5JH8A

Crystal structure of chitinase from chromobacterium violaceum atcc 12472
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
309
Chain Sequence
AAMVLAYYSGYAGNYAALTRYAASFNAVAVDFYNITAQGAVTGNGDPAPNDAISFLLGRIPAYGCVSNVDGNGNWSADIAHAVSTSAQSQAVANLVFAQDRFSGINVDFEAVAQGDRNNFSHFIQVLGRALHAKGLLIVSVPAFSADENHPANYGYDLRALGAAADYLQIMSYDEAIPAWDPGPVAGSDWMEDDLDYAVERVPAAKILNGIPAYGYDWRPGDGGMLYWDTQALIARYGAQPRYDAGTHSLTFNYGAADGSRHTVWTENARSVALKASLVNAYGLGGTSLYALGMEDDAFWAAVQGLAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable chitinase
publication title Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 101
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5jh8A02
1X6LA 1UR9A 3G6MA 2PI6A 3WD4A 3ARXA 1ZB5A 1X6NA 3ALFA 4PTMA 3RMEA 1HJXA 2WLZA 1GPFA 3ARVA 4LGXA 3AS3A 3WIJA 3RM8A 2WK2A 1W1TA 2DSUA 4P8WA 1EDQA 1WB0A 2A3EA 1LJYA 1TFVA 1ZL1A 3CZ8A 2ESCA 1D2KA 3ARQA 3ARRA 2G8ZA 2DSWA 1E6RA 3FY1A 1H0GA 4Q22A 1RD6A 1K9TA 2G41A 4MNJA 2WM0A 3RM4A 3W4RA 1E15A 2AOSA 3ARPA 1ZBVA 5DF0A 3WD3A 1W1PA 1O6IA 4DWSA 4MNKA 2WLYA 4WJXA 1NWRA 4Z2KA 1JNDA 3WQVA 3AS0A 2DT2A 1CTNA 4AY1A 4S3KA 4MNMA 1OGBA 1VF8A 2QF8A 3WL0A 1OGGA 1UR8A 1NWSA 3WL1A 4DWSD 1E9LA 2O92A 4DWSB 1GUVA 3ARWA 1LL6A 3WQWA 1EHNA 1LG1A 1OWQA 3FXYA 1LQ0A 5GPRA 3ARYA 4Z2GA 4WIWA 2O9OA 2DT1A 1E6PA 3ARUA 3B9EA 1EIBA 3AROA 1ITXA 4MNLA 3B9DA 2YBTA 1FFRA 1W9UA 2B31A 2A3AA 3QOKA 1NWUA 4DWSC 1ZBWA 2DT3A 2IUZA 4WKFA 4WK9A 4P8VA 3WKZA 3CHDA 2OLHA 4NZCA 4MAVA 1LG2A 4Z2HA 1NH6A 1XRVA 4R5EA 1E6ZA 3CHEA 4MTVA 3WD2A 1HKJA 3G6LA 3AQUA 3OA5A 1XHGA 4WKAA 1SYTA 4NSBA 3WD0A 3ARTA 5GQBA 2DPEA 3ARSA 4MPKA 4URIA 1HKKA 4Q7NA 1FFQA 1H0IA 1W9VA 1KFWA 3AS1A 3ARZA 4P8XA 1WNOA 1W9PA 5HBFA 1HJWA 3BXWA 4Z2LA 1W1YA 1LL4A 2A3CA 2DT0A 4W5UA 4Z2JA 3CH9A 4P8UA 4S3JA 1JNEA 3AS2A 1ZBKA 3CHFA 4Z2IA 3WD1A 2A3BA 5DEZA 1HKIA 2DSZA 1HKMA 2FDMA 1NWTA 3B9AA 4WKHA 3RM9A 1W1VA 1GOIA 1E6NA 1HJVA 1SR0A 3ALGA 3B8SA 5JH8A 1ZBCA 1LL7A 1ZU8A 4ML4A 1WAWA 2DSVA 3CHCA 2YBUA
chains in the Genus database with same CATH superfamily
1X6LA 1UR9A 2PI6A 3WD4A 2LJ4A 2RSEA 1ZB5A 1E44A 1J4RA 2M2AA 4PTMA 4GIVA 4BF8A 3O5QA 2N87A 2WLZA 4LGXA 1PINA 2ZR6A 4TYOA 4IPXA 4ZPVR 1EDQA 4J4NA 1FKGA 1ZK6A 2KO7A 4DRKA 1TFVA 1FKSA 2ESCA 4DIPA 3ARRA 4N19A 1JCHB 4IQCA 2WM0A 1Q6IA 1N1AA 3RM4A 5DITA 1Q6UA 2PBCA 1O6IA 4NNRA 1NWRA 2F4EA 2KE0A 2ZR5A 4XAKA 3CGNA 5DO2A 3AS0A 4AY1A 4MNMA 1E9LA 2XP8A 2ZQUA 3FXYA 3ARUA 4LAWA 2Y78A 2DG9A 3KACA 1D7IA 3B9DA 1FKFA 2A3AA 1NWUA 1FKHA 1D7HA 1ZBWA 2PN0A 2XP3A 2DG4A 2F2DA 5HWCA 4P8VA 2RUCA 4FN2A 4MAVA 1LG2A 1NH6A 4TNSA 4L72B 1J4HA 3LUOA 2ITKA 2K8IA 1HKJA 3UI5A 3G6LA 2XP6A 2LPVA 4NSBA 4Q7NA 1FFQA 1H0IA 1BL4A 3AS1A 2M1IA 4QIBA 1B6CA 1WNOA 2F21A 3TDBA 4DRJA 1FKKA 2D9FA 3BXWA 2DT0A 1YW5A 4Z2JA 3CH9A 4P8UA 2PV2A 1P5QA 3CHFA 3PRBA 3EY6A 4DZ2A 4ODRA 2DSZA 2XPBA 3O5FA 3UI6A 3B9AA 3KAGA 5GPGA 1HJVA 2FKEA 1LL7A 4HBEA 4JFJA 3CHCA 4ML4A 4WJXA 1FJDA 3MDYB 1EQ3A 3O5LA 1A7XA 1JNSA 3ALFA 4U85A 4DRIA 3KZ7A 3ARVA 3WIJA 3GPKA 4J4OA 4P8WA 2LKNA 1WB0A 2A3EA 2Q5AA 5BXJA 4IQ2A 4GGQA 1KT1A 3NI6A 2PV1A 3O5OA 1D2KA 4JYSA 5B8IC 1U79A 1E6RA 3TCZA 3FY1A 4ODPA 4MNJA 3IKGA 4TW7A 1ZBVA 3WD3A 4DWSA 2WLYA 4TW8A 4DH0A 3JXVA 3PRAA 2DT2A 4ITZA 5HW6A 2MLZA 4JFMA 2MPHA 1UR8A 4DWSD 5J6EA 1JNTA 4KQZA 4DRQA 4U86A 3ARWA 5HTGA 1LG1A 1TCOC 4Z2GA 1E6PA 3B9EA 4FAPA 3IK8A 3TC5A 3O5IA 2B31A 3QOKA 3IHZA 3OOBA 4HBOA 1BKFA 4DROA 2IUZA 4WKFA 3IKDA 4WK9A 3CHDA 2OLHA 4QT2A 1XRVA 4KR0B 4R5EA 3WD2A 4MSPA 1FKBA 2RQSA 3UQIA 3H9RB 2DPEA 3ARSA 4MPKA 4URIA 1HKKA 3JYJA 1W9VA 3O5MA 4HARA 4S3JA 1ZBKA 3PRDA 2PV3A 2A3BA 5DEZA 1J4IA 1R9HA 1NWTA 2OFNA 4MGVA 1FKRA 4TW6A 2KI3A 5JH8A 1FD9A 2RUDA 1WAWA 3AS2A 2DSVA 2YBUA 1ROUA 4LAXA 3ARXA 1HXVA 1X6NA 4ODMA 1QPLA 3NRKA 3RMEA 1HJXA 2FAPA 1GPFA 3RM8A 2WK2A 1W1TA 1FKDA 1ROTA 2M08A 2DSUA 4UDMA 1LJYA 1QPFA 3I6CA 3O5EA 3ARQA 2G8ZA 1H0GA 3W4RA 1E15A 2AOSA 1FAPA 3ARPA 3KAHA 1W1PA 3KABA 2L2SA 1FKTA 4Z2KA 1JNDA 4QT3A 2EULA 3JYMA 4S3KA 1OGBA 1VF8A 2ZR4A 2QF8A 1NWSA 1NSGA 3GU0A 3O5GA 4DRNA 1L1PA 2XP9A 4DWSB 1LL6A 3KCEA 4DRHA 1LQ0A 3O5RA 5GPRA 3ARYA 2PPPA 2DT1A 1IX5A 3WH0A 3CGMA 1EIBA 3KADA 1W9UA 2ZQVA 4W9QA 4DWSC 3UQBA 2AWGA 1T11A 2DT3A 1NMVA 4DT4A 2ZQTA 2LGOA 2IF4A 4Z2HA 4ZS6A 4L3NA 1E6ZA 3CHEA 2KGJA 3AQUA 3OA5A 1XHGA 1SYTA 2F23A 3BMBA 4U84A 5HBFA 4W5UA 1D7JA 3RGCA 1JNEA 1Q6HA 1QZ2A 2JZVA 3NTPA 2DG3A 4R0XA 2FDMA 4WKHA 4ODKA 2PPNA 2B5UB 1SR0A 4LAVA 1PBKA 3ALGA 4ODNA 1Q1CA 2XP4A 2RURA 2ZQSA 3B8SA 1ZBCA 4QZVB 3RFWA 3FAPA 1ZCNA 3WL1A 2XP7A 1GRJA 1JVWA 3G6MA 1KT0A 4ODOA 4ODQA 1J6YA 1F8AB 3GTYX 4JFKA 4ZPTR 2VN1A 5HUAA 4DRPA 2KR7A 3AS3A 1F40A 1EYMA 4JFIA 1ZL1A 3CZ8A 3UQAA 5DIVA 3O5PA 2DSWA 4DZ3A 4Q22A 1RD6A 1K9TA 2G41A 3UF8A 4W9PA 5DF0A 2UZ5A 4MNKA 3WQVA 3PA7A 1CTNA 1YATA 1FKJA 2P4VA 3WL0A 1OGGA 2XPAA 3KAFA 2O92A 1GUVA 3O5DA 4IT4A 3VAWA 3WQWA 5I98A 1EHNA 1FKIA 4LAYA 1OWQA 3EIPA 4WIWA 2O9OA 1NMWA 3AROA 1FKLA 1ITXA 4MNLA 2YBTA 1FFRA 3ODKA 3KAIA 2MLYA 1M5YA 3UI4A 3WKZA 5HT1A 4O2TA 4NZCA 4ZPWR 5HKGA 1Y0OA 2RUQA 4G50A 4MTVA 4TX0A 2PPOA 4IT6A 5D75A 2VCDA 2KFWA 4WKAA 4ODLA 3WD0A 4C02B 3ARTA 5GQBA 2ETNA 1C9HA 4DRMA 1KFWA 3ARZA 4P8XA 2MF9A 3O5JA 1W9PA 1HJWA 4Z2LA 3O5KA 1W1YA 1LL4A 2A3CA 5HW7A 5DIUA 1D6OA 2XP5A 2MLXA 4Z2IA 3WD1A 1HKIA 4JFLA 1HKMA 4G2PA 2MNTA 3PR9A 1W1VA 1GOIA 3RM9A 1E6NA 1W26A 5HWBA 3B7XA 1ZU8A 5HW8A 4W9OA
chains in the Genus database with same CATH topology
1X6LA 1UR9A 2PI6A 3WD4A 2LJ4A 2RSEA 1ZB5A 1J4RA 2M2AA 4PTMA 4GIVA 4BF8A 3O5QA 2N87A 2WLZA 4LGXA 1PINA 2ZR6A 4TYOA 4IPXA 4ZPVR 1EDQA 4J4NA 1FKGA 1ZK6A 2KO7A 4DRKA 1TFVA 1FKSA 2ESCA 4DIPA 3ARRA 4N19A 4IQCA 2WM0A 1Q6IA 1N1AA 3RM4A 5DITA 1Q6UA 2PBCA 1O6IA 4NNRA 1NWRA 2F4EA 2KE0A 2ZR5A 4XAKA 3CGNA 5DO2A 3AS0A 4AY1A 4MNMA 1E9LA 2XP8A 2ZQUA 3FXYA 3ARUA 4LAWA 2Y78A 2DG9A 3KACA 1D7IA 3B9DA 1FKFA 2A3AA 1NWUA 1FKHA 1D7HA 1ZBWA 2XP3A 2DG4A 2F2DA 5HWCA 4P8VA 2RUCA 4FN2A 4MAVA 1LG2A 1NH6A 4TNSA 4L72B 1J4HA 3LUOA 2ITKA 2K8IA 1HKJA 3UI5A 3G6LA 2XP6A 2LPVA 4NSBA 4Q7NA 1FFQA 1H0IA 1BL4A 3AS1A 2M1IA 4QIBA 1B6CA 1WNOA 2F21A 3TDBA 4DRJA 1FKKA 2D9FA 3BXWA 2DT0A 1YW5A 4Z2JA 3CH9A 4P8UA 2PV2A 1P5QA 3CHFA 3PRBA 3EY6A 4DZ2A 4ODRA 2DSZA 2XPBA 3O5FA 3UI6A 3B9AA 3KAGA 5GPGA 1HJVA 2FKEA 1LL7A 4HBEA 4JFJA 3CHCA 4ML4A 4WJXA 1FJDA 3MDYB 1EQ3A 3O5LA 1A7XA 1JNSA 3ALFA 4U85A 4DRIA 3KZ7A 3ARVA 3WIJA 3GPKA 4J4OA 4P8WA 2LKNA 1WB0A 2A3EA 2Q5AA 5BXJA 4IQ2A 4GGQA 1KT1A 3NI6A 2PV1A 3O5OA 1D2KA 4JYSA 5B8IC 1U79A 1E6RA 3TCZA 3FY1A 4ODPA 4MNJA 3IKGA 4TW7A 1ZBVA 3WD3A 4DWSA 2WLYA 4TW8A 4DH0A 3JXVA 3PRAA 2DT2A 4ITZA 5HW6A 2MLZA 4JFMA 2MPHA 1UR8A 4DWSD 5J6EA 1JNTA 4KQZA 4DRQA 4U86A 3ARWA 5HTGA 1LG1A 1TCOC 4Z2GA 1E6PA 3B9EA 4FAPA 3IK8A 3TC5A 3O5IA 2B31A 3QOKA 3IHZA 3OOBA 4HBOA 1BKFA 4DROA 2IUZA 4WKFA 3IKDA 4WK9A 3CHDA 2OLHA 4QT2A 1XRVA 4KR0B 4R5EA 3WD2A 4MSPA 1FKBA 2RQSA 3UQIA 3H9RB 2DPEA 3ARSA 4MPKA 4URIA 1HKKA 3JYJA 1W9VA 3O5MA 4HARA 4S3JA 1ZBKA 3PRDA 2PV3A 2A3BA 5DEZA 1J4IA 1R9HA 1NWTA 2OFNA 4MGVA 1FKRA 4TW6A 2KI3A 5JH8A 1FD9A 2RUDA 1WAWA 3AS2A 2DSVA 2YBUA 1ROUA 4LAXA 3ARXA 1HXVA 1X6NA 4ODMA 1QPLA 3NRKA 3RMEA 1HJXA 2FAPA 1GPFA 3RM8A 2WK2A 1W1TA 1FKDA 1ROTA 2M08A 2DSUA 1LJYA 1QPFA 3I6CA 3O5EA 3ARQA 2G8ZA 1H0GA 3W4RA 1E15A 2AOSA 1FAPA 3ARPA 3KAHA 1W1PA 3KABA 2L2SA 1FKTA 4Z2KA 1JNDA 4QT3A 3JYMA 4S3KA 1OGBA 1VF8A 2ZR4A 2QF8A 1NWSA 1NSGA 3O5GA 4DRNA 1L1PA 2XP9A 4DWSB 1LL6A 3KCEA 4DRHA 1LQ0A 3O5RA 5GPRA 3ARYA 2PPPA 2DT1A 1IX5A 3WH0A 3CGMA 1EIBA 3KADA 1W9UA 2ZQVA 4W9QA 4DWSC 3UQBA 2AWGA 1T11A 2DT3A 1NMVA 4DT4A 2ZQTA 2LGOA 2IF4A 4Z2HA 4ZS6A 4L3NA 1E6ZA 3CHEA 2KGJA 3AQUA 3OA5A 1XHGA 1SYTA 4U84A 5HBFA 4W5UA 1D7JA 3RGCA 1JNEA 1Q6HA 1QZ2A 2JZVA 3NTPA 2DG3A 4R0XA 2FDMA 4WKHA 4ODKA 2PPNA 1SR0A 4LAVA 1PBKA 3ALGA 4ODNA 1Q1CA 2XP4A 2RURA 2ZQSA 3B8SA 1ZBCA 4QZVB 3RFWA 3FAPA 1ZCNA 3WL1A 2XP7A 1JVWA 3G6MA 1KT0A 4ODOA 4ODQA 1J6YA 1F8AB 4JFKA 4ZPTR 2VN1A 5HUAA 4DRPA 2KR7A 3AS3A 1F40A 1EYMA 4JFIA 1ZL1A 3CZ8A 3UQAA 5DIVA 3O5PA 2DSWA 4DZ3A 4Q22A 1RD6A 1K9TA 2G41A 3UF8A 4W9PA 5DF0A 2UZ5A 4MNKA 3WQVA 3PA7A 1CTNA 1YATA 1FKJA 3WL0A 1OGGA 2XPAA 3KAFA 2O92A 1GUVA 3O5DA 4IT4A 3VAWA 3WQWA 5I98A 1EHNA 1FKIA 4LAYA 1OWQA 4WIWA 2O9OA 1NMWA 3AROA 1FKLA 1ITXA 4MNLA 2YBTA 1FFRA 3ODKA 3KAIA 2MLYA 1M5YA 3UI4A 3WKZA 5HT1A 4O2TA 4NZCA 4ZPWR 5HKGA 1Y0OA 2RUQA 4G50A 4MTVA 4TX0A 2PPOA 4IT6A 5D75A 2VCDA 2KFWA 4WKAA 4ODLA 3WD0A 4C02B 3ARTA 5GQBA 1C9HA 4DRMA 1KFWA 3ARZA 4P8XA 2MF9A 3O5JA 1W9PA 1HJWA 4Z2LA 3O5KA 1W1YA 1LL4A 2A3CA 5HW7A 5DIUA 1D6OA 2XP5A 2MLXA 4Z2IA 3WD1A 1HKIA 4JFLA 1HKMA 4G2PA 2MNTA 3PR9A 1W1VA 1GOIA 3RM9A 1E6NA 1W26A 5HWBA 3B7XA 1ZU8A 5HW8A 4W9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6L A;  1UR9 A;  3G6M A;  2PI6 A;  3WD4 A;  3ARX A;  1ZB5 A;  1X6N A;  3ALF A;  4PTM A;  3RME A;  1HJX A;  2WLZ A;  1GPF A;  3ARV A;  4LGX A;  3AS3 A;  3WIJ A;  3RM8 A;  2WK2 A;  1W1T A;  2DSU A;  4P8W A;  1EDQ A;  1WB0 A;  2A3E A;  1LJY A;  1TFV A;  1ZL1 A;  3CZ8 A;  2ESC A;  1D2K A;  3ARQ A;  3ARR A;  2G8Z A;  2DSW A;  1E6R A;  3FY1 A;  1H0G A;  4Q22 A;  1RD6 A;  1K9T A;  2G41 A;  4MNJ A;  2WM0 A;  3RM4 A;  3W4R A;  1E15 A;  2AOS A;  3ARP A;  1ZBV A;  5DF0 A;  3WD3 A;  1W1P A;  1O6I A;  4DWS A;  4MNK A;  2WLY A;  4WJX A;  1NWR A;  4Z2K A;  1JND A;  3WQV A;  3AS0 A;  2DT2 A;  1CTN A;  4AY1 A;  4S3K A;  4MNM A;  1OGB A;  1VF8 A;  2QF8 A;  3WL0 A;  1OGG A;  1UR8 A;  1NWS A;  3WL1 A;  4DWS D;  1E9L A;  2O92 A;  4DWS B;  1GUV A;  3ARW A;  1LL6 A;  3WQW A;  1EHN A;  1LG1 A;  1OWQ A;  3FXY A;  1LQ0 A;  5GPR A;  3ARY A;  4Z2G A;  4WIW A;  2O9O A;  2DT1 A;  1E6P A;  3ARU A;  3B9E A;  1EIB A;  3ARO A;  1ITX A;  4MNL A;  3B9D A;  2YBT A;  1FFR A;  1W9U A;  2B31 A;  2A3A A;  3QOK A;  1NWU A;  4DWS C;  1ZBW A;  2DT3 A;  2IUZ A;  4WKF A;  4WK9 A;  4P8V A;  3WKZ A;  3CHD A;  2OLH A;  4NZC A;  4MAV A;  1LG2 A;  4Z2H A;  1NH6 A;  1XRV A;  4R5E A;  1E6Z A;  3CHE A;  4MTV A;  3WD2 A;  1HKJ A;  3G6L A;  3AQU A;  3OA5 A;  1XHG A;  4WKA A;  1SYT A;  4NSB A;  3WD0 A;  3ART A;  5GQB A;  2DPE A;  3ARS A;  4MPK A;  4URI A;  1HKK A;  4Q7N A;  1FFQ A;  1H0I A;  1W9V A;  1KFW A;  3AS1 A;  3ARZ A;  4P8X A;  1WNO A;  1W9P A;  5HBF A;  1HJW A;  3BXW A;  4Z2L A;  1W1Y A;  1LL4 A;  2A3C A;  2DT0 A;  4W5U A;  4Z2J A;  3CH9 A;  4P8U A;  4S3J A;  1JNE A;  3AS2 A;  1ZBK A;  3CHF A;  4Z2I A;  3WD1 A;  2A3B A;  5DEZ A;  1HKI A;  2DSZ A;  1HKM A;  2FDM A;  1NWT A;  3B9A A;  4WKH A;  3RM9 A;  1W1V A;  1GOI A;  1E6N A;  1HJV A;  1SR0 A;  3ALG A;  3B8S A;  5JH8 A;  1ZBC A;  1LL7 A;  1ZU8 A;  4ML4 A;  1WAW A;  2DSV A;  3CHC A;  2YBU A; 
#chains in the Genus database with same CATH topology
 1X6L A;  1UR9 A;  2PI6 A;  3WD4 A;  2LJ4 A;  2RSE A;  1ZB5 A;  1E44 A;  1J4R A;  2M2A A;  4PTM A;  4GIV A;  4BF8 A;  3O5Q A;  2N87 A;  2WLZ A;  4LGX A;  1PIN A;  2ZR6 A;  4TYO A;  4IPX A;  4ZPV R;  1EDQ A;  4J4N A;  1FKG A;  1ZK6 A;  2KO7 A;  4DRK A;  1TFV A;  1FKS A;  2ESC A;  4DIP A;  3ARR A;  4N19 A;  1JCH B;  4IQC A;  2WM0 A;  1Q6I A;  1N1A A;  3RM4 A;  5DIT A;  1Q6U A;  2PBC A;  1O6I A;  4NNR A;  1NWR A;  2F4E A;  2KE0 A;  2ZR5 A;  4XAK A;  3CGN A;  5DO2 A;  3AS0 A;  4AY1 A;  4MNM A;  1E9L A;  2XP8 A;  2ZQU A;  3FXY A;  3ARU A;  4LAW A;  2Y78 A;  2DG9 A;  3KAC A;  1D7I A;  3B9D A;  1FKF A;  2A3A A;  1NWU A;  1FKH A;  1D7H A;  1ZBW A;  2PN0 A;  2XP3 A;  2DG4 A;  2F2D A;  5HWC A;  4P8V A;  2RUC A;  4FN2 A;  4MAV A;  1LG2 A;  1NH6 A;  4TNS A;  4L72 B;  1J4H A;  3LUO A;  2ITK A;  2K8I A;  1HKJ A;  3UI5 A;  3G6L A;  2XP6 A;  2LPV A;  4NSB A;  4Q7N A;  1FFQ A;  1H0I A;  1BL4 A;  3AS1 A;  2M1I A;  4QIB A;  1B6C A;  1WNO A;  2F21 A;  3TDB A;  4DRJ A;  1FKK A;  2D9F A;  3BXW A;  2DT0 A;  1YW5 A;  4Z2J A;  3CH9 A;  4P8U A;  2PV2 A;  1P5Q A;  3CHF A;  3PRB A;  3EY6 A;  4DZ2 A;  4ODR A;  2DSZ A;  2XPB A;  3O5F A;  3UI6 A;  3B9A A;  3KAG A;  5GPG A;  1HJV A;  2FKE A;  1LL7 A;  4HBE A;  4JFJ A;  3CHC A;  4ML4 A;  4WJX A;  1FJD A;  3MDY B;  1EQ3 A;  3O5L A;  1A7X A;  1JNS A;  3ALF A;  4U85 A;  4DRI A;  3KZ7 A;  3ARV A;  3WIJ A;  3GPK A;  4J4O A;  4P8W A;  2LKN A;  1WB0 A;  2A3E A;  2Q5A A;  5BXJ A;  4IQ2 A;  4GGQ A;  1KT1 A;  3NI6 A;  2PV1 A;  3O5O A;  1D2K A;  4JYS A;  5B8I C;  1U79 A;  1E6R A;  3TCZ A;  3FY1 A;  4ODP A;  4MNJ A;  3IKG A;  4TW7 A;  1ZBV A;  3WD3 A;  4DWS A;  2WLY A;  4TW8 A;  4DH0 A;  3JXV A;  3PRA A;  2DT2 A;  4ITZ A;  5HW6 A;  2MLZ A;  4JFM A;  2MPH A;  1UR8 A;  4DWS D;  5J6E A;  1JNT A;  4KQZ A;  4DRQ A;  4U86 A;  3ARW A;  5HTG A;  1LG1 A;  1TCO C;  4Z2G A;  1E6P A;  3B9E A;  4FAP A;  3IK8 A;  3TC5 A;  3O5I A;  2B31 A;  3QOK A;  3IHZ A;  3OOB A;  4HBO A;  1BKF A;  4DRO A;  2IUZ A;  4WKF A;  3IKD A;  4WK9 A;  3CHD A;  2OLH A;  4QT2 A;  1XRV A;  4KR0 B;  4R5E A;  3WD2 A;  4MSP A;  1FKB A;  2RQS A;  3UQI A;  3H9R B;  2DPE A;  3ARS A;  4MPK A;  4URI A;  1HKK A;  3JYJ A;  1W9V A;  3O5M A;  4HAR A;  4S3J A;  1ZBK A;  3PRD A;  2PV3 A;  2A3B A;  5DEZ A;  1J4I A;  1R9H A;  1NWT A;  2OFN A;  4MGV A;  1FKR A;  4TW6 A;  2KI3 A;  5JH8 A;  1FD9 A;  2RUD A;  1WAW A;  3AS2 A;  2DSV A;  2YBU A;  1ROU A;  4LAX A;  3ARX A;  1HXV A;  1X6N A;  4ODM A;  1QPL A;  3NRK A;  3RME A;  1HJX A;  2FAP A;  1GPF A;  3RM8 A;  2WK2 A;  1W1T A;  1FKD A;  1ROT A;  2M08 A;  2DSU A;  4UDM A;  1LJY A;  1QPF A;  3I6C A;  3O5E A;  3ARQ A;  2G8Z A;  1H0G A;  3W4R A;  1E15 A;  2AOS A;  1FAP A;  3ARP A;  3KAH A;  1W1P A;  3KAB A;  2L2S A;  1FKT A;  4Z2K A;  1JND A;  4QT3 A;  2EUL A;  3JYM A;  4S3K A;  1OGB A;  1VF8 A;  2ZR4 A;  2QF8 A;  1NWS A;  1NSG A;  3GU0 A;  3O5G A;  4DRN A;  1L1P A;  2XP9 A;  4DWS B;  1LL6 A;  3KCE A;  4DRH A;  1LQ0 A;  3O5R A;  5GPR A;  3ARY A;  2PPP A;  2DT1 A;  1IX5 A;  3WH0 A;  3CGM A;  1EIB A;  3KAD A;  1W9U A;  2ZQV A;  4W9Q A;  4DWS C;  3UQB A;  2AWG A;  1T11 A;  2DT3 A;  1NMV A;  4DT4 A;  2ZQT A;  2LGO A;  2IF4 A;  4Z2H A;  4ZS6 A;  4L3N A;  1E6Z A;  3CHE A;  2KGJ A;  3AQU A;  3OA5 A;  1XHG A;  1SYT A;  2F23 A;  3BMB A;  4U84 A;  5HBF A;  4W5U A;  1D7J A;  3RGC A;  1JNE A;  1Q6H A;  1QZ2 A;  2JZV A;  3NTP A;  2DG3 A;  4R0X A;  2FDM A;  4WKH A;  4ODK A;  2PPN A;  2B5U B;  1SR0 A;  4LAV A;  1PBK A;  3ALG A;  4ODN A;  1Q1C A;  2XP4 A;  2RUR A;  2ZQS A;  3B8S A;  1ZBC A;  4QZV B;  3RFW A;  3FAP A;  1ZCN A;  3WL1 A;  2XP7 A;  1GRJ A;  1JVW A;  3G6M A;  1KT0 A;  4ODO A;  4ODQ A;  1J6Y A;  1F8A B;  3GTY X;  4JFK A;  4ZPT R;  2VN1 A;  5HUA A;  4DRP A;  2KR7 A;  3AS3 A;  1F40 A;  1EYM A;  4JFI A;  1ZL1 A;  3CZ8 A;  3UQA A;  5DIV A;  3O5P A;  2DSW A;  4DZ3 A;  4Q22 A;  1RD6 A;  1K9T A;  2G41 A;  3UF8 A;  4W9P A;  5DF0 A;  2UZ5 A;  4MNK A;  3WQV A;  3PA7 A;  1CTN A;  1YAT A;  1FKJ A;  2P4V A;  3WL0 A;  1OGG A;  2XPA A;  3KAF A;  2O92 A;  1GUV A;  3O5D A;  4IT4 A;  3VAW A;  3WQW A;  5I98 A;  1EHN A;  1FKI A;  4LAY A;  1OWQ A;  3EIP A;  4WIW A;  2O9O A;  1NMW A;  3ARO A;  1FKL A;  1ITX A;  4MNL A;  2YBT A;  1FFR A;  3ODK A;  3KAI A;  2MLY A;  1M5Y A;  3UI4 A;  3WKZ A;  5HT1 A;  4O2T A;  4NZC A;  4ZPW R;  5HKG A;  1Y0O A;  2RUQ A;  4G50 A;  4MTV A;  4TX0 A;  2PPO A;  4IT6 A;  5D75 A;  2VCD A;  2KFW A;  4WKA A;  4ODL A;  3WD0 A;  4C02 B;  3ART A;  5GQB A;  2ETN A;  1C9H A;  4DRM A;  1KFW A;  3ARZ A;  4P8X A;  2MF9 A;  3O5J A;  1W9P A;  1HJW A;  4Z2L A;  3O5K A;  1W1Y A;  1LL4 A;  2A3C A;  5HW7 A;  5DIU A;  1D6O A;  2XP5 A;  2MLX A;  4Z2I A;  3WD1 A;  1HKI A;  4JFL A;  1HKM A;  4G2P A;  2MNT A;  3PR9 A;  1W1V A;  1GOI A;  3RM9 A;  1E6N A;  1W26 A;  5HWB A;  3B7X A;  1ZU8 A;  5HW8 A;  4W9O A; 
#chains in the Genus database with same CATH homology
 1X6L A;  1UR9 A;  2PI6 A;  3WD4 A;  2LJ4 A;  2RSE A;  1ZB5 A;  1J4R A;  2M2A A;  4PTM A;  4GIV A;  4BF8 A;  3O5Q A;  2N87 A;  2WLZ A;  4LGX A;  1PIN A;  2ZR6 A;  4TYO A;  4IPX A;  4ZPV R;  1EDQ A;  4J4N A;  1FKG A;  1ZK6 A;  2KO7 A;  4DRK A;  1TFV A;  1FKS A;  2ESC A;  4DIP A;  3ARR A;  4N19 A;  4IQC A;  2WM0 A;  1Q6I A;  1N1A A;  3RM4 A;  5DIT A;  1Q6U A;  2PBC A;  1O6I A;  4NNR A;  1NWR A;  2F4E A;  2KE0 A;  2ZR5 A;  4XAK A;  3CGN A;  5DO2 A;  3AS0 A;  4AY1 A;  4MNM A;  1E9L A;  2XP8 A;  2ZQU A;  3FXY A;  3ARU A;  4LAW A;  2Y78 A;  2DG9 A;  3KAC A;  1D7I A;  3B9D A;  1FKF A;  2A3A A;  1NWU A;  1FKH A;  1D7H A;  1ZBW A;  2XP3 A;  2DG4 A;  2F2D A;  5HWC A;  4P8V A;  2RUC A;  4FN2 A;  4MAV A;  1LG2 A;  1NH6 A;  4TNS A;  4L72 B;  1J4H A;  3LUO A;  2ITK A;  2K8I A;  1HKJ A;  3UI5 A;  3G6L A;  2XP6 A;  2LPV A;  4NSB A;  4Q7N A;  1FFQ A;  1H0I A;  1BL4 A;  3AS1 A;  2M1I A;  4QIB A;  1B6C A;  1WNO A;  2F21 A;  3TDB A;  4DRJ A;  1FKK A;  2D9F A;  3BXW A;  2DT0 A;  1YW5 A;  4Z2J A;  3CH9 A;  4P8U A;  2PV2 A;  1P5Q A;  3CHF A;  3PRB A;  3EY6 A;  4DZ2 A;  4ODR A;  2DSZ A;  2XPB A;  3O5F A;  3UI6 A;  3B9A A;  3KAG A;  5GPG A;  1HJV A;  2FKE A;  1LL7 A;  4HBE A;  4JFJ A;  3CHC A;  4ML4 A;  4WJX A;  1FJD A;  3MDY B;  1EQ3 A;  3O5L A;  1A7X A;  1JNS A;  3ALF A;  4U85 A;  4DRI A;  3KZ7 A;  3ARV A;  3WIJ A;  3GPK A;  4J4O A;  4P8W A;  2LKN A;  1WB0 A;  2A3E A;  2Q5A A;  5BXJ A;  4IQ2 A;  4GGQ A;  1KT1 A;  3NI6 A;  2PV1 A;  3O5O A;  1D2K A;  4JYS A;  5B8I C;  1U79 A;  1E6R A;  3TCZ A;  3FY1 A;  4ODP A;  4MNJ A;  3IKG A;  4TW7 A;  1ZBV A;  3WD3 A;  4DWS A;  2WLY A;  4TW8 A;  4DH0 A;  3JXV A;  3PRA A;  2DT2 A;  4ITZ A;  5HW6 A;  2MLZ A;  4JFM A;  2MPH A;  1UR8 A;  4DWS D;  5J6E A;  1JNT A;  4KQZ A;  4DRQ A;  4U86 A;  3ARW A;  5HTG A;  1LG1 A;  1TCO C;  4Z2G A;  1E6P A;  3B9E A;  4FAP A;  3IK8 A;  3TC5 A;  3O5I A;  2B31 A;  3QOK A;  3IHZ A;  3OOB A;  4HBO A;  1BKF A;  4DRO A;  2IUZ A;  4WKF A;  3IKD A;  4WK9 A;  3CHD A;  2OLH A;  4QT2 A;  1XRV A;  4KR0 B;  4R5E A;  3WD2 A;  4MSP A;  1FKB A;  2RQS A;  3UQI A;  3H9R B;  2DPE A;  3ARS A;  4MPK A;  4URI A;  1HKK A;  3JYJ A;  1W9V A;  3O5M A;  4HAR A;  4S3J A;  1ZBK A;  3PRD A;  2PV3 A;  2A3B A;  5DEZ A;  1J4I A;  1R9H A;  1NWT A;  2OFN A;  4MGV A;  1FKR A;  4TW6 A;  2KI3 A;  5JH8 A;  1FD9 A;  2RUD A;  1WAW A;  3AS2 A;  2DSV A;  2YBU A;  1ROU A;  4LAX A;  3ARX A;  1HXV A;  1X6N A;  4ODM A;  1QPL A;  3NRK A;  3RME A;  1HJX A;  2FAP A;  1GPF A;  3RM8 A;  2WK2 A;  1W1T A;  1FKD A;  1ROT A;  2M08 A;  2DSU A;  1LJY A;  1QPF A;  3I6C A;  3O5E A;  3ARQ A;  2G8Z A;  1H0G A;  3W4R A;  1E15 A;  2AOS A;  1FAP A;  3ARP A;  3KAH A;  1W1P A;  3KAB A;  2L2S A;  1FKT A;  4Z2K A;  1JND A;  4QT3 A;  3JYM A;  4S3K A;  1OGB A;  1VF8 A;  2ZR4 A;  2QF8 A;  1NWS A;  1NSG A;  3O5G A;  4DRN A;  1L1P A;  2XP9 A;  4DWS B;  1LL6 A;  3KCE A;  4DRH A;  1LQ0 A;  3O5R A;  5GPR A;  3ARY A;  2PPP A;  2DT1 A;  1IX5 A;  3WH0 A;  3CGM A;  1EIB A;  3KAD A;  1W9U A;  2ZQV A;  4W9Q A;  4DWS C;  3UQB A;  2AWG A;  1T11 A;  2DT3 A;  1NMV A;  4DT4 A;  2ZQT A;  2LGO A;  2IF4 A;  4Z2H A;  4ZS6 A;  4L3N A;  1E6Z A;  3CHE A;  2KGJ A;  3AQU A;  3OA5 A;  1XHG A;  1SYT A;  4U84 A;  5HBF A;  4W5U A;  1D7J A;  3RGC A;  1JNE A;  1Q6H A;  1QZ2 A;  2JZV A;  3NTP A;  2DG3 A;  4R0X A;  2FDM A;  4WKH A;  4ODK A;  2PPN A;  1SR0 A;  4LAV A;  1PBK A;  3ALG A;  4ODN A;  1Q1C A;  2XP4 A;  2RUR A;  2ZQS A;  3B8S A;  1ZBC A;  4QZV B;  3RFW A;  3FAP A;  1ZCN A;  3WL1 A;  2XP7 A;  1JVW A;  3G6M A;  1KT0 A;  4ODO A;  4ODQ A;  1J6Y A;  1F8A B;  4JFK A;  4ZPT R;  2VN1 A;  5HUA A;  4DRP A;  2KR7 A;  3AS3 A;  1F40 A;  1EYM A;  4JFI A;  1ZL1 A;  3CZ8 A;  3UQA A;  5DIV A;  3O5P A;  2DSW A;  4DZ3 A;  4Q22 A;  1RD6 A;  1K9T A;  2G41 A;  3UF8 A;  4W9P A;  5DF0 A;  2UZ5 A;  4MNK A;  3WQV A;  3PA7 A;  1CTN A;  1YAT A;  1FKJ A;  3WL0 A;  1OGG A;  2XPA A;  3KAF A;  2O92 A;  1GUV A;  3O5D A;  4IT4 A;  3VAW A;  3WQW A;  5I98 A;  1EHN A;  1FKI A;  4LAY A;  1OWQ A;  4WIW A;  2O9O A;  1NMW A;  3ARO A;  1FKL A;  1ITX A;  4MNL A;  2YBT A;  1FFR A;  3ODK A;  3KAI A;  2MLY A;  1M5Y A;  3UI4 A;  3WKZ A;  5HT1 A;  4O2T A;  4NZC A;  4ZPW R;  5HKG A;  1Y0O A;  2RUQ A;  4G50 A;  4MTV A;  4TX0 A;  2PPO A;  4IT6 A;  5D75 A;  2VCD A;  2KFW A;  4WKA A;  4ODL A;  3WD0 A;  4C02 B;  3ART A;  5GQB A;  1C9H A;  4DRM A;  1KFW A;  3ARZ A;  4P8X A;  2MF9 A;  3O5J A;  1W9P A;  1HJW A;  4Z2L A;  3O5K A;  1W1Y A;  1LL4 A;  2A3C A;  5HW7 A;  5DIU A;  1D6O A;  2XP5 A;  2MLX A;  4Z2I A;  3WD1 A;  1HKI A;  4JFL A;  1HKM A;  4G2P A;  2MNT A;  3PR9 A;  1W1V A;  1GOI A;  3RM9 A;  1E6N A;  1W26 A;  5HWB A;  3B7X A;  1ZU8 A;  5HW8 A;  4W9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...