2PV1A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide weyipnv
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
b'TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
molecule keywords Chaperone surA
source organism Escherichia coli
molecule tags Isomerase
total genus 28
structure length 103
sequence length 103
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv1A00
2M08A 3MDYB 1BKFA 1FKTA 3O5LA 1D7IA 2PV2A 4LAYA 1J4HA 4QT3A 1KT1A 4C02B 2IF4A 1FKJA 5DITA 2XP3A 3I6CA 4GIVA 4ITZA 3O5RA 1N1AA 1EQ3A 4MGVA 2K8IA 4LAWA 1FJDA 2ZQVA 2PBCA 1KT0A 3H9RB 3KAIA 3UI4A 3B7XA 2DG9A 2D9FA 5HW7A 2MPHA 1YW5A 1FD9A 1FKBA 1J4RA 3KADA 2MLYA 3NTPA 3O5EA 4LAXA 5HW8A 4ODKA 2XPBA 1A7XA 4DRHA 2KGJA 1QPLA 4DRJA 4TYOA 4O2TA 1J6YA 2KFWA 5I98A 3EY6A 4FAPA 3NRKA 2LPVA 4DRKA 4DROA 1ROTA 1YATA 5B8IC 5HWCA 2RUQA 4TW6A 1M5YA 1R9HA 2ZQSA 2XP5A 1TCOC 3CGMA 2KR7A 2XP4A 2VN1A 4ODOA 2ZR6A 4JFIA 4BF8A 4J4OA 5HKGA 2UZ5A 4MSPA 3KACA 3KAFA 3O5QA 1FKKA 2PPNA 3KCEA 5HTGA 1PINA 2RQSA 2KO7A 3KAGA 3PA7A 3RGCA 1FKIA 4IQ2A 3JYMA 4IPXA 1NMVA 1ROUA 2RURA 1FKDA 3GPKA 3IHZA 4J4NA 4LAVA 1ZCNA 2MNTA 2PPPA 2XP9A 3O5GA 2MLXA 2ZR4A 2F4EA 2JZVA 2Q5AA 4W9OA 4U84A 3UQIA 2LKNA 3IKGA 1BL4A 3OOBA 4DRNA 2XPAA 1T11A 2XP6A 1QPFA 1JNTA 3NI6A 5D75A 4DRMA 3O5PA 4DRQA 5HUAA 3UQAA 1W26A 4DRPA 2AWGA 4G50A 1L1PA 3O5IA 1NSGA 3UI5A 1HXVA 4ODMA 3TCZA 1EYMA 4ODPA 5HW6A 5GPGA 3PRDA 4ODNA 3UF8A 2DG3A 2N87A 3JXVA 4ODQA 4TW8A 1D6OA 2F21A 2FAPA 2MLZA 2OFNA 2XP7A 1NMWA 2ZR5A 3IKDA 5DIVA 3KABA 1Q6HA 2KI3A 4JFJA 3O5FA 4TW7A 4U85A 4TNSA 1Q1CA 2PV1A 2XP8A 4ODRA 4DZ2A 3UQBA 1F8AB 2Y78A 4U86A 5J6EA 3O5OA 1FKHA 1QZ2A 2PPOA 1JVWA 3O5JA 5BXJA 2ITKA 2LJ4A 4IQCA 1FKFA 4R0XA 4JFMA 2PV3A 1FKGA 4DIPA 4G2PA 2ZQUA 3TDBA 1D7HA 3PRBA 4W9QA 4NNRA 4JFLA 4DH0A 1FAPA 3WH0A 1B6CA 1Q6UA 3VAWA 4DRIA 3LUOA 4QT2A 3JYJA 4FN2A 2M2AA 3KAHA 3O5MA 4DT4A 3RFWA 5HWBA 2RUCA 2M1IA 3O5DA 4JFKA 4DZ3A 2L2SA 1J4IA 1D7JA 2RUDA 4GGQA 1FKRA 1ZK6A 1FKSA 2DG4A 1PBKA 3ODKA 4ODLA 3IK8A 4W9PA 3FAPA 3TC5A 2ZQTA 4TX0A 1F40A 1U79A 2FKEA 1C9HA 2MF9A 5DIUA 1JNSA 5HT1A 2F2DA 4JYSA 1P5QA 1Y0OA 2KE0A 3O5KA 1Q6IA 2RSEA 2LGOA 2VCDA 1FKLA 4N19A 3CGNA 3KZ7A 3UI6A 4QIBA
chains in the Genus database with same CATH superfamily
4W9PA 2EULA 1J4HA 4MPKA 1KT1A 3I6CA 4GIVA 1NWSA 3UI4A 3B7XA 2DG9A 2D9FA 1YW5A 3NTPA 4MAVA 4W5UA 2XPBA 2KGJA 4DWSA 1QPLA 4Z2JA 1LJYA 3GU0A 1J6YA 5I98A 3EY6A 4DROA 2PN0A 2RUQA 1M5YA 2XP5A 3CGMA 2XP4A 1W9PA 2ZR6A 4BF8A 4DWSB 5HKGA 2PI6A 2UZ5A 3KACA 3WIJA 1OGBA 2DPEA 1WB0A 1RD6A 1KFWA 4MNLA 4IPXA 2B5UB 3GPKA 1FKDA 3IHZA 4J4NA 1ZCNA 1TFVA 2MNTA 1HJWA 1WNOA 2JZVA 4U84A 3UQIA 2A3CA 4DRNA 1ZL1A 3ARUA 2XPAA 2XP6A 4DRQA 2QF8A 3UQAA 3RMEA 2AWGA 3O5IA 1E6NA 1NSGA 2IUZA 3ARZA 4ODMA 1EYMA 5GPGA 4DWSD 4ODNA 4MNJA 1NWTA 2G41A 4TW8A 2F21A 5DIVA 3KABA 4U85A 4TNSA 1W1TA 2XP8A 1LG1A 1F8AB 3O5OA 5BXJA 2ESCA 2WM0A 4IQCA 4ZPWR 1FKFA 3WD4A 4R0XA 3PRAA 4P8XA 3B9DA 2ZQUA 3PRBA 4JFLA 4DH0A 1WAWA 4QT2A 4L3NA 3KAHA 3O5MA 3WD3A 3RFWA 2M1IA 4DZ3A 2L2SA 1J4IA 1D7JA 3ARQA 4NSBA 3AS2A 1NH6A 1PBKA 4ODLA 1JNEA 3TC5A 2MF9A 4Z2LA 3WD2A 2F2DA 1HKMA 1H0GA 3WD1A 2DT3A 1FKLA 4N19A 4WIWA 3CGNA 3QOKA 4C02B 2IF4A 1FKJA 5DITA 2XP3A 1EQ3A 1ZU8A 3WL0A 1JNDA 2K8IA 1FJDA 2ZQVA 1KT0A 3B8SA 2MPHA 1H0IA 3KADA 4MTVA 4DRHA 3RM9A 4TYOA 3ARPA 5GQBA 2AOSA 2LPVA 5HWCA 3ARYA 1TCOC 3WKZA 1X6LA 2VN1A 3G6MA 3WD0A 3B9EA 1UR9A 4MSPA 1XHGA 2KO7A 1NWRA 3EIPA 3G6LA 3KAGA 4Z2IA 1NMVA 4LAVA 2XP9A 2MLXA 2ZR4A 2LKNA 5HBFA 3NI6A 5D75A 3ARRA 4DRMA 3O5PA 4KQZA 1W26A 1FFRA 3W4RA 4G50A 1ZBWA 3UI5A 4ODPA 3JXVA 3FY1A 2FAPA 2XP7A 1NMWA 1X6NA 1Q6HA 2KI3A 2DSVA 1Q1CA 2PV1A 3B9AA 4MNMA 4WKAA 5J6EA 1E9LA 1FKHA 1QZ2A 1JVWA 2A3EA 2ITKA 2LJ4A 2PV3A 1FFQA 3ARXA 4W9QA 4NNRA 4ML4A 1FAPA 3WH0A 1B6CA 1Q6UA 1GRJA 3JYJA 1E6ZA 1OWQA 3AS3A 1GUVA 1FKSA 3ODKA 3IK8A 2ZQTA 4TX0A 1U79A 3AQUA 1VF8A 5DIUA 3ARWA 2DSZA 4JYSA 1K9TA 2KE0A 3O5KA 2YBTA 1Q6IA 2LGOA 1W9VA 3KZ7A 3UI6A 2M08A 3O5LA 1BKFA 4LAYA 1D7IA 2PV2A 4QT3A 4MNKA 3WL1A 4ITZA 3O5RA 1N1AA 4MGVA 1ITXA 4LAWA 2P4VA 3H9RB 2A3BA 4LAXA 1GPFA 4ODKA 1A7XA 4DRJA 4WKHA 1LG2A 4FAPA 5GPRA 3ARTA 5B8IC 1YATA 1W9UA 4P8UA 1R9HA 2ZQSA 2DT0A 1ZBKA 4HBOA 4JFIA 1W1VA 2WK2A 1E15A 4WK9A 3KAFA 3O5QA 2PPNA 5HTGA 1PINA 3OA5A 4URIA 3PA7A 3RGCA 4IQ2A 3JYMA 4S3KA 4ZPVR 1ZBVA 2RURA 3O5GA 3CH9A 4LGXA 1BL4A 1QPFA 4QZVB 4UDMA 1EDQA 1GOIA 3BMBA 5DF0A 3TCZA 2A3AA 5HW6A 2DT1A 3PRDA 3UF8A 2N87A 1D6OA 2OFNA 2MLZA 2ZR5A 1CTNA 2DSUA 2F23A 4Q22A 1LL4A 4DZ2A 2Y78A 3O5JA 4P8VA 2DT2A 3ALFA 3VAWA 3LUOA 5DEZA 2M2AA 4DT4A 5HWBA 2B31A 3CHDA 2WLZA 1HJVA 3RM4A 1FKRA 1E6PA 2OLHA 1ZK6A 3CHFA 1E44A 5DO2A 3GTYX 3FAPA 4Z2KA 1W1YA 5HT1A 1D2KA 1P5QA 1Y0OA 1E6RA 3RM8A 2VCDA 3WQWA 4AY1A 1LQ0A 4QIBA 3MDYB 1FKTA 4R5EA 3ARSA 1UR8A 4XAKA 1ZB5A 2PBCA 3PR9A 3KAIA 5HW7A 3ARVA 1FD9A 1FKBA 1J4RA 5HW8A 2MLYA 3CHCA 3O5EA 4O2TA 3ALGA 1W1PA 2KFWA 1LL6A 4IT6A 3AS0A 3NRKA 4DRKA 1ROTA 2FDMA 4TW6A 3FXYA 2KR7A 2O92A 4ODOA 1OGGA 1LL7A 4J4OA 1FKKA 3KCEA 2RQSA 1FKIA 5JH8A 1ZBCA 1ROUA 2PPPA 1JCHB 2G8ZA 2F4EA 2Q5AA 4W9OA 3IKGA 3WQVA 3OOBA 3CHEA 1T11A 1JNTA 5HUAA 3AS1A 4DRPA 1HKKA 1L1PA 1HXVA 1SYTA 3AROA 1IX5A 2DG3A 4ODQA 3IKDA 1HJXA 1HKJA 4PTMA 4JFJA 3O5FA 4TW7A 4HARA 4L72B 4ODRA 3UQBA 1HKIA 1O6IA 4U86A 2PPOA 1NWUA 4S3JA 2YBUA 4WKFA 4JFMA 1FKGA 1XRVA 4KR0B 4Z2GA 4DIPA 4G2PA 4DWSC 4WJXA 3TDBA 1D7HA 2WLYA 4Q7NA 4P8WA 4DRIA 2ETNA 3CZ8A 4FN2A 4Z2HA 2RUCA 3O5DA 4JFKA 2RUDA 4GGQA 4NZCA 2DG4A 4IT4A 1EHNA 1F40A 2FKEA 1C9HA 1JNSA 4ZS6A 1EIBA 1SR0A 2DSWA 3BXWA 4ZPTR 2O9OA 2RSEA 4HBEA
chains in the Genus database with same CATH topology
4W9PA 1J4HA 4MPKA 1KT1A 3I6CA 4GIVA 1NWSA 3UI4A 3B7XA 2DG9A 2D9FA 1YW5A 3NTPA 4MAVA 4W5UA 2XPBA 2KGJA 4DWSA 1QPLA 4Z2JA 1LJYA 1J6YA 5I98A 3EY6A 4DROA 2RUQA 1M5YA 2XP5A 3CGMA 2XP4A 1W9PA 2ZR6A 4BF8A 4DWSB 5HKGA 2PI6A 2UZ5A 3KACA 3WIJA 1OGBA 2DPEA 1WB0A 1RD6A 1KFWA 4MNLA 4IPXA 3GPKA 1FKDA 3IHZA 4J4NA 1ZCNA 1TFVA 2MNTA 1HJWA 1WNOA 2JZVA 4U84A 3UQIA 2A3CA 4DRNA 1ZL1A 3ARUA 2XPAA 2XP6A 4DRQA 2QF8A 3UQAA 3RMEA 2AWGA 3O5IA 1E6NA 1NSGA 2IUZA 3ARZA 4ODMA 1EYMA 5GPGA 4DWSD 4ODNA 4MNJA 1NWTA 2G41A 4TW8A 2F21A 5DIVA 3KABA 4U85A 4TNSA 1W1TA 2XP8A 1LG1A 1F8AB 3O5OA 5BXJA 2ESCA 2WM0A 4IQCA 4ZPWR 1FKFA 3WD4A 4R0XA 3PRAA 4P8XA 3B9DA 2ZQUA 3PRBA 4JFLA 4DH0A 1WAWA 4QT2A 4L3NA 3KAHA 3O5MA 3WD3A 3RFWA 2M1IA 4DZ3A 2L2SA 1J4IA 1D7JA 3ARQA 4NSBA 3AS2A 1NH6A 1PBKA 4ODLA 1JNEA 3TC5A 2MF9A 4Z2LA 3WD2A 2F2DA 1HKMA 1H0GA 3WD1A 2DT3A 1FKLA 4N19A 4WIWA 3CGNA 3QOKA 4C02B 2IF4A 1FKJA 5DITA 2XP3A 1EQ3A 1ZU8A 3WL0A 1JNDA 2K8IA 1FJDA 2ZQVA 1KT0A 3B8SA 2MPHA 1H0IA 3KADA 4MTVA 4DRHA 3RM9A 4TYOA 3ARPA 5GQBA 2AOSA 2LPVA 5HWCA 3ARYA 1TCOC 3WKZA 1X6LA 2VN1A 3G6MA 3WD0A 3B9EA 1UR9A 4MSPA 1XHGA 2KO7A 1NWRA 3KAGA 3G6LA 4Z2IA 1NMVA 4LAVA 2XP9A 2MLXA 2ZR4A 2LKNA 5HBFA 3NI6A 5D75A 3ARRA 4DRMA 3O5PA 4KQZA 1W26A 1FFRA 3W4RA 4G50A 1ZBWA 3UI5A 4ODPA 3JXVA 3FY1A 2FAPA 2XP7A 1NMWA 1X6NA 1Q6HA 2KI3A 2DSVA 1Q1CA 2PV1A 3B9AA 4MNMA 4WKAA 5J6EA 1E9LA 1FKHA 1QZ2A 1JVWA 2A3EA 2ITKA 2LJ4A 2PV3A 1FFQA 3ARXA 4W9QA 4NNRA 4ML4A 1FAPA 3WH0A 1B6CA 1Q6UA 3JYJA 1E6ZA 1OWQA 3AS3A 1GUVA 1FKSA 3ODKA 3IK8A 2ZQTA 4TX0A 1U79A 3AQUA 1VF8A 5DIUA 3ARWA 2DSZA 4JYSA 1K9TA 2KE0A 3O5KA 2YBTA 1Q6IA 2LGOA 1W9VA 3KZ7A 3UI6A 2M08A 3O5LA 1BKFA 4LAYA 1D7IA 2PV2A 4QT3A 4MNKA 3WL1A 4ITZA 3O5RA 1N1AA 4MGVA 1ITXA 4LAWA 3H9RB 2A3BA 4LAXA 1GPFA 4ODKA 1A7XA 4DRJA 4WKHA 1LG2A 4FAPA 5GPRA 3ARTA 5B8IC 1YATA 1W9UA 4P8UA 1R9HA 2ZQSA 2DT0A 1ZBKA 4HBOA 4JFIA 1W1VA 2WK2A 1E15A 4WK9A 3KAFA 3O5QA 2PPNA 5HTGA 1PINA 3OA5A 4URIA 3PA7A 3RGCA 4IQ2A 3JYMA 4S3KA 4ZPVR 1ZBVA 2RURA 3O5GA 3CH9A 4LGXA 1BL4A 1QPFA 4QZVB 1EDQA 1GOIA 5DF0A 3TCZA 2A3AA 5HW6A 2DT1A 3PRDA 3UF8A 2N87A 1D6OA 2OFNA 2MLZA 2ZR5A 1CTNA 2DSUA 4Q22A 1LL4A 4DZ2A 2Y78A 3O5JA 4P8VA 2DT2A 3ALFA 3VAWA 3LUOA 5DEZA 2M2AA 4DT4A 5HWBA 2B31A 3CHDA 2WLZA 1HJVA 3RM4A 1FKRA 1E6PA 2OLHA 1ZK6A 3CHFA 5DO2A 3FAPA 4Z2KA 1W1YA 5HT1A 1D2KA 1P5QA 1Y0OA 1E6RA 3RM8A 2VCDA 3WQWA 4AY1A 1LQ0A 4QIBA 3MDYB 1FKTA 4R5EA 3ARSA 1UR8A 4XAKA 1ZB5A 2PBCA 3PR9A 3KAIA 5HW7A 3ARVA 1FD9A 1FKBA 1J4RA 5HW8A 2MLYA 3CHCA 3O5EA 4O2TA 3ALGA 1W1PA 2KFWA 1LL6A 4IT6A 3AS0A 3NRKA 4DRKA 1ROTA 2FDMA 4TW6A 3FXYA 2KR7A 2O92A 4ODOA 1OGGA 1LL7A 4J4OA 1FKKA 3KCEA 2RQSA 1FKIA 5JH8A 1ZBCA 1ROUA 2PPPA 2G8ZA 2F4EA 2Q5AA 4W9OA 3IKGA 3WQVA 3OOBA 3CHEA 1T11A 1JNTA 5HUAA 3AS1A 4DRPA 1HKKA 1L1PA 1HXVA 1SYTA 3AROA 1IX5A 2DG3A 4ODQA 3IKDA 1HJXA 1HKJA 4PTMA 4JFJA 3O5FA 4TW7A 4HARA 4L72B 4ODRA 3UQBA 1HKIA 1O6IA 4U86A 2PPOA 1NWUA 4S3JA 2YBUA 4WKFA 4JFMA 1FKGA 1XRVA 4KR0B 4Z2GA 4DIPA 4G2PA 4DWSC 4WJXA 3TDBA 1D7HA 2WLYA 4Q7NA 4P8WA 4DRIA 3CZ8A 4FN2A 4Z2HA 2RUCA 3O5DA 4JFKA 2RUDA 4GGQA 4NZCA 2DG4A 4IT4A 1EHNA 1F40A 2FKEA 1C9HA 1JNSA 4ZS6A 1EIBA 1SR0A 2DSWA 3BXWA 4ZPTR 2O9OA 2RSEA 4HBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M08 A;  3MDY B;  1BKF A;  1FKT A;  3O5L A;  1D7I A;  2PV2 A;  4LAY A;  1J4H A;  4QT3 A;  1KT1 A;  4C02 B;  2IF4 A;  1FKJ A;  5DIT A;  2XP3 A;  3I6C A;  4GIV A;  4ITZ A;  3O5R A;  1N1A A;  1EQ3 A;  4MGV A;  2K8I A;  4LAW A;  1FJD A;  2ZQV A;  2PBC A;  1KT0 A;  3H9R B;  3KAI A;  3UI4 A;  3B7X A;  2DG9 A;  2D9F A;  5HW7 A;  2MPH A;  1YW5 A;  1FD9 A;  1FKB A;  1J4R A;  3KAD A;  2MLY A;  3NTP A;  3O5E A;  4LAX A;  5HW8 A;  4ODK A;  2XPB A;  1A7X A;  4DRH A;  2KGJ A;  1QPL A;  4DRJ A;  4TYO A;  4O2T A;  1J6Y A;  2KFW A;  5I98 A;  3EY6 A;  4FAP A;  3NRK A;  2LPV A;  4DRK A;  4DRO A;  1ROT A;  1YAT A;  5B8I C;  5HWC A;  2RUQ A;  4TW6 A;  1M5Y A;  1R9H A;  2ZQS A;  2XP5 A;  1TCO C;  3CGM A;  2KR7 A;  2XP4 A;  2VN1 A;  4ODO A;  2ZR6 A;  4JFI A;  4BF8 A;  4J4O A;  5HKG A;  2UZ5 A;  4MSP A;  3KAC A;  3KAF A;  3O5Q A;  1FKK A;  2PPN A;  3KCE A;  5HTG A;  1PIN A;  2RQS A;  2KO7 A;  3KAG A;  3PA7 A;  3RGC A;  1FKI A;  4IQ2 A;  3JYM A;  4IPX A;  1NMV A;  1ROU A;  2RUR A;  1FKD A;  3GPK A;  3IHZ A;  4J4N A;  4LAV A;  1ZCN A;  2MNT A;  2PPP A;  2XP9 A;  3O5G A;  2MLX A;  2ZR4 A;  2F4E A;  2JZV A;  2Q5A A;  4W9O A;  4U84 A;  3UQI A;  2LKN A;  3IKG A;  1BL4 A;  3OOB A;  4DRN A;  2XPA A;  1T11 A;  2XP6 A;  1QPF A;  1JNT A;  3NI6 A;  5D75 A;  4DRM A;  3O5P A;  4DRQ A;  5HUA A;  3UQA A;  1W26 A;  4DRP A;  2AWG A;  4G50 A;  1L1P A;  3O5I A;  1NSG A;  3UI5 A;  1HXV A;  4ODM A;  3TCZ A;  1EYM A;  4ODP A;  5HW6 A;  5GPG A;  3PRD A;  4ODN A;  3UF8 A;  2DG3 A;  2N87 A;  3JXV A;  4ODQ A;  4TW8 A;  1D6O A;  2F21 A;  2FAP A;  2MLZ A;  2OFN A;  2XP7 A;  1NMW A;  2ZR5 A;  3IKD A;  5DIV A;  3KAB A;  1Q6H A;  2KI3 A;  4JFJ A;  3O5F A;  4TW7 A;  4U85 A;  4TNS A;  1Q1C A;  2PV1 A;  2XP8 A;  4ODR A;  4DZ2 A;  3UQB A;  1F8A B;  2Y78 A;  4U86 A;  5J6E A;  3O5O A;  1FKH A;  1QZ2 A;  2PPO A;  1JVW A;  3O5J A;  5BXJ A;  2ITK A;  2LJ4 A;  4IQC A;  1FKF A;  4R0X A;  4JFM A;  2PV3 A;  1FKG A;  4DIP A;  4G2P A;  2ZQU A;  3TDB A;  1D7H A;  3PRB A;  4W9Q A;  4NNR A;  4JFL A;  4DH0 A;  1FAP A;  3WH0 A;  1B6C A;  1Q6U A;  3VAW A;  4DRI A;  3LUO A;  4QT2 A;  3JYJ A;  4FN2 A;  2M2A A;  3KAH A;  3O5M A;  4DT4 A;  3RFW A;  5HWB A;  2RUC A;  2M1I A;  3O5D A;  4JFK A;  4DZ3 A;  2L2S A;  1J4I A;  1D7J A;  2RUD A;  4GGQ A;  1FKR A;  1ZK6 A;  1FKS A;  2DG4 A;  1PBK A;  3ODK A;  4ODL A;  3IK8 A;  4W9P A;  3FAP A;  3TC5 A;  2ZQT A;  4TX0 A;  1F40 A;  1U79 A;  2FKE A;  1C9H A;  2MF9 A;  5DIU A;  1JNS A;  5HT1 A;  2F2D A;  4JYS A;  1P5Q A;  1Y0O A;  2KE0 A;  3O5K A;  1Q6I A;  2RSE A;  2LGO A;  2VCD A;  1FKL A;  4N19 A;  3CGN A;  3KZ7 A;  3UI6 A;  4QIB A; 
#chains in the Genus database with same CATH topology
 4W9P A;  2EUL A;  1J4H A;  4MPK A;  1KT1 A;  3I6C A;  4GIV A;  1NWS A;  3UI4 A;  3B7X A;  2DG9 A;  2D9F A;  1YW5 A;  3NTP A;  4MAV A;  4W5U A;  2XPB A;  2KGJ A;  4DWS A;  1QPL A;  4Z2J A;  1LJY A;  3GU0 A;  1J6Y A;  5I98 A;  3EY6 A;  4DRO A;  2PN0 A;  2RUQ A;  1M5Y A;  2XP5 A;  3CGM A;  2XP4 A;  1W9P A;  2ZR6 A;  4BF8 A;  4DWS B;  5HKG A;  2PI6 A;  2UZ5 A;  3KAC A;  3WIJ A;  1OGB A;  2DPE A;  1WB0 A;  1RD6 A;  1KFW A;  4MNL A;  4IPX A;  2B5U B;  3GPK A;  1FKD A;  3IHZ A;  4J4N A;  1ZCN A;  1TFV A;  2MNT A;  1HJW A;  1WNO A;  2JZV A;  4U84 A;  3UQI A;  2A3C A;  4DRN A;  1ZL1 A;  3ARU A;  2XPA A;  2XP6 A;  4DRQ A;  2QF8 A;  3UQA A;  3RME A;  2AWG A;  3O5I A;  1E6N A;  1NSG A;  2IUZ A;  3ARZ A;  4ODM A;  1EYM A;  5GPG A;  4DWS D;  4ODN A;  4MNJ A;  1NWT A;  2G41 A;  4TW8 A;  2F21 A;  5DIV A;  3KAB A;  4U85 A;  4TNS A;  1W1T A;  2XP8 A;  1LG1 A;  1F8A B;  3O5O A;  5BXJ A;  2ESC A;  2WM0 A;  4IQC A;  4ZPW R;  1FKF A;  3WD4 A;  4R0X A;  3PRA A;  4P8X A;  3B9D A;  2ZQU A;  3PRB A;  4JFL A;  4DH0 A;  1WAW A;  4QT2 A;  4L3N A;  3KAH A;  3O5M A;  3WD3 A;  3RFW A;  2M1I A;  4DZ3 A;  2L2S A;  1J4I A;  1D7J A;  3ARQ A;  4NSB A;  3AS2 A;  1NH6 A;  1PBK A;  4ODL A;  1JNE A;  3TC5 A;  2MF9 A;  4Z2L A;  3WD2 A;  2F2D A;  1HKM A;  1H0G A;  3WD1 A;  2DT3 A;  1FKL A;  4N19 A;  4WIW A;  3CGN A;  3QOK A;  4C02 B;  2IF4 A;  1FKJ A;  5DIT A;  2XP3 A;  1EQ3 A;  1ZU8 A;  3WL0 A;  1JND A;  2K8I A;  1FJD A;  2ZQV A;  1KT0 A;  3B8S A;  2MPH A;  1H0I A;  3KAD A;  4MTV A;  4DRH A;  3RM9 A;  4TYO A;  3ARP A;  5GQB A;  2AOS A;  2LPV A;  5HWC A;  3ARY A;  1TCO C;  3WKZ A;  1X6L A;  2VN1 A;  3G6M A;  3WD0 A;  3B9E A;  1UR9 A;  4MSP A;  1XHG A;  2KO7 A;  1NWR A;  3EIP A;  3G6L A;  3KAG A;  4Z2I A;  1NMV A;  4LAV A;  2XP9 A;  2MLX A;  2ZR4 A;  2LKN A;  5HBF A;  3NI6 A;  5D75 A;  3ARR A;  4DRM A;  3O5P A;  4KQZ A;  1W26 A;  1FFR A;  3W4R A;  4G50 A;  1ZBW A;  3UI5 A;  4ODP A;  3JXV A;  3FY1 A;  2FAP A;  2XP7 A;  1NMW A;  1X6N A;  1Q6H A;  2KI3 A;  2DSV A;  1Q1C A;  2PV1 A;  3B9A A;  4MNM A;  4WKA A;  5J6E A;  1E9L A;  1FKH A;  1QZ2 A;  1JVW A;  2A3E A;  2ITK A;  2LJ4 A;  2PV3 A;  1FFQ A;  3ARX A;  4W9Q A;  4NNR A;  4ML4 A;  1FAP A;  3WH0 A;  1B6C A;  1Q6U A;  1GRJ A;  3JYJ A;  1E6Z A;  1OWQ A;  3AS3 A;  1GUV A;  1FKS A;  3ODK A;  3IK8 A;  2ZQT A;  4TX0 A;  1U79 A;  3AQU A;  1VF8 A;  5DIU A;  3ARW A;  2DSZ A;  4JYS A;  1K9T A;  2KE0 A;  3O5K A;  2YBT A;  1Q6I A;  2LGO A;  1W9V A;  3KZ7 A;  3UI6 A;  2M08 A;  3O5L A;  1BKF A;  4LAY A;  1D7I A;  2PV2 A;  4QT3 A;  4MNK A;  3WL1 A;  4ITZ A;  3O5R A;  1N1A A;  4MGV A;  1ITX A;  4LAW A;  2P4V A;  3H9R B;  2A3B A;  4LAX A;  1GPF A;  4ODK A;  1A7X A;  4DRJ A;  4WKH A;  1LG2 A;  4FAP A;  5GPR A;  3ART A;  5B8I C;  1YAT A;  1W9U A;  4P8U A;  1R9H A;  2ZQS A;  2DT0 A;  1ZBK A;  4HBO A;  4JFI A;  1W1V A;  2WK2 A;  1E15 A;  4WK9 A;  3KAF A;  3O5Q A;  2PPN A;  5HTG A;  1PIN A;  3OA5 A;  4URI A;  3PA7 A;  3RGC A;  4IQ2 A;  3JYM A;  4S3K A;  4ZPV R;  1ZBV A;  2RUR A;  3O5G A;  3CH9 A;  4LGX A;  1BL4 A;  1QPF A;  4QZV B;  4UDM A;  1EDQ A;  1GOI A;  3BMB A;  5DF0 A;  3TCZ A;  2A3A A;  5HW6 A;  2DT1 A;  3PRD A;  3UF8 A;  2N87 A;  1D6O A;  2OFN A;  2MLZ A;  2ZR5 A;  1CTN A;  2DSU A;  2F23 A;  4Q22 A;  1LL4 A;  4DZ2 A;  2Y78 A;  3O5J A;  4P8V A;  2DT2 A;  3ALF A;  3VAW A;  3LUO A;  5DEZ A;  2M2A A;  4DT4 A;  5HWB A;  2B31 A;  3CHD A;  2WLZ A;  1HJV A;  3RM4 A;  1FKR A;  1E6P A;  2OLH A;  1ZK6 A;  3CHF A;  1E44 A;  5DO2 A;  3GTY X;  3FAP A;  4Z2K A;  1W1Y A;  5HT1 A;  1D2K A;  1P5Q A;  1Y0O A;  1E6R A;  3RM8 A;  2VCD A;  3WQW A;  4AY1 A;  1LQ0 A;  4QIB A;  3MDY B;  1FKT A;  4R5E A;  3ARS A;  1UR8 A;  4XAK A;  1ZB5 A;  2PBC A;  3PR9 A;  3KAI A;  5HW7 A;  3ARV A;  1FD9 A;  1FKB A;  1J4R A;  5HW8 A;  2MLY A;  3CHC A;  3O5E A;  4O2T A;  3ALG A;  1W1P A;  2KFW A;  1LL6 A;  4IT6 A;  3AS0 A;  3NRK A;  4DRK A;  1ROT A;  2FDM A;  4TW6 A;  3FXY A;  2KR7 A;  2O92 A;  4ODO A;  1OGG A;  1LL7 A;  4J4O A;  1FKK A;  3KCE A;  2RQS A;  1FKI A;  5JH8 A;  1ZBC A;  1ROU A;  2PPP A;  1JCH B;  2G8Z A;  2F4E A;  2Q5A A;  4W9O A;  3IKG A;  3WQV A;  3OOB A;  3CHE A;  1T11 A;  1JNT A;  5HUA A;  3AS1 A;  4DRP A;  1HKK A;  1L1P A;  1HXV A;  1SYT A;  3ARO A;  1IX5 A;  2DG3 A;  4ODQ A;  3IKD A;  1HJX A;  1HKJ A;  4PTM A;  4JFJ A;  3O5F A;  4TW7 A;  4HAR A;  4L72 B;  4ODR A;  3UQB A;  1HKI A;  1O6I A;  4U86 A;  2PPO A;  1NWU A;  4S3J A;  2YBU A;  4WKF A;  4JFM A;  1FKG A;  1XRV A;  4KR0 B;  4Z2G A;  4DIP A;  4G2P A;  4DWS C;  4WJX A;  3TDB A;  1D7H A;  2WLY A;  4Q7N A;  4P8W A;  4DRI A;  2ETN A;  3CZ8 A;  4FN2 A;  4Z2H A;  2RUC A;  3O5D A;  4JFK A;  2RUD A;  4GGQ A;  4NZC A;  2DG4 A;  4IT4 A;  1EHN A;  1F40 A;  2FKE A;  1C9H A;  1JNS A;  4ZS6 A;  1EIB A;  1SR0 A;  2DSW A;  3BXW A;  4ZPT R;  2O9O A;  2RSE A;  4HBE A; 
#chains in the Genus database with same CATH homology
 4W9P A;  1J4H A;  4MPK A;  1KT1 A;  3I6C A;  4GIV A;  1NWS A;  3UI4 A;  3B7X A;  2DG9 A;  2D9F A;  1YW5 A;  3NTP A;  4MAV A;  4W5U A;  2XPB A;  2KGJ A;  4DWS A;  1QPL A;  4Z2J A;  1LJY A;  1J6Y A;  5I98 A;  3EY6 A;  4DRO A;  2RUQ A;  1M5Y A;  2XP5 A;  3CGM A;  2XP4 A;  1W9P A;  2ZR6 A;  4BF8 A;  4DWS B;  5HKG A;  2PI6 A;  2UZ5 A;  3KAC A;  3WIJ A;  1OGB A;  2DPE A;  1WB0 A;  1RD6 A;  1KFW A;  4MNL A;  4IPX A;  3GPK A;  1FKD A;  3IHZ A;  4J4N A;  1ZCN A;  1TFV A;  2MNT A;  1HJW A;  1WNO A;  2JZV A;  4U84 A;  3UQI A;  2A3C A;  4DRN A;  1ZL1 A;  3ARU A;  2XPA A;  2XP6 A;  4DRQ A;  2QF8 A;  3UQA A;  3RME A;  2AWG A;  3O5I A;  1E6N A;  1NSG A;  2IUZ A;  3ARZ A;  4ODM A;  1EYM A;  5GPG A;  4DWS D;  4ODN A;  4MNJ A;  1NWT A;  2G41 A;  4TW8 A;  2F21 A;  5DIV A;  3KAB A;  4U85 A;  4TNS A;  1W1T A;  2XP8 A;  1LG1 A;  1F8A B;  3O5O A;  5BXJ A;  2ESC A;  2WM0 A;  4IQC A;  4ZPW R;  1FKF A;  3WD4 A;  4R0X A;  3PRA A;  4P8X A;  3B9D A;  2ZQU A;  3PRB A;  4JFL A;  4DH0 A;  1WAW A;  4QT2 A;  4L3N A;  3KAH A;  3O5M A;  3WD3 A;  3RFW A;  2M1I A;  4DZ3 A;  2L2S A;  1J4I A;  1D7J A;  3ARQ A;  4NSB A;  3AS2 A;  1NH6 A;  1PBK A;  4ODL A;  1JNE A;  3TC5 A;  2MF9 A;  4Z2L A;  3WD2 A;  2F2D A;  1HKM A;  1H0G A;  3WD1 A;  2DT3 A;  1FKL A;  4N19 A;  4WIW A;  3CGN A;  3QOK A;  4C02 B;  2IF4 A;  1FKJ A;  5DIT A;  2XP3 A;  1EQ3 A;  1ZU8 A;  3WL0 A;  1JND A;  2K8I A;  1FJD A;  2ZQV A;  1KT0 A;  3B8S A;  2MPH A;  1H0I A;  3KAD A;  4MTV A;  4DRH A;  3RM9 A;  4TYO A;  3ARP A;  5GQB A;  2AOS A;  2LPV A;  5HWC A;  3ARY A;  1TCO C;  3WKZ A;  1X6L A;  2VN1 A;  3G6M A;  3WD0 A;  3B9E A;  1UR9 A;  4MSP A;  1XHG A;  2KO7 A;  1NWR A;  3KAG A;  3G6L A;  4Z2I A;  1NMV A;  4LAV A;  2XP9 A;  2MLX A;  2ZR4 A;  2LKN A;  5HBF A;  3NI6 A;  5D75 A;  3ARR A;  4DRM A;  3O5P A;  4KQZ A;  1W26 A;  1FFR A;  3W4R A;  4G50 A;  1ZBW A;  3UI5 A;  4ODP A;  3JXV A;  3FY1 A;  2FAP A;  2XP7 A;  1NMW A;  1X6N A;  1Q6H A;  2KI3 A;  2DSV A;  1Q1C A;  2PV1 A;  3B9A A;  4MNM A;  4WKA A;  5J6E A;  1E9L A;  1FKH A;  1QZ2 A;  1JVW A;  2A3E A;  2ITK A;  2LJ4 A;  2PV3 A;  1FFQ A;  3ARX A;  4W9Q A;  4NNR A;  4ML4 A;  1FAP A;  3WH0 A;  1B6C A;  1Q6U A;  3JYJ A;  1E6Z A;  1OWQ A;  3AS3 A;  1GUV A;  1FKS A;  3ODK A;  3IK8 A;  2ZQT A;  4TX0 A;  1U79 A;  3AQU A;  1VF8 A;  5DIU A;  3ARW A;  2DSZ A;  4JYS A;  1K9T A;  2KE0 A;  3O5K A;  2YBT A;  1Q6I A;  2LGO A;  1W9V A;  3KZ7 A;  3UI6 A;  2M08 A;  3O5L A;  1BKF A;  4LAY A;  1D7I A;  2PV2 A;  4QT3 A;  4MNK A;  3WL1 A;  4ITZ A;  3O5R A;  1N1A A;  4MGV A;  1ITX A;  4LAW A;  3H9R B;  2A3B A;  4LAX A;  1GPF A;  4ODK A;  1A7X A;  4DRJ A;  4WKH A;  1LG2 A;  4FAP A;  5GPR A;  3ART A;  5B8I C;  1YAT A;  1W9U A;  4P8U A;  1R9H A;  2ZQS A;  2DT0 A;  1ZBK A;  4HBO A;  4JFI A;  1W1V A;  2WK2 A;  1E15 A;  4WK9 A;  3KAF A;  3O5Q A;  2PPN A;  5HTG A;  1PIN A;  3OA5 A;  4URI A;  3PA7 A;  3RGC A;  4IQ2 A;  3JYM A;  4S3K A;  4ZPV R;  1ZBV A;  2RUR A;  3O5G A;  3CH9 A;  4LGX A;  1BL4 A;  1QPF A;  4QZV B;  1EDQ A;  1GOI A;  5DF0 A;  3TCZ A;  2A3A A;  5HW6 A;  2DT1 A;  3PRD A;  3UF8 A;  2N87 A;  1D6O A;  2OFN A;  2MLZ A;  2ZR5 A;  1CTN A;  2DSU A;  4Q22 A;  1LL4 A;  4DZ2 A;  2Y78 A;  3O5J A;  4P8V A;  2DT2 A;  3ALF A;  3VAW A;  3LUO A;  5DEZ A;  2M2A A;  4DT4 A;  5HWB A;  2B31 A;  3CHD A;  2WLZ A;  1HJV A;  3RM4 A;  1FKR A;  1E6P A;  2OLH A;  1ZK6 A;  3CHF A;  5DO2 A;  3FAP A;  4Z2K A;  1W1Y A;  5HT1 A;  1D2K A;  1P5Q A;  1Y0O A;  1E6R A;  3RM8 A;  2VCD A;  3WQW A;  4AY1 A;  1LQ0 A;  4QIB A;  3MDY B;  1FKT A;  4R5E A;  3ARS A;  1UR8 A;  4XAK A;  1ZB5 A;  2PBC A;  3PR9 A;  3KAI A;  5HW7 A;  3ARV A;  1FD9 A;  1FKB A;  1J4R A;  5HW8 A;  2MLY A;  3CHC A;  3O5E A;  4O2T A;  3ALG A;  1W1P A;  2KFW A;  1LL6 A;  4IT6 A;  3AS0 A;  3NRK A;  4DRK A;  1ROT A;  2FDM A;  4TW6 A;  3FXY A;  2KR7 A;  2O92 A;  4ODO A;  1OGG A;  1LL7 A;  4J4O A;  1FKK A;  3KCE A;  2RQS A;  1FKI A;  5JH8 A;  1ZBC A;  1ROU A;  2PPP A;  2G8Z A;  2F4E A;  2Q5A A;  4W9O A;  3IKG A;  3WQV A;  3OOB A;  3CHE A;  1T11 A;  1JNT A;  5HUA A;  3AS1 A;  4DRP A;  1HKK A;  1L1P A;  1HXV A;  1SYT A;  3ARO A;  1IX5 A;  2DG3 A;  4ODQ A;  3IKD A;  1HJX A;  1HKJ A;  4PTM A;  4JFJ A;  3O5F A;  4TW7 A;  4HAR A;  4L72 B;  4ODR A;  3UQB A;  1HKI A;  1O6I A;  4U86 A;  2PPO A;  1NWU A;  4S3J A;  2YBU A;  4WKF A;  4JFM A;  1FKG A;  1XRV A;  4KR0 B;  4Z2G A;  4DIP A;  4G2P A;  4DWS C;  4WJX A;  3TDB A;  1D7H A;  2WLY A;  4Q7N A;  4P8W A;  4DRI A;  3CZ8 A;  4FN2 A;  4Z2H A;  2RUC A;  3O5D A;  4JFK A;  2RUD A;  4GGQ A;  4NZC A;  2DG4 A;  4IT4 A;  1EHN A;  1F40 A;  2FKE A;  1C9H A;  1JNS A;  4ZS6 A;  1EIB A;  1SR0 A;  2DSW A;  3BXW A;  4ZPT R;  2O9O A;  2RSE A;  4HBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...