2PV1A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide weyipnv
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Chaperone surA
publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 103
sequence length 103
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv1A00
4DRJA 1NMVA 4ODOA 5HUAA 1FKLA 4GGQA 1YW5A 2PV3A 3JYMA 5GPGA 3GPKA 4G2PA 1Q1CA 1FKRA 4JFIA 3O5JA 1JNSA 2XPBA 3RGCA 4ODQA 2ZQSA 4ODMA 3PRDA 3TC5A 2KI3A 3CGNA 3KAHA 4MGVA 5DITA 1F40A 1HXVA 3NTPA 3IHZA 2FKEA 2PPPA 4C02B 2M2AA 4ODPA 5J6EA 3I6CA 3KAIA 4J4NA 3NI6A 5HKGA 1YATA 1J4IA 1QPLA 2MLYA 1D7IA 1NSGA 2KFWA 4JYSA 1FKTA 2XP5A 4DT4A 1ZCNA 4DRMA 1FKJA 4TX0A 4DH0A 4R0XA 2N87A 1FKDA 2MNTA 2RURA 1NMWA 3UQIA 3IKGA 1L1PA 3O5EA 5HT1A 2LPVA 4DRIA 2XP8A 5BXJA 2XP3A 3O5DA 1PBKA 2VN1A 3H9RB 3KAGA 1B6CA 1PINA 4LAXA 1D7JA 4DIPA 4QT2A 4ODNA 1J4HA 5D75A 2ZR6A 1JNTA 3KCEA 3LUOA 3NRKA 2XP6A 1JVWA 2VCDA 4DROA 5DIUA 1Q6UA 2PBCA 1QZ2A 2ZR5A 4U85A 2PPNA 1FKGA 4DRPA 4IQCA 2RUDA 5HWBA 4ODRA 2ZQVA 2LJ4A 1QPFA 3KACA 2XP4A 4O2TA 3OOBA 3UI6A 4ITZA 1EQ3A 3KAFA 4TNSA 3O5OA 4DZ3A 1Q6HA 2PV2A 3KABA 1TCOC 5HW8A 1BL4A 2K8IA 1Q6IA 2RQSA 1FD9A 2LKNA 4GIVA 4DRHA 4DZ2A 4IQ2A 2LGOA 1R9HA 2IF4A 2KR7A 1M5YA 3O5IA 3O5QA 3O5FA 4JFKA 1ROUA 3ODKA 1FKKA 2F2DA 3O5LA 3PA7A 4IPXA 1FKBA 4QIBA 1N1AA 4J4OA 1EYMA 3O5KA 4JFJA 4JFLA 4TW7A 2L2SA 4W9PA 2DG4A 3UQBA 1ZK6A 2UZ5A 2XPAA 3RFWA 1F8AB 5HW7A 1BKFA 1C9HA 2MF9A 4QT3A 3O5PA 2DG9A 2MPHA 2OFNA 3JXVA 3TCZA 3MDYB 4LAYA 1P5QA 4U86A 1KT1A 1T11A 2KO7A 2AWGA 3UI5A 4G50A 4LAVA 4ODKA 1J6YA 2RUCA 3KADA 4W9QA 3O5RA 2M1IA 2PPOA 2XP7A 2D9FA 1FAPA 4N19A 4BF8A 2JZVA 5HTGA 3FAPA 2DG3A 2MLZA 3JYJA 4W9OA 3UF8A 1J4RA 2M08A 3IKDA 1FKIA 1KT0A 4TW6A 5I98A 3B7XA 2FAPA 3UQAA 2RSEA 2PV1A 1Y0OA 4DRKA 2F4EA 4ODLA 1D6OA 3KZ7A 4NNRA 5B8IC 4TW8A 2F21A 1U79A 4FN2A 1A7XA 3O5MA 4DRQA 3WH0A 3UI4A 4JFMA 1FJDA 3PRBA 2ZQUA 1W26A 2KGJA 4MSPA 2KE0A 2ZR4A 4TYOA 2ITKA 2XP9A 4U84A 3TDBA 4FAPA 1FKSA 5HWCA 3IK8A 4DRNA 2Q5AA 3VAWA 3EY6A 5DIVA 5HW6A 2MLXA 3CGMA 2RUQA 1D7HA 1FKHA 1FKFA 2ZQTA 4LAWA 2Y78A 1ROTA 3O5GA
chains in the Genus database with same CATH superfamily
1HJWA 1RD6A 4HBOA 4P8UA 3AS0A 4GGQA 1YW5A 2PV3A 3JYMA 2QF8A 4G2PA 1Q1CA 1EIBA 4HBEA 3TC5A 5DITA 2FKEA 1X6NA 3WL1A 1LL6A 4J4NA 2EULA 1W9PA 2KFWA 2XP5A 4DH0A 2N87A 1LL4A 2RURA 2DT0A 3UQIA 2DT1A 5HT1A 2XP3A 4DIPA 3H9RB 3KAGA 1K9TA 1D7JA 1D2KA 2B31A 4MNLA 4QT2A 3WD2A 4Z2LA 3KCEA 2IUZA 2XP6A 1E6RA 5DIUA 2PBCA 2ZR5A 3FXYA 1FKGA 3RM4A 2RUDA 4DWSA 3WIJA 3CHDA 2A3CA 3KAFA 4TNSA 4DZ3A 1ZBVA 5HW8A 3KABA 1NWTA 3CHCA 4IT4A 1GOIA 3G6MA 2DT3A 2IF4A 1UR9A 1NH6A 4JFKA 4MPKA 3PA7A 1HKKA 1FKBA 1H0GA 4JFLA 3UQBA 2DG4A 2XPAA 3RFWA 5HW7A 1F8AB 2DG9A 4P8WA 3MDYB 3WL0A 3WQVA 4G50A 4ODKA 1HJVA 4MNJA 2PPOA 2D9FA 3G6LA 5GPRA 3FAPA 2DG3A 2MLZA 4W9OA 3ARVA 1KT0A 4WK9A 1Y0OA 1E6NA 1E44A 4NNRA 3AS2A 3O5MA 4DRQA 3PRBA 4TYOA 1HKMA 1W9UA 2ITKA 2AOSA 3AS1A 3WD4A 5HWCA 3BMBA 3VAWA 3CGMA 2RUQA 2A3EA 5DEZA 4R5EA 2Y78A 1OGGA 1H0IA 2DSVA 4ODOA 1FKLA 2ESCA 5GPGA 3GPKA 1NWRA 3O5JA 3BXWA 2YBUA 2KI3A 1F40A 3NTPA 3IHZA 1LJYA 2PPPA 5J6EA 3KAIA 1YATA 4Z2GA 1D7IA 1NSGA 4PTMA 4DT4A 3CH9A 4TX0A 4R0XA 3B9AA 1W9VA 3AQUA 4NSBA 4URIA 2PI6A 3WKZA 5BXJA 4DRIA 1W1YA 3CHEA 4ODNA 1W1TA 3LUOA 1JVWA 4DROA 4DRPA 4IQCA 2ZQVA 2LJ4A 3PR9A 3ARWA 4O2TA 2G8ZA 2O92A 1BL4A 3PRAA 2LKNA 4AY1A 4DWSB 4DZ2A 4IQ2A 3WD0A 2KR7A 2WM0A 1ZU8A 3O5FA 3ODKA 1FKKA 4IPXA 4QIBA 4W9PA 2UZ5A 3RM9A 2MPHA 2OFNA 1IX5A 1P5QA 4U86A 4ZS6A 3WD1A 1KT1A 2AWGA 1ZL1A 4LAVA 2RUCA 1OGBA 3ARXA 5HTGA 3UF8A 4IT6A 5I98A 1SYTA 4LGXA 1ITXA 4ODLA 4S3KA 4Q22A 1U79A 4FN2A 1A7XA 3CZ8A 3WH0A 4JFMA 3ARZA 2XP9A 3ARRA 3ARPA 3QOKA 3EY6A 4ZPTR 2DT2A 2MLXA 1FKHA 1FKFA 4LAWA 4P8VA 3B9DA 3ALFA 3ARTA 4Z2IA 4JFIA 1E6ZA 4ML4A 1JNSA 4S3JA 2ZQSA 4ODMA 3KAHA 4MGVA 1HXVA 5HBFA 2M2AA 3NI6A 3CHFA 2MLYA 3GU0A 4XAKA 1FKJA 4WKHA 4Z2HA 2MNTA 1NMWA 2LPVA 4LAXA 1GUVA 1B6CA 1PINA 3RM8A 1ZBKA 5D75A 1JNTA 3AS3A 2VCDA 1Q6UA 4WKFA 1EDQA 4U85A 2PPNA 4MAVA 1UR8A 4NZCA 1HJXA 1LG1A 4MNKA 2XP4A 3OOBA 3UI6A 1LG2A 1Q6HA 1TCOC 1NWUA 1FD9A 4GIVA 5DO2A 1WB0A 1ZBCA 2LGOA 4L3NA 1E6PA 1M5YA 3O5IA 1OWQA 3EIPA 2OLHA 1ROUA 2F2DA 3O5LA 1N1AA 4J4OA 1BKFA 1JNDA 1C9HA 4QT3A 3TCZA 4LAYA 5DF0A 2WLYA 1JCHB 1LQ0A 1GRJA 4Z2KA 4W9QA 3O5RA 2M1IA 4BF8A 1JNEA 1J4RA 3IKDA 2ETNA 3B7XA 1HKJA 2RSEA 2PV1A 5GQBA 1KFWA 3KZ7A 5B8IC 2DSUA 3ARQA 2F21A 3B8SA 3UI4A 2WK2A 4HARA 4MSPA 3RMEA 4FAPA 1E9LA 1E15A 3WD3A 1D7HA 1ZB5A 2B5UB 2O9OA 1EHNA 2ZQTA 1ROTA 3O5GA 4DRJA 1HKIA 1TFVA 4KR0B 1NMVA 5HUAA 2FDMA 4WIWA 1SR0A 2G41A 1FKRA 2XPBA 2DSZA 3RGCA 3ARYA 4ODQA 3PRDA 3CGNA 4KQZA 4C02B 1XRVA 3FY1A 2DSWA 4ODPA 1FFRA 3I6CA 1LL7A 5HKGA 4W5UA 1J4IA 1QPLA 3GTYX 4L72B 4JYSA 3ARUA 1FKTA 1FFQA 1ZCNA 4DRMA 1FKDA 1L1PA 1WAWA 3IKGA 3O5EA 2XP8A 4QZVB 4Z2JA 3O5DA 1PBKA 2VN1A 4ZPVR 3AROA 1J4HA 2ZR6A 3B9EA 3NRKA 3OA5A 2WLZA 1QZ2A 5HWBA 1X6LA 3ARSA 4ODRA 1W1PA 4ZPWR 1QPFA 2DPEA 3KACA 2P4VA 1W1VA 4ITZA 2F23A 1EQ3A 3O5OA 2PV2A 2K8IA 1Q6IA 2RQSA 4DRHA 1O6IA 1R9HA 4WJXA 3O5QA 4DWSC 1XHGA 4MNMA 1EYMA 3O5KA 4JFJA 4MTVA 4TW7A 2L2SA 1ZK6A 2MF9A 3O5PA 3JXVA 1GPFA 1T11A 2KO7A 3UI5A 1J6YA 3KADA 3W4RA 2A3BA 4UDMA 2XP7A 1FAPA 4N19A 2JZVA 3JYJA 4WKAA 1VF8A 2M08A 1FKIA 4TW6A 2PN0A 5JH8A 2A3AA 4DWSD 2FAPA 3UQAA 1NWSA 4DRKA 2F4EA 1D6OA 3ALGA 3WQWA 4TW8A 1FJDA 4Q7NA 2ZQUA 1W26A 2KGJA 3TDBA 2KE0A 2ZR4A 4P8XA 4U84A 1FKSA 3IK8A 4DRNA 2Q5AA 5DIVA 5HW6A 1WNOA 1CTNA 2YBTA 1ZBWA
chains in the Genus database with same CATH topology
1HJWA 1RD6A 4HBOA 4P8UA 3AS0A 4GGQA 1YW5A 2PV3A 3JYMA 2QF8A 4G2PA 1Q1CA 1EIBA 4HBEA 3TC5A 5DITA 2FKEA 1X6NA 3WL1A 1LL6A 4J4NA 1W9PA 2KFWA 2XP5A 4DH0A 2N87A 1LL4A 2RURA 2DT0A 3UQIA 2DT1A 5HT1A 2XP3A 4DIPA 3H9RB 3KAGA 1K9TA 1D7JA 1D2KA 2B31A 4MNLA 4QT2A 3WD2A 4Z2LA 3KCEA 2IUZA 2XP6A 1E6RA 5DIUA 2PBCA 2ZR5A 3FXYA 1FKGA 3RM4A 2RUDA 4DWSA 3WIJA 3CHDA 2A3CA 3KAFA 4TNSA 4DZ3A 1ZBVA 5HW8A 3KABA 1NWTA 3CHCA 4IT4A 1GOIA 3G6MA 2DT3A 2IF4A 1UR9A 1NH6A 4JFKA 4MPKA 3PA7A 1HKKA 1FKBA 1H0GA 4JFLA 3UQBA 2DG4A 2XPAA 3RFWA 5HW7A 1F8AB 2DG9A 4P8WA 3MDYB 3WL0A 3WQVA 4G50A 4ODKA 1HJVA 4MNJA 2PPOA 2D9FA 3G6LA 5GPRA 3FAPA 2DG3A 2MLZA 4W9OA 3ARVA 1KT0A 4WK9A 1Y0OA 1E6NA 4NNRA 3AS2A 3O5MA 4DRQA 3PRBA 4TYOA 1HKMA 1W9UA 2ITKA 2AOSA 3AS1A 3WD4A 5HWCA 3VAWA 3CGMA 2RUQA 2A3EA 5DEZA 4R5EA 2Y78A 1OGGA 1H0IA 2DSVA 4ODOA 1FKLA 2ESCA 5GPGA 3GPKA 1NWRA 3O5JA 3BXWA 2YBUA 2KI3A 1F40A 3NTPA 3IHZA 1LJYA 2PPPA 5J6EA 3KAIA 1YATA 4Z2GA 1D7IA 1NSGA 4PTMA 4DT4A 3CH9A 4TX0A 4R0XA 3B9AA 1W9VA 3AQUA 4NSBA 4URIA 2PI6A 3WKZA 5BXJA 4DRIA 1W1YA 3CHEA 4ODNA 1W1TA 3LUOA 1JVWA 4DROA 4DRPA 4IQCA 2ZQVA 2LJ4A 3PR9A 3ARWA 4O2TA 2G8ZA 2O92A 1BL4A 3PRAA 2LKNA 4AY1A 4DWSB 4DZ2A 4IQ2A 3WD0A 2KR7A 2WM0A 1ZU8A 3O5FA 3ODKA 1FKKA 4IPXA 4QIBA 4W9PA 2UZ5A 3RM9A 2MPHA 2OFNA 1IX5A 1P5QA 4U86A 4ZS6A 3WD1A 1KT1A 2AWGA 1ZL1A 4LAVA 2RUCA 1OGBA 3ARXA 5HTGA 3UF8A 4IT6A 5I98A 1SYTA 4LGXA 1ITXA 4ODLA 4S3KA 4Q22A 1U79A 4FN2A 1A7XA 3CZ8A 3WH0A 4JFMA 3ARZA 2XP9A 3ARRA 3ARPA 3QOKA 3EY6A 4ZPTR 2DT2A 2MLXA 1FKHA 1FKFA 4LAWA 4P8VA 3B9DA 3ALFA 3ARTA 4Z2IA 4JFIA 1E6ZA 4ML4A 1JNSA 4S3JA 2ZQSA 4ODMA 3KAHA 4MGVA 1HXVA 5HBFA 2M2AA 3NI6A 3CHFA 2MLYA 4XAKA 1FKJA 4WKHA 4Z2HA 2MNTA 1NMWA 2LPVA 4LAXA 1GUVA 1B6CA 1PINA 3RM8A 1ZBKA 5D75A 1JNTA 3AS3A 2VCDA 1Q6UA 4WKFA 1EDQA 4U85A 2PPNA 4MAVA 1UR8A 4NZCA 1HJXA 1LG1A 4MNKA 2XP4A 3OOBA 3UI6A 1LG2A 1Q6HA 1TCOC 1NWUA 1FD9A 4GIVA 5DO2A 1WB0A 1ZBCA 2LGOA 4L3NA 1E6PA 1M5YA 3O5IA 1OWQA 2OLHA 1ROUA 2F2DA 3O5LA 1N1AA 4J4OA 1BKFA 1JNDA 1C9HA 4QT3A 3TCZA 4LAYA 5DF0A 2WLYA 1LQ0A 4Z2KA 4W9QA 3O5RA 2M1IA 4BF8A 1JNEA 1J4RA 3IKDA 3B7XA 1HKJA 2RSEA 2PV1A 5GQBA 1KFWA 3KZ7A 5B8IC 2DSUA 3ARQA 2F21A 3B8SA 3UI4A 2WK2A 4HARA 4MSPA 3RMEA 4FAPA 1E9LA 1E15A 3WD3A 1D7HA 1ZB5A 2O9OA 1EHNA 2ZQTA 1ROTA 3O5GA 4DRJA 1HKIA 1TFVA 4KR0B 1NMVA 5HUAA 2FDMA 4WIWA 1SR0A 2G41A 1FKRA 2XPBA 2DSZA 3RGCA 3ARYA 4ODQA 3PRDA 3CGNA 4KQZA 4C02B 1XRVA 3FY1A 2DSWA 4ODPA 1FFRA 3I6CA 1LL7A 5HKGA 4W5UA 1J4IA 1QPLA 4L72B 4JYSA 3ARUA 1FKTA 1FFQA 1ZCNA 4DRMA 1FKDA 1L1PA 1WAWA 3IKGA 3O5EA 2XP8A 4QZVB 4Z2JA 3O5DA 1PBKA 2VN1A 4ZPVR 3AROA 1J4HA 2ZR6A 3B9EA 3NRKA 3OA5A 2WLZA 1QZ2A 5HWBA 1X6LA 3ARSA 4ODRA 1W1PA 4ZPWR 1QPFA 2DPEA 3KACA 1W1VA 4ITZA 1EQ3A 3O5OA 2PV2A 2K8IA 1Q6IA 2RQSA 4DRHA 1O6IA 1R9HA 4WJXA 3O5QA 4DWSC 1XHGA 4MNMA 1EYMA 3O5KA 4JFJA 4MTVA 4TW7A 2L2SA 1ZK6A 2MF9A 3O5PA 3JXVA 1GPFA 1T11A 2KO7A 3UI5A 1J6YA 3KADA 3W4RA 2A3BA 2XP7A 1FAPA 4N19A 2JZVA 3JYJA 4WKAA 1VF8A 2M08A 1FKIA 4TW6A 5JH8A 2A3AA 4DWSD 2FAPA 3UQAA 1NWSA 4DRKA 2F4EA 1D6OA 3ALGA 3WQWA 4TW8A 1FJDA 4Q7NA 2ZQUA 1W26A 2KGJA 3TDBA 2KE0A 2ZR4A 4P8XA 4U84A 1FKSA 3IK8A 4DRNA 2Q5AA 5DIVA 5HW6A 1WNOA 1CTNA 2YBTA 1ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRJ A;  1NMV A;  4ODO A;  5HUA A;  1FKL A;  4GGQ A;  1YW5 A;  2PV3 A;  3JYM A;  5GPG A;  3GPK A;  4G2P A;  1Q1C A;  1FKR A;  4JFI A;  3O5J A;  1JNS A;  2XPB A;  3RGC A;  4ODQ A;  2ZQS A;  4ODM A;  3PRD A;  3TC5 A;  2KI3 A;  3CGN A;  3KAH A;  4MGV A;  5DIT A;  1F40 A;  1HXV A;  3NTP A;  3IHZ A;  2FKE A;  2PPP A;  4C02 B;  2M2A A;  4ODP A;  5J6E A;  3I6C A;  3KAI A;  4J4N A;  3NI6 A;  5HKG A;  1YAT A;  1J4I A;  1QPL A;  2MLY A;  1D7I A;  1NSG A;  2KFW A;  4JYS A;  1FKT A;  2XP5 A;  4DT4 A;  1ZCN A;  4DRM A;  1FKJ A;  4TX0 A;  4DH0 A;  4R0X A;  2N87 A;  1FKD A;  2MNT A;  2RUR A;  1NMW A;  3UQI A;  3IKG A;  1L1P A;  3O5E A;  5HT1 A;  2LPV A;  4DRI A;  2XP8 A;  5BXJ A;  2XP3 A;  3O5D A;  1PBK A;  2VN1 A;  3H9R B;  3KAG A;  1B6C A;  1PIN A;  4LAX A;  1D7J A;  4DIP A;  4QT2 A;  4ODN A;  1J4H A;  5D75 A;  2ZR6 A;  1JNT A;  3KCE A;  3LUO A;  3NRK A;  2XP6 A;  1JVW A;  2VCD A;  4DRO A;  5DIU A;  1Q6U A;  2PBC A;  1QZ2 A;  2ZR5 A;  4U85 A;  2PPN A;  1FKG A;  4DRP A;  4IQC A;  2RUD A;  5HWB A;  4ODR A;  2ZQV A;  2LJ4 A;  1QPF A;  3KAC A;  2XP4 A;  4O2T A;  3OOB A;  3UI6 A;  4ITZ A;  1EQ3 A;  3KAF A;  4TNS A;  3O5O A;  4DZ3 A;  1Q6H A;  2PV2 A;  3KAB A;  1TCO C;  5HW8 A;  1BL4 A;  2K8I A;  1Q6I A;  2RQS A;  1FD9 A;  2LKN A;  4GIV A;  4DRH A;  4DZ2 A;  4IQ2 A;  2LGO A;  1R9H A;  2IF4 A;  2KR7 A;  1M5Y A;  3O5I A;  3O5Q A;  3O5F A;  4JFK A;  1ROU A;  3ODK A;  1FKK A;  2F2D A;  3O5L A;  3PA7 A;  4IPX A;  1FKB A;  4QIB A;  1N1A A;  4J4O A;  1EYM A;  3O5K A;  4JFJ A;  4JFL A;  4TW7 A;  2L2S A;  4W9P A;  2DG4 A;  3UQB A;  1ZK6 A;  2UZ5 A;  2XPA A;  3RFW A;  1F8A B;  5HW7 A;  1BKF A;  1C9H A;  2MF9 A;  4QT3 A;  3O5P A;  2DG9 A;  2MPH A;  2OFN A;  3JXV A;  3TCZ A;  3MDY B;  4LAY A;  1P5Q A;  4U86 A;  1KT1 A;  1T11 A;  2KO7 A;  2AWG A;  3UI5 A;  4G50 A;  4LAV A;  4ODK A;  1J6Y A;  2RUC A;  3KAD A;  4W9Q A;  3O5R A;  2M1I A;  2PPO A;  2XP7 A;  2D9F A;  1FAP A;  4N19 A;  4BF8 A;  2JZV A;  5HTG A;  3FAP A;  2DG3 A;  2MLZ A;  3JYJ A;  4W9O A;  3UF8 A;  1J4R A;  2M08 A;  3IKD A;  1FKI A;  1KT0 A;  4TW6 A;  5I98 A;  3B7X A;  2FAP A;  3UQA A;  2RSE A;  2PV1 A;  1Y0O A;  4DRK A;  2F4E A;  4ODL A;  1D6O A;  3KZ7 A;  4NNR A;  5B8I C;  4TW8 A;  2F21 A;  1U79 A;  4FN2 A;  1A7X A;  3O5M A;  4DRQ A;  3WH0 A;  3UI4 A;  4JFM A;  1FJD A;  3PRB A;  2ZQU A;  1W26 A;  2KGJ A;  4MSP A;  2KE0 A;  2ZR4 A;  4TYO A;  2ITK A;  2XP9 A;  4U84 A;  3TDB A;  4FAP A;  1FKS A;  5HWC A;  3IK8 A;  4DRN A;  2Q5A A;  3VAW A;  3EY6 A;  5DIV A;  5HW6 A;  2MLX A;  3CGM A;  2RUQ A;  1D7H A;  1FKH A;  1FKF A;  2ZQT A;  4LAW A;  2Y78 A;  1ROT A;  3O5G A; 
#chains in the Genus database with same CATH topology
 1HJW A;  1RD6 A;  4HBO A;  4P8U A;  3AS0 A;  4GGQ A;  1YW5 A;  2PV3 A;  3JYM A;  2QF8 A;  4G2P A;  1Q1C A;  1EIB A;  4HBE A;  3TC5 A;  5DIT A;  2FKE A;  1X6N A;  3WL1 A;  1LL6 A;  4J4N A;  2EUL A;  1W9P A;  2KFW A;  2XP5 A;  4DH0 A;  2N87 A;  1LL4 A;  2RUR A;  2DT0 A;  3UQI A;  2DT1 A;  5HT1 A;  2XP3 A;  4DIP A;  3H9R B;  3KAG A;  1K9T A;  1D7J A;  1D2K A;  2B31 A;  4MNL A;  4QT2 A;  3WD2 A;  4Z2L A;  3KCE A;  2IUZ A;  2XP6 A;  1E6R A;  5DIU A;  2PBC A;  2ZR5 A;  3FXY A;  1FKG A;  3RM4 A;  2RUD A;  4DWS A;  3WIJ A;  3CHD A;  2A3C A;  3KAF A;  4TNS A;  4DZ3 A;  1ZBV A;  5HW8 A;  3KAB A;  1NWT A;  3CHC A;  4IT4 A;  1GOI A;  3G6M A;  2DT3 A;  2IF4 A;  1UR9 A;  1NH6 A;  4JFK A;  4MPK A;  3PA7 A;  1HKK A;  1FKB A;  1H0G A;  4JFL A;  3UQB A;  2DG4 A;  2XPA A;  3RFW A;  5HW7 A;  1F8A B;  2DG9 A;  4P8W A;  3MDY B;  3WL0 A;  3WQV A;  4G50 A;  4ODK A;  1HJV A;  4MNJ A;  2PPO A;  2D9F A;  3G6L A;  5GPR A;  3FAP A;  2DG3 A;  2MLZ A;  4W9O A;  3ARV A;  1KT0 A;  4WK9 A;  1Y0O A;  1E6N A;  1E44 A;  4NNR A;  3AS2 A;  3O5M A;  4DRQ A;  3PRB A;  4TYO A;  1HKM A;  1W9U A;  2ITK A;  2AOS A;  3AS1 A;  3WD4 A;  5HWC A;  3BMB A;  3VAW A;  3CGM A;  2RUQ A;  2A3E A;  5DEZ A;  4R5E A;  2Y78 A;  1OGG A;  1H0I A;  2DSV A;  4ODO A;  1FKL A;  2ESC A;  5GPG A;  3GPK A;  1NWR A;  3O5J A;  3BXW A;  2YBU A;  2KI3 A;  1F40 A;  3NTP A;  3IHZ A;  1LJY A;  2PPP A;  5J6E A;  3KAI A;  1YAT A;  4Z2G A;  1D7I A;  1NSG A;  4PTM A;  4DT4 A;  3CH9 A;  4TX0 A;  4R0X A;  3B9A A;  1W9V A;  3AQU A;  4NSB A;  4URI A;  2PI6 A;  3WKZ A;  5BXJ A;  4DRI A;  1W1Y A;  3CHE A;  4ODN A;  1W1T A;  3LUO A;  1JVW A;  4DRO A;  4DRP A;  4IQC A;  2ZQV A;  2LJ4 A;  3PR9 A;  3ARW A;  4O2T A;  2G8Z A;  2O92 A;  1BL4 A;  3PRA A;  2LKN A;  4AY1 A;  4DWS B;  4DZ2 A;  4IQ2 A;  3WD0 A;  2KR7 A;  2WM0 A;  1ZU8 A;  3O5F A;  3ODK A;  1FKK A;  4IPX A;  4QIB A;  4W9P A;  2UZ5 A;  3RM9 A;  2MPH A;  2OFN A;  1IX5 A;  1P5Q A;  4U86 A;  4ZS6 A;  3WD1 A;  1KT1 A;  2AWG A;  1ZL1 A;  4LAV A;  2RUC A;  1OGB A;  3ARX A;  5HTG A;  3UF8 A;  4IT6 A;  5I98 A;  1SYT A;  4LGX A;  1ITX A;  4ODL A;  4S3K A;  4Q22 A;  1U79 A;  4FN2 A;  1A7X A;  3CZ8 A;  3WH0 A;  4JFM A;  3ARZ A;  2XP9 A;  3ARR A;  3ARP A;  3QOK A;  3EY6 A;  4ZPT R;  2DT2 A;  2MLX A;  1FKH A;  1FKF A;  4LAW A;  4P8V A;  3B9D A;  3ALF A;  3ART A;  4Z2I A;  4JFI A;  1E6Z A;  4ML4 A;  1JNS A;  4S3J A;  2ZQS A;  4ODM A;  3KAH A;  4MGV A;  1HXV A;  5HBF A;  2M2A A;  3NI6 A;  3CHF A;  2MLY A;  3GU0 A;  4XAK A;  1FKJ A;  4WKH A;  4Z2H A;  2MNT A;  1NMW A;  2LPV A;  4LAX A;  1GUV A;  1B6C A;  1PIN A;  3RM8 A;  1ZBK A;  5D75 A;  1JNT A;  3AS3 A;  2VCD A;  1Q6U A;  4WKF A;  1EDQ A;  4U85 A;  2PPN A;  4MAV A;  1UR8 A;  4NZC A;  1HJX A;  1LG1 A;  4MNK A;  2XP4 A;  3OOB A;  3UI6 A;  1LG2 A;  1Q6H A;  1TCO C;  1NWU A;  1FD9 A;  4GIV A;  5DO2 A;  1WB0 A;  1ZBC A;  2LGO A;  4L3N A;  1E6P A;  1M5Y A;  3O5I A;  1OWQ A;  3EIP A;  2OLH A;  1ROU A;  2F2D A;  3O5L A;  1N1A A;  4J4O A;  1BKF A;  1JND A;  1C9H A;  4QT3 A;  3TCZ A;  4LAY A;  5DF0 A;  2WLY A;  1JCH B;  1LQ0 A;  1GRJ A;  4Z2K A;  4W9Q A;  3O5R A;  2M1I A;  4BF8 A;  1JNE A;  1J4R A;  3IKD A;  2ETN A;  3B7X A;  1HKJ A;  2RSE A;  2PV1 A;  5GQB A;  1KFW A;  3KZ7 A;  5B8I C;  2DSU A;  3ARQ A;  2F21 A;  3B8S A;  3UI4 A;  2WK2 A;  4HAR A;  4MSP A;  3RME A;  4FAP A;  1E9L A;  1E15 A;  3WD3 A;  1D7H A;  1ZB5 A;  2B5U B;  2O9O A;  1EHN A;  2ZQT A;  1ROT A;  3O5G A;  4DRJ A;  1HKI A;  1TFV A;  4KR0 B;  1NMV A;  5HUA A;  2FDM A;  4WIW A;  1SR0 A;  2G41 A;  1FKR A;  2XPB A;  2DSZ A;  3RGC A;  3ARY A;  4ODQ A;  3PRD A;  3CGN A;  4KQZ A;  4C02 B;  1XRV A;  3FY1 A;  2DSW A;  4ODP A;  1FFR A;  3I6C A;  1LL7 A;  5HKG A;  4W5U A;  1J4I A;  1QPL A;  3GTY X;  4L72 B;  4JYS A;  3ARU A;  1FKT A;  1FFQ A;  1ZCN A;  4DRM A;  1FKD A;  1L1P A;  1WAW A;  3IKG A;  3O5E A;  2XP8 A;  4QZV B;  4Z2J A;  3O5D A;  1PBK A;  2VN1 A;  4ZPV R;  3ARO A;  1J4H A;  2ZR6 A;  3B9E A;  3NRK A;  3OA5 A;  2WLZ A;  1QZ2 A;  5HWB A;  1X6L A;  3ARS A;  4ODR A;  1W1P A;  4ZPW R;  1QPF A;  2DPE A;  3KAC A;  2P4V A;  1W1V A;  4ITZ A;  2F23 A;  1EQ3 A;  3O5O A;  2PV2 A;  2K8I A;  1Q6I A;  2RQS A;  4DRH A;  1O6I A;  1R9H A;  4WJX A;  3O5Q A;  4DWS C;  1XHG A;  4MNM A;  1EYM A;  3O5K A;  4JFJ A;  4MTV A;  4TW7 A;  2L2S A;  1ZK6 A;  2MF9 A;  3O5P A;  3JXV A;  1GPF A;  1T11 A;  2KO7 A;  3UI5 A;  1J6Y A;  3KAD A;  3W4R A;  2A3B A;  4UDM A;  2XP7 A;  1FAP A;  4N19 A;  2JZV A;  3JYJ A;  4WKA A;  1VF8 A;  2M08 A;  1FKI A;  4TW6 A;  2PN0 A;  5JH8 A;  2A3A A;  4DWS D;  2FAP A;  3UQA A;  1NWS A;  4DRK A;  2F4E A;  1D6O A;  3ALG A;  3WQW A;  4TW8 A;  1FJD A;  4Q7N A;  2ZQU A;  1W26 A;  2KGJ A;  3TDB A;  2KE0 A;  2ZR4 A;  4P8X A;  4U84 A;  1FKS A;  3IK8 A;  4DRN A;  2Q5A A;  5DIV A;  5HW6 A;  1WNO A;  1CTN A;  2YBT A;  1ZBW A; 
#chains in the Genus database with same CATH homology
 1HJW A;  1RD6 A;  4HBO A;  4P8U A;  3AS0 A;  4GGQ A;  1YW5 A;  2PV3 A;  3JYM A;  2QF8 A;  4G2P A;  1Q1C A;  1EIB A;  4HBE A;  3TC5 A;  5DIT A;  2FKE A;  1X6N A;  3WL1 A;  1LL6 A;  4J4N A;  1W9P A;  2KFW A;  2XP5 A;  4DH0 A;  2N87 A;  1LL4 A;  2RUR A;  2DT0 A;  3UQI A;  2DT1 A;  5HT1 A;  2XP3 A;  4DIP A;  3H9R B;  3KAG A;  1K9T A;  1D7J A;  1D2K A;  2B31 A;  4MNL A;  4QT2 A;  3WD2 A;  4Z2L A;  3KCE A;  2IUZ A;  2XP6 A;  1E6R A;  5DIU A;  2PBC A;  2ZR5 A;  3FXY A;  1FKG A;  3RM4 A;  2RUD A;  4DWS A;  3WIJ A;  3CHD A;  2A3C A;  3KAF A;  4TNS A;  4DZ3 A;  1ZBV A;  5HW8 A;  3KAB A;  1NWT A;  3CHC A;  4IT4 A;  1GOI A;  3G6M A;  2DT3 A;  2IF4 A;  1UR9 A;  1NH6 A;  4JFK A;  4MPK A;  3PA7 A;  1HKK A;  1FKB A;  1H0G A;  4JFL A;  3UQB A;  2DG4 A;  2XPA A;  3RFW A;  5HW7 A;  1F8A B;  2DG9 A;  4P8W A;  3MDY B;  3WL0 A;  3WQV A;  4G50 A;  4ODK A;  1HJV A;  4MNJ A;  2PPO A;  2D9F A;  3G6L A;  5GPR A;  3FAP A;  2DG3 A;  2MLZ A;  4W9O A;  3ARV A;  1KT0 A;  4WK9 A;  1Y0O A;  1E6N A;  4NNR A;  3AS2 A;  3O5M A;  4DRQ A;  3PRB A;  4TYO A;  1HKM A;  1W9U A;  2ITK A;  2AOS A;  3AS1 A;  3WD4 A;  5HWC A;  3VAW A;  3CGM A;  2RUQ A;  2A3E A;  5DEZ A;  4R5E A;  2Y78 A;  1OGG A;  1H0I A;  2DSV A;  4ODO A;  1FKL A;  2ESC A;  5GPG A;  3GPK A;  1NWR A;  3O5J A;  3BXW A;  2YBU A;  2KI3 A;  1F40 A;  3NTP A;  3IHZ A;  1LJY A;  2PPP A;  5J6E A;  3KAI A;  1YAT A;  4Z2G A;  1D7I A;  1NSG A;  4PTM A;  4DT4 A;  3CH9 A;  4TX0 A;  4R0X A;  3B9A A;  1W9V A;  3AQU A;  4NSB A;  4URI A;  2PI6 A;  3WKZ A;  5BXJ A;  4DRI A;  1W1Y A;  3CHE A;  4ODN A;  1W1T A;  3LUO A;  1JVW A;  4DRO A;  4DRP A;  4IQC A;  2ZQV A;  2LJ4 A;  3PR9 A;  3ARW A;  4O2T A;  2G8Z A;  2O92 A;  1BL4 A;  3PRA A;  2LKN A;  4AY1 A;  4DWS B;  4DZ2 A;  4IQ2 A;  3WD0 A;  2KR7 A;  2WM0 A;  1ZU8 A;  3O5F A;  3ODK A;  1FKK A;  4IPX A;  4QIB A;  4W9P A;  2UZ5 A;  3RM9 A;  2MPH A;  2OFN A;  1IX5 A;  1P5Q A;  4U86 A;  4ZS6 A;  3WD1 A;  1KT1 A;  2AWG A;  1ZL1 A;  4LAV A;  2RUC A;  1OGB A;  3ARX A;  5HTG A;  3UF8 A;  4IT6 A;  5I98 A;  1SYT A;  4LGX A;  1ITX A;  4ODL A;  4S3K A;  4Q22 A;  1U79 A;  4FN2 A;  1A7X A;  3CZ8 A;  3WH0 A;  4JFM A;  3ARZ A;  2XP9 A;  3ARR A;  3ARP A;  3QOK A;  3EY6 A;  4ZPT R;  2DT2 A;  2MLX A;  1FKH A;  1FKF A;  4LAW A;  4P8V A;  3B9D A;  3ALF A;  3ART A;  4Z2I A;  4JFI A;  1E6Z A;  4ML4 A;  1JNS A;  4S3J A;  2ZQS A;  4ODM A;  3KAH A;  4MGV A;  1HXV A;  5HBF A;  2M2A A;  3NI6 A;  3CHF A;  2MLY A;  4XAK A;  1FKJ A;  4WKH A;  4Z2H A;  2MNT A;  1NMW A;  2LPV A;  4LAX A;  1GUV A;  1B6C A;  1PIN A;  3RM8 A;  1ZBK A;  5D75 A;  1JNT A;  3AS3 A;  2VCD A;  1Q6U A;  4WKF A;  1EDQ A;  4U85 A;  2PPN A;  4MAV A;  1UR8 A;  4NZC A;  1HJX A;  1LG1 A;  4MNK A;  2XP4 A;  3OOB A;  3UI6 A;  1LG2 A;  1Q6H A;  1TCO C;  1NWU A;  1FD9 A;  4GIV A;  5DO2 A;  1WB0 A;  1ZBC A;  2LGO A;  4L3N A;  1E6P A;  1M5Y A;  3O5I A;  1OWQ A;  2OLH A;  1ROU A;  2F2D A;  3O5L A;  1N1A A;  4J4O A;  1BKF A;  1JND A;  1C9H A;  4QT3 A;  3TCZ A;  4LAY A;  5DF0 A;  2WLY A;  1LQ0 A;  4Z2K A;  4W9Q A;  3O5R A;  2M1I A;  4BF8 A;  1JNE A;  1J4R A;  3IKD A;  3B7X A;  1HKJ A;  2RSE A;  2PV1 A;  5GQB A;  1KFW A;  3KZ7 A;  5B8I C;  2DSU A;  3ARQ A;  2F21 A;  3B8S A;  3UI4 A;  2WK2 A;  4HAR A;  4MSP A;  3RME A;  4FAP A;  1E9L A;  1E15 A;  3WD3 A;  1D7H A;  1ZB5 A;  2O9O A;  1EHN A;  2ZQT A;  1ROT A;  3O5G A;  4DRJ A;  1HKI A;  1TFV A;  4KR0 B;  1NMV A;  5HUA A;  2FDM A;  4WIW A;  1SR0 A;  2G41 A;  1FKR A;  2XPB A;  2DSZ A;  3RGC A;  3ARY A;  4ODQ A;  3PRD A;  3CGN A;  4KQZ A;  4C02 B;  1XRV A;  3FY1 A;  2DSW A;  4ODP A;  1FFR A;  3I6C A;  1LL7 A;  5HKG A;  4W5U A;  1J4I A;  1QPL A;  4L72 B;  4JYS A;  3ARU A;  1FKT A;  1FFQ A;  1ZCN A;  4DRM A;  1FKD A;  1L1P A;  1WAW A;  3IKG A;  3O5E A;  2XP8 A;  4QZV B;  4Z2J A;  3O5D A;  1PBK A;  2VN1 A;  4ZPV R;  3ARO A;  1J4H A;  2ZR6 A;  3B9E A;  3NRK A;  3OA5 A;  2WLZ A;  1QZ2 A;  5HWB A;  1X6L A;  3ARS A;  4ODR A;  1W1P A;  4ZPW R;  1QPF A;  2DPE A;  3KAC A;  1W1V A;  4ITZ A;  1EQ3 A;  3O5O A;  2PV2 A;  2K8I A;  1Q6I A;  2RQS A;  4DRH A;  1O6I A;  1R9H A;  4WJX A;  3O5Q A;  4DWS C;  1XHG A;  4MNM A;  1EYM A;  3O5K A;  4JFJ A;  4MTV A;  4TW7 A;  2L2S A;  1ZK6 A;  2MF9 A;  3O5P A;  3JXV A;  1GPF A;  1T11 A;  2KO7 A;  3UI5 A;  1J6Y A;  3KAD A;  3W4R A;  2A3B A;  2XP7 A;  1FAP A;  4N19 A;  2JZV A;  3JYJ A;  4WKA A;  1VF8 A;  2M08 A;  1FKI A;  4TW6 A;  5JH8 A;  2A3A A;  4DWS D;  2FAP A;  3UQA A;  1NWS A;  4DRK A;  2F4E A;  1D6O A;  3ALG A;  3WQW A;  4TW8 A;  1FJD A;  4Q7N A;  2ZQU A;  1W26 A;  2KGJ A;  3TDB A;  2KE0 A;  2ZR4 A;  4P8X A;  4U84 A;  1FKS A;  3IK8 A;  4DRN A;  2Q5A A;  5DIV A;  5HW6 A;  1WNO A;  1CTN A;  2YBT A;  1ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...