1FKTA

Solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 AND RAPAMYCIN-BINDING PROTEIN
publication title Solution structure of FKBP, a rotamase enzyme and receptor for FK506 and rapamycin.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 19
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1992-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fktA00
4IQCA 4JFMA 4TX0A 2IF4A 2ZR4A 2DG3A 2ZQTA 2PBCA 4J4OA 2RUQA 1R9HA 1QPFA 2KE0A 2XP7A 3O5QA 2ZQUA 4ODRA 3O5MA 3WH0A 2XP5A 5D75A 3RFWA 5DIUA 1FJDA 1JVWA 3IKDA 2OFNA 5HT1A 3CGMA 3KCEA 4GIVA 4MGVA 4JFKA 5I98A 5HW7A 1J6YA 2RQSA 1ROTA 2XP3A 3O5LA 4DT4A 3B7XA 4LAWA 1P5QA 3PRDA 4MSPA 4ODOA 3KZ7A 1F8AB 2PV1A 1FKSA 2RUCA 3ODKA 4GGQA 3VAWA 2LPVA 3LUOA 3JYMA 1ZK6A 2LJ4A 2VCDA 2PV3A 4ITZA 1C9HA 3UI5A 3RGCA 4JYSA 4JFIA 1QPLA 3NRKA 2F4EA 2K8IA 2ZQVA 1F40A 4ODKA 1FKLA 3EY6A 1FKHA 2F21A 4J4NA 2MLYA 2M1IA 2JZVA 4W9PA 4DRPA 3O5GA 1J4HA 2D9FA 2ZQSA 2KGJA 2XPBA 4DH0A 1FKFA 3IK8A 4U86A 4G50A 4DROA 1KT1A 5HTGA 1Q6HA 5BXJA 1KT0A 5DITA 2XP8A 3IKGA 3O5FA 2XP9A 1Q6IA 2ZR5A 3KAFA 1FKGA 3TCZA 1J4IA 2ITKA 3H9RB 2RSEA 1L1PA 3GPKA 4U84A 1FKBA 4TYOA 1TCOC 3TDBA 2Q5AA 1JNSA 1FKDA 3FAPA 4N19A 1NMVA 1QZ2A 1D6OA 2M08A 3KADA 3O5EA 2RUDA 1FKRA 2Y78A 4ODNA 4DRMA 4DZ2A 2MPHA 1FKTA 4NNRA 4DZ3A 1PBKA 1BL4A 4R0XA 5B8IC 5HW6A 1EYMA 3UI6A 1B6CA 3UQIA 1D7IA 1U79A 2M2AA 3OOBA 4TW8A 1EQ3A 1FD9A 2LGOA 2F2DA 1Y0OA 4ODQA 2FKEA 1Q1CA 2PPNA 4DRHA 4DRNA 4TW6A 1N1AA 3KAIA 2PPPA 2RURA 1A7XA 4LAVA 3NI6A 2AWGA 2MLXA 4JFJA 5HWCA 2XP4A 3O5JA 2KR7A 3O5DA 2DG9A 4W9OA 3NTPA 4ODLA 1M5YA 2VN1A 2ZR6A 3O5IA 5HKGA 5HW8A 2FAPA 2LKNA 4ODMA 3I6CA 1W26A 1ZCNA 4DRIA 4U85A 5HWBA 4QT2A 1HXVA 4QIBA 1YATA 2MLZA 1FKJA 4IQ2A 1FKKA 2N87A 1FAPA 1ROUA 1T11A 2KI3A 3O5RA 4JFLA 4O2TA 4TNSA 5GPGA 3UQAA 3UF8A 1BKFA 4IPXA 3JYJA 1YW5A 3O5KA 4DRQA 5DIVA 1NMWA 1NSGA 3PA7A 4FN2A 2KFWA 4G2PA 1J4RA 1Q6UA 3O5PA 2PPOA 4ODPA 2XPAA 3KAGA 4TW7A 5J6EA 3KABA 3TC5A 4DIPA 3IHZA 1D7JA 3UQBA 3JXVA 3CGNA 2MF9A 2XP6A 3KAHA 3O5OA 4LAYA 3KACA 2KO7A 3MDYB 4C02B 3UI4A 4LAXA 4DRJA 1JNTA 2UZ5A 4W9QA 4BF8A 1D7HA 2L2SA 1FKIA 2DG4A 4QT3A 4DRKA 1PINA 4FAPA 2PV2A 2MNTA 5HUAA 3PRBA
chains in the Genus database with same CATH superfamily
2PN0A 2RUQA 3O5MA 3WH0A 5D75A 1FJDA 3GU0A 1JVWA 5HT1A 1WAWA 5HW7A 1J6YA 2RQSA 1P5QA 3ALGA 1UR8A 3AS2A 3KZ7A 1FKSA 3RM8A 3PRAA 3PR9A 2DSZA 2LJ4A 1UR9A 2ETNA 4ITZA 1C9HA 4JYSA 1QPLA 1VF8A 2F4EA 1LL6A 2F21A 3WD0A 4Z2IA 4Q22A 2DT3A 2KGJA 4U86A 4G50A 5BXJA 5DITA 2ZR5A 3KAFA 3TCZA 1J4IA 4HARA 3WD3A 4U84A 2Q5AA 1JNSA 3FAPA 3WKZA 3KADA 1D6OA 1OGBA 4W5UA 4ODNA 4DRMA 2MPHA 4DZ3A 1PBKA 4WJXA 3UQIA 4LGXA 1D7IA 4DWSC 3WL1A 1FD9A 4ODQA 1H0GA 4S3JA 4DRNA 2OLHA 2G41A 2RURA 1GUVA 4LAVA 3NI6A 2AWGA 2DG9A 2DT1A 1LL4A 3BMBA 3FY1A 1LG1A 4ODMA 2EULA 4DWSB 3I6CA 3ALFA 4DRIA 2DT2A 4QIBA 2B5UB 1YATA 1ZBCA 5GPRA 1FKJA 4IQ2A 1WNOA 2KI3A 4O2TA 4TNSA 3UF8A 1BKFA 3JYJA 3O5KA 1NMWA 3PA7A 2KFWA 2YBTA 4G2PA 1Q6UA 2WM0A 1JNEA 4TW7A 3KABA 3WL0A 3JXVA 4LAYA 3O5OA 3MDYB 2KO7A 1GRJA 4DRPA 4DRKA 1D7HA 3G6MA 2PV2A 4JFMA 4TX0A 3ARQA 2IF4A 4AY1A 4J4OA 1QPFA 2ZQUA 4ODRA 4ZS6A 3B9DA 1W1VA 4MAVA 3IKDA 5GQBA 3CHDA 3AS1A 5I98A 1ROTA 1FFQA 2WLYA 1HJXA 1EDQA 4LAWA 4ODOA 3ODKA 1F8AB 2PV1A 2RUCA 3WD1A 1KFWA 2LPVA 1HKJA 1W9UA 3ARPA 2VCDA 1ZBKA 1NWTA 3WQVA 1LJYA 3NRKA 4ZPTR 1XHGA 2K8IA 2ZQVA 3EY6A 3GTYX 2M1IA 5DO2A 5DEZA 1E6RA 1SR0A 2A3AA 3IK8A 1KT0A 1Q6IA 2ITKA 1L1PA 3ARZA 3RMEA 1FKBA 4TYOA 1K9TA 4KQZA 5JH8A 2IUZA 4MNJA 1NMVA 1ZB5A 1FKRA 1E15A 1BL4A 4R0XA 5B8IC 5HW6A 1IX5A 1U79A 3WIJA 3OOBA 2F2DA 3RM4A 3W4RA 5HWCA 2XP4A 4HBOA 3WD2A 4ODLA 1HJWA 2LKNA 4L72B 1W26A 2ESCA 2AOSA 1NH6A 4QT2A 4MTVA 2MLZA 3RM9A 1NSGA 2A3BA 3O5PA 2PPOA 4ODPA 2XPAA 3KAGA 5J6EA 3TC5A 2A3EA 4MNLA 4DIPA 3IHZA 4LAXA 4HBEA 2UZ5A 4W9QA 4BF8A 2L2SA 3WQWA 1PINA 1ZBWA 5HUAA 3PRBA 4IT4A 2ZR4A 1WB0A 2XP7A 1W9VA 3ARXA 1SYTA 2XP5A 3RFWA 3CHFA 2OFNA 3CGMA 4MGVA 2DSVA 2XP3A 3O5LA 3B7XA 4MSPA 2FDMA 3LUOA 1ZK6A 1H0IA 1JNDA 3RGCA 1F40A 4Q7NA 1FKLA 4J4NA 1ZL1A 2MLYA 3CZ8A 4W9PA 3O5GA 2D9FA 1FKFA 1EIBA 3CHEA 1KT1A 2B31A 1Q6HA 5HTGA 1EHNA 2RSEA 3GPKA 2DSUA 3ARUA 1FKDA 2M08A 1X6NA 4DZ2A 3UQBA 4NNRA 2DT0A 1EYMA 1GOIA 1B6CA 3UI6A 1HKKA 4TW8A 2LGOA 1Y0OA 1LL7A 1Q1CA 2PPNA 4DRHA 4P8XA 4TW6A 1N1AA 2PI6A 1TFVA 3KAIA 1A7XA 2MLXA 4Z2HA 3O5JA 2KR7A 4W9OA 3NTPA 1O6IA 1NWUA 2ZR6A 3O5IA 5HKGA 2FAPA 1E6ZA 4Z2KA 4UDMA 1JCHB 4Z2GA 1LQ0A 1XRVA 1OWQA 3AQUA 2YBUA 1FKKA 1FFRA 2N87A 1T11A 3O5RA 5GPGA 3B9EA 3ARSA 5DIVA 1J4RA 4IT6A 3B9AA 2XP6A 3KACA 4C02B 4DRJA 1FKIA 4FAPA 2MNTA 1NWSA 5DIUA 4IQCA 3AS3A 4DWSA 3FXYA 2DG3A 2ZQTA 2PBCA 1R9HA 2KE0A 3O5QA 4MNMA 1E6PA 4Z2JA 3CHCA 4XAKA 1RD6A 3ARTA 3KCEA 4GIVA 4JFKA 4P8VA 1HKIA 1OGGA 2WK2A 1E9LA 4DT4A 4ML4A 3PRDA 1NWRA 1ZU8A 4P8WA 4DWSD 4GGQA 3ARYA 3BXWA 4WKAA 3VAWA 3EIPA 3WD4A 3JYMA 3ARWA 2PV3A 3UI5A 3ARVA 4JFIA 2DPEA 4ODKA 1E44A 1FKHA 1W9PA 3AS0A 2JZVA 1J4HA 2F23A 2ZQSA 2XPBA 4DH0A 4R5EA 4DROA 1CTNA 1W1TA 2XP8A 2A3CA 3IKGA 3O5FA 2XP9A 1FKGA 1W1PA 3H9RB 1W1YA 4P8UA 1HKMA 1TCOC 4MNKA 3TDBA 1ITXA 4WIWA 4N19A 1QZ2A 3O5EA 2RUDA 4PTMA 2Y78A 1FKTA 3ARRA 2DSWA 2QF8A 2M2AA 4L3NA 1EQ3A 2FKEA 4KR0B 1GPFA 4QZVB 2PPPA 4JFJA 4MPKA 4NSBA 3O5DA 5HBFA 4WK9A 3CH9A 1M5YA 2VN1A 5HW8A 1X6LA 3QOKA 1LG2A 4S3KA 4URIA 1ZCNA 4WKHA 4U85A 4NZCA 5HWBA 1E6NA 4WKFA 1HXVA 1FAPA 1ROUA 4JFLA 3UQAA 4Z2LA 2WLZA 4IPXA 1YW5A 3OA5A 4ZPWR 4DRQA 4FN2A 2G8ZA 3AROA 2O92A 1D2KA 2P4VA 1D7JA 3G6LA 5DF0A 3CGNA 2MF9A 3KAHA 4ZPVR 2O9OA 1HJVA 3UI4A 3B8SA 1JNTA 2DG4A 4QT3A 1ZBVA
chains in the Genus database with same CATH topology
2RUQA 3O5MA 3WH0A 5D75A 1FJDA 1JVWA 5HT1A 1WAWA 5HW7A 1J6YA 2RQSA 1P5QA 3ALGA 1UR8A 3AS2A 3KZ7A 1FKSA 3RM8A 3PRAA 3PR9A 2DSZA 2LJ4A 1UR9A 4ITZA 1C9HA 4JYSA 1QPLA 1VF8A 2F4EA 1LL6A 2F21A 3WD0A 4Z2IA 4Q22A 2DT3A 2KGJA 4U86A 4G50A 5BXJA 5DITA 2ZR5A 3KAFA 3TCZA 1J4IA 4HARA 3WD3A 4U84A 2Q5AA 1JNSA 3FAPA 3WKZA 3KADA 1D6OA 1OGBA 4W5UA 4ODNA 4DRMA 2MPHA 4DZ3A 1PBKA 4WJXA 3UQIA 4LGXA 1D7IA 4DWSC 3WL1A 1FD9A 4ODQA 1H0GA 4S3JA 4DRNA 2OLHA 2G41A 2RURA 1GUVA 4LAVA 3NI6A 2AWGA 2DG9A 2DT1A 1LL4A 3FY1A 1LG1A 4ODMA 4DWSB 3I6CA 3ALFA 4DRIA 2DT2A 4QIBA 1YATA 1ZBCA 5GPRA 1FKJA 4IQ2A 1WNOA 2KI3A 4O2TA 4TNSA 3UF8A 1BKFA 3JYJA 3O5KA 1NMWA 3PA7A 2KFWA 2YBTA 4G2PA 1Q6UA 2WM0A 1JNEA 4TW7A 3KABA 3WL0A 3JXVA 4LAYA 3O5OA 3MDYB 2KO7A 4DRPA 4DRKA 1D7HA 3G6MA 2PV2A 4JFMA 4TX0A 3ARQA 2IF4A 4AY1A 4J4OA 1QPFA 2ZQUA 4ODRA 4ZS6A 3B9DA 1W1VA 4MAVA 3IKDA 5GQBA 3CHDA 3AS1A 5I98A 1ROTA 1FFQA 2WLYA 1HJXA 1EDQA 4LAWA 4ODOA 3ODKA 1F8AB 2PV1A 2RUCA 3WD1A 1KFWA 2LPVA 1HKJA 1W9UA 3ARPA 2VCDA 1ZBKA 1NWTA 3WQVA 1LJYA 3NRKA 4ZPTR 1XHGA 2K8IA 2ZQVA 3EY6A 2M1IA 5DO2A 5DEZA 1E6RA 1SR0A 2A3AA 3IK8A 1KT0A 1Q6IA 2ITKA 1L1PA 3ARZA 3RMEA 1FKBA 4TYOA 1K9TA 4KQZA 5JH8A 2IUZA 4MNJA 1NMVA 1ZB5A 1FKRA 1E15A 1BL4A 4R0XA 5B8IC 5HW6A 1IX5A 1U79A 3WIJA 3OOBA 2F2DA 3RM4A 3W4RA 5HWCA 2XP4A 4HBOA 3WD2A 4ODLA 1HJWA 2LKNA 4L72B 1W26A 2ESCA 2AOSA 1NH6A 4QT2A 4MTVA 2MLZA 3RM9A 1NSGA 2A3BA 3O5PA 2PPOA 4ODPA 2XPAA 3KAGA 5J6EA 3TC5A 2A3EA 4MNLA 4DIPA 3IHZA 4LAXA 4HBEA 2UZ5A 4W9QA 4BF8A 2L2SA 3WQWA 1PINA 1ZBWA 5HUAA 3PRBA 4IT4A 2ZR4A 1WB0A 2XP7A 1W9VA 3ARXA 1SYTA 2XP5A 3RFWA 3CHFA 2OFNA 3CGMA 4MGVA 2DSVA 2XP3A 3O5LA 3B7XA 4MSPA 2FDMA 3LUOA 1ZK6A 1H0IA 1JNDA 3RGCA 1F40A 4Q7NA 1FKLA 4J4NA 1ZL1A 2MLYA 3CZ8A 4W9PA 3O5GA 2D9FA 1FKFA 1EIBA 3CHEA 1KT1A 2B31A 1Q6HA 5HTGA 1EHNA 2RSEA 3GPKA 2DSUA 3ARUA 1FKDA 2M08A 1X6NA 4DZ2A 3UQBA 4NNRA 2DT0A 1EYMA 1GOIA 1B6CA 3UI6A 1HKKA 4TW8A 2LGOA 1Y0OA 1LL7A 1Q1CA 2PPNA 4DRHA 4P8XA 4TW6A 1N1AA 2PI6A 1TFVA 3KAIA 1A7XA 2MLXA 4Z2HA 3O5JA 2KR7A 4W9OA 3NTPA 1O6IA 1NWUA 2ZR6A 3O5IA 5HKGA 2FAPA 1E6ZA 4Z2KA 4Z2GA 1LQ0A 1XRVA 1OWQA 3AQUA 2YBUA 1FKKA 1FFRA 2N87A 1T11A 3O5RA 5GPGA 3B9EA 3ARSA 5DIVA 1J4RA 4IT6A 3B9AA 2XP6A 3KACA 4C02B 4DRJA 1FKIA 4FAPA 2MNTA 1NWSA 5DIUA 4IQCA 3AS3A 4DWSA 3FXYA 2DG3A 2ZQTA 2PBCA 1R9HA 2KE0A 3O5QA 4MNMA 1E6PA 4Z2JA 3CHCA 4XAKA 1RD6A 3ARTA 3KCEA 4GIVA 4JFKA 4P8VA 1HKIA 1OGGA 2WK2A 1E9LA 4DT4A 4ML4A 3PRDA 1NWRA 1ZU8A 4P8WA 4DWSD 4GGQA 3ARYA 3BXWA 4WKAA 3VAWA 3WD4A 3JYMA 3ARWA 2PV3A 3UI5A 3ARVA 4JFIA 2DPEA 4ODKA 1FKHA 1W9PA 3AS0A 2JZVA 1J4HA 2ZQSA 2XPBA 4DH0A 4R5EA 4DROA 1CTNA 1W1TA 2XP8A 2A3CA 3IKGA 3O5FA 2XP9A 1FKGA 1W1PA 3H9RB 1W1YA 4P8UA 1HKMA 1TCOC 4MNKA 3TDBA 1ITXA 4WIWA 4N19A 1QZ2A 3O5EA 2RUDA 4PTMA 2Y78A 1FKTA 3ARRA 2DSWA 2QF8A 2M2AA 4L3NA 1EQ3A 2FKEA 4KR0B 1GPFA 4QZVB 2PPPA 4JFJA 4MPKA 4NSBA 3O5DA 5HBFA 4WK9A 3CH9A 1M5YA 2VN1A 5HW8A 1X6LA 3QOKA 1LG2A 4S3KA 4URIA 1ZCNA 4WKHA 4U85A 4NZCA 5HWBA 1E6NA 4WKFA 1HXVA 1FAPA 1ROUA 4JFLA 3UQAA 4Z2LA 2WLZA 4IPXA 1YW5A 3OA5A 4ZPWR 4DRQA 4FN2A 2G8ZA 3AROA 2O92A 1D2KA 1D7JA 3G6LA 5DF0A 3CGNA 2MF9A 3KAHA 4ZPVR 2O9OA 1HJVA 3UI4A 3B8SA 1JNTA 2DG4A 4QT3A 1ZBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQC A;  4JFM A;  4TX0 A;  2IF4 A;  2ZR4 A;  2DG3 A;  2ZQT A;  2PBC A;  4J4O A;  2RUQ A;  1R9H A;  1QPF A;  2KE0 A;  2XP7 A;  3O5Q A;  2ZQU A;  4ODR A;  3O5M A;  3WH0 A;  2XP5 A;  5D75 A;  3RFW A;  5DIU A;  1FJD A;  1JVW A;  3IKD A;  2OFN A;  5HT1 A;  3CGM A;  3KCE A;  4GIV A;  4MGV A;  4JFK A;  5I98 A;  5HW7 A;  1J6Y A;  2RQS A;  1ROT A;  2XP3 A;  3O5L A;  4DT4 A;  3B7X A;  4LAW A;  1P5Q A;  3PRD A;  4MSP A;  4ODO A;  3KZ7 A;  1F8A B;  2PV1 A;  1FKS A;  2RUC A;  3ODK A;  4GGQ A;  3VAW A;  2LPV A;  3LUO A;  3JYM A;  1ZK6 A;  2LJ4 A;  2VCD A;  2PV3 A;  4ITZ A;  1C9H A;  3UI5 A;  3RGC A;  4JYS A;  4JFI A;  1QPL A;  3NRK A;  2F4E A;  2K8I A;  2ZQV A;  1F40 A;  4ODK A;  1FKL A;  3EY6 A;  1FKH A;  2F21 A;  4J4N A;  2MLY A;  2M1I A;  2JZV A;  4W9P A;  4DRP A;  3O5G A;  1J4H A;  2D9F A;  2ZQS A;  2KGJ A;  2XPB A;  4DH0 A;  1FKF A;  3IK8 A;  4U86 A;  4G50 A;  4DRO A;  1KT1 A;  5HTG A;  1Q6H A;  5BXJ A;  1KT0 A;  5DIT A;  2XP8 A;  3IKG A;  3O5F A;  2XP9 A;  1Q6I A;  2ZR5 A;  3KAF A;  1FKG A;  3TCZ A;  1J4I A;  2ITK A;  3H9R B;  2RSE A;  1L1P A;  3GPK A;  4U84 A;  1FKB A;  4TYO A;  1TCO C;  3TDB A;  2Q5A A;  1JNS A;  1FKD A;  3FAP A;  4N19 A;  1NMV A;  1QZ2 A;  1D6O A;  2M08 A;  3KAD A;  3O5E A;  2RUD A;  1FKR A;  2Y78 A;  4ODN A;  4DRM A;  4DZ2 A;  2MPH A;  1FKT A;  4NNR A;  4DZ3 A;  1PBK A;  1BL4 A;  4R0X A;  5B8I C;  5HW6 A;  1EYM A;  3UI6 A;  1B6C A;  3UQI A;  1D7I A;  1U79 A;  2M2A A;  3OOB A;  4TW8 A;  1EQ3 A;  1FD9 A;  2LGO A;  2F2D A;  1Y0O A;  4ODQ A;  2FKE A;  1Q1C A;  2PPN A;  4DRH A;  4DRN A;  4TW6 A;  1N1A A;  3KAI A;  2PPP A;  2RUR A;  1A7X A;  4LAV A;  3NI6 A;  2AWG A;  2MLX A;  4JFJ A;  5HWC A;  2XP4 A;  3O5J A;  2KR7 A;  3O5D A;  2DG9 A;  4W9O A;  3NTP A;  4ODL A;  1M5Y A;  2VN1 A;  2ZR6 A;  3O5I A;  5HKG A;  5HW8 A;  2FAP A;  2LKN A;  4ODM A;  3I6C A;  1W26 A;  1ZCN A;  4DRI A;  4U85 A;  5HWB A;  4QT2 A;  1HXV A;  4QIB A;  1YAT A;  2MLZ A;  1FKJ A;  4IQ2 A;  1FKK A;  2N87 A;  1FAP A;  1ROU A;  1T11 A;  2KI3 A;  3O5R A;  4JFL A;  4O2T A;  4TNS A;  5GPG A;  3UQA A;  3UF8 A;  1BKF A;  4IPX A;  3JYJ A;  1YW5 A;  3O5K A;  4DRQ A;  5DIV A;  1NMW A;  1NSG A;  3PA7 A;  4FN2 A;  2KFW A;  4G2P A;  1J4R A;  1Q6U A;  3O5P A;  2PPO A;  4ODP A;  2XPA A;  3KAG A;  4TW7 A;  5J6E A;  3KAB A;  3TC5 A;  4DIP A;  3IHZ A;  1D7J A;  3UQB A;  3JXV A;  3CGN A;  2MF9 A;  2XP6 A;  3KAH A;  3O5O A;  4LAY A;  3KAC A;  2KO7 A;  3MDY B;  4C02 B;  3UI4 A;  4LAX A;  4DRJ A;  1JNT A;  2UZ5 A;  4W9Q A;  4BF8 A;  1D7H A;  2L2S A;  1FKI A;  2DG4 A;  4QT3 A;  4DRK A;  1PIN A;  4FAP A;  2PV2 A;  2MNT A;  5HUA A;  3PRB A; 
#chains in the Genus database with same CATH topology
 2PN0 A;  2RUQ A;  3O5M A;  3WH0 A;  5D75 A;  1FJD A;  3GU0 A;  1JVW A;  5HT1 A;  1WAW A;  5HW7 A;  1J6Y A;  2RQS A;  1P5Q A;  3ALG A;  1UR8 A;  3AS2 A;  3KZ7 A;  1FKS A;  3RM8 A;  3PRA A;  3PR9 A;  2DSZ A;  2LJ4 A;  1UR9 A;  2ETN A;  4ITZ A;  1C9H A;  4JYS A;  1QPL A;  1VF8 A;  2F4E A;  1LL6 A;  2F21 A;  3WD0 A;  4Z2I A;  4Q22 A;  2DT3 A;  2KGJ A;  4U86 A;  4G50 A;  5BXJ A;  5DIT A;  2ZR5 A;  3KAF A;  3TCZ A;  1J4I A;  4HAR A;  3WD3 A;  4U84 A;  2Q5A A;  1JNS A;  3FAP A;  3WKZ A;  3KAD A;  1D6O A;  1OGB A;  4W5U A;  4ODN A;  4DRM A;  2MPH A;  4DZ3 A;  1PBK A;  4WJX A;  3UQI A;  4LGX A;  1D7I A;  4DWS C;  3WL1 A;  1FD9 A;  4ODQ A;  1H0G A;  4S3J A;  4DRN A;  2OLH A;  2G41 A;  2RUR A;  1GUV A;  4LAV A;  3NI6 A;  2AWG A;  2DG9 A;  2DT1 A;  1LL4 A;  3BMB A;  3FY1 A;  1LG1 A;  4ODM A;  2EUL A;  4DWS B;  3I6C A;  3ALF A;  4DRI A;  2DT2 A;  4QIB A;  2B5U B;  1YAT A;  1ZBC A;  5GPR A;  1FKJ A;  4IQ2 A;  1WNO A;  2KI3 A;  4O2T A;  4TNS A;  3UF8 A;  1BKF A;  3JYJ A;  3O5K A;  1NMW A;  3PA7 A;  2KFW A;  2YBT A;  4G2P A;  1Q6U A;  2WM0 A;  1JNE A;  4TW7 A;  3KAB A;  3WL0 A;  3JXV A;  4LAY A;  3O5O A;  3MDY B;  2KO7 A;  1GRJ A;  4DRP A;  4DRK A;  1D7H A;  3G6M A;  2PV2 A;  4JFM A;  4TX0 A;  3ARQ A;  2IF4 A;  4AY1 A;  4J4O A;  1QPF A;  2ZQU A;  4ODR A;  4ZS6 A;  3B9D A;  1W1V A;  4MAV A;  3IKD A;  5GQB A;  3CHD A;  3AS1 A;  5I98 A;  1ROT A;  1FFQ A;  2WLY A;  1HJX A;  1EDQ A;  4LAW A;  4ODO A;  3ODK A;  1F8A B;  2PV1 A;  2RUC A;  3WD1 A;  1KFW A;  2LPV A;  1HKJ A;  1W9U A;  3ARP A;  2VCD A;  1ZBK A;  1NWT A;  3WQV A;  1LJY A;  3NRK A;  4ZPT R;  1XHG A;  2K8I A;  2ZQV A;  3EY6 A;  3GTY X;  2M1I A;  5DO2 A;  5DEZ A;  1E6R A;  1SR0 A;  2A3A A;  3IK8 A;  1KT0 A;  1Q6I A;  2ITK A;  1L1P A;  3ARZ A;  3RME A;  1FKB A;  4TYO A;  1K9T A;  4KQZ A;  5JH8 A;  2IUZ A;  4MNJ A;  1NMV A;  1ZB5 A;  1FKR A;  1E15 A;  1BL4 A;  4R0X A;  5B8I C;  5HW6 A;  1IX5 A;  1U79 A;  3WIJ A;  3OOB A;  2F2D A;  3RM4 A;  3W4R A;  5HWC A;  2XP4 A;  4HBO A;  3WD2 A;  4ODL A;  1HJW A;  2LKN A;  4L72 B;  1W26 A;  2ESC A;  2AOS A;  1NH6 A;  4QT2 A;  4MTV A;  2MLZ A;  3RM9 A;  1NSG A;  2A3B A;  3O5P A;  2PPO A;  4ODP A;  2XPA A;  3KAG A;  5J6E A;  3TC5 A;  2A3E A;  4MNL A;  4DIP A;  3IHZ A;  4LAX A;  4HBE A;  2UZ5 A;  4W9Q A;  4BF8 A;  2L2S A;  3WQW A;  1PIN A;  1ZBW A;  5HUA A;  3PRB A;  4IT4 A;  2ZR4 A;  1WB0 A;  2XP7 A;  1W9V A;  3ARX A;  1SYT A;  2XP5 A;  3RFW A;  3CHF A;  2OFN A;  3CGM A;  4MGV A;  2DSV A;  2XP3 A;  3O5L A;  3B7X A;  4MSP A;  2FDM A;  3LUO A;  1ZK6 A;  1H0I A;  1JND A;  3RGC A;  1F40 A;  4Q7N A;  1FKL A;  4J4N A;  1ZL1 A;  2MLY A;  3CZ8 A;  4W9P A;  3O5G A;  2D9F A;  1FKF A;  1EIB A;  3CHE A;  1KT1 A;  2B31 A;  1Q6H A;  5HTG A;  1EHN A;  2RSE A;  3GPK A;  2DSU A;  3ARU A;  1FKD A;  2M08 A;  1X6N A;  4DZ2 A;  3UQB A;  4NNR A;  2DT0 A;  1EYM A;  1GOI A;  1B6C A;  3UI6 A;  1HKK A;  4TW8 A;  2LGO A;  1Y0O A;  1LL7 A;  1Q1C A;  2PPN A;  4DRH A;  4P8X A;  4TW6 A;  1N1A A;  2PI6 A;  1TFV A;  3KAI A;  1A7X A;  2MLX A;  4Z2H A;  3O5J A;  2KR7 A;  4W9O A;  3NTP A;  1O6I A;  1NWU A;  2ZR6 A;  3O5I A;  5HKG A;  2FAP A;  1E6Z A;  4Z2K A;  4UDM A;  1JCH B;  4Z2G A;  1LQ0 A;  1XRV A;  1OWQ A;  3AQU A;  2YBU A;  1FKK A;  1FFR A;  2N87 A;  1T11 A;  3O5R A;  5GPG A;  3B9E A;  3ARS A;  5DIV A;  1J4R A;  4IT6 A;  3B9A A;  2XP6 A;  3KAC A;  4C02 B;  4DRJ A;  1FKI A;  4FAP A;  2MNT A;  1NWS A;  5DIU A;  4IQC A;  3AS3 A;  4DWS A;  3FXY A;  2DG3 A;  2ZQT A;  2PBC A;  1R9H A;  2KE0 A;  3O5Q A;  4MNM A;  1E6P A;  4Z2J A;  3CHC A;  4XAK A;  1RD6 A;  3ART A;  3KCE A;  4GIV A;  4JFK A;  4P8V A;  1HKI A;  1OGG A;  2WK2 A;  1E9L A;  4DT4 A;  4ML4 A;  3PRD A;  1NWR A;  1ZU8 A;  4P8W A;  4DWS D;  4GGQ A;  3ARY A;  3BXW A;  4WKA A;  3VAW A;  3EIP A;  3WD4 A;  3JYM A;  3ARW A;  2PV3 A;  3UI5 A;  3ARV A;  4JFI A;  2DPE A;  4ODK A;  1E44 A;  1FKH A;  1W9P A;  3AS0 A;  2JZV A;  1J4H A;  2F23 A;  2ZQS A;  2XPB A;  4DH0 A;  4R5E A;  4DRO A;  1CTN A;  1W1T A;  2XP8 A;  2A3C A;  3IKG A;  3O5F A;  2XP9 A;  1FKG A;  1W1P A;  3H9R B;  1W1Y A;  4P8U A;  1HKM A;  1TCO C;  4MNK A;  3TDB A;  1ITX A;  4WIW A;  4N19 A;  1QZ2 A;  3O5E A;  2RUD A;  4PTM A;  2Y78 A;  1FKT A;  3ARR A;  2DSW A;  2QF8 A;  2M2A A;  4L3N A;  1EQ3 A;  2FKE A;  4KR0 B;  1GPF A;  4QZV B;  2PPP A;  4JFJ A;  4MPK A;  4NSB A;  3O5D A;  5HBF A;  4WK9 A;  3CH9 A;  1M5Y A;  2VN1 A;  5HW8 A;  1X6L A;  3QOK A;  1LG2 A;  4S3K A;  4URI A;  1ZCN A;  4WKH A;  4U85 A;  4NZC A;  5HWB A;  1E6N A;  4WKF A;  1HXV A;  1FAP A;  1ROU A;  4JFL A;  3UQA A;  4Z2L A;  2WLZ A;  4IPX A;  1YW5 A;  3OA5 A;  4ZPW R;  4DRQ A;  4FN2 A;  2G8Z A;  3ARO A;  2O92 A;  1D2K A;  2P4V A;  1D7J A;  3G6L A;  5DF0 A;  3CGN A;  2MF9 A;  3KAH A;  4ZPV R;  2O9O A;  1HJV A;  3UI4 A;  3B8S A;  1JNT A;  2DG4 A;  4QT3 A;  1ZBV A; 
#chains in the Genus database with same CATH homology
 2RUQ A;  3O5M A;  3WH0 A;  5D75 A;  1FJD A;  1JVW A;  5HT1 A;  1WAW A;  5HW7 A;  1J6Y A;  2RQS A;  1P5Q A;  3ALG A;  1UR8 A;  3AS2 A;  3KZ7 A;  1FKS A;  3RM8 A;  3PRA A;  3PR9 A;  2DSZ A;  2LJ4 A;  1UR9 A;  4ITZ A;  1C9H A;  4JYS A;  1QPL A;  1VF8 A;  2F4E A;  1LL6 A;  2F21 A;  3WD0 A;  4Z2I A;  4Q22 A;  2DT3 A;  2KGJ A;  4U86 A;  4G50 A;  5BXJ A;  5DIT A;  2ZR5 A;  3KAF A;  3TCZ A;  1J4I A;  4HAR A;  3WD3 A;  4U84 A;  2Q5A A;  1JNS A;  3FAP A;  3WKZ A;  3KAD A;  1D6O A;  1OGB A;  4W5U A;  4ODN A;  4DRM A;  2MPH A;  4DZ3 A;  1PBK A;  4WJX A;  3UQI A;  4LGX A;  1D7I A;  4DWS C;  3WL1 A;  1FD9 A;  4ODQ A;  1H0G A;  4S3J A;  4DRN A;  2OLH A;  2G41 A;  2RUR A;  1GUV A;  4LAV A;  3NI6 A;  2AWG A;  2DG9 A;  2DT1 A;  1LL4 A;  3FY1 A;  1LG1 A;  4ODM A;  4DWS B;  3I6C A;  3ALF A;  4DRI A;  2DT2 A;  4QIB A;  1YAT A;  1ZBC A;  5GPR A;  1FKJ A;  4IQ2 A;  1WNO A;  2KI3 A;  4O2T A;  4TNS A;  3UF8 A;  1BKF A;  3JYJ A;  3O5K A;  1NMW A;  3PA7 A;  2KFW A;  2YBT A;  4G2P A;  1Q6U A;  2WM0 A;  1JNE A;  4TW7 A;  3KAB A;  3WL0 A;  3JXV A;  4LAY A;  3O5O A;  3MDY B;  2KO7 A;  4DRP A;  4DRK A;  1D7H A;  3G6M A;  2PV2 A;  4JFM A;  4TX0 A;  3ARQ A;  2IF4 A;  4AY1 A;  4J4O A;  1QPF A;  2ZQU A;  4ODR A;  4ZS6 A;  3B9D A;  1W1V A;  4MAV A;  3IKD A;  5GQB A;  3CHD A;  3AS1 A;  5I98 A;  1ROT A;  1FFQ A;  2WLY A;  1HJX A;  1EDQ A;  4LAW A;  4ODO A;  3ODK A;  1F8A B;  2PV1 A;  2RUC A;  3WD1 A;  1KFW A;  2LPV A;  1HKJ A;  1W9U A;  3ARP A;  2VCD A;  1ZBK A;  1NWT A;  3WQV A;  1LJY A;  3NRK A;  4ZPT R;  1XHG A;  2K8I A;  2ZQV A;  3EY6 A;  2M1I A;  5DO2 A;  5DEZ A;  1E6R A;  1SR0 A;  2A3A A;  3IK8 A;  1KT0 A;  1Q6I A;  2ITK A;  1L1P A;  3ARZ A;  3RME A;  1FKB A;  4TYO A;  1K9T A;  4KQZ A;  5JH8 A;  2IUZ A;  4MNJ A;  1NMV A;  1ZB5 A;  1FKR A;  1E15 A;  1BL4 A;  4R0X A;  5B8I C;  5HW6 A;  1IX5 A;  1U79 A;  3WIJ A;  3OOB A;  2F2D A;  3RM4 A;  3W4R A;  5HWC A;  2XP4 A;  4HBO A;  3WD2 A;  4ODL A;  1HJW A;  2LKN A;  4L72 B;  1W26 A;  2ESC A;  2AOS A;  1NH6 A;  4QT2 A;  4MTV A;  2MLZ A;  3RM9 A;  1NSG A;  2A3B A;  3O5P A;  2PPO A;  4ODP A;  2XPA A;  3KAG A;  5J6E A;  3TC5 A;  2A3E A;  4MNL A;  4DIP A;  3IHZ A;  4LAX A;  4HBE A;  2UZ5 A;  4W9Q A;  4BF8 A;  2L2S A;  3WQW A;  1PIN A;  1ZBW A;  5HUA A;  3PRB A;  4IT4 A;  2ZR4 A;  1WB0 A;  2XP7 A;  1W9V A;  3ARX A;  1SYT A;  2XP5 A;  3RFW A;  3CHF A;  2OFN A;  3CGM A;  4MGV A;  2DSV A;  2XP3 A;  3O5L A;  3B7X A;  4MSP A;  2FDM A;  3LUO A;  1ZK6 A;  1H0I A;  1JND A;  3RGC A;  1F40 A;  4Q7N A;  1FKL A;  4J4N A;  1ZL1 A;  2MLY A;  3CZ8 A;  4W9P A;  3O5G A;  2D9F A;  1FKF A;  1EIB A;  3CHE A;  1KT1 A;  2B31 A;  1Q6H A;  5HTG A;  1EHN A;  2RSE A;  3GPK A;  2DSU A;  3ARU A;  1FKD A;  2M08 A;  1X6N A;  4DZ2 A;  3UQB A;  4NNR A;  2DT0 A;  1EYM A;  1GOI A;  1B6C A;  3UI6 A;  1HKK A;  4TW8 A;  2LGO A;  1Y0O A;  1LL7 A;  1Q1C A;  2PPN A;  4DRH A;  4P8X A;  4TW6 A;  1N1A A;  2PI6 A;  1TFV A;  3KAI A;  1A7X A;  2MLX A;  4Z2H A;  3O5J A;  2KR7 A;  4W9O A;  3NTP A;  1O6I A;  1NWU A;  2ZR6 A;  3O5I A;  5HKG A;  2FAP A;  1E6Z A;  4Z2K A;  4Z2G A;  1LQ0 A;  1XRV A;  1OWQ A;  3AQU A;  2YBU A;  1FKK A;  1FFR A;  2N87 A;  1T11 A;  3O5R A;  5GPG A;  3B9E A;  3ARS A;  5DIV A;  1J4R A;  4IT6 A;  3B9A A;  2XP6 A;  3KAC A;  4C02 B;  4DRJ A;  1FKI A;  4FAP A;  2MNT A;  1NWS A;  5DIU A;  4IQC A;  3AS3 A;  4DWS A;  3FXY A;  2DG3 A;  2ZQT A;  2PBC A;  1R9H A;  2KE0 A;  3O5Q A;  4MNM A;  1E6P A;  4Z2J A;  3CHC A;  4XAK A;  1RD6 A;  3ART A;  3KCE A;  4GIV A;  4JFK A;  4P8V A;  1HKI A;  1OGG A;  2WK2 A;  1E9L A;  4DT4 A;  4ML4 A;  3PRD A;  1NWR A;  1ZU8 A;  4P8W A;  4DWS D;  4GGQ A;  3ARY A;  3BXW A;  4WKA A;  3VAW A;  3WD4 A;  3JYM A;  3ARW A;  2PV3 A;  3UI5 A;  3ARV A;  4JFI A;  2DPE A;  4ODK A;  1FKH A;  1W9P A;  3AS0 A;  2JZV A;  1J4H A;  2ZQS A;  2XPB A;  4DH0 A;  4R5E A;  4DRO A;  1CTN A;  1W1T A;  2XP8 A;  2A3C A;  3IKG A;  3O5F A;  2XP9 A;  1FKG A;  1W1P A;  3H9R B;  1W1Y A;  4P8U A;  1HKM A;  1TCO C;  4MNK A;  3TDB A;  1ITX A;  4WIW A;  4N19 A;  1QZ2 A;  3O5E A;  2RUD A;  4PTM A;  2Y78 A;  1FKT A;  3ARR A;  2DSW A;  2QF8 A;  2M2A A;  4L3N A;  1EQ3 A;  2FKE A;  4KR0 B;  1GPF A;  4QZV B;  2PPP A;  4JFJ A;  4MPK A;  4NSB A;  3O5D A;  5HBF A;  4WK9 A;  3CH9 A;  1M5Y A;  2VN1 A;  5HW8 A;  1X6L A;  3QOK A;  1LG2 A;  4S3K A;  4URI A;  1ZCN A;  4WKH A;  4U85 A;  4NZC A;  5HWB A;  1E6N A;  4WKF A;  1HXV A;  1FAP A;  1ROU A;  4JFL A;  3UQA A;  4Z2L A;  2WLZ A;  4IPX A;  1YW5 A;  3OA5 A;  4ZPW R;  4DRQ A;  4FN2 A;  2G8Z A;  3ARO A;  2O92 A;  1D2K A;  1D7J A;  3G6L A;  5DF0 A;  3CGN A;  2MF9 A;  3KAH A;  4ZPV R;  2O9O A;  1HJV A;  3UI4 A;  3B8S A;  1JNT A;  2DG4 A;  4QT3 A;  1ZBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...