2PV1A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide weyipnv
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
b'TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone surA
molecule tags Isomerase
source organism Escherichia coli
publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
total genus 28
structure length 103
sequence length 103
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv1A00
1FKDA 3NTPA 4GIVA 4ODLA 1C9HA 2LJ4A 2XP6A 4IQ2A 2ZR6A 3NI6A 1M5YA 2MLYA 3ODKA 4DRKA 1B6CA 3I6CA 3UQBA 1D6OA 1J4HA 2PBCA 4C02B 2MF9A 3O5DA 2ZQTA 2M2AA 1Q6HA 1QPLA 4U86A 3FAPA 3KAHA 2RUCA 1FKLA 4DT4A 2LGOA 2ZQSA 2FAPA 2ZQVA 3MDYB 2PPPA 5D75A 4G50A 4DRIA 3TC5A 4QT2A 3UQAA 1F8AB 3O5MA 5GPGA 5HKGA 1L1PA 1FKRA 1J4IA 4MGVA 5HWBA 4TW6A 3CGNA 4TX0A 2D9FA 4O2TA 4ODKA 5B8IC 3O5OA 5DITA 3VAWA 4TYOA 2MLZA 3O5KA 4FAPA 3O5LA 1ROUA 3O5GA 3IKGA 2PV3A 4BF8A 1EQ3A 2Y78A 4JFLA 5DIVA 1R9HA 4G2PA 1D7JA 1KT1A 1BKFA 3IKDA 4LAXA 2PV2A 2KO7A 4NNRA 1HXVA 2DG3A 3H9RB 1FJDA 2XP4A 4DRQA 3JYMA 5HT1A 1J4RA 2KGJA 1JNTA 1PBKA 2FKEA 2UZ5A 3O5PA 5I98A 5BXJA 2ZR4A 3WH0A 2ZQUA 2OFNA 1Y0OA 4TNSA 3UF8A 4J4OA 3JYJA 2XP5A 1YATA 2MNTA 2XP3A 3KAIA 2IF4A 3O5QA 3NRKA 4U84A 4W9OA 4FN2A 4W9PA 4GGQA 4J4NA 1FKHA 4DRNA 4TW7A 3RGCA 1FKGA 2PPOA 2RQSA 4R0XA 5HW8A 4LAYA 4DRHA 3O5FA 1FKFA 1U79A 2ZR5A 3KZ7A 3B7XA 3IK8A 1P5QA 2AWGA 1N1AA 2DG9A 1FKKA 2LKNA 1BL4A 4DH0A 1J6YA 2XP9A 3UQIA 3KACA 4ODRA 1FKTA 3KCEA 4DRPA 1D7IA 3OOBA 2K8IA 4U85A 2KFWA 2L2SA 5HWCA 3UI4A 4ODMA 1Q6UA 3RFWA 1JVWA 1Q6IA 1FAPA 2MPHA 3KAFA 3TCZA 4W9QA 4JFKA 1D7HA 3O5JA 3O5RA 3PA7A 2F2DA 2VN1A 4ODOA 2M1IA 1QPFA 1ZCNA 2N87A 4TW8A 1F40A 1KT0A 2ITKA 1FKBA 2XP7A 3JXVA 5HW7A 2KE0A 4DZ3A 4DZ2A 2F4EA 3UI5A 2MLXA 1T11A 3PRBA 2RURA 3O5EA 3PRDA 1NMWA 4ITZA 4DRMA 1FKJA 1ZK6A 3GPKA 3IHZA 4QT3A 3TDBA 3KAGA 4DROA 4JFMA 2PV1A 1FD9A 2VCDA 1YW5A 3UI6A 5HW6A 1TCOC 2XPBA 4IQCA 4LAVA 1QZ2A 5HTGA 4ODPA 2JZVA 2Q5AA 1Q1CA 4N19A 1NSGA 2RUDA 4JFIA 1FKIA 5DIUA 1JNSA 1ROTA 4JYSA 5HUAA 5J6EA 1A7XA 4ODQA 2XPAA 2KI3A 2LPVA 2M08A 4LAWA 4ODNA 1FKSA 1PINA 2DG4A 2F21A 2KR7A 2XP8A 3O5IA 2PPNA 3CGMA 4IPXA 3EY6A 1NMVA 1W26A 3KABA 4JFJA 4DRJA 2RUQA 4QIBA 4DIPA 3LUOA 2RSEA 1EYMA 3KADA 4MSPA
chains in the Genus database with same CATH superfamily
3NTPA 4DWSA 3AS1A 3AS3A 1NWSA 3PRAA 4LGXA 1M5YA 1HJXA 4C02B 2MF9A 3O5DA 2DSZA 1Q6HA 2M2AA 1JNDA 2DT3A 4U86A 3WD0A 1UR8A 1FKLA 4HARA 2ZQSA 1H0IA 2DSWA 1J4IA 5HWBA 4TW6A 2D9FA 4O2TA 1NH6A 3RMEA 1H0GA 1ROUA 3IKGA 1EQ3A 4DWSC 3ALGA 1W9PA 3IKDA 1UR9A 4DRQA 1J4RA 1JNTA 1PBKA 3O5PA 1OGGA 5BXJA 4TNSA 4J4OA 3O5QA 3RM8A 1W9UA 4P8XA 4WKHA 1SYTA 2PN0A 3RGCA 5HW8A 2PPOA 4R0XA 4LAYA 2YBTA 1FKFA 3IK8A 3ARWA 2DG9A 3AS0A 3UQIA 1WAWA 4ODRA 4Z2JA 3ARUA 3CH9A 4DRPA 2WK2A 2K8IA 5HWCA 2KFWA 5DF0A 1LQ0A 1Q6UA 4PTMA 2MPHA 3TCZA 4JFKA 1NWRA 3O5RA 1LG1A 2VN1A 5GQBA 2N87A 3WL0A 3BMBA 4ML4A 1TFVA 3FXYA 5DO2A 2F4EA 3UI5A 1E9LA 3PRDA 1NWTA 3O5EA 3IHZA 5HW6A 1YW5A 1TCOC 3ARRA 1HKIA 4AY1A 1ZL1A 1VF8A 4N19A 1XHGA 2DPEA 5DIUA 2DT1A 4MNKA 2P4VA 1E6NA 5HUAA 5J6EA 2OLHA 1D2KA 2LPVA 2M08A 2B5UB 1LL4A 3CGMA 3EY6A 3ARPA 1ITXA 4IPXA 2WLZA 1XRVA 1W1PA 4GIVA 4QZVB 1C9HA 4IQ2A 2DT0A 2ZR6A 2PI6A 3NI6A 4XAKA 3ODKA 2DSUA 4DRKA 1D6OA 2PBCA 3ARQA 4WJXA 2ZQTA 1QPLA 2RUCA 2LGOA 2FAPA 3MDYB 1HKJA 3TC5A 4Z2HA 3UQAA 1GOIA 5HKGA 1L1PA 1FKRA 1HJWA 1NWUA 3CGNA 4TX0A 4DWSD 2MLZA 2YBUA 3O5LA 4WK9A 4BF8A 2Y78A 4LAXA 1LL6A 4NNRA 3JYMA 2FKEA 2UZ5A 1LJYA 3BXWA 1ZBVA 1HJVA 1OGBA 3OA5A 3KAIA 2XP3A 3FY1A 2IF4A 4W9OA 4W9PA 4URIA 4MAVA 4J4NA 2B31A 1FKGA 3WQVA 4WKFA 1RD6A 3KZ7A 1WNOA 2EULA 1P5QA 2AWGA 3AQUA 1FKKA 4DH0A 1BL4A 1E6ZA 1JNEA 2XP9A 4DWSB 1X6NA 3OOBA 4U85A 1W1YA 2L2SA 2WM0A 2O9OA 4L3NA 1FAPA 4W9QA 4Z2IA 3AROA 4Z2LA 1CTNA 2F2DA 1F40A 1QPFA 1ZCNA 4TW8A 1LG2A 1FKBA 3RM9A 1T11A 3PRBA 4ITZA 1NMWA 4QT3A 1ZK6A 4DROA 1WB0A 4MNLA 1FD9A 2AOSA 3B9DA 4IQCA 2JZVA 4P8UA 1GPFA 4ZS6A 1FKIA 1A7XA 3QOKA 4LAWA 3ARYA 4IT6A 2F21A 3B9AA 2PPNA 1NMVA 2RUQA 4L72B 4DIPA 3LUOA 1FFQA 1EYMA 3KADA 4MSPA 1FKDA 4UDMA 4IT4A 1E15A 1B6CA 3I6CA 2QF8A 3FAPA 3KAHA 4WKAA 1FFRA 1ZU8A 2ZQVA 2G41A 4G50A 4QT2A 3O5MA 5HBFA 5GPGA 4KR0B 3B8SA 3B9EA 4ODKA 5B8IC 5DITA 3VAWA 5JH8A 1EIBA 4TYOA 3O5KA 4FAPA 5DIVA 1R9HA 1D7JA 1KT1A 1BKFA 4ZPVR 2PV2A 1HXVA 3H9RB 4HBOA 2XP4A 3G6LA 5HT1A 2KGJA 4NZCA 5I98A 3WH0A 2ZQUA 2OFNA 1Y0OA 2MNTA 3NRKA 4FN2A 1W1VA 2DSVA 1FKHA 2A3EA 2F23A 4P8VA 2RQSA 4TW7A 4S3KA 4P8WA 3O5FA 1U79A 1ZBWA 1N1AA 2LKNA 1J6YA 3KACA 4HBEA 1D7IA 3W4RA 1GUVA 4Z2KA 3CHCA 4ODMA 2FDMA 1Q6IA 4Q7NA 3KAFA 3ARSA 4MNMA 1D7HA 3WL1A 1ZBKA 3PA7A 4ODOA 1ZBCA 2M1IA 1KT0A 2XP7A 3WD1A 3ARXA 3G6MA 1KFWA 4ZPTR 1HKKA 3GPKA 3TDBA 1SR0A 4JFMA 2PV1A 2VCDA 3UI6A 5HTGA 1QZ2A 4ODPA 4MTVA 1Q1CA 3ARZA 1JNSA 5DEZA 1ROTA 4ODQA 1GRJA 4ODNA 3WQWA 3O5IA 2XP8A 3KABA 4DRJA 1ZB5A 4QIBA 3WD4A 2RSEA 3WD3A 4ODLA 2LJ4A 2XP6A 4MPKA 2MLYA 3UQBA 4R5EA 3ALFA 4KQZA 1J4HA 4ZPWR 4Q22A 4DT4A 2A3CA 3CHFA 5D75A 2PPPA 3CHDA 1EHNA 4DRIA 1OWQA 3ARVA 1O6IA 4Z2GA 2O92A 1F8AB 2G8ZA 1K9TA 2IUZA 3ARTA 4MGVA 3RM4A 3O5OA 3GTYX 3O5GA 2PV3A 4MNJA 4JFLA 4G2PA 1LL7A 2KO7A 5GPRA 1JCHB 2DG3A 1FJDA 2ZR4A 1W9VA 3UF8A 3WD2A 3JYJA 2XP5A 1YATA 4S3JA 4U84A 3PR9A 4GGQA 4DRNA 1E6PA 3WIJA 3WKZA 4DRHA 2ESCA 2ZR5A 3B7XA 3CZ8A 4W5UA 1FKTA 3KCEA 1W1TA 2A3BA 3UI4A 1EDQA 1JVWA 3RFWA 1HKMA 3O5JA 3GU0A 2WLYA 2ITKA 5HW7A 3JXVA 2KE0A 3EIPA 4DZ3A 4DZ2A 2MLXA 1E6RA 2A3AA 2RURA 4DRMA 1X6LA 1IX5A 1FKJA 3KAGA 3CHEA 4LAVA 2XPBA 2Q5AA 4NSBA 1NSGA 2RUDA 4JFIA 4JYSA 2XPAA 2KI3A 1FKSA 1PINA 2DG4A 2KR7A 4JFJA 1W26A 1E44A 4WIWA 2DT2A 3AS2A 2ETNA
chains in the Genus database with same CATH topology
3NTPA 4DWSA 3AS1A 3AS3A 1NWSA 3PRAA 4LGXA 1M5YA 1HJXA 4C02B 2MF9A 3O5DA 2DSZA 1Q6HA 2M2AA 1JNDA 2DT3A 4U86A 3WD0A 1UR8A 1FKLA 4HARA 2ZQSA 1H0IA 2DSWA 1J4IA 5HWBA 4TW6A 2D9FA 4O2TA 1NH6A 3RMEA 1H0GA 1ROUA 3IKGA 1EQ3A 4DWSC 3ALGA 1W9PA 3IKDA 1UR9A 4DRQA 1J4RA 1JNTA 1PBKA 3O5PA 1OGGA 5BXJA 4TNSA 4J4OA 3O5QA 3RM8A 1W9UA 4P8XA 4WKHA 1SYTA 3RGCA 5HW8A 2PPOA 4R0XA 4LAYA 2YBTA 1FKFA 3IK8A 3ARWA 2DG9A 3AS0A 3UQIA 1WAWA 4ODRA 4Z2JA 3ARUA 3CH9A 4DRPA 2WK2A 2K8IA 5HWCA 2KFWA 5DF0A 1LQ0A 1Q6UA 4PTMA 2MPHA 3TCZA 4JFKA 1NWRA 3O5RA 1LG1A 2VN1A 5GQBA 2N87A 3WL0A 4ML4A 1TFVA 3FXYA 5DO2A 2F4EA 3UI5A 1E9LA 3PRDA 1NWTA 3O5EA 3IHZA 5HW6A 1YW5A 1TCOC 3ARRA 1HKIA 4AY1A 1ZL1A 1VF8A 4N19A 1XHGA 2DPEA 5DIUA 2DT1A 4MNKA 1E6NA 5HUAA 5J6EA 2OLHA 1D2KA 2LPVA 2M08A 1LL4A 3CGMA 3EY6A 3ARPA 1ITXA 4IPXA 2WLZA 1XRVA 1W1PA 4GIVA 4QZVB 1C9HA 4IQ2A 2DT0A 2ZR6A 2PI6A 3NI6A 4XAKA 3ODKA 2DSUA 4DRKA 1D6OA 2PBCA 3ARQA 4WJXA 2ZQTA 1QPLA 2RUCA 2LGOA 2FAPA 3MDYB 1HKJA 3TC5A 4Z2HA 3UQAA 1GOIA 5HKGA 1L1PA 1FKRA 1HJWA 1NWUA 3CGNA 4TX0A 4DWSD 2MLZA 2YBUA 3O5LA 4WK9A 4BF8A 2Y78A 4LAXA 1LL6A 4NNRA 3JYMA 2FKEA 2UZ5A 1LJYA 3BXWA 1ZBVA 1HJVA 1OGBA 3OA5A 3KAIA 2XP3A 3FY1A 2IF4A 4W9OA 4W9PA 4URIA 4MAVA 4J4NA 2B31A 1FKGA 3WQVA 4WKFA 1RD6A 3KZ7A 1WNOA 1P5QA 2AWGA 3AQUA 1FKKA 4DH0A 1BL4A 1E6ZA 1JNEA 2XP9A 4DWSB 1X6NA 3OOBA 4U85A 1W1YA 2L2SA 2WM0A 2O9OA 4L3NA 1FAPA 4W9QA 4Z2IA 3AROA 4Z2LA 1CTNA 2F2DA 1F40A 1QPFA 1ZCNA 4TW8A 1LG2A 1FKBA 3RM9A 1T11A 3PRBA 4ITZA 1NMWA 4QT3A 1ZK6A 4DROA 1WB0A 4MNLA 1FD9A 2AOSA 3B9DA 4IQCA 2JZVA 4P8UA 1GPFA 4ZS6A 1FKIA 1A7XA 3QOKA 4LAWA 3ARYA 4IT6A 2F21A 3B9AA 2PPNA 1NMVA 2RUQA 4L72B 4DIPA 3LUOA 1FFQA 1EYMA 3KADA 4MSPA 1FKDA 4IT4A 1E15A 1B6CA 3I6CA 2QF8A 3FAPA 3KAHA 4WKAA 1FFRA 1ZU8A 2ZQVA 2G41A 4G50A 4QT2A 3O5MA 5HBFA 5GPGA 4KR0B 3B8SA 3B9EA 4ODKA 5B8IC 5DITA 3VAWA 5JH8A 1EIBA 4TYOA 3O5KA 4FAPA 5DIVA 1R9HA 1D7JA 1KT1A 1BKFA 4ZPVR 2PV2A 1HXVA 3H9RB 4HBOA 2XP4A 3G6LA 5HT1A 2KGJA 4NZCA 5I98A 3WH0A 2ZQUA 2OFNA 1Y0OA 2MNTA 3NRKA 4FN2A 1W1VA 2DSVA 1FKHA 2A3EA 4P8VA 4TW7A 2RQSA 4S3KA 4P8WA 3O5FA 1U79A 1ZBWA 1N1AA 2LKNA 1J6YA 3KACA 4HBEA 1D7IA 3W4RA 1GUVA 4Z2KA 3CHCA 4ODMA 2FDMA 1Q6IA 4Q7NA 3KAFA 3ARSA 4MNMA 1D7HA 3WL1A 1ZBKA 3PA7A 4ODOA 1ZBCA 2M1IA 1KT0A 2XP7A 3WD1A 3ARXA 3G6MA 1KFWA 4ZPTR 1HKKA 3GPKA 3TDBA 1SR0A 4JFMA 2PV1A 2VCDA 3UI6A 5HTGA 1QZ2A 4ODPA 4MTVA 1Q1CA 3ARZA 1JNSA 5DEZA 1ROTA 4ODQA 4ODNA 3WQWA 3O5IA 2XP8A 3KABA 4DRJA 1ZB5A 4QIBA 3WD4A 2RSEA 3WD3A 4ODLA 2LJ4A 2XP6A 4MPKA 2MLYA 3UQBA 4R5EA 3ALFA 4KQZA 1J4HA 4ZPWR 4Q22A 4DT4A 2A3CA 3CHFA 5D75A 2PPPA 3CHDA 1EHNA 4DRIA 1OWQA 3ARVA 1O6IA 4Z2GA 2O92A 1F8AB 2G8ZA 1K9TA 2IUZA 3ARTA 4MGVA 3RM4A 3O5OA 3O5GA 2PV3A 4MNJA 4JFLA 4G2PA 1LL7A 2KO7A 5GPRA 2DG3A 1FJDA 2ZR4A 1W9VA 3UF8A 3WD2A 3JYJA 2XP5A 1YATA 4S3JA 4U84A 3PR9A 4GGQA 4DRNA 1E6PA 3WIJA 3WKZA 4DRHA 2ESCA 2ZR5A 3B7XA 3CZ8A 4W5UA 1FKTA 3KCEA 1W1TA 2A3BA 3UI4A 1EDQA 1JVWA 3RFWA 1HKMA 3O5JA 2WLYA 2ITKA 5HW7A 3JXVA 2KE0A 4DZ3A 4DZ2A 2MLXA 1E6RA 2A3AA 2RURA 4DRMA 1X6LA 1IX5A 1FKJA 3KAGA 3CHEA 4LAVA 2XPBA 2Q5AA 4NSBA 1NSGA 2RUDA 4JFIA 4JYSA 2XPAA 2KI3A 1FKSA 1PINA 2DG4A 2KR7A 4JFJA 1W26A 4WIWA 2DT2A 3AS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKD A;  3NTP A;  4GIV A;  4ODL A;  1C9H A;  2LJ4 A;  2XP6 A;  4IQ2 A;  2ZR6 A;  3NI6 A;  1M5Y A;  2MLY A;  3ODK A;  4DRK A;  1B6C A;  3I6C A;  3UQB A;  1D6O A;  1J4H A;  2PBC A;  4C02 B;  2MF9 A;  3O5D A;  2ZQT A;  2M2A A;  1Q6H A;  1QPL A;  4U86 A;  3FAP A;  3KAH A;  2RUC A;  1FKL A;  4DT4 A;  2LGO A;  2ZQS A;  2FAP A;  2ZQV A;  3MDY B;  2PPP A;  5D75 A;  4G50 A;  4DRI A;  3TC5 A;  4QT2 A;  3UQA A;  1F8A B;  3O5M A;  5GPG A;  5HKG A;  1L1P A;  1FKR A;  1J4I A;  4MGV A;  5HWB A;  4TW6 A;  3CGN A;  4TX0 A;  2D9F A;  4O2T A;  4ODK A;  5B8I C;  3O5O A;  5DIT A;  3VAW A;  4TYO A;  2MLZ A;  3O5K A;  4FAP A;  3O5L A;  1ROU A;  3O5G A;  3IKG A;  2PV3 A;  4BF8 A;  1EQ3 A;  2Y78 A;  4JFL A;  5DIV A;  1R9H A;  4G2P A;  1D7J A;  1KT1 A;  1BKF A;  3IKD A;  4LAX A;  2PV2 A;  2KO7 A;  4NNR A;  1HXV A;  2DG3 A;  3H9R B;  1FJD A;  2XP4 A;  4DRQ A;  3JYM A;  5HT1 A;  1J4R A;  2KGJ A;  1JNT A;  1PBK A;  2FKE A;  2UZ5 A;  3O5P A;  5I98 A;  5BXJ A;  2ZR4 A;  3WH0 A;  2ZQU A;  2OFN A;  1Y0O A;  4TNS A;  3UF8 A;  4J4O A;  3JYJ A;  2XP5 A;  1YAT A;  2MNT A;  2XP3 A;  3KAI A;  2IF4 A;  3O5Q A;  3NRK A;  4U84 A;  4W9O A;  4FN2 A;  4W9P A;  4GGQ A;  4J4N A;  1FKH A;  4DRN A;  4TW7 A;  3RGC A;  1FKG A;  2PPO A;  2RQS A;  4R0X A;  5HW8 A;  4LAY A;  4DRH A;  3O5F A;  1FKF A;  1U79 A;  2ZR5 A;  3KZ7 A;  3B7X A;  3IK8 A;  1P5Q A;  2AWG A;  1N1A A;  2DG9 A;  1FKK A;  2LKN A;  1BL4 A;  4DH0 A;  1J6Y A;  2XP9 A;  3UQI A;  3KAC A;  4ODR A;  1FKT A;  3KCE A;  4DRP A;  1D7I A;  3OOB A;  2K8I A;  4U85 A;  2KFW A;  2L2S A;  5HWC A;  3UI4 A;  4ODM A;  1Q6U A;  3RFW A;  1JVW A;  1Q6I A;  1FAP A;  2MPH A;  3KAF A;  3TCZ A;  4W9Q A;  4JFK A;  1D7H A;  3O5J A;  3O5R A;  3PA7 A;  2F2D A;  2VN1 A;  4ODO A;  2M1I A;  1QPF A;  1ZCN A;  2N87 A;  4TW8 A;  1F40 A;  1KT0 A;  2ITK A;  1FKB A;  2XP7 A;  3JXV A;  5HW7 A;  2KE0 A;  4DZ3 A;  4DZ2 A;  2F4E A;  3UI5 A;  2MLX A;  1T11 A;  3PRB A;  2RUR A;  3O5E A;  3PRD A;  1NMW A;  4ITZ A;  4DRM A;  1FKJ A;  1ZK6 A;  3GPK A;  3IHZ A;  4QT3 A;  3TDB A;  3KAG A;  4DRO A;  4JFM A;  2PV1 A;  1FD9 A;  2VCD A;  1YW5 A;  3UI6 A;  5HW6 A;  1TCO C;  2XPB A;  4IQC A;  4LAV A;  1QZ2 A;  5HTG A;  4ODP A;  2JZV A;  2Q5A A;  1Q1C A;  4N19 A;  1NSG A;  2RUD A;  4JFI A;  1FKI A;  5DIU A;  1JNS A;  1ROT A;  4JYS A;  5HUA A;  5J6E A;  1A7X A;  4ODQ A;  2XPA A;  2KI3 A;  2LPV A;  2M08 A;  4LAW A;  4ODN A;  1FKS A;  1PIN A;  2DG4 A;  2F21 A;  2KR7 A;  2XP8 A;  3O5I A;  2PPN A;  3CGM A;  4IPX A;  3EY6 A;  1NMV A;  1W26 A;  3KAB A;  4JFJ A;  4DRJ A;  2RUQ A;  4QIB A;  4DIP A;  3LUO A;  2RSE A;  1EYM A;  3KAD A;  4MSP A; 
#chains in the Genus database with same CATH topology
 3NTP A;  4DWS A;  3AS1 A;  3AS3 A;  1NWS A;  3PRA A;  4LGX A;  1M5Y A;  1HJX A;  4C02 B;  2MF9 A;  3O5D A;  2DSZ A;  1Q6H A;  2M2A A;  1JND A;  2DT3 A;  4U86 A;  3WD0 A;  1UR8 A;  1FKL A;  4HAR A;  2ZQS A;  1H0I A;  2DSW A;  1J4I A;  5HWB A;  4TW6 A;  2D9F A;  4O2T A;  1NH6 A;  3RME A;  1H0G A;  1ROU A;  3IKG A;  1EQ3 A;  4DWS C;  3ALG A;  1W9P A;  3IKD A;  1UR9 A;  4DRQ A;  1J4R A;  1JNT A;  1PBK A;  3O5P A;  1OGG A;  5BXJ A;  4TNS A;  4J4O A;  3O5Q A;  3RM8 A;  1W9U A;  4P8X A;  4WKH A;  1SYT A;  2PN0 A;  3RGC A;  5HW8 A;  2PPO A;  4R0X A;  4LAY A;  2YBT A;  1FKF A;  3IK8 A;  3ARW A;  2DG9 A;  3AS0 A;  3UQI A;  1WAW A;  4ODR A;  4Z2J A;  3ARU A;  3CH9 A;  4DRP A;  2WK2 A;  2K8I A;  5HWC A;  2KFW A;  5DF0 A;  1LQ0 A;  1Q6U A;  4PTM A;  2MPH A;  3TCZ A;  4JFK A;  1NWR A;  3O5R A;  1LG1 A;  2VN1 A;  5GQB A;  2N87 A;  3WL0 A;  3BMB A;  4ML4 A;  1TFV A;  3FXY A;  5DO2 A;  2F4E A;  3UI5 A;  1E9L A;  3PRD A;  1NWT A;  3O5E A;  3IHZ A;  5HW6 A;  1YW5 A;  1TCO C;  3ARR A;  1HKI A;  4AY1 A;  1ZL1 A;  1VF8 A;  4N19 A;  1XHG A;  2DPE A;  5DIU A;  2DT1 A;  4MNK A;  2P4V A;  1E6N A;  5HUA A;  5J6E A;  2OLH A;  1D2K A;  2LPV A;  2M08 A;  2B5U B;  1LL4 A;  3CGM A;  3EY6 A;  3ARP A;  1ITX A;  4IPX A;  2WLZ A;  1XRV A;  1W1P A;  4GIV A;  4QZV B;  1C9H A;  4IQ2 A;  2DT0 A;  2ZR6 A;  2PI6 A;  3NI6 A;  4XAK A;  3ODK A;  2DSU A;  4DRK A;  1D6O A;  2PBC A;  3ARQ A;  4WJX A;  2ZQT A;  1QPL A;  2RUC A;  2LGO A;  2FAP A;  3MDY B;  1HKJ A;  3TC5 A;  4Z2H A;  3UQA A;  1GOI A;  5HKG A;  1L1P A;  1FKR A;  1HJW A;  1NWU A;  3CGN A;  4TX0 A;  4DWS D;  2MLZ A;  2YBU A;  3O5L A;  4WK9 A;  4BF8 A;  2Y78 A;  4LAX A;  1LL6 A;  4NNR A;  3JYM A;  2FKE A;  2UZ5 A;  1LJY A;  3BXW A;  1ZBV A;  1HJV A;  1OGB A;  3OA5 A;  3KAI A;  2XP3 A;  3FY1 A;  2IF4 A;  4W9O A;  4W9P A;  4URI A;  4MAV A;  4J4N A;  2B31 A;  1FKG A;  3WQV A;  4WKF A;  1RD6 A;  3KZ7 A;  1WNO A;  2EUL A;  1P5Q A;  2AWG A;  3AQU A;  1FKK A;  4DH0 A;  1BL4 A;  1E6Z A;  1JNE A;  2XP9 A;  4DWS B;  1X6N A;  3OOB A;  4U85 A;  1W1Y A;  2L2S A;  2WM0 A;  2O9O A;  4L3N A;  1FAP A;  4W9Q A;  4Z2I A;  3ARO A;  4Z2L A;  1CTN A;  2F2D A;  1F40 A;  1QPF A;  1ZCN A;  4TW8 A;  1LG2 A;  1FKB A;  3RM9 A;  1T11 A;  3PRB A;  4ITZ A;  1NMW A;  4QT3 A;  1ZK6 A;  4DRO A;  1WB0 A;  4MNL A;  1FD9 A;  2AOS A;  3B9D A;  4IQC A;  2JZV A;  4P8U A;  1GPF A;  4ZS6 A;  1FKI A;  1A7X A;  3QOK A;  4LAW A;  3ARY A;  4IT6 A;  2F21 A;  3B9A A;  2PPN A;  1NMV A;  2RUQ A;  4L72 B;  4DIP A;  3LUO A;  1FFQ A;  1EYM A;  3KAD A;  4MSP A;  1FKD A;  4UDM A;  4IT4 A;  1E15 A;  1B6C A;  3I6C A;  2QF8 A;  3FAP A;  3KAH A;  4WKA A;  1FFR A;  1ZU8 A;  2ZQV A;  2G41 A;  4G50 A;  4QT2 A;  3O5M A;  5HBF A;  5GPG A;  4KR0 B;  3B8S A;  3B9E A;  4ODK A;  5B8I C;  5DIT A;  3VAW A;  5JH8 A;  1EIB A;  4TYO A;  3O5K A;  4FAP A;  5DIV A;  1R9H A;  1D7J A;  1KT1 A;  1BKF A;  4ZPV R;  2PV2 A;  1HXV A;  3H9R B;  4HBO A;  2XP4 A;  3G6L A;  5HT1 A;  2KGJ A;  4NZC A;  5I98 A;  3WH0 A;  2ZQU A;  2OFN A;  1Y0O A;  2MNT A;  3NRK A;  4FN2 A;  1W1V A;  2DSV A;  1FKH A;  2A3E A;  2F23 A;  4P8V A;  2RQS A;  4TW7 A;  4S3K A;  4P8W A;  3O5F A;  1U79 A;  1ZBW A;  1N1A A;  2LKN A;  1J6Y A;  3KAC A;  4HBE A;  1D7I A;  3W4R A;  1GUV A;  4Z2K A;  3CHC A;  4ODM A;  2FDM A;  1Q6I A;  4Q7N A;  3KAF A;  3ARS A;  4MNM A;  1D7H A;  3WL1 A;  1ZBK A;  3PA7 A;  4ODO A;  1ZBC A;  2M1I A;  1KT0 A;  2XP7 A;  3WD1 A;  3ARX A;  3G6M A;  1KFW A;  4ZPT R;  1HKK A;  3GPK A;  3TDB A;  1SR0 A;  4JFM A;  2PV1 A;  2VCD A;  3UI6 A;  5HTG A;  1QZ2 A;  4ODP A;  4MTV A;  1Q1C A;  3ARZ A;  1JNS A;  5DEZ A;  1ROT A;  4ODQ A;  1GRJ A;  4ODN A;  3WQW A;  3O5I A;  2XP8 A;  3KAB A;  4DRJ A;  1ZB5 A;  4QIB A;  3WD4 A;  2RSE A;  3WD3 A;  4ODL A;  2LJ4 A;  2XP6 A;  4MPK A;  2MLY A;  3UQB A;  4R5E A;  3ALF A;  4KQZ A;  1J4H A;  4ZPW R;  4Q22 A;  4DT4 A;  2A3C A;  3CHF A;  5D75 A;  2PPP A;  3CHD A;  1EHN A;  4DRI A;  1OWQ A;  3ARV A;  1O6I A;  4Z2G A;  2O92 A;  1F8A B;  2G8Z A;  1K9T A;  2IUZ A;  3ART A;  4MGV A;  3RM4 A;  3O5O A;  3GTY X;  3O5G A;  2PV3 A;  4MNJ A;  4JFL A;  4G2P A;  1LL7 A;  2KO7 A;  5GPR A;  1JCH B;  2DG3 A;  1FJD A;  2ZR4 A;  1W9V A;  3UF8 A;  3WD2 A;  3JYJ A;  2XP5 A;  1YAT A;  4S3J A;  4U84 A;  3PR9 A;  4GGQ A;  4DRN A;  1E6P A;  3WIJ A;  3WKZ A;  4DRH A;  2ESC A;  2ZR5 A;  3B7X A;  3CZ8 A;  4W5U A;  1FKT A;  3KCE A;  1W1T A;  2A3B A;  3UI4 A;  1EDQ A;  1JVW A;  3RFW A;  1HKM A;  3O5J A;  3GU0 A;  2WLY A;  2ITK A;  5HW7 A;  3JXV A;  2KE0 A;  3EIP A;  4DZ3 A;  4DZ2 A;  2MLX A;  1E6R A;  2A3A A;  2RUR A;  4DRM A;  1X6L A;  1IX5 A;  1FKJ A;  3KAG A;  3CHE A;  4LAV A;  2XPB A;  2Q5A A;  4NSB A;  1NSG A;  2RUD A;  4JFI A;  4JYS A;  2XPA A;  2KI3 A;  1FKS A;  1PIN A;  2DG4 A;  2KR7 A;  4JFJ A;  1W26 A;  1E44 A;  4WIW A;  2DT2 A;  3AS2 A;  2ETN A; 
#chains in the Genus database with same CATH homology
 3NTP A;  4DWS A;  3AS1 A;  3AS3 A;  1NWS A;  3PRA A;  4LGX A;  1M5Y A;  1HJX A;  4C02 B;  2MF9 A;  3O5D A;  2DSZ A;  1Q6H A;  2M2A A;  1JND A;  2DT3 A;  4U86 A;  3WD0 A;  1UR8 A;  1FKL A;  4HAR A;  2ZQS A;  1H0I A;  2DSW A;  1J4I A;  5HWB A;  4TW6 A;  2D9F A;  4O2T A;  1NH6 A;  3RME A;  1H0G A;  1ROU A;  3IKG A;  1EQ3 A;  4DWS C;  3ALG A;  1W9P A;  3IKD A;  1UR9 A;  4DRQ A;  1J4R A;  1JNT A;  1PBK A;  3O5P A;  1OGG A;  5BXJ A;  4TNS A;  4J4O A;  3O5Q A;  3RM8 A;  1W9U A;  4P8X A;  4WKH A;  1SYT A;  3RGC A;  5HW8 A;  2PPO A;  4R0X A;  4LAY A;  2YBT A;  1FKF A;  3IK8 A;  3ARW A;  2DG9 A;  3AS0 A;  3UQI A;  1WAW A;  4ODR A;  4Z2J A;  3ARU A;  3CH9 A;  4DRP A;  2WK2 A;  2K8I A;  5HWC A;  2KFW A;  5DF0 A;  1LQ0 A;  1Q6U A;  4PTM A;  2MPH A;  3TCZ A;  4JFK A;  1NWR A;  3O5R A;  1LG1 A;  2VN1 A;  5GQB A;  2N87 A;  3WL0 A;  4ML4 A;  1TFV A;  3FXY A;  5DO2 A;  2F4E A;  3UI5 A;  1E9L A;  3PRD A;  1NWT A;  3O5E A;  3IHZ A;  5HW6 A;  1YW5 A;  1TCO C;  3ARR A;  1HKI A;  4AY1 A;  1ZL1 A;  1VF8 A;  4N19 A;  1XHG A;  2DPE A;  5DIU A;  2DT1 A;  4MNK A;  1E6N A;  5HUA A;  5J6E A;  2OLH A;  1D2K A;  2LPV A;  2M08 A;  1LL4 A;  3CGM A;  3EY6 A;  3ARP A;  1ITX A;  4IPX A;  2WLZ A;  1XRV A;  1W1P A;  4GIV A;  4QZV B;  1C9H A;  4IQ2 A;  2DT0 A;  2ZR6 A;  2PI6 A;  3NI6 A;  4XAK A;  3ODK A;  2DSU A;  4DRK A;  1D6O A;  2PBC A;  3ARQ A;  4WJX A;  2ZQT A;  1QPL A;  2RUC A;  2LGO A;  2FAP A;  3MDY B;  1HKJ A;  3TC5 A;  4Z2H A;  3UQA A;  1GOI A;  5HKG A;  1L1P A;  1FKR A;  1HJW A;  1NWU A;  3CGN A;  4TX0 A;  4DWS D;  2MLZ A;  2YBU A;  3O5L A;  4WK9 A;  4BF8 A;  2Y78 A;  4LAX A;  1LL6 A;  4NNR A;  3JYM A;  2FKE A;  2UZ5 A;  1LJY A;  3BXW A;  1ZBV A;  1HJV A;  1OGB A;  3OA5 A;  3KAI A;  2XP3 A;  3FY1 A;  2IF4 A;  4W9O A;  4W9P A;  4URI A;  4MAV A;  4J4N A;  2B31 A;  1FKG A;  3WQV A;  4WKF A;  1RD6 A;  3KZ7 A;  1WNO A;  1P5Q A;  2AWG A;  3AQU A;  1FKK A;  4DH0 A;  1BL4 A;  1E6Z A;  1JNE A;  2XP9 A;  4DWS B;  1X6N A;  3OOB A;  4U85 A;  1W1Y A;  2L2S A;  2WM0 A;  2O9O A;  4L3N A;  1FAP A;  4W9Q A;  4Z2I A;  3ARO A;  4Z2L A;  1CTN A;  2F2D A;  1F40 A;  1QPF A;  1ZCN A;  4TW8 A;  1LG2 A;  1FKB A;  3RM9 A;  1T11 A;  3PRB A;  4ITZ A;  1NMW A;  4QT3 A;  1ZK6 A;  4DRO A;  1WB0 A;  4MNL A;  1FD9 A;  2AOS A;  3B9D A;  4IQC A;  2JZV A;  4P8U A;  1GPF A;  4ZS6 A;  1FKI A;  1A7X A;  3QOK A;  4LAW A;  3ARY A;  4IT6 A;  2F21 A;  3B9A A;  2PPN A;  1NMV A;  2RUQ A;  4L72 B;  4DIP A;  3LUO A;  1FFQ A;  1EYM A;  3KAD A;  4MSP A;  1FKD A;  4IT4 A;  1E15 A;  1B6C A;  3I6C A;  2QF8 A;  3FAP A;  3KAH A;  4WKA A;  1FFR A;  1ZU8 A;  2ZQV A;  2G41 A;  4G50 A;  4QT2 A;  3O5M A;  5HBF A;  5GPG A;  4KR0 B;  3B8S A;  3B9E A;  4ODK A;  5B8I C;  5DIT A;  3VAW A;  5JH8 A;  1EIB A;  4TYO A;  3O5K A;  4FAP A;  5DIV A;  1R9H A;  1D7J A;  1KT1 A;  1BKF A;  4ZPV R;  2PV2 A;  1HXV A;  3H9R B;  4HBO A;  2XP4 A;  3G6L A;  5HT1 A;  2KGJ A;  4NZC A;  5I98 A;  3WH0 A;  2ZQU A;  2OFN A;  1Y0O A;  2MNT A;  3NRK A;  4FN2 A;  1W1V A;  2DSV A;  1FKH A;  2A3E A;  4P8V A;  4TW7 A;  2RQS A;  4S3K A;  4P8W A;  3O5F A;  1U79 A;  1ZBW A;  1N1A A;  2LKN A;  1J6Y A;  3KAC A;  4HBE A;  1D7I A;  3W4R A;  1GUV A;  4Z2K A;  3CHC A;  4ODM A;  2FDM A;  1Q6I A;  4Q7N A;  3KAF A;  3ARS A;  4MNM A;  1D7H A;  3WL1 A;  1ZBK A;  3PA7 A;  4ODO A;  1ZBC A;  2M1I A;  1KT0 A;  2XP7 A;  3WD1 A;  3ARX A;  3G6M A;  1KFW A;  4ZPT R;  1HKK A;  3GPK A;  3TDB A;  1SR0 A;  4JFM A;  2PV1 A;  2VCD A;  3UI6 A;  5HTG A;  1QZ2 A;  4ODP A;  4MTV A;  1Q1C A;  3ARZ A;  1JNS A;  5DEZ A;  1ROT A;  4ODQ A;  4ODN A;  3WQW A;  3O5I A;  2XP8 A;  3KAB A;  4DRJ A;  1ZB5 A;  4QIB A;  3WD4 A;  2RSE A;  3WD3 A;  4ODL A;  2LJ4 A;  2XP6 A;  4MPK A;  2MLY A;  3UQB A;  4R5E A;  3ALF A;  4KQZ A;  1J4H A;  4ZPW R;  4Q22 A;  4DT4 A;  2A3C A;  3CHF A;  5D75 A;  2PPP A;  3CHD A;  1EHN A;  4DRI A;  1OWQ A;  3ARV A;  1O6I A;  4Z2G A;  2O92 A;  1F8A B;  2G8Z A;  1K9T A;  2IUZ A;  3ART A;  4MGV A;  3RM4 A;  3O5O A;  3O5G A;  2PV3 A;  4MNJ A;  4JFL A;  4G2P A;  1LL7 A;  2KO7 A;  5GPR A;  2DG3 A;  1FJD A;  2ZR4 A;  1W9V A;  3UF8 A;  3WD2 A;  3JYJ A;  2XP5 A;  1YAT A;  4S3J A;  4U84 A;  3PR9 A;  4GGQ A;  4DRN A;  1E6P A;  3WIJ A;  3WKZ A;  4DRH A;  2ESC A;  2ZR5 A;  3B7X A;  3CZ8 A;  4W5U A;  1FKT A;  3KCE A;  1W1T A;  2A3B A;  3UI4 A;  1EDQ A;  1JVW A;  3RFW A;  1HKM A;  3O5J A;  2WLY A;  2ITK A;  5HW7 A;  3JXV A;  2KE0 A;  4DZ3 A;  4DZ2 A;  2MLX A;  1E6R A;  2A3A A;  2RUR A;  4DRM A;  1X6L A;  1IX5 A;  1FKJ A;  3KAG A;  3CHE A;  4LAV A;  2XPB A;  2Q5A A;  4NSB A;  1NSG A;  2RUD A;  4JFI A;  4JYS A;  2XPA A;  2KI3 A;  1FKS A;  1PIN A;  2DG4 A;  2KR7 A;  4JFJ A;  1W26 A;  4WIW A;  2DT2 A;  3AS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...