4JFMA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 2-(3,4-dimethoxyphenoxy)ethyl (2s)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfmA00
3UI5A 2Y78A 1FAPA 3NTPA 1JVWA 4FN2A 1J4IA 4QT2A 4GGQA 2UZ5A 2PPOA 4JFIA 4DRNA 2PPNA 4ODOA 1EYMA 2XP4A 3O5QA 4DRKA 3O5EA 4ODLA 5BXJA 2Q5AA 2IF4A 3IKGA 2KE0A 5HW8A 4JFMA 4U84A 1FKKA 2FAPA 2XP5A 3KACA 3RFWA 5HKGA 3PA7A 4FAPA 4TX0A 5HT1A 3UQIA 1A7XA 4DRHA 1JNTA 1FD9A 1C9HA 2KO7A 2AWGA 2F2DA 1FKRA 2XP3A 4MGVA 2PPPA 4ODPA 1D7HA 3UI6A 2MPHA 1Q1CA 2MLXA 1F40A 1BKFA 4JFJA 4ODMA 1D6OA 2VN1A 1FKLA 5HWBA 2MF9A 2LPVA 2XP7A 4JYSA 2ZQTA 2RUQA 2KR7A 4QT3A 1L1PA 3KAIA 4DT4A 3CGNA 4MSPA 5J6EA 3KAFA 1KT1A 2KFWA 1Q6IA 3WH0A 2PV3A 3UQBA 4DRMA 1ZCNA 3KZ7A 4IQ2A 5DIVA 3OOBA 1J4HA 3UI4A 4DZ3A 1N1AA 2XPAA 4DRQA 4LAVA 4IPXA 3TCZA 3O5DA 4N19A 3NRKA 3O5KA 5I98A 1J4RA 1FKTA 3UF8A 5HTGA 2MNTA 4ODKA 2N87A 3TC5A 1Y0OA 4LAXA 1ROTA 1T11A 3RGCA 4W9QA 1B6CA 1TCOC 2PBCA 2XP9A 2ZQSA 4R0XA 4U85A 3IKDA 1U79A 3O5RA 3KAHA 2DG3A 3O5JA 3O5PA 2MLYA 2M2AA 4JFLA 4TW6A 5GPGA 2LJ4A 4W9OA 2RUDA 3TDBA 5D75A 5B8IC 4TW7A 3ODKA 1ZK6A 4J4NA 2DG4A 5HUAA 2ZR5A 1FKBA 3GPKA 3KAGA 2K8IA 2RSEA 1D7JA 3O5OA 2OFNA 3NI6A 3UQAA 2ZQUA 3I6CA 1QZ2A 3FAPA 3MDYB 4JFKA 4DZ2A 4O2TA 1EQ3A 1QPLA 2XPBA 2RQSA 3LUOA 3O5LA 4LAWA 3PRDA 3JYMA 1P5QA 1YATA 1BL4A 1PINA 4ODNA 4QIBA 3O5GA 3O5MA 1R9HA 2VCDA 3O5IA 1PBKA 4DH0A 1QPFA 1NSGA 3VAWA 5HWCA 2LGOA 3JYJA 2L2SA 1FKDA 1Q6HA 3KADA 5DIUA 1M5YA 2MLZA 2PV1A 3KABA 4LAYA 1FKGA 2F4EA 2LKNA 3IHZA 4J4OA 1KT0A 1FKFA 3CGMA 2RUCA 4GIVA 4DRIA 4ODQA 3H9RB 5HW7A 2ITKA 4DRJA 4ITZA 2XP6A 4TYOA 4DROA 4ODRA 2ZR6A 1FKJA 1NMWA 1HXVA 2F21A 2M08A 4G2PA 4TW8A 3O5FA 4G50A 4NNRA 1J6YA 1YW5A 3JXVA 4U86A 1FKSA 2RURA 1Q6UA 4DRPA 1FKIA 1FJDA 3KCEA 2JZVA 4C02B 3EY6A 1D7IA 1NMVA 2ZR4A 4DIPA 2KI3A 4W9PA 1W26A 2PV2A 1ROUA 5HW6A 2ZQVA 3IK8A 2DG9A 1JNSA 4IQCA 2KGJA 2D9FA 1FKHA 5DITA 2XP8A 3B7XA 2FKEA 4TNSA 1F8AB 3PRBA 4BF8A 2M1IA
chains in the Genus database with same CATH superfamily
1FAPA 1JVWA 4MNKA 4GGQA 2PPOA 4DRNA 2XP4A 4ODLA 2Q5AA 5HW8A 1ZBKA 1FKKA 2XP5A 4Q7NA 4NZCA 1EHNA 2DT2A 3ARSA 4MGVA 1EDQA 5GQBA 2O92A 1BKFA 1FKLA 3BXWA 2LPVA 1L1PA 1NWUA 3RM4A 4DT4A 4MSPA 2KFWA 4WJXA 3UQBA 2PN0A 4LAVA 3WL1A 3TCZA 1FKTA 5HTGA 2N87A 4Z2GA 1ROTA 1T11A 1OGBA 4NSBA 3KAHA 3O5JA 4TW6A 2M2AA 1TFVA 3PR9A 3TDBA 5B8IC 3AROA 1E6ZA 2ZR5A 2K8IA 3WQWA 4MNJA 3O5OA 3QOKA 3RM9A 3I6CA 2B31A 3MDYB 4DWSD 3G6LA 3O5LA 1H0GA 1HKJA 1BL4A 1PINA 1W1PA 1WB0A 4QIBA 1HJXA 3O5MA 1PBKA 1ITXA 2LGOA 3JYJA 2L2SA 3KADA 4LAYA 1FKGA 2LKNA 1ZU8A 3WD0A 4KR0B 1D2KA 4DRJA 1JNDA 2XP6A 2ZR6A 3GTYX 3ARWA 2F21A 1HKKA 2M08A 1VF8A 4G50A 4NNRA 3JXVA 1GOIA 3CH9A 4L3NA 1FKSA 4P8XA 2WK2A 1W9VA 3KCEA 1ZBWA 4DIPA 2ZR4A 1W26A 2ZQVA 4MNLA 2KGJA 2D9FA 3ARVA 4W5UA 3B7XA 2QF8A 4TNSA 4DWSC 3ARXA 2M1IA 4BF8A 3NTPA 2ETNA 5DEZA 2ESCA 4IT4A 2PPNA 3AS3A 3ARUA 1E15A 2DSZA 5BXJA 3RFWA 1LQ0A 3CZ8A 3PA7A 4LGXA 4DRHA 2AWGA 2F2DA 1FKRA 2XP3A 4ODPA 4ZPTR 1D7HA 2MPHA 1HKMA 1Q1CA 1F40A 1LJYA 1RD6A 1ZBCA 1D6OA 2VN1A 1W9UA 4UDMA 2MF9A 2XP7A 5HWBA 2YBTA 4QT3A 3CGNA 1NWTA 1X6LA 3RM8A 5J6EA 4WKAA 2PV3A 4DRMA 5JH8A 5DIVA 1N1AA 3WD3A 4DRQA 3O5DA 2A3CA 2DT0A 3TC5A 3RGCA 3AQUA 1B6CA 1TCOC 4U85A 3IKDA 1EIBA 3FY1A 5GPGA 2LJ4A 4W9OA 3PRAA 1XRVA 3KAGA 3NI6A 3UQAA 2ZQUA 1QZ2A 3FAPA 4O2TA 5DO2A 1EQ3A 3ALFA 1OGGA 2EULA 3PRDA 3AS2A 4ODNA 3WQVA 3VAWA 1NSGA 1W1TA 3AS1A 2DSVA 5DIUA 2MLZA 4DWSA 3CHEA 1E9LA 2P4VA 4Z2KA 3IHZA 3CGMA 4DRIA 3ARQA 4ITZA 2DPEA 1FKJA 1NWRA 4TW8A 4G2PA 3O5FA 3WD2A 2WLZA 4U86A 2RURA 4DRPA 2OLHA 1JCHB 2KI3A 1ROUA 1UR8A 2DSUA 4Z2JA 4MPKA 2RQSA 3PRBA 1GPFA 1J4IA 4QT2A 4JFIA 1LL6A 3ALGA 4DRKA 3O5EA 3WD1A 2KE0A 2FAPA 2F23A 4XAKA 4FAPA 4TX0A 5HT1A 3UQIA 1FD9A 1C9HA 2A3EA 1LG2A 2WLYA 4JFJA 4JYSA 2A3AA 1X6NA 2RUQA 3KAFA 1Q6IA 3WH0A 1GUVA 3OOBA 1HJWA 4DZ3A 1CTNA 4IPXA 4DWSB 3O5KA 3WD4A 1W9PA 4MTVA 1Y0OA 4LAXA 4IT6A 2XP9A 2ZQSA 2MLYA 4JFLA 1W1YA 2RUDA 4MNMA 5GPRA 1O6IA 4J4NA 1ZK6A 1W1VA 2RSEA 2OFNA 3B9DA 4URIA 4MAVA 1FFQA 3JYMA 3ARRA 3WKZA 1XHGA 2VCDA 3O5IA 5HWCA 1FKDA 1Q6HA 3B9EA 2PV1A 4HARA 1ZBVA 3BMBA 4J4OA 1FKFA 3CHDA 5HW7A 4TYOA 3B9AA 4ODRA 4DROA 1NMWA 1YW5A 1ZB5A 1E6PA 5DF0A 2G41A 4Z2LA 4QZVB 2JZVA 3EY6A 4W9PA 1LL7A 3EIPA 3IK8A 2DG9A 1JNSA 4WKHA 5DITA 3AS0A 2DT3A 3UI5A 4Z2IA 2Y78A 4PTMA 4FN2A 2UZ5A 4ODOA 1EYMA 3O5QA 2FDMA 1KFWA 2IF4A 3IKGA 4JFMA 4U84A 1OWQA 4Z2HA 3KACA 4AY1A 5HKGA 1E6RA 3RMEA 4HBOA 1A7XA 1NH6A 4S3JA 1JNTA 4S3KA 2KO7A 2PPPA 3UI6A 2AOSA 2MLXA 1LL4A 3CHCA 4ODMA 3ARYA 4P8WA 2DSWA 4HBEA 1UR9A 2ZQTA 2DT1A 2KR7A 3OA5A 3KAIA 1GRJA 1KT1A 1FFRA 1ZCNA 3KZ7A 4IQ2A 2B5UB 3GU0A 1J4HA 3UI4A 3WIJA 2XPAA 4N19A 3NRKA 5I98A 2WM0A 1J4RA 2PI6A 3UF8A 3ARPA 1HKIA 2MNTA 4ODKA 1WNOA 4W9QA 2PBCA 1E6NA 2O9OA 4R0XA 1SR0A 4ZPWR 1U79A 3O5RA 2DG3A 3O5PA 3WL0A 5D75A 4TW7A 3ODKA 4WIWA 2DG4A 4P8UA 5HUAA 1FKBA 1HJVA 3GPKA 2G8ZA 1D7JA 3ARZA 4ZS6A 1SYTA 4JFKA 4DZ2A 5HBFA 1QPLA 2XPBA 3LUOA 4LAWA 2IUZA 4Q22A 1P5QA 1YATA 3ARTA 4DH0A 3O5GA 1R9HA 1QPFA 1IX5A 2YBUA 1M5YA 1NWSA 3KABA 2F4EA 4ZPVR 3G6MA 1K9TA 1KT0A 2RUCA 4GIVA 4ODQA 3H9RB 1LG1A 2ITKA 1E44A 4WK9A 1HXVA 4ML4A 4L72B 3W4RA 4R5EA 1J6YA 1WAWA 1Q6UA 1ZL1A 4WKFA 2A3BA 1FKIA 4P8VA 1FJDA 4C02B 1D7IA 1NMVA 1JNEA 1H0IA 3B8SA 2PV2A 3CHFA 5HW6A 3FXYA 4IQCA 4KQZA 1FKHA 2XP8A 2FKEA 1F8AB
chains in the Genus database with same CATH topology
1FAPA 1JVWA 4MNKA 4GGQA 2PPOA 4DRNA 2XP4A 4ODLA 2Q5AA 5HW8A 1ZBKA 1FKKA 2XP5A 4Q7NA 4NZCA 1EHNA 2DT2A 3ARSA 4MGVA 1EDQA 5GQBA 2O92A 1BKFA 1FKLA 3BXWA 2LPVA 1L1PA 1NWUA 3RM4A 4DT4A 4MSPA 2KFWA 4WJXA 3UQBA 4LAVA 3WL1A 3TCZA 1FKTA 5HTGA 2N87A 4Z2GA 1ROTA 1T11A 1OGBA 4NSBA 3KAHA 3O5JA 4TW6A 2M2AA 1TFVA 3PR9A 3TDBA 5B8IC 3AROA 1E6ZA 2ZR5A 2K8IA 3WQWA 4MNJA 3O5OA 3QOKA 3RM9A 3I6CA 2B31A 3MDYB 4DWSD 3G6LA 3O5LA 1H0GA 1HKJA 1BL4A 1PINA 1W1PA 1WB0A 4QIBA 1HJXA 3O5MA 1PBKA 1ITXA 2LGOA 3JYJA 2L2SA 3KADA 4LAYA 1FKGA 2LKNA 1ZU8A 3WD0A 4KR0B 1D2KA 4DRJA 1JNDA 2XP6A 2ZR6A 3ARWA 2F21A 1HKKA 2M08A 1VF8A 4G50A 4NNRA 3JXVA 1GOIA 3CH9A 4L3NA 1FKSA 4P8XA 2WK2A 1W9VA 3KCEA 1ZBWA 4DIPA 2ZR4A 1W26A 2ZQVA 4MNLA 2KGJA 2D9FA 3ARVA 4W5UA 3B7XA 2QF8A 4TNSA 4DWSC 3ARXA 2M1IA 4BF8A 3NTPA 5DEZA 2ESCA 4IT4A 2PPNA 3AS3A 3ARUA 1E15A 2DSZA 5BXJA 3RFWA 1LQ0A 3CZ8A 3PA7A 4LGXA 4DRHA 2AWGA 2F2DA 1FKRA 2XP3A 4ODPA 4ZPTR 1D7HA 2MPHA 1HKMA 1Q1CA 1F40A 1LJYA 1RD6A 1ZBCA 1D6OA 2VN1A 1W9UA 5HWBA 2MF9A 2XP7A 2YBTA 4QT3A 3CGNA 1NWTA 1X6LA 3RM8A 5J6EA 4WKAA 2PV3A 4DRMA 5JH8A 5DIVA 1N1AA 3WD3A 4DRQA 3O5DA 2A3CA 2DT0A 3TC5A 3RGCA 3AQUA 1B6CA 1TCOC 4U85A 3IKDA 1EIBA 3FY1A 5GPGA 2LJ4A 4W9OA 3PRAA 1XRVA 3KAGA 3NI6A 3UQAA 2ZQUA 1QZ2A 3FAPA 4O2TA 5DO2A 1EQ3A 3ALFA 1OGGA 3PRDA 3AS2A 4ODNA 3WQVA 3VAWA 1NSGA 1W1TA 3AS1A 2DSVA 5DIUA 2MLZA 4DWSA 3CHEA 1E9LA 4Z2KA 3IHZA 3CGMA 4DRIA 3ARQA 4ITZA 2DPEA 1FKJA 1NWRA 4TW8A 4G2PA 3O5FA 3WD2A 2WLZA 4U86A 2RURA 4DRPA 2OLHA 2KI3A 1ROUA 1UR8A 2DSUA 4Z2JA 4MPKA 2RQSA 3PRBA 1GPFA 1J4IA 4QT2A 4JFIA 1LL6A 3ALGA 4DRKA 3O5EA 3WD1A 2KE0A 2FAPA 4XAKA 4FAPA 4TX0A 5HT1A 3UQIA 1FD9A 1C9HA 2A3EA 1LG2A 2WLYA 4JFJA 4JYSA 2A3AA 1X6NA 2RUQA 3KAFA 1Q6IA 3WH0A 1GUVA 3OOBA 1HJWA 4DZ3A 1CTNA 4IPXA 4DWSB 3O5KA 3WD4A 1W9PA 4MTVA 1Y0OA 4LAXA 4IT6A 2XP9A 2ZQSA 2MLYA 4JFLA 1W1YA 2RUDA 4MNMA 5GPRA 1O6IA 4J4NA 1ZK6A 1W1VA 2RSEA 2OFNA 3B9DA 4URIA 4MAVA 1FFQA 3JYMA 3ARRA 3WKZA 1XHGA 2VCDA 3O5IA 5HWCA 1FKDA 1Q6HA 3B9EA 2PV1A 4HARA 1ZBVA 4J4OA 1FKFA 3CHDA 5HW7A 4TYOA 3B9AA 4ODRA 4DROA 1NMWA 1YW5A 1ZB5A 1E6PA 5DF0A 2G41A 4Z2LA 4QZVB 2JZVA 3EY6A 4W9PA 1LL7A 3IK8A 2DG9A 1JNSA 4WKHA 5DITA 3AS0A 2DT3A 3UI5A 4Z2IA 2Y78A 4PTMA 4FN2A 2UZ5A 4ODOA 1EYMA 3O5QA 2FDMA 1KFWA 2IF4A 3IKGA 4JFMA 4U84A 1OWQA 4Z2HA 3KACA 4AY1A 5HKGA 1E6RA 3RMEA 4HBOA 1A7XA 1NH6A 4S3JA 1JNTA 4S3KA 2KO7A 2PPPA 3UI6A 2AOSA 2MLXA 1LL4A 3CHCA 4ODMA 3ARYA 4P8WA 2DSWA 4HBEA 1UR9A 2ZQTA 2DT1A 2KR7A 3OA5A 3KAIA 1KT1A 1FFRA 1ZCNA 3KZ7A 4IQ2A 3WIJA 1J4HA 3UI4A 2XPAA 4N19A 3NRKA 5I98A 2WM0A 1J4RA 2PI6A 3UF8A 3ARPA 1HKIA 2MNTA 4ODKA 1WNOA 4W9QA 2PBCA 1E6NA 2O9OA 4R0XA 1SR0A 4ZPWR 1U79A 3O5RA 2DG3A 3O5PA 3WL0A 5D75A 4TW7A 3ODKA 4WIWA 2DG4A 4P8UA 5HUAA 1FKBA 1HJVA 3GPKA 2G8ZA 1D7JA 3ARZA 4ZS6A 1SYTA 4JFKA 4DZ2A 5HBFA 1QPLA 2XPBA 3LUOA 4LAWA 2IUZA 4Q22A 1P5QA 1YATA 3ARTA 4DH0A 3O5GA 1R9HA 1QPFA 1IX5A 2YBUA 1M5YA 1NWSA 3KABA 2F4EA 4ZPVR 3G6MA 1K9TA 1KT0A 2RUCA 4GIVA 4ODQA 3H9RB 1LG1A 2ITKA 4WK9A 1HXVA 4ML4A 4L72B 3W4RA 4R5EA 1J6YA 1WAWA 1Q6UA 1ZL1A 4WKFA 2A3BA 1FKIA 4P8VA 1FJDA 4C02B 1D7IA 1NMVA 1JNEA 1H0IA 3B8SA 2PV2A 3CHFA 5HW6A 3FXYA 4IQCA 4KQZA 1FKHA 2XP8A 2FKEA 1F8AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI5 A;  2Y78 A;  1FAP A;  3NTP A;  1JVW A;  4FN2 A;  1J4I A;  4QT2 A;  4GGQ A;  2UZ5 A;  2PPO A;  4JFI A;  4DRN A;  2PPN A;  4ODO A;  1EYM A;  2XP4 A;  3O5Q A;  4DRK A;  3O5E A;  4ODL A;  5BXJ A;  2Q5A A;  2IF4 A;  3IKG A;  2KE0 A;  5HW8 A;  4JFM A;  4U84 A;  1FKK A;  2FAP A;  2XP5 A;  3KAC A;  3RFW A;  5HKG A;  3PA7 A;  4FAP A;  4TX0 A;  5HT1 A;  3UQI A;  1A7X A;  4DRH A;  1JNT A;  1FD9 A;  1C9H A;  2KO7 A;  2AWG A;  2F2D A;  1FKR A;  2XP3 A;  4MGV A;  2PPP A;  4ODP A;  1D7H A;  3UI6 A;  2MPH A;  1Q1C A;  2MLX A;  1F40 A;  1BKF A;  4JFJ A;  4ODM A;  1D6O A;  2VN1 A;  1FKL A;  5HWB A;  2MF9 A;  2LPV A;  2XP7 A;  4JYS A;  2ZQT A;  2RUQ A;  2KR7 A;  4QT3 A;  1L1P A;  3KAI A;  4DT4 A;  3CGN A;  4MSP A;  5J6E A;  3KAF A;  1KT1 A;  2KFW A;  1Q6I A;  3WH0 A;  2PV3 A;  3UQB A;  4DRM A;  1ZCN A;  3KZ7 A;  4IQ2 A;  5DIV A;  3OOB A;  1J4H A;  3UI4 A;  4DZ3 A;  1N1A A;  2XPA A;  4DRQ A;  4LAV A;  4IPX A;  3TCZ A;  3O5D A;  4N19 A;  3NRK A;  3O5K A;  5I98 A;  1J4R A;  1FKT A;  3UF8 A;  5HTG A;  2MNT A;  4ODK A;  2N87 A;  3TC5 A;  1Y0O A;  4LAX A;  1ROT A;  1T11 A;  3RGC A;  4W9Q A;  1B6C A;  1TCO C;  2PBC A;  2XP9 A;  2ZQS A;  4R0X A;  4U85 A;  3IKD A;  1U79 A;  3O5R A;  3KAH A;  2DG3 A;  3O5J A;  3O5P A;  2MLY A;  2M2A A;  4JFL A;  4TW6 A;  5GPG A;  2LJ4 A;  4W9O A;  2RUD A;  3TDB A;  5D75 A;  5B8I C;  4TW7 A;  3ODK A;  1ZK6 A;  4J4N A;  2DG4 A;  5HUA A;  2ZR5 A;  1FKB A;  3GPK A;  3KAG A;  2K8I A;  2RSE A;  1D7J A;  3O5O A;  2OFN A;  3NI6 A;  3UQA A;  2ZQU A;  3I6C A;  1QZ2 A;  3FAP A;  3MDY B;  4JFK A;  4DZ2 A;  4O2T A;  1EQ3 A;  1QPL A;  2XPB A;  2RQS A;  3LUO A;  3O5L A;  4LAW A;  3PRD A;  3JYM A;  1P5Q A;  1YAT A;  1BL4 A;  1PIN A;  4ODN A;  4QIB A;  3O5G A;  3O5M A;  1R9H A;  2VCD A;  3O5I A;  1PBK A;  4DH0 A;  1QPF A;  1NSG A;  3VAW A;  5HWC A;  2LGO A;  3JYJ A;  2L2S A;  1FKD A;  1Q6H A;  3KAD A;  5DIU A;  1M5Y A;  2MLZ A;  2PV1 A;  3KAB A;  4LAY A;  1FKG A;  2F4E A;  2LKN A;  3IHZ A;  4J4O A;  1KT0 A;  1FKF A;  3CGM A;  2RUC A;  4GIV A;  4DRI A;  4ODQ A;  3H9R B;  5HW7 A;  2ITK A;  4DRJ A;  4ITZ A;  2XP6 A;  4TYO A;  4DRO A;  4ODR A;  2ZR6 A;  1FKJ A;  1NMW A;  1HXV A;  2F21 A;  2M08 A;  4G2P A;  4TW8 A;  3O5F A;  4G50 A;  4NNR A;  1J6Y A;  1YW5 A;  3JXV A;  4U86 A;  1FKS A;  2RUR A;  1Q6U A;  4DRP A;  1FKI A;  1FJD A;  3KCE A;  2JZV A;  4C02 B;  3EY6 A;  1D7I A;  1NMV A;  2ZR4 A;  4DIP A;  2KI3 A;  4W9P A;  1W26 A;  2PV2 A;  1ROU A;  5HW6 A;  2ZQV A;  3IK8 A;  2DG9 A;  1JNS A;  4IQC A;  2KGJ A;  2D9F A;  1FKH A;  5DIT A;  2XP8 A;  3B7X A;  2FKE A;  4TNS A;  1F8A B;  3PRB A;  4BF8 A;  2M1I A; 
#chains in the Genus database with same CATH topology
 1FAP A;  1JVW A;  4MNK A;  4GGQ A;  2PPO A;  4DRN A;  2XP4 A;  4ODL A;  2Q5A A;  5HW8 A;  1ZBK A;  1FKK A;  2XP5 A;  4Q7N A;  4NZC A;  1EHN A;  2DT2 A;  3ARS A;  4MGV A;  1EDQ A;  5GQB A;  2O92 A;  1BKF A;  1FKL A;  3BXW A;  2LPV A;  1L1P A;  1NWU A;  3RM4 A;  4DT4 A;  4MSP A;  2KFW A;  4WJX A;  3UQB A;  2PN0 A;  4LAV A;  3WL1 A;  3TCZ A;  1FKT A;  5HTG A;  2N87 A;  4Z2G A;  1ROT A;  1T11 A;  1OGB A;  4NSB A;  3KAH A;  3O5J A;  4TW6 A;  2M2A A;  1TFV A;  3PR9 A;  3TDB A;  5B8I C;  3ARO A;  1E6Z A;  2ZR5 A;  2K8I A;  3WQW A;  4MNJ A;  3O5O A;  3QOK A;  3RM9 A;  3I6C A;  2B31 A;  3MDY B;  4DWS D;  3G6L A;  3O5L A;  1H0G A;  1HKJ A;  1BL4 A;  1PIN A;  1W1P A;  1WB0 A;  4QIB A;  1HJX A;  3O5M A;  1PBK A;  1ITX A;  2LGO A;  3JYJ A;  2L2S A;  3KAD A;  4LAY A;  1FKG A;  2LKN A;  1ZU8 A;  3WD0 A;  4KR0 B;  1D2K A;  4DRJ A;  1JND A;  2XP6 A;  2ZR6 A;  3GTY X;  3ARW A;  2F21 A;  1HKK A;  2M08 A;  1VF8 A;  4G50 A;  4NNR A;  3JXV A;  1GOI A;  3CH9 A;  4L3N A;  1FKS A;  4P8X A;  2WK2 A;  1W9V A;  3KCE A;  1ZBW A;  4DIP A;  2ZR4 A;  1W26 A;  2ZQV A;  4MNL A;  2KGJ A;  2D9F A;  3ARV A;  4W5U A;  3B7X A;  2QF8 A;  4TNS A;  4DWS C;  3ARX A;  2M1I A;  4BF8 A;  3NTP A;  2ETN A;  5DEZ A;  2ESC A;  4IT4 A;  2PPN A;  3AS3 A;  3ARU A;  1E15 A;  2DSZ A;  5BXJ A;  3RFW A;  1LQ0 A;  3CZ8 A;  3PA7 A;  4LGX A;  4DRH A;  2AWG A;  2F2D A;  1FKR A;  2XP3 A;  4ODP A;  4ZPT R;  1D7H A;  2MPH A;  1HKM A;  1Q1C A;  1F40 A;  1LJY A;  1RD6 A;  1ZBC A;  1D6O A;  2VN1 A;  1W9U A;  4UDM A;  2MF9 A;  2XP7 A;  5HWB A;  2YBT A;  4QT3 A;  3CGN A;  1NWT A;  1X6L A;  3RM8 A;  5J6E A;  4WKA A;  2PV3 A;  4DRM A;  5JH8 A;  5DIV A;  1N1A A;  3WD3 A;  4DRQ A;  3O5D A;  2A3C A;  2DT0 A;  3TC5 A;  3RGC A;  3AQU A;  1B6C A;  1TCO C;  4U85 A;  3IKD A;  1EIB A;  3FY1 A;  5GPG A;  2LJ4 A;  4W9O A;  3PRA A;  1XRV A;  3KAG A;  3NI6 A;  3UQA A;  2ZQU A;  1QZ2 A;  3FAP A;  4O2T A;  5DO2 A;  1EQ3 A;  3ALF A;  1OGG A;  2EUL A;  3PRD A;  3AS2 A;  4ODN A;  3WQV A;  3VAW A;  1NSG A;  1W1T A;  3AS1 A;  2DSV A;  5DIU A;  2MLZ A;  4DWS A;  3CHE A;  1E9L A;  2P4V A;  4Z2K A;  3IHZ A;  3CGM A;  4DRI A;  3ARQ A;  4ITZ A;  2DPE A;  1FKJ A;  1NWR A;  4TW8 A;  4G2P A;  3O5F A;  3WD2 A;  2WLZ A;  4U86 A;  2RUR A;  4DRP A;  2OLH A;  1JCH B;  2KI3 A;  1ROU A;  1UR8 A;  2DSU A;  4Z2J A;  4MPK A;  2RQS A;  3PRB A;  1GPF A;  1J4I A;  4QT2 A;  4JFI A;  1LL6 A;  3ALG A;  4DRK A;  3O5E A;  3WD1 A;  2KE0 A;  2FAP A;  2F23 A;  4XAK A;  4FAP A;  4TX0 A;  5HT1 A;  3UQI A;  1FD9 A;  1C9H A;  2A3E A;  1LG2 A;  2WLY A;  4JFJ A;  4JYS A;  2A3A A;  1X6N A;  2RUQ A;  3KAF A;  1Q6I A;  3WH0 A;  1GUV A;  3OOB A;  1HJW A;  4DZ3 A;  1CTN A;  4IPX A;  4DWS B;  3O5K A;  3WD4 A;  1W9P A;  4MTV A;  1Y0O A;  4LAX A;  4IT6 A;  2XP9 A;  2ZQS A;  2MLY A;  4JFL A;  1W1Y A;  2RUD A;  4MNM A;  5GPR A;  1O6I A;  4J4N A;  1ZK6 A;  1W1V A;  2RSE A;  2OFN A;  3B9D A;  4URI A;  4MAV A;  1FFQ A;  3JYM A;  3ARR A;  3WKZ A;  1XHG A;  2VCD A;  3O5I A;  5HWC A;  1FKD A;  1Q6H A;  3B9E A;  2PV1 A;  4HAR A;  1ZBV A;  3BMB A;  4J4O A;  1FKF A;  3CHD A;  5HW7 A;  4TYO A;  3B9A A;  4ODR A;  4DRO A;  1NMW A;  1YW5 A;  1ZB5 A;  1E6P A;  5DF0 A;  2G41 A;  4Z2L A;  4QZV B;  2JZV A;  3EY6 A;  4W9P A;  1LL7 A;  3EIP A;  3IK8 A;  2DG9 A;  1JNS A;  4WKH A;  5DIT A;  3AS0 A;  2DT3 A;  3UI5 A;  4Z2I A;  2Y78 A;  4PTM A;  4FN2 A;  2UZ5 A;  4ODO A;  1EYM A;  3O5Q A;  2FDM A;  1KFW A;  2IF4 A;  3IKG A;  4JFM A;  4U84 A;  1OWQ A;  4Z2H A;  3KAC A;  4AY1 A;  5HKG A;  1E6R A;  3RME A;  4HBO A;  1A7X A;  1NH6 A;  4S3J A;  1JNT A;  4S3K A;  2KO7 A;  2PPP A;  3UI6 A;  2AOS A;  2MLX A;  1LL4 A;  3CHC A;  4ODM A;  3ARY A;  4P8W A;  2DSW A;  4HBE A;  1UR9 A;  2ZQT A;  2DT1 A;  2KR7 A;  3OA5 A;  3KAI A;  1GRJ A;  1KT1 A;  1FFR A;  1ZCN A;  3KZ7 A;  4IQ2 A;  2B5U B;  3GU0 A;  1J4H A;  3UI4 A;  3WIJ A;  2XPA A;  4N19 A;  3NRK A;  5I98 A;  2WM0 A;  1J4R A;  2PI6 A;  3UF8 A;  3ARP A;  1HKI A;  2MNT A;  4ODK A;  1WNO A;  4W9Q A;  2PBC A;  1E6N A;  2O9O A;  4R0X A;  1SR0 A;  4ZPW R;  1U79 A;  3O5R A;  2DG3 A;  3O5P A;  3WL0 A;  5D75 A;  4TW7 A;  3ODK A;  4WIW A;  2DG4 A;  4P8U A;  5HUA A;  1FKB A;  1HJV A;  3GPK A;  2G8Z A;  1D7J A;  3ARZ A;  4ZS6 A;  1SYT A;  4JFK A;  4DZ2 A;  5HBF A;  1QPL A;  2XPB A;  3LUO A;  4LAW A;  2IUZ A;  4Q22 A;  1P5Q A;  1YAT A;  3ART A;  4DH0 A;  3O5G A;  1R9H A;  1QPF A;  1IX5 A;  2YBU A;  1M5Y A;  1NWS A;  3KAB A;  2F4E A;  4ZPV R;  3G6M A;  1K9T A;  1KT0 A;  2RUC A;  4GIV A;  4ODQ A;  3H9R B;  1LG1 A;  2ITK A;  1E44 A;  4WK9 A;  1HXV A;  4ML4 A;  4L72 B;  3W4R A;  4R5E A;  1J6Y A;  1WAW A;  1Q6U A;  1ZL1 A;  4WKF A;  2A3B A;  1FKI A;  4P8V A;  1FJD A;  4C02 B;  1D7I A;  1NMV A;  1JNE A;  1H0I A;  3B8S A;  2PV2 A;  3CHF A;  5HW6 A;  3FXY A;  4IQC A;  4KQZ A;  1FKH A;  2XP8 A;  2FKE A;  1F8A B; 
#chains in the Genus database with same CATH homology
 1FAP A;  1JVW A;  4MNK A;  4GGQ A;  2PPO A;  4DRN A;  2XP4 A;  4ODL A;  2Q5A A;  5HW8 A;  1ZBK A;  1FKK A;  2XP5 A;  4Q7N A;  4NZC A;  1EHN A;  2DT2 A;  3ARS A;  4MGV A;  1EDQ A;  5GQB A;  2O92 A;  1BKF A;  1FKL A;  3BXW A;  2LPV A;  1L1P A;  1NWU A;  3RM4 A;  4DT4 A;  4MSP A;  2KFW A;  4WJX A;  3UQB A;  4LAV A;  3WL1 A;  3TCZ A;  1FKT A;  5HTG A;  2N87 A;  4Z2G A;  1ROT A;  1T11 A;  1OGB A;  4NSB A;  3KAH A;  3O5J A;  4TW6 A;  2M2A A;  1TFV A;  3PR9 A;  3TDB A;  5B8I C;  3ARO A;  1E6Z A;  2ZR5 A;  2K8I A;  3WQW A;  4MNJ A;  3O5O A;  3QOK A;  3RM9 A;  3I6C A;  2B31 A;  3MDY B;  4DWS D;  3G6L A;  3O5L A;  1H0G A;  1HKJ A;  1BL4 A;  1PIN A;  1W1P A;  1WB0 A;  4QIB A;  1HJX A;  3O5M A;  1PBK A;  1ITX A;  2LGO A;  3JYJ A;  2L2S A;  3KAD A;  4LAY A;  1FKG A;  2LKN A;  1ZU8 A;  3WD0 A;  4KR0 B;  1D2K A;  4DRJ A;  1JND A;  2XP6 A;  2ZR6 A;  3ARW A;  2F21 A;  1HKK A;  2M08 A;  1VF8 A;  4G50 A;  4NNR A;  3JXV A;  1GOI A;  3CH9 A;  4L3N A;  1FKS A;  4P8X A;  2WK2 A;  1W9V A;  3KCE A;  1ZBW A;  4DIP A;  2ZR4 A;  1W26 A;  2ZQV A;  4MNL A;  2KGJ A;  2D9F A;  3ARV A;  4W5U A;  3B7X A;  2QF8 A;  4TNS A;  4DWS C;  3ARX A;  2M1I A;  4BF8 A;  3NTP A;  5DEZ A;  2ESC A;  4IT4 A;  2PPN A;  3AS3 A;  3ARU A;  1E15 A;  2DSZ A;  5BXJ A;  3RFW A;  1LQ0 A;  3CZ8 A;  3PA7 A;  4LGX A;  4DRH A;  2AWG A;  2F2D A;  1FKR A;  2XP3 A;  4ODP A;  4ZPT R;  1D7H A;  2MPH A;  1HKM A;  1Q1C A;  1F40 A;  1LJY A;  1RD6 A;  1ZBC A;  1D6O A;  2VN1 A;  1W9U A;  5HWB A;  2MF9 A;  2XP7 A;  2YBT A;  4QT3 A;  3CGN A;  1NWT A;  1X6L A;  3RM8 A;  5J6E A;  4WKA A;  2PV3 A;  4DRM A;  5JH8 A;  5DIV A;  1N1A A;  3WD3 A;  4DRQ A;  3O5D A;  2A3C A;  2DT0 A;  3TC5 A;  3RGC A;  3AQU A;  1B6C A;  1TCO C;  4U85 A;  3IKD A;  1EIB A;  3FY1 A;  5GPG A;  2LJ4 A;  4W9O A;  3PRA A;  1XRV A;  3KAG A;  3NI6 A;  3UQA A;  2ZQU A;  1QZ2 A;  3FAP A;  4O2T A;  5DO2 A;  1EQ3 A;  3ALF A;  1OGG A;  3PRD A;  3AS2 A;  4ODN A;  3WQV A;  3VAW A;  1NSG A;  1W1T A;  3AS1 A;  2DSV A;  5DIU A;  2MLZ A;  4DWS A;  3CHE A;  1E9L A;  4Z2K A;  3IHZ A;  3CGM A;  4DRI A;  3ARQ A;  4ITZ A;  2DPE A;  1FKJ A;  1NWR A;  4TW8 A;  4G2P A;  3O5F A;  3WD2 A;  2WLZ A;  4U86 A;  2RUR A;  4DRP A;  2OLH A;  2KI3 A;  1ROU A;  1UR8 A;  2DSU A;  4Z2J A;  4MPK A;  2RQS A;  3PRB A;  1GPF A;  1J4I A;  4QT2 A;  4JFI A;  1LL6 A;  3ALG A;  4DRK A;  3O5E A;  3WD1 A;  2KE0 A;  2FAP A;  4XAK A;  4FAP A;  4TX0 A;  5HT1 A;  3UQI A;  1FD9 A;  1C9H A;  2A3E A;  1LG2 A;  2WLY A;  4JFJ A;  4JYS A;  2A3A A;  1X6N A;  2RUQ A;  3KAF A;  1Q6I A;  3WH0 A;  1GUV A;  3OOB A;  1HJW A;  4DZ3 A;  1CTN A;  4IPX A;  4DWS B;  3O5K A;  3WD4 A;  1W9P A;  4MTV A;  1Y0O A;  4LAX A;  4IT6 A;  2XP9 A;  2ZQS A;  2MLY A;  4JFL A;  1W1Y A;  2RUD A;  4MNM A;  5GPR A;  1O6I A;  4J4N A;  1ZK6 A;  1W1V A;  2RSE A;  2OFN A;  3B9D A;  4URI A;  4MAV A;  1FFQ A;  3JYM A;  3ARR A;  3WKZ A;  1XHG A;  2VCD A;  3O5I A;  5HWC A;  1FKD A;  1Q6H A;  3B9E A;  2PV1 A;  4HAR A;  1ZBV A;  4J4O A;  1FKF A;  3CHD A;  5HW7 A;  4TYO A;  3B9A A;  4ODR A;  4DRO A;  1NMW A;  1YW5 A;  1ZB5 A;  1E6P A;  5DF0 A;  2G41 A;  4Z2L A;  4QZV B;  2JZV A;  3EY6 A;  4W9P A;  1LL7 A;  3IK8 A;  2DG9 A;  1JNS A;  4WKH A;  5DIT A;  3AS0 A;  2DT3 A;  3UI5 A;  4Z2I A;  2Y78 A;  4PTM A;  4FN2 A;  2UZ5 A;  4ODO A;  1EYM A;  3O5Q A;  2FDM A;  1KFW A;  2IF4 A;  3IKG A;  4JFM A;  4U84 A;  1OWQ A;  4Z2H A;  3KAC A;  4AY1 A;  5HKG A;  1E6R A;  3RME A;  4HBO A;  1A7X A;  1NH6 A;  4S3J A;  1JNT A;  4S3K A;  2KO7 A;  2PPP A;  3UI6 A;  2AOS A;  2MLX A;  1LL4 A;  3CHC A;  4ODM A;  3ARY A;  4P8W A;  2DSW A;  4HBE A;  1UR9 A;  2ZQT A;  2DT1 A;  2KR7 A;  3OA5 A;  3KAI A;  1KT1 A;  1FFR A;  1ZCN A;  3KZ7 A;  4IQ2 A;  3WIJ A;  1J4H A;  3UI4 A;  2XPA A;  4N19 A;  3NRK A;  5I98 A;  2WM0 A;  1J4R A;  2PI6 A;  3UF8 A;  3ARP A;  1HKI A;  2MNT A;  4ODK A;  1WNO A;  4W9Q A;  2PBC A;  1E6N A;  2O9O A;  4R0X A;  1SR0 A;  4ZPW R;  1U79 A;  3O5R A;  2DG3 A;  3O5P A;  3WL0 A;  5D75 A;  4TW7 A;  3ODK A;  4WIW A;  2DG4 A;  4P8U A;  5HUA A;  1FKB A;  1HJV A;  3GPK A;  2G8Z A;  1D7J A;  3ARZ A;  4ZS6 A;  1SYT A;  4JFK A;  4DZ2 A;  5HBF A;  1QPL A;  2XPB A;  3LUO A;  4LAW A;  2IUZ A;  4Q22 A;  1P5Q A;  1YAT A;  3ART A;  4DH0 A;  3O5G A;  1R9H A;  1QPF A;  1IX5 A;  2YBU A;  1M5Y A;  1NWS A;  3KAB A;  2F4E A;  4ZPV R;  3G6M A;  1K9T A;  1KT0 A;  2RUC A;  4GIV A;  4ODQ A;  3H9R B;  1LG1 A;  2ITK A;  4WK9 A;  1HXV A;  4ML4 A;  4L72 B;  3W4R A;  4R5E A;  1J6Y A;  1WAW A;  1Q6U A;  1ZL1 A;  4WKF A;  2A3B A;  1FKI A;  4P8V A;  1FJD A;  4C02 B;  1D7I A;  1NMV A;  1JNE A;  1H0I A;  3B8S A;  2PV2 A;  3CHF A;  5HW6 A;  3FXY A;  4IQC A;  4KQZ A;  1FKH A;  2XP8 A;  2FKE A;  1F8A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...