2PV1A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide weyipnv
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone surA
publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 28
structure length 103
sequence length 103
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv1A00
2L2SA 2PPOA 3O5MA 3RFWA 1ZK6A 1KT1A 3CGMA 3FAPA 1FKKA 3O5OA 3JYMA 3KAIA 4O2TA 3TCZA 3NRKA 1Q6IA 2M1IA 1JVWA 1QPLA 1ROUA 2ZR4A 3UI5A 1FKDA 1QZ2A 2ZQSA 2MLZA 3I6CA 5HWBA 1QPFA 2MPHA 2RUCA 4DRJA 3IHZA 3JYJA 4GIVA 3MDYB 1YW5A 5HTGA 3UQBA 2ITKA 2LKNA 1FKBA 2LPVA 4FAPA 4IQCA 3KAHA 3NTPA 4ODMA 4W9OA 1FKGA 4LAWA 1D7JA 1D7IA 3O5QA 4JFKA 5BXJA 2MLXA 3KCEA 3UI6A 2PV1A 1F40A 4TW7A 2RUDA 4J4NA 4DRHA 5DITA 2XP5A 2XPAA 1FKHA 1NMWA 2XP8A 4ITZA 4W9PA 5HWCA 1JNTA 3KAFA 4C02B 4DRIA 4TNSA 3UQAA 5J6EA 1D7HA 4BF8A 2RUQA 2KI3A 3JXVA 2AWGA 1Q6UA 2IF4A 3IK8A 4ODQA 2FKEA 3O5IA 5D75A 4QIBA 5HUAA 4ODPA 4QT2A 2RURA 2XP9A 4ODKA 3IKGA 1PBKA 4ODRA 2KE0A 4U85A 1T11A 4FN2A 4DZ2A 2RSEA 1JNSA 2ZQUA 1A7XA 2XP3A 2F4EA 2KO7A 3TDBA 2UZ5A 3PRBA 3PRDA 4DRPA 1NMVA 1B6CA 2F21A 3O5KA 4R0XA 4NNRA 1TCOC 4DT4A 1YATA 4IQ2A 3WH0A 5I98A 3UF8A 5HW8A 4MSPA 1FAPA 3KACA 2MF9A 2Y78A 5DIUA 3UI4A 4LAXA 5HKGA 2VN1A 2ZR6A 2OFNA 1BL4A 1N1AA 2DG3A 3O5JA 1J4HA 2MNTA 2LGOA 3CGNA 3O5RA 4U86A 4DRQA 1J4RA 3IKDA 2LJ4A 3O5GA 2K8IA 3B7XA 3O5EA 4G50A 4LAYA 2KFWA 2FAPA 3O5LA 2M08A 1HXVA 1FKFA 1F8AB 1M5YA 1EQ3A 2DG9A 1ZCNA 1KT0A 3OOBA 5GPGA 1FD9A 1NSGA 3KABA 4JFIA 2XPBA 3EY6A 5HT1A 1P5QA 2ZQTA 3KZ7A 1FKIA 2XP7A 4TW8A 5DIVA 2DG4A 2PPPA 1J4IA 4LAVA 1EYMA 4JFJA 4ODLA 4JYSA 2D9FA 4DROA 2XP6A 2PV3A 3RGCA 4DH0A 5HW7A 2JZVA 4G2PA 4GGQA 3TC5A 4ODNA 2PBCA 4TYOA 4W9QA 1R9HA 2M2AA 4JFMA 1BKFA 3KADA 3ODKA 1FKJA 2Q5AA 2ZQVA 2KGJA 3GPKA 4DRKA 1D6OA 3VAWA 1FKTA 4DZ3A 3O5PA 2XP4A 1FKRA 5B8IC 1C9HA 1Q6HA 1W26A 4DRNA 4DRMA 3LUOA 4TX0A 1U79A 2MLYA 3PA7A 3O5DA 1J6YA 1Q1CA 1FKLA 4J4OA 4TW6A 5HW6A 2F2DA 1PINA 1Y0OA 4IPXA 1FKSA 3NI6A 4U84A 2N87A 2PPNA 4N19A 3KAGA 4QT3A 1FJDA 3UQIA 3O5FA 1ROTA 4DIPA 4JFLA 2KR7A 2PV2A 2RQSA 2ZR5A 4ODOA 2VCDA 4MGVA 3H9RB 1L1PA
chains in the Genus database with same CATH superfamily
1IX5A 2PPOA 3O5MA 3AROA 1KT1A 1FKKA 3JYMA 1SR0A 1JVWA 1ROUA 1FKDA 2ZQSA 3B9EA 1ZBVA 1XHGA 2PN0A 3GTYX 4MNKA 4GIVA 3JYJA 5HTGA 3UQBA 2ITKA 3WD4A 4W9OA 4LAWA 5DO2A 3CHEA 1ZU8A 1D7IA 2B31A 4TW7A 3FY1A 1JCHB 1W1VA 1JNTA 4DRIA 4IT6A 2AWGA 1Q6UA 4QT2A 1OGBA 2RURA 3ALFA 3IKGA 3ARTA 1PBKA 4U85A 3G6LA 1T11A 4DZ2A 2WM0A 1E6RA 2F4EA 1LJYA 2G41A 3WIJA 1EHNA 3PRBA 1B6CA 3O5KA 1GPFA 3WH0A 3ARRA 5HW8A 4DWSD 3EIPA 3RM8A 3WD0A 2VN1A 2LJ4A 2K8IA 4G50A 4S3KA 1F8AB 1M5YA 1VF8A 1NSGA 4JFIA 2XPBA 3EY6A 1WNOA 2FDMA 2XP7A 3AS1A 2DG4A 1K9TA 4LAVA 4JFJA 3ARYA 4JYSA 2PV3A 4WKFA 1D2KA 2YBTA 1RD6A 4Q22A 2PBCA 4TYOA 1HJXA 1SYTA 3KADA 1E6NA 3WD3A 1NWUA 3VAWA 3CHFA 1Q6HA 1LL7A 1Q1CA 1FKLA 4J4OA 2F2DA 1Y0OA 1HKIA 4ML4A 1GUVA 2PPNA 1HKKA 3O5FA 3CZ8A 4DIPA 4JFLA 2RQSA 2ZR5A 2VCDA 3BMBA 1L1PA 1EIBA 3RFWA 1ZK6A 4O2TA 1CTNA 1WB0A 3KAIA 3NRKA 1E15A 2WLYA 3OA5A 1UR9A 2B5UB 3AS2A 2YBUA 2DT0A 1NWTA 4FAPA 2DSZA 3O5QA 2QF8A 4JFKA 4MAVA 4DRHA 4ITZA 4W9PA 3KAFA 4C02B 2F23A 4TNSA 3JXVA 5D75A 3AS3A 4QIBA 2XP9A 4AY1A 4ODRA 1JNEA 1HKJA 2RSEA 2ZQUA 4KQZA 1H0IA 4Z2KA 2UZ5A 4DRPA 3ARZA 4DT4A 1KFWA 3UI4A 1W1YA 4LAXA 1LQ0A 4P8WA 2OFNA 1N1AA 2P4VA 1J4HA 2MNTA 1GRJA 2LGOA 3CGNA 1J4RA 3B7XA 4DWSA 3O5LA 2G8ZA 3OOBA 3KABA 1ZB5A 2A3BA 3WD2A 1P5QA 4KR0B 3KZ7A 4DWSB 2PI6A 2WK2A 3WD1A 3RGCA 3WQVA 1OWQA 5HW7A 2DPEA 3TC5A 4ODNA 4HBEA 2DSWA 1R9HA 2Q5AA 4MNLA 1H0GA 2A3AA 3O5PA 1FKRA 5B8IC 4ZPVR 1W26A 1U79A 4ZPTR 4S3JA 3PA7A 1J6YA 1NWSA 4IPXA 2O9OA 4QT3A 4WK9A 3UQIA 4ODKA 4MGVA 4ODMA 3RM9A 4MNJA 2L2SA 3FAPA 3TCZA 1LL6A 1OGGA 3O5OA 1FFQA 1E44A 4IT4A 4WIWA 3RMEA 2DSVA 1QZ2A 1X6NA 1QPFA 5HWBA 4DRJA 3IHZA 2A3CA 3MDYB 1YW5A 4ZPWR 2AOSA 2LKNA 1FKBA 3WQWA 2LPVA 3KAHA 1FKGA 3ALGA 1D7JA 3WKZA 3KCEA 1NH6A 4Z2JA 5DITA 1NWRA 2XP5A 1FKHA 2XP8A 5HWCA 5GPRA 3ARSA 1W9PA 1D7HA 4BF8A 5J6EA 2IF4A 4HARA 3O5IA 3B8SA 2DT3A 1TFVA 2KE0A 4FN2A 5HBFA 1JNSA 2XP3A 4LGXA 3TDBA 1W9UA 2F21A 4R0XA 1HKMA 1UR8A 4IQ2A 4URIA 4QZVB 2A3EA 5I98A 4P8VA 1JNDA 1FAPA 3KACA 4MTVA 3O5JA 1HJWA 2O92A 4DRQA 3IKDA 3O5GA 3FXYA 4LAYA 3WL1A 3RM4A 1KT0A 5GPGA 1FD9A 4Q7NA 5HT1A 4XAKA 4R5EA 4TW8A 1LL4A 1J4IA 1LG2A 1ZL1A 4ODLA 2D9FA 4DROA 2XP6A 4G2PA 4P8UA 4GGQA 5JH8A 3CH9A 3ARUA 4W9QA 2M2AA 1BKFA 4Z2GA 1XRVA 2KGJA 1EDQA 1D6OA 3PR9A 2XP4A 5DF0A 4DRNA 1ZBWA 1X6LA 5HW6A 1PINA 3NI6A 4U84A 2KR7A 2PV2A 4ODOA 4ODQA 3KAGA 3H9RB 4P8XA 1EQ3A 3CGMA 1Q6IA 2M1IA 1QPLA 3UI5A 2ZR4A 3ARWA 4MNMA 2MLZA 3I6CA 2MPHA 2RUCA 3PRAA 3ARVA 1E9LA 2DSUA 4MPKA 3B9DA 4IQCA 3NTPA 5BXJA 2MLXA 3UI6A 3WL0A 2PV1A 3AS0A 2DT1A 1F40A 3ARQA 2RUDA 4J4NA 2XPAA 1NMWA 3BXWA 3W4RA 3UQAA 2RUQA 2KI3A 5HUAA 3IK8A 1LG1A 2FKEA 4ODPA 4UDMA 2WLZA 3ARXA 1WAWA 4HBOA 1HJVA 1A7XA 4W5UA 2KO7A 4L3NA 3PRDA 1NMVA 4NNRA 1TCOC 4L72B 1YATA 3B9AA 1W1PA 3UF8A 4MSPA 2MF9A 2Y78A 5DIUA 3AQUA 3CHCA 4PTMA 4WKHA 5HKGA 1FFRA 2ZR6A 1BL4A 2DG3A 3QOKA 3O5RA 2ETNA 4U86A 4Z2HA 3ARPA 3O5EA 2KFWA 2FAPA 2M08A 4NZCA 1HXVA 1FKFA 1ITXA 2DG9A 1ZCNA 1ZBCA 1E6ZA 2IUZA 2OLHA 4WJXA 2ZQTA 1O6IA 1FKIA 1W1TA 5DIVA 2PPPA 1EYMA 2DT2A 5DEZA 1E6PA 1W9VA 4DH0A 4DWSC 2JZVA 3G6MA 4JFMA 3ODKA 1FKJA 4NSBA 2ZQVA 3GPKA 4DRKA 2ESCA 4DZ3A 1FKTA 1C9HA 3CHDA 1ZBKA 4DRMA 3LUOA 4TX0A 4Z2IA 2MLYA 5GQBA 3O5DA 4TW6A 1FKSA 3GU0A 2EULA 2N87A 4ZS6A 4N19A 1FJDA 4Z2LA 1GOIA 4WKAA 1ROTA
chains in the Genus database with same CATH topology
1IX5A 2PPOA 3O5MA 3AROA 1KT1A 1FKKA 3JYMA 1SR0A 1JVWA 1ROUA 1FKDA 2ZQSA 3B9EA 1ZBVA 1XHGA 4MNKA 4GIVA 3JYJA 5HTGA 3UQBA 2ITKA 3WD4A 4W9OA 4LAWA 5DO2A 3CHEA 1ZU8A 1D7IA 2B31A 4TW7A 3FY1A 1W1VA 1JNTA 4DRIA 4IT6A 2AWGA 1Q6UA 4QT2A 1OGBA 2RURA 3ALFA 3IKGA 3ARTA 1PBKA 4U85A 3G6LA 1T11A 4DZ2A 2WM0A 1E6RA 2F4EA 1LJYA 2G41A 3WIJA 1EHNA 3PRBA 1B6CA 3O5KA 1GPFA 3WH0A 3ARRA 5HW8A 4DWSD 3RM8A 3WD0A 2VN1A 2LJ4A 2K8IA 4G50A 4S3KA 1F8AB 1M5YA 1VF8A 1NSGA 4JFIA 2XPBA 3EY6A 1WNOA 2FDMA 2XP7A 3AS1A 2DG4A 1K9TA 4LAVA 4JFJA 3ARYA 4JYSA 2PV3A 4WKFA 1D2KA 2YBTA 1RD6A 4Q22A 2PBCA 4TYOA 1HJXA 1SYTA 3KADA 1E6NA 3WD3A 1NWUA 3VAWA 3CHFA 1Q6HA 1LL7A 1Q1CA 1FKLA 4J4OA 2F2DA 1Y0OA 1HKIA 4ML4A 1GUVA 2PPNA 1HKKA 3O5FA 3CZ8A 4DIPA 4JFLA 2RQSA 2ZR5A 2VCDA 1L1PA 1EIBA 3RFWA 1ZK6A 4O2TA 1CTNA 1WB0A 3KAIA 3NRKA 1E15A 2WLYA 3OA5A 1UR9A 3AS2A 2YBUA 2DT0A 1NWTA 4FAPA 2DSZA 3O5QA 2QF8A 4JFKA 4MAVA 4DRHA 4ITZA 4W9PA 3KAFA 4C02B 4TNSA 3JXVA 5D75A 3AS3A 4QIBA 2XP9A 4AY1A 4ODRA 1JNEA 1HKJA 2RSEA 2ZQUA 4KQZA 1H0IA 4Z2KA 2UZ5A 4DRPA 3ARZA 4DT4A 1KFWA 3UI4A 1W1YA 4LAXA 1LQ0A 4P8WA 2OFNA 1N1AA 1J4HA 2MNTA 2LGOA 3CGNA 1J4RA 3B7XA 4DWSA 3O5LA 2G8ZA 3OOBA 3KABA 1ZB5A 2A3BA 3WD2A 1P5QA 4KR0B 3KZ7A 4DWSB 2PI6A 2WK2A 3WD1A 3RGCA 3WQVA 1OWQA 5HW7A 2DPEA 3TC5A 4ODNA 4HBEA 2DSWA 1R9HA 2Q5AA 4MNLA 1H0GA 2A3AA 3O5PA 1FKRA 5B8IC 4ZPVR 1W26A 1U79A 4ZPTR 4S3JA 3PA7A 1J6YA 1NWSA 4IPXA 2O9OA 4QT3A 4WK9A 3UQIA 4ODKA 4MGVA 4ODMA 3RM9A 4MNJA 2L2SA 3FAPA 3TCZA 1LL6A 1OGGA 3O5OA 1FFQA 4IT4A 4WIWA 3RMEA 2DSVA 1QZ2A 1X6NA 1QPFA 5HWBA 4DRJA 3IHZA 2A3CA 3MDYB 1YW5A 4ZPWR 2AOSA 2LKNA 1FKBA 3WQWA 2LPVA 3KAHA 1FKGA 3ALGA 1D7JA 3WKZA 3KCEA 1NH6A 4Z2JA 5DITA 1NWRA 2XP5A 1FKHA 2XP8A 5HWCA 5GPRA 3ARSA 1W9PA 1D7HA 4BF8A 5J6EA 2IF4A 4HARA 3O5IA 3B8SA 2DT3A 1TFVA 2KE0A 4FN2A 5HBFA 1JNSA 2XP3A 4LGXA 3TDBA 1W9UA 2F21A 4R0XA 1HKMA 1UR8A 4IQ2A 4URIA 4QZVB 2A3EA 5I98A 4P8VA 1JNDA 1FAPA 3KACA 4MTVA 3O5JA 1HJWA 2O92A 4DRQA 3IKDA 3O5GA 3FXYA 4LAYA 3WL1A 3RM4A 1KT0A 5GPGA 1FD9A 4Q7NA 5HT1A 4XAKA 4R5EA 4TW8A 1LL4A 1J4IA 1LG2A 1ZL1A 4ODLA 2D9FA 4DROA 2XP6A 4G2PA 4P8UA 4GGQA 5JH8A 3CH9A 3ARUA 4W9QA 2M2AA 1BKFA 4Z2GA 1XRVA 2KGJA 1EDQA 1D6OA 3PR9A 2XP4A 5DF0A 4DRNA 1ZBWA 1X6LA 5HW6A 1PINA 3NI6A 4U84A 2KR7A 2PV2A 4ODOA 4ODQA 3KAGA 3H9RB 4P8XA 1EQ3A 3CGMA 1Q6IA 2M1IA 1QPLA 3UI5A 2ZR4A 3ARWA 4MNMA 2MLZA 3I6CA 2MPHA 2RUCA 3PRAA 3ARVA 1E9LA 2DSUA 4MPKA 3B9DA 4IQCA 3NTPA 5BXJA 2MLXA 3UI6A 3WL0A 2PV1A 3AS0A 2DT1A 1F40A 3ARQA 2RUDA 4J4NA 2XPAA 1NMWA 3BXWA 3W4RA 3UQAA 2RUQA 2KI3A 5HUAA 3IK8A 1LG1A 2FKEA 4ODPA 2WLZA 3ARXA 1WAWA 4HBOA 1HJVA 1A7XA 4W5UA 2KO7A 4L3NA 3PRDA 1NMVA 4NNRA 1TCOC 4L72B 1YATA 3B9AA 1W1PA 3UF8A 4MSPA 2MF9A 2Y78A 5DIUA 3AQUA 3CHCA 4PTMA 4WKHA 5HKGA 1FFRA 2ZR6A 1BL4A 2DG3A 3QOKA 3O5RA 4U86A 4Z2HA 3ARPA 3O5EA 2KFWA 2FAPA 2M08A 4NZCA 1HXVA 1FKFA 1ITXA 2DG9A 1ZCNA 1ZBCA 1E6ZA 2IUZA 2OLHA 4WJXA 2ZQTA 1O6IA 1FKIA 1W1TA 5DIVA 2PPPA 1EYMA 2DT2A 5DEZA 1E6PA 1W9VA 4DH0A 4DWSC 2JZVA 3G6MA 4JFMA 3ODKA 1FKJA 4NSBA 2ZQVA 3GPKA 4DRKA 2ESCA 4DZ3A 1FKTA 1C9HA 3CHDA 1ZBKA 4DRMA 3LUOA 4TX0A 4Z2IA 2MLYA 5GQBA 3O5DA 4TW6A 1FKSA 2N87A 4ZS6A 4N19A 1FJDA 4Z2LA 1GOIA 4WKAA 1ROTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2S A;  2PPO A;  3O5M A;  3RFW A;  1ZK6 A;  1KT1 A;  3CGM A;  3FAP A;  1FKK A;  3O5O A;  3JYM A;  3KAI A;  4O2T A;  3TCZ A;  3NRK A;  1Q6I A;  2M1I A;  1JVW A;  1QPL A;  1ROU A;  2ZR4 A;  3UI5 A;  1FKD A;  1QZ2 A;  2ZQS A;  2MLZ A;  3I6C A;  5HWB A;  1QPF A;  2MPH A;  2RUC A;  4DRJ A;  3IHZ A;  3JYJ A;  4GIV A;  3MDY B;  1YW5 A;  5HTG A;  3UQB A;  2ITK A;  2LKN A;  1FKB A;  2LPV A;  4FAP A;  4IQC A;  3KAH A;  3NTP A;  4ODM A;  4W9O A;  1FKG A;  4LAW A;  1D7J A;  1D7I A;  3O5Q A;  4JFK A;  5BXJ A;  2MLX A;  3KCE A;  3UI6 A;  2PV1 A;  1F40 A;  4TW7 A;  2RUD A;  4J4N A;  4DRH A;  5DIT A;  2XP5 A;  2XPA A;  1FKH A;  1NMW A;  2XP8 A;  4ITZ A;  4W9P A;  5HWC A;  1JNT A;  3KAF A;  4C02 B;  4DRI A;  4TNS A;  3UQA A;  5J6E A;  1D7H A;  4BF8 A;  2RUQ A;  2KI3 A;  3JXV A;  2AWG A;  1Q6U A;  2IF4 A;  3IK8 A;  4ODQ A;  2FKE A;  3O5I A;  5D75 A;  4QIB A;  5HUA A;  4ODP A;  4QT2 A;  2RUR A;  2XP9 A;  4ODK A;  3IKG A;  1PBK A;  4ODR A;  2KE0 A;  4U85 A;  1T11 A;  4FN2 A;  4DZ2 A;  2RSE A;  1JNS A;  2ZQU A;  1A7X A;  2XP3 A;  2F4E A;  2KO7 A;  3TDB A;  2UZ5 A;  3PRB A;  3PRD A;  4DRP A;  1NMV A;  1B6C A;  2F21 A;  3O5K A;  4R0X A;  4NNR A;  1TCO C;  4DT4 A;  1YAT A;  4IQ2 A;  3WH0 A;  5I98 A;  3UF8 A;  5HW8 A;  4MSP A;  1FAP A;  3KAC A;  2MF9 A;  2Y78 A;  5DIU A;  3UI4 A;  4LAX A;  5HKG A;  2VN1 A;  2ZR6 A;  2OFN A;  1BL4 A;  1N1A A;  2DG3 A;  3O5J A;  1J4H A;  2MNT A;  2LGO A;  3CGN A;  3O5R A;  4U86 A;  4DRQ A;  1J4R A;  3IKD A;  2LJ4 A;  3O5G A;  2K8I A;  3B7X A;  3O5E A;  4G50 A;  4LAY A;  2KFW A;  2FAP A;  3O5L A;  2M08 A;  1HXV A;  1FKF A;  1F8A B;  1M5Y A;  1EQ3 A;  2DG9 A;  1ZCN A;  1KT0 A;  3OOB A;  5GPG A;  1FD9 A;  1NSG A;  3KAB A;  4JFI A;  2XPB A;  3EY6 A;  5HT1 A;  1P5Q A;  2ZQT A;  3KZ7 A;  1FKI A;  2XP7 A;  4TW8 A;  5DIV A;  2DG4 A;  2PPP A;  1J4I A;  4LAV A;  1EYM A;  4JFJ A;  4ODL A;  4JYS A;  2D9F A;  4DRO A;  2XP6 A;  2PV3 A;  3RGC A;  4DH0 A;  5HW7 A;  2JZV A;  4G2P A;  4GGQ A;  3TC5 A;  4ODN A;  2PBC A;  4TYO A;  4W9Q A;  1R9H A;  2M2A A;  4JFM A;  1BKF A;  3KAD A;  3ODK A;  1FKJ A;  2Q5A A;  2ZQV A;  2KGJ A;  3GPK A;  4DRK A;  1D6O A;  3VAW A;  1FKT A;  4DZ3 A;  3O5P A;  2XP4 A;  1FKR A;  5B8I C;  1C9H A;  1Q6H A;  1W26 A;  4DRN A;  4DRM A;  3LUO A;  4TX0 A;  1U79 A;  2MLY A;  3PA7 A;  3O5D A;  1J6Y A;  1Q1C A;  1FKL A;  4J4O A;  4TW6 A;  5HW6 A;  2F2D A;  1PIN A;  1Y0O A;  4IPX A;  1FKS A;  3NI6 A;  4U84 A;  2N87 A;  2PPN A;  4N19 A;  3KAG A;  4QT3 A;  1FJD A;  3UQI A;  3O5F A;  1ROT A;  4DIP A;  4JFL A;  2KR7 A;  2PV2 A;  2RQS A;  2ZR5 A;  4ODO A;  2VCD A;  4MGV A;  3H9R B;  1L1P A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  2PPO A;  3O5M A;  3ARO A;  1KT1 A;  1FKK A;  3JYM A;  1SR0 A;  1JVW A;  1ROU A;  1FKD A;  2ZQS A;  3B9E A;  1ZBV A;  1XHG A;  2PN0 A;  3GTY X;  4MNK A;  4GIV A;  3JYJ A;  5HTG A;  3UQB A;  2ITK A;  3WD4 A;  4W9O A;  4LAW A;  5DO2 A;  3CHE A;  1ZU8 A;  1D7I A;  2B31 A;  4TW7 A;  3FY1 A;  1JCH B;  1W1V A;  1JNT A;  4DRI A;  4IT6 A;  2AWG A;  1Q6U A;  4QT2 A;  1OGB A;  2RUR A;  3ALF A;  3IKG A;  3ART A;  1PBK A;  4U85 A;  3G6L A;  1T11 A;  4DZ2 A;  2WM0 A;  1E6R A;  2F4E A;  1LJY A;  2G41 A;  3WIJ A;  1EHN A;  3PRB A;  1B6C A;  3O5K A;  1GPF A;  3WH0 A;  3ARR A;  5HW8 A;  4DWS D;  3EIP A;  3RM8 A;  3WD0 A;  2VN1 A;  2LJ4 A;  2K8I A;  4G50 A;  4S3K A;  1F8A B;  1M5Y A;  1VF8 A;  1NSG A;  4JFI A;  2XPB A;  3EY6 A;  1WNO A;  2FDM A;  2XP7 A;  3AS1 A;  2DG4 A;  1K9T A;  4LAV A;  4JFJ A;  3ARY A;  4JYS A;  2PV3 A;  4WKF A;  1D2K A;  2YBT A;  1RD6 A;  4Q22 A;  2PBC A;  4TYO A;  1HJX A;  1SYT A;  3KAD A;  1E6N A;  3WD3 A;  1NWU A;  3VAW A;  3CHF A;  1Q6H A;  1LL7 A;  1Q1C A;  1FKL A;  4J4O A;  2F2D A;  1Y0O A;  1HKI A;  4ML4 A;  1GUV A;  2PPN A;  1HKK A;  3O5F A;  3CZ8 A;  4DIP A;  4JFL A;  2RQS A;  2ZR5 A;  2VCD A;  3BMB A;  1L1P A;  1EIB A;  3RFW A;  1ZK6 A;  4O2T A;  1CTN A;  1WB0 A;  3KAI A;  3NRK A;  1E15 A;  2WLY A;  3OA5 A;  1UR9 A;  2B5U B;  3AS2 A;  2YBU A;  2DT0 A;  1NWT A;  4FAP A;  2DSZ A;  3O5Q A;  2QF8 A;  4JFK A;  4MAV A;  4DRH A;  4ITZ A;  4W9P A;  3KAF A;  4C02 B;  2F23 A;  4TNS A;  3JXV A;  5D75 A;  3AS3 A;  4QIB A;  2XP9 A;  4AY1 A;  4ODR A;  1JNE A;  1HKJ A;  2RSE A;  2ZQU A;  4KQZ A;  1H0I A;  4Z2K A;  2UZ5 A;  4DRP A;  3ARZ A;  4DT4 A;  1KFW A;  3UI4 A;  1W1Y A;  4LAX A;  1LQ0 A;  4P8W A;  2OFN A;  1N1A A;  2P4V A;  1J4H A;  2MNT A;  1GRJ A;  2LGO A;  3CGN A;  1J4R A;  3B7X A;  4DWS A;  3O5L A;  2G8Z A;  3OOB A;  3KAB A;  1ZB5 A;  2A3B A;  3WD2 A;  1P5Q A;  4KR0 B;  3KZ7 A;  4DWS B;  2PI6 A;  2WK2 A;  3WD1 A;  3RGC A;  3WQV A;  1OWQ A;  5HW7 A;  2DPE A;  3TC5 A;  4ODN A;  4HBE A;  2DSW A;  1R9H A;  2Q5A A;  4MNL A;  1H0G A;  2A3A A;  3O5P A;  1FKR A;  5B8I C;  4ZPV R;  1W26 A;  1U79 A;  4ZPT R;  4S3J A;  3PA7 A;  1J6Y A;  1NWS A;  4IPX A;  2O9O A;  4QT3 A;  4WK9 A;  3UQI A;  4ODK A;  4MGV A;  4ODM A;  3RM9 A;  4MNJ A;  2L2S A;  3FAP A;  3TCZ A;  1LL6 A;  1OGG A;  3O5O A;  1FFQ A;  1E44 A;  4IT4 A;  4WIW A;  3RME A;  2DSV A;  1QZ2 A;  1X6N A;  1QPF A;  5HWB A;  4DRJ A;  3IHZ A;  2A3C A;  3MDY B;  1YW5 A;  4ZPW R;  2AOS A;  2LKN A;  1FKB A;  3WQW A;  2LPV A;  3KAH A;  1FKG A;  3ALG A;  1D7J A;  3WKZ A;  3KCE A;  1NH6 A;  4Z2J A;  5DIT A;  1NWR A;  2XP5 A;  1FKH A;  2XP8 A;  5HWC A;  5GPR A;  3ARS A;  1W9P A;  1D7H A;  4BF8 A;  5J6E A;  2IF4 A;  4HAR A;  3O5I A;  3B8S A;  2DT3 A;  1TFV A;  2KE0 A;  4FN2 A;  5HBF A;  1JNS A;  2XP3 A;  4LGX A;  3TDB A;  1W9U A;  2F21 A;  4R0X A;  1HKM A;  1UR8 A;  4IQ2 A;  4URI A;  4QZV B;  2A3E A;  5I98 A;  4P8V A;  1JND A;  1FAP A;  3KAC A;  4MTV A;  3O5J A;  1HJW A;  2O92 A;  4DRQ A;  3IKD A;  3O5G A;  3FXY A;  4LAY A;  3WL1 A;  3RM4 A;  1KT0 A;  5GPG A;  1FD9 A;  4Q7N A;  5HT1 A;  4XAK A;  4R5E A;  4TW8 A;  1LL4 A;  1J4I A;  1LG2 A;  1ZL1 A;  4ODL A;  2D9F A;  4DRO A;  2XP6 A;  4G2P A;  4P8U A;  4GGQ A;  5JH8 A;  3CH9 A;  3ARU A;  4W9Q A;  2M2A A;  1BKF A;  4Z2G A;  1XRV A;  2KGJ A;  1EDQ A;  1D6O A;  3PR9 A;  2XP4 A;  5DF0 A;  4DRN A;  1ZBW A;  1X6L A;  5HW6 A;  1PIN A;  3NI6 A;  4U84 A;  2KR7 A;  2PV2 A;  4ODO A;  4ODQ A;  3KAG A;  3H9R B;  4P8X A;  1EQ3 A;  3CGM A;  1Q6I A;  2M1I A;  1QPL A;  3UI5 A;  2ZR4 A;  3ARW A;  4MNM A;  2MLZ A;  3I6C A;  2MPH A;  2RUC A;  3PRA A;  3ARV A;  1E9L A;  2DSU A;  4MPK A;  3B9D A;  4IQC A;  3NTP A;  5BXJ A;  2MLX A;  3UI6 A;  3WL0 A;  2PV1 A;  3AS0 A;  2DT1 A;  1F40 A;  3ARQ A;  2RUD A;  4J4N A;  2XPA A;  1NMW A;  3BXW A;  3W4R A;  3UQA A;  2RUQ A;  2KI3 A;  5HUA A;  3IK8 A;  1LG1 A;  2FKE A;  4ODP A;  4UDM A;  2WLZ A;  3ARX A;  1WAW A;  4HBO A;  1HJV A;  1A7X A;  4W5U A;  2KO7 A;  4L3N A;  3PRD A;  1NMV A;  4NNR A;  1TCO C;  4L72 B;  1YAT A;  3B9A A;  1W1P A;  3UF8 A;  4MSP A;  2MF9 A;  2Y78 A;  5DIU A;  3AQU A;  3CHC A;  4PTM A;  4WKH A;  5HKG A;  1FFR A;  2ZR6 A;  1BL4 A;  2DG3 A;  3QOK A;  3O5R A;  2ETN A;  4U86 A;  4Z2H A;  3ARP A;  3O5E A;  2KFW A;  2FAP A;  2M08 A;  4NZC A;  1HXV A;  1FKF A;  1ITX A;  2DG9 A;  1ZCN A;  1ZBC A;  1E6Z A;  2IUZ A;  2OLH A;  4WJX A;  2ZQT A;  1O6I A;  1FKI A;  1W1T A;  5DIV A;  2PPP A;  1EYM A;  2DT2 A;  5DEZ A;  1E6P A;  1W9V A;  4DH0 A;  4DWS C;  2JZV A;  3G6M A;  4JFM A;  3ODK A;  1FKJ A;  4NSB A;  2ZQV A;  3GPK A;  4DRK A;  2ESC A;  4DZ3 A;  1FKT A;  1C9H A;  3CHD A;  1ZBK A;  4DRM A;  3LUO A;  4TX0 A;  4Z2I A;  2MLY A;  5GQB A;  3O5D A;  4TW6 A;  1FKS A;  3GU0 A;  2EUL A;  2N87 A;  4ZS6 A;  4N19 A;  1FJD A;  4Z2L A;  1GOI A;  4WKA A;  1ROT A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  2PPO A;  3O5M A;  3ARO A;  1KT1 A;  1FKK A;  3JYM A;  1SR0 A;  1JVW A;  1ROU A;  1FKD A;  2ZQS A;  3B9E A;  1ZBV A;  1XHG A;  4MNK A;  4GIV A;  3JYJ A;  5HTG A;  3UQB A;  2ITK A;  3WD4 A;  4W9O A;  4LAW A;  5DO2 A;  3CHE A;  1ZU8 A;  1D7I A;  2B31 A;  4TW7 A;  3FY1 A;  1W1V A;  1JNT A;  4DRI A;  4IT6 A;  2AWG A;  1Q6U A;  4QT2 A;  1OGB A;  2RUR A;  3ALF A;  3IKG A;  3ART A;  1PBK A;  4U85 A;  3G6L A;  1T11 A;  4DZ2 A;  2WM0 A;  1E6R A;  2F4E A;  1LJY A;  2G41 A;  3WIJ A;  1EHN A;  3PRB A;  1B6C A;  3O5K A;  1GPF A;  3WH0 A;  3ARR A;  5HW8 A;  4DWS D;  3RM8 A;  3WD0 A;  2VN1 A;  2LJ4 A;  2K8I A;  4G50 A;  4S3K A;  1F8A B;  1M5Y A;  1VF8 A;  1NSG A;  4JFI A;  2XPB A;  3EY6 A;  1WNO A;  2FDM A;  2XP7 A;  3AS1 A;  2DG4 A;  1K9T A;  4LAV A;  4JFJ A;  3ARY A;  4JYS A;  2PV3 A;  4WKF A;  1D2K A;  2YBT A;  1RD6 A;  4Q22 A;  2PBC A;  4TYO A;  1HJX A;  1SYT A;  3KAD A;  1E6N A;  3WD3 A;  1NWU A;  3VAW A;  3CHF A;  1Q6H A;  1LL7 A;  1Q1C A;  1FKL A;  4J4O A;  2F2D A;  1Y0O A;  1HKI A;  4ML4 A;  1GUV A;  2PPN A;  1HKK A;  3O5F A;  3CZ8 A;  4DIP A;  4JFL A;  2RQS A;  2ZR5 A;  2VCD A;  1L1P A;  1EIB A;  3RFW A;  1ZK6 A;  4O2T A;  1CTN A;  1WB0 A;  3KAI A;  3NRK A;  1E15 A;  2WLY A;  3OA5 A;  1UR9 A;  3AS2 A;  2YBU A;  2DT0 A;  1NWT A;  4FAP A;  2DSZ A;  3O5Q A;  2QF8 A;  4JFK A;  4MAV A;  4DRH A;  4ITZ A;  4W9P A;  3KAF A;  4C02 B;  4TNS A;  3JXV A;  5D75 A;  3AS3 A;  4QIB A;  2XP9 A;  4AY1 A;  4ODR A;  1JNE A;  1HKJ A;  2RSE A;  2ZQU A;  4KQZ A;  1H0I A;  4Z2K A;  2UZ5 A;  4DRP A;  3ARZ A;  4DT4 A;  1KFW A;  3UI4 A;  1W1Y A;  4LAX A;  1LQ0 A;  4P8W A;  2OFN A;  1N1A A;  1J4H A;  2MNT A;  2LGO A;  3CGN A;  1J4R A;  3B7X A;  4DWS A;  3O5L A;  2G8Z A;  3OOB A;  3KAB A;  1ZB5 A;  2A3B A;  3WD2 A;  1P5Q A;  4KR0 B;  3KZ7 A;  4DWS B;  2PI6 A;  2WK2 A;  3WD1 A;  3RGC A;  3WQV A;  1OWQ A;  5HW7 A;  2DPE A;  3TC5 A;  4ODN A;  4HBE A;  2DSW A;  1R9H A;  2Q5A A;  4MNL A;  1H0G A;  2A3A A;  3O5P A;  1FKR A;  5B8I C;  4ZPV R;  1W26 A;  1U79 A;  4ZPT R;  4S3J A;  3PA7 A;  1J6Y A;  1NWS A;  4IPX A;  2O9O A;  4QT3 A;  4WK9 A;  3UQI A;  4ODK A;  4MGV A;  4ODM A;  3RM9 A;  4MNJ A;  2L2S A;  3FAP A;  3TCZ A;  1LL6 A;  1OGG A;  3O5O A;  1FFQ A;  4IT4 A;  4WIW A;  3RME A;  2DSV A;  1QZ2 A;  1X6N A;  1QPF A;  5HWB A;  4DRJ A;  3IHZ A;  2A3C A;  3MDY B;  1YW5 A;  4ZPW R;  2AOS A;  2LKN A;  1FKB A;  3WQW A;  2LPV A;  3KAH A;  1FKG A;  3ALG A;  1D7J A;  3WKZ A;  3KCE A;  1NH6 A;  4Z2J A;  5DIT A;  1NWR A;  2XP5 A;  1FKH A;  2XP8 A;  5HWC A;  5GPR A;  3ARS A;  1W9P A;  1D7H A;  4BF8 A;  5J6E A;  2IF4 A;  4HAR A;  3O5I A;  3B8S A;  2DT3 A;  1TFV A;  2KE0 A;  4FN2 A;  5HBF A;  1JNS A;  2XP3 A;  4LGX A;  3TDB A;  1W9U A;  2F21 A;  4R0X A;  1HKM A;  1UR8 A;  4IQ2 A;  4URI A;  4QZV B;  2A3E A;  5I98 A;  4P8V A;  1JND A;  1FAP A;  3KAC A;  4MTV A;  3O5J A;  1HJW A;  2O92 A;  4DRQ A;  3IKD A;  3O5G A;  3FXY A;  4LAY A;  3WL1 A;  3RM4 A;  1KT0 A;  5GPG A;  1FD9 A;  4Q7N A;  5HT1 A;  4XAK A;  4R5E A;  4TW8 A;  1LL4 A;  1J4I A;  1LG2 A;  1ZL1 A;  4ODL A;  2D9F A;  4DRO A;  2XP6 A;  4G2P A;  4P8U A;  4GGQ A;  5JH8 A;  3CH9 A;  3ARU A;  4W9Q A;  2M2A A;  1BKF A;  4Z2G A;  1XRV A;  2KGJ A;  1EDQ A;  1D6O A;  3PR9 A;  2XP4 A;  5DF0 A;  4DRN A;  1ZBW A;  1X6L A;  5HW6 A;  1PIN A;  3NI6 A;  4U84 A;  2KR7 A;  2PV2 A;  4ODO A;  4ODQ A;  3KAG A;  3H9R B;  4P8X A;  1EQ3 A;  3CGM A;  1Q6I A;  2M1I A;  1QPL A;  3UI5 A;  2ZR4 A;  3ARW A;  4MNM A;  2MLZ A;  3I6C A;  2MPH A;  2RUC A;  3PRA A;  3ARV A;  1E9L A;  2DSU A;  4MPK A;  3B9D A;  4IQC A;  3NTP A;  5BXJ A;  2MLX A;  3UI6 A;  3WL0 A;  2PV1 A;  3AS0 A;  2DT1 A;  1F40 A;  3ARQ A;  2RUD A;  4J4N A;  2XPA A;  1NMW A;  3BXW A;  3W4R A;  3UQA A;  2RUQ A;  2KI3 A;  5HUA A;  3IK8 A;  1LG1 A;  2FKE A;  4ODP A;  2WLZ A;  3ARX A;  1WAW A;  4HBO A;  1HJV A;  1A7X A;  4W5U A;  2KO7 A;  4L3N A;  3PRD A;  1NMV A;  4NNR A;  1TCO C;  4L72 B;  1YAT A;  3B9A A;  1W1P A;  3UF8 A;  4MSP A;  2MF9 A;  2Y78 A;  5DIU A;  3AQU A;  3CHC A;  4PTM A;  4WKH A;  5HKG A;  1FFR A;  2ZR6 A;  1BL4 A;  2DG3 A;  3QOK A;  3O5R A;  4U86 A;  4Z2H A;  3ARP A;  3O5E A;  2KFW A;  2FAP A;  2M08 A;  4NZC A;  1HXV A;  1FKF A;  1ITX A;  2DG9 A;  1ZCN A;  1ZBC A;  1E6Z A;  2IUZ A;  2OLH A;  4WJX A;  2ZQT A;  1O6I A;  1FKI A;  1W1T A;  5DIV A;  2PPP A;  1EYM A;  2DT2 A;  5DEZ A;  1E6P A;  1W9V A;  4DH0 A;  4DWS C;  2JZV A;  3G6M A;  4JFM A;  3ODK A;  1FKJ A;  4NSB A;  2ZQV A;  3GPK A;  4DRK A;  2ESC A;  4DZ3 A;  1FKT A;  1C9H A;  3CHD A;  1ZBK A;  4DRM A;  3LUO A;  4TX0 A;  4Z2I A;  2MLY A;  5GQB A;  3O5D A;  4TW6 A;  1FKS A;  2N87 A;  4ZS6 A;  4N19 A;  1FJD A;  4Z2L A;  1GOI A;  4WKA A;  1ROT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...