A;  3UQI A;  3OOB A;  2F2D A;  4ODQ A;  2XP8 A;  3O5P A;  5HWC A;  4BF8 A;  5BXJ A;  1N1A A;  1YW5 A;  3JYM A;  3KAI A;  5DIV A;  2ITK A;  2F21 A;  4DRQ A;  4N19 A;  1D7I A;  3IKG A;  1R9H A;  4LAX A;  3LUO A;  4ODO A;  2XP9 A;  4TX0 A;  1QZ2 A;  2MLY A;  4IQC A;  2KGJ A;  3UI5 A;  3H9R B;  1HXV A;  1P5Q A;  3EY6 A;  4ODM A;  4TW6 A;  1TCO C;  1U79 A;  4IPX A;  2LGO A;  3PRD A;  2VN1 A;  4W9Q A;  2ZQT A;  1JVW A;  2LJ4 A;  2N87 A;  3O5D A;  1W26 A;  3O5J A;  5DIU A;  2ZR4 A;  3TDB A;  2KO7 A;  2RQS A;  4O2T A;  2VCD A;  5HW8 A;  1FKG A;  3O5K A;  3IK8 A;  4DRK A;  5HUA A;  2M1I A;  1PIN A;  2F4E A;  3O5G A;  3RGC A;  4DRH A;  4DRI A;  3KAD A;  1D7H A;  3O5F A;  4DIP A;  2RUR A;  1J4H A;  3NRK A;  2XP4 A;  4J4O A;  4C02 B;  1J6Y A;  2PV2 A;  4QIB A; 
#chains in the Genus database with same CATH topology
 3WQV A;  4XAK A;  1D6O A;  3KAB A;  2MF9 A;  1C9H A;  1GOI A;  1JNS A;  1HKI A;  2DSZ A;  1X6N A;  4HBE A;  4R0X A;  4TYO A;  3TCZ A;  1KT1 A;  3CGM A;  1ZBV A;  2RUQ A;  3MDY B;  5DF0 A;  4DWS C;  2YBU A;  3UQB A;  1NMV A;  1J4R A;  1NWT A;  3O5M A;  1HKK A;  3AQU A;  4R5E A;  1H0G A;  5HKG A;  1H0I A;  1W1Y A;  1T11 A;  3ARP A;  1FKJ A;  4PTM A;  1ZK6 A;  1FKH A;  2JZV A;  2PI6 A;  3CHE A;  2G41 A;  4JFJ A;  5I98 A;  4DT4 A;  4ITZ A;  1EIB A;  4UDM A;  2F23 A;  4WKF A;  2DT2 A;  2AWG A;  1ITX A;  4MNM A;  2KI3 A;  4JFI A;  5DEZ A;  1W1T A;  1PBK A;  2DSU A;  3RM4 A;  4Z2L A;  5J6E A;  3AS2 A;  3ARU A;  2A3E A;  4DRP A;  1D2K A;  4QT3 A;  1BKF A;  4DWS D;  3UF8 A;  2ZR5 A;  4G50 A;  2F2D A;  2XP8 A;  3O5P A;  4BF8 A;  2ITK A;  3OA5 A;  4WKH A;  4MNJ A;  4MNL A;  3ALF A;  4TX0 A;  3WD2 A;  1GRJ A;  4S3K A;  3H9R B;  3EY6 A;  2DSV A;  1TCO C;  4IPX A;  3RME A;  1HJW A;  3PRD A;  4Q22 A;  2ZQT A;  3O5D A;  3TDB A;  3BXW A;  2M1I A;  3O5G A;  1XRV A;  3KAD A;  2ETN A;  1J4H A;  2XP4 A;  3ALG A;  4QIB A;  2LKN A;  1ZB5 A;  2XP7 A;  2WLZ A;  1M5Y A;  3PR9 A;  4L3N A;  1D7J A;  2IF4 A;  4TNS A;  2XPB A;  1E6N A;  3ART A;  4Q7N A;  1SR0 A;  1QPL A;  1FKL A;  2D9F A;  3KAG A;  2XP3 A;  3RFW A;  4WKA A;  1L1P A;  4J4N A;  3WQW A;  4DRM A;  3ARX A;  4JFK A;  4TW7 A;  1HXV A;  2UZ5 A;  1FKB A;  3O5L A;  4W9O A;  4HBO A;  4ZPW R;  4LGX A;  4P8U A;  1Q1C A;  4IT4 A;  1JNE A;  1FJD A;  1JNT A;  2WK2 A;  4LAW A;  4DZ3 A;  1EQ3 A;  5DO2 A;  1NWR A;  5HTG A;  4MSP A;  3WD0 A;  3KAC A;  4TW8 A;  4ODK A;  3WD4 A;  3ARW A;  1WB0 A;  1LL4 A;  4IQ2 A;  2QF8 A;  1W9U A;  2FDM A;  2YBT A;  1GUV A;  4QT2 A;  3B7X A;  1ROT A;  3FAP A;  3O5I A;  1ZBK A;  1W9V A;  4DH0 A;  3ARY A;  3NTP A;  2L2S A;  1Q6U A;  1BL4 A;  3CHF A;  3VAW A;  2MNT A;  3O5O A;  2KFW A;  4ODN A;  4DRJ A;  3B9E A;  4URI A;  1Q6I A;  2DG4 A;  1J4I A;  2PPO A;  4WIW A;  4U84 A;  1FFR A;  4WJX A;  4ODQ A;  5HWC A;  5BXJ A;  1YW5 A;  3FXY A;  4DRQ A;  3WL0 A;  4QZV B;  4N19 A;  2XP9 A;  1KFW A;  4TW6 A;  1U79 A;  2LGO A;  5HBF A;  2VN1 A;  2O92 A;  2N87 A;  2KO7 A;  2RQS A;  3CHD A;  4O2T A;  1E6P A;  2EUL A;  1FKG A;  4WK9 A;  5HUA A;  1PIN A;  4DRI A;  1NWS A;  1D7H A;  3O5F A;  4DWS B;  3WIJ A;  3NRK A;  1J6Y A;  1X6L A;  2AOS A;  2PPN A;  1JND A;  1EYM A;  3ARS A;  1ROU A;  1EHN A;  1YAT A;  4Z2I A;  3CH9 A;  5GPG A;  3JXV A;  1FKS A;  4P8V A;  1B6C A;  1FAP A;  1IX5 A;  2FAP A;  3JYJ A;  4U85 A;  4MAV A;  1LL6 A;  1Q6H A;  4FAP A;  1QPF A;  2ZR6 A;  3I6C A;  5GPR A;  3TC5 A;  1LL7 A;  4JFL A;  2K8I A;  4LAY A;  3ARQ A;  1FKI A;  1GPF A;  1OWQ A;  1ZBC A;  1Y0O A;  1NMW A;  1F40 A;  2LPV A;  2DG9 A;  1HJX A;  4ODR A;  4DZ2 A;  4Z2H A;  4AY1 A;  1FFQ A;  2M2A A;  3IHZ A;  1E6R A;  3FY1 A;  1F8A B;  2MLZ A;  2ZQU A;  2PV3 A;  4ZS6 A;  3AS0 A;  1ZCN A;  4ODL A;  4IT6 A;  5B8I C;  3PRA A;  3GTY X;  4Z2G A;  4MNK A;  1FKR A;  4GGQ A;  1NWU A;  4G2P A;  4HAR A;  1LJY A;  3UI6 A;  4DRN A;  5JH8 A;  4FN2 A;  2XPA A;  5D75 A;  1NSG A;  1WNO A;  2RUD A;  2FKE A;  5HW6 A;  4NZC A;  3UQA A;  2DG3 A;  1HJV A;  2OLH A;  2XP5 A;  4W9P A;  4NNR A;  3OOB A;  1ZBW A;  2A3B A;  1K9T A;  1N1A A;  2ESC A;  3JYM A;  3KAI A;  4MTV A;  3WD3 A;  2F21 A;  1LG2 A;  4ML4 A;  3IKG A;  4ODO A;  4LAX A;  2DSW A;  4KR0 B;  4ODM A;  2G8Z A;  1XHG A;  4L72 B;  1E44 A;  1JVW A;  1ZL1 A;  3CZ8 A;  5DIU A;  3O5J A;  4ZPT R;  2ZR4 A;  1VF8 A;  1TFV A;  1W1P A;  4NSB A;  2VCD A;  5HW8 A;  1RD6 A;  3IK8 A;  4DRK A;  2F4E A;  4DRH A;  2RUR A;  4C02 B;  3RM8 A;  3ARO A;  2Y78 A;  5HT1 A;  4Z2K A;  3WH0 A;  1UR8 A;  2XP6 A;  2PPP A;  1SYT A;  3BMB A;  3UI4 A;  2RSE A;  4U86 A;  4MGV A;  1FD9 A;  3B9A A;  2DT0 A;  3IKD A;  1LG1 A;  1FKK A;  3CHC A;  1HKJ A;  2DT1 A;  1FKT A;  1OGB A;  2MLX A;  4JYS A;  2KE0 A;  3KAH A;  2PV1 A;  4W5U A;  5HWB A;  3NI6 A;  4GIV A;  4JFM A;  4P8X A;  3WD1 A;  2O9O A;  2P4V A;  3PA7 A;  2MPH A;  1A7X A;  1O6I A;  3B8S A;  2PBC A;  4ODP A;  3WL1 A;  1E15 A;  2RUC A;  2WM0 A;  4LAV A;  3O5R A;  2ZQS A;  2ZQV A;  3KAF A;  1HKM A;  3G6M A;  1EDQ A;  3ARR A;  2OFN A;  3ARZ A;  3G6L A;  4S3J A;  2B5U B;  2M08 A;  1FKF A;  3GPK A;  2KR7 A;  3KCE A;  4KQZ A;  3B9D A;  1E6Z A;  3QOK A;  4DRO A;  3PRB A;  3AS3 A;  2Q5A A;  1UR9 A;  2DT3 A;  1KT0 A;  3CGN A;  1E9L A;  2IUZ A;  3WKZ A;  3ODK A;  1W1V A;  3O5E A;  2DPE A;  3O5Q A;  5DIT A;  4DWS A;  5HW7 A;  3KZ7 A;  1FKD A;  2B31 A;  3UQI A;  5DIV A;  1LQ0 A;  1WAW A;  3GU0 A;  3W4R A;  5GQB A;  1D7I A;  2WLY A;  2PN0 A;  3AS1 A;  1R9H A;  3LUO A;  1QZ2 A;  2MLY A;  4IQC A;  2KGJ A;  3UI5 A;  1JCH B;  1P5Q A;  3EIP A;  1NH6 A;  4Z2J A;  2A3A A;  4W9Q A;  1CTN A;  2LJ4 A;  1W26 A;  2A3C A;  3O5K A;  1ZU8 A;  3RM9 A;  3RGC A;  3ARV A;  4ZPV R;  4P8W A;  1W9P A;  4DIP A;  4MPK A;  4J4O A;  2PV2 A;  1OGG A; 
#chains in the Genus database with same CATH homology
 3WQV A;  4XAK A;  1D6O A;  3KAB A;  2MF9 A;  1C9H A;  1GOI A;  1JNS A;  1HKI A;  2DSZ A;  1X6N A;  4HBE A;  4R0X A;  4TYO A;  3TCZ A;  1KT1 A;  3CGM A;  1ZBV A;  2RUQ A;  3MDY B;  5DF0 A;  4DWS C;  2YBU A;  3UQB A;  1NMV A;  1J4R A;  1NWT A;  3O5M A;  1HKK A;  3AQU A;  4R5E A;  1H0G A;  5HKG A;  1H0I A;  1W1Y A;  1T11 A;  3ARP A;  1FKJ A;  4PTM A;  1ZK6 A;  1FKH A;  2JZV A;  2PI6 A;  3CHE A;  2G41 A;  4JFJ A;  5I98 A;  4DT4 A;  4ITZ A;  1EIB A;  4WKF A;  2DT2 A;  2AWG A;  1ITX A;  4MNM A;  2KI3 A;  4JFI A;  5DEZ A;  1W1T A;  1PBK A;  2DSU A;  3RM4 A;  4Z2L A;  5J6E A;  3AS2 A;  3ARU A;  2A3E A;  4DRP A;  1D2K A;  4QT3 A;  1BKF A;  4DWS D;  3UF8 A;  2ZR5 A;  4G50 A;  2F2D A;  2XP8 A;  3O5P A;  4BF8 A;  2ITK A;  3OA5 A;  4WKH A;  4MNJ A;  4MNL A;  3ALF A;  4TX0 A;  3WD2 A;  4S3K A;  3H9R B;  3EY6 A;  2DSV A;  1TCO C;  4IPX A;  3RME A;  1HJW A;  3PRD A;  4Q22 A;  2ZQT A;  3O5D A;  3TDB A;  3BXW A;  2M1I A;  3O5G A;  1XRV A;  3KAD A;  1J4H A;  2XP4 A;  3ALG A;  4QIB A;  2LKN A;  1ZB5 A;  2XP7 A;  2WLZ A;  1M5Y A;  3PR9 A;  4L3N A;  1D7J A;  2IF4 A;  4TNS A;  2XPB A;  1E6N A;  3ART A;  4Q7N A;  1SR0 A;  1QPL A;  1FKL A;  2D9F A;  3KAG A;  2XP3 A;  3RFW A;  4WKA A;  1L1P A;  4J4N A;  3WQW A;  4DRM A;  3ARX A;  4JFK A;  4TW7 A;  1HXV A;  2UZ5 A;  1FKB A;  3O5L A;  4W9O A;  4HBO A;  4ZPW R;  4LGX A;  4P8U A;  1Q1C A;  4IT4 A;  1JNE A;  1FJD A;  1JNT A;  2WK2 A;  4LAW A;  4DZ3 A;  1EQ3 A;  5DO2 A;  1NWR A;  5HTG A;  4MSP A;  3WD0 A;  3KAC A;  4TW8 A;  4ODK A;  3WD4 A;  3ARW A;  1WB0 A;  1LL4 A;  4IQ2 A;  2QF8 A;  1W9U A;  2FDM A;  2YBT A;  1GUV A;  4QT2 A;  3B7X A;  1ROT A;  3FAP A;  3O5I A;  1ZBK A;  1W9V A;  4DH0 A;  3ARY A;  3NTP A;  2L2S A;  1Q6U A;  1BL4 A;  3CHF A;  3VAW A;  2MNT A;  3O5O A;  2KFW A;  4ODN A;  4DRJ A;  3B9E A;  4URI A;  1Q6I A;  2DG4 A;  1J4I A;  2PPO A;  4WIW A;  4U84 A;  1FFR A;  4WJX A;  4ODQ A;  5HWC A;  5BXJ A;  1YW5 A;  3FXY A;  4DRQ A;  3WL0 A;  4QZV B;  4N19 A;  2XP9 A;  1KFW A;  4TW6 A;  1U79 A;  2LGO A;  5HBF A;  2VN1 A;  2O92 A;  2N87 A;  2KO7 A;  2RQS A;  3CHD A;  4O2T A;  1E6P A;  1FKG A;  4WK9 A;  5HUA A;  1PIN A;  4DRI A;  1NWS A;  1D7H A;  3O5F A;  4DWS B;  3WIJ A;  3NRK A;  1J6Y A;  1X6L A;  2AOS A;  2PPN A;  1JND A;  1EYM A;  3ARS A;  1ROU A;  1EHN A;  1YAT A;  4Z2I A;  3CH9 A;  5GPG A;  3JXV A;  1FKS A;  4P8V A;  1B6C A;  1FAP A;  1IX5 A;  2FAP A;  3JYJ A;  4U85 A;  4MAV A;  1LL6 A;  1Q6H A;  4FAP A;  1QPF A;  2ZR6 A;  3I6C A;  5GPR A;  3TC5 A;  1LL7 A;  4JFL A;  2K8I A;  4LAY A;  3ARQ A;  1FKI A;  1GPF A;  1OWQ A;  1ZBC A;  1Y0O A;  1NMW A;  1F40 A;  2LPV A;  2DG9 A;  1HJX A;  4ODR A;  4DZ2 A;  4Z2H A;  4AY1 A;  1FFQ A;  2M2A A;  3IHZ A;  1E6R A;  3FY1 A;  1F8A B;  2MLZ A;  2ZQU A;  2PV3 A;  4ZS6 A;  3AS0 A;  1ZCN A;  4ODL A;  4IT6 A;  5B8I C;  3PRA A;  4Z2G A;  4MNK A;  1FKR A;  4GGQ A;  1NWU A;  4G2P A;  4HAR A;  1LJY A;  3UI6 A;  4DRN A;  5JH8 A;  4FN2 A;  2XPA A;  5D75 A;  1NSG A;  1WNO A;  2RUD A;  2FKE A;  5HW6 A;  4NZC A;  3UQA A;  2DG3 A;  1HJV A;  2OLH A;  2XP5 A;  4W9P A;  4NNR A;  3OOB A;  1ZBW A;  2A3B A;  1K9T A;  1N1A A;  2ESC A;  3JYM A;  3KAI A;  4MTV A;  3WD3 A;  2F21 A;  1LG2 A;  4ML4 A;  3IKG A;  4ODO A;  4LAX A;  2DSW A;  4KR0 B;  4ODM A;  2G8Z A;  1XHG A;  4L72 B;  1JVW A;  1ZL1 A;  3CZ8 A;  5DIU A;  3O5J A;  4ZPT R;  2ZR4 A;  1VF8 A;  1TFV A;  1W1P A;  4NSB A;  2VCD A;  5HW8 A;  1RD6 A;  3IK8 A;  4DRK A;  2F4E A;  4DRH A;  2RUR A;  4C02 B;  3RM8 A;  3ARO A;  2Y78 A;  5HT1 A;  4Z2K A;  3WH0 A;  1UR8 A;  2XP6 A;  2PPP A;  1SYT A;  3UI4 A;  2RSE A;  4U86 A;  4MGV A;  1FD9 A;  3B9A A;  2DT0 A;  3IKD A;  1LG1 A;  1FKK A;  3CHC A;  1HKJ A;  2DT1 A;  1FKT A;  1OGB A;  2MLX A;  4JYS A;  2KE0 A;  3KAH A;  2PV1 A;  4W5U A;  5HWB A;  3NI6 A;  4GIV A;  4JFM A;  4P8X A;  3WD1 A;  2O9O A;  3PA7 A;  2MPH A;  1A7X A;  1O6I A;  3B8S A;  2PBC A;  4ODP A;  3WL1 A;  1E15 A;  2RUC A;  2WM0 A;  4LAV A;  3O5R A;  2ZQS A;  2ZQV A;  3KAF A;  1HKM A;  3G6M A;  1EDQ A;  3ARR A;  2OFN A;  3ARZ A;  3G6L A;  4S3J A;  2M08 A;  1FKF A;  3GPK A;  2KR7 A;  3KCE A;  4KQZ A;  3B9D A;  1E6Z A;  3QOK A;  4DRO A;  3PRB A;  3AS3 A;  2Q5A A;  1UR9 A;  2DT3 A;  1KT0 A;  3CGN A;  1E9L A;  2IUZ A;  3WKZ A;  3ODK A;  1W1V A;  3O5E A;  2DPE A;  3O5Q A;  5DIT A;  4DWS A;  5HW7 A;  3KZ7 A;  1FKD A;  2B31 A;  3UQI A;  5DIV A;  1LQ0 A;  1WAW A;  3W4R A;  5GQB A;  1D7I A;  2WLY A;  3AS1 A;  1R9H A;  3LUO A;  1QZ2 A;  2MLY A;  4IQC A;  2KGJ A;  3UI5 A;  1P5Q A;  1NH6 A;  4Z2J A;  2A3A A;  4W9Q A;  1CTN A;  2LJ4 A;  1W26 A;  2A3C A;  3O5K A;  1ZU8 A;  3RM9 A;  3RGC A;  3ARV A;  4ZPV R;  4P8W A;  1W9P A;  4DIP A;  4MPK A;  4J4O A;  2PV2 A;  1OGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...