5JH8A

Crystal structure of chitinase from chromobacterium violaceum atcc 12472
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
309
Chain Sequence
AAMVLAYYSGYAGNYAALTRYAASFNAVAVDFYNITAQGAVTGNGDPAPNDAISFLLGRIPAYGCVSNVDGNGNWSADIAHAVSTSAQSQAVANLVFAQDRFSGINVDFEAVAQGDRNNFSHFIQVLGRALHAKGLLIVSVPAFSADENHPANYGYDLRALGAAADYLQIMSYDEAIPAWDPGPVAGSDWMEDDLDYAVERVPAAKILNGIPAYGYDWRPGDGGMLYWDTQALIARYGAQPRYDAGTHSLTFNYGAADGSRHTVWTENARSVALKASLVNAYGLGGTSLYALGMEDDAFWAAVQGLAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
molecule keywords Probable chitinase
total genus 101
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5jh8A02
1ZBVA 1HJWA 2B31A 1W9PA 3WL0A 1X6LA 1EIBA 3W4RA 1NH6A 3FY1A 1LG2A 2DSVA 3RM9A 2DPEA 1NWRA 4LGXA 3CHFA 4P8VA 3WD0A 3RM8A 2DSUA 3QOKA 4MNKA 3ALGA 1OGGA 4MNJA 1SR0A 2OLHA 3ARVA 3WD2A 1E6PA 1HKMA 1O6IA 3ARPA 3AS0A 4WIWA 2DT3A 2A3EA 2WM0A 4Z2HA 2G41A 4DWSB 4R5EA 2DSWA 2DT1A 3OA5A 4DWSA 1H0GA 4NZCA 1E9LA 2QF8A 1H0IA 1E6ZA 3B9DA 1OGBA 1K9TA 3AS3A 5GQBA 4DWSD 3ARZA 2A3BA 2O92A 1HKIA 2ESCA 2WLZA 5JH8A 2YBTA 1HKJA 3ARYA 1TFVA 3ARQA 3ARXA 1JNDA 1LQ0A 1RD6A 5HBFA 1LL6A 1W1TA 1HJXA 1ZBKA 3WD3A 3WD1A 1XRVA 2DT2A 3AQUA 3AROA 1LJYA 1D2KA 1W9VA 3G6LA 4Z2GA 1UR9A 1KFWA 4AY1A 4P8UA 3WD4A 2IUZA 1OWQA 3ARRA 1NWUA 1VF8A 2FDMA 1EDQA 1ZB5A 4WKFA 1FFQA 1W1YA 4MAVA 2YBUA 3RM4A 1LL4A 3G6MA 1E6NA 2WLYA 1NWTA 3ARTA 4Z2KA 4NSBA 1UR8A 4S3JA 1WAWA 1ITXA 1JNEA 4Q7NA 3ARWA 3CHCA 3B9EA 3WKZA 1GOIA 1ZL1A 1X6NA 1ZU8A 1E15A 3WIJA 4URIA 2AOSA 2G8ZA 1XHGA 3CHEA 1CTNA 1EHNA 1W1VA 4P8XA 1LL7A 3AS2A 3B9AA 3CHDA 2A3AA 4DWSC 3AS1A 2A3CA 1SYTA 4S3KA 1GUVA 4WKHA 2DT0A 3ALFA 1WB0A 1HJVA 1ZBWA 4MNMA 4Q22A 1ZBCA 5DF0A 3CZ8A 1E6RA 2DSZA 1HKKA 3ARUA 3RMEA 3WQWA 4PTMA 1FFRA 1W1PA 4W5UA 3ARSA 1GPFA 4ML4A 3WQVA 4Z2JA 5GPRA 2WK2A 3WL1A 4Z2IA 5DEZA 1LG1A 4MTVA 4P8WA 3B8SA 4MNLA 4Z2LA 4WK9A 4WKAA 1W9UA 4WJXA 4MPKA 2O9OA 1NWSA 1WNOA 2PI6A 3BXWA 3FXYA 3CH9A
chains in the Genus database with same CATH superfamily
4HARA 1HJWA 1EIBA 3W4RA 1J4HA 1ZK6A 3PRDA 3MDYB 1LG2A 1KT1A 2DPEA 4LGXA 5HKGA 3WD0A 4IQCA 2DSUA 4JFIA 3KACA 1Q6UA 1FKSA 3AS0A 4WIWA 5HWBA 2VCDA 2XP7A 3EY6A 1QPFA 2L2SA 3OA5A 4DROA 2Q5AA 4L3NA 1E9LA 1H0IA 1E6ZA 1OGBA 5I98A 2ESCA 4KR0B 2XPAA 2LKNA 3O5MA 3JYJA 1LQ0A 2RUDA 1JCHB 1W1TA 2KI3A 1KFWA 2FDMA 4U84A 1ZB5A 4WKFA 4MAVA 1LL4A 2M1IA 4TYOA 3G6MA 4UDMA 5DIVA 1P5QA 1FKDA 4ODNA 2ETNA 4NSBA 4S3JA 3KZ7A 3BMBA 1YATA 1JNEA 3ARWA 1F40A 1ZL1A 2Y78A 4IT4A 1ZU8A 2MPHA 4JFKA 2F23A 3O5RA 4O2TA 2AOSA 2RURA 1W1VA 3TDBA 2XPBA 3UI5A 2A3AA 1A7XA 4GIVA 1GUVA 3ALFA 4W9OA 3O5LA 4G2PA 4IT6A 1J4IA 1NSGA 1HKKA 3RMEA 1FFRA 1QPLA 2PPNA 1NMWA 3ARSA 3WH0A 3WQVA 4Z2JA 4Z2IA 4P8WA 3B8SA 4Z2LA 1FKJA 3GU0A 4WJXA 2O9OA 1NWSA 3BXWA 3FXYA 4ODKA 2PPOA 1W9PA 3PR9A 1FKRA 3RM9A 1NWRA 4HBOA 3CHFA 4P8VA 1E44A 3TCZA 4DRHA 4ODQA 3QOKA 1KT0A 3ALGA 1SR0A 2OLHA 3KAGA 5HWCA 4TW6A 5HW7A 4LAXA 4Z2HA 2MLZA 4R5EA 4JYSA 2KGJA 3UQAA 2PN0A 4DRKA 4JFJA 5HW8A 2ZR6A 2A3BA 2O92A 4ODPA 2ZR5A 4BF8A 3PRBA 2YBTA 3ODKA 4ODLA 4DRMA 3ARQA 3ARXA 1RD6A 1HJXA 1ZBKA 2PV1A 3O5DA 3WD1A 2PPPA 1XRVA 2DT2A 4DRIA 2PV2A 1OWQA 3NI6A 4DT4A 1VF8A 1EDQA 5B8IC 1W1YA 1C9HA 2VN1A 1NWTA 3ARTA 4Z2KA 1UR8A 1Q1CA 1TCOC 4Q7NA 4LAWA 3B9EA 1GOIA 3RFWA 1X6NA 2F2DA 2OFNA 4FAPA 5HW6A 5J6EA 2KR7A 1BKFA 3AS2A 3B9AA 4L72B 2ZR4A 3KAHA 2A3CA 1SYTA 4ODRA 4WKHA 1ZBWA 3FAPA 5DF0A 3CZ8A 1E6RA 5BXJA 2UZ5A 3KABA 4JFMA 4DRJA 2ITKA 1D7HA 2FKEA 3ARUA 4KQZA 3IKDA 3PRAA 3EIPA 1GPFA 2ZQVA 4W9QA 5GPRA 2WK2A 3WL1A 4JFLA 5D75A 2JZVA 4MPKA 1R9HA 2PBCA 4FN2A 4MNMA 4DRNA 2B31A 3O5PA 3WL0A 3FY1A 2DSVA 3I6CA 4U86A 2XP3A 4MNKA 1OGGA 4MNJA 3WD2A 3ARVA 3KADA 2IF4A 2RUQA 1E6PA 1HKMA 1O6IA 3ARPA 4DZ2A 3IK8A 2DT3A 2A3EA 3CGNA 4LAYA 2WM0A 4ITZA 2ZQSA 4DWSB 2DSWA 2DT1A 2QF8A 2XP5A 2XP4A 1K9TA 3AS3A 5GQBA 4DRQA 4DWSD 3ARZA 3CGMA 1M5YA 1PBKA 4J4NA 1FAPA 1QZ2A 5JH8A 2ZQUA 3TC5A 1HKJA 4DIPA 3ARYA 1TFVA 2MLYA 3UQBA 1JNDA 1FD9A 1LL6A 1D7JA 1NMVA 3NRKA 3LUOA 4IPXA 1W9VA 1D2KA 2M08A 3G6LA 5DITA 1GRJA 1Q6HA 2DG9A 4GGQA 4DH0A 2F4EA 4IQ2A 3O5FA 2F21A 4U85A 4ZPWR 4ZS6A 3OOBA 4ODMA 1E6NA 2WLYA 1WAWA 2ZQTA 3WKZA 3CHCA 1FJDA 3WIJA 2LPVA 3GTYX 4URIA 1XHGA 3CHEA 4P8XA 1LL7A 3CHDA 3JYMA 2XP6A 4DWSC 3NTPA 3AS1A 4N19A 2DT0A 1B6CA 1EYMA 1FKGA 1WB0A 1ZBCA 3H9RB 2DG3A 1JVWA 3O5OA 2DSZA 3RGCA 3O5GA 4XAKA 4PTMA 1F8AB 4W5UA 1HXVA 3UI4A 4TW7A 4W9PA 4ML4A 5DEZA 1BL4A 3JXVA 2RUCA 4WKAA 3IHZA 3PA7A 5HUAA 3CH9A 3UI6A 1ZBVA 3GPKA 3KAFA 1X6LA 1EQ3A 3VAWA 1NH6A 1JNTA 2M2AA 2MF9A 1N1AA 1Y0OA 2LGOA 3RM8A 1D6OA 1PINA 1FKTA 4J4OA 3O5QA 1FKHA 2K8IA 2XP9A 2RQSA 4TNSA 1JNSA 2FAPA 2AWGA 3KAIA 2G41A 5DIUA 3O5KA 5GPGA 4DWSA 1D7IA 4QIBA 1H0GA 4NZCA 2EULA 1W26A 1FKKA 3B9DA 1Q6IA 5DO2A 1HKIA 1T11A 5HTGA 4TX0A 2WLZA 3KCEA 2RSEA 4ZPTR 5HBFA 1ZCNA 3UQIA 1YW5A 3WD3A 3AQUA 3AROA 1LJYA 4Z2GA 1UR9A 4AY1A 2MLXA 4P8UA 3WD4A 2IUZA 2DG4A 4MSPA 3ARRA 1NWUA 3O5JA 2MNTA 1FFQA 2YBUA 3RM4A 4QZVB 1J6YA 4DRPA 4C02B 3O5IA 3IKGA 4MGVA 5HT1A 1IX5A 1J4RA 4R0XA 1ROUA 1ITXA 1U79A 1E15A 4DZ3A 2N87A 1FKIA 2G8ZA 1CTNA 1EHNA 4QT2A 4QT3A 4TW8A 4ZPVR 4S3KA 4ODOA 1HJVA 1L1PA 4Q22A 2KO7A 2B5UB 2KFWA 2KE0A 1ROTA 2XP8A 3WQWA 1FKBA 1W1PA 2D9FA 3B7XA 3O5EA 2LJ4A 1LG1A 4MTVA 4LAVA 4MNLA 1FKFA 4NNRA 4WK9A 1W9UA 2P4VA 4HBEA 1WNOA 2PI6A 2PV3A 4G50A 3UF8A 1FKLA
chains in the Genus database with same CATH topology
4HARA 1HJWA 1EIBA 3W4RA 1J4HA 1ZK6A 3PRDA 3MDYB 1LG2A 1KT1A 2DPEA 4LGXA 5HKGA 3WD0A 4IQCA 2DSUA 4JFIA 3KACA 1Q6UA 1FKSA 3AS0A 4WIWA 5HWBA 2VCDA 2XP7A 3EY6A 1QPFA 2L2SA 3OA5A 4DROA 2Q5AA 4L3NA 1E9LA 1H0IA 1E6ZA 1OGBA 5I98A 2ESCA 4KR0B 2XPAA 2LKNA 3O5MA 3JYJA 1LQ0A 2RUDA 1W1TA 2KI3A 1KFWA 2FDMA 4U84A 1ZB5A 4WKFA 4MAVA 1LL4A 2M1IA 4TYOA 3G6MA 5DIVA 1P5QA 1FKDA 4ODNA 4NSBA 4S3JA 3KZ7A 1YATA 1JNEA 3ARWA 1F40A 1ZL1A 2Y78A 4IT4A 1ZU8A 2MPHA 4JFKA 3O5RA 4O2TA 2AOSA 2RURA 1W1VA 3TDBA 2XPBA 3UI5A 2A3AA 1A7XA 4GIVA 1GUVA 3ALFA 4W9OA 3O5LA 4G2PA 4IT6A 1J4IA 1NSGA 1HKKA 3RMEA 1FFRA 1QPLA 2PPNA 1NMWA 3ARSA 3WH0A 3WQVA 4Z2JA 4Z2IA 4P8WA 3B8SA 4Z2LA 1FKJA 4WJXA 2O9OA 1NWSA 3BXWA 3FXYA 4ODKA 2PPOA 1W9PA 3PR9A 1FKRA 3RM9A 1NWRA 4HBOA 3CHFA 4P8VA 3TCZA 4DRHA 4ODQA 3QOKA 1KT0A 3ALGA 1SR0A 2OLHA 3KAGA 5HWCA 4TW6A 5HW7A 4LAXA 4Z2HA 2MLZA 4R5EA 4JYSA 2KGJA 3UQAA 4DRKA 4JFJA 5HW8A 2ZR6A 2A3BA 2O92A 4ODPA 2ZR5A 4BF8A 3PRBA 2YBTA 3ODKA 4ODLA 4DRMA 3ARQA 3ARXA 1RD6A 1HJXA 1ZBKA 2PV1A 3O5DA 3WD1A 2PPPA 1XRVA 2DT2A 4DRIA 2PV2A 1OWQA 3NI6A 4DT4A 1VF8A 1EDQA 5B8IC 1W1YA 1C9HA 2VN1A 1NWTA 3ARTA 4Z2KA 1UR8A 1Q1CA 1TCOC 4Q7NA 4LAWA 3B9EA 1GOIA 3RFWA 1X6NA 2F2DA 2OFNA 4FAPA 5HW6A 5J6EA 2KR7A 1BKFA 3AS2A 3B9AA 4L72B 2ZR4A 3KAHA 2A3CA 1SYTA 4ODRA 4WKHA 1ZBWA 3FAPA 5DF0A 3CZ8A 1E6RA 5BXJA 2UZ5A 3KABA 4JFMA 4DRJA 2ITKA 1D7HA 2FKEA 3ARUA 4KQZA 3IKDA 3PRAA 1GPFA 2ZQVA 4W9QA 5GPRA 2WK2A 3WL1A 4JFLA 5D75A 2JZVA 4MPKA 1R9HA 2PBCA 4FN2A 4MNMA 4DRNA 2B31A 3O5PA 3WL0A 3FY1A 2DSVA 3I6CA 4U86A 2XP3A 4MNKA 1OGGA 4MNJA 3WD2A 3ARVA 3KADA 2IF4A 2RUQA 1E6PA 1HKMA 1O6IA 3ARPA 4DZ2A 3IK8A 2DT3A 2A3EA 3CGNA 4LAYA 2WM0A 4ITZA 2ZQSA 4DWSB 2DSWA 2DT1A 2QF8A 2XP5A 2XP4A 1K9TA 3AS3A 5GQBA 4DRQA 4DWSD 3ARZA 3CGMA 1M5YA 1PBKA 4J4NA 1FAPA 1QZ2A 5JH8A 2ZQUA 3TC5A 1HKJA 4DIPA 3ARYA 1TFVA 2MLYA 3UQBA 1JNDA 1FD9A 1LL6A 1D7JA 1NMVA 3NRKA 3LUOA 4IPXA 1W9VA 1D2KA 2M08A 3G6LA 5DITA 1Q6HA 2DG9A 4GGQA 4DH0A 2F4EA 4IQ2A 3O5FA 2F21A 4U85A 4ZPWR 4ZS6A 3OOBA 4ODMA 1E6NA 2WLYA 1WAWA 2ZQTA 3WKZA 3CHCA 1FJDA 3WIJA 2LPVA 4URIA 1XHGA 3CHEA 4P8XA 1LL7A 3CHDA 3JYMA 2XP6A 4DWSC 3NTPA 3AS1A 4N19A 2DT0A 1B6CA 1EYMA 1FKGA 1WB0A 1ZBCA 3H9RB 2DG3A 1JVWA 3O5OA 2DSZA 3RGCA 3O5GA 4XAKA 4PTMA 1F8AB 4W5UA 1HXVA 3UI4A 4TW7A 4W9PA 4ML4A 5DEZA 1BL4A 3JXVA 2RUCA 4WKAA 3IHZA 3PA7A 5HUAA 3CH9A 3UI6A 1ZBVA 3GPKA 3KAFA 1X6LA 1EQ3A 3VAWA 1NH6A 1JNTA 2M2AA 2MF9A 1N1AA 1Y0OA 2LGOA 3RM8A 1D6OA 1PINA 1FKTA 4J4OA 3O5QA 1FKHA 2K8IA 2XP9A 2RQSA 4TNSA 1JNSA 2FAPA 2AWGA 3KAIA 2G41A 5DIUA 3O5KA 5GPGA 4DWSA 1D7IA 4QIBA 1H0GA 4NZCA 1W26A 1FKKA 3B9DA 1Q6IA 5DO2A 1HKIA 1T11A 5HTGA 4TX0A 2WLZA 3KCEA 2RSEA 4ZPTR 5HBFA 1ZCNA 3UQIA 1YW5A 3WD3A 3AQUA 3AROA 1LJYA 4Z2GA 1UR9A 4AY1A 2MLXA 4P8UA 3WD4A 2IUZA 2DG4A 4MSPA 3ARRA 1NWUA 3O5JA 2MNTA 1FFQA 2YBUA 3RM4A 4QZVB 1J6YA 4DRPA 4C02B 3O5IA 3IKGA 4MGVA 5HT1A 1IX5A 1J4RA 4R0XA 1ROUA 1ITXA 1U79A 1E15A 4DZ3A 2N87A 1FKIA 2G8ZA 1CTNA 1EHNA 4QT2A 4QT3A 4TW8A 4ZPVR 4S3KA 4ODOA 1HJVA 1L1PA 4Q22A 2KO7A 2KFWA 2KE0A 1ROTA 2XP8A 3WQWA 1FKBA 1W1PA 2D9FA 3B7XA 3O5EA 2LJ4A 1LG1A 4MTVA 4LAVA 4MNLA 1FKFA 4NNRA 4WK9A 1W9UA 4HBEA 1WNOA 2PI6A 2PV3A 4G50A 3UF8A 1FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBV A;  1HJW A;  2B31 A;  1W9P A;  3WL0 A;  1X6L A;  1EIB A;  3W4R A;  1NH6 A;  3FY1 A;  1LG2 A;  2DSV A;  3RM9 A;  2DPE A;  1NWR A;  4LGX A;  3CHF A;  4P8V A;  3WD0 A;  3RM8 A;  2DSU A;  3QOK A;  4MNK A;  3ALG A;  1OGG A;  4MNJ A;  1SR0 A;  2OLH A;  3ARV A;  3WD2 A;  1E6P A;  1HKM A;  1O6I A;  3ARP A;  3AS0 A;  4WIW A;  2DT3 A;  2A3E A;  2WM0 A;  4Z2H A;  2G41 A;  4DWS B;  4R5E A;  2DSW A;  2DT1 A;  3OA5 A;  4DWS A;  1H0G A;  4NZC A;  1E9L A;  2QF8 A;  1H0I A;  1E6Z A;  3B9D A;  1OGB A;  1K9T A;  3AS3 A;  5GQB A;  4DWS D;  3ARZ A;  2A3B A;  2O92 A;  1HKI A;  2ESC A;  2WLZ A;  5JH8 A;  2YBT A;  1HKJ A;  3ARY A;  1TFV A;  3ARQ A;  3ARX A;  1JND A;  1LQ0 A;  1RD6 A;  5HBF A;  1LL6 A;  1W1T A;  1HJX A;  1ZBK A;  3WD3 A;  3WD1 A;  1XRV A;  2DT2 A;  3AQU A;  3ARO A;  1LJY A;  1D2K A;  1W9V A;  3G6L A;  4Z2G A;  1UR9 A;  1KFW A;  4AY1 A;  4P8U A;  3WD4 A;  2IUZ A;  1OWQ A;  3ARR A;  1NWU A;  1VF8 A;  2FDM A;  1EDQ A;  1ZB5 A;  4WKF A;  1FFQ A;  1W1Y A;  4MAV A;  2YBU A;  3RM4 A;  1LL4 A;  3G6M A;  1E6N A;  2WLY A;  1NWT A;  3ART A;  4Z2K A;  4NSB A;  1UR8 A;  4S3J A;  1WAW A;  1ITX A;  1JNE A;  4Q7N A;  3ARW A;  3CHC A;  3B9E A;  3WKZ A;  1GOI A;  1ZL1 A;  1X6N A;  1ZU8 A;  1E15 A;  3WIJ A;  4URI A;  2AOS A;  2G8Z A;  1XHG A;  3CHE A;  1CTN A;  1EHN A;  1W1V A;  4P8X A;  1LL7 A;  3AS2 A;  3B9A A;  3CHD A;  2A3A A;  4DWS C;  3AS1 A;  2A3C A;  1SYT A;  4S3K A;  1GUV A;  4WKH A;  2DT0 A;  3ALF A;  1WB0 A;  1HJV A;  1ZBW A;  4MNM A;  4Q22 A;  1ZBC A;  5DF0 A;  3CZ8 A;  1E6R A;  2DSZ A;  1HKK A;  3ARU A;  3RME A;  3WQW A;  4PTM A;  1FFR A;  1W1P A;  4W5U A;  3ARS A;  1GPF A;  4ML4 A;  3WQV A;  4Z2J A;  5GPR A;  2WK2 A;  3WL1 A;  4Z2I A;  5DEZ A;  1LG1 A;  4MTV A;  4P8W A;  3B8S A;  4MNL A;  4Z2L A;  4WK9 A;  4WKA A;  1W9U A;  4WJX A;  4MPK A;  2O9O A;  1NWS A;  1WNO A;  2PI6 A;  3BXW A;  3FXY A;  3CH9 A; 
#chains in the Genus database with same CATH topology
 4HAR A;  1HJW A;  1EIB A;  3W4R A;  1J4H A;  1ZK6 A;  3PRD A;  3MDY B;  1LG2 A;  1KT1 A;  2DPE A;  4LGX A;  5HKG A;  3WD0 A;  4IQC A;  2DSU A;  4JFI A;  3KAC A;  1Q6U A;  1FKS A;  3AS0 A;  4WIW A;  5HWB A;  2VCD A;  2XP7 A;  3EY6 A;  1QPF A;  2L2S A;  3OA5 A;  4DRO A;  2Q5A A;  4L3N A;  1E9L A;  1H0I A;  1E6Z A;  1OGB A;  5I98 A;  2ESC A;  4KR0 B;  2XPA A;  2LKN A;  3O5M A;  3JYJ A;  1LQ0 A;  2RUD A;  1JCH B;  1W1T A;  2KI3 A;  1KFW A;  2FDM A;  4U84 A;  1ZB5 A;  4WKF A;  4MAV A;  1LL4 A;  2M1I A;  4TYO A;  3G6M A;  4UDM A;  5DIV A;  1P5Q A;  1FKD A;  4ODN A;  2ETN A;  4NSB A;  4S3J A;  3KZ7 A;  3BMB A;  1YAT A;  1JNE A;  3ARW A;  1F40 A;  1ZL1 A;  2Y78 A;  4IT4 A;  1ZU8 A;  2MPH A;  4JFK A;  2F23 A;  3O5R A;  4O2T A;  2AOS A;  2RUR A;  1W1V A;  3TDB A;  2XPB A;  3UI5 A;  2A3A A;  1A7X A;  4GIV A;  1GUV A;  3ALF A;  4W9O A;  3O5L A;  4G2P A;  4IT6 A;  1J4I A;  1NSG A;  1HKK A;  3RME A;  1FFR A;  1QPL A;  2PPN A;  1NMW A;  3ARS A;  3WH0 A;  3WQV A;  4Z2J A;  4Z2I A;  4P8W A;  3B8S A;  4Z2L A;  1FKJ A;  3GU0 A;  4WJX A;  2O9O A;  1NWS A;  3BXW A;  3FXY A;  4ODK A;  2PPO A;  1W9P A;  3PR9 A;  1FKR A;  3RM9 A;  1NWR A;  4HBO A;  3CHF A;  4P8V A;  1E44 A;  3TCZ A;  4DRH A;  4ODQ A;  3QOK A;  1KT0 A;  3ALG A;  1SR0 A;  2OLH A;  3KAG A;  5HWC A;  4TW6 A;  5HW7 A;  4LAX A;  4Z2H A;  2MLZ A;  4R5E A;  4JYS A;  2KGJ A;  3UQA A;  2PN0 A;  4DRK A;  4JFJ A;  5HW8 A;  2ZR6 A;  2A3B A;  2O92 A;  4ODP A;  2ZR5 A;  4BF8 A;  3PRB A;  2YBT A;  3ODK A;  4ODL A;  4DRM A;  3ARQ A;  3ARX A;  1RD6 A;  1HJX A;  1ZBK A;  2PV1 A;  3O5D A;  3WD1 A;  2PPP A;  1XRV A;  2DT2 A;  4DRI A;  2PV2 A;  1OWQ A;  3NI6 A;  4DT4 A;  1VF8 A;  1EDQ A;  5B8I C;  1W1Y A;  1C9H A;  2VN1 A;  1NWT A;  3ART A;  4Z2K A;  1UR8 A;  1Q1C A;  1TCO C;  4Q7N A;  4LAW A;  3B9E A;  1GOI A;  3RFW A;  1X6N A;  2F2D A;  2OFN A;  4FAP A;  5HW6 A;  5J6E A;  2KR7 A;  1BKF A;  3AS2 A;  3B9A A;  4L72 B;  2ZR4 A;  3KAH A;  2A3C A;  1SYT A;  4ODR A;  4WKH A;  1ZBW A;  3FAP A;  5DF0 A;  3CZ8 A;  1E6R A;  5BXJ A;  2UZ5 A;  3KAB A;  4JFM A;  4DRJ A;  2ITK A;  1D7H A;  2FKE A;  3ARU A;  4KQZ A;  3IKD A;  3PRA A;  3EIP A;  1GPF A;  2ZQV A;  4W9Q A;  5GPR A;  2WK2 A;  3WL1 A;  4JFL A;  5D75 A;  2JZV A;  4MPK A;  1R9H A;  2PBC A;  4FN2 A;  4MNM A;  4DRN A;  2B31 A;  3O5P A;  3WL0 A;  3FY1 A;  2DSV A;  3I6C A;  4U86 A;  2XP3 A;  4MNK A;  1OGG A;  4MNJ A;  3WD2 A;  3ARV A;  3KAD A;  2IF4 A;  2RUQ A;  1E6P A;  1HKM A;  1O6I A;  3ARP A;  4DZ2 A;  3IK8 A;  2DT3 A;  2A3E A;  3CGN A;  4LAY A;  2WM0 A;  4ITZ A;  2ZQS A;  4DWS B;  2DSW A;  2DT1 A;  2QF8 A;  2XP5 A;  2XP4 A;  1K9T A;  3AS3 A;  5GQB A;  4DRQ A;  4DWS D;  3ARZ A;  3CGM A;  1M5Y A;  1PBK A;  4J4N A;  1FAP A;  1QZ2 A;  5JH8 A;  2ZQU A;  3TC5 A;  1HKJ A;  4DIP A;  3ARY A;  1TFV A;  2MLY A;  3UQB A;  1JND A;  1FD9 A;  1LL6 A;  1D7J A;  1NMV A;  3NRK A;  3LUO A;  4IPX A;  1W9V A;  1D2K A;  2M08 A;  3G6L A;  5DIT A;  1GRJ A;  1Q6H A;  2DG9 A;  4GGQ A;  4DH0 A;  2F4E A;  4IQ2 A;  3O5F A;  2F21 A;  4U85 A;  4ZPW R;  4ZS6 A;  3OOB A;  4ODM A;  1E6N A;  2WLY A;  1WAW A;  2ZQT A;  3WKZ A;  3CHC A;  1FJD A;  3WIJ A;  2LPV A;  3GTY X;  4URI A;  1XHG A;  3CHE A;  4P8X A;  1LL7 A;  3CHD A;  3JYM A;  2XP6 A;  4DWS C;  3NTP A;  3AS1 A;  4N19 A;  2DT0 A;  1B6C A;  1EYM A;  1FKG A;  1WB0 A;  1ZBC A;  3H9R B;  2DG3 A;  1JVW A;  3O5O A;  2DSZ A;  3RGC A;  3O5G A;  4XAK A;  4PTM A;  1F8A B;  4W5U A;  1HXV A;  3UI4 A;  4TW7 A;  4W9P A;  4ML4 A;  5DEZ A;  1BL4 A;  3JXV A;  2RUC A;  4WKA A;  3IHZ A;  3PA7 A;  5HUA A;  3CH9 A;  3UI6 A;  1ZBV A;  3GPK A;  3KAF A;  1X6L A;  1EQ3 A;  3VAW A;  1NH6 A;  1JNT A;  2M2A A;  2MF9 A;  1N1A A;  1Y0O A;  2LGO A;  3RM8 A;  1D6O A;  1PIN A;  1FKT A;  4J4O A;  3O5Q A;  1FKH A;  2K8I A;  2XP9 A;  2RQS A;  4TNS A;  1JNS A;  2FAP A;  2AWG A;  3KAI A;  2G41 A;  5DIU A;  3O5K A;  5GPG A;  4DWS A;  1D7I A;  4QIB A;  1H0G A;  4NZC A;  2EUL A;  1W26 A;  1FKK A;  3B9D A;  1Q6I A;  5DO2 A;  1HKI A;  1T11 A;  5HTG A;  4TX0 A;  2WLZ A;  3KCE A;  2RSE A;  4ZPT R;  5HBF A;  1ZCN A;  3UQI A;  1YW5 A;  3WD3 A;  3AQU A;  3ARO A;  1LJY A;  4Z2G A;  1UR9 A;  4AY1 A;  2MLX A;  4P8U A;  3WD4 A;  2IUZ A;  2DG4 A;  4MSP A;  3ARR A;  1NWU A;  3O5J A;  2MNT A;  1FFQ A;  2YBU A;  3RM4 A;  4QZV B;  1J6Y A;  4DRP A;  4C02 B;  3O5I A;  3IKG A;  4MGV A;  5HT1 A;  1IX5 A;  1J4R A;  4R0X A;  1ROU A;  1ITX A;  1U79 A;  1E15 A;  4DZ3 A;  2N87 A;  1FKI A;  2G8Z A;  1CTN A;  1EHN A;  4QT2 A;  4QT3 A;  4TW8 A;  4ZPV R;  4S3K A;  4ODO A;  1HJV A;  1L1P A;  4Q22 A;  2KO7 A;  2B5U B;  2KFW A;  2KE0 A;  1ROT A;  2XP8 A;  3WQW A;  1FKB A;  1W1P A;  2D9F A;  3B7X A;  3O5E A;  2LJ4 A;  1LG1 A;  4MTV A;  4LAV A;  4MNL A;  1FKF A;  4NNR A;  4WK9 A;  1W9U A;  2P4V A;  4HBE A;  1WNO A;  2PI6 A;  2PV3 A;  4G50 A;  3UF8 A;  1FKL A; 
#chains in the Genus database with same CATH homology
 4HAR A;  1HJW A;  1EIB A;  3W4R A;  1J4H A;  1ZK6 A;  3PRD A;  3MDY B;  1LG2 A;  1KT1 A;  2DPE A;  4LGX A;  5HKG A;  3WD0 A;  4IQC A;  2DSU A;  4JFI A;  3KAC A;  1Q6U A;  1FKS A;  3AS0 A;  4WIW A;  5HWB A;  2VCD A;  2XP7 A;  3EY6 A;  1QPF A;  2L2S A;  3OA5 A;  4DRO A;  2Q5A A;  4L3N A;  1E9L A;  1H0I A;  1E6Z A;  1OGB A;  5I98 A;  2ESC A;  4KR0 B;  2XPA A;  2LKN A;  3O5M A;  3JYJ A;  1LQ0 A;  2RUD A;  1W1T A;  2KI3 A;  1KFW A;  2FDM A;  4U84 A;  1ZB5 A;  4WKF A;  4MAV A;  1LL4 A;  2M1I A;  4TYO A;  3G6M A;  5DIV A;  1P5Q A;  1FKD A;  4ODN A;  4NSB A;  4S3J A;  3KZ7 A;  1YAT A;  1JNE A;  3ARW A;  1F40 A;  1ZL1 A;  2Y78 A;  4IT4 A;  1ZU8 A;  2MPH A;  4JFK A;  3O5R A;  4O2T A;  2AOS A;  2RUR A;  1W1V A;  3TDB A;  2XPB A;  3UI5 A;  2A3A A;  1A7X A;  4GIV A;  1GUV A;  3ALF A;  4W9O A;  3O5L A;  4G2P A;  4IT6 A;  1J4I A;  1NSG A;  1HKK A;  3RME A;  1FFR A;  1QPL A;  2PPN A;  1NMW A;  3ARS A;  3WH0 A;  3WQV A;  4Z2J A;  4Z2I A;  4P8W A;  3B8S A;  4Z2L A;  1FKJ A;  4WJX A;  2O9O A;  1NWS A;  3BXW A;  3FXY A;  4ODK A;  2PPO A;  1W9P A;  3PR9 A;  1FKR A;  3RM9 A;  1NWR A;  4HBO A;  3CHF A;  4P8V A;  3TCZ A;  4DRH A;  4ODQ A;  3QOK A;  1KT0 A;  3ALG A;  1SR0 A;  2OLH A;  3KAG A;  5HWC A;  4TW6 A;  5HW7 A;  4LAX A;  4Z2H A;  2MLZ A;  4R5E A;  4JYS A;  2KGJ A;  3UQA A;  4DRK A;  4JFJ A;  5HW8 A;  2ZR6 A;  2A3B A;  2O92 A;  4ODP A;  2ZR5 A;  4BF8 A;  3PRB A;  2YBT A;  3ODK A;  4ODL A;  4DRM A;  3ARQ A;  3ARX A;  1RD6 A;  1HJX A;  1ZBK A;  2PV1 A;  3O5D A;  3WD1 A;  2PPP A;  1XRV A;  2DT2 A;  4DRI A;  2PV2 A;  1OWQ A;  3NI6 A;  4DT4 A;  1VF8 A;  1EDQ A;  5B8I C;  1W1Y A;  1C9H A;  2VN1 A;  1NWT A;  3ART A;  4Z2K A;  1UR8 A;  1Q1C A;  1TCO C;  4Q7N A;  4LAW A;  3B9E A;  1GOI A;  3RFW A;  1X6N A;  2F2D A;  2OFN A;  4FAP A;  5HW6 A;  5J6E A;  2KR7 A;  1BKF A;  3AS2 A;  3B9A A;  4L72 B;  2ZR4 A;  3KAH A;  2A3C A;  1SYT A;  4ODR A;  4WKH A;  1ZBW A;  3FAP A;  5DF0 A;  3CZ8 A;  1E6R A;  5BXJ A;  2UZ5 A;  3KAB A;  4JFM A;  4DRJ A;  2ITK A;  1D7H A;  2FKE A;  3ARU A;  4KQZ A;  3IKD A;  3PRA A;  1GPF A;  2ZQV A;  4W9Q A;  5GPR A;  2WK2 A;  3WL1 A;  4JFL A;  5D75 A;  2JZV A;  4MPK A;  1R9H A;  2PBC A;  4FN2 A;  4MNM A;  4DRN A;  2B31 A;  3O5P A;  3WL0 A;  3FY1 A;  2DSV A;  3I6C A;  4U86 A;  2XP3 A;  4MNK A;  1OGG A;  4MNJ A;  3WD2 A;  3ARV A;  3KAD A;  2IF4 A;  2RUQ A;  1E6P A;  1HKM A;  1O6I A;  3ARP A;  4DZ2 A;  3IK8 A;  2DT3 A;  2A3E A;  3CGN A;  4LAY A;  2WM0 A;  4ITZ A;  2ZQS A;  4DWS B;  2DSW A;  2DT1 A;  2QF8 A;  2XP5 A;  2XP4 A;  1K9T A;  3AS3 A;  5GQB A;  4DRQ A;  4DWS D;  3ARZ A;  3CGM A;  1M5Y A;  1PBK A;  4J4N A;  1FAP A;  1QZ2 A;  5JH8 A;  2ZQU A;  3TC5 A;  1HKJ A;  4DIP A;  3ARY A;  1TFV A;  2MLY A;  3UQB A;  1JND A;  1FD9 A;  1LL6 A;  1D7J A;  1NMV A;  3NRK A;  3LUO A;  4IPX A;  1W9V A;  1D2K A;  2M08 A;  3G6L A;  5DIT A;  1Q6H A;  2DG9 A;  4GGQ A;  4DH0 A;  2F4E A;  4IQ2 A;  3O5F A;  2F21 A;  4U85 A;  4ZPW R;  4ZS6 A;  3OOB A;  4ODM A;  1E6N A;  2WLY A;  1WAW A;  2ZQT A;  3WKZ A;  3CHC A;  1FJD A;  3WIJ A;  2LPV A;  4URI A;  1XHG A;  3CHE A;  4P8X A;  1LL7 A;  3CHD A;  3JYM A;  2XP6 A;  4DWS C;  3NTP A;  3AS1 A;  4N19 A;  2DT0 A;  1B6C A;  1EYM A;  1FKG A;  1WB0 A;  1ZBC A;  3H9R B;  2DG3 A;  1JVW A;  3O5O A;  2DSZ A;  3RGC A;  3O5G A;  4XAK A;  4PTM A;  1F8A B;  4W5U A;  1HXV A;  3UI4 A;  4TW7 A;  4W9P A;  4ML4 A;  5DEZ A;  1BL4 A;  3JXV A;  2RUC A;  4WKA A;  3IHZ A;  3PA7 A;  5HUA A;  3CH9 A;  3UI6 A;  1ZBV A;  3GPK A;  3KAF A;  1X6L A;  1EQ3 A;  3VAW A;  1NH6 A;  1JNT A;  2M2A A;  2MF9 A;  1N1A A;  1Y0O A;  2LGO A;  3RM8 A;  1D6O A;  1PIN A;  1FKT A;  4J4O A;  3O5Q A;  1FKH A;  2K8I A;  2XP9 A;  2RQS A;  4TNS A;  1JNS A;  2FAP A;  2AWG A;  3KAI A;  2G41 A;  5DIU A;  3O5K A;  5GPG A;  4DWS A;  1D7I A;  4QIB A;  1H0G A;  4NZC A;  1W26 A;  1FKK A;  3B9D A;  1Q6I A;  5DO2 A;  1HKI A;  1T11 A;  5HTG A;  4TX0 A;  2WLZ A;  3KCE A;  2RSE A;  4ZPT R;  5HBF A;  1ZCN A;  3UQI A;  1YW5 A;  3WD3 A;  3AQU A;  3ARO A;  1LJY A;  4Z2G A;  1UR9 A;  4AY1 A;  2MLX A;  4P8U A;  3WD4 A;  2IUZ A;  2DG4 A;  4MSP A;  3ARR A;  1NWU A;  3O5J A;  2MNT A;  1FFQ A;  2YBU A;  3RM4 A;  4QZV B;  1J6Y A;  4DRP A;  4C02 B;  3O5I A;  3IKG A;  4MGV A;  5HT1 A;  1IX5 A;  1J4R A;  4R0X A;  1ROU A;  1ITX A;  1U79 A;  1E15 A;  4DZ3 A;  2N87 A;  1FKI A;  2G8Z A;  1CTN A;  1EHN A;  4QT2 A;  4QT3 A;  4TW8 A;  4ZPV R;  4S3K A;  4ODO A;  1HJV A;  1L1P A;  4Q22 A;  2KO7 A;  2KFW A;  2KE0 A;  1ROT A;  2XP8 A;  3WQW A;  1FKB A;  1W1P A;  2D9F A;  3B7X A;  3O5E A;  2LJ4 A;  1LG1 A;  4MTV A;  4LAV A;  4MNL A;  1FKF A;  4NNR A;  4WK9 A;  1W9U A;  4HBE A;  1WNO A;  2PI6 A;  2PV3 A;  4G50 A;  3UF8 A;  1FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...