5JH8A

Crystal structure of chitinase from chromobacterium violaceum atcc 12472
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
309
Chain Sequence
AAMVLAYYSGYAGNYAALTRYAASFNAVAVDFYNITAQGAVTGNGDPAPNDAISFLLGRIPAYGCVSNVDGNGNWSADIAHAVSTSAQSQAVANLVFAQDRFSGINVDFEAVAQGDRNNFSHFIQVLGRALHAKGLLIVSVPAFSADENHPANYGYDLRALGAAADYLQIMSYDEAIPAWDPGPVAGSDWMEDDLDYAVERVPAAKILNGIPAYGYDWRPGDGGMLYWDTQALIARYGAQPRYDAGTHSLTFNYGAADGSRHTVWTENARSVALKASLVNAYGLGGTSLYALGMEDDAFWAAVQGLAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
molecule keywords Probable chitinase
total genus 101
structure length 309
sequence length 317
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5jh8A02
1VF8A 3CHDA 2A3EA 3CHFA 3AROA 1K9TA 3AS3A 3ARPA 2AOSA 1W9VA 1W1YA 1W1PA 1W1TA 3FXYA 4MPKA 1HJWA 1LQ0A 2O9OA 2WM0A 4WKAA 3AS2A 2DPEA 3W4RA 2YBTA 1E15A 3FY1A 5GQBA 3ARTA 1H0IA 2G41A 1XRVA 1LG1A 3RM9A 3AS0A 4NSBA 1W9UA 2B31A 1HJVA 1CTNA 4Z2KA 3ARXA 3B9EA 3ARYA 4S3JA 3WQVA 3AQUA 3QOKA 4Z2LA 2A3AA 1E6RA 4DWSC 3OA5A 4MTVA 1NWTA 1ZL1A 2WK2A 3WD3A 3ARQA 4P8WA 4WJXA 3WIJA 1OGGA 3AS1A 4URIA 1WNOA 4R5EA 1UR8A 1ZBKA 2DT1A 2PI6A 2DSZA 3ARUA 5HBFA 2A3CA 3ARRA 4W5UA 1TFVA 2WLYA 1GPFA 1FFRA 3WD4A 4MNLA 4ML4A 2QF8A 5DEZA 3G6LA 4DWSB 1NWUA 1UR9A 4Q7NA 4Z2HA 3RM8A 2DSWA 4MAVA 4Z2GA 3RMEA 4NZCA 1NH6A 1WB0A 1HKJA 1NWSA 2FDMA 4WK9A 4AY1A 1JNEA 1ITXA 1E6PA 1HKIA 2ESCA 1XHGA 1E9LA 1HKMA 1H0GA 1ZBVA 1LJYA 1ZBCA 1ZU8A 4WKHA 2WLZA 3ARWA 1GUVA 1EHNA 1EDQA 3ARSA 3B8SA 4P8VA 1FFQA 3ARZA 4Q22A 2G8ZA 1HJXA 1W1VA 3B9AA 2DT0A 2DT3A 2DSUA 4P8UA 3WKZA 3CZ8A 1X6NA 4DWSA 3WQWA 4WIWA 1E6ZA 4MNMA 4LGXA 1EIBA 3CHCA 1OWQA 1LL6A 3RM4A 1W9PA 4DWSD 4Z2IA 1X6LA 4Z2JA 1GOIA 1HKKA 5GPRA 4MNKA 1D2KA 3WL1A 5JH8A 3CH9A 3WD0A 3WL0A 2DT2A 4S3KA 5DF0A 3ALGA 1ZB5A 4PTMA 1LL4A 1JNDA 1LG2A 1SR0A 3BXWA 3WD1A 1NWRA 3B9DA 4WKFA 4MNJA 1RD6A 2IUZA 3ALFA 2O92A 1OGBA 1E6NA 3G6MA 3WD2A 1KFWA 1ZBWA 3CHEA 1WAWA 2A3BA 1LL7A 2YBUA 2DSVA 1SYTA 4P8XA 3ARVA 1O6IA 2OLHA
chains in the Genus database with same CATH superfamily
1VF8A 2KE0A 3CHDA 3PRAA 4KQZA 4UDMA 3CHFA 3B7XA 3AROA 1K9TA 1W1PA 1W1TA 4MPKA 2WM0A 3W4RA 3FY1A 3PR9A 4G50A 1F40A 3CGMA 1FKIA 1XRVA 1ZCNA 4NSBA 4FAPA 2D9FA 3ARYA 2JZVA 2M1IA 4U86A 3OA5A 3EIPA 3FAPA 4MTVA 3O5PA 1KT0A 4P8WA 4C02B 3KCEA 1OGGA 3AS1A 3KZ7A 1UR8A 4DRHA 1QPFA 4ZS6A 3UQIA 2FKEA 4TYOA 2WLYA 1FFRA 1J6YA 2QF8A 4DWSB 4Q7NA 4MAVA 3RMEA 5GPGA 2DG4A 2ESCA 1LJYA 1F8AB 4DRQA 1FD9A 2WLZA 1EHNA 1D7JA 2M2AA 2B5UB 4IPXA 1JNSA 1HJXA 2FAPA 1HXVA 3O5EA 2DSUA 3WKZA 3WH0A 4WIWA 2P4VA 4ZPWR 4QT3A 4MSPA 1GOIA 1HKKA 1JCHB 2L2SA 3WD0A 3WL0A 4DRPA 3O5LA 1ROTA 2PPOA 3GTYX 4XAKA 1ZB5A 1SR0A 3WD1A 1NWRA 4G2PA 3B9DA 4WKFA 4N19A 1YW5A 1FKJA 4J4OA 1E6NA 2PPNA 4JFKA 4U85A 3WD2A 4JFLA 3UI5A 3O5GA 5D75A 3KAFA 5HTGA 3NI6A 4LAVA 1SYTA 4J4NA 1FKKA 1GRJA 3UI4A 2A3EA 2XP5A 2ZR6A 1FAPA 1L1PA 3GU0A 2O9OA 4O2TA 3AS2A 2YBTA 3H9RB 1E15A 5GQBA 4W9PA 1P5QA 2UZ5A 2MLYA 2F2DA 1CTNA 4DRKA 4Z2LA 3QOKA 1ZL1A 2ZR4A 3I6CA 3NTPA 2MPHA 2WK2A 3UF8A 3ARQA 5HUAA 1QZ2A 2PV1A 1U79A 4R5EA 2PI6A 2DSZA 2A3CA 1EYMA 1Q6HA 3ARRA 1Q6UA 1TFVA 1GPFA 4HBEA 2AWGA 3WD4A 4MNLA 5HW8A 1E44A 1UR9A 4Z2HA 3EY6A 3RM8A 2DSWA 4L72B 1W26A 2OFNA 2PV3A 4DROA 1NWSA 2FDMA 4WK9A 4JFJA 1ITXA 1E6PA 1HKIA 5HT1A 1A7XA 1XHGA 1FKSA 1ZBVA 4ODPA 1ZBCA 4BF8A 1C9HA 4WKHA 3IKGA 1EDQA 3B8SA 3ARZA 4Q22A 1W1VA 2N87A 3B9AA 2DT0A 1N1AA 4DRMA 2DT3A 2ZQTA 2KFWA 4TW8A 4DWSA 3KADA 5J6EA 4MNMA 4LGXA 3CHCA 2IF4A 2LJ4A 1LL6A 3RM4A 1X6LA 4ODLA 3JYJA 5GPRA 2XPAA 1FJDA 3GPKA 3WL1A 1FKFA 2DT2A 3RFWA 4ODOA 3ALGA 4PTMA 2M08A 1LG2A 5HWCA 2ITKA 1J4IA 3O5JA 2RSEA 3ALFA 4ODRA 3CHEA 3UQBA 1WAWA 4QZVB 2A3BA 2VN1A 4DRIA 2YBUA 3NRKA 2OLHA 2ZR5A 4JYSA 1T11A 2KI3A 1W9VA 5HW7A 1HJWA 5B8IC 2DPEA 2PBCA 3RGCA 4DT4A 1LG1A 3LUOA 3RM9A 1W9UA 3IK8A 1HJVA 4Z2KA 3ARXA 3B9EA 3CGNA 2EULA 3ODKA 2A3AA 5HWBA 1NWTA 1YATA 5DITA 4TW6A 4LAXA 3WD3A 1ROUA 4QIBA 3PRDA 4ZPTR 3O5RA 1ZBKA 4FN2A 4ODMA 3BMBA 1FKDA 3TDBA 4W5UA 1QPLA 4LAYA 4ODKA 4TW7A 4W9QA 4HBOA 5DEZA 1O6IA 5DIVA 1NWUA 4IQ2A 2MF9A 5HW6A 4NZCA 2VCDA 1NH6A 1WB0A 1Q1CA 3OOBA 1HKJA 4ODNA 4AY1A 2XP4A 1JNEA 2XP6A 4DZ3A 2XP7A 1E9LA 4DH0A 1HKMA 3O5MA 1ZU8A 1R9HA 1Q6IA 4U84A 2PN0A 1GUVA 5I98A 2XP3A 2G8ZA 2F4EA 1FKBA 3O5KA 4MGVA 4P8UA 3CZ8A 1PBKA 2DG3A 2Q5AA 3O5IA 1Y0OA 1EIBA 3IKDA 4DWSD 3VAWA 2F23A 2K8IA 2LKNA 4MNKA 4R0XA 3O5OA 5HKGA 4HARA 3CH9A 4S3KA 5DF0A 1JNDA 1RD6A 2O92A 1OGBA 3G6MA 4DZ2A 3KAGA 5BXJA 4GGQA 4W9OA 3ARVA 3UI6A 4IT6A 1J4HA 2KGJA 3JYMA 3ARPA 2AOSA 2LPVA 3KABA 1W1YA 2Y78A 3FXYA 1LQ0A 4WKAA 1ZK6A 4L3NA 3ARTA 1EQ3A 3KAHA 1H0IA 2G41A 2XP8A 2KO7A 3JXVA 4GIVA 3AS0A 2MNTA 2B31A 2RUCA 4S3JA 3WQVA 3AQUA 4QT2A 4DRJA 1E6RA 4DWSC 2ETNA 1JNTA 1D7HA 1BKFA 4WJXA 3WIJA 3IHZA 4URIA 1WNOA 5DO2A 2DT1A 3ARUA 3PRBA 5HBFA 3UQAA 2XP9A 2PV2A 4KR0B 2ZQUA 4ML4A 3G6LA 1D7IA 4Z2GA 4TNSA 1IX5A 1FKRA 4DRNA 1NMWA 1BL4A 1J4RA 1H0GA 1M5YA 2RURA 2F21A 1FKTA 4ZPVR 2XPBA 4ODQA 3ARWA 3TC5A 3ARSA 4P8VA 1JVWA 1FFQA 4DIPA 1PINA 3TCZA 1FKGA 3PA7A 2DG9A 1X6NA 2KR7A 3WQWA 4ITZA 4IT4A 1E6ZA 2RQSA 2LGOA 2RUQA 1OWQA 1W9PA 3O5FA 4Z2IA 3MDYB 4Z2JA 2ZQSA 4JFIA 4LAWA 2MLZA 1D2KA 5JH8A 4JFMA 3KACA 1D6OA 3O5QA 5DIUA 4IQCA 1TCOC 1LL4A 3BXWA 2ZQVA 4NNRA 4MNJA 2MLXA 1NSGA 2IUZA 1B6CA 3O5DA 4TX0A 1KFWA 1ZBWA 1FKHA 1LL7A 2DSVA 2RUDA 4P8XA 1NMVA 2PPPA 3AS3A 3KAIA 1FKLA 1KT1A
chains in the Genus database with same CATH topology
1VF8A 2KE0A 3CHDA 3PRAA 4KQZA 3CHFA 3B7XA 3AROA 1K9TA 1W1PA 1W1TA 4MPKA 2WM0A 3W4RA 3FY1A 3PR9A 4G50A 1F40A 3CGMA 1FKIA 1XRVA 1ZCNA 4NSBA 4FAPA 2D9FA 3ARYA 2JZVA 2M1IA 4U86A 3OA5A 3FAPA 4MTVA 3O5PA 1KT0A 4P8WA 4C02B 3KCEA 1OGGA 3AS1A 3KZ7A 1UR8A 4DRHA 1QPFA 4ZS6A 3UQIA 2FKEA 4TYOA 2WLYA 1FFRA 1J6YA 2QF8A 4DWSB 4Q7NA 4MAVA 3RMEA 5GPGA 2DG4A 2ESCA 1LJYA 1F8AB 4DRQA 1FD9A 2WLZA 1EHNA 1D7JA 2M2AA 4IPXA 1JNSA 1HJXA 2FAPA 1HXVA 3O5EA 2DSUA 3WKZA 3WH0A 4WIWA 4ZPWR 4QT3A 4MSPA 1GOIA 1HKKA 2L2SA 3WD0A 3WL0A 4DRPA 3O5LA 1ROTA 2PPOA 4XAKA 1ZB5A 1SR0A 3WD1A 1NWRA 4G2PA 3B9DA 4WKFA 4N19A 1YW5A 1FKJA 4J4OA 1E6NA 2PPNA 4JFKA 4U85A 3WD2A 4JFLA 3UI5A 3O5GA 5D75A 3KAFA 5HTGA 3NI6A 4LAVA 1SYTA 4J4NA 1FKKA 3UI4A 2A3EA 2XP5A 2ZR6A 1FAPA 1L1PA 2O9OA 4O2TA 3AS2A 2YBTA 3H9RB 1E15A 5GQBA 4W9PA 1P5QA 2UZ5A 2MLYA 2F2DA 1CTNA 4DRKA 4Z2LA 3QOKA 1ZL1A 2ZR4A 3I6CA 3NTPA 2MPHA 2WK2A 3UF8A 3ARQA 5HUAA 1QZ2A 2PV1A 1U79A 4R5EA 2PI6A 2DSZA 2A3CA 1EYMA 1Q6HA 3ARRA 1Q6UA 1TFVA 1GPFA 4HBEA 2AWGA 3WD4A 4MNLA 5HW8A 1UR9A 4Z2HA 3EY6A 3RM8A 2DSWA 4L72B 1W26A 2OFNA 2PV3A 4DROA 1NWSA 2FDMA 4WK9A 4JFJA 1ITXA 1E6PA 1HKIA 5HT1A 1A7XA 1XHGA 1FKSA 1ZBVA 4ODPA 1ZBCA 4BF8A 1C9HA 4WKHA 3IKGA 1EDQA 3B8SA 3ARZA 4Q22A 1W1VA 2N87A 3B9AA 2DT0A 1N1AA 4DRMA 2DT3A 2ZQTA 2KFWA 4TW8A 4DWSA 3KADA 5J6EA 4MNMA 4LGXA 3CHCA 2IF4A 2LJ4A 1LL6A 3RM4A 1X6LA 4ODLA 3JYJA 5GPRA 2XPAA 1FJDA 3GPKA 3WL1A 1FKFA 2DT2A 3RFWA 4ODOA 3ALGA 4PTMA 2M08A 1LG2A 5HWCA 2ITKA 1J4IA 3O5JA 2RSEA 3ALFA 4ODRA 3CHEA 3UQBA 1WAWA 4QZVB 2A3BA 2VN1A 4DRIA 2YBUA 3NRKA 2OLHA 2ZR5A 4JYSA 1T11A 2KI3A 1W9VA 5HW7A 1HJWA 5B8IC 2DPEA 2PBCA 3RGCA 4DT4A 1LG1A 3LUOA 3RM9A 1W9UA 3IK8A 1HJVA 4Z2KA 3ARXA 3B9EA 3CGNA 3ODKA 2A3AA 5HWBA 1NWTA 1YATA 5DITA 4TW6A 4LAXA 3WD3A 1ROUA 4QIBA 3PRDA 4ZPTR 3O5RA 1ZBKA 4FN2A 4ODMA 1FKDA 3TDBA 4W5UA 1QPLA 4LAYA 4ODKA 4TW7A 4W9QA 4HBOA 5DEZA 1O6IA 5DIVA 1NWUA 4IQ2A 2MF9A 5HW6A 4NZCA 2VCDA 1NH6A 1WB0A 1Q1CA 3OOBA 1HKJA 4ODNA 4AY1A 2XP4A 1JNEA 2XP6A 4DZ3A 2XP7A 1E9LA 4DH0A 1HKMA 3O5MA 1ZU8A 1R9HA 1Q6IA 4U84A 1GUVA 5I98A 2XP3A 2G8ZA 2F4EA 1FKBA 3O5KA 4MGVA 4P8UA 3CZ8A 1PBKA 2DG3A 2Q5AA 3O5IA 1Y0OA 1EIBA 3IKDA 4DWSD 3VAWA 2K8IA 2LKNA 4MNKA 4R0XA 3O5OA 5HKGA 4HARA 3CH9A 4S3KA 5DF0A 1JNDA 1RD6A 2O92A 1OGBA 3G6MA 4DZ2A 3KAGA 5BXJA 4GGQA 4W9OA 3ARVA 3UI6A 4IT6A 1J4HA 2KGJA 3JYMA 3ARPA 2AOSA 2LPVA 3KABA 1W1YA 2Y78A 3FXYA 1LQ0A 4WKAA 1ZK6A 4L3NA 3ARTA 1EQ3A 3KAHA 1H0IA 2G41A 2XP8A 2KO7A 3JXVA 4GIVA 3AS0A 2MNTA 2B31A 2RUCA 4S3JA 3WQVA 3AQUA 4QT2A 4DRJA 1E6RA 4DWSC 1JNTA 1D7HA 1BKFA 4WJXA 3WIJA 3IHZA 4URIA 1WNOA 5DO2A 2DT1A 3ARUA 3PRBA 5HBFA 3UQAA 2XP9A 2PV2A 4KR0B 2ZQUA 4ML4A 3G6LA 1D7IA 4Z2GA 4TNSA 1IX5A 1FKRA 4DRNA 1NMWA 1BL4A 1J4RA 1H0GA 1M5YA 2RURA 2F21A 1FKTA 4ZPVR 2XPBA 4ODQA 3ARWA 3TC5A 3ARSA 4P8VA 1JVWA 1FFQA 4DIPA 1PINA 3TCZA 1FKGA 3PA7A 2DG9A 1X6NA 2KR7A 3WQWA 4ITZA 4IT4A 1E6ZA 2RQSA 2LGOA 2RUQA 1OWQA 1W9PA 3O5FA 4Z2IA 3MDYB 4Z2JA 2ZQSA 4JFIA 4LAWA 2MLZA 1D2KA 5JH8A 4JFMA 3KACA 1D6OA 3O5QA 5DIUA 4IQCA 1TCOC 1LL4A 3BXWA 2ZQVA 4NNRA 4MNJA 2MLXA 1NSGA 2IUZA 1B6CA 3O5DA 4TX0A 1KFWA 1ZBWA 1FKHA 1LL7A 2DSVA 2RUDA 4P8XA 1NMVA 2PPPA 3AS3A 3KAIA 1FKLA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF8 A;  3CHD A;  2A3E A;  3CHF A;  3ARO A;  1K9T A;  3AS3 A;  3ARP A;  2AOS A;  1W9V A;  1W1Y A;  1W1P A;  1W1T A;  3FXY A;  4MPK A;  1HJW A;  1LQ0 A;  2O9O A;  2WM0 A;  4WKA A;  3AS2 A;  2DPE A;  3W4R A;  2YBT A;  1E15 A;  3FY1 A;  5GQB A;  3ART A;  1H0I A;  2G41 A;  1XRV A;  1LG1 A;  3RM9 A;  3AS0 A;  4NSB A;  1W9U A;  2B31 A;  1HJV A;  1CTN A;  4Z2K A;  3ARX A;  3B9E A;  3ARY A;  4S3J A;  3WQV A;  3AQU A;  3QOK A;  4Z2L A;  2A3A A;  1E6R A;  4DWS C;  3OA5 A;  4MTV A;  1NWT A;  1ZL1 A;  2WK2 A;  3WD3 A;  3ARQ A;  4P8W A;  4WJX A;  3WIJ A;  1OGG A;  3AS1 A;  4URI A;  1WNO A;  4R5E A;  1UR8 A;  1ZBK A;  2DT1 A;  2PI6 A;  2DSZ A;  3ARU A;  5HBF A;  2A3C A;  3ARR A;  4W5U A;  1TFV A;  2WLY A;  1GPF A;  1FFR A;  3WD4 A;  4MNL A;  4ML4 A;  2QF8 A;  5DEZ A;  3G6L A;  4DWS B;  1NWU A;  1UR9 A;  4Q7N A;  4Z2H A;  3RM8 A;  2DSW A;  4MAV A;  4Z2G A;  3RME A;  4NZC A;  1NH6 A;  1WB0 A;  1HKJ A;  1NWS A;  2FDM A;  4WK9 A;  4AY1 A;  1JNE A;  1ITX A;  1E6P A;  1HKI A;  2ESC A;  1XHG A;  1E9L A;  1HKM A;  1H0G A;  1ZBV A;  1LJY A;  1ZBC A;  1ZU8 A;  4WKH A;  2WLZ A;  3ARW A;  1GUV A;  1EHN A;  1EDQ A;  3ARS A;  3B8S A;  4P8V A;  1FFQ A;  3ARZ A;  4Q22 A;  2G8Z A;  1HJX A;  1W1V A;  3B9A A;  2DT0 A;  2DT3 A;  2DSU A;  4P8U A;  3WKZ A;  3CZ8 A;  1X6N A;  4DWS A;  3WQW A;  4WIW A;  1E6Z A;  4MNM A;  4LGX A;  1EIB A;  3CHC A;  1OWQ A;  1LL6 A;  3RM4 A;  1W9P A;  4DWS D;  4Z2I A;  1X6L A;  4Z2J A;  1GOI A;  1HKK A;  5GPR A;  4MNK A;  1D2K A;  3WL1 A;  5JH8 A;  3CH9 A;  3WD0 A;  3WL0 A;  2DT2 A;  4S3K A;  5DF0 A;  3ALG A;  1ZB5 A;  4PTM A;  1LL4 A;  1JND A;  1LG2 A;  1SR0 A;  3BXW A;  3WD1 A;  1NWR A;  3B9D A;  4WKF A;  4MNJ A;  1RD6 A;  2IUZ A;  3ALF A;  2O92 A;  1OGB A;  1E6N A;  3G6M A;  3WD2 A;  1KFW A;  1ZBW A;  3CHE A;  1WAW A;  2A3B A;  1LL7 A;  2YBU A;  2DSV A;  1SYT A;  4P8X A;  3ARV A;  1O6I A;  2OLH A; 
#chains in the Genus database with same CATH topology
 1VF8 A;  2KE0 A;  3CHD A;  3PRA A;  4KQZ A;  4UDM A;  3CHF A;  3B7X A;  3ARO A;  1K9T A;  1W1P A;  1W1T A;  4MPK A;  2WM0 A;  3W4R A;  3FY1 A;  3PR9 A;  4G50 A;  1F40 A;  3CGM A;  1FKI A;  1XRV A;  1ZCN A;  4NSB A;  4FAP A;  2D9F A;  3ARY A;  2JZV A;  2M1I A;  4U86 A;  3OA5 A;  3EIP A;  3FAP A;  4MTV A;  3O5P A;  1KT0 A;  4P8W A;  4C02 B;  3KCE A;  1OGG A;  3AS1 A;  3KZ7 A;  1UR8 A;  4DRH A;  1QPF A;  4ZS6 A;  3UQI A;  2FKE A;  4TYO A;  2WLY A;  1FFR A;  1J6Y A;  2QF8 A;  4DWS B;  4Q7N A;  4MAV A;  3RME A;  5GPG A;  2DG4 A;  2ESC A;  1LJY A;  1F8A B;  4DRQ A;  1FD9 A;  2WLZ A;  1EHN A;  1D7J A;  2M2A A;  2B5U B;  4IPX A;  1JNS A;  1HJX A;  2FAP A;  1HXV A;  3O5E A;  2DSU A;  3WKZ A;  3WH0 A;  4WIW A;  2P4V A;  4ZPW R;  4QT3 A;  4MSP A;  1GOI A;  1HKK A;  1JCH B;  2L2S A;  3WD0 A;  3WL0 A;  4DRP A;  3O5L A;  1ROT A;  2PPO A;  3GTY X;  4XAK A;  1ZB5 A;  1SR0 A;  3WD1 A;  1NWR A;  4G2P A;  3B9D A;  4WKF A;  4N19 A;  1YW5 A;  1FKJ A;  4J4O A;  1E6N A;  2PPN A;  4JFK A;  4U85 A;  3WD2 A;  4JFL A;  3UI5 A;  3O5G A;  5D75 A;  3KAF A;  5HTG A;  3NI6 A;  4LAV A;  1SYT A;  4J4N A;  1FKK A;  1GRJ A;  3UI4 A;  2A3E A;  2XP5 A;  2ZR6 A;  1FAP A;  1L1P A;  3GU0 A;  2O9O A;  4O2T A;  3AS2 A;  2YBT A;  3H9R B;  1E15 A;  5GQB A;  4W9P A;  1P5Q A;  2UZ5 A;  2MLY A;  2F2D A;  1CTN A;  4DRK A;  4Z2L A;  3QOK A;  1ZL1 A;  2ZR4 A;  3I6C A;  3NTP A;  2MPH A;  2WK2 A;  3UF8 A;  3ARQ A;  5HUA A;  1QZ2 A;  2PV1 A;  1U79 A;  4R5E A;  2PI6 A;  2DSZ A;  2A3C A;  1EYM A;  1Q6H A;  3ARR A;  1Q6U A;  1TFV A;  1GPF A;  4HBE A;  2AWG A;  3WD4 A;  4MNL A;  5HW8 A;  1E44 A;  1UR9 A;  4Z2H A;  3EY6 A;  3RM8 A;  2DSW A;  4L72 B;  1W26 A;  2OFN A;  2PV3 A;  4DRO A;  1NWS A;  2FDM A;  4WK9 A;  4JFJ A;  1ITX A;  1E6P A;  1HKI A;  5HT1 A;  1A7X A;  1XHG A;  1FKS A;  1ZBV A;  4ODP A;  1ZBC A;  4BF8 A;  1C9H A;  4WKH A;  3IKG A;  1EDQ A;  3B8S A;  3ARZ A;  4Q22 A;  1W1V A;  2N87 A;  3B9A A;  2DT0 A;  1N1A A;  4DRM A;  2DT3 A;  2ZQT A;  2KFW A;  4TW8 A;  4DWS A;  3KAD A;  5J6E A;  4MNM A;  4LGX A;  3CHC A;  2IF4 A;  2LJ4 A;  1LL6 A;  3RM4 A;  1X6L A;  4ODL A;  3JYJ A;  5GPR A;  2XPA A;  1FJD A;  3GPK A;  3WL1 A;  1FKF A;  2DT2 A;  3RFW A;  4ODO A;  3ALG A;  4PTM A;  2M08 A;  1LG2 A;  5HWC A;  2ITK A;  1J4I A;  3O5J A;  2RSE A;  3ALF A;  4ODR A;  3CHE A;  3UQB A;  1WAW A;  4QZV B;  2A3B A;  2VN1 A;  4DRI A;  2YBU A;  3NRK A;  2OLH A;  2ZR5 A;  4JYS A;  1T11 A;  2KI3 A;  1W9V A;  5HW7 A;  1HJW A;  5B8I C;  2DPE A;  2PBC A;  3RGC A;  4DT4 A;  1LG1 A;  3LUO A;  3RM9 A;  1W9U A;  3IK8 A;  1HJV A;  4Z2K A;  3ARX A;  3B9E A;  3CGN A;  2EUL A;  3ODK A;  2A3A A;  5HWB A;  1NWT A;  1YAT A;  5DIT A;  4TW6 A;  4LAX A;  3WD3 A;  1ROU A;  4QIB A;  3PRD A;  4ZPT R;  3O5R A;  1ZBK A;  4FN2 A;  4ODM A;  3BMB A;  1FKD A;  3TDB A;  4W5U A;  1QPL A;  4LAY A;  4ODK A;  4TW7 A;  4W9Q A;  4HBO A;  5DEZ A;  1O6I A;  5DIV A;  1NWU A;  4IQ2 A;  2MF9 A;  5HW6 A;  4NZC A;  2VCD A;  1NH6 A;  1WB0 A;  1Q1C A;  3OOB A;  1HKJ A;  4ODN A;  4AY1 A;  2XP4 A;  1JNE A;  2XP6 A;  4DZ3 A;  2XP7 A;  1E9L A;  4DH0 A;  1HKM A;  3O5M A;  1ZU8 A;  1R9H A;  1Q6I A;  4U84 A;  2PN0 A;  1GUV A;  5I98 A;  2XP3 A;  2G8Z A;  2F4E A;  1FKB A;  3O5K A;  4MGV A;  4P8U A;  3CZ8 A;  1PBK A;  2DG3 A;  2Q5A A;  3O5I A;  1Y0O A;  1EIB A;  3IKD A;  4DWS D;  3VAW A;  2F23 A;  2K8I A;  2LKN A;  4MNK A;  4R0X A;  3O5O A;  5HKG A;  4HAR A;  3CH9 A;  4S3K A;  5DF0 A;  1JND A;  1RD6 A;  2O92 A;  1OGB A;  3G6M A;  4DZ2 A;  3KAG A;  5BXJ A;  4GGQ A;  4W9O A;  3ARV A;  3UI6 A;  4IT6 A;  1J4H A;  2KGJ A;  3JYM A;  3ARP A;  2AOS A;  2LPV A;  3KAB A;  1W1Y A;  2Y78 A;  3FXY A;  1LQ0 A;  4WKA A;  1ZK6 A;  4L3N A;  3ART A;  1EQ3 A;  3KAH A;  1H0I A;  2G41 A;  2XP8 A;  2KO7 A;  3JXV A;  4GIV A;  3AS0 A;  2MNT A;  2B31 A;  2RUC A;  4S3J A;  3WQV A;  3AQU A;  4QT2 A;  4DRJ A;  1E6R A;  4DWS C;  2ETN A;  1JNT A;  1D7H A;  1BKF A;  4WJX A;  3WIJ A;  3IHZ A;  4URI A;  1WNO A;  5DO2 A;  2DT1 A;  3ARU A;  3PRB A;  5HBF A;  3UQA A;  2XP9 A;  2PV2 A;  4KR0 B;  2ZQU A;  4ML4 A;  3G6L A;  1D7I A;  4Z2G A;  4TNS A;  1IX5 A;  1FKR A;  4DRN A;  1NMW A;  1BL4 A;  1J4R A;  1H0G A;  1M5Y A;  2RUR A;  2F21 A;  1FKT A;  4ZPV R;  2XPB A;  4ODQ A;  3ARW A;  3TC5 A;  3ARS A;  4P8V A;  1JVW A;  1FFQ A;  4DIP A;  1PIN A;  3TCZ A;  1FKG A;  3PA7 A;  2DG9 A;  1X6N A;  2KR7 A;  3WQW A;  4ITZ A;  4IT4 A;  1E6Z A;  2RQS A;  2LGO A;  2RUQ A;  1OWQ A;  1W9P A;  3O5F A;  4Z2I A;  3MDY B;  4Z2J A;  2ZQS A;  4JFI A;  4LAW A;  2MLZ A;  1D2K A;  5JH8 A;  4JFM A;  3KAC A;  1D6O A;  3O5Q A;  5DIU A;  4IQC A;  1TCO C;  1LL4 A;  3BXW A;  2ZQV A;  4NNR A;  4MNJ A;  2MLX A;  1NSG A;  2IUZ A;  1B6C A;  3O5D A;  4TX0 A;  1KFW A;  1ZBW A;  1FKH A;  1LL7 A;  2DSV A;  2RUD A;  4P8X A;  1NMV A;  2PPP A;  3AS3 A;  3KAI A;  1FKL A;  1KT1 A; 
#chains in the Genus database with same CATH homology
 1VF8 A;  2KE0 A;  3CHD A;  3PRA A;  4KQZ A;  3CHF A;  3B7X A;  3ARO A;  1K9T A;  1W1P A;  1W1T A;  4MPK A;  2WM0 A;  3W4R A;  3FY1 A;  3PR9 A;  4G50 A;  1F40 A;  3CGM A;  1FKI A;  1XRV A;  1ZCN A;  4NSB A;  4FAP A;  2D9F A;  3ARY A;  2JZV A;  2M1I A;  4U86 A;  3OA5 A;  3FAP A;  4MTV A;  3O5P A;  1KT0 A;  4P8W A;  4C02 B;  3KCE A;  1OGG A;  3AS1 A;  3KZ7 A;  1UR8 A;  4DRH A;  1QPF A;  4ZS6 A;  3UQI A;  2FKE A;  4TYO A;  2WLY A;  1FFR A;  1J6Y A;  2QF8 A;  4DWS B;  4Q7N A;  4MAV A;  3RME A;  5GPG A;  2DG4 A;  2ESC A;  1LJY A;  1F8A B;  4DRQ A;  1FD9 A;  2WLZ A;  1EHN A;  1D7J A;  2M2A A;  4IPX A;  1JNS A;  1HJX A;  2FAP A;  1HXV A;  3O5E A;  2DSU A;  3WKZ A;  3WH0 A;  4WIW A;  4ZPW R;  4QT3 A;  4MSP A;  1GOI A;  1HKK A;  2L2S A;  3WD0 A;  3WL0 A;  4DRP A;  3O5L A;  1ROT A;  2PPO A;  4XAK A;  1ZB5 A;  1SR0 A;  3WD1 A;  1NWR A;  4G2P A;  3B9D A;  4WKF A;  4N19 A;  1YW5 A;  1FKJ A;  4J4O A;  1E6N A;  2PPN A;  4JFK A;  4U85 A;  3WD2 A;  4JFL A;  3UI5 A;  3O5G A;  5D75 A;  3KAF A;  5HTG A;  3NI6 A;  4LAV A;  1SYT A;  4J4N A;  1FKK A;  3UI4 A;  2A3E A;  2XP5 A;  2ZR6 A;  1FAP A;  1L1P A;  2O9O A;  4O2T A;  3AS2 A;  2YBT A;  3H9R B;  1E15 A;  5GQB A;  4W9P A;  1P5Q A;  2UZ5 A;  2MLY A;  2F2D A;  1CTN A;  4DRK A;  4Z2L A;  3QOK A;  1ZL1 A;  2ZR4 A;  3I6C A;  3NTP A;  2MPH A;  2WK2 A;  3UF8 A;  3ARQ A;  5HUA A;  1QZ2 A;  2PV1 A;  1U79 A;  4R5E A;  2PI6 A;  2DSZ A;  2A3C A;  1EYM A;  1Q6H A;  3ARR A;  1Q6U A;  1TFV A;  1GPF A;  4HBE A;  2AWG A;  3WD4 A;  4MNL A;  5HW8 A;  1UR9 A;  4Z2H A;  3EY6 A;  3RM8 A;  2DSW A;  4L72 B;  1W26 A;  2OFN A;  2PV3 A;  4DRO A;  1NWS A;  2FDM A;  4WK9 A;  4JFJ A;  1ITX A;  1E6P A;  1HKI A;  5HT1 A;  1A7X A;  1XHG A;  1FKS A;  1ZBV A;  4ODP A;  1ZBC A;  4BF8 A;  1C9H A;  4WKH A;  3IKG A;  1EDQ A;  3B8S A;  3ARZ A;  4Q22 A;  1W1V A;  2N87 A;  3B9A A;  2DT0 A;  1N1A A;  4DRM A;  2DT3 A;  2ZQT A;  2KFW A;  4TW8 A;  4DWS A;  3KAD A;  5J6E A;  4MNM A;  4LGX A;  3CHC A;  2IF4 A;  2LJ4 A;  1LL6 A;  3RM4 A;  1X6L A;  4ODL A;  3JYJ A;  5GPR A;  2XPA A;  1FJD A;  3GPK A;  3WL1 A;  1FKF A;  2DT2 A;  3RFW A;  4ODO A;  3ALG A;  4PTM A;  2M08 A;  1LG2 A;  5HWC A;  2ITK A;  1J4I A;  3O5J A;  2RSE A;  3ALF A;  4ODR A;  3CHE A;  3UQB A;  1WAW A;  4QZV B;  2A3B A;  2VN1 A;  4DRI A;  2YBU A;  3NRK A;  2OLH A;  2ZR5 A;  4JYS A;  1T11 A;  2KI3 A;  1W9V A;  5HW7 A;  1HJW A;  5B8I C;  2DPE A;  2PBC A;  3RGC A;  4DT4 A;  1LG1 A;  3LUO A;  3RM9 A;  1W9U A;  3IK8 A;  1HJV A;  4Z2K A;  3ARX A;  3B9E A;  3CGN A;  3ODK A;  2A3A A;  5HWB A;  1NWT A;  1YAT A;  5DIT A;  4TW6 A;  4LAX A;  3WD3 A;  1ROU A;  4QIB A;  3PRD A;  4ZPT R;  3O5R A;  1ZBK A;  4FN2 A;  4ODM A;  1FKD A;  3TDB A;  4W5U A;  1QPL A;  4LAY A;  4ODK A;  4TW7 A;  4W9Q A;  4HBO A;  5DEZ A;  1O6I A;  5DIV A;  1NWU A;  4IQ2 A;  2MF9 A;  5HW6 A;  4NZC A;  2VCD A;  1NH6 A;  1WB0 A;  1Q1C A;  3OOB A;  1HKJ A;  4ODN A;  4AY1 A;  2XP4 A;  1JNE A;  2XP6 A;  4DZ3 A;  2XP7 A;  1E9L A;  4DH0 A;  1HKM A;  3O5M A;  1ZU8 A;  1R9H A;  1Q6I A;  4U84 A;  1GUV A;  5I98 A;  2XP3 A;  2G8Z A;  2F4E A;  1FKB A;  3O5K A;  4MGV A;  4P8U A;  3CZ8 A;  1PBK A;  2DG3 A;  2Q5A A;  3O5I A;  1Y0O A;  1EIB A;  3IKD A;  4DWS D;  3VAW A;  2K8I A;  2LKN A;  4MNK A;  4R0X A;  3O5O A;  5HKG A;  4HAR A;  3CH9 A;  4S3K A;  5DF0 A;  1JND A;  1RD6 A;  2O92 A;  1OGB A;  3G6M A;  4DZ2 A;  3KAG A;  5BXJ A;  4GGQ A;  4W9O A;  3ARV A;  3UI6 A;  4IT6 A;  1J4H A;  2KGJ A;  3JYM A;  3ARP A;  2AOS A;  2LPV A;  3KAB A;  1W1Y A;  2Y78 A;  3FXY A;  1LQ0 A;  4WKA A;  1ZK6 A;  4L3N A;  3ART A;  1EQ3 A;  3KAH A;  1H0I A;  2G41 A;  2XP8 A;  2KO7 A;  3JXV A;  4GIV A;  3AS0 A;  2MNT A;  2B31 A;  2RUC A;  4S3J A;  3WQV A;  3AQU A;  4QT2 A;  4DRJ A;  1E6R A;  4DWS C;  1JNT A;  1D7H A;  1BKF A;  4WJX A;  3WIJ A;  3IHZ A;  4URI A;  1WNO A;  5DO2 A;  2DT1 A;  3ARU A;  3PRB A;  5HBF A;  3UQA A;  2XP9 A;  2PV2 A;  4KR0 B;  2ZQU A;  4ML4 A;  3G6L A;  1D7I A;  4Z2G A;  4TNS A;  1IX5 A;  1FKR A;  4DRN A;  1NMW A;  1BL4 A;  1J4R A;  1H0G A;  1M5Y A;  2RUR A;  2F21 A;  1FKT A;  4ZPV R;  2XPB A;  4ODQ A;  3ARW A;  3TC5 A;  3ARS A;  4P8V A;  1JVW A;  1FFQ A;  4DIP A;  1PIN A;  3TCZ A;  1FKG A;  3PA7 A;  2DG9 A;  1X6N A;  2KR7 A;  3WQW A;  4ITZ A;  4IT4 A;  1E6Z A;  2RQS A;  2LGO A;  2RUQ A;  1OWQ A;  1W9P A;  3O5F A;  4Z2I A;  3MDY B;  4Z2J A;  2ZQS A;  4JFI A;  4LAW A;  2MLZ A;  1D2K A;  5JH8 A;  4JFM A;  3KAC A;  1D6O A;  3O5Q A;  5DIU A;  4IQC A;  1TCO C;  1LL4 A;  3BXW A;  2ZQV A;  4NNR A;  4MNJ A;  2MLX A;  1NSG A;  2IUZ A;  1B6C A;  3O5D A;  4TX0 A;  1KFW A;  1ZBW A;  1FKH A;  1LL7 A;  2DSV A;  2RUD A;  4P8X A;  1NMV A;  2PPP A;  3AS3 A;  3KAI A;  1FKL A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...