2PV1A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide weyipnv
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone surA
publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 28
structure length 103
sequence length 103
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv1A00
1FD9A 3CGMA 4JFKA 1FKFA 2PV1A 2VN1A 2ZR6A 3CGNA 4JFIA 4MSPA 1B6CA 3UQIA 4W9OA 2JZVA 3O5RA 5HTGA 2RUDA 1D6OA 3IKGA 2RQSA 5HW7A 2DG4A 2XPBA 4TW7A 4DRPA 3WH0A 4U86A 4G2PA 5D75A 2RUCA 4DRNA 1F8AB 4JFJA 5HT1A 2N87A 1KT1A 3JYMA 2UZ5A 1Q6UA 4DH0A 2XP3A 4ODMA 1R9HA 2OFNA 4FAPA 5BXJA 1ZCNA 3UF8A 2F21A 3O5GA 4DZ3A 4QT3A 1N1AA 4QIBA 1EYMA 4IPXA 3O5DA 2XP5A 4G50A 4FN2A 1J4RA 4GIVA 1ZK6A 4W9QA 1YW5A 4MGVA 1D7JA 2MNTA 1FJDA 3PA7A 3O5PA 3O5JA 2ZR4A 1FKDA 4IQ2A 4LAWA 5DITA 3UQBA 2ZR5A 4JFMA 4ODQA 2D9FA 3NTPA 4JFLA 4DRMA 5DIUA 4ODLA 4TYOA 3OOBA 1QZ2A 3KCEA 1NMWA 4O2TA 3EY6A 2PV2A 2ZQUA 2MLZA 1L1PA 2MPHA 5HW6A 1A7XA 3O5QA 3IK8A 4IQCA 4LAXA 3GPKA 4N19A 4NNRA 3VAWA 1Q6IA 1EQ3A 3IHZA 1C9HA 1TCOC 1FKHA 2AWGA 2KE0A 4J4NA 4C02B 1PBKA 2LJ4A 2LPVA 2MLXA 4ODOA 5GPGA 2KI3A 2XP7A 3MDYB 2FAPA 2KGJA 4ODNA 1F40A 3I6CA 3RFWA 2PBCA 3JYJA 4W9PA 4DRIA 3KAHA 2KFWA 2KO7A 2PPOA 3KAIA 2ZQTA 1FKKA 3KACA 1FKIA 3O5EA 4QT2A 1J6YA 2XPAA 4GGQA 1FAPA 1JNTA 1KT0A 1NSGA 1Y0OA 2LGOA 3NRKA 4U84A 1U79A 2MF9A 4DIPA 4DRJA 4LAYA 4DRHA 1J4IA 1ROUA 5HW8A 1NMVA 5HWCA 2DG9A 4U85A 1FKJA 1JNSA 1T11A 2M08A 2ZQSA 3O5OA 3KAGA 5DIVA 1JVWA 1FKLA 2XP6A 2XP9A 2RSEA 3H9RB 2FKEA 2M2AA 3UI6A 4DROA 2M1IA 3JXVA 5HUAA 4JYSA 1FKTA 4ITZA 2ZQVA 1PINA 1QPLA 1FKSA 1P5QA 4DRKA 2PPPA 1HXVA 3O5LA 3UI4A 2IF4A 4R0XA 1J4HA 4DRQA 1ROTA 1BKFA 1D7IA 2XP8A 4ODPA 5I98A 2RUQA 3O5KA 2KR7A 3FAPA 3PRBA 5J6EA 3TDBA 2LKNA 4DT4A 2Q5AA 1BL4A 3B7XA 2XP4A 4TW8A 2PPNA 5B8IC 3PRDA 1FKRA 1M5YA 1D7HA 5HKGA 4TNSA 3KZ7A 3NI6A 2PV3A 3RGCA 3UI5A 2F2DA 2K8IA 3KAFA 3TCZA 2DG3A 3LUOA 5HWBA 1QPFA 3KADA 2F4EA 3O5MA 1YATA 4DZ2A 4J4OA 1FKBA 1Q6HA 4ODRA 3KABA 3O5FA 4ODKA 2VCDA 1FKGA 4TX0A 4BF8A 2L2SA 2MLYA 3UQAA 4TW6A 1W26A 3ODKA 1Q1CA 3IKDA 2Y78A 3TC5A 2ITKA 3O5IA 2RURA 4LAVA
chains in the Genus database with same CATH superfamily
1FD9A 3G6MA 3CGMA 1FKFA 2VN1A 1X6LA 1D6OA 3IKGA 1LL6A 5HW7A 2DG4A 2XPBA 2YBTA 3WH0A 3WD1A 5D75A 4JFJA 1OGGA 3RMEA 1Q6UA 4MNJA 2DSZA 2WLZA 2XP3A 2F23A 3CH9A 3UF8A 2F21A 5GPRA 4DZ3A 3ARYA 4IPXA 3O5DA 4G50A 1UR9A 1ZBWA 4W9QA 2ZR4A 1NWRA 1FKDA 4IQ2A 4LAWA 3NTPA 1QZ2A 3KCEA 2PV2A 2ZQUA 1L1PA 3CZ8A 3O5QA 1W9PA 3IK8A 3B9EA 4LAXA 4N19A 3IHZA 1C9HA 1HJXA 2KE0A 4C02B 1PBKA 1EIBA 5GPGA 2XP7A 4DWSC 4DWSD 3MDYB 2KGJA 1W1PA 3I6CA 2DSWA 2PBCA 1EHNA 1E6ZA 2KO7A 1OWQA 3O5EA 4QT2A 1FKKA 5DF0A 1J6YA 3AS0A 1HKJA 3NRKA 4DIPA 5JH8A 2PI6A 1J4IA 1NMVA 1E6RA 3AS1A 4HBOA 3OA5A 1FKLA 3ARPA 2XP6A 4ZS6A 4DROA 4NSBA 3WD0A 2M1IA 3JXVA 4JYSA 1FKTA 1QPLA 1XRVA 2IF4A 1ROTA 1BKFA 5I98A 2RUQA 4AY1A 4WKFA 4TW8A 4ZPVR 2PPNA 1FKRA 1WAWA 4TNSA 1LG2A 3KZ7A 4LGXA 3UI5A 3WKZA 2K8IA 5DO2A 1H0IA 3ARUA 1HKIA 1FKBA 3O5FA 1FKGA 1FFQA 2DT3A 1ZB5A 4Q7NA 2MLYA 3UQAA 3ARZA 2DSVA 4LAVA 2O92A 4ZPTR 2PV1A 4MSPA 1WB0A 3UQIA 4MAVA 2JZVA 5HTGA 3WD3A 2RQSA 1IX5A 4TW7A 4DRPA 4G2PA 4L72B 2RUCA 3ARWA 3RM4A 1F8AB 5HT1A 2UZ5A 1GOIA 4DH0A 4R5EA 1ZCNA 3ARTA 3B8SA 1N1AA 4QIBA 2XP5A 1J4RA 4GIVA 1GUVA 2WK2A 3WD2A 1YW5A 4MGVA 1D7JA 1NWSA 2YBUA 4MPKA 3PA7A 1ZBKA 3UQBA 3ALFA 4ODQA 5DIUA 4ODLA 4TYOA 4P8UA 2EULA 4PTMA 4O2TA 3EY6A 3CHEA 2AOSA 1JNEA 5HW6A 1HKKA 4HARA 2DT1A 1FKHA 2AWGA 3FY1A 3CHCA 2LPVA 4P8XA 3FXYA 1HKMA 3RFWA 3JYJA 3PRAA 2ZQTA 3KACA 1E15A 4GGQA 4P8WA 4MTVA 2MF9A 4DRJA 1ROUA 2DG9A 1FKJA 1JNSA 1T11A 2M08A 4MNMA 3O5OA 4Q22A 3W4RA 3H9RB 3ARXA 1E44A 1PINA 2A3CA 1P5QA 4W5UA 1W9VA 3O5LA 3UI4A 4DRQA 4ODPA 3PRBA 2KR7A 2DT0A 3AS3A 3FAPA 4XAKA 5B8IC 1VF8A 1D7HA 3NI6A 2F2DA 3KAFA 3TCZA 3LUOA 3KADA 4Z2IA 4IT4A 2F4EA 1YATA 1E6NA 2G41A 2VCDA 4BF8A 2WM0A 4TW6A 4S3KA 4S3JA 4DWSB 1FFRA 1W9UA 4W9OA 2FDMA 2RUDA 2A3AA 3ARQA 4UDMA 4DRNA 3GTYX 3CHFA 1O6IA 4FAPA 1R9HA 4QT3A 3ARRA 4FN2A 1E9LA 1WNOA 1ZBCA 2MNTA 1E6PA 2G8ZA 1FJDA 3O5PA 2DT2A 4JFMA 4DRMA 2D9FA 1NWTA 3OOBA 1JNDA 3RM8A 2MPHA 1LQ0A 4IQCA 3AROA 3GPKA 4QZVB 3VAWA 1Q6IA 4J4NA 2LJ4A 2MLXA 4ODOA 1KFWA 4W9PA 4DRIA 1ZU8A 3KAHA 1ZBVA 2PPOA 3KAIA 1FKIA 2ESCA 3PR9A 3G6LA 1FAPA 1JNTA 1KT0A 4U84A 5HW8A 2LGOA 3B9AA 1U79A 4LAYA 1W1VA 1SYTA 3BXWA 1EDQA 3KAGA 5DIVA 1JVWA 4MNLA 3WIJA 2FKEA 2M2AA 2A3BA 1H0GA 4ITZA 2ZQVA 1FKSA 4WIWA 1HXVA 4R0XA 1J4HA 2A3EA 2XP8A 2P4VA 5DEZA 5J6EA 2DPEA 2LKNA 2Q5AA 1XHGA 2XP4A 4Z2GA 3CHDA 3QOKA 1M5YA 4Z2KA 1ZL1A 2PV3A 1LL7A 3ARVA 3O5MA 5HBFA 4DZ2A 4WKAA 1Q6HA 4ML4A 4ODKA 1NH6A 4KQZA 3GU0A 4TX0A 3ODKA 1Q1CA 3WD4A 3IKDA 2Y78A 2ITKA 3O5IA 2RURA 2IUZA 1LJYA 1GPFA 4ZPWR 4Z2LA 4JFKA 2ZR6A 4JFIA 3CGNA 1B6CA 4HBEA 4KR0B 1NWUA 1JCHB 3O5RA 4WKHA 1RD6A 1HJWA 4Z2HA 4U86A 3ARSA 2N87A 1KT1A 3WQWA 3JYMA 4MNKA 4NZCA 2ETNA 4ODMA 2OFNA 1W1TA 5BXJA 3O5GA 3RM9A 1EYMA 3EIPA 1ZK6A 1CTNA 1LG1A 4L3NA 3O5JA 3WL1A 5DITA 2ZR5A 5GQBA 4JFLA 1W1YA 3AS2A 4URIA 1HJVA 1NMWA 1LL4A 1SR0A 2MLZA 1A7XA 2DSUA 4NNRA 1D2KA 1EQ3A 4DWSA 1TCOC 2B5UB 2KI3A 2FAPA 1GRJA 4ODNA 1F40A 2PN0A 2KFWA 3WL0A 2XPAA 3ALGA 1Y0OA 1NSGA 2O9OA 2B31A 4DRHA 3WQVA 5HWCA 2WLYA 4U85A 2ZQSA 2QF8A 1X6NA 4Z2JA 2XP9A 2RSEA 3UI6A 3BMBA 5HUAA 4DRKA 2PPPA 1D7IA 1K9TA 3O5KA 3TDBA 4DT4A 4P8VA 1BL4A 3B7XA 5HKGA 1TFVA 1UR8A 3RGCA 2DG3A 5HWBA 1QPFA 4J4OA 1ITXA 2OLHA 4IT6A 4ODRA 3KABA 4WJXA 3AQUA 3B9DA 2L2SA 4WK9A 1OGBA 1W26A 3TC5A 3PRDA
chains in the Genus database with same CATH topology
1FD9A 3G6MA 3CGMA 1FKFA 2VN1A 1X6LA 1D6OA 3IKGA 1LL6A 5HW7A 2DG4A 2XPBA 2YBTA 3WH0A 3WD1A 5D75A 4JFJA 1OGGA 3RMEA 1Q6UA 4MNJA 2DSZA 2WLZA 2XP3A 3CH9A 3UF8A 2F21A 5GPRA 4DZ3A 3ARYA 4IPXA 3O5DA 4G50A 1UR9A 1ZBWA 4W9QA 2ZR4A 1NWRA 1FKDA 4IQ2A 4LAWA 3NTPA 1QZ2A 3KCEA 2PV2A 2ZQUA 1L1PA 3CZ8A 3O5QA 1W9PA 3IK8A 3B9EA 4LAXA 4N19A 3IHZA 1C9HA 1HJXA 2KE0A 4C02B 1PBKA 1EIBA 5GPGA 2XP7A 4DWSC 4DWSD 3MDYB 2KGJA 1W1PA 3I6CA 2DSWA 2PBCA 1EHNA 1E6ZA 3O5EA 1OWQA 2KO7A 4QT2A 1FKKA 5DF0A 1J6YA 3AS0A 1HKJA 3NRKA 4DIPA 5JH8A 2PI6A 1J4IA 1NMVA 1E6RA 3AS1A 4HBOA 3OA5A 1FKLA 3ARPA 2XP6A 4ZS6A 4DROA 4NSBA 3WD0A 2M1IA 3JXVA 4JYSA 1FKTA 1QPLA 1XRVA 2IF4A 1ROTA 1BKFA 5I98A 2RUQA 4AY1A 4WKFA 4TW8A 4ZPVR 2PPNA 1FKRA 1WAWA 4TNSA 1LG2A 3KZ7A 4LGXA 3UI5A 3WKZA 2K8IA 5DO2A 1H0IA 3ARUA 1HKIA 1FKBA 3O5FA 1FKGA 1FFQA 2DT3A 1ZB5A 4Q7NA 2MLYA 3UQAA 3ARZA 2DSVA 4LAVA 2O92A 4ZPTR 2PV1A 4MSPA 1WB0A 3UQIA 4MAVA 2JZVA 5HTGA 3WD3A 2RQSA 1IX5A 4TW7A 4DRPA 4G2PA 4L72B 2RUCA 3ARWA 3RM4A 1F8AB 5HT1A 2UZ5A 1GOIA 4DH0A 4R5EA 1ZCNA 3ARTA 3B8SA 1N1AA 4QIBA 2XP5A 1J4RA 4GIVA 1GUVA 2WK2A 3WD2A 1YW5A 4MGVA 1D7JA 1NWSA 2YBUA 4MPKA 3PA7A 1ZBKA 3UQBA 3ALFA 4ODQA 5DIUA 4ODLA 4TYOA 4P8UA 4PTMA 4O2TA 3EY6A 3CHEA 2AOSA 1JNEA 5HW6A 1HKKA 4HARA 2DT1A 1FKHA 2AWGA 3FY1A 3CHCA 2LPVA 4P8XA 3FXYA 1HKMA 3RFWA 3JYJA 3PRAA 2ZQTA 3KACA 1E15A 4GGQA 4P8WA 4MTVA 2MF9A 4DRJA 1ROUA 2DG9A 1FKJA 1JNSA 1T11A 2M08A 4MNMA 3O5OA 4Q22A 3W4RA 3H9RB 3ARXA 1PINA 2A3CA 1P5QA 4W5UA 1W9VA 3O5LA 3UI4A 4DRQA 4ODPA 3PRBA 2KR7A 2DT0A 3AS3A 3FAPA 4XAKA 5B8IC 1VF8A 1D7HA 3NI6A 2F2DA 3KAFA 3TCZA 3LUOA 3KADA 4Z2IA 4IT4A 2F4EA 1YATA 1E6NA 2G41A 2VCDA 4BF8A 2WM0A 4TW6A 4S3KA 4S3JA 4DWSB 1FFRA 1W9UA 4W9OA 2FDMA 2RUDA 2A3AA 3ARQA 4DRNA 3CHFA 1O6IA 4FAPA 1R9HA 4QT3A 3ARRA 4FN2A 1E9LA 1WNOA 1ZBCA 2MNTA 1E6PA 2G8ZA 1FJDA 3O5PA 2DT2A 4JFMA 4DRMA 2D9FA 1NWTA 3OOBA 1JNDA 3RM8A 2MPHA 1LQ0A 4IQCA 3AROA 3GPKA 4QZVB 3VAWA 1Q6IA 4J4NA 2LJ4A 2MLXA 4ODOA 1KFWA 4W9PA 4DRIA 1ZU8A 3KAHA 1ZBVA 2PPOA 3KAIA 1FKIA 2ESCA 3PR9A 3G6LA 1FAPA 1JNTA 1KT0A 4U84A 5HW8A 2LGOA 3B9AA 1U79A 4LAYA 1W1VA 1SYTA 3BXWA 1EDQA 3KAGA 5DIVA 1JVWA 4MNLA 3WIJA 2FKEA 2M2AA 2A3BA 1H0GA 4ITZA 2ZQVA 1FKSA 4WIWA 1HXVA 4R0XA 1J4HA 2A3EA 2XP8A 5DEZA 5J6EA 2DPEA 2LKNA 2Q5AA 1XHGA 2XP4A 4Z2GA 3CHDA 3QOKA 1M5YA 4Z2KA 1ZL1A 2PV3A 1LL7A 3ARVA 3O5MA 5HBFA 4DZ2A 4WKAA 1Q6HA 4ML4A 4ODKA 1NH6A 4KQZA 4TX0A 3ODKA 1Q1CA 3WD4A 3IKDA 2Y78A 2ITKA 3O5IA 2RURA 2IUZA 1LJYA 1GPFA 4ZPWR 4Z2LA 4JFKA 2ZR6A 4JFIA 3CGNA 1B6CA 4HBEA 4KR0B 1NWUA 3O5RA 4WKHA 1RD6A 1HJWA 4Z2HA 4U86A 3ARSA 2N87A 1KT1A 3WQWA 3JYMA 4MNKA 4NZCA 4ODMA 2OFNA 1W1TA 5BXJA 3O5GA 3RM9A 1EYMA 1ZK6A 1CTNA 1LG1A 4L3NA 3O5JA 3WL1A 5DITA 2ZR5A 5GQBA 4JFLA 1W1YA 3AS2A 4URIA 1HJVA 1NMWA 1LL4A 1SR0A 2MLZA 1A7XA 2DSUA 4NNRA 1D2KA 1EQ3A 4DWSA 1TCOC 2KI3A 2FAPA 4ODNA 1F40A 2KFWA 3WL0A 2XPAA 3ALGA 1Y0OA 1NSGA 2O9OA 2B31A 4DRHA 3WQVA 5HWCA 2WLYA 4U85A 2ZQSA 2QF8A 1X6NA 4Z2JA 2XP9A 2RSEA 3UI6A 5HUAA 4DRKA 2PPPA 1D7IA 1K9TA 3O5KA 3TDBA 4DT4A 4P8VA 1BL4A 3B7XA 5HKGA 1TFVA 1UR8A 3RGCA 2DG3A 5HWBA 1QPFA 4J4OA 1ITXA 2OLHA 4IT6A 4ODRA 3KABA 4WJXA 3AQUA 3B9DA 2L2SA 4WK9A 1OGBA 1W26A 3TC5A 3PRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD9 A;  3CGM A;  4JFK A;  1FKF A;  2PV1 A;  2VN1 A;  2ZR6 A;  3CGN A;  4JFI A;  4MSP A;  1B6C A;  3UQI A;  4W9O A;  2JZV A;  3O5R A;  5HTG A;  2RUD A;  1D6O A;  3IKG A;  2RQS A;  5HW7 A;  2DG4 A;  2XPB A;  4TW7 A;  4DRP A;  3WH0 A;  4U86 A;  4G2P A;  5D75 A;  2RUC A;  4DRN A;  1F8A B;  4JFJ A;  5HT1 A;  2N87 A;  1KT1 A;  3JYM A;  2UZ5 A;  1Q6U A;  4DH0 A;  2XP3 A;  4ODM A;  1R9H A;  2OFN A;  4FAP A;  5BXJ A;  1ZCN A;  3UF8 A;  2F21 A;  3O5G A;  4DZ3 A;  4QT3 A;  1N1A A;  4QIB A;  1EYM A;  4IPX A;  3O5D A;  2XP5 A;  4G50 A;  4FN2 A;  1J4R A;  4GIV A;  1ZK6 A;  4W9Q A;  1YW5 A;  4MGV A;  1D7J A;  2MNT A;  1FJD A;  3PA7 A;  3O5P A;  3O5J A;  2ZR4 A;  1FKD A;  4IQ2 A;  4LAW A;  5DIT A;  3UQB A;  2ZR5 A;  4JFM A;  4ODQ A;  2D9F A;  3NTP A;  4JFL A;  4DRM A;  5DIU A;  4ODL A;  4TYO A;  3OOB A;  1QZ2 A;  3KCE A;  1NMW A;  4O2T A;  3EY6 A;  2PV2 A;  2ZQU A;  2MLZ A;  1L1P A;  2MPH A;  5HW6 A;  1A7X A;  3O5Q A;  3IK8 A;  4IQC A;  4LAX A;  3GPK A;  4N19 A;  4NNR A;  3VAW A;  1Q6I A;  1EQ3 A;  3IHZ A;  1C9H A;  1TCO C;  1FKH A;  2AWG A;  2KE0 A;  4J4N A;  4C02 B;  1PBK A;  2LJ4 A;  2LPV A;  2MLX A;  4ODO A;  5GPG A;  2KI3 A;  2XP7 A;  3MDY B;  2FAP A;  2KGJ A;  4ODN A;  1F40 A;  3I6C A;  3RFW A;  2PBC A;  3JYJ A;  4W9P A;  4DRI A;  3KAH A;  2KFW A;  2KO7 A;  2PPO A;  3KAI A;  2ZQT A;  1FKK A;  3KAC A;  1FKI A;  3O5E A;  4QT2 A;  1J6Y A;  2XPA A;  4GGQ A;  1FAP A;  1JNT A;  1KT0 A;  1NSG A;  1Y0O A;  2LGO A;  3NRK A;  4U84 A;  1U79 A;  2MF9 A;  4DIP A;  4DRJ A;  4LAY A;  4DRH A;  1J4I A;  1ROU A;  5HW8 A;  1NMV A;  5HWC A;  2DG9 A;  4U85 A;  1FKJ A;  1JNS A;  1T11 A;  2M08 A;  2ZQS A;  3O5O A;  3KAG A;  5DIV A;  1JVW A;  1FKL A;  2XP6 A;  2XP9 A;  2RSE A;  3H9R B;  2FKE A;  2M2A A;  3UI6 A;  4DRO A;  2M1I A;  3JXV A;  5HUA A;  4JYS A;  1FKT A;  4ITZ A;  2ZQV A;  1PIN A;  1QPL A;  1FKS A;  1P5Q A;  4DRK A;  2PPP A;  1HXV A;  3O5L A;  3UI4 A;  2IF4 A;  4R0X A;  1J4H A;  4DRQ A;  1ROT A;  1BKF A;  1D7I A;  2XP8 A;  4ODP A;  5I98 A;  2RUQ A;  3O5K A;  2KR7 A;  3FAP A;  3PRB A;  5J6E A;  3TDB A;  2LKN A;  4DT4 A;  2Q5A A;  1BL4 A;  3B7X A;  2XP4 A;  4TW8 A;  2PPN A;  5B8I C;  3PRD A;  1FKR A;  1M5Y A;  1D7H A;  5HKG A;  4TNS A;  3KZ7 A;  3NI6 A;  2PV3 A;  3RGC A;  3UI5 A;  2F2D A;  2K8I A;  3KAF A;  3TCZ A;  2DG3 A;  3LUO A;  5HWB A;  1QPF A;  3KAD A;  2F4E A;  3O5M A;  1YAT A;  4DZ2 A;  4J4O A;  1FKB A;  1Q6H A;  4ODR A;  3KAB A;  3O5F A;  4ODK A;  2VCD A;  1FKG A;  4TX0 A;  4BF8 A;  2L2S A;  2MLY A;  3UQA A;  4TW6 A;  1W26 A;  3ODK A;  1Q1C A;  3IKD A;  2Y78 A;  3TC5 A;  2ITK A;  3O5I A;  2RUR A;  4LAV A; 
#chains in the Genus database with same CATH topology
 1FD9 A;  3G6M A;  3CGM A;  1FKF A;  2VN1 A;  1X6L A;  1D6O A;  3IKG A;  1LL6 A;  5HW7 A;  2DG4 A;  2XPB A;  2YBT A;  3WH0 A;  3WD1 A;  5D75 A;  4JFJ A;  1OGG A;  3RME A;  1Q6U A;  4MNJ A;  2DSZ A;  2WLZ A;  2XP3 A;  2F23 A;  3CH9 A;  3UF8 A;  2F21 A;  5GPR A;  4DZ3 A;  3ARY A;  4IPX A;  3O5D A;  4G50 A;  1UR9 A;  1ZBW A;  4W9Q A;  2ZR4 A;  1NWR A;  1FKD A;  4IQ2 A;  4LAW A;  3NTP A;  1QZ2 A;  3KCE A;  2PV2 A;  2ZQU A;  1L1P A;  3CZ8 A;  3O5Q A;  1W9P A;  3IK8 A;  3B9E A;  4LAX A;  4N19 A;  3IHZ A;  1C9H A;  1HJX A;  2KE0 A;  4C02 B;  1PBK A;  1EIB A;  5GPG A;  2XP7 A;  4DWS C;  4DWS D;  3MDY B;  2KGJ A;  1W1P A;  3I6C A;  2DSW A;  2PBC A;  1EHN A;  1E6Z A;  2KO7 A;  1OWQ A;  3O5E A;  4QT2 A;  1FKK A;  5DF0 A;  1J6Y A;  3AS0 A;  1HKJ A;  3NRK A;  4DIP A;  5JH8 A;  2PI6 A;  1J4I A;  1NMV A;  1E6R A;  3AS1 A;  4HBO A;  3OA5 A;  1FKL A;  3ARP A;  2XP6 A;  4ZS6 A;  4DRO A;  4NSB A;  3WD0 A;  2M1I A;  3JXV A;  4JYS A;  1FKT A;  1QPL A;  1XRV A;  2IF4 A;  1ROT A;  1BKF A;  5I98 A;  2RUQ A;  4AY1 A;  4WKF A;  4TW8 A;  4ZPV R;  2PPN A;  1FKR A;  1WAW A;  4TNS A;  1LG2 A;  3KZ7 A;  4LGX A;  3UI5 A;  3WKZ A;  2K8I A;  5DO2 A;  1H0I A;  3ARU A;  1HKI A;  1FKB A;  3O5F A;  1FKG A;  1FFQ A;  2DT3 A;  1ZB5 A;  4Q7N A;  2MLY A;  3UQA A;  3ARZ A;  2DSV A;  4LAV A;  2O92 A;  4ZPT R;  2PV1 A;  4MSP A;  1WB0 A;  3UQI A;  4MAV A;  2JZV A;  5HTG A;  3WD3 A;  2RQS A;  1IX5 A;  4TW7 A;  4DRP A;  4G2P A;  4L72 B;  2RUC A;  3ARW A;  3RM4 A;  1F8A B;  5HT1 A;  2UZ5 A;  1GOI A;  4DH0 A;  4R5E A;  1ZCN A;  3ART A;  3B8S A;  1N1A A;  4QIB A;  2XP5 A;  1J4R A;  4GIV A;  1GUV A;  2WK2 A;  3WD2 A;  1YW5 A;  4MGV A;  1D7J A;  1NWS A;  2YBU A;  4MPK A;  3PA7 A;  1ZBK A;  3UQB A;  3ALF A;  4ODQ A;  5DIU A;  4ODL A;  4TYO A;  4P8U A;  2EUL A;  4PTM A;  4O2T A;  3EY6 A;  3CHE A;  2AOS A;  1JNE A;  5HW6 A;  1HKK A;  4HAR A;  2DT1 A;  1FKH A;  2AWG A;  3FY1 A;  3CHC A;  2LPV A;  4P8X A;  3FXY A;  1HKM A;  3RFW A;  3JYJ A;  3PRA A;  2ZQT A;  3KAC A;  1E15 A;  4GGQ A;  4P8W A;  4MTV A;  2MF9 A;  4DRJ A;  1ROU A;  2DG9 A;  1FKJ A;  1JNS A;  1T11 A;  2M08 A;  4MNM A;  3O5O A;  4Q22 A;  3W4R A;  3H9R B;  3ARX A;  1E44 A;  1PIN A;  2A3C A;  1P5Q A;  4W5U A;  1W9V A;  3O5L A;  3UI4 A;  4DRQ A;  4ODP A;  3PRB A;  2KR7 A;  2DT0 A;  3AS3 A;  3FAP A;  4XAK A;  5B8I C;  1VF8 A;  1D7H A;  3NI6 A;  2F2D A;  3KAF A;  3TCZ A;  3LUO A;  3KAD A;  4Z2I A;  4IT4 A;  2F4E A;  1YAT A;  1E6N A;  2G41 A;  2VCD A;  4BF8 A;  2WM0 A;  4TW6 A;  4S3K A;  4S3J A;  4DWS B;  1FFR A;  1W9U A;  4W9O A;  2FDM A;  2RUD A;  2A3A A;  3ARQ A;  4UDM A;  4DRN A;  3GTY X;  3CHF A;  1O6I A;  4FAP A;  1R9H A;  4QT3 A;  3ARR A;  4FN2 A;  1E9L A;  1WNO A;  1ZBC A;  2MNT A;  1E6P A;  2G8Z A;  1FJD A;  3O5P A;  2DT2 A;  4JFM A;  4DRM A;  2D9F A;  1NWT A;  3OOB A;  1JND A;  3RM8 A;  2MPH A;  1LQ0 A;  4IQC A;  3ARO A;  3GPK A;  4QZV B;  3VAW A;  1Q6I A;  4J4N A;  2LJ4 A;  2MLX A;  4ODO A;  1KFW A;  4W9P A;  4DRI A;  1ZU8 A;  3KAH A;  1ZBV A;  2PPO A;  3KAI A;  1FKI A;  2ESC A;  3PR9 A;  3G6L A;  1FAP A;  1JNT A;  1KT0 A;  4U84 A;  5HW8 A;  2LGO A;  3B9A A;  1U79 A;  4LAY A;  1W1V A;  1SYT A;  3BXW A;  1EDQ A;  3KAG A;  5DIV A;  1JVW A;  4MNL A;  3WIJ A;  2FKE A;  2M2A A;  2A3B A;  1H0G A;  4ITZ A;  2ZQV A;  1FKS A;  4WIW A;  1HXV A;  4R0X A;  1J4H A;  2A3E A;  2XP8 A;  2P4V A;  5DEZ A;  5J6E A;  2DPE A;  2LKN A;  2Q5A A;  1XHG A;  2XP4 A;  4Z2G A;  3CHD A;  3QOK A;  1M5Y A;  4Z2K A;  1ZL1 A;  2PV3 A;  1LL7 A;  3ARV A;  3O5M A;  5HBF A;  4DZ2 A;  4WKA A;  1Q6H A;  4ML4 A;  4ODK A;  1NH6 A;  4KQZ A;  3GU0 A;  4TX0 A;  3ODK A;  1Q1C A;  3WD4 A;  3IKD A;  2Y78 A;  2ITK A;  3O5I A;  2RUR A;  2IUZ A;  1LJY A;  1GPF A;  4ZPW R;  4Z2L A;  4JFK A;  2ZR6 A;  4JFI A;  3CGN A;  1B6C A;  4HBE A;  4KR0 B;  1NWU A;  1JCH B;  3O5R A;  4WKH A;  1RD6 A;  1HJW A;  4Z2H A;  4U86 A;  3ARS A;  2N87 A;  1KT1 A;  3WQW A;  3JYM A;  4MNK A;  4NZC A;  2ETN A;  4ODM A;  2OFN A;  1W1T A;  5BXJ A;  3O5G A;  3RM9 A;  1EYM A;  3EIP A;  1ZK6 A;  1CTN A;  1LG1 A;  4L3N A;  3O5J A;  3WL1 A;  5DIT A;  2ZR5 A;  5GQB A;  4JFL A;  1W1Y A;  3AS2 A;  4URI A;  1HJV A;  1NMW A;  1LL4 A;  1SR0 A;  2MLZ A;  1A7X A;  2DSU A;  4NNR A;  1D2K A;  1EQ3 A;  4DWS A;  1TCO C;  2B5U B;  2KI3 A;  2FAP A;  1GRJ A;  4ODN A;  1F40 A;  2PN0 A;  2KFW A;  3WL0 A;  2XPA A;  3ALG A;  1Y0O A;  1NSG A;  2O9O A;  2B31 A;  4DRH A;  3WQV A;  5HWC A;  2WLY A;  4U85 A;  2ZQS A;  2QF8 A;  1X6N A;  4Z2J A;  2XP9 A;  2RSE A;  3UI6 A;  3BMB A;  5HUA A;  4DRK A;  2PPP A;  1D7I A;  1K9T A;  3O5K A;  3TDB A;  4DT4 A;  4P8V A;  1BL4 A;  3B7X A;  5HKG A;  1TFV A;  1UR8 A;  3RGC A;  2DG3 A;  5HWB A;  1QPF A;  4J4O A;  1ITX A;  2OLH A;  4IT6 A;  4ODR A;  3KAB A;  4WJX A;  3AQU A;  3B9D A;  2L2S A;  4WK9 A;  1OGB A;  1W26 A;  3TC5 A;  3PRD A; 
#chains in the Genus database with same CATH homology
 1FD9 A;  3G6M A;  3CGM A;  1FKF A;  2VN1 A;  1X6L A;  1D6O A;  3IKG A;  1LL6 A;  5HW7 A;  2DG4 A;  2XPB A;  2YBT A;  3WH0 A;  3WD1 A;  5D75 A;  4JFJ A;  1OGG A;  3RME A;  1Q6U A;  4MNJ A;  2DSZ A;  2WLZ A;  2XP3 A;  3CH9 A;  3UF8 A;  2F21 A;  5GPR A;  4DZ3 A;  3ARY A;  4IPX A;  3O5D A;  4G50 A;  1UR9 A;  1ZBW A;  4W9Q A;  2ZR4 A;  1NWR A;  1FKD A;  4IQ2 A;  4LAW A;  3NTP A;  1QZ2 A;  3KCE A;  2PV2 A;  2ZQU A;  1L1P A;  3CZ8 A;  3O5Q A;  1W9P A;  3IK8 A;  3B9E A;  4LAX A;  4N19 A;  3IHZ A;  1C9H A;  1HJX A;  2KE0 A;  4C02 B;  1PBK A;  1EIB A;  5GPG A;  2XP7 A;  4DWS C;  4DWS D;  3MDY B;  2KGJ A;  1W1P A;  3I6C A;  2DSW A;  2PBC A;  1EHN A;  1E6Z A;  3O5E A;  1OWQ A;  2KO7 A;  4QT2 A;  1FKK A;  5DF0 A;  1J6Y A;  3AS0 A;  1HKJ A;  3NRK A;  4DIP A;  5JH8 A;  2PI6 A;  1J4I A;  1NMV A;  1E6R A;  3AS1 A;  4HBO A;  3OA5 A;  1FKL A;  3ARP A;  2XP6 A;  4ZS6 A;  4DRO A;  4NSB A;  3WD0 A;  2M1I A;  3JXV A;  4JYS A;  1FKT A;  1QPL A;  1XRV A;  2IF4 A;  1ROT A;  1BKF A;  5I98 A;  2RUQ A;  4AY1 A;  4WKF A;  4TW8 A;  4ZPV R;  2PPN A;  1FKR A;  1WAW A;  4TNS A;  1LG2 A;  3KZ7 A;  4LGX A;  3UI5 A;  3WKZ A;  2K8I A;  5DO2 A;  1H0I A;  3ARU A;  1HKI A;  1FKB A;  3O5F A;  1FKG A;  1FFQ A;  2DT3 A;  1ZB5 A;  4Q7N A;  2MLY A;  3UQA A;  3ARZ A;  2DSV A;  4LAV A;  2O92 A;  4ZPT R;  2PV1 A;  4MSP A;  1WB0 A;  3UQI A;  4MAV A;  2JZV A;  5HTG A;  3WD3 A;  2RQS A;  1IX5 A;  4TW7 A;  4DRP A;  4G2P A;  4L72 B;  2RUC A;  3ARW A;  3RM4 A;  1F8A B;  5HT1 A;  2UZ5 A;  1GOI A;  4DH0 A;  4R5E A;  1ZCN A;  3ART A;  3B8S A;  1N1A A;  4QIB A;  2XP5 A;  1J4R A;  4GIV A;  1GUV A;  2WK2 A;  3WD2 A;  1YW5 A;  4MGV A;  1D7J A;  1NWS A;  2YBU A;  4MPK A;  3PA7 A;  1ZBK A;  3UQB A;  3ALF A;  4ODQ A;  5DIU A;  4ODL A;  4TYO A;  4P8U A;  4PTM A;  4O2T A;  3EY6 A;  3CHE A;  2AOS A;  1JNE A;  5HW6 A;  1HKK A;  4HAR A;  2DT1 A;  1FKH A;  2AWG A;  3FY1 A;  3CHC A;  2LPV A;  4P8X A;  3FXY A;  1HKM A;  3RFW A;  3JYJ A;  3PRA A;  2ZQT A;  3KAC A;  1E15 A;  4GGQ A;  4P8W A;  4MTV A;  2MF9 A;  4DRJ A;  1ROU A;  2DG9 A;  1FKJ A;  1JNS A;  1T11 A;  2M08 A;  4MNM A;  3O5O A;  4Q22 A;  3W4R A;  3H9R B;  3ARX A;  1PIN A;  2A3C A;  1P5Q A;  4W5U A;  1W9V A;  3O5L A;  3UI4 A;  4DRQ A;  4ODP A;  3PRB A;  2KR7 A;  2DT0 A;  3AS3 A;  3FAP A;  4XAK A;  5B8I C;  1VF8 A;  1D7H A;  3NI6 A;  2F2D A;  3KAF A;  3TCZ A;  3LUO A;  3KAD A;  4Z2I A;  4IT4 A;  2F4E A;  1YAT A;  1E6N A;  2G41 A;  2VCD A;  4BF8 A;  2WM0 A;  4TW6 A;  4S3K A;  4S3J A;  4DWS B;  1FFR A;  1W9U A;  4W9O A;  2FDM A;  2RUD A;  2A3A A;  3ARQ A;  4DRN A;  3CHF A;  1O6I A;  4FAP A;  1R9H A;  4QT3 A;  3ARR A;  4FN2 A;  1E9L A;  1WNO A;  1ZBC A;  2MNT A;  1E6P A;  2G8Z A;  1FJD A;  3O5P A;  2DT2 A;  4JFM A;  4DRM A;  2D9F A;  1NWT A;  3OOB A;  1JND A;  3RM8 A;  2MPH A;  1LQ0 A;  4IQC A;  3ARO A;  3GPK A;  4QZV B;  3VAW A;  1Q6I A;  4J4N A;  2LJ4 A;  2MLX A;  4ODO A;  1KFW A;  4W9P A;  4DRI A;  1ZU8 A;  3KAH A;  1ZBV A;  2PPO A;  3KAI A;  1FKI A;  2ESC A;  3PR9 A;  3G6L A;  1FAP A;  1JNT A;  1KT0 A;  4U84 A;  5HW8 A;  2LGO A;  3B9A A;  1U79 A;  4LAY A;  1W1V A;  1SYT A;  3BXW A;  1EDQ A;  3KAG A;  5DIV A;  1JVW A;  4MNL A;  3WIJ A;  2FKE A;  2M2A A;  2A3B A;  1H0G A;  4ITZ A;  2ZQV A;  1FKS A;  4WIW A;  1HXV A;  4R0X A;  1J4H A;  2A3E A;  2XP8 A;  5DEZ A;  5J6E A;  2DPE A;  2LKN A;  2Q5A A;  1XHG A;  2XP4 A;  4Z2G A;  3CHD A;  3QOK A;  1M5Y A;  4Z2K A;  1ZL1 A;  2PV3 A;  1LL7 A;  3ARV A;  3O5M A;  5HBF A;  4DZ2 A;  4WKA A;  1Q6H A;  4ML4 A;  4ODK A;  1NH6 A;  4KQZ A;  4TX0 A;  3ODK A;  1Q1C A;  3WD4 A;  3IKD A;  2Y78 A;  2ITK A;  3O5I A;  2RUR A;  2IUZ A;  1LJY A;  1GPF A;  4ZPW R;  4Z2L A;  4JFK A;  2ZR6 A;  4JFI A;  3CGN A;  1B6C A;  4HBE A;  4KR0 B;  1NWU A;  3O5R A;  4WKH A;  1RD6 A;  1HJW A;  4Z2H A;  4U86 A;  3ARS A;  2N87 A;  1KT1 A;  3WQW A;  3JYM A;  4MNK A;  4NZC A;  4ODM A;  2OFN A;  1W1T A;  5BXJ A;  3O5G A;  3RM9 A;  1EYM A;  1ZK6 A;  1CTN A;  1LG1 A;  4L3N A;  3O5J A;  3WL1 A;  5DIT A;  2ZR5 A;  5GQB A;  4JFL A;  1W1Y A;  3AS2 A;  4URI A;  1HJV A;  1NMW A;  1LL4 A;  1SR0 A;  2MLZ A;  1A7X A;  2DSU A;  4NNR A;  1D2K A;  1EQ3 A;  4DWS A;  1TCO C;  2KI3 A;  2FAP A;  4ODN A;  1F40 A;  2KFW A;  3WL0 A;  2XPA A;  3ALG A;  1Y0O A;  1NSG A;  2O9O A;  2B31 A;  4DRH A;  3WQV A;  5HWC A;  2WLY A;  4U85 A;  2ZQS A;  2QF8 A;  1X6N A;  4Z2J A;  2XP9 A;  2RSE A;  3UI6 A;  5HUA A;  4DRK A;  2PPP A;  1D7I A;  1K9T A;  3O5K A;  3TDB A;  4DT4 A;  4P8V A;  1BL4 A;  3B7X A;  5HKG A;  1TFV A;  1UR8 A;  3RGC A;  2DG3 A;  5HWB A;  1QPF A;  4J4O A;  1ITX A;  2OLH A;  4IT6 A;  4ODR A;  3KAB A;  4WJX A;  3AQU A;  3B9D A;  2L2S A;  4WK9 A;  1OGB A;  1W26 A;  3TC5 A;  3PRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...