1FKTA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cis-trans isomerase
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
total genus 19
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fktA00
4IQCA 5I98A 1Q6HA 4JFIA 4DRPA 2ZQUA 1FJDA 1D7IA 3O5IA 3KABA 1FKHA 1FKLA 1YATA 1TCOC 4IQ2A 3WH0A 3RFWA 2F4EA 3IKGA 3CGNA 3KZ7A 3ODKA 2LPVA 4DRQA 2K8IA 1Q6UA 5B8IC 2VN1A 3TC5A 3UI5A 2MLZA 3KCEA 2RQSA 3JYJA 1Y0OA 4ODPA 4DT4A 1KT1A 2RURA 1A7XA 1Q1CA 1J4IA 2DG9A 3KADA 5HW7A 2M2AA 2MNTA 1ZCNA 5HWBA 5HUAA 4FAPA 1JVWA 3NTPA 3O5MA 4JYSA 1NMVA 2ZR6A 2FAPA 2KGJA 1FKDA 4LAXA 1D6OA 1FKGA 1FD9A 4MSPA 2RUQA 4DRHA 4ODLA 3O5OA 2PV1A 4TNSA 2KE0A 1BL4A 2FKEA 3O5JA 1J6YA 2LJ4A 1U79A 1J4RA 3O5PA 4TW7A 1YW5A 1NSGA 3OOBA 2M08A 3KAIA 4LAWA 3TDBA 4DRMA 4MGVA 3EY6A 1B6CA 2MPHA 4W9OA 4DRJA 1PINA 4N19A 2XPBA 3KACA 2ZQVA 4GGQA 4TX0A 4LAVA 3UI4A 1FKRA 2XP3A 3O5DA 3FAPA 3O5KA 4LAYA 1JNSA 4TYOA 4QT3A 5HKGA 4JFMA 3VAWA 1P5QA 2ZR4A 4GIVA 4FN2A 2PBCA 3O5QA 1ROTA 4TW8A 4DRNA 2ZQSA 4QIBA 4G2PA 5HT1A 3O5GA 4DIPA 4DRIA 5HW6A 1EQ3A 3IKDA 2ITKA 2ZR5A 1FKBA 3KAFA 2D9FA 4ODNA 3B7XA 3CGMA 2PV2A 5BXJA 1NMWA 2LKNA 4DZ3A 2UZ5A 3JXVA 3LUOA 1N1AA 1D7JA 2RSEA 4DROA 2Y78A 4ODMA 4C02B 1FKJA 3UF8A 3GPKA 1BKFA 2RUCA 3H9RB 2MLYA 2XP8A 3O5EA 5DITA 3TCZA 1ZK6A 5DIUA 2PPNA 5HW8A 2MLXA 5GPGA 3I6CA 1QPFA 4R0XA 1W26A 3NI6A 4QT2A 2XP5A 2XP7A 4DZ2A 2DG3A 4U84A 5HTGA 2F21A 2ZQTA 4ITZA 1R9HA 1FKTA 1C9HA 4JFLA 4JFJA 4BF8A 2Q5AA 1F8AB 4ODRA 3UQBA 4JFKA 4J4OA 1ROUA 1QZ2A 3IHZA 4IPXA 3PRBA 4O2TA 2N87A 2IF4A 4U85A 2JZVA 2AWGA 4TW6A 1M5YA 4NNRA 4U86A 2F2DA 4ODOA 2VCDA 1FAPA 3UI6A 1HXVA 3MDYB 3JYMA 1F40A 2M1IA 2MF9A 3KAHA 2XPAA 3IK8A 4G50A 1EYMA 2LGOA 3UQIA 4DH0A 5D75A 1L1PA 1T11A 3KAGA 1JNTA 3UQAA 3O5FA 4ODQA 1FKFA 4J4NA 3RGCA 2PV3A 1J4HA 1Q6IA 2XP6A 4W9QA 1PBKA 2PPPA 2XP9A 3O5LA 2OFNA 1KT0A 2KI3A 4W9PA 5HWCA 1D7HA 5J6EA 3O5RA 2KR7A 2RUDA 1FKKA 2DG4A 2PPOA 2XP4A 2KFWA 3NRKA 3PRDA 4ODKA 4DRKA 1FKSA 1FKIA 2L2SA 5DIVA 3PA7A 2KO7A 1QPLA
chains in the Genus database with same CATH superfamily
4JFIA 1FKHA 1FKLA 3WH0A 3RFWA 3ODKA 3RM9A 1ZBKA 3UI5A 3ALGA 2RURA 1A7XA 1Q1CA 2DG9A 4IT6A 1SYTA 3ARUA 5HBFA 5HW7A 3GU0A 5HUAA 1JVWA 1NMVA 2ZR6A 2F23A 2FAPA 2KGJA 1FKGA 1JNEA 4DRHA 4ODLA 1JCHB 1EDQA 2KE0A 4Z2KA 3O5JA 1J6YA 1H0GA 3AS2A 2LJ4A 1SR0A 4WJXA 3O5PA 4DRMA 1YW5A 2M08A 3KAIA 4KQZA 4MGVA 3EY6A 4Z2GA 2XPBA 3KACA 3O5DA 3FAPA 3O5KA 1JNSA 4TYOA 4JFMA 4ZPWR 3WQWA 3O5QA 2AOSA 3UQBA 2ZQSA 4QIBA 4G2PA 3CHDA 4DIPA 5HW6A 1K9TA 4Q7NA 1XHGA 4ODNA 3PRAA 1LJYA 2DT0A 3JXVA 1N1AA 1D7JA 2Y78A 1NWTA 3UF8A 2RUCA 3H9RB 4L72B 4WKHA 5DITA 5HW8A 1ZK6A 1QPFA 2B31A 3WL1A 1W26A 4DZ2A 3WKZA 1E9LA 4PTMA 4P8XA 3ARVA 1ROUA 3IHZA 4AY1A 1W1TA 4TW6A 1E6RA 1F40A 1EIBA 1LL6A 3IK8A 4DWSD 3QOKA 3ARSA 3UQAA 4ML4A 1FKFA 1Q6IA 1E6NA 4W9PA 2KR7A 2RUDA 2DG4A 4WKAA 1OWQA 2G8ZA 1QPLA 4IQCA 1Q6HA 1E44A 1IX5A 1FJDA 1D7IA 3O5IA 3RM8A 4IQ2A 3AROA 1CTNA 3B8SA 4DRQA 1VF8A 4P8UA 5B8IC 2VN1A 3TC5A 2YBTA 2RQSA 3JYJA 4S3JA 1ZCNA 5HWBA 4WIWA 3CH9A 1D6OA 1FD9A 3O5OA 4WK9A 1OGGA 5JH8A 2DT2A 4P8VA 1B6CA 3WD4A 4Q22A 1W1YA 1NWSA 4N19A 1HKKA 3ARWA 4LAVA 2XP3A 3ALFA 4QT3A 2QF8A 1P5QA 2ZR4A 1HJWA 4FN2A 4GIVA 5HT1A 2ITKA 2ZR5A 2D9FA 1W1VA 4C02B 2DSZA 1HJVA 1FKJA 1HKMA 3GPKA 3O5EA 2MLYA 2XP8A 5DIUA 1NWUA 4R0XA 1HKJA 1NWRA 2XP5A 2XP7A 2DG3A 4U84A 2ZQTA 2P4VA 1C9HA 4JFLA 4JFJA 4HARA 1W9UA 3B9DA 1W1PA 4ODRA 4P8WA 4JFKA 5DEZA 1QZ2A 4IPXA 2N87A 4U85A 2JZVA 2AWGA 4ZPVR 3ARYA 4U86A 2F2DA 1FAPA 2XPAA 4G50A 1L1PA 1GRJA 5D75A 1T11A 3KAGA 4R5EA 2PV3A 1J4HA 1PBKA 1JNDA 2A3BA 2DPEA 2XP9A 1GUVA 4Z2LA 3ARRA 4MNKA 4DWSC 2WLZA 1ZBCA 2PPOA 3PRDA 4MNJA 2KFWA 3PA7A 4ODQA 2KO7A 1HJXA 2ZQUA 1FFRA 1GOIA 1YATA 1TCOC 1UR8A 5DO2A 2LPVA 3RMEA 2G41A 1Q6UA 2WK2A 5GQBA 1KT1A 1HKIA 3ARXA 1ZBVA 2O9OA 3KADA 4NSBA 3ARPA 2MNTA 3RM4A 4Z2JA 1WAWA 3AS3A 4JYSA 3PR9A 4MSPA 4LAXA 2DSWA 2RUQA 4TNSA 1BL4A 4WKFA 4QZVB 1GPFA 3CHEA 3BXWA 3TDBA 3OOBA 4LAWA 2A3AA 2MPHA 4W9OA 4DRJA 1PINA 3UI4A 2ZQVA 4GGQA 1FKRA 1WB0A 4LAYA 4DWSA 5HKGA 2DT3A 1LG1A 1H0IA 2WLYA 2DT1A 1ROTA 3AQUA 3WD2A 1FKBA 3KAFA 2PN0A 2PV2A 1OGBA 2LKNA 4DZ3A 2UZ5A 1TFVA 1UR9A 2RSEA 1ZL1A 3BMBA 3G6MA 2PPNA 1O6IA 5GPGA 3I6CA 3AS0A 1W9VA 2DSUA 5HTGA 1LL4A 3CHFA 4ITZA 4HBEA 4BF8A 1F8AB 1KFWA 2FDMA 4MNLA 2OLHA 4J4OA 4Z2HA 3AS1A 4O2TA 1E15A 1M5YA 4NNRA 4Z2IA 4ODOA 4W5UA 3MDYB 2O92A 3WIJA 1ZU8A 1E6ZA 1W9PA 4LGXA 3KAHA 4MTVA 4DH0A 1EYMA 2LGOA 3RGCA 4J4NA 2B5UB 4DWSB 1FFQA 2XP6A 4W9QA 4HBOA 4URIA 2PPPA 3O5LA 1LL7A 1KT0A 2ESCA 1D7HA 4DRKA 3NRKA 3WD3A 1FKIA 2L2SA 5DIVA 3WQVA 5GPRA 5I98A 1LG2A 4DRPA 3GTYX 3KABA 3WD1A 2F4EA 3IKGA 3CGNA 3KZ7A 3W4RA 2K8IA 2WM0A 2A3EA 2MLZA 3KCEA 4DT4A 1Y0OA 4ODPA 2IUZA 4MNMA 1J4IA 2M2AA 3ARZA 4FAPA 3NTPA 3O5MA 1FKDA 2DSVA 2PV1A 2PI6A 3FY1A 2FKEA 1NH6A 1WNOA 2A3CA 1ZB5A 3ARTA 4IT4A 3WD0A 1U79A 1J4RA 4TW7A 1ITXA 1NSGA 3CHCA 3CZ8A 4TX0A 1EHNA 3VAWA 2PBCA 4DRNA 1RD6A 4TW8A 2YBUA 1EQ3A 3O5GA 4DRIA 3OA5A 3IKDA 3B7XA 3CGMA 4MAVA 5BXJA 1NMWA 1X6LA 3LUOA 1E6PA 4DROA 4UDMA 4ODMA 1BKFA 1XRVA 3TCZA 1D2KA 2MLXA 3NI6A 4QT2A 3G6LA 2F21A 4MPKA 1R9HA 1FKTA 3ARQA 2Q5AA 3B9AA 3B9EA 3PRBA 1LQ0A 2IF4A 4KR0B 4S3KA 2VCDA 3UI6A 1HXVA 3EIPA 3JYMA 5DF0A 3FXYA 2M1IA 2MF9A 3UQIA 4ZS6A 1JNTA 3O5FA 3WL0A 2ETNA 4NZCA 4XAKA 2OFNA 2EULA 2KI3A 5HWCA 5J6EA 3O5RA 1X6NA 4ZPTR 1ZBWA 1FKKA 2XP4A 4ODKA 1FKSA 4L3NA
chains in the Genus database with same CATH topology
4JFIA 1FKHA 1FKLA 3WH0A 3RFWA 3ODKA 3RM9A 1ZBKA 3UI5A 3ALGA 2RURA 1A7XA 1Q1CA 2DG9A 4IT6A 1SYTA 3ARUA 5HBFA 5HW7A 5HUAA 1JVWA 1NMVA 2ZR6A 2FAPA 2KGJA 1FKGA 1JNEA 4DRHA 4ODLA 1EDQA 2KE0A 4Z2KA 3O5JA 1J6YA 1H0GA 3AS2A 2LJ4A 1SR0A 4WJXA 3O5PA 4DRMA 1YW5A 2M08A 3KAIA 4KQZA 4MGVA 3EY6A 4Z2GA 2XPBA 3KACA 3O5DA 3FAPA 3O5KA 1JNSA 4TYOA 4JFMA 4ZPWR 3WQWA 3O5QA 2AOSA 3UQBA 2ZQSA 4QIBA 4G2PA 3CHDA 4DIPA 5HW6A 1K9TA 4Q7NA 1XHGA 4ODNA 3PRAA 1LJYA 2DT0A 3JXVA 1N1AA 1D7JA 2Y78A 1NWTA 3UF8A 2RUCA 3H9RB 4L72B 4WKHA 5DITA 5HW8A 1ZK6A 1QPFA 2B31A 3WL1A 1W26A 4DZ2A 3WKZA 1E9LA 4PTMA 4P8XA 3ARVA 1ROUA 3IHZA 4AY1A 1W1TA 4TW6A 1E6RA 1F40A 1EIBA 1LL6A 3IK8A 4DWSD 3QOKA 3ARSA 3UQAA 4ML4A 1FKFA 1Q6IA 1E6NA 4W9PA 2KR7A 2RUDA 2DG4A 4WKAA 1OWQA 2G8ZA 1QPLA 4IQCA 1Q6HA 1IX5A 1FJDA 1D7IA 3O5IA 3RM8A 4IQ2A 3AROA 1CTNA 3B8SA 4DRQA 1VF8A 4P8UA 5B8IC 2VN1A 3TC5A 2YBTA 2RQSA 3JYJA 4S3JA 1ZCNA 5HWBA 4WIWA 3CH9A 1D6OA 1FD9A 3O5OA 4WK9A 1OGGA 5JH8A 2DT2A 4P8VA 1B6CA 3WD4A 4Q22A 1W1YA 1NWSA 4N19A 1HKKA 3ARWA 4LAVA 2XP3A 3ALFA 4QT3A 2QF8A 1P5QA 2ZR4A 1HJWA 4FN2A 4GIVA 5HT1A 2ITKA 2ZR5A 2D9FA 1W1VA 4C02B 2DSZA 1HJVA 1FKJA 1HKMA 3GPKA 3O5EA 2MLYA 2XP8A 5DIUA 1NWUA 4R0XA 1HKJA 1NWRA 2XP5A 2XP7A 2DG3A 4U84A 2ZQTA 1C9HA 4JFLA 4JFJA 4HARA 1W9UA 3B9DA 1W1PA 4ODRA 4P8WA 4JFKA 5DEZA 1QZ2A 4IPXA 2N87A 4U85A 2JZVA 2AWGA 4ZPVR 3ARYA 4U86A 2F2DA 1FAPA 2XPAA 4G50A 1L1PA 5D75A 1T11A 3KAGA 4R5EA 2PV3A 1J4HA 1PBKA 1JNDA 2A3BA 2DPEA 2XP9A 1GUVA 4Z2LA 3ARRA 4MNKA 4DWSC 2WLZA 1ZBCA 2PPOA 3PRDA 4MNJA 2KFWA 3PA7A 4ODQA 2KO7A 1HJXA 2ZQUA 1FFRA 1GOIA 1YATA 1TCOC 1UR8A 5DO2A 2LPVA 3RMEA 2G41A 1Q6UA 2WK2A 5GQBA 1KT1A 1HKIA 3ARXA 1ZBVA 2O9OA 3KADA 4NSBA 3ARPA 2MNTA 3RM4A 4Z2JA 1WAWA 3AS3A 4JYSA 3PR9A 4MSPA 4LAXA 2DSWA 2RUQA 4TNSA 1BL4A 4WKFA 4QZVB 1GPFA 3CHEA 3BXWA 3TDBA 3OOBA 4LAWA 2A3AA 2MPHA 4W9OA 4DRJA 1PINA 3UI4A 2ZQVA 4GGQA 1FKRA 1WB0A 4LAYA 4DWSA 5HKGA 2DT3A 1LG1A 1H0IA 2WLYA 2DT1A 1ROTA 3AQUA 3WD2A 1FKBA 3KAFA 2PV2A 1OGBA 2LKNA 4DZ3A 2UZ5A 1TFVA 1UR9A 2RSEA 1ZL1A 3G6MA 2PPNA 1O6IA 5GPGA 3I6CA 3AS0A 1W9VA 2DSUA 5HTGA 1LL4A 3CHFA 4ITZA 4HBEA 4BF8A 1F8AB 1KFWA 2FDMA 4MNLA 2OLHA 4J4OA 4Z2HA 3AS1A 4O2TA 1E15A 1M5YA 4NNRA 4Z2IA 4ODOA 4W5UA 3MDYB 2O92A 3WIJA 1ZU8A 1E6ZA 1W9PA 4LGXA 3KAHA 4MTVA 4DH0A 1EYMA 2LGOA 3RGCA 4J4NA 4DWSB 1FFQA 2XP6A 4W9QA 4HBOA 4URIA 2PPPA 3O5LA 1LL7A 1KT0A 2ESCA 1D7HA 4DRKA 3NRKA 3WD3A 1FKIA 2L2SA 5DIVA 3WQVA 5GPRA 5I98A 1LG2A 4DRPA 3KABA 3WD1A 2F4EA 3IKGA 3CGNA 3KZ7A 3W4RA 2K8IA 2WM0A 2A3EA 2MLZA 3KCEA 4DT4A 1Y0OA 4ODPA 2IUZA 4MNMA 1J4IA 2M2AA 3ARZA 4FAPA 3NTPA 3O5MA 1FKDA 2DSVA 2PV1A 2PI6A 3FY1A 2FKEA 1NH6A 1WNOA 2A3CA 1ZB5A 3ARTA 4IT4A 3WD0A 1U79A 1J4RA 4TW7A 1ITXA 1NSGA 3CHCA 3CZ8A 4TX0A 1EHNA 3VAWA 2PBCA 4DRNA 1RD6A 4TW8A 2YBUA 1EQ3A 3O5GA 4DRIA 3OA5A 3IKDA 3B7XA 3CGMA 4MAVA 5BXJA 1NMWA 1X6LA 3LUOA 1E6PA 4DROA 4ODMA 1BKFA 1XRVA 3TCZA 1D2KA 2MLXA 3NI6A 4QT2A 3G6LA 2F21A 4MPKA 1R9HA 1FKTA 3ARQA 2Q5AA 3B9AA 3B9EA 3PRBA 1LQ0A 2IF4A 4KR0B 4S3KA 2VCDA 3UI6A 1HXVA 3JYMA 5DF0A 3FXYA 2M1IA 2MF9A 3UQIA 4ZS6A 1JNTA 3O5FA 3WL0A 4NZCA 4XAKA 2OFNA 2KI3A 5HWCA 5J6EA 3O5RA 1X6NA 4ZPTR 1ZBWA 1FKKA 2XP4A 4ODKA 1FKSA 4L3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQC A;  5I98 A;  1Q6H A;  4JFI A;  4DRP A;  2ZQU A;  1FJD A;  1D7I A;  3O5I A;  3KAB A;  1FKH A;  1FKL A;  1YAT A;  1TCO C;  4IQ2 A;  3WH0 A;  3RFW A;  2F4E A;  3IKG A;  3CGN A;  3KZ7 A;  3ODK A;  2LPV A;  4DRQ A;  2K8I A;  1Q6U A;  5B8I C;  2VN1 A;  3TC5 A;  3UI5 A;  2MLZ A;  3KCE A;  2RQS A;  3JYJ A;  1Y0O A;  4ODP A;  4DT4 A;  1KT1 A;  2RUR A;  1A7X A;  1Q1C A;  1J4I A;  2DG9 A;  3KAD A;  5HW7 A;  2M2A A;  2MNT A;  1ZCN A;  5HWB A;  5HUA A;  4FAP A;  1JVW A;  3NTP A;  3O5M A;  4JYS A;  1NMV A;  2ZR6 A;  2FAP A;  2KGJ A;  1FKD A;  4LAX A;  1D6O A;  1FKG A;  1FD9 A;  4MSP A;  2RUQ A;  4DRH A;  4ODL A;  3O5O A;  2PV1 A;  4TNS A;  2KE0 A;  1BL4 A;  2FKE A;  3O5J A;  1J6Y A;  2LJ4 A;  1U79 A;  1J4R A;  3O5P A;  4TW7 A;  1YW5 A;  1NSG A;  3OOB A;  2M08 A;  3KAI A;  4LAW A;  3TDB A;  4DRM A;  4MGV A;  3EY6 A;  1B6C A;  2MPH A;  4W9O A;  4DRJ A;  1PIN A;  4N19 A;  2XPB A;  3KAC A;  2ZQV A;  4GGQ A;  4TX0 A;  4LAV A;  3UI4 A;  1FKR A;  2XP3 A;  3O5D A;  3FAP A;  3O5K A;  4LAY A;  1JNS A;  4TYO A;  4QT3 A;  5HKG A;  4JFM A;  3VAW A;  1P5Q A;  2ZR4 A;  4GIV A;  4FN2 A;  2PBC A;  3O5Q A;  1ROT A;  4TW8 A;  4DRN A;  2ZQS A;  4QIB A;  4G2P A;  5HT1 A;  3O5G A;  4DIP A;  4DRI A;  5HW6 A;  1EQ3 A;  3IKD A;  2ITK A;  2ZR5 A;  1FKB A;  3KAF A;  2D9F A;  4ODN A;  3B7X A;  3CGM A;  2PV2 A;  5BXJ A;  1NMW A;  2LKN A;  4DZ3 A;  2UZ5 A;  3JXV A;  3LUO A;  1N1A A;  1D7J A;  2RSE A;  4DRO A;  2Y78 A;  4ODM A;  4C02 B;  1FKJ A;  3UF8 A;  3GPK A;  1BKF A;  2RUC A;  3H9R B;  2MLY A;  2XP8 A;  3O5E A;  5DIT A;  3TCZ A;  1ZK6 A;  5DIU A;  2PPN A;  5HW8 A;  2MLX A;  5GPG A;  3I6C A;  1QPF A;  4R0X A;  1W26 A;  3NI6 A;  4QT2 A;  2XP5 A;  2XP7 A;  4DZ2 A;  2DG3 A;  4U84 A;  5HTG A;  2F21 A;  2ZQT A;  4ITZ A;  1R9H A;  1FKT A;  1C9H A;  4JFL A;  4JFJ A;  4BF8 A;  2Q5A A;  1F8A B;  4ODR A;  3UQB A;  4JFK A;  4J4O A;  1ROU A;  1QZ2 A;  3IHZ A;  4IPX A;  3PRB A;  4O2T A;  2N87 A;  2IF4 A;  4U85 A;  2JZV A;  2AWG A;  4TW6 A;  1M5Y A;  4NNR A;  4U86 A;  2F2D A;  4ODO A;  2VCD A;  1FAP A;  3UI6 A;  1HXV A;  3MDY B;  3JYM A;  1F40 A;  2M1I A;  2MF9 A;  3KAH A;  2XPA A;  3IK8 A;  4G50 A;  1EYM A;  2LGO A;  3UQI A;  4DH0 A;  5D75 A;  1L1P A;  1T11 A;  3KAG A;  1JNT A;  3UQA A;  3O5F A;  4ODQ A;  1FKF A;  4J4N A;  3RGC A;  2PV3 A;  1J4H A;  1Q6I A;  2XP6 A;  4W9Q A;  1PBK A;  2PPP A;  2XP9 A;  3O5L A;  2OFN A;  1KT0 A;  2KI3 A;  4W9P A;  5HWC A;  1D7H A;  5J6E A;  3O5R A;  2KR7 A;  2RUD A;  1FKK A;  2DG4 A;  2PPO A;  2XP4 A;  2KFW A;  3NRK A;  3PRD A;  4ODK A;  4DRK A;  1FKS A;  1FKI A;  2L2S A;  5DIV A;  3PA7 A;  2KO7 A;  1QPL A; 
#chains in the Genus database with same CATH topology
 4JFI A;  1FKH A;  1FKL A;  3WH0 A;  3RFW A;  3ODK A;  3RM9 A;  1ZBK A;  3UI5 A;  3ALG A;  2RUR A;  1A7X A;  1Q1C A;  2DG9 A;  4IT6 A;  1SYT A;  3ARU A;  5HBF A;  5HW7 A;  3GU0 A;  5HUA A;  1JVW A;  1NMV A;  2ZR6 A;  2F23 A;  2FAP A;  2KGJ A;  1FKG A;  1JNE A;  4DRH A;  4ODL A;  1JCH B;  1EDQ A;  2KE0 A;  4Z2K A;  3O5J A;  1J6Y A;  1H0G A;  3AS2 A;  2LJ4 A;  1SR0 A;  4WJX A;  3O5P A;  4DRM A;  1YW5 A;  2M08 A;  3KAI A;  4KQZ A;  4MGV A;  3EY6 A;  4Z2G A;  2XPB A;  3KAC A;  3O5D A;  3FAP A;  3O5K A;  1JNS A;  4TYO A;  4JFM A;  4ZPW R;  3WQW A;  3O5Q A;  2AOS A;  3UQB A;  2ZQS A;  4QIB A;  4G2P A;  3CHD A;  4DIP A;  5HW6 A;  1K9T A;  4Q7N A;  1XHG A;  4ODN A;  3PRA A;  1LJY A;  2DT0 A;  3JXV A;  1N1A A;  1D7J A;  2Y78 A;  1NWT A;  3UF8 A;  2RUC A;  3H9R B;  4L72 B;  4WKH A;  5DIT A;  5HW8 A;  1ZK6 A;  1QPF A;  2B31 A;  3WL1 A;  1W26 A;  4DZ2 A;  3WKZ A;  1E9L A;  4PTM A;  4P8X A;  3ARV A;  1ROU A;  3IHZ A;  4AY1 A;  1W1T A;  4TW6 A;  1E6R A;  1F40 A;  1EIB A;  1LL6 A;  3IK8 A;  4DWS D;  3QOK A;  3ARS A;  3UQA A;  4ML4 A;  1FKF A;  1Q6I A;  1E6N A;  4W9P A;  2KR7 A;  2RUD A;  2DG4 A;  4WKA A;  1OWQ A;  2G8Z A;  1QPL A;  4IQC A;  1Q6H A;  1E44 A;  1IX5 A;  1FJD A;  1D7I A;  3O5I A;  3RM8 A;  4IQ2 A;  3ARO A;  1CTN A;  3B8S A;  4DRQ A;  1VF8 A;  4P8U A;  5B8I C;  2VN1 A;  3TC5 A;  2YBT A;  2RQS A;  3JYJ A;  4S3J A;  1ZCN A;  5HWB A;  4WIW A;  3CH9 A;  1D6O A;  1FD9 A;  3O5O A;  4WK9 A;  1OGG A;  5JH8 A;  2DT2 A;  4P8V A;  1B6C A;  3WD4 A;  4Q22 A;  1W1Y A;  1NWS A;  4N19 A;  1HKK A;  3ARW A;  4LAV A;  2XP3 A;  3ALF A;  4QT3 A;  2QF8 A;  1P5Q A;  2ZR4 A;  1HJW A;  4FN2 A;  4GIV A;  5HT1 A;  2ITK A;  2ZR5 A;  2D9F A;  1W1V A;  4C02 B;  2DSZ A;  1HJV A;  1FKJ A;  1HKM A;  3GPK A;  3O5E A;  2MLY A;  2XP8 A;  5DIU A;  1NWU A;  4R0X A;  1HKJ A;  1NWR A;  2XP5 A;  2XP7 A;  2DG3 A;  4U84 A;  2ZQT A;  2P4V A;  1C9H A;  4JFL A;  4JFJ A;  4HAR A;  1W9U A;  3B9D A;  1W1P A;  4ODR A;  4P8W A;  4JFK A;  5DEZ A;  1QZ2 A;  4IPX A;  2N87 A;  4U85 A;  2JZV A;  2AWG A;  4ZPV R;  3ARY A;  4U86 A;  2F2D A;  1FAP A;  2XPA A;  4G50 A;  1L1P A;  1GRJ A;  5D75 A;  1T11 A;  3KAG A;  4R5E A;  2PV3 A;  1J4H A;  1PBK A;  1JND A;  2A3B A;  2DPE A;  2XP9 A;  1GUV A;  4Z2L A;  3ARR A;  4MNK A;  4DWS C;  2WLZ A;  1ZBC A;  2PPO A;  3PRD A;  4MNJ A;  2KFW A;  3PA7 A;  4ODQ A;  2KO7 A;  1HJX A;  2ZQU A;  1FFR A;  1GOI A;  1YAT A;  1TCO C;  1UR8 A;  5DO2 A;  2LPV A;  3RME A;  2G41 A;  1Q6U A;  2WK2 A;  5GQB A;  1KT1 A;  1HKI A;  3ARX A;  1ZBV A;  2O9O A;  3KAD A;  4NSB A;  3ARP A;  2MNT A;  3RM4 A;  4Z2J A;  1WAW A;  3AS3 A;  4JYS A;  3PR9 A;  4MSP A;  4LAX A;  2DSW A;  2RUQ A;  4TNS A;  1BL4 A;  4WKF A;  4QZV B;  1GPF A;  3CHE A;  3BXW A;  3TDB A;  3OOB A;  4LAW A;  2A3A A;  2MPH A;  4W9O A;  4DRJ A;  1PIN A;  3UI4 A;  2ZQV A;  4GGQ A;  1FKR A;  1WB0 A;  4LAY A;  4DWS A;  5HKG A;  2DT3 A;  1LG1 A;  1H0I A;  2WLY A;  2DT1 A;  1ROT A;  3AQU A;  3WD2 A;  1FKB A;  3KAF A;  2PN0 A;  2PV2 A;  1OGB A;  2LKN A;  4DZ3 A;  2UZ5 A;  1TFV A;  1UR9 A;  2RSE A;  1ZL1 A;  3BMB A;  3G6M A;  2PPN A;  1O6I A;  5GPG A;  3I6C A;  3AS0 A;  1W9V A;  2DSU A;  5HTG A;  1LL4 A;  3CHF A;  4ITZ A;  4HBE A;  4BF8 A;  1F8A B;  1KFW A;  2FDM A;  4MNL A;  2OLH A;  4J4O A;  4Z2H A;  3AS1 A;  4O2T A;  1E15 A;  1M5Y A;  4NNR A;  4Z2I A;  4ODO A;  4W5U A;  3MDY B;  2O92 A;  3WIJ A;  1ZU8 A;  1E6Z A;  1W9P A;  4LGX A;  3KAH A;  4MTV A;  4DH0 A;  1EYM A;  2LGO A;  3RGC A;  4J4N A;  2B5U B;  4DWS B;  1FFQ A;  2XP6 A;  4W9Q A;  4HBO A;  4URI A;  2PPP A;  3O5L A;  1LL7 A;  1KT0 A;  2ESC A;  1D7H A;  4DRK A;  3NRK A;  3WD3 A;  1FKI A;  2L2S A;  5DIV A;  3WQV A;  5GPR A;  5I98 A;  1LG2 A;  4DRP A;  3GTY X;  3KAB A;  3WD1 A;  2F4E A;  3IKG A;  3CGN A;  3KZ7 A;  3W4R A;  2K8I A;  2WM0 A;  2A3E A;  2MLZ A;  3KCE A;  4DT4 A;  1Y0O A;  4ODP A;  2IUZ A;  4MNM A;  1J4I A;  2M2A A;  3ARZ A;  4FAP A;  3NTP A;  3O5M A;  1FKD A;  2DSV A;  2PV1 A;  2PI6 A;  3FY1 A;  2FKE A;  1NH6 A;  1WNO A;  2A3C A;  1ZB5 A;  3ART A;  4IT4 A;  3WD0 A;  1U79 A;  1J4R A;  4TW7 A;  1ITX A;  1NSG A;  3CHC A;  3CZ8 A;  4TX0 A;  1EHN A;  3VAW A;  2PBC A;  4DRN A;  1RD6 A;  4TW8 A;  2YBU A;  1EQ3 A;  3O5G A;  4DRI A;  3OA5 A;  3IKD A;  3B7X A;  3CGM A;  4MAV A;  5BXJ A;  1NMW A;  1X6L A;  3LUO A;  1E6P A;  4DRO A;  4UDM A;  4ODM A;  1BKF A;  1XRV A;  3TCZ A;  1D2K A;  2MLX A;  3NI6 A;  4QT2 A;  3G6L A;  2F21 A;  4MPK A;  1R9H A;  1FKT A;  3ARQ A;  2Q5A A;  3B9A A;  3B9E A;  3PRB A;  1LQ0 A;  2IF4 A;  4KR0 B;  4S3K A;  2VCD A;  3UI6 A;  1HXV A;  3EIP A;  3JYM A;  5DF0 A;  3FXY A;  2M1I A;  2MF9 A;  3UQI A;  4ZS6 A;  1JNT A;  3O5F A;  3WL0 A;  2ETN A;  4NZC A;  4XAK A;  2OFN A;  2EUL A;  2KI3 A;  5HWC A;  5J6E A;  3O5R A;  1X6N A;  4ZPT R;  1ZBW A;  1FKK A;  2XP4 A;  4ODK A;  1FKS A;  4L3N A; 
#chains in the Genus database with same CATH homology
 4JFI A;  1FKH A;  1FKL A;  3WH0 A;  3RFW A;  3ODK A;  3RM9 A;  1ZBK A;  3UI5 A;  3ALG A;  2RUR A;  1A7X A;  1Q1C A;  2DG9 A;  4IT6 A;  1SYT A;  3ARU A;  5HBF A;  5HW7 A;  5HUA A;  1JVW A;  1NMV A;  2ZR6 A;  2FAP A;  2KGJ A;  1FKG A;  1JNE A;  4DRH A;  4ODL A;  1EDQ A;  2KE0 A;  4Z2K A;  3O5J A;  1J6Y A;  1H0G A;  3AS2 A;  2LJ4 A;  1SR0 A;  4WJX A;  3O5P A;  4DRM A;  1YW5 A;  2M08 A;  3KAI A;  4KQZ A;  4MGV A;  3EY6 A;  4Z2G A;  2XPB A;  3KAC A;  3O5D A;  3FAP A;  3O5K A;  1JNS A;  4TYO A;  4JFM A;  4ZPW R;  3WQW A;  3O5Q A;  2AOS A;  3UQB A;  2ZQS A;  4QIB A;  4G2P A;  3CHD A;  4DIP A;  5HW6 A;  1K9T A;  4Q7N A;  1XHG A;  4ODN A;  3PRA A;  1LJY A;  2DT0 A;  3JXV A;  1N1A A;  1D7J A;  2Y78 A;  1NWT A;  3UF8 A;  2RUC A;  3H9R B;  4L72 B;  4WKH A;  5DIT A;  5HW8 A;  1ZK6 A;  1QPF A;  2B31 A;  3WL1 A;  1W26 A;  4DZ2 A;  3WKZ A;  1E9L A;  4PTM A;  4P8X A;  3ARV A;  1ROU A;  3IHZ A;  4AY1 A;  1W1T A;  4TW6 A;  1E6R A;  1F40 A;  1EIB A;  1LL6 A;  3IK8 A;  4DWS D;  3QOK A;  3ARS A;  3UQA A;  4ML4 A;  1FKF A;  1Q6I A;  1E6N A;  4W9P A;  2KR7 A;  2RUD A;  2DG4 A;  4WKA A;  1OWQ A;  2G8Z A;  1QPL A;  4IQC A;  1Q6H A;  1IX5 A;  1FJD A;  1D7I A;  3O5I A;  3RM8 A;  4IQ2 A;  3ARO A;  1CTN A;  3B8S A;  4DRQ A;  1VF8 A;  4P8U A;  5B8I C;  2VN1 A;  3TC5 A;  2YBT A;  2RQS A;  3JYJ A;  4S3J A;  1ZCN A;  5HWB A;  4WIW A;  3CH9 A;  1D6O A;  1FD9 A;  3O5O A;  4WK9 A;  1OGG A;  5JH8 A;  2DT2 A;  4P8V A;  1B6C A;  3WD4 A;  4Q22 A;  1W1Y A;  1NWS A;  4N19 A;  1HKK A;  3ARW A;  4LAV A;  2XP3 A;  3ALF A;  4QT3 A;  2QF8 A;  1P5Q A;  2ZR4 A;  1HJW A;  4FN2 A;  4GIV A;  5HT1 A;  2ITK A;  2ZR5 A;  2D9F A;  1W1V A;  4C02 B;  2DSZ A;  1HJV A;  1FKJ A;  1HKM A;  3GPK A;  3O5E A;  2MLY A;  2XP8 A;  5DIU A;  1NWU A;  4R0X A;  1HKJ A;  1NWR A;  2XP5 A;  2XP7 A;  2DG3 A;  4U84 A;  2ZQT A;  1C9H A;  4JFL A;  4JFJ A;  4HAR A;  1W9U A;  3B9D A;  1W1P A;  4ODR A;  4P8W A;  4JFK A;  5DEZ A;  1QZ2 A;  4IPX A;  2N87 A;  4U85 A;  2JZV A;  2AWG A;  4ZPV R;  3ARY A;  4U86 A;  2F2D A;  1FAP A;  2XPA A;  4G50 A;  1L1P A;  5D75 A;  1T11 A;  3KAG A;  4R5E A;  2PV3 A;  1J4H A;  1PBK A;  1JND A;  2A3B A;  2DPE A;  2XP9 A;  1GUV A;  4Z2L A;  3ARR A;  4MNK A;  4DWS C;  2WLZ A;  1ZBC A;  2PPO A;  3PRD A;  4MNJ A;  2KFW A;  3PA7 A;  4ODQ A;  2KO7 A;  1HJX A;  2ZQU A;  1FFR A;  1GOI A;  1YAT A;  1TCO C;  1UR8 A;  5DO2 A;  2LPV A;  3RME A;  2G41 A;  1Q6U A;  2WK2 A;  5GQB A;  1KT1 A;  1HKI A;  3ARX A;  1ZBV A;  2O9O A;  3KAD A;  4NSB A;  3ARP A;  2MNT A;  3RM4 A;  4Z2J A;  1WAW A;  3AS3 A;  4JYS A;  3PR9 A;  4MSP A;  4LAX A;  2DSW A;  2RUQ A;  4TNS A;  1BL4 A;  4WKF A;  4QZV B;  1GPF A;  3CHE A;  3BXW A;  3TDB A;  3OOB A;  4LAW A;  2A3A A;  2MPH A;  4W9O A;  4DRJ A;  1PIN A;  3UI4 A;  2ZQV A;  4GGQ A;  1FKR A;  1WB0 A;  4LAY A;  4DWS A;  5HKG A;  2DT3 A;  1LG1 A;  1H0I A;  2WLY A;  2DT1 A;  1ROT A;  3AQU A;  3WD2 A;  1FKB A;  3KAF A;  2PV2 A;  1OGB A;  2LKN A;  4DZ3 A;  2UZ5 A;  1TFV A;  1UR9 A;  2RSE A;  1ZL1 A;  3G6M A;  2PPN A;  1O6I A;  5GPG A;  3I6C A;  3AS0 A;  1W9V A;  2DSU A;  5HTG A;  1LL4 A;  3CHF A;  4ITZ A;  4HBE A;  4BF8 A;  1F8A B;  1KFW A;  2FDM A;  4MNL A;  2OLH A;  4J4O A;  4Z2H A;  3AS1 A;  4O2T A;  1E15 A;  1M5Y A;  4NNR A;  4Z2I A;  4ODO A;  4W5U A;  3MDY B;  2O92 A;  3WIJ A;  1ZU8 A;  1E6Z A;  1W9P A;  4LGX A;  3KAH A;  4MTV A;  4DH0 A;  1EYM A;  2LGO A;  3RGC A;  4J4N A;  4DWS B;  1FFQ A;  2XP6 A;  4W9Q A;  4HBO A;  4URI A;  2PPP A;  3O5L A;  1LL7 A;  1KT0 A;  2ESC A;  1D7H A;  4DRK A;  3NRK A;  3WD3 A;  1FKI A;  2L2S A;  5DIV A;  3WQV A;  5GPR A;  5I98 A;  1LG2 A;  4DRP A;  3KAB A;  3WD1 A;  2F4E A;  3IKG A;  3CGN A;  3KZ7 A;  3W4R A;  2K8I A;  2WM0 A;  2A3E A;  2MLZ A;  3KCE A;  4DT4 A;  1Y0O A;  4ODP A;  2IUZ A;  4MNM A;  1J4I A;  2M2A A;  3ARZ A;  4FAP A;  3NTP A;  3O5M A;  1FKD A;  2DSV A;  2PV1 A;  2PI6 A;  3FY1 A;  2FKE A;  1NH6 A;  1WNO A;  2A3C A;  1ZB5 A;  3ART A;  4IT4 A;  3WD0 A;  1U79 A;  1J4R A;  4TW7 A;  1ITX A;  1NSG A;  3CHC A;  3CZ8 A;  4TX0 A;  1EHN A;  3VAW A;  2PBC A;  4DRN A;  1RD6 A;  4TW8 A;  2YBU A;  1EQ3 A;  3O5G A;  4DRI A;  3OA5 A;  3IKD A;  3B7X A;  3CGM A;  4MAV A;  5BXJ A;  1NMW A;  1X6L A;  3LUO A;  1E6P A;  4DRO A;  4ODM A;  1BKF A;  1XRV A;  3TCZ A;  1D2K A;  2MLX A;  3NI6 A;  4QT2 A;  3G6L A;  2F21 A;  4MPK A;  1R9H A;  1FKT A;  3ARQ A;  2Q5A A;  3B9A A;  3B9E A;  3PRB A;  1LQ0 A;  2IF4 A;  4KR0 B;  4S3K A;  2VCD A;  3UI6 A;  1HXV A;  3JYM A;  5DF0 A;  3FXY A;  2M1I A;  2MF9 A;  3UQI A;  4ZS6 A;  1JNT A;  3O5F A;  3WL0 A;  4NZC A;  4XAK A;  2OFN A;  2KI3 A;  5HWC A;  5J6E A;  3O5R A;  1X6N A;  4ZPT R;  1ZBW A;  1FKK A;  2XP4 A;  4ODK A;  1FKS A;  4L3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...