2PV1A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide weyipnv
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Chaperone surA
total genus 28
structure length 103
sequence length 103
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv1A00
2XPBA 3CGMA 1FKJA 4QT2A 1JNTA 2LPVA 1J4HA 3RFWA 2LKNA 2MF9A 2OFNA 1QPFA 5HUAA 1FD9A 5GPGA 1J4IA 5D75A 3UI5A 1F40A 4FAPA 2IF4A 1EQ3A 3H9RB 3JYJA 4ITZA 4ODLA 4O2TA 2ZQSA 3LUOA 2Q5AA 4TYOA 3MDYB 4W9PA 4J4NA 2AWGA 1JNSA 3PA7A 3IKDA 3UI4A 1EYMA 1FKBA 1D7HA 2KR7A 2MLXA 2XPAA 2KO7A 4U85A 2PV3A 4ODOA 1PINA 4J4OA 4N19A 3KADA 4G2PA 3KAGA 1ZK6A 2XP9A 3NRKA 4ODMA 1QPLA 5DIVA 4R0XA 5BXJA 1Y0OA 2MLZA 3O5GA 5HWBA 4W9QA 1FKSA 5HW7A 2KGJA 2K8IA 3KAFA 3IK8A 4JFKA 4LAVA 1D7JA 1N1AA 2XP4A 1ROUA 1JVWA 3O5DA 4JFIA 3UF8A 4DZ2A 2RUDA 2XP7A 2MNTA 2ZR4A 2PBCA 4DRPA 1ROTA 2ITKA 3I6CA 2L2SA 5HW6A 1Q6HA 3KAIA 3KCEA 4ODQA 4C02B 4DRMA 4DH0A 4QT3A 4DT4A 5HT1A 2VN1A 2DG4A 3KAHA 1D6OA 3O5EA 1F8AB 2LGOA 4GIVA 3NI6A 3RGCA 2M2AA 4W9OA 4DIPA 3IKGA 3NTPA 1FKFA 4LAXA 2RUQA 1BL4A 1FKGA 1T11A 3O5JA 1M5YA 3O5QA 3JYMA 4IQ2A 2DG9A 3VAWA 3UQBA 1Q1CA 1Q6UA 1TCOC 2F4EA 2RURA 2UZ5A 4ODKA 2RQSA 4NNRA 4TX0A 1A7XA 3UQIA 2DG3A 2MLYA 2D9FA 3ODKA 2VCDA 2XP8A 4QIBA 4DRIA 1NSGA 4ODRA 4MGVA 1YW5A 3TDBA 2ZR5A 1D7IA 4DRQA 4LAWA 1L1PA 2F2DA 3EY6A 1C9HA 2ZQTA 3O5FA 3WH0A 3O5OA 4G50A 4BF8A 3UQAA 1ZCNA 3OOBA 1NMVA 3B7XA 2PPOA 4IQCA 1P5QA 2ZQVA 2KFWA 3KZ7A 2PPPA 1QZ2A 1KT0A 1FKKA 4JFLA 3KABA 3O5PA 4JYSA 5HTGA 1FKIA 3FAPA 4ODNA 3O5LA 3TC5A 4DROA 4LAYA 3TCZA 4DRNA 2XP5A 4U86A 5HW8A 1J6YA 5J6EA 4ODPA 1FKTA 4DRKA 1YATA 2M08A 2XP3A 2Y78A 3O5IA 1W26A 3O5KA 4IPXA 1FJDA 4FN2A 1HXVA 2KE0A 3KACA 4TW8A 2ZR6A 5DITA 1PBKA 3PRBA 4DRHA 1FKRA 1BKFA 2JZVA 3CGNA 1B6CA 1FAPA 1U79A 5I98A 2FKEA 3JXVA 1R9HA 2LJ4A 4JFMA 1FKDA 3O5RA 4MSPA 2N87A 2PV2A 3O5MA 2RUCA 2XP6A 2PPNA 2ZQUA 2F21A 2MPHA 4TW7A 4DRJA 4U84A 5B8IC 2KI3A 2PV1A 2RSEA 4DZ3A 1FKHA 5HKGA 5DIUA 3UI6A 3PRDA 1FKLA 3IHZA 3GPKA 1J4RA 4TW6A 1KT1A 4TNSA 2M1IA 1Q6IA 4JFJA 4GGQA 2FAPA 5HWCA 1NMWA
chains in the Genus database with same CATH superfamily
3CGMA 2WK2A 2LPVA 2DT0A 2LKNA 4ZS6A 1EQ3A 5HBFA 3CHEA 4J4NA 4KQZA 1FKBA 1ZB5A 3AS1A 2PV3A 1H0GA 4J4OA 1EIBA 3NRKA 4IT4A 4R0XA 1Y0OA 4Z2KA 4WJXA 1JNDA 5HWBA 4Z2JA 1GPFA 2KGJA 2K8IA 2DSVA 4C02B 4P8VA 4ZPWR 4QT3A 1K9TA 1E6RA 5HT1A 3KAHA 3O5EA 3ARYA 1TFVA 3NI6A 2M2AA 4W5UA 4DIPA 2P4VA 3NTPA 3GU0A 1M5YA 1Q1CA 4NNRA 4NSBA 1OGGA 2VCDA 1HJXA 4QIBA 4DRIA 3ARZA 1NWTA 1YW5A 2ZR5A 1NWUA 4Q7NA 4Z2GA 5DF0A 2A3AA 4WIWA 3KZ7A 1GOIA 2PPPA 4JFLA 4ODNA 1H0IA 4U86A 1LL4A 1YATA 3CZ8A 4MPKA 4TW8A 4DRHA 2EULA 1D2KA 2JZVA 1B6CA 1U79A 3CGNA 3JXVA 4P8UA 1R9HA 2LJ4A 3WD2A 2N87A 1E6NA 1HJVA 2PPNA 3WIJA 2PV1A 2RSEA 4DZ3A 1FKHA 3UI6A 4Q22A 1SYTA 1FKLA 1J4RA 1GRJA 1OGBA 4JFJA 1Q6IA 4ML4A 2FAPA 5HWCA 2XPBA 4UDMA 1FKJA 1HKKA 1JNTA 3RFWA 2MF9A 5HUAA 1E9LA 3UI5A 1F40A 1LL6A 3PR9A 4MAVA 3H9RB 4O2TA 2Q5AA 3WD4A 3PA7A 3UI4A 1NH6A 2KO7A 3WL0A 2WLZA 4G2PA 1QPLA 5DIVA 2O9OA 1FKSA 5HW7A 2YBUA 4JFKA 4LAVA 1D7JA 1ZL1A 1W9UA 4DZ2A 3UF8A 5JH8A 3QOKA 4DRPA 2ITKA 4XAKA 4ODQA 4DRMA 4DH0A 2DG4A 2PN0A 1D6OA 1X6NA 1F8AB 2LGOA 1HKJA 3OA5A 4GIVA 2AOSA 4W9OA 4WKAA 1O6IA 3VAWA 1T11A 3O5JA 3JYMA 2DG9A 3FXYA 1Q6UA 1TCOC 2F4EA 2RURA 2RQSA 2MLYA 1E6PA 3BXWA 4ODRA 3AROA 3O5FA 1W1YA 1ZBKA 4ZPVR 4MTVA 3O5OA 4BF8A 1W1VA 2PPOA 3RMEA 4IQCA 2ZQVA 2KFWA 1QZ2A 3KABA 3O5PA 1FKIA 3FAPA 5HW8A 3TCZA 4DRNA 4ODPA 1FKTA 4DRKA 2M08A 2Y78A 2XP3A 1EDQA 1W26A 3O5KA 4FN2A 3RM8A 3KACA 2DSWA 4HBOA 2WLYA 3ARQA 4KR0B 3AS2A 2FKEA 1VF8A 4JFMA 1FKDA 1RD6A 4MSPA 2DT3A 4TW7A 4DRJA 1W1PA 2DT1A 3G6MA 3ARXA 3GPKA 2IUZA 4NZCA 4TNSA 1EHNA 4GGQA 2F2DA 1ZU8A 3ARTA 4HARA 4QT2A 1IX5A 2OFNA 4Z2LA 1NWSA 5GPGA 2FDMA 3CHCA 1LL7A 4ITZA 3B9DA 1CTNA 3W4RA 1JNSA 1X6LA 2MLXA 2XPAA 4U85A 2DPEA 1HKMA 1PINA 1UR8A 3KADA 3KAGA 2XP9A 1E44A 1LG1A 3CHDA 1UR9A 1WNOA 1LQ0A 1XRVA 4URIA 1ITXA 3ALGA 2XP4A 3O5DA 1ROUA 1JVWA 2DSZA 2F23A 3B9EA 2RUDA 4JFIA 1E6ZA 3RM9A 2PBCA 4DWSA 1ROTA 3I6CA 2L2SA 3WQWA 4R5EA 3AS0A 3KAIA 3KCEA 1W1TA 4S3JA 4ZPTR 2VN1A 3RGCA 3IKGA 3FY1A 1BL4A 4IQ2A 1XHGA 2G8ZA 4QZVB 3ALFA 2UZ5A 4LGXA 1JCHB 2B5UB 4HBEA 4WKFA 3UQIA 2DG3A 4DWSC 3ODKA 2XP8A 2DSUA 5GPRA 1NWRA 3RM4A 3EY6A 1ZBCA 2ZQTA 2DT2A 3ARSA 3OOBA 3B7XA 2ESCA 1FFQA 3WD3A 3CH9A 1FKKA 5HTGA 2YBTA 1FJDA 3TC5A 5HW6A 3O5LA 4LAYA 2XP5A 1ZBWA 3O5IA 1E15A 1JNEA 5DEZA 1HXVA 1ZBVA 1HJWA 1PBKA 1BKFA 5I98A 3AS3A 3O5RA 3AQUA 3O5MA 2A3EA 2RUCA 5GQBA 2MPHA 5B8IC 4Z2IA 4MNLA 1KFWA 5DIUA 3PRDA 3IHZA 4TW6A 3ARPA 3WQVA 2M1IA 1NMWA 2A3CA 1J4HA 1QPFA 1FD9A 1J4IA 2O92A 5D75A 4FAPA 2IF4A 3JYJA 4ODLA 2QF8A 2ZQSA 3LUOA 4TYOA 3MDYB 4W9PA 2AWGA 3IKDA 4MNKA 1EYMA 2KR7A 1D7HA 2A3BA 4L3NA 4ODOA 4N19A 3BMBA 1ZK6A 1LJYA 1OWQA 4ODMA 5BXJA 2MLZA 3WL1A 3O5GA 1WB0A 4IT6A 4W9QA 3KAFA 3IK8A 4MNJA 1N1AA 3GTYX 2XP7A 2MNTA 2ZR4A 3EIPA 2B31A 1Q6HA 4DT4A 3CHFA 4L72B 3PRAA 1HKIA 3ARRA 3ARUA 4WK9A 1FKFA 3WKZA 4LAXA 2RUQA 3O5QA 1FKGA 2WM0A 2ETNA 4Z2HA 3UQBA 4ODKA 4PTMA 1LG2A 4TX0A 1A7XA 2PI6A 1W9VA 2D9FA 1NSGA 3G6LA 4P8XA 4MGVA 3TDBA 4MNMA 1D7IA 4DRQA 4LAWA 1L1PA 1C9HA 3WH0A 5DO2A 4G50A 3UQAA 1ZCNA 1NMVA 1P5QA 2G41A 1KT0A 4JYSA 1WAWA 4DROA 1J6YA 2OLHA 5J6EA 4P8WA 1SR0A 4IPXA 4S3KA 2KE0A 2ZR6A 5DITA 3WD0A 3PRBA 1GUVA 4AY1A 1FKRA 1FAPA 3B8SA 1W9PA 2PV2A 3ARVA 2XP6A 2ZQUA 2F21A 4U84A 2KI3A 5HKGA 4DWSB 3ARWA 1KT1A 4WKHA 4DWSD 3B9AA 3WD1A 1FFRA
chains in the Genus database with same CATH topology
3CGMA 2WK2A 2LPVA 2DT0A 2LKNA 4ZS6A 1EQ3A 5HBFA 3CHEA 4J4NA 4KQZA 1FKBA 1ZB5A 3AS1A 2PV3A 1H0GA 4J4OA 1EIBA 3NRKA 4IT4A 4R0XA 1Y0OA 4Z2KA 4WJXA 1JNDA 5HWBA 4Z2JA 1GPFA 2KGJA 2K8IA 2DSVA 4C02B 4P8VA 4ZPWR 4QT3A 1K9TA 1E6RA 5HT1A 3KAHA 3O5EA 3ARYA 1TFVA 3NI6A 2M2AA 4W5UA 4DIPA 3NTPA 1M5YA 1Q1CA 4NNRA 4NSBA 1OGGA 2VCDA 1HJXA 4QIBA 4DRIA 3ARZA 1NWTA 1YW5A 2ZR5A 1NWUA 4Q7NA 4Z2GA 5DF0A 2A3AA 4WIWA 3KZ7A 1GOIA 2PPPA 4JFLA 4ODNA 1H0IA 4U86A 1LL4A 1YATA 3CZ8A 4MPKA 4TW8A 4DRHA 1D2KA 2JZVA 1B6CA 1U79A 3CGNA 3JXVA 4P8UA 1R9HA 2LJ4A 3WD2A 2N87A 1E6NA 1HJVA 2PPNA 3WIJA 2PV1A 2RSEA 4DZ3A 1FKHA 3UI6A 4Q22A 1SYTA 1FKLA 1J4RA 1OGBA 4JFJA 1Q6IA 4ML4A 2FAPA 5HWCA 2XPBA 1FKJA 1HKKA 1JNTA 3RFWA 2MF9A 5HUAA 1E9LA 3UI5A 1F40A 1LL6A 3PR9A 4MAVA 3H9RB 4O2TA 2Q5AA 3WD4A 3PA7A 3UI4A 1NH6A 2KO7A 3WL0A 2WLZA 4G2PA 1QPLA 5DIVA 2O9OA 1FKSA 5HW7A 2YBUA 4JFKA 4LAVA 1D7JA 1ZL1A 1W9UA 4DZ2A 3UF8A 5JH8A 3QOKA 4DRPA 2ITKA 4XAKA 4ODQA 4DRMA 4DH0A 2DG4A 1D6OA 1X6NA 1F8AB 2LGOA 1HKJA 3OA5A 4GIVA 2AOSA 4W9OA 4WKAA 1O6IA 3VAWA 1T11A 3O5JA 3JYMA 2DG9A 3FXYA 1Q6UA 1TCOC 2F4EA 2RURA 2RQSA 2MLYA 1E6PA 3BXWA 4ODRA 3AROA 3O5FA 1W1YA 1ZBKA 4ZPVR 4MTVA 3O5OA 4BF8A 1W1VA 2PPOA 3RMEA 4IQCA 2ZQVA 2KFWA 1QZ2A 3KABA 3O5PA 1FKIA 3FAPA 5HW8A 3TCZA 4DRNA 4ODPA 1FKTA 4DRKA 2M08A 2Y78A 2XP3A 1EDQA 1W26A 3O5KA 4FN2A 3RM8A 3KACA 2DSWA 4HBOA 2WLYA 3ARQA 4KR0B 3AS2A 2FKEA 1VF8A 4JFMA 1FKDA 1RD6A 4MSPA 2DT3A 4TW7A 4DRJA 1W1PA 2DT1A 3G6MA 3ARXA 3GPKA 2IUZA 4NZCA 4TNSA 1EHNA 4GGQA 2F2DA 1ZU8A 3ARTA 4HARA 4QT2A 1IX5A 2OFNA 4Z2LA 1NWSA 5GPGA 2FDMA 3CHCA 1LL7A 4ITZA 3B9DA 1CTNA 3W4RA 1JNSA 1X6LA 2MLXA 2XPAA 4U85A 2DPEA 1HKMA 1PINA 1UR8A 3KADA 3KAGA 2XP9A 1LG1A 3CHDA 1UR9A 1WNOA 1LQ0A 1XRVA 4URIA 1ITXA 3ALGA 2XP4A 1ROUA 1JVWA 2DSZA 3B9EA 3O5DA 4JFIA 2RUDA 1E6ZA 3RM9A 2PBCA 4DWSA 1ROTA 3I6CA 2L2SA 3WQWA 4R5EA 3AS0A 3KAIA 3KCEA 1W1TA 4S3JA 4ZPTR 2VN1A 3RGCA 3IKGA 3FY1A 1BL4A 4IQ2A 1XHGA 2G8ZA 4QZVB 3ALFA 2UZ5A 4LGXA 4HBEA 4WKFA 3UQIA 2DG3A 4DWSC 3ODKA 2XP8A 2DSUA 5GPRA 1NWRA 3RM4A 3EY6A 1ZBCA 2ZQTA 2DT2A 3ARSA 3OOBA 3B7XA 2ESCA 1FFQA 3WD3A 3CH9A 1FKKA 5HTGA 2YBTA 1FJDA 3TC5A 5HW6A 3O5LA 4LAYA 2XP5A 1ZBWA 3O5IA 1E15A 1JNEA 5DEZA 1HXVA 1ZBVA 1HJWA 1PBKA 1BKFA 5I98A 3AS3A 3O5RA 3AQUA 3O5MA 2A3EA 2RUCA 5GQBA 2MPHA 5B8IC 4Z2IA 4MNLA 1KFWA 5DIUA 3PRDA 3IHZA 4TW6A 3ARPA 3WQVA 2M1IA 1NMWA 2A3CA 1J4HA 1QPFA 1FD9A 1J4IA 2O92A 5D75A 4FAPA 2IF4A 3JYJA 4ODLA 2QF8A 2ZQSA 3LUOA 4TYOA 3MDYB 4W9PA 2AWGA 3IKDA 4MNKA 1EYMA 2KR7A 1D7HA 2A3BA 4L3NA 4ODOA 4N19A 1ZK6A 1LJYA 1OWQA 4ODMA 5BXJA 2MLZA 3WL1A 3O5GA 1WB0A 4IT6A 4W9QA 3KAFA 3IK8A 4MNJA 1N1AA 2XP7A 2MNTA 2ZR4A 2B31A 1Q6HA 4DT4A 3CHFA 4L72B 3PRAA 1HKIA 3ARRA 3ARUA 4WK9A 1FKFA 3WKZA 4LAXA 2RUQA 3O5QA 1FKGA 2WM0A 4Z2HA 3UQBA 4ODKA 4PTMA 1LG2A 4TX0A 1A7XA 2PI6A 1W9VA 2D9FA 1NSGA 3G6LA 4P8XA 4MGVA 3TDBA 4MNMA 1D7IA 4DRQA 4LAWA 1L1PA 1C9HA 3WH0A 5DO2A 4G50A 3UQAA 1ZCNA 1NMVA 1P5QA 2G41A 1KT0A 4JYSA 1WAWA 4DROA 1J6YA 2OLHA 5J6EA 4P8WA 1SR0A 4IPXA 4S3KA 2KE0A 2ZR6A 5DITA 3WD0A 3PRBA 1GUVA 4AY1A 1FKRA 1FAPA 3B8SA 1W9PA 2PV2A 3ARVA 2XP6A 2ZQUA 2F21A 4U84A 2KI3A 5HKGA 4DWSB 3ARWA 1KT1A 4WKHA 4DWSD 3B9AA 3WD1A 1FFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPB A;  3CGM A;  1FKJ A;  4QT2 A;  1JNT A;  2LPV A;  1J4H A;  3RFW A;  2LKN A;  2MF9 A;  2OFN A;  1QPF A;  5HUA A;  1FD9 A;  5GPG A;  1J4I A;  5D75 A;  3UI5 A;  1F40 A;  4FAP A;  2IF4 A;  1EQ3 A;  3H9R B;  3JYJ A;  4ITZ A;  4ODL A;  4O2T A;  2ZQS A;  3LUO A;  2Q5A A;  4TYO A;  3MDY B;  4W9P A;  4J4N A;  2AWG A;  1JNS A;  3PA7 A;  3IKD A;  3UI4 A;  1EYM A;  1FKB A;  1D7H A;  2KR7 A;  2MLX A;  2XPA A;  2KO7 A;  4U85 A;  2PV3 A;  4ODO A;  1PIN A;  4J4O A;  4N19 A;  3KAD A;  4G2P A;  3KAG A;  1ZK6 A;  2XP9 A;  3NRK A;  4ODM A;  1QPL A;  5DIV A;  4R0X A;  5BXJ A;  1Y0O A;  2MLZ A;  3O5G A;  5HWB A;  4W9Q A;  1FKS A;  5HW7 A;  2KGJ A;  2K8I A;  3KAF A;  3IK8 A;  4JFK A;  4LAV A;  1D7J A;  1N1A A;  2XP4 A;  1ROU A;  1JVW A;  3O5D A;  4JFI A;  3UF8 A;  4DZ2 A;  2RUD A;  2XP7 A;  2MNT A;  2ZR4 A;  2PBC A;  4DRP A;  1ROT A;  2ITK A;  3I6C A;  2L2S A;  5HW6 A;  1Q6H A;  3KAI A;  3KCE A;  4ODQ A;  4C02 B;  4DRM A;  4DH0 A;  4QT3 A;  4DT4 A;  5HT1 A;  2VN1 A;  2DG4 A;  3KAH A;  1D6O A;  3O5E A;  1F8A B;  2LGO A;  4GIV A;  3NI6 A;  3RGC A;  2M2A A;  4W9O A;  4DIP A;  3IKG A;  3NTP A;  1FKF A;  4LAX A;  2RUQ A;  1BL4 A;  1FKG A;  1T11 A;  3O5J A;  1M5Y A;  3O5Q A;  3JYM A;  4IQ2 A;  2DG9 A;  3VAW A;  3UQB A;  1Q1C A;  1Q6U A;  1TCO C;  2F4E A;  2RUR A;  2UZ5 A;  4ODK A;  2RQS A;  4NNR A;  4TX0 A;  1A7X A;  3UQI A;  2DG3 A;  2MLY A;  2D9F A;  3ODK A;  2VCD A;  2XP8 A;  4QIB A;  4DRI A;  1NSG A;  4ODR A;  4MGV A;  1YW5 A;  3TDB A;  2ZR5 A;  1D7I A;  4DRQ A;  4LAW A;  1L1P A;  2F2D A;  3EY6 A;  1C9H A;  2ZQT A;  3O5F A;  3WH0 A;  3O5O A;  4G50 A;  4BF8 A;  3UQA A;  1ZCN A;  3OOB A;  1NMV A;  3B7X A;  2PPO A;  4IQC A;  1P5Q A;  2ZQV A;  2KFW A;  3KZ7 A;  2PPP A;  1QZ2 A;  1KT0 A;  1FKK A;  4JFL A;  3KAB A;  3O5P A;  4JYS A;  5HTG A;  1FKI A;  3FAP A;  4ODN A;  3O5L A;  3TC5 A;  4DRO A;  4LAY A;  3TCZ A;  4DRN A;  2XP5 A;  4U86 A;  5HW8 A;  1J6Y A;  5J6E A;  4ODP A;  1FKT A;  4DRK A;  1YAT A;  2M08 A;  2XP3 A;  2Y78 A;  3O5I A;  1W26 A;  3O5K A;  4IPX A;  1FJD A;  4FN2 A;  1HXV A;  2KE0 A;  3KAC A;  4TW8 A;  2ZR6 A;  5DIT A;  1PBK A;  3PRB A;  4DRH A;  1FKR A;  1BKF A;  2JZV A;  3CGN A;  1B6C A;  1FAP A;  1U79 A;  5I98 A;  2FKE A;  3JXV A;  1R9H A;  2LJ4 A;  4JFM A;  1FKD A;  3O5R A;  4MSP A;  2N87 A;  2PV2 A;  3O5M A;  2RUC A;  2XP6 A;  2PPN A;  2ZQU A;  2F21 A;  2MPH A;  4TW7 A;  4DRJ A;  4U84 A;  5B8I C;  2KI3 A;  2PV1 A;  2RSE A;  4DZ3 A;  1FKH A;  5HKG A;  5DIU A;  3UI6 A;  3PRD A;  1FKL A;  3IHZ A;  3GPK A;  1J4R A;  4TW6 A;  1KT1 A;  4TNS A;  2M1I A;  1Q6I A;  4JFJ A;  4GGQ A;  2FAP A;  5HWC A;  1NMW A; 
#chains in the Genus database with same CATH topology
 3CGM A;  2WK2 A;  2LPV A;  2DT0 A;  2LKN A;  4ZS6 A;  1EQ3 A;  5HBF A;  3CHE A;  4J4N A;  4KQZ A;  1FKB A;  1ZB5 A;  3AS1 A;  2PV3 A;  1H0G A;  4J4O A;  1EIB A;  3NRK A;  4IT4 A;  4R0X A;  1Y0O A;  4Z2K A;  4WJX A;  1JND A;  5HWB A;  4Z2J A;  1GPF A;  2KGJ A;  2K8I A;  2DSV A;  4C02 B;  4P8V A;  4ZPW R;  4QT3 A;  1K9T A;  1E6R A;  5HT1 A;  3KAH A;  3O5E A;  3ARY A;  1TFV A;  3NI6 A;  2M2A A;  4W5U A;  4DIP A;  2P4V A;  3NTP A;  3GU0 A;  1M5Y A;  1Q1C A;  4NNR A;  4NSB A;  1OGG A;  2VCD A;  1HJX A;  4QIB A;  4DRI A;  3ARZ A;  1NWT A;  1YW5 A;  2ZR5 A;  1NWU A;  4Q7N A;  4Z2G A;  5DF0 A;  2A3A A;  4WIW A;  3KZ7 A;  1GOI A;  2PPP A;  4JFL A;  4ODN A;  1H0I A;  4U86 A;  1LL4 A;  1YAT A;  3CZ8 A;  4MPK A;  4TW8 A;  4DRH A;  2EUL A;  1D2K A;  2JZV A;  1B6C A;  1U79 A;  3CGN A;  3JXV A;  4P8U A;  1R9H A;  2LJ4 A;  3WD2 A;  2N87 A;  1E6N A;  1HJV A;  2PPN A;  3WIJ A;  2PV1 A;  2RSE A;  4DZ3 A;  1FKH A;  3UI6 A;  4Q22 A;  1SYT A;  1FKL A;  1J4R A;  1GRJ A;  1OGB A;  4JFJ A;  1Q6I A;  4ML4 A;  2FAP A;  5HWC A;  2XPB A;  4UDM A;  1FKJ A;  1HKK A;  1JNT A;  3RFW A;  2MF9 A;  5HUA A;  1E9L A;  3UI5 A;  1F40 A;  1LL6 A;  3PR9 A;  4MAV A;  3H9R B;  4O2T A;  2Q5A A;  3WD4 A;  3PA7 A;  3UI4 A;  1NH6 A;  2KO7 A;  3WL0 A;  2WLZ A;  4G2P A;  1QPL A;  5DIV A;  2O9O A;  1FKS A;  5HW7 A;  2YBU A;  4JFK A;  4LAV A;  1D7J A;  1ZL1 A;  1W9U A;  4DZ2 A;  3UF8 A;  5JH8 A;  3QOK A;  4DRP A;  2ITK A;  4XAK A;  4ODQ A;  4DRM A;  4DH0 A;  2DG4 A;  2PN0 A;  1D6O A;  1X6N A;  1F8A B;  2LGO A;  1HKJ A;  3OA5 A;  4GIV A;  2AOS A;  4W9O A;  4WKA A;  1O6I A;  3VAW A;  1T11 A;  3O5J A;  3JYM A;  2DG9 A;  3FXY A;  1Q6U A;  1TCO C;  2F4E A;  2RUR A;  2RQS A;  2MLY A;  1E6P A;  3BXW A;  4ODR A;  3ARO A;  3O5F A;  1W1Y A;  1ZBK A;  4ZPV R;  4MTV A;  3O5O A;  4BF8 A;  1W1V A;  2PPO A;  3RME A;  4IQC A;  2ZQV A;  2KFW A;  1QZ2 A;  3KAB A;  3O5P A;  1FKI A;  3FAP A;  5HW8 A;  3TCZ A;  4DRN A;  4ODP A;  1FKT A;  4DRK A;  2M08 A;  2Y78 A;  2XP3 A;  1EDQ A;  1W26 A;  3O5K A;  4FN2 A;  3RM8 A;  3KAC A;  2DSW A;  4HBO A;  2WLY A;  3ARQ A;  4KR0 B;  3AS2 A;  2FKE A;  1VF8 A;  4JFM A;  1FKD A;  1RD6 A;  4MSP A;  2DT3 A;  4TW7 A;  4DRJ A;  1W1P A;  2DT1 A;  3G6M A;  3ARX A;  3GPK A;  2IUZ A;  4NZC A;  4TNS A;  1EHN A;  4GGQ A;  2F2D A;  1ZU8 A;  3ART A;  4HAR A;  4QT2 A;  1IX5 A;  2OFN A;  4Z2L A;  1NWS A;  5GPG A;  2FDM A;  3CHC A;  1LL7 A;  4ITZ A;  3B9D A;  1CTN A;  3W4R A;  1JNS A;  1X6L A;  2MLX A;  2XPA A;  4U85 A;  2DPE A;  1HKM A;  1PIN A;  1UR8 A;  3KAD A;  3KAG A;  2XP9 A;  1E44 A;  1LG1 A;  3CHD A;  1UR9 A;  1WNO A;  1LQ0 A;  1XRV A;  4URI A;  1ITX A;  3ALG A;  2XP4 A;  3O5D A;  1ROU A;  1JVW A;  2DSZ A;  2F23 A;  3B9E A;  2RUD A;  4JFI A;  1E6Z A;  3RM9 A;  2PBC A;  4DWS A;  1ROT A;  3I6C A;  2L2S A;  3WQW A;  4R5E A;  3AS0 A;  3KAI A;  3KCE A;  1W1T A;  4S3J A;  4ZPT R;  2VN1 A;  3RGC A;  3IKG A;  3FY1 A;  1BL4 A;  4IQ2 A;  1XHG A;  2G8Z A;  4QZV B;  3ALF A;  2UZ5 A;  4LGX A;  1JCH B;  2B5U B;  4HBE A;  4WKF A;  3UQI A;  2DG3 A;  4DWS C;  3ODK A;  2XP8 A;  2DSU A;  5GPR A;  1NWR A;  3RM4 A;  3EY6 A;  1ZBC A;  2ZQT A;  2DT2 A;  3ARS A;  3OOB A;  3B7X A;  2ESC A;  1FFQ A;  3WD3 A;  3CH9 A;  1FKK A;  5HTG A;  2YBT A;  1FJD A;  3TC5 A;  5HW6 A;  3O5L A;  4LAY A;  2XP5 A;  1ZBW A;  3O5I A;  1E15 A;  1JNE A;  5DEZ A;  1HXV A;  1ZBV A;  1HJW A;  1PBK A;  1BKF A;  5I98 A;  3AS3 A;  3O5R A;  3AQU A;  3O5M A;  2A3E A;  2RUC A;  5GQB A;  2MPH A;  5B8I C;  4Z2I A;  4MNL A;  1KFW A;  5DIU A;  3PRD A;  3IHZ A;  4TW6 A;  3ARP A;  3WQV A;  2M1I A;  1NMW A;  2A3C A;  1J4H A;  1QPF A;  1FD9 A;  1J4I A;  2O92 A;  5D75 A;  4FAP A;  2IF4 A;  3JYJ A;  4ODL A;  2QF8 A;  2ZQS A;  3LUO A;  4TYO A;  3MDY B;  4W9P A;  2AWG A;  3IKD A;  4MNK A;  1EYM A;  2KR7 A;  1D7H A;  2A3B A;  4L3N A;  4ODO A;  4N19 A;  3BMB A;  1ZK6 A;  1LJY A;  1OWQ A;  4ODM A;  5BXJ A;  2MLZ A;  3WL1 A;  3O5G A;  1WB0 A;  4IT6 A;  4W9Q A;  3KAF A;  3IK8 A;  4MNJ A;  1N1A A;  3GTY X;  2XP7 A;  2MNT A;  2ZR4 A;  3EIP A;  2B31 A;  1Q6H A;  4DT4 A;  3CHF A;  4L72 B;  3PRA A;  1HKI A;  3ARR A;  3ARU A;  4WK9 A;  1FKF A;  3WKZ A;  4LAX A;  2RUQ A;  3O5Q A;  1FKG A;  2WM0 A;  2ETN A;  4Z2H A;  3UQB A;  4ODK A;  4PTM A;  1LG2 A;  4TX0 A;  1A7X A;  2PI6 A;  1W9V A;  2D9F A;  1NSG A;  3G6L A;  4P8X A;  4MGV A;  3TDB A;  4MNM A;  1D7I A;  4DRQ A;  4LAW A;  1L1P A;  1C9H A;  3WH0 A;  5DO2 A;  4G50 A;  3UQA A;  1ZCN A;  1NMV A;  1P5Q A;  2G41 A;  1KT0 A;  4JYS A;  1WAW A;  4DRO A;  1J6Y A;  2OLH A;  5J6E A;  4P8W A;  1SR0 A;  4IPX A;  4S3K A;  2KE0 A;  2ZR6 A;  5DIT A;  3WD0 A;  3PRB A;  1GUV A;  4AY1 A;  1FKR A;  1FAP A;  3B8S A;  1W9P A;  2PV2 A;  3ARV A;  2XP6 A;  2ZQU A;  2F21 A;  4U84 A;  2KI3 A;  5HKG A;  4DWS B;  3ARW A;  1KT1 A;  4WKH A;  4DWS D;  3B9A A;  3WD1 A;  1FFR A; 
#chains in the Genus database with same CATH homology
 3CGM A;  2WK2 A;  2LPV A;  2DT0 A;  2LKN A;  4ZS6 A;  1EQ3 A;  5HBF A;  3CHE A;  4J4N A;  4KQZ A;  1FKB A;  1ZB5 A;  3AS1 A;  2PV3 A;  1H0G A;  4J4O A;  1EIB A;  3NRK A;  4IT4 A;  4R0X A;  1Y0O A;  4Z2K A;  4WJX A;  1JND A;  5HWB A;  4Z2J A;  1GPF A;  2KGJ A;  2K8I A;  2DSV A;  4C02 B;  4P8V A;  4ZPW R;  4QT3 A;  1K9T A;  1E6R A;  5HT1 A;  3KAH A;  3O5E A;  3ARY A;  1TFV A;  3NI6 A;  2M2A A;  4W5U A;  4DIP A;  3NTP A;  1M5Y A;  1Q1C A;  4NNR A;  4NSB A;  1OGG A;  2VCD A;  1HJX A;  4QIB A;  4DRI A;  3ARZ A;  1NWT A;  1YW5 A;  2ZR5 A;  1NWU A;  4Q7N A;  4Z2G A;  5DF0 A;  2A3A A;  4WIW A;  3KZ7 A;  1GOI A;  2PPP A;  4JFL A;  4ODN A;  1H0I A;  4U86 A;  1LL4 A;  1YAT A;  3CZ8 A;  4MPK A;  4TW8 A;  4DRH A;  1D2K A;  2JZV A;  1B6C A;  1U79 A;  3CGN A;  3JXV A;  4P8U A;  1R9H A;  2LJ4 A;  3WD2 A;  2N87 A;  1E6N A;  1HJV A;  2PPN A;  3WIJ A;  2PV1 A;  2RSE A;  4DZ3 A;  1FKH A;  3UI6 A;  4Q22 A;  1SYT A;  1FKL A;  1J4R A;  1OGB A;  4JFJ A;  1Q6I A;  4ML4 A;  2FAP A;  5HWC A;  2XPB A;  1FKJ A;  1HKK A;  1JNT A;  3RFW A;  2MF9 A;  5HUA A;  1E9L A;  3UI5 A;  1F40 A;  1LL6 A;  3PR9 A;  4MAV A;  3H9R B;  4O2T A;  2Q5A A;  3WD4 A;  3PA7 A;  3UI4 A;  1NH6 A;  2KO7 A;  3WL0 A;  2WLZ A;  4G2P A;  1QPL A;  5DIV A;  2O9O A;  1FKS A;  5HW7 A;  2YBU A;  4JFK A;  4LAV A;  1D7J A;  1ZL1 A;  1W9U A;  4DZ2 A;  3UF8 A;  5JH8 A;  3QOK A;  4DRP A;  2ITK A;  4XAK A;  4ODQ A;  4DRM A;  4DH0 A;  2DG4 A;  1D6O A;  1X6N A;  1F8A B;  2LGO A;  1HKJ A;  3OA5 A;  4GIV A;  2AOS A;  4W9O A;  4WKA A;  1O6I A;  3VAW A;  1T11 A;  3O5J A;  3JYM A;  2DG9 A;  3FXY A;  1Q6U A;  1TCO C;  2F4E A;  2RUR A;  2RQS A;  2MLY A;  1E6P A;  3BXW A;  4ODR A;  3ARO A;  3O5F A;  1W1Y A;  1ZBK A;  4ZPV R;  4MTV A;  3O5O A;  4BF8 A;  1W1V A;  2PPO A;  3RME A;  4IQC A;  2ZQV A;  2KFW A;  1QZ2 A;  3KAB A;  3O5P A;  1FKI A;  3FAP A;  5HW8 A;  3TCZ A;  4DRN A;  4ODP A;  1FKT A;  4DRK A;  2M08 A;  2Y78 A;  2XP3 A;  1EDQ A;  1W26 A;  3O5K A;  4FN2 A;  3RM8 A;  3KAC A;  2DSW A;  4HBO A;  2WLY A;  3ARQ A;  4KR0 B;  3AS2 A;  2FKE A;  1VF8 A;  4JFM A;  1FKD A;  1RD6 A;  4MSP A;  2DT3 A;  4TW7 A;  4DRJ A;  1W1P A;  2DT1 A;  3G6M A;  3ARX A;  3GPK A;  2IUZ A;  4NZC A;  4TNS A;  1EHN A;  4GGQ A;  2F2D A;  1ZU8 A;  3ART A;  4HAR A;  4QT2 A;  1IX5 A;  2OFN A;  4Z2L A;  1NWS A;  5GPG A;  2FDM A;  3CHC A;  1LL7 A;  4ITZ A;  3B9D A;  1CTN A;  3W4R A;  1JNS A;  1X6L A;  2MLX A;  2XPA A;  4U85 A;  2DPE A;  1HKM A;  1PIN A;  1UR8 A;  3KAD A;  3KAG A;  2XP9 A;  1LG1 A;  3CHD A;  1UR9 A;  1WNO A;  1LQ0 A;  1XRV A;  4URI A;  1ITX A;  3ALG A;  2XP4 A;  1ROU A;  1JVW A;  2DSZ A;  3B9E A;  3O5D A;  4JFI A;  2RUD A;  1E6Z A;  3RM9 A;  2PBC A;  4DWS A;  1ROT A;  3I6C A;  2L2S A;  3WQW A;  4R5E A;  3AS0 A;  3KAI A;  3KCE A;  1W1T A;  4S3J A;  4ZPT R;  2VN1 A;  3RGC A;  3IKG A;  3FY1 A;  1BL4 A;  4IQ2 A;  1XHG A;  2G8Z A;  4QZV B;  3ALF A;  2UZ5 A;  4LGX A;  4HBE A;  4WKF A;  3UQI A;  2DG3 A;  4DWS C;  3ODK A;  2XP8 A;  2DSU A;  5GPR A;  1NWR A;  3RM4 A;  3EY6 A;  1ZBC A;  2ZQT A;  2DT2 A;  3ARS A;  3OOB A;  3B7X A;  2ESC A;  1FFQ A;  3WD3 A;  3CH9 A;  1FKK A;  5HTG A;  2YBT A;  1FJD A;  3TC5 A;  5HW6 A;  3O5L A;  4LAY A;  2XP5 A;  1ZBW A;  3O5I A;  1E15 A;  1JNE A;  5DEZ A;  1HXV A;  1ZBV A;  1HJW A;  1PBK A;  1BKF A;  5I98 A;  3AS3 A;  3O5R A;  3AQU A;  3O5M A;  2A3E A;  2RUC A;  5GQB A;  2MPH A;  5B8I C;  4Z2I A;  4MNL A;  1KFW A;  5DIU A;  3PRD A;  3IHZ A;  4TW6 A;  3ARP A;  3WQV A;  2M1I A;  1NMW A;  2A3C A;  1J4H A;  1QPF A;  1FD9 A;  1J4I A;  2O92 A;  5D75 A;  4FAP A;  2IF4 A;  3JYJ A;  4ODL A;  2QF8 A;  2ZQS A;  3LUO A;  4TYO A;  3MDY B;  4W9P A;  2AWG A;  3IKD A;  4MNK A;  1EYM A;  2KR7 A;  1D7H A;  2A3B A;  4L3N A;  4ODO A;  4N19 A;  1ZK6 A;  1LJY A;  1OWQ A;  4ODM A;  5BXJ A;  2MLZ A;  3WL1 A;  3O5G A;  1WB0 A;  4IT6 A;  4W9Q A;  3KAF A;  3IK8 A;  4MNJ A;  1N1A A;  2XP7 A;  2MNT A;  2ZR4 A;  2B31 A;  1Q6H A;  4DT4 A;  3CHF A;  4L72 B;  3PRA A;  1HKI A;  3ARR A;  3ARU A;  4WK9 A;  1FKF A;  3WKZ A;  4LAX A;  2RUQ A;  3O5Q A;  1FKG A;  2WM0 A;  4Z2H A;  3UQB A;  4ODK A;  4PTM A;  1LG2 A;  4TX0 A;  1A7X A;  2PI6 A;  1W9V A;  2D9F A;  1NSG A;  3G6L A;  4P8X A;  4MGV A;  3TDB A;  4MNM A;  1D7I A;  4DRQ A;  4LAW A;  1L1P A;  1C9H A;  3WH0 A;  5DO2 A;  4G50 A;  3UQA A;  1ZCN A;  1NMV A;  1P5Q A;  2G41 A;  1KT0 A;  4JYS A;  1WAW A;  4DRO A;  1J6Y A;  2OLH A;  5J6E A;  4P8W A;  1SR0 A;  4IPX A;  4S3K A;  2KE0 A;  2ZR6 A;  5DIT A;  3WD0 A;  3PRB A;  1GUV A;  4AY1 A;  1FKR A;  1FAP A;  3B8S A;  1W9P A;  2PV2 A;  3ARV A;  2XP6 A;  2ZQU A;  2F21 A;  4U84 A;  2KI3 A;  5HKG A;  4DWS B;  3ARW A;  1KT1 A;  4WKH A;  4DWS D;  3B9A A;  3WD1 A;  1FFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...