4JFMA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 2-(3,4-dimethoxyphenoxy)ethyl (2s)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfmA00
3TCZA 3KADA 1QPFA 4G2PA 1ROUA 2F4EA 2ITKA 3TDBA 4JFMA 4ODLA 5D75A 2XP8A 2RUDA 4ODOA 3KACA 2ZR6A 3O5EA 3O5KA 1EYMA 2MLXA 4BF8A 3O5PA 1QPLA 3JXVA 3WH0A 1FAPA 1Q6IA 2LGOA 1FKRA 2XPAA 2LKNA 1N1AA 1D7HA 2AWGA 2LPVA 2RSEA 4TW6A 3O5MA 2XP3A 3O5QA 4JFLA 2DG4A 1PBKA 1FKFA 2XP9A 3GPKA 3KAHA 5I98A 1U79A 1PINA 3O5JA 2M2AA 2UZ5A 3O5OA 2PPOA 4LAWA 4QT2A 2JZVA 2DG3A 3RFWA 2D9FA 2XP4A 2N87A 3UF8A 2XP7A 1FKLA 2DG9A 4TNSA 4QIBA 4DIPA 3UQIA 4U86A 1HXVA 1FKGA 2MPHA 5HW8A 3B7XA 1D6OA 4W9PA 5DIVA 4LAYA 4IPXA 4QT3A 4J4OA 2KR7A 1R9HA 3KAIA 1FKBA 4ITZA 1L1PA 4MGVA 2RURA 2FKEA 3IK8A 3ODKA 3UI6A 2IF4A 1KT1A 2ZR5A 3O5FA 3CGMA 2M1IA 4FN2A 4ODMA 3OOBA 1J6YA 1Q6HA 3LUOA 1EQ3A 2KO7A 1NMWA 1C9HA 3IKGA 3NI6A 4GGQA 1FKSA 2XPBA 3KABA 1A7XA 3JYJA 4ODRA 4ODKA 4LAXA 4O2TA 2PV3A 3PRDA 1W26A 4IQ2A 4JFJA 4N19A 3JYMA 4W9OA 2K8IA 2RUQA 5HTGA 1TCOC 4JYSA 1J4HA 5HW7A 3KAFA 2PPPA 3UI4A 4DRJA 2VCDA 5J6EA 3O5GA 1B6CA 4ODNA 1FKHA 1BL4A 3UQAA 1FKDA 3EY6A 3PA7A 2XP5A 4DRQA 5DITA 1D7IA 2PV1A 2KGJA 1M5YA 4U84A 2ZQVA 4DRHA 2Q5AA 2VN1A 1JVWA 1FKKA 2FAPA 3H9RB 4DT4A 4NNRA 1Q6UA 5HT1A 5HWCA 5HUAA 1BKFA 2LJ4A 4MSPA 3RGCA 2MLYA 3KAGA 2PBCA 5DIUA 3TC5A 2RQSA 1JNTA 1Q1CA 4DRIA 4DRNA 1FKIA 2KE0A 3PRBA 2F2DA 4DROA 1QZ2A 4U85A 3FAPA 3KZ7A 3NRKA 2ZQTA 4DZ3A 4DRPA 4C02B 2KFWA 2XP6A 3CGNA 4IQCA 2F21A 3VAWA 2KI3A 4LAVA 4W9QA 3IHZA 2OFNA 3MDYB 1ZCNA 1YW5A 4G50A 2MF9A 1FKJA 4TX0A 3IKDA 1T11A 2PPNA 5HKGA 4TYOA 3KCEA 1ZK6A 5BXJA 3I6CA 4J4NA 3UI5A 5GPGA 4FAPA 2L2SA 3O5LA 3O5DA 4TW7A 5HWBA 4JFKA 1D7JA 2MLZA 2ZQSA 2RUCA 3NTPA 4GIVA 1FD9A 4ODQA 4TW8A 4ODPA 4DH0A 2MNTA 3O5IA 1JNSA 1Y0OA 2ZQUA 4R0XA 5HW6A 2PV2A 1ROTA 1J4IA 2ZR4A 4JFIA 4DRKA 4DRMA 1KT0A 1NSGA 3UQBA 2M08A 1J4RA 4DZ2A 1FKTA 1NMVA 2Y78A 3O5RA 1P5QA 5B8IC 1F40A 1YATA 1F8AB 1FJDA
chains in the Genus database with same CATH superfamily
3KADA 2F4EA 1NWUA 3ARTA 1WAWA 2RUDA 3O5KA 2MLXA 3O5PA 1QPLA 2FDMA 3WKZA 4S3KA 4Z2JA 1FKRA 2AWGA 2DG4A 3B9EA 3GPKA 3KAHA 1U79A 1PINA 1W1YA 2M2AA 3B9DA 2O9OA 1E6NA 4Q22A 3WL0A 2XP4A 3B8SA 4DIPA 3WD4A 1HJXA 3CZ8A 2MPHA 4LAYA 2DSVA 1SR0A 1R9HA 1FKBA 1GRJA 2A3BA 2G8ZA 1E44A 1LJYA 3CGMA 2M1IA 4FN2A 4ODMA 3OOBA 4WKHA 3IKGA 3NI6A 1E6RA 4LAXA 4PTMA 4ZPVR 4HARA 4W9OA 4JFJA 2K8IA 2G41A 1TCOC 3KAFA 2VCDA 3ALFA 1GOIA 1FKHA 2YBTA 3ARWA 3B9AA 4DWSB 2KGJA 4NSBA 1FFRA 3H9RB 3ARVA 5HUAA 3KAGA 5DIUA 1O6IA 1X6NA 1QZ2A 3PRAA 3FAPA 3KZ7A 2WM0A 1OWQA 3ARZA 4DZ3A 3AS2A 4DRPA 4C02B 2KFWA 4ML4A 2WLYA 4LAVA 2OFNA 4G50A 2MF9A 1TFVA 5BXJA 3G6LA 1H0GA 4J4NA 4DWSD 4LGXA 4TW7A 3O5LA 3O5DA 4ODQA 4DH0A 3O5IA 3GTYX 3FY1A 1ROTA 1J4IA 2ZR4A 1KT0A 1J4RA 2P4VA 1FJDA 3CHFA 4G2PA 1ROUA 2F23A 4JFMA 4ODOA 3KACA 2ZR6A 1EYMA 3WH0A 2LGOA 4WJXA 4Z2LA 2OLHA 1HKMA 4Z2GA 3O5MA 3AS1A 2XP3A 4JFLA 1PBKA 1FKFA 5I98A 3O5OA 1GUVA 1E6PA 1JNDA 2D9FA 4P8VA 2XP7A 3BMBA 4TNSA 1NWSA 3AS0A 1FKGA 1D2KA 1H0IA 5HW8A 2PI6A 5DIVA 4J4OA 3PR9A 3FXYA 1L1PA 1E15A 4MGVA 3UI6A 3IK8A 2ZR5A 3O5FA 1EIBA 3WD3A 1Q6HA 2KO7A 2QF8A 2XPBA 3KABA 4ODRA 4Z2IA 4O2TA 1OGBA 1WB0A 3PRDA 1W26A 3CHCA 2A3CA 4JYSA 1J4HA 5HW7A 3EIPA 2PPPA 3UI4A 4DRJA 5J6EA 3O5GA 4ODNA 1HJVA 1BL4A 1RD6A 3EY6A 2XP5A 3RM4A 2O92A 2ZQVA 3W4RA 1W1PA 2FAPA 4Z2HA 4NNRA 2YBUA 2DT2A 5HWCA 1BKFA 4MSPA 3RGCA 3TC5A 1LG2A 4R5EA 4P8WA 1JNTA 1Q1CA 2KE0A 3PRBA 2F2DA 5DO2A 4DROA 4U85A 4IT6A 4ZPTR 3MDYB 1YW5A 4P8UA 3BXWA 3IKDA 2PPNA 3KCEA 1LG1A 4FAPA 5HWBA 3ARSA 4JFKA 4MAVA 2MLZA 5DEZA 4GIVA 4MNMA 1ZU8A 2MNTA 1JNSA 1Y0OA 1JCHB 2PV2A 4DRKA 2A3AA 1X6LA 5DF0A 5B8IC 1FKTA 1YATA 3TCZA 1QPFA 4WIWA 2ITKA 2WK2A 1GPFA 4ODLA 5D75A 5HBFA 3O5EA 3JXVA 2A3EA 3ARQA 3ARPA 1XRVA 1Q6IA 5JH8A 2LKNA 2RSEA 4MTVA 1ZBWA 1VF8A 2XP9A 3O5JA 4QT2A 2PPOA 2JZVA 1OGGA 2N87A 3UF8A 1HKIA 1FKLA 1KFWA 1E9LA 4QIBA 1ZBKA 3CHEA 4U86A 1HXVA 3B7XA 3WD0A 2DT3A 3KAIA 4ITZA 1W9VA 2FKEA 2RURA 3ODKA 1J6YA 3LUOA 5GQBA 1EQ3A 1C9HA 2IUZA 3AS3A 4DWSC 4MPKA 1FKSA 4ODKA 2DPEA 2DSWA 5HTGA 4IT4A 1HKJA 3WIJA 1B6CA 3WQWA 3UQAA 1FKDA 3PA7A 4DRQA 2PV1A 4L3NA 3AQUA 4WKFA 1FKKA 1UR9A 4KR0B 1HKKA 2ETNA 2LJ4A 2PBCA 1FKIA 2B5UB 2B31A 2ZQTA 3GU0A 4MNJA 2F21A 3VAWA 3WD1A 4W9QA 3IHZA 1FKJA 4TX0A 5HKGA 4TYOA 1ZK6A 1W9UA 3UI5A 5GPGA 1W1TA 2L2SA 4QZVB 3WD2A 2RUCA 1WNOA 3NTPA 4TW8A 4ODPA 3QOKA 4HBOA 5HW6A 4DRMA 1NSGA 2DT0A 4DZ2A 1F40A 3O5RA 1P5QA 1F8AB 3ARRA 3OA5A 3TDBA 2XP8A 3AROA 4BF8A 1FAPA 3ARXA 4ZS6A 2XPAA 4WKAA 1N1AA 1D7HA 2LPVA 3ARUA 4TW6A 1CTNA 1SYTA 3O5QA 4LAWA 2DSUA 2UZ5A 3RM9A 1ITXA 1FFQA 1ZBCA 2DG3A 3RFWA 3ALGA 1ZB5A 2DG9A 3UQIA 1LL6A 1JNEA 1D6OA 4W9PA 3RMEA 4IPXA 3ARYA 4QT3A 2KR7A 1LL4A 2PN0A 2IF4A 2EULA 4XAKA 1KT1A 2WLZA 1UR8A 1NMWA 2DSZA 4GGQA 1A7XA 3JYJA 2PV3A 4IQ2A 4N19A 3JYMA 1K9TA 4URIA 2RUQA 4Q7NA 4MNKA 4DWSA 1LL7A 3CH9A 4WK9A 5DITA 1D7IA 1M5YA 4U84A 1EHNA 4DRHA 2Q5AA 2VN1A 1JVWA 1NWRA 4W5UA 4DT4A 2DT1A 1Q6UA 1ZBVA 1HJWA 5GPRA 5HT1A 4S3JA 2MLYA 4DRIA 2RQSA 1EDQA 4DRNA 4UDMA 1W1VA 1ZL1A 3RM8A 3NRKA 1IX5A 1W9PA 4MNLA 2XP6A 3CGNA 4IQCA 1NWTA 2ESCA 2KI3A 4KQZA 1E6ZA 4Z2KA 3WQVA 1ZCNA 1LQ0A 1T11A 1XHGA 4AY1A 3I6CA 4L72B 4HBEA 4ZPWR 2AOSA 1D7JA 2ZQSA 1FD9A 1NH6A 2ZQUA 4R0XA 3CHDA 4JFIA 3WL1A 4P8XA 3UQBA 2M08A 4NZCA 1NMVA 2Y78A 3G6MA
chains in the Genus database with same CATH topology
3KADA 2F4EA 1NWUA 3ARTA 1WAWA 2RUDA 3O5KA 2MLXA 3O5PA 1QPLA 2FDMA 3WKZA 4S3KA 4Z2JA 1FKRA 2AWGA 2DG4A 3B9EA 3GPKA 3KAHA 1U79A 1PINA 1W1YA 2M2AA 3B9DA 2O9OA 1E6NA 4Q22A 3WL0A 2XP4A 3B8SA 4DIPA 3WD4A 1HJXA 3CZ8A 2MPHA 4LAYA 2DSVA 1SR0A 1R9HA 1FKBA 2A3BA 2G8ZA 1LJYA 3CGMA 2M1IA 4FN2A 4ODMA 3OOBA 4WKHA 3IKGA 3NI6A 1E6RA 4LAXA 4PTMA 4ZPVR 4HARA 4W9OA 4JFJA 2K8IA 2G41A 1TCOC 3KAFA 2VCDA 3ALFA 1GOIA 1FKHA 2YBTA 3ARWA 3B9AA 4DWSB 2KGJA 4NSBA 1FFRA 3H9RB 3ARVA 5HUAA 3KAGA 5DIUA 1O6IA 1X6NA 1QZ2A 3PRAA 3FAPA 3KZ7A 2WM0A 1OWQA 3ARZA 4DZ3A 3AS2A 4DRPA 4C02B 2KFWA 4ML4A 2WLYA 4LAVA 2OFNA 4G50A 2MF9A 1TFVA 5BXJA 3G6LA 1H0GA 4J4NA 4DWSD 4LGXA 4TW7A 3O5LA 3O5DA 4ODQA 4DH0A 3O5IA 3FY1A 1ROTA 1J4IA 2ZR4A 1KT0A 1J4RA 1FJDA 3CHFA 4G2PA 1ROUA 4JFMA 4ODOA 3KACA 2ZR6A 1EYMA 3WH0A 2LGOA 4WJXA 4Z2LA 2OLHA 1HKMA 4Z2GA 3O5MA 3AS1A 2XP3A 4JFLA 1PBKA 1FKFA 5I98A 3O5OA 1GUVA 1E6PA 1JNDA 2D9FA 4P8VA 2XP7A 4TNSA 1NWSA 3AS0A 1FKGA 1D2KA 1H0IA 5HW8A 2PI6A 5DIVA 4J4OA 3PR9A 3FXYA 1L1PA 1E15A 4MGVA 3UI6A 3IK8A 2ZR5A 3O5FA 1EIBA 3WD3A 1Q6HA 2KO7A 2QF8A 2XPBA 3KABA 4ODRA 4Z2IA 4O2TA 1OGBA 1WB0A 3PRDA 1W26A 3CHCA 2A3CA 4JYSA 1J4HA 5HW7A 2PPPA 3UI4A 4DRJA 5J6EA 3O5GA 4ODNA 1HJVA 1BL4A 1RD6A 3EY6A 2XP5A 3RM4A 2O92A 2ZQVA 3W4RA 1W1PA 2FAPA 4Z2HA 4NNRA 2YBUA 2DT2A 5HWCA 1BKFA 4MSPA 3RGCA 3TC5A 1LG2A 4R5EA 4P8WA 1JNTA 1Q1CA 2KE0A 3PRBA 2F2DA 5DO2A 4DROA 4U85A 4IT6A 4ZPTR 3MDYB 1YW5A 4P8UA 3BXWA 3IKDA 2PPNA 3KCEA 1LG1A 4FAPA 5HWBA 3ARSA 4JFKA 4MAVA 2MLZA 5DEZA 4GIVA 4MNMA 1ZU8A 2MNTA 1JNSA 1Y0OA 2PV2A 4DRKA 2A3AA 1X6LA 5DF0A 5B8IC 1FKTA 1YATA 3TCZA 1QPFA 4WIWA 2ITKA 2WK2A 1GPFA 4ODLA 5D75A 5HBFA 3O5EA 3JXVA 2A3EA 3ARQA 3ARPA 1XRVA 1Q6IA 5JH8A 2LKNA 2RSEA 4MTVA 1ZBWA 1VF8A 2XP9A 3O5JA 4QT2A 2PPOA 2JZVA 1OGGA 2N87A 3UF8A 1HKIA 1FKLA 1KFWA 1E9LA 4QIBA 1ZBKA 3CHEA 4U86A 1HXVA 3B7XA 3WD0A 2DT3A 3KAIA 4ITZA 1W9VA 2FKEA 2RURA 3ODKA 1J6YA 3LUOA 5GQBA 1EQ3A 1C9HA 2IUZA 3AS3A 4DWSC 4MPKA 1FKSA 4ODKA 2DPEA 2DSWA 5HTGA 4IT4A 1HKJA 3WIJA 1B6CA 3WQWA 3UQAA 1FKDA 3PA7A 4DRQA 2PV1A 4L3NA 3AQUA 4WKFA 1FKKA 1UR9A 4KR0B 1HKKA 2LJ4A 2PBCA 1FKIA 2B31A 2ZQTA 4MNJA 2F21A 3VAWA 3WD1A 4W9QA 3IHZA 1FKJA 4TX0A 5HKGA 4TYOA 1ZK6A 1W9UA 3UI5A 5GPGA 1W1TA 2L2SA 4QZVB 3WD2A 2RUCA 1WNOA 3NTPA 4TW8A 4ODPA 3QOKA 4HBOA 5HW6A 4DRMA 1NSGA 2DT0A 4DZ2A 1F40A 3O5RA 1P5QA 1F8AB 3ARRA 3OA5A 3TDBA 2XP8A 3AROA 4BF8A 1FAPA 3ARXA 4ZS6A 2XPAA 4WKAA 1N1AA 1D7HA 2LPVA 3ARUA 4TW6A 1CTNA 1SYTA 3O5QA 4LAWA 2DSUA 2UZ5A 3RM9A 1ITXA 1FFQA 1ZBCA 2DG3A 3RFWA 3ALGA 1ZB5A 2DG9A 3UQIA 1LL6A 1JNEA 1D6OA 4W9PA 3RMEA 4IPXA 3ARYA 4QT3A 2KR7A 1LL4A 2IF4A 4XAKA 1KT1A 2WLZA 1UR8A 1NMWA 2DSZA 4GGQA 1A7XA 3JYJA 2PV3A 4IQ2A 4N19A 3JYMA 1K9TA 4URIA 2RUQA 4Q7NA 4MNKA 4DWSA 1LL7A 3CH9A 4WK9A 5DITA 1D7IA 1M5YA 4U84A 1EHNA 4DRHA 2Q5AA 2VN1A 1JVWA 1NWRA 4W5UA 4DT4A 2DT1A 1Q6UA 1ZBVA 1HJWA 5GPRA 5HT1A 4S3JA 2MLYA 4DRIA 2RQSA 1EDQA 4DRNA 1W1VA 1ZL1A 3RM8A 3NRKA 1IX5A 1W9PA 4MNLA 2XP6A 3CGNA 4IQCA 1NWTA 2ESCA 2KI3A 4KQZA 1E6ZA 4Z2KA 3WQVA 1ZCNA 1LQ0A 1T11A 1XHGA 4AY1A 3I6CA 4L72B 4HBEA 4ZPWR 2AOSA 1D7JA 2ZQSA 1FD9A 1NH6A 2ZQUA 4R0XA 3CHDA 4JFIA 3WL1A 4P8XA 3UQBA 2M08A 4NZCA 1NMVA 2Y78A 3G6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCZ A;  3KAD A;  1QPF A;  4G2P A;  1ROU A;  2F4E A;  2ITK A;  3TDB A;  4JFM A;  4ODL A;  5D75 A;  2XP8 A;  2RUD A;  4ODO A;  3KAC A;  2ZR6 A;  3O5E A;  3O5K A;  1EYM A;  2MLX A;  4BF8 A;  3O5P A;  1QPL A;  3JXV A;  3WH0 A;  1FAP A;  1Q6I A;  2LGO A;  1FKR A;  2XPA A;  2LKN A;  1N1A A;  1D7H A;  2AWG A;  2LPV A;  2RSE A;  4TW6 A;  3O5M A;  2XP3 A;  3O5Q A;  4JFL A;  2DG4 A;  1PBK A;  1FKF A;  2XP9 A;  3GPK A;  3KAH A;  5I98 A;  1U79 A;  1PIN A;  3O5J A;  2M2A A;  2UZ5 A;  3O5O A;  2PPO A;  4LAW A;  4QT2 A;  2JZV A;  2DG3 A;  3RFW A;  2D9F A;  2XP4 A;  2N87 A;  3UF8 A;  2XP7 A;  1FKL A;  2DG9 A;  4TNS A;  4QIB A;  4DIP A;  3UQI A;  4U86 A;  1HXV A;  1FKG A;  2MPH A;  5HW8 A;  3B7X A;  1D6O A;  4W9P A;  5DIV A;  4LAY A;  4IPX A;  4QT3 A;  4J4O A;  2KR7 A;  1R9H A;  3KAI A;  1FKB A;  4ITZ A;  1L1P A;  4MGV A;  2RUR A;  2FKE A;  3IK8 A;  3ODK A;  3UI6 A;  2IF4 A;  1KT1 A;  2ZR5 A;  3O5F A;  3CGM A;  2M1I A;  4FN2 A;  4ODM A;  3OOB A;  1J6Y A;  1Q6H A;  3LUO A;  1EQ3 A;  2KO7 A;  1NMW A;  1C9H A;  3IKG A;  3NI6 A;  4GGQ A;  1FKS A;  2XPB A;  3KAB A;  1A7X A;  3JYJ A;  4ODR A;  4ODK A;  4LAX A;  4O2T A;  2PV3 A;  3PRD A;  1W26 A;  4IQ2 A;  4JFJ A;  4N19 A;  3JYM A;  4W9O A;  2K8I A;  2RUQ A;  5HTG A;  1TCO C;  4JYS A;  1J4H A;  5HW7 A;  3KAF A;  2PPP A;  3UI4 A;  4DRJ A;  2VCD A;  5J6E A;  3O5G A;  1B6C A;  4ODN A;  1FKH A;  1BL4 A;  3UQA A;  1FKD A;  3EY6 A;  3PA7 A;  2XP5 A;  4DRQ A;  5DIT A;  1D7I A;  2PV1 A;  2KGJ A;  1M5Y A;  4U84 A;  2ZQV A;  4DRH A;  2Q5A A;  2VN1 A;  1JVW A;  1FKK A;  2FAP A;  3H9R B;  4DT4 A;  4NNR A;  1Q6U A;  5HT1 A;  5HWC A;  5HUA A;  1BKF A;  2LJ4 A;  4MSP A;  3RGC A;  2MLY A;  3KAG A;  2PBC A;  5DIU A;  3TC5 A;  2RQS A;  1JNT A;  1Q1C A;  4DRI A;  4DRN A;  1FKI A;  2KE0 A;  3PRB A;  2F2D A;  4DRO A;  1QZ2 A;  4U85 A;  3FAP A;  3KZ7 A;  3NRK A;  2ZQT A;  4DZ3 A;  4DRP A;  4C02 B;  2KFW A;  2XP6 A;  3CGN A;  4IQC A;  2F21 A;  3VAW A;  2KI3 A;  4LAV A;  4W9Q A;  3IHZ A;  2OFN A;  3MDY B;  1ZCN A;  1YW5 A;  4G50 A;  2MF9 A;  1FKJ A;  4TX0 A;  3IKD A;  1T11 A;  2PPN A;  5HKG A;  4TYO A;  3KCE A;  1ZK6 A;  5BXJ A;  3I6C A;  4J4N A;  3UI5 A;  5GPG A;  4FAP A;  2L2S A;  3O5L A;  3O5D A;  4TW7 A;  5HWB A;  4JFK A;  1D7J A;  2MLZ A;  2ZQS A;  2RUC A;  3NTP A;  4GIV A;  1FD9 A;  4ODQ A;  4TW8 A;  4ODP A;  4DH0 A;  2MNT A;  3O5I A;  1JNS A;  1Y0O A;  2ZQU A;  4R0X A;  5HW6 A;  2PV2 A;  1ROT A;  1J4I A;  2ZR4 A;  4JFI A;  4DRK A;  4DRM A;  1KT0 A;  1NSG A;  3UQB A;  2M08 A;  1J4R A;  4DZ2 A;  1FKT A;  1NMV A;  2Y78 A;  3O5R A;  1P5Q A;  5B8I C;  1F40 A;  1YAT A;  1F8A B;  1FJD A; 
#chains in the Genus database with same CATH topology
 3KAD A;  2F4E A;  1NWU A;  3ART A;  1WAW A;  2RUD A;  3O5K A;  2MLX A;  3O5P A;  1QPL A;  2FDM A;  3WKZ A;  4S3K A;  4Z2J A;  1FKR A;  2AWG A;  2DG4 A;  3B9E A;  3GPK A;  3KAH A;  1U79 A;  1PIN A;  1W1Y A;  2M2A A;  3B9D A;  2O9O A;  1E6N A;  4Q22 A;  3WL0 A;  2XP4 A;  3B8S A;  4DIP A;  3WD4 A;  1HJX A;  3CZ8 A;  2MPH A;  4LAY A;  2DSV A;  1SR0 A;  1R9H A;  1FKB A;  1GRJ A;  2A3B A;  2G8Z A;  1E44 A;  1LJY A;  3CGM A;  2M1I A;  4FN2 A;  4ODM A;  3OOB A;  4WKH A;  3IKG A;  3NI6 A;  1E6R A;  4LAX A;  4PTM A;  4ZPV R;  4HAR A;  4W9O A;  4JFJ A;  2K8I A;  2G41 A;  1TCO C;  3KAF A;  2VCD A;  3ALF A;  1GOI A;  1FKH A;  2YBT A;  3ARW A;  3B9A A;  4DWS B;  2KGJ A;  4NSB A;  1FFR A;  3H9R B;  3ARV A;  5HUA A;  3KAG A;  5DIU A;  1O6I A;  1X6N A;  1QZ2 A;  3PRA A;  3FAP A;  3KZ7 A;  2WM0 A;  1OWQ A;  3ARZ A;  4DZ3 A;  3AS2 A;  4DRP A;  4C02 B;  2KFW A;  4ML4 A;  2WLY A;  4LAV A;  2OFN A;  4G50 A;  2MF9 A;  1TFV A;  5BXJ A;  3G6L A;  1H0G A;  4J4N A;  4DWS D;  4LGX A;  4TW7 A;  3O5L A;  3O5D A;  4ODQ A;  4DH0 A;  3O5I A;  3GTY X;  3FY1 A;  1ROT A;  1J4I A;  2ZR4 A;  1KT0 A;  1J4R A;  2P4V A;  1FJD A;  3CHF A;  4G2P A;  1ROU A;  2F23 A;  4JFM A;  4ODO A;  3KAC A;  2ZR6 A;  1EYM A;  3WH0 A;  2LGO A;  4WJX A;  4Z2L A;  2OLH A;  1HKM A;  4Z2G A;  3O5M A;  3AS1 A;  2XP3 A;  4JFL A;  1PBK A;  1FKF A;  5I98 A;  3O5O A;  1GUV A;  1E6P A;  1JND A;  2D9F A;  4P8V A;  2XP7 A;  3BMB A;  4TNS A;  1NWS A;  3AS0 A;  1FKG A;  1D2K A;  1H0I A;  5HW8 A;  2PI6 A;  5DIV A;  4J4O A;  3PR9 A;  3FXY A;  1L1P A;  1E15 A;  4MGV A;  3UI6 A;  3IK8 A;  2ZR5 A;  3O5F A;  1EIB A;  3WD3 A;  1Q6H A;  2KO7 A;  2QF8 A;  2XPB A;  3KAB A;  4ODR A;  4Z2I A;  4O2T A;  1OGB A;  1WB0 A;  3PRD A;  1W26 A;  3CHC A;  2A3C A;  4JYS A;  1J4H A;  5HW7 A;  3EIP A;  2PPP A;  3UI4 A;  4DRJ A;  5J6E A;  3O5G A;  4ODN A;  1HJV A;  1BL4 A;  1RD6 A;  3EY6 A;  2XP5 A;  3RM4 A;  2O92 A;  2ZQV A;  3W4R A;  1W1P A;  2FAP A;  4Z2H A;  4NNR A;  2YBU A;  2DT2 A;  5HWC A;  1BKF A;  4MSP A;  3RGC A;  3TC5 A;  1LG2 A;  4R5E A;  4P8W A;  1JNT A;  1Q1C A;  2KE0 A;  3PRB A;  2F2D A;  5DO2 A;  4DRO A;  4U85 A;  4IT6 A;  4ZPT R;  3MDY B;  1YW5 A;  4P8U A;  3BXW A;  3IKD A;  2PPN A;  3KCE A;  1LG1 A;  4FAP A;  5HWB A;  3ARS A;  4JFK A;  4MAV A;  2MLZ A;  5DEZ A;  4GIV A;  4MNM A;  1ZU8 A;  2MNT A;  1JNS A;  1Y0O A;  1JCH B;  2PV2 A;  4DRK A;  2A3A A;  1X6L A;  5DF0 A;  5B8I C;  1FKT A;  1YAT A;  3TCZ A;  1QPF A;  4WIW A;  2ITK A;  2WK2 A;  1GPF A;  4ODL A;  5D75 A;  5HBF A;  3O5E A;  3JXV A;  2A3E A;  3ARQ A;  3ARP A;  1XRV A;  1Q6I A;  5JH8 A;  2LKN A;  2RSE A;  4MTV A;  1ZBW A;  1VF8 A;  2XP9 A;  3O5J A;  4QT2 A;  2PPO A;  2JZV A;  1OGG A;  2N87 A;  3UF8 A;  1HKI A;  1FKL A;  1KFW A;  1E9L A;  4QIB A;  1ZBK A;  3CHE A;  4U86 A;  1HXV A;  3B7X A;  3WD0 A;  2DT3 A;  3KAI A;  4ITZ A;  1W9V A;  2FKE A;  2RUR A;  3ODK A;  1J6Y A;  3LUO A;  5GQB A;  1EQ3 A;  1C9H A;  2IUZ A;  3AS3 A;  4DWS C;  4MPK A;  1FKS A;  4ODK A;  2DPE A;  2DSW A;  5HTG A;  4IT4 A;  1HKJ A;  3WIJ A;  1B6C A;  3WQW A;  3UQA A;  1FKD A;  3PA7 A;  4DRQ A;  2PV1 A;  4L3N A;  3AQU A;  4WKF A;  1FKK A;  1UR9 A;  4KR0 B;  1HKK A;  2ETN A;  2LJ4 A;  2PBC A;  1FKI A;  2B5U B;  2B31 A;  2ZQT A;  3GU0 A;  4MNJ A;  2F21 A;  3VAW A;  3WD1 A;  4W9Q A;  3IHZ A;  1FKJ A;  4TX0 A;  5HKG A;  4TYO A;  1ZK6 A;  1W9U A;  3UI5 A;  5GPG A;  1W1T A;  2L2S A;  4QZV B;  3WD2 A;  2RUC A;  1WNO A;  3NTP A;  4TW8 A;  4ODP A;  3QOK A;  4HBO A;  5HW6 A;  4DRM A;  1NSG A;  2DT0 A;  4DZ2 A;  1F40 A;  3O5R A;  1P5Q A;  1F8A B;  3ARR A;  3OA5 A;  3TDB A;  2XP8 A;  3ARO A;  4BF8 A;  1FAP A;  3ARX A;  4ZS6 A;  2XPA A;  4WKA A;  1N1A A;  1D7H A;  2LPV A;  3ARU A;  4TW6 A;  1CTN A;  1SYT A;  3O5Q A;  4LAW A;  2DSU A;  2UZ5 A;  3RM9 A;  1ITX A;  1FFQ A;  1ZBC A;  2DG3 A;  3RFW A;  3ALG A;  1ZB5 A;  2DG9 A;  3UQI A;  1LL6 A;  1JNE A;  1D6O A;  4W9P A;  3RME A;  4IPX A;  3ARY A;  4QT3 A;  2KR7 A;  1LL4 A;  2PN0 A;  2IF4 A;  2EUL A;  4XAK A;  1KT1 A;  2WLZ A;  1UR8 A;  1NMW A;  2DSZ A;  4GGQ A;  1A7X A;  3JYJ A;  2PV3 A;  4IQ2 A;  4N19 A;  3JYM A;  1K9T A;  4URI A;  2RUQ A;  4Q7N A;  4MNK A;  4DWS A;  1LL7 A;  3CH9 A;  4WK9 A;  5DIT A;  1D7I A;  1M5Y A;  4U84 A;  1EHN A;  4DRH A;  2Q5A A;  2VN1 A;  1JVW A;  1NWR A;  4W5U A;  4DT4 A;  2DT1 A;  1Q6U A;  1ZBV A;  1HJW A;  5GPR A;  5HT1 A;  4S3J A;  2MLY A;  4DRI A;  2RQS A;  1EDQ A;  4DRN A;  4UDM A;  1W1V A;  1ZL1 A;  3RM8 A;  3NRK A;  1IX5 A;  1W9P A;  4MNL A;  2XP6 A;  3CGN A;  4IQC A;  1NWT A;  2ESC A;  2KI3 A;  4KQZ A;  1E6Z A;  4Z2K A;  3WQV A;  1ZCN A;  1LQ0 A;  1T11 A;  1XHG A;  4AY1 A;  3I6C A;  4L72 B;  4HBE A;  4ZPW R;  2AOS A;  1D7J A;  2ZQS A;  1FD9 A;  1NH6 A;  2ZQU A;  4R0X A;  3CHD A;  4JFI A;  3WL1 A;  4P8X A;  3UQB A;  2M08 A;  4NZC A;  1NMV A;  2Y78 A;  3G6M A; 
#chains in the Genus database with same CATH homology
 3KAD A;  2F4E A;  1NWU A;  3ART A;  1WAW A;  2RUD A;  3O5K A;  2MLX A;  3O5P A;  1QPL A;  2FDM A;  3WKZ A;  4S3K A;  4Z2J A;  1FKR A;  2AWG A;  2DG4 A;  3B9E A;  3GPK A;  3KAH A;  1U79 A;  1PIN A;  1W1Y A;  2M2A A;  3B9D A;  2O9O A;  1E6N A;  4Q22 A;  3WL0 A;  2XP4 A;  3B8S A;  4DIP A;  3WD4 A;  1HJX A;  3CZ8 A;  2MPH A;  4LAY A;  2DSV A;  1SR0 A;  1R9H A;  1FKB A;  2A3B A;  2G8Z A;  1LJY A;  3CGM A;  2M1I A;  4FN2 A;  4ODM A;  3OOB A;  4WKH A;  3IKG A;  3NI6 A;  1E6R A;  4LAX A;  4PTM A;  4ZPV R;  4HAR A;  4W9O A;  4JFJ A;  2K8I A;  2G41 A;  1TCO C;  3KAF A;  2VCD A;  3ALF A;  1GOI A;  1FKH A;  2YBT A;  3ARW A;  3B9A A;  4DWS B;  2KGJ A;  4NSB A;  1FFR A;  3H9R B;  3ARV A;  5HUA A;  3KAG A;  5DIU A;  1O6I A;  1X6N A;  1QZ2 A;  3PRA A;  3FAP A;  3KZ7 A;  2WM0 A;  1OWQ A;  3ARZ A;  4DZ3 A;  3AS2 A;  4DRP A;  4C02 B;  2KFW A;  4ML4 A;  2WLY A;  4LAV A;  2OFN A;  4G50 A;  2MF9 A;  1TFV A;  5BXJ A;  3G6L A;  1H0G A;  4J4N A;  4DWS D;  4LGX A;  4TW7 A;  3O5L A;  3O5D A;  4ODQ A;  4DH0 A;  3O5I A;  3FY1 A;  1ROT A;  1J4I A;  2ZR4 A;  1KT0 A;  1J4R A;  1FJD A;  3CHF A;  4G2P A;  1ROU A;  4JFM A;  4ODO A;  3KAC A;  2ZR6 A;  1EYM A;  3WH0 A;  2LGO A;  4WJX A;  4Z2L A;  2OLH A;  1HKM A;  4Z2G A;  3O5M A;  3AS1 A;  2XP3 A;  4JFL A;  1PBK A;  1FKF A;  5I98 A;  3O5O A;  1GUV A;  1E6P A;  1JND A;  2D9F A;  4P8V A;  2XP7 A;  4TNS A;  1NWS A;  3AS0 A;  1FKG A;  1D2K A;  1H0I A;  5HW8 A;  2PI6 A;  5DIV A;  4J4O A;  3PR9 A;  3FXY A;  1L1P A;  1E15 A;  4MGV A;  3UI6 A;  3IK8 A;  2ZR5 A;  3O5F A;  1EIB A;  3WD3 A;  1Q6H A;  2KO7 A;  2QF8 A;  2XPB A;  3KAB A;  4ODR A;  4Z2I A;  4O2T A;  1OGB A;  1WB0 A;  3PRD A;  1W26 A;  3CHC A;  2A3C A;  4JYS A;  1J4H A;  5HW7 A;  2PPP A;  3UI4 A;  4DRJ A;  5J6E A;  3O5G A;  4ODN A;  1HJV A;  1BL4 A;  1RD6 A;  3EY6 A;  2XP5 A;  3RM4 A;  2O92 A;  2ZQV A;  3W4R A;  1W1P A;  2FAP A;  4Z2H A;  4NNR A;  2YBU A;  2DT2 A;  5HWC A;  1BKF A;  4MSP A;  3RGC A;  3TC5 A;  1LG2 A;  4R5E A;  4P8W A;  1JNT A;  1Q1C A;  2KE0 A;  3PRB A;  2F2D A;  5DO2 A;  4DRO A;  4U85 A;  4IT6 A;  4ZPT R;  3MDY B;  1YW5 A;  4P8U A;  3BXW A;  3IKD A;  2PPN A;  3KCE A;  1LG1 A;  4FAP A;  5HWB A;  3ARS A;  4JFK A;  4MAV A;  2MLZ A;  5DEZ A;  4GIV A;  4MNM A;  1ZU8 A;  2MNT A;  1JNS A;  1Y0O A;  2PV2 A;  4DRK A;  2A3A A;  1X6L A;  5DF0 A;  5B8I C;  1FKT A;  1YAT A;  3TCZ A;  1QPF A;  4WIW A;  2ITK A;  2WK2 A;  1GPF A;  4ODL A;  5D75 A;  5HBF A;  3O5E A;  3JXV A;  2A3E A;  3ARQ A;  3ARP A;  1XRV A;  1Q6I A;  5JH8 A;  2LKN A;  2RSE A;  4MTV A;  1ZBW A;  1VF8 A;  2XP9 A;  3O5J A;  4QT2 A;  2PPO A;  2JZV A;  1OGG A;  2N87 A;  3UF8 A;  1HKI A;  1FKL A;  1KFW A;  1E9L A;  4QIB A;  1ZBK A;  3CHE A;  4U86 A;  1HXV A;  3B7X A;  3WD0 A;  2DT3 A;  3KAI A;  4ITZ A;  1W9V A;  2FKE A;  2RUR A;  3ODK A;  1J6Y A;  3LUO A;  5GQB A;  1EQ3 A;  1C9H A;  2IUZ A;  3AS3 A;  4DWS C;  4MPK A;  1FKS A;  4ODK A;  2DPE A;  2DSW A;  5HTG A;  4IT4 A;  1HKJ A;  3WIJ A;  1B6C A;  3WQW A;  3UQA A;  1FKD A;  3PA7 A;  4DRQ A;  2PV1 A;  4L3N A;  3AQU A;  4WKF A;  1FKK A;  1UR9 A;  4KR0 B;  1HKK A;  2LJ4 A;  2PBC A;  1FKI A;  2B31 A;  2ZQT A;  4MNJ A;  2F21 A;  3VAW A;  3WD1 A;  4W9Q A;  3IHZ A;  1FKJ A;  4TX0 A;  5HKG A;  4TYO A;  1ZK6 A;  1W9U A;  3UI5 A;  5GPG A;  1W1T A;  2L2S A;  4QZV B;  3WD2 A;  2RUC A;  1WNO A;  3NTP A;  4TW8 A;  4ODP A;  3QOK A;  4HBO A;  5HW6 A;  4DRM A;  1NSG A;  2DT0 A;  4DZ2 A;  1F40 A;  3O5R A;  1P5Q A;  1F8A B;  3ARR A;  3OA5 A;  3TDB A;  2XP8 A;  3ARO A;  4BF8 A;  1FAP A;  3ARX A;  4ZS6 A;  2XPA A;  4WKA A;  1N1A A;  1D7H A;  2LPV A;  3ARU A;  4TW6 A;  1CTN A;  1SYT A;  3O5Q A;  4LAW A;  2DSU A;  2UZ5 A;  3RM9 A;  1ITX A;  1FFQ A;  1ZBC A;  2DG3 A;  3RFW A;  3ALG A;  1ZB5 A;  2DG9 A;  3UQI A;  1LL6 A;  1JNE A;  1D6O A;  4W9P A;  3RME A;  4IPX A;  3ARY A;  4QT3 A;  2KR7 A;  1LL4 A;  2IF4 A;  4XAK A;  1KT1 A;  2WLZ A;  1UR8 A;  1NMW A;  2DSZ A;  4GGQ A;  1A7X A;  3JYJ A;  2PV3 A;  4IQ2 A;  4N19 A;  3JYM A;  1K9T A;  4URI A;  2RUQ A;  4Q7N A;  4MNK A;  4DWS A;  1LL7 A;  3CH9 A;  4WK9 A;  5DIT A;  1D7I A;  1M5Y A;  4U84 A;  1EHN A;  4DRH A;  2Q5A A;  2VN1 A;  1JVW A;  1NWR A;  4W5U A;  4DT4 A;  2DT1 A;  1Q6U A;  1ZBV A;  1HJW A;  5GPR A;  5HT1 A;  4S3J A;  2MLY A;  4DRI A;  2RQS A;  1EDQ A;  4DRN A;  1W1V A;  1ZL1 A;  3RM8 A;  3NRK A;  1IX5 A;  1W9P A;  4MNL A;  2XP6 A;  3CGN A;  4IQC A;  1NWT A;  2ESC A;  2KI3 A;  4KQZ A;  1E6Z A;  4Z2K A;  3WQV A;  1ZCN A;  1LQ0 A;  1T11 A;  1XHG A;  4AY1 A;  3I6C A;  4L72 B;  4HBE A;  4ZPW R;  2AOS A;  1D7J A;  2ZQS A;  1FD9 A;  1NH6 A;  2ZQU A;  4R0X A;  3CHD A;  4JFI A;  3WL1 A;  4P8X A;  3UQB A;  2M08 A;  4NZC A;  1NMV A;  2Y78 A;  3G6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...