1FKTA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 19
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fktA00
3UI5A 5HW8A 2PV2A 1FKGA 1FKLA 3B7XA 2ZR6A 4LAYA 3I6CA 1BL4A 5D75A 1JVWA 2XP7A 5I98A 1L1PA 3O5EA 1ROUA 1HXVA 5HW7A 1ZCNA 2ZQSA 3KCEA 4ODQA 2FKEA 2IF4A 3GPKA 2KO7A 2MNTA 3O5QA 3TCZA 1FKDA 2JZVA 2RUDA 2XP8A 4W9OA 5DIVA 1FKRA 4J4OA 3PRBA 3FAPA 3O5DA 3UF8A 4C02B 3H9RB 1J4RA 1U79A 2XP5A 4W9PA 1ROTA 4IQ2A 3JYMA 3IKGA 5DITA 4DIPA 1FD9A 4DRPA 1FKKA 2ZR4A 3PRDA 4TW7A 3O5GA 3WH0A 3NI6A 4NNRA 2K8IA 2F21A 3O5JA 2LPVA 1J6YA 1Y0OA 1FKHA 3KABA 1FKFA 1EQ3A 2PV1A 1C9HA 4QT3A 4TNSA 1QPLA 4DROA 2ITKA 4ODNA 4ODMA 5HWBA 1YW5A 1QZ2A 1KT0A 3CGNA 3O5PA 4G2PA 4GIVA 3RFWA 2VCDA 3O5KA 1FKTA 1FKSA 3LUOA 4U85A 3VAWA 4J4NA 1EYMA 2M08A 5DIUA 2LGOA 2KI3A 1J4IA 2KE0A 2RSEA 2M2AA 3KZ7A 5BXJA 2MLYA 5GPGA 5HW6A 2RQSA 1FKJA 5B8IC 4R0XA 3NTPA 4JFKA 3OOBA 4U84A 4TYOA 4DRHA 4DRNA 1QPFA 2PPNA 2PBCA 3O5RA 2KR7A 2LKNA 3JXVA 3TDBA 2DG4A 2MLXA 1TCOC 4TW6A 4IQCA 2FAPA 3CGMA 1T11A 3IKDA 3NRKA 4GGQA 4ODLA 4BF8A 5HUAA 2D9FA 1M5YA 4LAWA 4DT4A 3KAGA 2AWGA 2MPHA 2Q5AA 5HT1A 4ODPA 4QT2A 1FAPA 3RGCA 4MSPA 2MLZA 1FKBA 1W26A 2VN1A 2PPOA 4MGVA 4DRQA 1NMVA 3KAHA 2ZQTA 4ODOA 1ZK6A 3KAIA 5HWCA 1J4HA 4DZ2A 3UQBA 5HTGA 4FAPA 4DRIA 1JNSA 4W9QA 3UI4A 2RUCA 2DG9A 3O5IA 1Q6UA 2KFWA 2OFNA 1N1AA 1NSGA 3O5MA 3UQAA 1BKFA 1P5QA 3ODKA 4JFIA 4DRMA 4LAVA 4G50A 3UQIA 3O5FA 2RURA 3PA7A 1D7IA 4DRKA 1D6OA 4DH0A 4DZ3A 1F8AB 2MF9A 2ZQVA 4ITZA 1F40A 5J6EA 2M1IA 2DG3A 4ODKA 3EY6A 2UZ5A 2RUQA 4QIBA 4JYSA 1FKIA 2LJ4A 1D7JA 4N19A 2L2SA 1R9HA 3KACA 4TW8A 4O2TA 1FJDA 2PV3A 2ZQUA 1JNTA 2XP4A 4IPXA 2N87A 2XP9A 1YATA 1Q6HA 4JFMA 5HKGA 4LAXA 3O5LA 2Y78A 4TX0A 2ZR5A 1Q1CA 4ODRA 3KAFA 2PPPA 3IHZA 1A7XA 1D7HA 4JFJA 4U86A 4DRJA 2XPAA 2XP6A 2F2DA 2KGJA 3O5OA 3JYJA 3KADA 3TC5A 4FN2A 4JFLA 3MDYB 1NMWA 2XP3A 2XPBA 3IK8A 1KT1A 1PBKA 2F4EA 3UI6A 1B6CA 1PINA 1Q6IA
chains in the Genus database with same CATH superfamily
4Q7NA 1HKKA 1FKGA 1FFQA 1BL4A 2XP7A 3ARXA 4Z2IA 1ZCNA 2OLHA 2QF8A 1JNEA 2FKEA 1LG2A 3O5QA 2MNTA 1TFVA 1FKRA 2RUDA 5DIVA 4J4OA 3RM9A 3PRBA 1ZBKA 4R5EA 3H9RB 3ARZA 2YBTA 2ZR4A 4TW7A 3WH0A 1VF8A 2K8IA 1J6YA 3CH9A 1FKHA 4QT3A 4DROA 3ARSA 1ZU8A 1YW5A 1QZ2A 3AS0A 1HJXA 3O5PA 4G2PA 2DT2A 4S3JA 5DIUA 4DWSB 4KQZA 3RM8A 3KZ7A 4R0XA 3OOBA 4U84A 4TYOA 2IUZA 4DRHA 2PPNA 2PBCA 2KR7A 3ALGA 1HJVA 2MLXA 4TW6A 2FAPA 1T11A 3NRKA 5HUAA 5HBFA 4LAWA 1OWQA 5HT1A 1GPFA 5GPRA 2FDMA 1FKBA 4MGVA 2PN0A 1NMVA 4ODOA 1H0IA 1GRJA 4DZ2A 3UI4A 2RUCA 4W5UA 3OA5A 1NSGA 1JNDA 4JFIA 2A3BA 2A3CA 2RURA 1D6OA 1F8AB 4ODKA 2UZ5A 4QIBA 4JYSA 1FKIA 4ZPVR 2DSUA 4N19A 1GOIA 4O2TA 1FJDA 3GU0A 2DSWA 2ZQUA 2O92A 2DSVA 1FFRA 4JFMA 3ARRA 1Q1CA 4HBEA 2PPPA 3IHZA 1ZL1A 2F2DA 2KGJA 3CHEA 4MNJA 4ML4A 2ESCA 4XAKA 4P8VA 3ARUA 3O5EA 3UI5A 1LG1A 1W1PA 3WIJA 4MPKA 3G6LA 3WQWA 3B7XA 2ZR6A 1LL7A 3QOKA 3RMEA 5I98A 1ROUA 3CZ8A 4ODQA 2G41A 2ETNA 4MNKA 3TCZA 2JZVA 2XP8A 4W9OA 4ZPTR 4L72B 3O5DA 3UF8A 4C02B 3FY1A 1J4RA 3JYMA 4DIPA 1JCHB 3PRDA 3O5GA 3NI6A 4NNRA 3ALFA 2P4VA 1EIBA 1LL4A 3B8SA 5HWBA 1W9VA 4Q22A 4J4NA 4MTVA 2M08A 2KE0A 2M2AA 5HW6A 2MLYA 5GPGA 3NTPA 4DRNA 1QPFA 3PRAA 4WJXA 2PI6A 3TDBA 4IQCA 1ITXA 3CGMA 3IKDA 4GGQA 4MNLA 1M5YA 4DT4A 3KAGA 2WM0A 2MPHA 2Q5AA 4ODPA 4QT2A 1FAPA 1EDQA 3RM4A 1W26A 2PPOA 1HJWA 4MNMA 3KAHA 2F23A 1NWUA 4P8XA 1J4HA 3UQBA 5DEZA 1CTNA 2DG9A 2KFWA 1X6NA 1N1AA 3ODKA 4AY1A 4LAVA 5JH8A 3UQIA 3O5FA 1F40A 1ZBWA 2MF9A 3ARPA 2DG3A 1LL6A 3EY6A 4IT6A 1E6PA 3CHDA 2LJ4A 1D7JA 1ZB5A 3AS3A 4Z2LA 1W9UA 1JNTA 4IPXA 3WD2A 1YATA 1Q6HA 2Y78A 2ZR5A 4ODRA 4U86A 4JFJA 2XPAA 3O5OA 3JYJA 4FN2A 4JFLA 2XPBA 3UI6A 1PINA 1Q6IA 2PV2A 1E15A 1D2KA 1E9LA 1HXVA 5HW7A 2DPEA 1XRVA 3GPKA 2KO7A 4P8WA 3FXYA 3FAPA 1U79A 4W9PA 1ROTA 1W9PA 5DITA 3IKGA 1SR0A 1FD9A 1HKIA 4Z2GA 2YBUA 1NWTA 2F21A 4P8UA 3WD3A 3O5JA 4KR0B 1Y0OA 3KABA 1FKFA 1EQ3A 3W4RA 4TNSA 3WD1A 2ITKA 4ODMA 4Z2JA 4GIVA 3B9AA 1KT0A 3CGNA 4DRPA 3O5KA 3LUOA 4U85A 1K9TA 3AS2A 2KI3A 2RSEA 2RQSA 5B8IC 1E6ZA 4DWSC 1UR8A 3WQVA 1ZBVA 3G6MA 5DO2A 3WD4A 2D9FA 2WLZA 2AWGA 1SYTA 2O9OA 4MSPA 2VN1A 1ZBCA 1E6RA 1X6LA 1RD6A 1XHGA 1ZK6A 5HWCA 4NZCA 5HTGA 4DRIA 4DWSA 4ZPWR 4L3NA 1WNOA 1Q6UA 2OFNA 3ARVA 3O5MA 3UQAA 5DF0A 1BKFA 1OGGA 4DRMA 4G50A 3WKZA 1D7IA 4DRKA 2ZQVA 2B5UB 1LQ0A 2M1IA 3ARTA 2G8ZA 4WIWA 2L2SA 4TW8A 2DSZA 4URIA 4QZVB 2XP9A 4LAXA 3GTYX 3O5LA 2DT1A 4TX0A 3WL0A 3KAFA 1A7XA 3AROA 3WD0A 3TC5A 3KADA 4HBOA 3MDYB 3WL1A 2XP3A 1HKJA 3IK8A 1KT1A 5HW8A 3ARWA 1FKLA 4LAYA 3I6CA 1NWSA 2WK2A 5D75A 4NSBA 1JVWA 1L1PA 4Z2KA 1OGBA 2ZQSA 3KCEA 2IF4A 2DT0A 3CHCA 1FKDA 1E6NA 1W1YA 4WK9A 2XP5A 4IQ2A 3AS1A 3B9DA 1E44A 1FKKA 1O6IA 1UR9A 2LPVA 2PV1A 1GUVA 1C9HA 1QPLA 4WKFA 4ODNA 3RFWA 4LGXA 2VCDA 1FKTA 1FKSA 3VAWA 4DWSD 3ARYA 1EYMA 2LGOA 1J4IA 5BXJA 1FKJA 2DT3A 4JFKA 4PTMA 3O5RA 2LKNA 3JXVA 1WB0A 2DG4A 1TCOC 4WKHA 3BXWA 1KFWA 4ODLA 4BF8A 1LJYA 3B9EA 1W1VA 3ARQA 3RGCA 2MLZA 1WAWA 4DRQA 3CHFA 1W1TA 2ZQTA 4IT4A 2WLYA 3KAIA 3BMBA 4FAPA 1JNSA 4W9QA 3O5IA 1EHNA 1P5QA 2A3AA 4S3KA 1NWRA 3PA7A 4DH0A 2AOSA 4DZ3A 4ITZA 4Z2HA 5J6EA 4ZS6A 4HARA 2RUQA 1R9HA 4UDMA 3PR9A 3KACA 2B31A 1IX5A 1HKMA 2PV3A 2XP4A 2N87A 5HKGA 4WKAA 1H0GA 2A3EA 1NH6A 3AQUA 2EULA 4DRJA 1D7HA 4MAVA 2XP6A 1NMWA 5GQBA 2F4EA 1PBKA 3EIPA 1B6CA
chains in the Genus database with same CATH topology
4Q7NA 1HKKA 1FKGA 1FFQA 1BL4A 2XP7A 3ARXA 4Z2IA 1ZCNA 2OLHA 2QF8A 1JNEA 2FKEA 1LG2A 3O5QA 2MNTA 1TFVA 1FKRA 2RUDA 5DIVA 4J4OA 3RM9A 3PRBA 1ZBKA 4R5EA 3H9RB 3ARZA 2YBTA 2ZR4A 4TW7A 3WH0A 1VF8A 2K8IA 1J6YA 3CH9A 1FKHA 4QT3A 4DROA 3ARSA 1ZU8A 1YW5A 1QZ2A 3AS0A 1HJXA 3O5PA 4G2PA 2DT2A 4S3JA 5DIUA 4DWSB 4KQZA 3RM8A 3KZ7A 4R0XA 3OOBA 4U84A 4TYOA 2IUZA 4DRHA 2PPNA 2PBCA 2KR7A 3ALGA 1HJVA 2MLXA 4TW6A 2FAPA 1T11A 3NRKA 5HUAA 5HBFA 4LAWA 1OWQA 5HT1A 1GPFA 5GPRA 2FDMA 1FKBA 4MGVA 1NMVA 4ODOA 1H0IA 4DZ2A 3UI4A 2RUCA 4W5UA 3OA5A 1NSGA 1JNDA 4JFIA 2A3BA 2A3CA 2RURA 1D6OA 1F8AB 4ODKA 2UZ5A 4QIBA 4JYSA 1FKIA 4ZPVR 2DSUA 4N19A 1GOIA 4O2TA 1FJDA 2DSWA 2ZQUA 2O92A 2DSVA 1FFRA 4JFMA 3ARRA 1Q1CA 4HBEA 2PPPA 3IHZA 1ZL1A 2F2DA 2KGJA 3CHEA 4MNJA 4ML4A 2ESCA 4XAKA 4P8VA 3ARUA 3O5EA 3UI5A 1LG1A 1W1PA 3WIJA 4MPKA 3G6LA 3WQWA 3B7XA 2ZR6A 1LL7A 3QOKA 3RMEA 5I98A 1ROUA 3CZ8A 4ODQA 2G41A 4MNKA 3TCZA 2JZVA 2XP8A 4W9OA 4ZPTR 4L72B 3O5DA 3UF8A 4C02B 3FY1A 1J4RA 3JYMA 4DIPA 3PRDA 3O5GA 3NI6A 4NNRA 3ALFA 1EIBA 1LL4A 3B8SA 5HWBA 1W9VA 4Q22A 4J4NA 4MTVA 2M08A 2KE0A 2M2AA 5HW6A 2MLYA 5GPGA 3NTPA 4DRNA 1QPFA 3PRAA 4WJXA 2PI6A 3TDBA 4IQCA 1ITXA 3CGMA 3IKDA 4GGQA 4MNLA 1M5YA 4DT4A 3KAGA 2WM0A 2MPHA 2Q5AA 4ODPA 4QT2A 1FAPA 1EDQA 3RM4A 1W26A 2PPOA 1HJWA 4MNMA 3KAHA 1NWUA 4P8XA 1J4HA 3UQBA 5DEZA 1CTNA 2DG9A 2KFWA 1X6NA 1N1AA 3ODKA 4AY1A 4LAVA 5JH8A 3UQIA 3O5FA 1F40A 1ZBWA 2MF9A 3ARPA 2DG3A 1LL6A 3EY6A 4IT6A 1E6PA 3CHDA 2LJ4A 1D7JA 1ZB5A 3AS3A 4Z2LA 1W9UA 1JNTA 4IPXA 3WD2A 1YATA 1Q6HA 2Y78A 2ZR5A 4ODRA 4U86A 4JFJA 2XPAA 3O5OA 3JYJA 4FN2A 4JFLA 2XPBA 3UI6A 1PINA 1Q6IA 2PV2A 1E15A 1D2KA 1E9LA 1HXVA 5HW7A 2DPEA 1XRVA 3GPKA 2KO7A 4P8WA 3FXYA 3FAPA 1U79A 4W9PA 1ROTA 1W9PA 5DITA 3IKGA 1SR0A 1FD9A 1HKIA 4Z2GA 2YBUA 1NWTA 2F21A 4P8UA 3WD3A 3O5JA 4KR0B 1Y0OA 3KABA 1FKFA 1EQ3A 3W4RA 4TNSA 3WD1A 2ITKA 4ODMA 4Z2JA 4GIVA 3B9AA 1KT0A 3CGNA 4DRPA 3O5KA 3LUOA 4U85A 1K9TA 3AS2A 2KI3A 2RSEA 2RQSA 5B8IC 1E6ZA 4DWSC 1UR8A 3WQVA 1ZBVA 3G6MA 5DO2A 3WD4A 2D9FA 2WLZA 2AWGA 1SYTA 2O9OA 4MSPA 2VN1A 1ZBCA 1E6RA 1X6LA 1RD6A 1XHGA 1ZK6A 5HWCA 4NZCA 5HTGA 4DRIA 4DWSA 4ZPWR 4L3NA 1WNOA 1Q6UA 2OFNA 3ARVA 3O5MA 3UQAA 5DF0A 1BKFA 1OGGA 4DRMA 4G50A 3WKZA 1D7IA 4DRKA 2ZQVA 2M1IA 1LQ0A 3ARTA 2G8ZA 4WIWA 2L2SA 4TW8A 2DSZA 4URIA 4QZVB 2XP9A 4LAXA 3O5LA 2DT1A 4TX0A 3WL0A 3KAFA 1A7XA 3AROA 3WD0A 3TC5A 3KADA 4HBOA 3MDYB 3WL1A 2XP3A 1HKJA 3IK8A 1KT1A 5HW8A 3ARWA 1FKLA 4LAYA 3I6CA 1NWSA 2WK2A 5D75A 4NSBA 1JVWA 1L1PA 4Z2KA 1OGBA 2ZQSA 3KCEA 2IF4A 2DT0A 3CHCA 1FKDA 1E6NA 1W1YA 4WK9A 2XP5A 4IQ2A 3AS1A 3B9DA 1FKKA 1O6IA 1UR9A 2LPVA 2PV1A 1GUVA 1C9HA 1QPLA 4WKFA 4ODNA 3RFWA 4LGXA 2VCDA 1FKTA 1FKSA 3VAWA 4DWSD 3ARYA 1EYMA 2LGOA 1J4IA 5BXJA 1FKJA 2DT3A 4JFKA 4PTMA 3O5RA 2LKNA 3JXVA 1WB0A 2DG4A 1TCOC 4WKHA 3BXWA 1KFWA 4ODLA 4BF8A 1LJYA 3B9EA 1W1VA 3ARQA 3RGCA 2MLZA 1WAWA 4DRQA 3CHFA 1W1TA 2ZQTA 4IT4A 2WLYA 3KAIA 4FAPA 1JNSA 4W9QA 3O5IA 1EHNA 1P5QA 2A3AA 4S3KA 1NWRA 3PA7A 4DH0A 2AOSA 4DZ3A 4ITZA 4Z2HA 5J6EA 4ZS6A 4HARA 2RUQA 1R9HA 3PR9A 3KACA 2B31A 1IX5A 1HKMA 2PV3A 2XP4A 2N87A 5HKGA 4WKAA 1H0GA 2A3EA 1NH6A 3AQUA 4DRJA 1D7HA 4MAVA 2XP6A 1NMWA 5GQBA 2F4EA 1PBKA 1B6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI5 A;  5HW8 A;  2PV2 A;  1FKG A;  1FKL A;  3B7X A;  2ZR6 A;  4LAY A;  3I6C A;  1BL4 A;  5D75 A;  1JVW A;  2XP7 A;  5I98 A;  1L1P A;  3O5E A;  1ROU A;  1HXV A;  5HW7 A;  1ZCN A;  2ZQS A;  3KCE A;  4ODQ A;  2FKE A;  2IF4 A;  3GPK A;  2KO7 A;  2MNT A;  3O5Q A;  3TCZ A;  1FKD A;  2JZV A;  2RUD A;  2XP8 A;  4W9O A;  5DIV A;  1FKR A;  4J4O A;  3PRB A;  3FAP A;  3O5D A;  3UF8 A;  4C02 B;  3H9R B;  1J4R A;  1U79 A;  2XP5 A;  4W9P A;  1ROT A;  4IQ2 A;  3JYM A;  3IKG A;  5DIT A;  4DIP A;  1FD9 A;  4DRP A;  1FKK A;  2ZR4 A;  3PRD A;  4TW7 A;  3O5G A;  3WH0 A;  3NI6 A;  4NNR A;  2K8I A;  2F21 A;  3O5J A;  2LPV A;  1J6Y A;  1Y0O A;  1FKH A;  3KAB A;  1FKF A;  1EQ3 A;  2PV1 A;  1C9H A;  4QT3 A;  4TNS A;  1QPL A;  4DRO A;  2ITK A;  4ODN A;  4ODM A;  5HWB A;  1YW5 A;  1QZ2 A;  1KT0 A;  3CGN A;  3O5P A;  4G2P A;  4GIV A;  3RFW A;  2VCD A;  3O5K A;  1FKT A;  1FKS A;  3LUO A;  4U85 A;  3VAW A;  4J4N A;  1EYM A;  2M08 A;  5DIU A;  2LGO A;  2KI3 A;  1J4I A;  2KE0 A;  2RSE A;  2M2A A;  3KZ7 A;  5BXJ A;  2MLY A;  5GPG A;  5HW6 A;  2RQS A;  1FKJ A;  5B8I C;  4R0X A;  3NTP A;  4JFK A;  3OOB A;  4U84 A;  4TYO A;  4DRH A;  4DRN A;  1QPF A;  2PPN A;  2PBC A;  3O5R A;  2KR7 A;  2LKN A;  3JXV A;  3TDB A;  2DG4 A;  2MLX A;  1TCO C;  4TW6 A;  4IQC A;  2FAP A;  3CGM A;  1T11 A;  3IKD A;  3NRK A;  4GGQ A;  4ODL A;  4BF8 A;  5HUA A;  2D9F A;  1M5Y A;  4LAW A;  4DT4 A;  3KAG A;  2AWG A;  2MPH A;  2Q5A A;  5HT1 A;  4ODP A;  4QT2 A;  1FAP A;  3RGC A;  4MSP A;  2MLZ A;  1FKB A;  1W26 A;  2VN1 A;  2PPO A;  4MGV A;  4DRQ A;  1NMV A;  3KAH A;  2ZQT A;  4ODO A;  1ZK6 A;  3KAI A;  5HWC A;  1J4H A;  4DZ2 A;  3UQB A;  5HTG A;  4FAP A;  4DRI A;  1JNS A;  4W9Q A;  3UI4 A;  2RUC A;  2DG9 A;  3O5I A;  1Q6U A;  2KFW A;  2OFN A;  1N1A A;  1NSG A;  3O5M A;  3UQA A;  1BKF A;  1P5Q A;  3ODK A;  4JFI A;  4DRM A;  4LAV A;  4G50 A;  3UQI A;  3O5F A;  2RUR A;  3PA7 A;  1D7I A;  4DRK A;  1D6O A;  4DH0 A;  4DZ3 A;  1F8A B;  2MF9 A;  2ZQV A;  4ITZ A;  1F40 A;  5J6E A;  2M1I A;  2DG3 A;  4ODK A;  3EY6 A;  2UZ5 A;  2RUQ A;  4QIB A;  4JYS A;  1FKI A;  2LJ4 A;  1D7J A;  4N19 A;  2L2S A;  1R9H A;  3KAC A;  4TW8 A;  4O2T A;  1FJD A;  2PV3 A;  2ZQU A;  1JNT A;  2XP4 A;  4IPX A;  2N87 A;  2XP9 A;  1YAT A;  1Q6H A;  4JFM A;  5HKG A;  4LAX A;  3O5L A;  2Y78 A;  4TX0 A;  2ZR5 A;  1Q1C A;  4ODR A;  3KAF A;  2PPP A;  3IHZ A;  1A7X A;  1D7H A;  4JFJ A;  4U86 A;  4DRJ A;  2XPA A;  2XP6 A;  2F2D A;  2KGJ A;  3O5O A;  3JYJ A;  3KAD A;  3TC5 A;  4FN2 A;  4JFL A;  3MDY B;  1NMW A;  2XP3 A;  2XPB A;  3IK8 A;  1KT1 A;  1PBK A;  2F4E A;  3UI6 A;  1B6C A;  1PIN A;  1Q6I A; 
#chains in the Genus database with same CATH topology
 4Q7N A;  1HKK A;  1FKG A;  1FFQ A;  1BL4 A;  2XP7 A;  3ARX A;  4Z2I A;  1ZCN A;  2OLH A;  2QF8 A;  1JNE A;  2FKE A;  1LG2 A;  3O5Q A;  2MNT A;  1TFV A;  1FKR A;  2RUD A;  5DIV A;  4J4O A;  3RM9 A;  3PRB A;  1ZBK A;  4R5E A;  3H9R B;  3ARZ A;  2YBT A;  2ZR4 A;  4TW7 A;  3WH0 A;  1VF8 A;  2K8I A;  1J6Y A;  3CH9 A;  1FKH A;  4QT3 A;  4DRO A;  3ARS A;  1ZU8 A;  1YW5 A;  1QZ2 A;  3AS0 A;  1HJX A;  3O5P A;  4G2P A;  2DT2 A;  4S3J A;  5DIU A;  4DWS B;  4KQZ A;  3RM8 A;  3KZ7 A;  4R0X A;  3OOB A;  4U84 A;  4TYO A;  2IUZ A;  4DRH A;  2PPN A;  2PBC A;  2KR7 A;  3ALG A;  1HJV A;  2MLX A;  4TW6 A;  2FAP A;  1T11 A;  3NRK A;  5HUA A;  5HBF A;  4LAW A;  1OWQ A;  5HT1 A;  1GPF A;  5GPR A;  2FDM A;  1FKB A;  4MGV A;  2PN0 A;  1NMV A;  4ODO A;  1H0I A;  1GRJ A;  4DZ2 A;  3UI4 A;  2RUC A;  4W5U A;  3OA5 A;  1NSG A;  1JND A;  4JFI A;  2A3B A;  2A3C A;  2RUR A;  1D6O A;  1F8A B;  4ODK A;  2UZ5 A;  4QIB A;  4JYS A;  1FKI A;  4ZPV R;  2DSU A;  4N19 A;  1GOI A;  4O2T A;  1FJD A;  3GU0 A;  2DSW A;  2ZQU A;  2O92 A;  2DSV A;  1FFR A;  4JFM A;  3ARR A;  1Q1C A;  4HBE A;  2PPP A;  3IHZ A;  1ZL1 A;  2F2D A;  2KGJ A;  3CHE A;  4MNJ A;  4ML4 A;  2ESC A;  4XAK A;  4P8V A;  3ARU A;  3O5E A;  3UI5 A;  1LG1 A;  1W1P A;  3WIJ A;  4MPK A;  3G6L A;  3WQW A;  3B7X A;  2ZR6 A;  1LL7 A;  3QOK A;  3RME A;  5I98 A;  1ROU A;  3CZ8 A;  4ODQ A;  2G41 A;  2ETN A;  4MNK A;  3TCZ A;  2JZV A;  2XP8 A;  4W9O A;  4ZPT R;  4L72 B;  3O5D A;  3UF8 A;  4C02 B;  3FY1 A;  1J4R A;  3JYM A;  4DIP A;  1JCH B;  3PRD A;  3O5G A;  3NI6 A;  4NNR A;  3ALF A;  2P4V A;  1EIB A;  1LL4 A;  3B8S A;  5HWB A;  1W9V A;  4Q22 A;  4J4N A;  4MTV A;  2M08 A;  2KE0 A;  2M2A A;  5HW6 A;  2MLY A;  5GPG A;  3NTP A;  4DRN A;  1QPF A;  3PRA A;  4WJX A;  2PI6 A;  3TDB A;  4IQC A;  1ITX A;  3CGM A;  3IKD A;  4GGQ A;  4MNL A;  1M5Y A;  4DT4 A;  3KAG A;  2WM0 A;  2MPH A;  2Q5A A;  4ODP A;  4QT2 A;  1FAP A;  1EDQ A;  3RM4 A;  1W26 A;  2PPO A;  1HJW A;  4MNM A;  3KAH A;  2F23 A;  1NWU A;  4P8X A;  1J4H A;  3UQB A;  5DEZ A;  1CTN A;  2DG9 A;  2KFW A;  1X6N A;  1N1A A;  3ODK A;  4AY1 A;  4LAV A;  5JH8 A;  3UQI A;  3O5F A;  1F40 A;  1ZBW A;  2MF9 A;  3ARP A;  2DG3 A;  1LL6 A;  3EY6 A;  4IT6 A;  1E6P A;  3CHD A;  2LJ4 A;  1D7J A;  1ZB5 A;  3AS3 A;  4Z2L A;  1W9U A;  1JNT A;  4IPX A;  3WD2 A;  1YAT A;  1Q6H A;  2Y78 A;  2ZR5 A;  4ODR A;  4U86 A;  4JFJ A;  2XPA A;  3O5O A;  3JYJ A;  4FN2 A;  4JFL A;  2XPB A;  3UI6 A;  1PIN A;  1Q6I A;  2PV2 A;  1E15 A;  1D2K A;  1E9L A;  1HXV A;  5HW7 A;  2DPE A;  1XRV A;  3GPK A;  2KO7 A;  4P8W A;  3FXY A;  3FAP A;  1U79 A;  4W9P A;  1ROT A;  1W9P A;  5DIT A;  3IKG A;  1SR0 A;  1FD9 A;  1HKI A;  4Z2G A;  2YBU A;  1NWT A;  2F21 A;  4P8U A;  3WD3 A;  3O5J A;  4KR0 B;  1Y0O A;  3KAB A;  1FKF A;  1EQ3 A;  3W4R A;  4TNS A;  3WD1 A;  2ITK A;  4ODM A;  4Z2J A;  4GIV A;  3B9A A;  1KT0 A;  3CGN A;  4DRP A;  3O5K A;  3LUO A;  4U85 A;  1K9T A;  3AS2 A;  2KI3 A;  2RSE A;  2RQS A;  5B8I C;  1E6Z A;  4DWS C;  1UR8 A;  3WQV A;  1ZBV A;  3G6M A;  5DO2 A;  3WD4 A;  2D9F A;  2WLZ A;  2AWG A;  1SYT A;  2O9O A;  4MSP A;  2VN1 A;  1ZBC A;  1E6R A;  1X6L A;  1RD6 A;  1XHG A;  1ZK6 A;  5HWC A;  4NZC A;  5HTG A;  4DRI A;  4DWS A;  4ZPW R;  4L3N A;  1WNO A;  1Q6U A;  2OFN A;  3ARV A;  3O5M A;  3UQA A;  5DF0 A;  1BKF A;  1OGG A;  4DRM A;  4G50 A;  3WKZ A;  1D7I A;  4DRK A;  2ZQV A;  2B5U B;  1LQ0 A;  2M1I A;  3ART A;  2G8Z A;  4WIW A;  2L2S A;  4TW8 A;  2DSZ A;  4URI A;  4QZV B;  2XP9 A;  4LAX A;  3GTY X;  3O5L A;  2DT1 A;  4TX0 A;  3WL0 A;  3KAF A;  1A7X A;  3ARO A;  3WD0 A;  3TC5 A;  3KAD A;  4HBO A;  3MDY B;  3WL1 A;  2XP3 A;  1HKJ A;  3IK8 A;  1KT1 A;  5HW8 A;  3ARW A;  1FKL A;  4LAY A;  3I6C A;  1NWS A;  2WK2 A;  5D75 A;  4NSB A;  1JVW A;  1L1P A;  4Z2K A;  1OGB A;  2ZQS A;  3KCE A;  2IF4 A;  2DT0 A;  3CHC A;  1FKD A;  1E6N A;  1W1Y A;  4WK9 A;  2XP5 A;  4IQ2 A;  3AS1 A;  3B9D A;  1E44 A;  1FKK A;  1O6I A;  1UR9 A;  2LPV A;  2PV1 A;  1GUV A;  1C9H A;  1QPL A;  4WKF A;  4ODN A;  3RFW A;  4LGX A;  2VCD A;  1FKT A;  1FKS A;  3VAW A;  4DWS D;  3ARY A;  1EYM A;  2LGO A;  1J4I A;  5BXJ A;  1FKJ A;  2DT3 A;  4JFK A;  4PTM A;  3O5R A;  2LKN A;  3JXV A;  1WB0 A;  2DG4 A;  1TCO C;  4WKH A;  3BXW A;  1KFW A;  4ODL A;  4BF8 A;  1LJY A;  3B9E A;  1W1V A;  3ARQ A;  3RGC A;  2MLZ A;  1WAW A;  4DRQ A;  3CHF A;  1W1T A;  2ZQT A;  4IT4 A;  2WLY A;  3KAI A;  3BMB A;  4FAP A;  1JNS A;  4W9Q A;  3O5I A;  1EHN A;  1P5Q A;  2A3A A;  4S3K A;  1NWR A;  3PA7 A;  4DH0 A;  2AOS A;  4DZ3 A;  4ITZ A;  4Z2H A;  5J6E A;  4ZS6 A;  4HAR A;  2RUQ A;  1R9H A;  4UDM A;  3PR9 A;  3KAC A;  2B31 A;  1IX5 A;  1HKM A;  2PV3 A;  2XP4 A;  2N87 A;  5HKG A;  4WKA A;  1H0G A;  2A3E A;  1NH6 A;  3AQU A;  2EUL A;  4DRJ A;  1D7H A;  4MAV A;  2XP6 A;  1NMW A;  5GQB A;  2F4E A;  1PBK A;  3EIP A;  1B6C A; 
#chains in the Genus database with same CATH homology
 4Q7N A;  1HKK A;  1FKG A;  1FFQ A;  1BL4 A;  2XP7 A;  3ARX A;  4Z2I A;  1ZCN A;  2OLH A;  2QF8 A;  1JNE A;  2FKE A;  1LG2 A;  3O5Q A;  2MNT A;  1TFV A;  1FKR A;  2RUD A;  5DIV A;  4J4O A;  3RM9 A;  3PRB A;  1ZBK A;  4R5E A;  3H9R B;  3ARZ A;  2YBT A;  2ZR4 A;  4TW7 A;  3WH0 A;  1VF8 A;  2K8I A;  1J6Y A;  3CH9 A;  1FKH A;  4QT3 A;  4DRO A;  3ARS A;  1ZU8 A;  1YW5 A;  1QZ2 A;  3AS0 A;  1HJX A;  3O5P A;  4G2P A;  2DT2 A;  4S3J A;  5DIU A;  4DWS B;  4KQZ A;  3RM8 A;  3KZ7 A;  4R0X A;  3OOB A;  4U84 A;  4TYO A;  2IUZ A;  4DRH A;  2PPN A;  2PBC A;  2KR7 A;  3ALG A;  1HJV A;  2MLX A;  4TW6 A;  2FAP A;  1T11 A;  3NRK A;  5HUA A;  5HBF A;  4LAW A;  1OWQ A;  5HT1 A;  1GPF A;  5GPR A;  2FDM A;  1FKB A;  4MGV A;  1NMV A;  4ODO A;  1H0I A;  4DZ2 A;  3UI4 A;  2RUC A;  4W5U A;  3OA5 A;  1NSG A;  1JND A;  4JFI A;  2A3B A;  2A3C A;  2RUR A;  1D6O A;  1F8A B;  4ODK A;  2UZ5 A;  4QIB A;  4JYS A;  1FKI A;  4ZPV R;  2DSU A;  4N19 A;  1GOI A;  4O2T A;  1FJD A;  2DSW A;  2ZQU A;  2O92 A;  2DSV A;  1FFR A;  4JFM A;  3ARR A;  1Q1C A;  4HBE A;  2PPP A;  3IHZ A;  1ZL1 A;  2F2D A;  2KGJ A;  3CHE A;  4MNJ A;  4ML4 A;  2ESC A;  4XAK A;  4P8V A;  3ARU A;  3O5E A;  3UI5 A;  1LG1 A;  1W1P A;  3WIJ A;  4MPK A;  3G6L A;  3WQW A;  3B7X A;  2ZR6 A;  1LL7 A;  3QOK A;  3RME A;  5I98 A;  1ROU A;  3CZ8 A;  4ODQ A;  2G41 A;  4MNK A;  3TCZ A;  2JZV A;  2XP8 A;  4W9O A;  4ZPT R;  4L72 B;  3O5D A;  3UF8 A;  4C02 B;  3FY1 A;  1J4R A;  3JYM A;  4DIP A;  3PRD A;  3O5G A;  3NI6 A;  4NNR A;  3ALF A;  1EIB A;  1LL4 A;  3B8S A;  5HWB A;  1W9V A;  4Q22 A;  4J4N A;  4MTV A;  2M08 A;  2KE0 A;  2M2A A;  5HW6 A;  2MLY A;  5GPG A;  3NTP A;  4DRN A;  1QPF A;  3PRA A;  4WJX A;  2PI6 A;  3TDB A;  4IQC A;  1ITX A;  3CGM A;  3IKD A;  4GGQ A;  4MNL A;  1M5Y A;  4DT4 A;  3KAG A;  2WM0 A;  2MPH A;  2Q5A A;  4ODP A;  4QT2 A;  1FAP A;  1EDQ A;  3RM4 A;  1W26 A;  2PPO A;  1HJW A;  4MNM A;  3KAH A;  1NWU A;  4P8X A;  1J4H A;  3UQB A;  5DEZ A;  1CTN A;  2DG9 A;  2KFW A;  1X6N A;  1N1A A;  3ODK A;  4AY1 A;  4LAV A;  5JH8 A;  3UQI A;  3O5F A;  1F40 A;  1ZBW A;  2MF9 A;  3ARP A;  2DG3 A;  1LL6 A;  3EY6 A;  4IT6 A;  1E6P A;  3CHD A;  2LJ4 A;  1D7J A;  1ZB5 A;  3AS3 A;  4Z2L A;  1W9U A;  1JNT A;  4IPX A;  3WD2 A;  1YAT A;  1Q6H A;  2Y78 A;  2ZR5 A;  4ODR A;  4U86 A;  4JFJ A;  2XPA A;  3O5O A;  3JYJ A;  4FN2 A;  4JFL A;  2XPB A;  3UI6 A;  1PIN A;  1Q6I A;  2PV2 A;  1E15 A;  1D2K A;  1E9L A;  1HXV A;  5HW7 A;  2DPE A;  1XRV A;  3GPK A;  2KO7 A;  4P8W A;  3FXY A;  3FAP A;  1U79 A;  4W9P A;  1ROT A;  1W9P A;  5DIT A;  3IKG A;  1SR0 A;  1FD9 A;  1HKI A;  4Z2G A;  2YBU A;  1NWT A;  2F21 A;  4P8U A;  3WD3 A;  3O5J A;  4KR0 B;  1Y0O A;  3KAB A;  1FKF A;  1EQ3 A;  3W4R A;  4TNS A;  3WD1 A;  2ITK A;  4ODM A;  4Z2J A;  4GIV A;  3B9A A;  1KT0 A;  3CGN A;  4DRP A;  3O5K A;  3LUO A;  4U85 A;  1K9T A;  3AS2 A;  2KI3 A;  2RSE A;  2RQS A;  5B8I C;  1E6Z A;  4DWS C;  1UR8 A;  3WQV A;  1ZBV A;  3G6M A;  5DO2 A;  3WD4 A;  2D9F A;  2WLZ A;  2AWG A;  1SYT A;  2O9O A;  4MSP A;  2VN1 A;  1ZBC A;  1E6R A;  1X6L A;  1RD6 A;  1XHG A;  1ZK6 A;  5HWC A;  4NZC A;  5HTG A;  4DRI A;  4DWS A;  4ZPW R;  4L3N A;  1WNO A;  1Q6U A;  2OFN A;  3ARV A;  3O5M A;  3UQA A;  5DF0 A;  1BKF A;  1OGG A;  4DRM A;  4G50 A;  3WKZ A;  1D7I A;  4DRK A;  2ZQV A;  2M1I A;  1LQ0 A;  3ART A;  2G8Z A;  4WIW A;  2L2S A;  4TW8 A;  2DSZ A;  4URI A;  4QZV B;  2XP9 A;  4LAX A;  3O5L A;  2DT1 A;  4TX0 A;  3WL0 A;  3KAF A;  1A7X A;  3ARO A;  3WD0 A;  3TC5 A;  3KAD A;  4HBO A;  3MDY B;  3WL1 A;  2XP3 A;  1HKJ A;  3IK8 A;  1KT1 A;  5HW8 A;  3ARW A;  1FKL A;  4LAY A;  3I6C A;  1NWS A;  2WK2 A;  5D75 A;  4NSB A;  1JVW A;  1L1P A;  4Z2K A;  1OGB A;  2ZQS A;  3KCE A;  2IF4 A;  2DT0 A;  3CHC A;  1FKD A;  1E6N A;  1W1Y A;  4WK9 A;  2XP5 A;  4IQ2 A;  3AS1 A;  3B9D A;  1FKK A;  1O6I A;  1UR9 A;  2LPV A;  2PV1 A;  1GUV A;  1C9H A;  1QPL A;  4WKF A;  4ODN A;  3RFW A;  4LGX A;  2VCD A;  1FKT A;  1FKS A;  3VAW A;  4DWS D;  3ARY A;  1EYM A;  2LGO A;  1J4I A;  5BXJ A;  1FKJ A;  2DT3 A;  4JFK A;  4PTM A;  3O5R A;  2LKN A;  3JXV A;  1WB0 A;  2DG4 A;  1TCO C;  4WKH A;  3BXW A;  1KFW A;  4ODL A;  4BF8 A;  1LJY A;  3B9E A;  1W1V A;  3ARQ A;  3RGC A;  2MLZ A;  1WAW A;  4DRQ A;  3CHF A;  1W1T A;  2ZQT A;  4IT4 A;  2WLY A;  3KAI A;  4FAP A;  1JNS A;  4W9Q A;  3O5I A;  1EHN A;  1P5Q A;  2A3A A;  4S3K A;  1NWR A;  3PA7 A;  4DH0 A;  2AOS A;  4DZ3 A;  4ITZ A;  4Z2H A;  5J6E A;  4ZS6 A;  4HAR A;  2RUQ A;  1R9H A;  3PR9 A;  3KAC A;  2B31 A;  1IX5 A;  1HKM A;  2PV3 A;  2XP4 A;  2N87 A;  5HKG A;  4WKA A;  1H0G A;  2A3E A;  1NH6 A;  3AQU A;  4DRJ A;  1D7H A;  4MAV A;  2XP6 A;  1NMW A;  5GQB A;  2F4E A;  1PBK A;  1B6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...