5JH8A

Crystal structure of chitinase from chromobacterium violaceum atcc 12472
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
309
Chain Sequence
AAMVLAYYSGYAGNYAALTRYAASFNAVAVDFYNITAQGAVTGNGDPAPNDAISFLLGRIPAYGCVSNVDGNGNWSADIAHAVSTSAQSQAVANLVFAQDRFSGINVDFEAVAQGDRNNFSHFIQVLGRALHAKGLLIVSVPAFSADENHPANYGYDLRALGAAADYLQIMSYDEAIPAWDPGPVAGSDWMEDDLDYAVERVPAAKILNGIPAYGYDWRPGDGGMLYWDTQALIARYGAQPRYDAGTHSLTFNYGAADGSRHTVWTENARSVALKASLVNAYGLGGTSLYALGMEDDAFWAAVQGLAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable chitinase
publication title Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
total genus 101
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5jh8A02
1X6NA 1W9VA 1HKIA 3FY1A 5DEZA 5HBFA 4DWSC 1EDQA 3WD4A 1LJYA 3AQUA 1RD6A 1FFQA 1GUVA 2FDMA 1ZL1A 2WK2A 2DT2A 3AROA 1TFVA 3WL0A 4Z2KA 1ZBVA 1NWRA 4S3KA 3WQVA 4MPKA 1ZBWA 2YBUA 4P8WA 1EIBA 2YBTA 3WD2A 1OGBA 3B8SA 2A3BA 2DSWA 1HKKA 3WD0A 1GOIA 4WKAA 4WIWA 1H0IA 4MNKA 4Z2LA 3W4RA 3CHCA 3AS1A 1ZB5A 4MNMA 2DPEA 1OGGA 2O92A 4NZCA 5DF0A 2ESCA 3WD3A 3B9EA 1WNOA 2G41A 4DWSA 3ARPA 4ML4A 4Q7NA 3WQWA 4URIA 3BXWA 1ZBKA 1ITXA 1H0GA 3ARZA 1E6ZA 3AS3A 3ARYA 3ARXA 3WD1A 1EHNA 4MAVA 4Z2IA 2WLYA 3ARUA 1ZU8A 5JH8A 4Z2HA 1SYTA 4PTMA 2DSVA 1VF8A 1E6PA 1NWSA 1JNEA 3RM9A 3QOKA 3G6MA 1W1YA 1KFWA 1GPFA 3G6LA 4Z2GA 3ARSA 2A3AA 1E15A 1FFRA 2A3CA 2DT1A 3B9DA 3ARRA 4WJXA 1W1VA 4WKFA 1LL6A 2QF8A 1W1PA 3WKZA 1WB0A 3CHDA 4R5EA 1E6NA 4DWSB 3CHFA 1HJWA 2DSUA 1OWQA 1W1TA 1SR0A 1ZBCA 1CTNA 4P8VA 3ARQA 3ARWA 1W9PA 2PI6A 2WM0A 3B9AA 1XRVA 1HKMA 2DT3A 1NWTA 1UR9A 2WLZA 1E6RA 4MNJA 1E9LA 1LG2A 1UR8A 3RMEA 3WIJA 2G8ZA 4P8XA 2A3EA 4S3JA 3CZ8A 4NSBA 3CHEA 1W9UA 4Q22A 1JNDA 3RM8A 1NWUA 2DT0A 1HJXA 3AS2A 4MNLA 2DSZA 1X6LA 1HJVA 2IUZA 2O9OA 3AS0A 1K9TA 3ARTA 4MTVA 5GQBA 1NH6A 4AY1A 4DWSD 1LQ0A 1D2KA 4LGXA 1LL7A 1O6IA 1WAWA 2B31A 4P8UA 4W5UA 3OA5A 3ARVA 1XHGA 3CH9A 1LG1A 1HKJA 4WK9A 3WL1A 3RM4A 4Z2JA 3ALFA 1LL4A 2OLHA 4WKHA 5GPRA 2AOSA 3FXYA 3ALGA
chains in the Genus database with same CATH superfamily
1X6NA 5HBFA 1HKIA 5DEZA 3VAWA 1FFQA 2WK2A 1ZL1A 1FJDA 2DT2A 4W9QA 1TFVA 4TX0A 1JVWA 1N1AA 4LAXA 1F40A 3UQIA 2A3BA 2DSWA 2PV3A 4DH0A 4WIWA 3O5MA 1HXVA 5HTGA 2IF4A 1YATA 3EIPA 3WD3A 4DWSA 3KAGA 3O5OA 3O5IA 3ARPA 3WQWA 4URIA 3BXWA 1ZBKA 4ODKA 1W26A 3WD1A 1P5QA 5HW6A 3JYMA 2FKEA 4DRJA 3G6LA 3KAFA 4Z2GA 2ZQUA 4MGVA 3CGNA 1FKKA 2A3AA 1J4RA 4KR0B 4WJXA 2MF9A 3ODKA 2XP3A 2DSUA 1SR0A 3B7XA 2PPPA 4TW8A 3ARQA 3PR9A 4ITZA 2Q5AA 1M5YA 2UZ5A 1NWTA 1UR9A 2XP6A 5DIVA 5DIUA 1U79A 3JYJA 4P8XA 4JFKA 1JNDA 2DT0A 3O5KA 1B6CA 1HJVA 4L72B 2O9OA 1NH6A 1PBKA 2K8IA 2F2DA 1O6IA 3MDYB 3ARVA 4LAVA 3IK8A 1LG1A 5I98A 2MLZA 1ZK6A 3RM4A 5GPGA 4TNSA 4FN2A 3ALFA 1D6OA 4W9OA 5GPRA 2AOSA 4DRKA 1W9VA 1FKGA 1QPFA 2LKNA 2PN0A 1EDQA 3KZ7A 3AQUA 4G2PA 2FDMA 1NWRA 4L3NA 1TCOC 1ZBWA 4ZPTR 3O5LA 3WD0A 1GOIA 1D7JA 1FKBA 2XP7A 3IKDA 2EULA 4DRHA 4GGQA 2XP9A 1ROTA 1D7HA 1QPLA 1NMWA 4MNMA 3O5PA 1OGGA 4MSPA 5DO2A 2KFWA 3GTYX 2DG4A 4Q7NA 4J4OA 1L1PA 4JFIA 4IPXA 3ARXA 1EHNA 1PINA 4MAVA 2XP4A 1ZU8A 2LJ4A 3KABA 2DSVA 1E6PA 4TW6A 1J4HA 3RM9A 1W1YA 4QIBA 2M08A 2F23A 5HT1A 5HW7A 1QZ2A 1FFRA 2A3CA 1Q6UA 3B9DA 1W1PA 1ZCNA 4N19A 1WB0A 4UDMA 5BXJA 1NMVA 2ZQTA 3UI6A 2XPBA 4ZPVR 2PPOA 2B5UB 1OWQA 5HWCA 1FKTA 3ARWA 4JFJA 4TW7A 4DROA 4QT3A 1HKMA 3KACA 2WLZA 4MNJA 2DG9A 5D75A 4R0XA 3O5JA 2PV2A 2ZQSA 4NSBA 4Q22A 2XP5A 3AS2A 1D2KA 1LL7A 1WAWA 4P8UA 4W5UA 4BF8A 4QT2A 3UI4A 3NTPA 2RUQA 5DITA 1JNTA 1HKJA 3WL1A 3KADA 3H9RB 3FAPA 1LL4A 2F21A 2MPHA 3ALGA 4DT4A 2N87A 2F4EA 4DWSC 3WD4A 3O5QA 2RURA 1RD6A 2L2SA 1FAPA 3BMBA 3WL0A 4Z2KA 4LAYA 3WQVA 4S3KA 4MPKA 1YW5A 4IT6A 4P8WA 2YBTA 3WD2A 3O5FA 1OGBA 1EQ3A 4ZPWR 3B8SA 3IKGA 1HKKA 1Y0OA 4J4NA 2AWGA 4DRMA 4DRPA 1H0IA 4MNKA 2KR7A 2ZR4A 1BKFA 3JXVA 3PRDA 3W4RA 3CHCA 3O5RA 3AS1A 1ZB5A 4XAKA 5DF0A 2DPEA 2M1IA 2O92A 3O5DA 1WNOA 3GU0A 4ML4A 1H0GA 2MLXA 4JFMA 2WLYA 5HWBA 1SYTA 4KQZA 1VF8A 2MNTA 2PPNA 1F8AB 1JCHB 1GPFA 4U85A 2XPAA 3ARSA 2ZR5A 1NSGA 4ODOA 2OFNA 4WKFA 1EYMA 1LL6A 2QF8A 2ZR6A 3WKZA 3CHDA 4R5EA 1E6NA 1KT1A 3UI5A 4QZVB 3CHFA 5HUAA 3GPKA 4TYOA 1ZBCA 1Q6HA 4DIPA 4JFLA 1FKLA 1W9PA 4DZ3A 1XRVA 2DT3A 4ODRA 3RMEA 1Q6IA 1J6YA 2G8ZA 2LPVA 3PRBA 3CZ8A 4IT4A 2LGOA 4ODNA 1NWUA 1HJXA 3I6CA 2RUCA 2DSZA 4DZ2A 1X6LA 2KGJA 3AS0A 1K9TA 4AY1A 4DWSD 1LQ0A 1GRJA 2ZQVA 5B8IC 1XHGA 1Q1CA 2RQSA 1J4IA 1C9HA 3RFWA 3O5GA 1T11A 4U84A 2OLHA 4WKHA 2ITKA 4FAPA 2VCDA 4W9PA 3FY1A 2RUDA 4ODMA 1ROUA 4ZS6A 1LJYA 3KCEA 1GUVA 3AROA 3O5EA 4G50A 2ETNA 1A7XA 1ZBVA 2P4VA 4ODQA 2YBUA 1EIBA 1IX5A 1FKHA 2KI3A 4WKAA 4Z2LA 2Y78A 2FAPA 4NZCA 2ESCA 3IHZA 3B9EA 1D7IA 2G41A 4NNRA 3LUOA 4GIVA 4IQCA 1ITXA 1E44A 3ARZA 1E6ZA 3AS3A 3ARYA 1FKSA 3RGCA 4Z2IA 3ARUA 5JH8A 3EY6A 3PRAA 4Z2HA 4PTMA 3UQBA 1NWSA 4HARA 4DRIA 1JNEA 4IQ2A 3QOKA 3G6MA 4O2TA 1KFWA 5HKGA 1FD9A 2M2AA 3KAHA 3CGMA 3WH0A 1E15A 3PA7A 3OOBA 2DT1A 3ARRA 3UF8A 5HW8A 2JZVA 1W1VA 2XP8A 2DG3A 4DRNA 4DWSB 2KE0A 3TC5A 1HJWA 3TDBA 2RSEA 1W1TA 1CTNA 4P8VA 2WM0A 2PI6A 1FKJA 3B9AA 4JYSA 4DRQA 1E6RA 1E9LA 1LG2A 3TCZA 5J6EA 1UR8A 3WIJA 4U86A 4C02B 1KT0A 2A3EA 4S3JA 1BL4A 1FKRA 3NI6A 3CHEA 1W9UA 2VN1A 3RM8A 4MNLA 2IUZA 4MTVA 2KO7A 3ARTA 5GQBA 4HBEA 4LGXA 4ODPA 2B31A 2PV1A 1JNSA 1FKDA 3OA5A 2PBCA 3CH9A 3NRKA 2D9FA 4HBOA 4WK9A 1FKFA 4Z2JA 3KAIA 4LAWA 2MLYA 1R9HA 3UQAA 1FKIA 3FXYA 4ODLA
chains in the Genus database with same CATH topology
1X6NA 5HBFA 1HKIA 5DEZA 3VAWA 1FFQA 2WK2A 1ZL1A 1FJDA 2DT2A 4W9QA 1TFVA 4TX0A 1JVWA 1N1AA 4LAXA 1F40A 3UQIA 2A3BA 2DSWA 2PV3A 4DH0A 4WIWA 3O5MA 1HXVA 5HTGA 2IF4A 1YATA 3WD3A 4DWSA 3KAGA 3O5OA 3O5IA 3ARPA 3WQWA 4URIA 3BXWA 1ZBKA 4ODKA 1W26A 3WD1A 1P5QA 5HW6A 3JYMA 2FKEA 4DRJA 3G6LA 3KAFA 4Z2GA 2ZQUA 4MGVA 3CGNA 1FKKA 2A3AA 1J4RA 4KR0B 4WJXA 2MF9A 3ODKA 2XP3A 2DSUA 1SR0A 3B7XA 2PPPA 4TW8A 3ARQA 3PR9A 4ITZA 2Q5AA 1M5YA 2UZ5A 1NWTA 1UR9A 2XP6A 5DIVA 5DIUA 1U79A 3JYJA 4P8XA 4JFKA 1JNDA 2DT0A 3O5KA 1B6CA 1HJVA 4L72B 2O9OA 1NH6A 1PBKA 2K8IA 2F2DA 1O6IA 3MDYB 3ARVA 4LAVA 3IK8A 1LG1A 5I98A 2MLZA 1ZK6A 3RM4A 5GPGA 4TNSA 4FN2A 3ALFA 1D6OA 4W9OA 5GPRA 2AOSA 4DRKA 1W9VA 1FKGA 1QPFA 2LKNA 1EDQA 3KZ7A 3AQUA 4G2PA 2FDMA 1NWRA 4L3NA 1TCOC 1ZBWA 4ZPTR 3O5LA 3WD0A 1GOIA 1D7JA 1FKBA 2XP7A 3IKDA 4DRHA 4GGQA 2XP9A 1ROTA 1D7HA 1QPLA 1NMWA 4MNMA 3O5PA 1OGGA 4MSPA 5DO2A 2KFWA 2DG4A 4Q7NA 4J4OA 1L1PA 4JFIA 4IPXA 3ARXA 1EHNA 1PINA 4MAVA 2XP4A 1ZU8A 2LJ4A 3KABA 2DSVA 1E6PA 4TW6A 1J4HA 3RM9A 1W1YA 4QIBA 2M08A 5HT1A 5HW7A 1QZ2A 1FFRA 2A3CA 1Q6UA 3B9DA 1W1PA 1ZCNA 4N19A 1WB0A 5BXJA 1NMVA 2ZQTA 3UI6A 2XPBA 4ZPVR 2PPOA 1OWQA 5HWCA 1FKTA 3ARWA 4JFJA 4TW7A 4DROA 4QT3A 1HKMA 3KACA 2WLZA 4MNJA 2DG9A 5D75A 4R0XA 3O5JA 2PV2A 2ZQSA 4NSBA 4Q22A 2XP5A 3AS2A 1D2KA 1LL7A 1WAWA 4P8UA 4W5UA 4BF8A 4QT2A 3UI4A 3NTPA 2RUQA 5DITA 1JNTA 1HKJA 3WL1A 3KADA 3H9RB 3FAPA 1LL4A 2F21A 2MPHA 3ALGA 4DT4A 2N87A 2F4EA 4DWSC 3WD4A 3O5QA 2RURA 1RD6A 2L2SA 1FAPA 3WL0A 4Z2KA 4LAYA 3WQVA 4S3KA 4MPKA 1YW5A 4IT6A 4P8WA 2YBTA 3WD2A 3O5FA 1OGBA 1EQ3A 4ZPWR 3B8SA 3IKGA 1HKKA 1Y0OA 4J4NA 2AWGA 4DRMA 4DRPA 1H0IA 4MNKA 2KR7A 2ZR4A 1BKFA 3JXVA 3PRDA 3W4RA 3CHCA 3O5RA 3AS1A 1ZB5A 4XAKA 5DF0A 2DPEA 2M1IA 2O92A 3O5DA 1WNOA 4ML4A 1H0GA 2MLXA 4JFMA 2WLYA 5HWBA 1SYTA 4KQZA 1VF8A 2MNTA 2PPNA 1F8AB 1GPFA 4U85A 2XPAA 3ARSA 2ZR5A 1NSGA 4ODOA 2OFNA 4WKFA 1EYMA 1LL6A 2QF8A 2ZR6A 3WKZA 3CHDA 4R5EA 1E6NA 1KT1A 3UI5A 4QZVB 3CHFA 5HUAA 3GPKA 4TYOA 1ZBCA 1Q6HA 4DIPA 4JFLA 1FKLA 1W9PA 4DZ3A 1XRVA 2DT3A 4ODRA 3RMEA 1Q6IA 1J6YA 2G8ZA 2LPVA 3PRBA 3CZ8A 4IT4A 2LGOA 4ODNA 1NWUA 1HJXA 3I6CA 2RUCA 2DSZA 4DZ2A 1X6LA 2KGJA 3AS0A 1K9TA 4AY1A 4DWSD 1LQ0A 2ZQVA 5B8IC 1XHGA 1Q1CA 2RQSA 1J4IA 1C9HA 3RFWA 3O5GA 1T11A 4U84A 2OLHA 4WKHA 2ITKA 4FAPA 2VCDA 4W9PA 3FY1A 2RUDA 4ODMA 1ROUA 4ZS6A 1LJYA 3KCEA 1GUVA 3AROA 3O5EA 4G50A 1A7XA 1ZBVA 4ODQA 2YBUA 1EIBA 1IX5A 1FKHA 2KI3A 4WKAA 4Z2LA 2Y78A 2FAPA 4NZCA 2ESCA 3IHZA 3B9EA 1D7IA 2G41A 4NNRA 3LUOA 4GIVA 4IQCA 1ITXA 3ARZA 1E6ZA 3AS3A 3ARYA 1FKSA 3RGCA 4Z2IA 3ARUA 5JH8A 3EY6A 3PRAA 4Z2HA 4PTMA 3UQBA 1NWSA 4HARA 4DRIA 1JNEA 4IQ2A 3QOKA 3G6MA 4O2TA 1KFWA 5HKGA 1FD9A 2M2AA 3KAHA 3CGMA 3WH0A 1E15A 3PA7A 3OOBA 2DT1A 3ARRA 3UF8A 5HW8A 2JZVA 1W1VA 2XP8A 2DG3A 4DRNA 4DWSB 2KE0A 3TC5A 1HJWA 3TDBA 2RSEA 1W1TA 1CTNA 4P8VA 2WM0A 2PI6A 1FKJA 3B9AA 4JYSA 4DRQA 1E6RA 1E9LA 1LG2A 3TCZA 5J6EA 1UR8A 3WIJA 4U86A 4C02B 1KT0A 2A3EA 4S3JA 1BL4A 1FKRA 3NI6A 3CHEA 1W9UA 2VN1A 3RM8A 4MNLA 2IUZA 4MTVA 2KO7A 3ARTA 5GQBA 4HBEA 4LGXA 4ODPA 2B31A 2PV1A 1JNSA 1FKDA 3OA5A 2PBCA 3CH9A 3NRKA 2D9FA 4HBOA 4WK9A 1FKFA 4Z2JA 3KAIA 4LAWA 2MLYA 1R9HA 3UQAA 1FKIA 3FXYA 4ODLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6N A;  1W9V A;  1HKI A;  3FY1 A;  5DEZ A;  5HBF A;  4DWS C;  1EDQ A;  3WD4 A;  1LJY A;  3AQU A;  1RD6 A;  1FFQ A;  1GUV A;  2FDM A;  1ZL1 A;  2WK2 A;  2DT2 A;  3ARO A;  1TFV A;  3WL0 A;  4Z2K A;  1ZBV A;  1NWR A;  4S3K A;  3WQV A;  4MPK A;  1ZBW A;  2YBU A;  4P8W A;  1EIB A;  2YBT A;  3WD2 A;  1OGB A;  3B8S A;  2A3B A;  2DSW A;  1HKK A;  3WD0 A;  1GOI A;  4WKA A;  4WIW A;  1H0I A;  4MNK A;  4Z2L A;  3W4R A;  3CHC A;  3AS1 A;  1ZB5 A;  4MNM A;  2DPE A;  1OGG A;  2O92 A;  4NZC A;  5DF0 A;  2ESC A;  3WD3 A;  3B9E A;  1WNO A;  2G41 A;  4DWS A;  3ARP A;  4ML4 A;  4Q7N A;  3WQW A;  4URI A;  3BXW A;  1ZBK A;  1ITX A;  1H0G A;  3ARZ A;  1E6Z A;  3AS3 A;  3ARY A;  3ARX A;  3WD1 A;  1EHN A;  4MAV A;  4Z2I A;  2WLY A;  3ARU A;  1ZU8 A;  5JH8 A;  4Z2H A;  1SYT A;  4PTM A;  2DSV A;  1VF8 A;  1E6P A;  1NWS A;  1JNE A;  3RM9 A;  3QOK A;  3G6M A;  1W1Y A;  1KFW A;  1GPF A;  3G6L A;  4Z2G A;  3ARS A;  2A3A A;  1E15 A;  1FFR A;  2A3C A;  2DT1 A;  3B9D A;  3ARR A;  4WJX A;  1W1V A;  4WKF A;  1LL6 A;  2QF8 A;  1W1P A;  3WKZ A;  1WB0 A;  3CHD A;  4R5E A;  1E6N A;  4DWS B;  3CHF A;  1HJW A;  2DSU A;  1OWQ A;  1W1T A;  1SR0 A;  1ZBC A;  1CTN A;  4P8V A;  3ARQ A;  3ARW A;  1W9P A;  2PI6 A;  2WM0 A;  3B9A A;  1XRV A;  1HKM A;  2DT3 A;  1NWT A;  1UR9 A;  2WLZ A;  1E6R A;  4MNJ A;  1E9L A;  1LG2 A;  1UR8 A;  3RME A;  3WIJ A;  2G8Z A;  4P8X A;  2A3E A;  4S3J A;  3CZ8 A;  4NSB A;  3CHE A;  1W9U A;  4Q22 A;  1JND A;  3RM8 A;  1NWU A;  2DT0 A;  1HJX A;  3AS2 A;  4MNL A;  2DSZ A;  1X6L A;  1HJV A;  2IUZ A;  2O9O A;  3AS0 A;  1K9T A;  3ART A;  4MTV A;  5GQB A;  1NH6 A;  4AY1 A;  4DWS D;  1LQ0 A;  1D2K A;  4LGX A;  1LL7 A;  1O6I A;  1WAW A;  2B31 A;  4P8U A;  4W5U A;  3OA5 A;  3ARV A;  1XHG A;  3CH9 A;  1LG1 A;  1HKJ A;  4WK9 A;  3WL1 A;  3RM4 A;  4Z2J A;  3ALF A;  1LL4 A;  2OLH A;  4WKH A;  5GPR A;  2AOS A;  3FXY A;  3ALG A; 
#chains in the Genus database with same CATH topology
 1X6N A;  5HBF A;  1HKI A;  5DEZ A;  3VAW A;  1FFQ A;  2WK2 A;  1ZL1 A;  1FJD A;  2DT2 A;  4W9Q A;  1TFV A;  4TX0 A;  1JVW A;  1N1A A;  4LAX A;  1F40 A;  3UQI A;  2A3B A;  2DSW A;  2PV3 A;  4DH0 A;  4WIW A;  3O5M A;  1HXV A;  5HTG A;  2IF4 A;  1YAT A;  3EIP A;  3WD3 A;  4DWS A;  3KAG A;  3O5O A;  3O5I A;  3ARP A;  3WQW A;  4URI A;  3BXW A;  1ZBK A;  4ODK A;  1W26 A;  3WD1 A;  1P5Q A;  5HW6 A;  3JYM A;  2FKE A;  4DRJ A;  3G6L A;  3KAF A;  4Z2G A;  2ZQU A;  4MGV A;  3CGN A;  1FKK A;  2A3A A;  1J4R A;  4KR0 B;  4WJX A;  2MF9 A;  3ODK A;  2XP3 A;  2DSU A;  1SR0 A;  3B7X A;  2PPP A;  4TW8 A;  3ARQ A;  3PR9 A;  4ITZ A;  2Q5A A;  1M5Y A;  2UZ5 A;  1NWT A;  1UR9 A;  2XP6 A;  5DIV A;  5DIU A;  1U79 A;  3JYJ A;  4P8X A;  4JFK A;  1JND A;  2DT0 A;  3O5K A;  1B6C A;  1HJV A;  4L72 B;  2O9O A;  1NH6 A;  1PBK A;  2K8I A;  2F2D A;  1O6I A;  3MDY B;  3ARV A;  4LAV A;  3IK8 A;  1LG1 A;  5I98 A;  2MLZ A;  1ZK6 A;  3RM4 A;  5GPG A;  4TNS A;  4FN2 A;  3ALF A;  1D6O A;  4W9O A;  5GPR A;  2AOS A;  4DRK A;  1W9V A;  1FKG A;  1QPF A;  2LKN A;  2PN0 A;  1EDQ A;  3KZ7 A;  3AQU A;  4G2P A;  2FDM A;  1NWR A;  4L3N A;  1TCO C;  1ZBW A;  4ZPT R;  3O5L A;  3WD0 A;  1GOI A;  1D7J A;  1FKB A;  2XP7 A;  3IKD A;  2EUL A;  4DRH A;  4GGQ A;  2XP9 A;  1ROT A;  1D7H A;  1QPL A;  1NMW A;  4MNM A;  3O5P A;  1OGG A;  4MSP A;  5DO2 A;  2KFW A;  3GTY X;  2DG4 A;  4Q7N A;  4J4O A;  1L1P A;  4JFI A;  4IPX A;  3ARX A;  1EHN A;  1PIN A;  4MAV A;  2XP4 A;  1ZU8 A;  2LJ4 A;  3KAB A;  2DSV A;  1E6P A;  4TW6 A;  1J4H A;  3RM9 A;  1W1Y A;  4QIB A;  2M08 A;  2F23 A;  5HT1 A;  5HW7 A;  1QZ2 A;  1FFR A;  2A3C A;  1Q6U A;  3B9D A;  1W1P A;  1ZCN A;  4N19 A;  1WB0 A;  4UDM A;  5BXJ A;  1NMV A;  2ZQT A;  3UI6 A;  2XPB A;  4ZPV R;  2PPO A;  2B5U B;  1OWQ A;  5HWC A;  1FKT A;  3ARW A;  4JFJ A;  4TW7 A;  4DRO A;  4QT3 A;  1HKM A;  3KAC A;  2WLZ A;  4MNJ A;  2DG9 A;  5D75 A;  4R0X A;  3O5J A;  2PV2 A;  2ZQS A;  4NSB A;  4Q22 A;  2XP5 A;  3AS2 A;  1D2K A;  1LL7 A;  1WAW A;  4P8U A;  4W5U A;  4BF8 A;  4QT2 A;  3UI4 A;  3NTP A;  2RUQ A;  5DIT A;  1JNT A;  1HKJ A;  3WL1 A;  3KAD A;  3H9R B;  3FAP A;  1LL4 A;  2F21 A;  2MPH A;  3ALG A;  4DT4 A;  2N87 A;  2F4E A;  4DWS C;  3WD4 A;  3O5Q A;  2RUR A;  1RD6 A;  2L2S A;  1FAP A;  3BMB A;  3WL0 A;  4Z2K A;  4LAY A;  3WQV A;  4S3K A;  4MPK A;  1YW5 A;  4IT6 A;  4P8W A;  2YBT A;  3WD2 A;  3O5F A;  1OGB A;  1EQ3 A;  4ZPW R;  3B8S A;  3IKG A;  1HKK A;  1Y0O A;  4J4N A;  2AWG A;  4DRM A;  4DRP A;  1H0I A;  4MNK A;  2KR7 A;  2ZR4 A;  1BKF A;  3JXV A;  3PRD A;  3W4R A;  3CHC A;  3O5R A;  3AS1 A;  1ZB5 A;  4XAK A;  5DF0 A;  2DPE A;  2M1I A;  2O92 A;  3O5D A;  1WNO A;  3GU0 A;  4ML4 A;  1H0G A;  2MLX A;  4JFM A;  2WLY A;  5HWB A;  1SYT A;  4KQZ A;  1VF8 A;  2MNT A;  2PPN A;  1F8A B;  1JCH B;  1GPF A;  4U85 A;  2XPA A;  3ARS A;  2ZR5 A;  1NSG A;  4ODO A;  2OFN A;  4WKF A;  1EYM A;  1LL6 A;  2QF8 A;  2ZR6 A;  3WKZ A;  3CHD A;  4R5E A;  1E6N A;  1KT1 A;  3UI5 A;  4QZV B;  3CHF A;  5HUA A;  3GPK A;  4TYO A;  1ZBC A;  1Q6H A;  4DIP A;  4JFL A;  1FKL A;  1W9P A;  4DZ3 A;  1XRV A;  2DT3 A;  4ODR A;  3RME A;  1Q6I A;  1J6Y A;  2G8Z A;  2LPV A;  3PRB A;  3CZ8 A;  4IT4 A;  2LGO A;  4ODN A;  1NWU A;  1HJX A;  3I6C A;  2RUC A;  2DSZ A;  4DZ2 A;  1X6L A;  2KGJ A;  3AS0 A;  1K9T A;  4AY1 A;  4DWS D;  1LQ0 A;  1GRJ A;  2ZQV A;  5B8I C;  1XHG A;  1Q1C A;  2RQS A;  1J4I A;  1C9H A;  3RFW A;  3O5G A;  1T11 A;  4U84 A;  2OLH A;  4WKH A;  2ITK A;  4FAP A;  2VCD A;  4W9P A;  3FY1 A;  2RUD A;  4ODM A;  1ROU A;  4ZS6 A;  1LJY A;  3KCE A;  1GUV A;  3ARO A;  3O5E A;  4G50 A;  2ETN A;  1A7X A;  1ZBV A;  2P4V A;  4ODQ A;  2YBU A;  1EIB A;  1IX5 A;  1FKH A;  2KI3 A;  4WKA A;  4Z2L A;  2Y78 A;  2FAP A;  4NZC A;  2ESC A;  3IHZ A;  3B9E A;  1D7I A;  2G41 A;  4NNR A;  3LUO A;  4GIV A;  4IQC A;  1ITX A;  1E44 A;  3ARZ A;  1E6Z A;  3AS3 A;  3ARY A;  1FKS A;  3RGC A;  4Z2I A;  3ARU A;  5JH8 A;  3EY6 A;  3PRA A;  4Z2H A;  4PTM A;  3UQB A;  1NWS A;  4HAR A;  4DRI A;  1JNE A;  4IQ2 A;  3QOK A;  3G6M A;  4O2T A;  1KFW A;  5HKG A;  1FD9 A;  2M2A A;  3KAH A;  3CGM A;  3WH0 A;  1E15 A;  3PA7 A;  3OOB A;  2DT1 A;  3ARR A;  3UF8 A;  5HW8 A;  2JZV A;  1W1V A;  2XP8 A;  2DG3 A;  4DRN A;  4DWS B;  2KE0 A;  3TC5 A;  1HJW A;  3TDB A;  2RSE A;  1W1T A;  1CTN A;  4P8V A;  2WM0 A;  2PI6 A;  1FKJ A;  3B9A A;  4JYS A;  4DRQ A;  1E6R A;  1E9L A;  1LG2 A;  3TCZ A;  5J6E A;  1UR8 A;  3WIJ A;  4U86 A;  4C02 B;  1KT0 A;  2A3E A;  4S3J A;  1BL4 A;  1FKR A;  3NI6 A;  3CHE A;  1W9U A;  2VN1 A;  3RM8 A;  4MNL A;  2IUZ A;  4MTV A;  2KO7 A;  3ART A;  5GQB A;  4HBE A;  4LGX A;  4ODP A;  2B31 A;  2PV1 A;  1JNS A;  1FKD A;  3OA5 A;  2PBC A;  3CH9 A;  3NRK A;  2D9F A;  4HBO A;  4WK9 A;  1FKF A;  4Z2J A;  3KAI A;  4LAW A;  2MLY A;  1R9H A;  3UQA A;  1FKI A;  3FXY A;  4ODL A; 
#chains in the Genus database with same CATH homology
 1X6N A;  5HBF A;  1HKI A;  5DEZ A;  3VAW A;  1FFQ A;  2WK2 A;  1ZL1 A;  1FJD A;  2DT2 A;  4W9Q A;  1TFV A;  4TX0 A;  1JVW A;  1N1A A;  4LAX A;  1F40 A;  3UQI A;  2A3B A;  2DSW A;  2PV3 A;  4DH0 A;  4WIW A;  3O5M A;  1HXV A;  5HTG A;  2IF4 A;  1YAT A;  3WD3 A;  4DWS A;  3KAG A;  3O5O A;  3O5I A;  3ARP A;  3WQW A;  4URI A;  3BXW A;  1ZBK A;  4ODK A;  1W26 A;  3WD1 A;  1P5Q A;  5HW6 A;  3JYM A;  2FKE A;  4DRJ A;  3G6L A;  3KAF A;  4Z2G A;  2ZQU A;  4MGV A;  3CGN A;  1FKK A;  2A3A A;  1J4R A;  4KR0 B;  4WJX A;  2MF9 A;  3ODK A;  2XP3 A;  2DSU A;  1SR0 A;  3B7X A;  2PPP A;  4TW8 A;  3ARQ A;  3PR9 A;  4ITZ A;  2Q5A A;  1M5Y A;  2UZ5 A;  1NWT A;  1UR9 A;  2XP6 A;  5DIV A;  5DIU A;  1U79 A;  3JYJ A;  4P8X A;  4JFK A;  1JND A;  2DT0 A;  3O5K A;  1B6C A;  1HJV A;  4L72 B;  2O9O A;  1NH6 A;  1PBK A;  2K8I A;  2F2D A;  1O6I A;  3MDY B;  3ARV A;  4LAV A;  3IK8 A;  1LG1 A;  5I98 A;  2MLZ A;  1ZK6 A;  3RM4 A;  5GPG A;  4TNS A;  4FN2 A;  3ALF A;  1D6O A;  4W9O A;  5GPR A;  2AOS A;  4DRK A;  1W9V A;  1FKG A;  1QPF A;  2LKN A;  1EDQ A;  3KZ7 A;  3AQU A;  4G2P A;  2FDM A;  1NWR A;  4L3N A;  1TCO C;  1ZBW A;  4ZPT R;  3O5L A;  3WD0 A;  1GOI A;  1D7J A;  1FKB A;  2XP7 A;  3IKD A;  4DRH A;  4GGQ A;  2XP9 A;  1ROT A;  1D7H A;  1QPL A;  1NMW A;  4MNM A;  3O5P A;  1OGG A;  4MSP A;  5DO2 A;  2KFW A;  2DG4 A;  4Q7N A;  4J4O A;  1L1P A;  4JFI A;  4IPX A;  3ARX A;  1EHN A;  1PIN A;  4MAV A;  2XP4 A;  1ZU8 A;  2LJ4 A;  3KAB A;  2DSV A;  1E6P A;  4TW6 A;  1J4H A;  3RM9 A;  1W1Y A;  4QIB A;  2M08 A;  5HT1 A;  5HW7 A;  1QZ2 A;  1FFR A;  2A3C A;  1Q6U A;  3B9D A;  1W1P A;  1ZCN A;  4N19 A;  1WB0 A;  5BXJ A;  1NMV A;  2ZQT A;  3UI6 A;  2XPB A;  4ZPV R;  2PPO A;  1OWQ A;  5HWC A;  1FKT A;  3ARW A;  4JFJ A;  4TW7 A;  4DRO A;  4QT3 A;  1HKM A;  3KAC A;  2WLZ A;  4MNJ A;  2DG9 A;  5D75 A;  4R0X A;  3O5J A;  2PV2 A;  2ZQS A;  4NSB A;  4Q22 A;  2XP5 A;  3AS2 A;  1D2K A;  1LL7 A;  1WAW A;  4P8U A;  4W5U A;  4BF8 A;  4QT2 A;  3UI4 A;  3NTP A;  2RUQ A;  5DIT A;  1JNT A;  1HKJ A;  3WL1 A;  3KAD A;  3H9R B;  3FAP A;  1LL4 A;  2F21 A;  2MPH A;  3ALG A;  4DT4 A;  2N87 A;  2F4E A;  4DWS C;  3WD4 A;  3O5Q A;  2RUR A;  1RD6 A;  2L2S A;  1FAP A;  3WL0 A;  4Z2K A;  4LAY A;  3WQV A;  4S3K A;  4MPK A;  1YW5 A;  4IT6 A;  4P8W A;  2YBT A;  3WD2 A;  3O5F A;  1OGB A;  1EQ3 A;  4ZPW R;  3B8S A;  3IKG A;  1HKK A;  1Y0O A;  4J4N A;  2AWG A;  4DRM A;  4DRP A;  1H0I A;  4MNK A;  2KR7 A;  2ZR4 A;  1BKF A;  3JXV A;  3PRD A;  3W4R A;  3CHC A;  3O5R A;  3AS1 A;  1ZB5 A;  4XAK A;  5DF0 A;  2DPE A;  2M1I A;  2O92 A;  3O5D A;  1WNO A;  4ML4 A;  1H0G A;  2MLX A;  4JFM A;  2WLY A;  5HWB A;  1SYT A;  4KQZ A;  1VF8 A;  2MNT A;  2PPN A;  1F8A B;  1GPF A;  4U85 A;  2XPA A;  3ARS A;  2ZR5 A;  1NSG A;  4ODO A;  2OFN A;  4WKF A;  1EYM A;  1LL6 A;  2QF8 A;  2ZR6 A;  3WKZ A;  3CHD A;  4R5E A;  1E6N A;  1KT1 A;  3UI5 A;  4QZV B;  3CHF A;  5HUA A;  3GPK A;  4TYO A;  1ZBC A;  1Q6H A;  4DIP A;  4JFL A;  1FKL A;  1W9P A;  4DZ3 A;  1XRV A;  2DT3 A;  4ODR A;  3RME A;  1Q6I A;  1J6Y A;  2G8Z A;  2LPV A;  3PRB A;  3CZ8 A;  4IT4 A;  2LGO A;  4ODN A;  1NWU A;  1HJX A;  3I6C A;  2RUC A;  2DSZ A;  4DZ2 A;  1X6L A;  2KGJ A;  3AS0 A;  1K9T A;  4AY1 A;  4DWS D;  1LQ0 A;  2ZQV A;  5B8I C;  1XHG A;  1Q1C A;  2RQS A;  1J4I A;  1C9H A;  3RFW A;  3O5G A;  1T11 A;  4U84 A;  2OLH A;  4WKH A;  2ITK A;  4FAP A;  2VCD A;  4W9P A;  3FY1 A;  2RUD A;  4ODM A;  1ROU A;  4ZS6 A;  1LJY A;  3KCE A;  1GUV A;  3ARO A;  3O5E A;  4G50 A;  1A7X A;  1ZBV A;  4ODQ A;  2YBU A;  1EIB A;  1IX5 A;  1FKH A;  2KI3 A;  4WKA A;  4Z2L A;  2Y78 A;  2FAP A;  4NZC A;  2ESC A;  3IHZ A;  3B9E A;  1D7I A;  2G41 A;  4NNR A;  3LUO A;  4GIV A;  4IQC A;  1ITX A;  3ARZ A;  1E6Z A;  3AS3 A;  3ARY A;  1FKS A;  3RGC A;  4Z2I A;  3ARU A;  5JH8 A;  3EY6 A;  3PRA A;  4Z2H A;  4PTM A;  3UQB A;  1NWS A;  4HAR A;  4DRI A;  1JNE A;  4IQ2 A;  3QOK A;  3G6M A;  4O2T A;  1KFW A;  5HKG A;  1FD9 A;  2M2A A;  3KAH A;  3CGM A;  3WH0 A;  1E15 A;  3PA7 A;  3OOB A;  2DT1 A;  3ARR A;  3UF8 A;  5HW8 A;  2JZV A;  1W1V A;  2XP8 A;  2DG3 A;  4DRN A;  4DWS B;  2KE0 A;  3TC5 A;  1HJW A;  3TDB A;  2RSE A;  1W1T A;  1CTN A;  4P8V A;  2WM0 A;  2PI6 A;  1FKJ A;  3B9A A;  4JYS A;  4DRQ A;  1E6R A;  1E9L A;  1LG2 A;  3TCZ A;  5J6E A;  1UR8 A;  3WIJ A;  4U86 A;  4C02 B;  1KT0 A;  2A3E A;  4S3J A;  1BL4 A;  1FKR A;  3NI6 A;  3CHE A;  1W9U A;  2VN1 A;  3RM8 A;  4MNL A;  2IUZ A;  4MTV A;  2KO7 A;  3ART A;  5GQB A;  4HBE A;  4LGX A;  4ODP A;  2B31 A;  2PV1 A;  1JNS A;  1FKD A;  3OA5 A;  2PBC A;  3CH9 A;  3NRK A;  2D9F A;  4HBO A;  4WK9 A;  1FKF A;  4Z2J A;  3KAI A;  4LAW A;  2MLY A;  1R9H A;  3UQA A;  1FKI A;  3FXY A;  4ODL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...