5JH8A

Crystal structure of chitinase from chromobacterium violaceum atcc 12472
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
309
Chain Sequence
b'AAMVLAYYSGYAGNYAALTRYAASFNAVAVDFYNITAQGAVTGNGDPAPNDAISFLLGRIPAYGCVSNVDGNGNWSADIAHAVSTSAQSQAVANLVFAQDRFSGINVDFEAVAQGDRNNFSHFIQVLGRALHAKGLLIVSVPAFSADENHPANYGYDLRALGAAADYLQIMSYDEAIPAWDPGPVAGSDWMEDDLDYAVERVPAAKILNGIPAYGYDWRPGDGGMLYWDTQALIARYGAQPRYDAGTHSLTFNYGAADGSRHTVWTENARSVALKASLVNAYGLGGTSLYALGMEDDAFWAAVQGLAQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable chitinase
publication title Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 101
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5jh8A02
3ALFA 1E6RA 4DWSA 1HJWA 1ZU8A 4Z2LA 4Q22A 4AY1A 1X6LA 2DT3A 1LL4A 1ITXA 3G6MA 1OWQA 3ARUA 4WK9A 2B31A 3AS3A 1H0GA 2ESCA 2A3AA 1FFQA 1W1PA 4MNJA 1NWRA 1NWTA 1CTNA 3G6LA 4URIA 1HKMA 1LL7A 3WQWA 5JH8A 2DSVA 1LL6A 4MNLA 1E6PA 1ZB5A 1VF8A 3WKZA 4Z2HA 1ZBKA 1LJYA 1WNOA 3RM4A 4S3JA 4Z2KA 2DSZA 2WK2A 4LGXA 1JNDA 1E6NA 1NWSA 4Z2IA 1SYTA 3CZ8A 3W4RA 1XHGA 2G8ZA 3OA5A 4MNKA 4S3KA 1HJVA 3WL0A 3AROA 2DT2A 3CHDA 3BXWA 3ARVA 4PTMA 3WD0A 1OGGA 1W9UA 3WIJA 2WLYA 3WD3A 1ZBVA 2DSWA 1EIBA 2DT0A 3B9EA 4P8WA 2YBTA 1LQ0A 3RMEA 3B9AA 3CHFA 1E15A 1WAWA 2DPEA 2IUZA 1E6ZA 2O92A 4DWSC 4W5UA 1ZBCA 2O9OA 1X6NA 2QF8A 1HKKA 3AS0A 3CHCA 1W9VA 4WIWA 1EDQA 3WD4A 3ARTA 4MAVA 1FFRA 3AQUA 3ARZA 3ARYA 3B8SA 4NZCA 4DWSD 2A3BA 3ARQA 4DWSB 3B9DA 2FDMA 2DSUA 4R5EA 4WKHA 1UR8A 1H0IA 3WL1A 3FY1A 2PI6A 1LG1A 3ALGA 1EHNA 5GPRA 1WB0A 5GQBA 1SR0A 5HBFA 1ZL1A 4MPKA 4P8UA 5DEZA 1W1YA 4MTVA 2A3EA 1LG2A 1OGBA 1W9PA 4MNMA 1XRVA 1GPFA 2YBUA 3RM8A 1KFWA 4Q7NA 3AS1A 3WD2A 4WKFA 3RM9A 3WD1A 3FXYA 3ARPA 3CHEA 3WQVA 1ZBWA 1RD6A 3ARXA 1HKJA 2G41A 2OLHA 5DF0A 2AOSA 2DT1A 3CH9A 4P8VA 1GOIA 1HJXA 4WJXA 4ML4A 4P8XA 1O6IA 1W1VA 1NH6A 3ARRA 1GUVA 2A3CA 3ARWA 3QOKA 4NSBA 4WKAA 1UR9A 1NWUA 1W1TA 1D2KA 4Z2GA 1TFVA 2WM0A 1K9TA 4Z2JA 1JNEA 2WLZA 1E9LA 1HKIA 3AS2A 3ARSA
chains in the Genus database with same CATH superfamily
1E6RA 1Q6IA 4QIBA 3ODKA 4Q22A 1J4HA 1LL4A 3G6MA 1OWQA 5HWBA 1H0GA 2ESCA 1J4IA 4DRNA 1W1PA 1ZK6A 1NWRA 1FKKA 3O5GA 4G2PA 3KAGA 1TCOC 1NMWA 4UDMA 4ODRA 1FKJA 1LJYA 1ZBKA 2ZR4A 4ZS6A 4TW7A 1FKFA 1JNDA 2VN1A 1E6NA 4TW6A 4Z2IA 4FAPA 1C9HA 2FKEA 3O5RA 2PV2A 4MNKA 1HJVA 3AROA 3UI4A 2MLYA 2DG4A 4R0XA 3B9EA 2YBTA 2OFNA 3CHFA 4IT6A 1E6ZA 4W5UA 1X6NA 3AS0A 4W9PA 1FKSA 3CHCA 4BF8A 4W9OA 1QPFA 3PA7A 2ZR5A 3RFWA 4DRJA 5BXJA 5HKGA 4KQZA 3WD4A 4MAVA 1Q6UA 3AQUA 2MNTA 3B8SA 1L1PA 4ITZA 4LAWA 2PN0A 1UR8A 1H0IA 3PR9A 2LJ4A 1EHNA 2RSEA 5GPRA 1HXVA 1ZL1A 3PRDA 4DH0A 4MPKA 4TX0A 3O5KA 1W1YA 5HTGA 1OGBA 5HW7A 3IKGA 5D75A 2LPVA 4WKFA 1YW5A 4IQCA 2OLHA 2M1IA 4HBEA 3BMBA 5DO2A 1ROUA 2A3CA 3O5DA 3QOKA 1UR9A 1NMVA 4Z2GA 2D9FA 2RUQA 2LKNA 2RUDA 3ALFA 5DITA 1PBKA 2VCDA 3ARUA 3O5IA 2B31A 4MNJA 3KCEA 1ZCNA 1HKMA 5JH8A 2DSVA 4MNLA 3FAPA 4QT2A 1E6PA 4DZ3A 2XP5A 1A7XA 1VF8A 2JZVA 1WNOA 3UF8A 4DRQA 1EQ3A 1JVWA 3KAIA 2XPBA 3CZ8A 2ZQVA 4U85A 3UQBA 2F21A 3W4RA 2G8ZA 4S3KA 3WL0A 4U84A 2EULA 3TC5A 1OGGA 3WIJA 2XP8A 2WLYA 4IPXA 2DSWA 2RQSA 4JFJA 1Y0OA 2DT0A 5HT1A 4P8WA 1LQ0A 3RMEA 3B9AA 1E15A 1D7HA 2DPEA 1F40A 1B6CA 4DWSC 2O9OA 2XP9A 4JFMA 3O5QA 1W9VA 4ZPWR 3JYJA 3UQIA 2P4VA 1EDQA 2DG3A 1FFRA 3ARYA 2K8IA 4NZCA 4DWSD 4DWSB 3JXVA 3B9DA 2ZQTA 2B5UB 4MGVA 2DG9A 3FY1A 3GU0A 4NNRA 4IQ2A 4JFLA 4W9QA 2A3EA 4JFIA 4DRMA 2RUCA 1GPFA 4Q7NA 3WD2A 3WD1A 2XP6A 3WQVA 3NI6A 1RD6A 1J6YA 1FJDA 1GRJA 1F8AB 5DF0A 3CH9A 4WJXA 1PINA 2AWGA 3GTYX 4ML4A 1O6IA 3ARRA 3OOBA 3O5JA 3TDBA 3ARWA 4LAYA 4IT4A 4ODOA 5DIUA 1K9TA 2XPAA 3O5EA 2LGOA 1JNEA 2UZ5A 5DIVA 2F4EA 2KR7A 3O5MA 4L72B 1E44A 1QZ2A 2PPOA 4MSPA 4AY1A 1X6LA 2DT3A 2M2AA 1ITXA 4XAKA 1FKTA 4WK9A 1T11A 4KR0B 4L3NA 2A3AA 3NTPA 4TYOA 1D7JA 1CTNA 4URIA 3WH0A 3WQWA 1LL6A 2Y78A 2ZQUA 3CGMA 2F23A 2ETNA 3KAHA 3WKZA 3RM4A 4S3JA 4Z2KA 2DSZA 2WK2A 4O2TA 3KADA 1SYTA 4DZ2A 1XHGA 2DT2A 1R9HA 3ARVA 4PTMA 4TW8A 3WD0A 2MLXA 3WD3A 2F2DA 5GPGA 4JYSA 4DIPA 1WAWA 2IUZA 3UQAA 2O92A 1D6OA 3EIPA 1ZBCA 2QF8A 3O5FA 4FN2A 4HARA 2L2SA 1Q6HA 3ARTA 2FDMA 3IKDA 2DSUA 4R5EA 4WKHA 4ODMA 4ODQA 1LG1A 3ALGA 5GQBA 1WB0A 1ROTA 4G50A 1FKLA 4P8UA 4MNMA 1W9PA 1XRVA 3IK8A 2PBCA 4ODKA 2YBUA 3EY6A 4JFKA 3RM9A 3FXYA 2G41A 1W26A 2M08A 3UI6A 1Q1CA 2AOSA 1KT1A 4DT4A 2PV1A 4P8VA 3JYMA 1HJXA 4DRIA 2KE0A 4P8XA 1W1VA 4LAXA 4ZPVR 4NSBA 4WKAA 4DRPA 1KT0A 1FAPA 1TFVA 4Z2JA 3RGCA 4GGQA 1FKRA 1FKHA 2WLZA 2MPHA 1FKIA 2KO7A 1HKIA 3AS2A 4QT3A 3PRAA 4DWSA 1HJWA 3PRBA 1ZU8A 4Z2LA 5HUAA 4C02B 1FD9A 3AS3A 3I6CA 2PPNA 1D7IA 1FFQA 4GIVA 1BKFA 1NWTA 1U79A 3G6LA 1LL7A 1J4RA 1ZB5A 5HW6A 4Z2HA 2IF4A 4LAVA 3O5PA 4LGXA 1NWSA 4ODNA 2XP7A 3O5LA 5J6EA 2XP4A 3B7XA 3OA5A 3IHZA 2PPPA 2KGJA 3CHDA 3BXWA 1NSGA 4N19A 3H9RB 1BL4A 1W9UA 2KI3A 1ZBVA 1EIBA 1EYMA 4HBOA 3TCZA 1YATA 2FAPA 5HWCA 4ODPA 3NRKA 3KABA 1HKKA 4TNSA 4DROA 4U86A 4WIWA 4DRKA 3GPKA 2Q5AA 1M5YA 3ARZA 1IX5A 3KACA 1N1AA 2A3BA 3ARQA 5I98A 1JCHB 3WL1A 4ODLA 2ITKA 2PI6A 1FKGA 5HBFA 1SR0A 1FKDA 2ZQSA 5DEZA 1JNTA 4MTVA 3VAWA 4J4NA 2MF9A 1LG2A 3UI5A 4J4OA 1FKBA 3RM8A 3LUOA 1KFWA 3MDYB 3O5OA 2XP3A 3AS1A 3CGNA 3ARPA 1QPLA 1ZBWA 3ARXA 1HKJA 5B8IC 2KFWA 2DT1A 2MLZA 1GOIA 4DRHA 2RURA 1P5QA 1JNSA 1NH6A 5HW8A 1GUVA 4QZVB 4ZPTR 3KAFA 1NWUA 1W1TA 1D2KA 2PV3A 2ZR6A 2WM0A 3KZ7A 2N87A 1E9LA 3CHEA 3ARSA
chains in the Genus database with same CATH topology
1E6RA 1Q6IA 4QIBA 3ODKA 4Q22A 1J4HA 1LL4A 3G6MA 1OWQA 5HWBA 1H0GA 2ESCA 1J4IA 4DRNA 1W1PA 1ZK6A 1NWRA 1FKKA 3O5GA 4G2PA 3KAGA 1TCOC 1NMWA 4ODRA 1FKJA 1LJYA 1ZBKA 2ZR4A 4ZS6A 4TW7A 1FKFA 1JNDA 2VN1A 1E6NA 4TW6A 4Z2IA 4FAPA 1C9HA 2FKEA 3O5RA 2PV2A 4MNKA 1HJVA 3AROA 3UI4A 2MLYA 2DG4A 4R0XA 3B9EA 2YBTA 2OFNA 3CHFA 4IT6A 1E6ZA 4W5UA 1X6NA 3AS0A 4W9PA 1FKSA 3CHCA 4BF8A 4W9OA 1QPFA 3PA7A 2ZR5A 3RFWA 4DRJA 5BXJA 5HKGA 4KQZA 3WD4A 4MAVA 1Q6UA 3AQUA 2MNTA 3B8SA 1L1PA 4ITZA 4LAWA 1UR8A 1H0IA 3PR9A 2LJ4A 1EHNA 2RSEA 5GPRA 1HXVA 1ZL1A 3PRDA 4DH0A 4MPKA 4TX0A 3O5KA 1W1YA 5HTGA 1OGBA 5HW7A 3IKGA 5D75A 2LPVA 4WKFA 1YW5A 4IQCA 2OLHA 2M1IA 4HBEA 5DO2A 1ROUA 2A3CA 3O5DA 3QOKA 1UR9A 1NMVA 4Z2GA 2D9FA 2RUQA 2LKNA 2RUDA 3ALFA 5DITA 1PBKA 2VCDA 3ARUA 3O5IA 2B31A 4MNJA 3KCEA 1ZCNA 1HKMA 5JH8A 2DSVA 4MNLA 3FAPA 4QT2A 1E6PA 4DZ3A 2XP5A 1A7XA 1VF8A 2JZVA 1WNOA 3UF8A 4DRQA 1EQ3A 1JVWA 3KAIA 2XPBA 3CZ8A 2ZQVA 4U85A 3UQBA 2F21A 3W4RA 2G8ZA 4S3KA 3WL0A 4U84A 3TC5A 1OGGA 3WIJA 2XP8A 2WLYA 4IPXA 2DSWA 2RQSA 4JFJA 1Y0OA 2DT0A 5HT1A 4P8WA 1LQ0A 3RMEA 3B9AA 1E15A 1D7HA 2DPEA 1F40A 1B6CA 4DWSC 2O9OA 2XP9A 4JFMA 3O5QA 1W9VA 4ZPWR 3JYJA 3UQIA 1EDQA 2DG3A 1FFRA 3ARYA 2K8IA 4NZCA 4DWSD 4DWSB 3JXVA 3B9DA 2ZQTA 4MGVA 2DG9A 3FY1A 4NNRA 4IQ2A 4JFLA 4W9QA 2A3EA 4JFIA 4DRMA 2RUCA 1GPFA 4Q7NA 3WD2A 3WD1A 2XP6A 3WQVA 3NI6A 1RD6A 1J6YA 1FJDA 5DF0A 1F8AB 3CH9A 4WJXA 1PINA 2AWGA 4ML4A 1O6IA 3ARRA 3OOBA 3O5JA 3TDBA 3ARWA 4LAYA 4IT4A 4ODOA 5DIUA 1K9TA 2XPAA 3O5EA 2LGOA 1JNEA 2UZ5A 5DIVA 2F4EA 2KR7A 3O5MA 4L72B 1QZ2A 2PPOA 4MSPA 4AY1A 1X6LA 2DT3A 2M2AA 1ITXA 4XAKA 1FKTA 4WK9A 1T11A 4KR0B 4L3NA 2A3AA 3NTPA 4TYOA 1D7JA 1CTNA 4URIA 3WH0A 3WQWA 1LL6A 2Y78A 2ZQUA 3CGMA 3KAHA 3WKZA 3RM4A 4S3JA 4Z2KA 2DSZA 2WK2A 4O2TA 3KADA 1SYTA 4DZ2A 1XHGA 2DT2A 1R9HA 3ARVA 4PTMA 4TW8A 3WD0A 2MLXA 3WD3A 2F2DA 5GPGA 4JYSA 4DIPA 1WAWA 2IUZA 3UQAA 2O92A 1D6OA 1ZBCA 2QF8A 3O5FA 4FN2A 4HARA 2L2SA 1Q6HA 3ARTA 2FDMA 3IKDA 2DSUA 4R5EA 4WKHA 4ODMA 4ODQA 1LG1A 3ALGA 5GQBA 1WB0A 1ROTA 4G50A 1FKLA 4P8UA 4MNMA 1W9PA 1XRVA 3IK8A 2PBCA 4ODKA 2YBUA 3EY6A 4JFKA 3RM9A 3FXYA 2G41A 1W26A 2M08A 3UI6A 1Q1CA 2AOSA 1KT1A 4DT4A 2PV1A 4P8VA 3JYMA 1HJXA 4DRIA 2KE0A 4P8XA 1W1VA 4LAXA 4ZPVR 4NSBA 4WKAA 4DRPA 1KT0A 1FAPA 1TFVA 4Z2JA 3RGCA 4GGQA 1FKRA 1FKHA 2WLZA 2MPHA 1FKIA 2KO7A 1HKIA 3AS2A 4QT3A 3PRAA 4DWSA 1HJWA 3PRBA 1ZU8A 4Z2LA 5HUAA 4C02B 1FD9A 3AS3A 3I6CA 2PPNA 1D7IA 1FFQA 4GIVA 1BKFA 1NWTA 1U79A 3G6LA 1LL7A 1J4RA 1ZB5A 5HW6A 4Z2HA 2IF4A 4LAVA 3O5PA 4LGXA 1NWSA 4ODNA 2XP7A 3O5LA 5J6EA 2XP4A 3B7XA 3OA5A 3IHZA 2PPPA 2KGJA 3CHDA 3BXWA 1NSGA 4N19A 3H9RB 1BL4A 1W9UA 2KI3A 1ZBVA 1EIBA 1EYMA 4HBOA 3TCZA 1YATA 2FAPA 5HWCA 4ODPA 3NRKA 3KABA 1HKKA 4TNSA 4DROA 4U86A 4WIWA 4DRKA 3GPKA 2Q5AA 1M5YA 3ARZA 1IX5A 3KACA 1N1AA 2A3BA 3ARQA 5I98A 3WL1A 4ODLA 2ITKA 2PI6A 1FKGA 5HBFA 1SR0A 1FKDA 2ZQSA 5DEZA 1JNTA 4MTVA 3VAWA 4J4NA 2MF9A 1LG2A 3UI5A 4J4OA 1FKBA 3RM8A 3LUOA 1KFWA 3MDYB 3O5OA 2XP3A 3AS1A 3CGNA 3ARPA 1QPLA 1ZBWA 3ARXA 1HKJA 5B8IC 2KFWA 2DT1A 2MLZA 1GOIA 4DRHA 2RURA 1P5QA 1JNSA 1NH6A 5HW8A 1GUVA 4QZVB 4ZPTR 3KAFA 1NWUA 1W1TA 1D2KA 2PV3A 2ZR6A 2WM0A 3KZ7A 2N87A 1E9LA 3CHEA 3ARSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ALF A;  1E6R A;  4DWS A;  1HJW A;  1ZU8 A;  4Z2L A;  4Q22 A;  4AY1 A;  1X6L A;  2DT3 A;  1LL4 A;  1ITX A;  3G6M A;  1OWQ A;  3ARU A;  4WK9 A;  2B31 A;  3AS3 A;  1H0G A;  2ESC A;  2A3A A;  1FFQ A;  1W1P A;  4MNJ A;  1NWR A;  1NWT A;  1CTN A;  3G6L A;  4URI A;  1HKM A;  1LL7 A;  3WQW A;  5JH8 A;  2DSV A;  1LL6 A;  4MNL A;  1E6P A;  1ZB5 A;  1VF8 A;  3WKZ A;  4Z2H A;  1ZBK A;  1LJY A;  1WNO A;  3RM4 A;  4S3J A;  4Z2K A;  2DSZ A;  2WK2 A;  4LGX A;  1JND A;  1E6N A;  1NWS A;  4Z2I A;  1SYT A;  3CZ8 A;  3W4R A;  1XHG A;  2G8Z A;  3OA5 A;  4MNK A;  4S3K A;  1HJV A;  3WL0 A;  3ARO A;  2DT2 A;  3CHD A;  3BXW A;  3ARV A;  4PTM A;  3WD0 A;  1OGG A;  1W9U A;  3WIJ A;  2WLY A;  3WD3 A;  1ZBV A;  2DSW A;  1EIB A;  2DT0 A;  3B9E A;  4P8W A;  2YBT A;  1LQ0 A;  3RME A;  3B9A A;  3CHF A;  1E15 A;  1WAW A;  2DPE A;  2IUZ A;  1E6Z A;  2O92 A;  4DWS C;  4W5U A;  1ZBC A;  2O9O A;  1X6N A;  2QF8 A;  1HKK A;  3AS0 A;  3CHC A;  1W9V A;  4WIW A;  1EDQ A;  3WD4 A;  3ART A;  4MAV A;  1FFR A;  3AQU A;  3ARZ A;  3ARY A;  3B8S A;  4NZC A;  4DWS D;  2A3B A;  3ARQ A;  4DWS B;  3B9D A;  2FDM A;  2DSU A;  4R5E A;  4WKH A;  1UR8 A;  1H0I A;  3WL1 A;  3FY1 A;  2PI6 A;  1LG1 A;  3ALG A;  1EHN A;  5GPR A;  1WB0 A;  5GQB A;  1SR0 A;  5HBF A;  1ZL1 A;  4MPK A;  4P8U A;  5DEZ A;  1W1Y A;  4MTV A;  2A3E A;  1LG2 A;  1OGB A;  1W9P A;  4MNM A;  1XRV A;  1GPF A;  2YBU A;  3RM8 A;  1KFW A;  4Q7N A;  3AS1 A;  3WD2 A;  4WKF A;  3RM9 A;  3WD1 A;  3FXY A;  3ARP A;  3CHE A;  3WQV A;  1ZBW A;  1RD6 A;  3ARX A;  1HKJ A;  2G41 A;  2OLH A;  5DF0 A;  2AOS A;  2DT1 A;  3CH9 A;  4P8V A;  1GOI A;  1HJX A;  4WJX A;  4ML4 A;  4P8X A;  1O6I A;  1W1V A;  1NH6 A;  3ARR A;  1GUV A;  2A3C A;  3ARW A;  3QOK A;  4NSB A;  4WKA A;  1UR9 A;  1NWU A;  1W1T A;  1D2K A;  4Z2G A;  1TFV A;  2WM0 A;  1K9T A;  4Z2J A;  1JNE A;  2WLZ A;  1E9L A;  1HKI A;  3AS2 A;  3ARS A; 
#chains in the Genus database with same CATH topology
 1E6R A;  1Q6I A;  4QIB A;  3ODK A;  4Q22 A;  1J4H A;  1LL4 A;  3G6M A;  1OWQ A;  5HWB A;  1H0G A;  2ESC A;  1J4I A;  4DRN A;  1W1P A;  1ZK6 A;  1NWR A;  1FKK A;  3O5G A;  4G2P A;  3KAG A;  1TCO C;  1NMW A;  4UDM A;  4ODR A;  1FKJ A;  1LJY A;  1ZBK A;  2ZR4 A;  4ZS6 A;  4TW7 A;  1FKF A;  1JND A;  2VN1 A;  1E6N A;  4TW6 A;  4Z2I A;  4FAP A;  1C9H A;  2FKE A;  3O5R A;  2PV2 A;  4MNK A;  1HJV A;  3ARO A;  3UI4 A;  2MLY A;  2DG4 A;  4R0X A;  3B9E A;  2YBT A;  2OFN A;  3CHF A;  4IT6 A;  1E6Z A;  4W5U A;  1X6N A;  3AS0 A;  4W9P A;  1FKS A;  3CHC A;  4BF8 A;  4W9O A;  1QPF A;  3PA7 A;  2ZR5 A;  3RFW A;  4DRJ A;  5BXJ A;  5HKG A;  4KQZ A;  3WD4 A;  4MAV A;  1Q6U A;  3AQU A;  2MNT A;  3B8S A;  1L1P A;  4ITZ A;  4LAW A;  2PN0 A;  1UR8 A;  1H0I A;  3PR9 A;  2LJ4 A;  1EHN A;  2RSE A;  5GPR A;  1HXV A;  1ZL1 A;  3PRD A;  4DH0 A;  4MPK A;  4TX0 A;  3O5K A;  1W1Y A;  5HTG A;  1OGB A;  5HW7 A;  3IKG A;  5D75 A;  2LPV A;  4WKF A;  1YW5 A;  4IQC A;  2OLH A;  2M1I A;  4HBE A;  3BMB A;  5DO2 A;  1ROU A;  2A3C A;  3O5D A;  3QOK A;  1UR9 A;  1NMV A;  4Z2G A;  2D9F A;  2RUQ A;  2LKN A;  2RUD A;  3ALF A;  5DIT A;  1PBK A;  2VCD A;  3ARU A;  3O5I A;  2B31 A;  4MNJ A;  3KCE A;  1ZCN A;  1HKM A;  5JH8 A;  2DSV A;  4MNL A;  3FAP A;  4QT2 A;  1E6P A;  4DZ3 A;  2XP5 A;  1A7X A;  1VF8 A;  2JZV A;  1WNO A;  3UF8 A;  4DRQ A;  1EQ3 A;  1JVW A;  3KAI A;  2XPB A;  3CZ8 A;  2ZQV A;  4U85 A;  3UQB A;  2F21 A;  3W4R A;  2G8Z A;  4S3K A;  3WL0 A;  4U84 A;  2EUL A;  3TC5 A;  1OGG A;  3WIJ A;  2XP8 A;  2WLY A;  4IPX A;  2DSW A;  2RQS A;  4JFJ A;  1Y0O A;  2DT0 A;  5HT1 A;  4P8W A;  1LQ0 A;  3RME A;  3B9A A;  1E15 A;  1D7H A;  2DPE A;  1F40 A;  1B6C A;  4DWS C;  2O9O A;  2XP9 A;  4JFM A;  3O5Q A;  1W9V A;  4ZPW R;  3JYJ A;  3UQI A;  2P4V A;  1EDQ A;  2DG3 A;  1FFR A;  3ARY A;  2K8I A;  4NZC A;  4DWS D;  4DWS B;  3JXV A;  3B9D A;  2ZQT A;  2B5U B;  4MGV A;  2DG9 A;  3FY1 A;  3GU0 A;  4NNR A;  4IQ2 A;  4JFL A;  4W9Q A;  2A3E A;  4JFI A;  4DRM A;  2RUC A;  1GPF A;  4Q7N A;  3WD2 A;  3WD1 A;  2XP6 A;  3WQV A;  3NI6 A;  1RD6 A;  1J6Y A;  1FJD A;  1GRJ A;  1F8A B;  5DF0 A;  3CH9 A;  4WJX A;  1PIN A;  2AWG A;  3GTY X;  4ML4 A;  1O6I A;  3ARR A;  3OOB A;  3O5J A;  3TDB A;  3ARW A;  4LAY A;  4IT4 A;  4ODO A;  5DIU A;  1K9T A;  2XPA A;  3O5E A;  2LGO A;  1JNE A;  2UZ5 A;  5DIV A;  2F4E A;  2KR7 A;  3O5M A;  4L72 B;  1E44 A;  1QZ2 A;  2PPO A;  4MSP A;  4AY1 A;  1X6L A;  2DT3 A;  2M2A A;  1ITX A;  4XAK A;  1FKT A;  4WK9 A;  1T11 A;  4KR0 B;  4L3N A;  2A3A A;  3NTP A;  4TYO A;  1D7J A;  1CTN A;  4URI A;  3WH0 A;  3WQW A;  1LL6 A;  2Y78 A;  2ZQU A;  3CGM A;  2F23 A;  2ETN A;  3KAH A;  3WKZ A;  3RM4 A;  4S3J A;  4Z2K A;  2DSZ A;  2WK2 A;  4O2T A;  3KAD A;  1SYT A;  4DZ2 A;  1XHG A;  2DT2 A;  1R9H A;  3ARV A;  4PTM A;  4TW8 A;  3WD0 A;  2MLX A;  3WD3 A;  2F2D A;  5GPG A;  4JYS A;  4DIP A;  1WAW A;  2IUZ A;  3UQA A;  2O92 A;  1D6O A;  3EIP A;  1ZBC A;  2QF8 A;  3O5F A;  4FN2 A;  4HAR A;  2L2S A;  1Q6H A;  3ART A;  2FDM A;  3IKD A;  2DSU A;  4R5E A;  4WKH A;  4ODM A;  4ODQ A;  1LG1 A;  3ALG A;  5GQB A;  1WB0 A;  1ROT A;  4G50 A;  1FKL A;  4P8U A;  4MNM A;  1W9P A;  1XRV A;  3IK8 A;  2PBC A;  4ODK A;  2YBU A;  3EY6 A;  4JFK A;  3RM9 A;  3FXY A;  2G41 A;  1W26 A;  2M08 A;  3UI6 A;  1Q1C A;  2AOS A;  1KT1 A;  4DT4 A;  2PV1 A;  4P8V A;  3JYM A;  1HJX A;  4DRI A;  2KE0 A;  4P8X A;  1W1V A;  4LAX A;  4ZPV R;  4NSB A;  4WKA A;  4DRP A;  1KT0 A;  1FAP A;  1TFV A;  4Z2J A;  3RGC A;  4GGQ A;  1FKR A;  1FKH A;  2WLZ A;  2MPH A;  1FKI A;  2KO7 A;  1HKI A;  3AS2 A;  4QT3 A;  3PRA A;  4DWS A;  1HJW A;  3PRB A;  1ZU8 A;  4Z2L A;  5HUA A;  4C02 B;  1FD9 A;  3AS3 A;  3I6C A;  2PPN A;  1D7I A;  1FFQ A;  4GIV A;  1BKF A;  1NWT A;  1U79 A;  3G6L A;  1LL7 A;  1J4R A;  1ZB5 A;  5HW6 A;  4Z2H A;  2IF4 A;  4LAV A;  3O5P A;  4LGX A;  1NWS A;  4ODN A;  2XP7 A;  3O5L A;  5J6E A;  2XP4 A;  3B7X A;  3OA5 A;  3IHZ A;  2PPP A;  2KGJ A;  3CHD A;  3BXW A;  1NSG A;  4N19 A;  3H9R B;  1BL4 A;  1W9U A;  2KI3 A;  1ZBV A;  1EIB A;  1EYM A;  4HBO A;  3TCZ A;  1YAT A;  2FAP A;  5HWC A;  4ODP A;  3NRK A;  3KAB A;  1HKK A;  4TNS A;  4DRO A;  4U86 A;  4WIW A;  4DRK A;  3GPK A;  2Q5A A;  1M5Y A;  3ARZ A;  1IX5 A;  3KAC A;  1N1A A;  2A3B A;  3ARQ A;  5I98 A;  1JCH B;  3WL1 A;  4ODL A;  2ITK A;  2PI6 A;  1FKG A;  5HBF A;  1SR0 A;  1FKD A;  2ZQS A;  5DEZ A;  1JNT A;  4MTV A;  3VAW A;  4J4N A;  2MF9 A;  1LG2 A;  3UI5 A;  4J4O A;  1FKB A;  3RM8 A;  3LUO A;  1KFW A;  3MDY B;  3O5O A;  2XP3 A;  3AS1 A;  3CGN A;  3ARP A;  1QPL A;  1ZBW A;  3ARX A;  1HKJ A;  5B8I C;  2KFW A;  2DT1 A;  2MLZ A;  1GOI A;  4DRH A;  2RUR A;  1P5Q A;  1JNS A;  1NH6 A;  5HW8 A;  1GUV A;  4QZV B;  4ZPT R;  3KAF A;  1NWU A;  1W1T A;  1D2K A;  2PV3 A;  2ZR6 A;  2WM0 A;  3KZ7 A;  2N87 A;  1E9L A;  3CHE A;  3ARS A; 
#chains in the Genus database with same CATH homology
 1E6R A;  1Q6I A;  4QIB A;  3ODK A;  4Q22 A;  1J4H A;  1LL4 A;  3G6M A;  1OWQ A;  5HWB A;  1H0G A;  2ESC A;  1J4I A;  4DRN A;  1W1P A;  1ZK6 A;  1NWR A;  1FKK A;  3O5G A;  4G2P A;  3KAG A;  1TCO C;  1NMW A;  4ODR A;  1FKJ A;  1LJY A;  1ZBK A;  2ZR4 A;  4ZS6 A;  4TW7 A;  1FKF A;  1JND A;  2VN1 A;  1E6N A;  4TW6 A;  4Z2I A;  4FAP A;  1C9H A;  2FKE A;  3O5R A;  2PV2 A;  4MNK A;  1HJV A;  3ARO A;  3UI4 A;  2MLY A;  2DG4 A;  4R0X A;  3B9E A;  2YBT A;  2OFN A;  3CHF A;  4IT6 A;  1E6Z A;  4W5U A;  1X6N A;  3AS0 A;  4W9P A;  1FKS A;  3CHC A;  4BF8 A;  4W9O A;  1QPF A;  3PA7 A;  2ZR5 A;  3RFW A;  4DRJ A;  5BXJ A;  5HKG A;  4KQZ A;  3WD4 A;  4MAV A;  1Q6U A;  3AQU A;  2MNT A;  3B8S A;  1L1P A;  4ITZ A;  4LAW A;  1UR8 A;  1H0I A;  3PR9 A;  2LJ4 A;  1EHN A;  2RSE A;  5GPR A;  1HXV A;  1ZL1 A;  3PRD A;  4DH0 A;  4MPK A;  4TX0 A;  3O5K A;  1W1Y A;  5HTG A;  1OGB A;  5HW7 A;  3IKG A;  5D75 A;  2LPV A;  4WKF A;  1YW5 A;  4IQC A;  2OLH A;  2M1I A;  4HBE A;  5DO2 A;  1ROU A;  2A3C A;  3O5D A;  3QOK A;  1UR9 A;  1NMV A;  4Z2G A;  2D9F A;  2RUQ A;  2LKN A;  2RUD A;  3ALF A;  5DIT A;  1PBK A;  2VCD A;  3ARU A;  3O5I A;  2B31 A;  4MNJ A;  3KCE A;  1ZCN A;  1HKM A;  5JH8 A;  2DSV A;  4MNL A;  3FAP A;  4QT2 A;  1E6P A;  4DZ3 A;  2XP5 A;  1A7X A;  1VF8 A;  2JZV A;  1WNO A;  3UF8 A;  4DRQ A;  1EQ3 A;  1JVW A;  3KAI A;  2XPB A;  3CZ8 A;  2ZQV A;  4U85 A;  3UQB A;  2F21 A;  3W4R A;  2G8Z A;  4S3K A;  3WL0 A;  4U84 A;  3TC5 A;  1OGG A;  3WIJ A;  2XP8 A;  2WLY A;  4IPX A;  2DSW A;  2RQS A;  4JFJ A;  1Y0O A;  2DT0 A;  5HT1 A;  4P8W A;  1LQ0 A;  3RME A;  3B9A A;  1E15 A;  1D7H A;  2DPE A;  1F40 A;  1B6C A;  4DWS C;  2O9O A;  2XP9 A;  4JFM A;  3O5Q A;  1W9V A;  4ZPW R;  3JYJ A;  3UQI A;  1EDQ A;  2DG3 A;  1FFR A;  3ARY A;  2K8I A;  4NZC A;  4DWS D;  4DWS B;  3JXV A;  3B9D A;  2ZQT A;  4MGV A;  2DG9 A;  3FY1 A;  4NNR A;  4IQ2 A;  4JFL A;  4W9Q A;  2A3E A;  4JFI A;  4DRM A;  2RUC A;  1GPF A;  4Q7N A;  3WD2 A;  3WD1 A;  2XP6 A;  3WQV A;  3NI6 A;  1RD6 A;  1J6Y A;  1FJD A;  5DF0 A;  1F8A B;  3CH9 A;  4WJX A;  1PIN A;  2AWG A;  4ML4 A;  1O6I A;  3ARR A;  3OOB A;  3O5J A;  3TDB A;  3ARW A;  4LAY A;  4IT4 A;  4ODO A;  5DIU A;  1K9T A;  2XPA A;  3O5E A;  2LGO A;  1JNE A;  2UZ5 A;  5DIV A;  2F4E A;  2KR7 A;  3O5M A;  4L72 B;  1QZ2 A;  2PPO A;  4MSP A;  4AY1 A;  1X6L A;  2DT3 A;  2M2A A;  1ITX A;  4XAK A;  1FKT A;  4WK9 A;  1T11 A;  4KR0 B;  4L3N A;  2A3A A;  3NTP A;  4TYO A;  1D7J A;  1CTN A;  4URI A;  3WH0 A;  3WQW A;  1LL6 A;  2Y78 A;  2ZQU A;  3CGM A;  3KAH A;  3WKZ A;  3RM4 A;  4S3J A;  4Z2K A;  2DSZ A;  2WK2 A;  4O2T A;  3KAD A;  1SYT A;  4DZ2 A;  1XHG A;  2DT2 A;  1R9H A;  3ARV A;  4PTM A;  4TW8 A;  3WD0 A;  2MLX A;  3WD3 A;  2F2D A;  5GPG A;  4JYS A;  4DIP A;  1WAW A;  2IUZ A;  3UQA A;  2O92 A;  1D6O A;  1ZBC A;  2QF8 A;  3O5F A;  4FN2 A;  4HAR A;  2L2S A;  1Q6H A;  3ART A;  2FDM A;  3IKD A;  2DSU A;  4R5E A;  4WKH A;  4ODM A;  4ODQ A;  1LG1 A;  3ALG A;  5GQB A;  1WB0 A;  1ROT A;  4G50 A;  1FKL A;  4P8U A;  4MNM A;  1W9P A;  1XRV A;  3IK8 A;  2PBC A;  4ODK A;  2YBU A;  3EY6 A;  4JFK A;  3RM9 A;  3FXY A;  2G41 A;  1W26 A;  2M08 A;  3UI6 A;  1Q1C A;  2AOS A;  1KT1 A;  4DT4 A;  2PV1 A;  4P8V A;  3JYM A;  1HJX A;  4DRI A;  2KE0 A;  4P8X A;  1W1V A;  4LAX A;  4ZPV R;  4NSB A;  4WKA A;  4DRP A;  1KT0 A;  1FAP A;  1TFV A;  4Z2J A;  3RGC A;  4GGQ A;  1FKR A;  1FKH A;  2WLZ A;  2MPH A;  1FKI A;  2KO7 A;  1HKI A;  3AS2 A;  4QT3 A;  3PRA A;  4DWS A;  1HJW A;  3PRB A;  1ZU8 A;  4Z2L A;  5HUA A;  4C02 B;  1FD9 A;  3AS3 A;  3I6C A;  2PPN A;  1D7I A;  1FFQ A;  4GIV A;  1BKF A;  1NWT A;  1U79 A;  3G6L A;  1LL7 A;  1J4R A;  1ZB5 A;  5HW6 A;  4Z2H A;  2IF4 A;  4LAV A;  3O5P A;  4LGX A;  1NWS A;  4ODN A;  2XP7 A;  3O5L A;  5J6E A;  2XP4 A;  3B7X A;  3OA5 A;  3IHZ A;  2PPP A;  2KGJ A;  3CHD A;  3BXW A;  1NSG A;  4N19 A;  3H9R B;  1BL4 A;  1W9U A;  2KI3 A;  1ZBV A;  1EIB A;  1EYM A;  4HBO A;  3TCZ A;  1YAT A;  2FAP A;  5HWC A;  4ODP A;  3NRK A;  3KAB A;  1HKK A;  4TNS A;  4DRO A;  4U86 A;  4WIW A;  4DRK A;  3GPK A;  2Q5A A;  1M5Y A;  3ARZ A;  1IX5 A;  3KAC A;  1N1A A;  2A3B A;  3ARQ A;  5I98 A;  3WL1 A;  4ODL A;  2ITK A;  2PI6 A;  1FKG A;  5HBF A;  1SR0 A;  1FKD A;  2ZQS A;  5DEZ A;  1JNT A;  4MTV A;  3VAW A;  4J4N A;  2MF9 A;  1LG2 A;  3UI5 A;  4J4O A;  1FKB A;  3RM8 A;  3LUO A;  1KFW A;  3MDY B;  3O5O A;  2XP3 A;  3AS1 A;  3CGN A;  3ARP A;  1QPL A;  1ZBW A;  3ARX A;  1HKJ A;  5B8I C;  2KFW A;  2DT1 A;  2MLZ A;  1GOI A;  4DRH A;  2RUR A;  1P5Q A;  1JNS A;  1NH6 A;  5HW8 A;  1GUV A;  4QZV B;  4ZPT R;  3KAF A;  1NWU A;  1W1T A;  1D2K A;  2PV3 A;  2ZR6 A;  2WM0 A;  3KZ7 A;  2N87 A;  1E9L A;  3CHE A;  3ARS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...