4JFMA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 2-(3,4-dimethoxyphenoxy)ethyl (2s)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfmA00
2F4EA 3O5JA 3WH0A 4J4NA 2XP6A 1D6OA 2ZQUA 4LAYA 3PA7A 4NNRA 3KAIA 1FKIA 2MLYA 2ZR6A 1Q6HA 2DG4A 4ODNA 1Q6IA 3O5MA 4U84A 1ROUA 1W26A 1FKKA 2F2DA 1NMWA 3O5GA 4ODRA 2KGJA 2KO7A 1FAPA 4N19A 4QIBA 1N1AA 4MSPA 4MGVA 1J6YA 4JFLA 2IF4A 4JYSA 4U86A 1FKJA 2ITKA 3O5EA 2N87A 2XP4A 3TCZA 3UF8A 1YW5A 2AWGA 3IK8A 4GIVA 2LPVA 2KI3A 2KE0A 4ODQA 3KADA 5HUAA 3NRKA 4ITZA 5B8IC 4ODOA 3KAGA 3NTPA 5DIVA 1FKRA 2PV3A 1B6CA 1NMVA 2PPOA 2PPPA 1D7IA 3O5DA 1ZK6A 1FJDA 1PBKA 2LKNA 4DRMA 5HW6A 4IQ2A 4W9QA 2DG3A 4W9PA 3TDBA 3CGNA 5DITA 4FAPA 1J4IA 3IKGA 3VAWA 3O5QA 1P5QA 2K8IA 5HT1A 3IHZA 4DRNA 3KZ7A 4IPXA 3RFWA 1JNSA 4U85A 2JZVA 3O5PA 3B7XA 4ODLA 2DG9A 4DRJA 4ODKA 1FD9A 1FKBA 3LUOA 4JFIA 2RUQA 3PRBA 1R9HA 1KT1A 5HW8A 1FKTA 3JXVA 2XP3A 4R0XA 4O2TA 3UI5A 3I6CA 4TW8A 3UQIA 1C9HA 4DROA 1F40A 2XPAA 4J4OA 3PRDA 1JVWA 1M5YA 1PINA 1EQ3A 4DZ2A 1FKLA 4FN2A 2VN1A 2MLZA 2OFNA 2F21A 2D9FA 2PV1A 3O5FA 4LAXA 4DRHA 3KABA 5BXJA 1ZCNA 3UQBA 3GPKA 4DRKA 4G2PA 1Q6UA 4TNSA 1NSGA 2ZR4A 2M1IA 2XPBA 3KACA 4TYOA 1HXVA 4DIPA 2KFWA 1BL4A 4QT3A 2RSEA 5HWBA 4TW6A 3H9RB 1FKDA 3KAHA 1T11A 5HWCA 2MLXA 1EYMA 1QZ2A 2ZQSA 4G50A 2MPHA 3O5RA 1FKGA 1QPLA 1A7XA 1Q1CA 3IKDA 3TC5A 1QPFA 4LAVA 2LGOA 2UZ5A 5D75A 2FKEA 2PBCA 3UQAA 2LJ4A 4QT2A 4GGQA 2RUCA 2ZQTA 2L2SA 2VCDA 2KR7A 1FKHA 2MNTA 2XP9A 4ODPA 1U79A 1TCOC 3UI4A 4DRIA 4DRPA 3O5LA 5HW7A 4LAWA 2RUDA 1JNTA 3JYMA 1FKFA 4C02B 3O5KA 1L1PA 2Y78A 3KCEA 1BKFA 2Q5AA 2ZQVA 4DT4A 1FKSA 4W9OA 1KT0A 3NI6A 2PV2A 3KAFA 2ZR5A 4IQCA 1ROTA 2MF9A 4TW7A 1F8AB 4DH0A 4DRQA 3O5OA 3JYJA 1D7JA 3MDYB 2M08A 4ODMA 5J6EA 2M2AA 5HTGA 4BF8A 3CGMA 3FAPA 5DIUA 4JFMA 3OOBA 3UI6A 5HKGA 2RQSA 2PPNA 1Y0OA 1YATA 3EY6A 5GPGA 1D7HA 1J4HA 1J4RA 3O5IA 2XP7A 3ODKA 2FAPA 2RURA 5I98A 4JFKA 3RGCA 2XP8A 4JFJA 2XP5A 4DZ3A 4TX0A
chains in the Genus database with same CATH superfamily
2F4EA 3B9DA 2QF8A 1D6OA 2MLYA 3G6MA 2A3EA 2G8ZA 3ARTA 2PN0A 1FKKA 4ODRA 1ZBCA 4N19A 1E6PA 1FAPA 2O92A 2IF4A 1W1VA 2B31A 3ALFA 1W9VA 2ITKA 3B9AA 3TCZA 2A3BA 4ODQA 3NRKA 4ITZA 5DIVA 4Q7NA 1B6CA 1NMVA 4DRMA 2B5UB 1NWTA 2DT1A 2WK2A 1HJVA 3AS0A 1J4IA 1JCHB 1P5QA 1HKKA 2K8IA 3WKZA 3IHZA 4DRNA 3ARYA 1JNSA 1LG1A 1LL6A 3O5PA 4ODLA 1FKBA 3WD1A 2RUQA 3PRBA 4LGXA 2DPEA 3UI5A 3I6CA 3UQIA 1F40A 4L3NA 3W4RA 4HBEA 3PR9A 4FN2A 2MLZA 1W1TA 4MNJA 4L72B 2D9FA 1GRJA 3KABA 1ZCNA 4DRKA 1FFRA 4G2PA 4TNSA 1NSGA 4R5EA 4QT3A 4WKHA 3RM4A 2RSEA 5DO2A 1JNDA 3AS3A 3PRAA 3B9EA 4G50A 1IX5A 1FKGA 3AS2A 3IKDA 1HJWA 2UZ5A 5D75A 4HARA 4DRIA 3B8SA 1FKHA 1LJYA 4ODPA 3UI4A 2AOSA 1XHGA 4C02B 3GU0A 1FKSA 3AS1A 1KT0A 3NI6A 4DH0A 4TW7A 4IQCA 1ROTA 3ARXA 3O5OA 1D7JA 3MDYB 1H0IA 2M2AA 3FAPA 3ARVA 1W1YA 1ITXA 3UI6A 5HKGA 1Y0OA 3FY1A 1J4RA 3ARZA 3ODKA 2RURA 3BXWA 2EULA 4DZ3A 4TX0A 1LQ0A 4NNRA 4ODNA 2ZR6A 1EIBA 1NMWA 1SYTA 4QIBA 1X6NA 4U86A 2DT2A 3CZ8A 2DSVA 4IT6A 1YW5A 3IK8A 2LPVA 3KADA 5B8IC 4Q22A 2PV3A 2PPPA 1OGBA 3O5DA 1ZK6A 4W9QA 2DG3A 3FXYA 4MNMA 1XRVA 3CGNA 3VAWA 3O5QA 1E6ZA 1JNEA 1LL7A 1VF8A 3OA5A 1ZB5A 4ZS6A 3WD4A 2ESCA 4S3KA 1ZL1A 3B7XA 4DRJA 4WIWA 4O2TA 4TW8A 2O9OA 5GPRA 3PRDA 1E15A 2YBTA 3AQUA 4WKFA 2OFNA 2F21A 2PV1A 3UQBA 3GPKA 1ZBVA 1Q6UA 4ML4A 3CHEA 4MTVA 3KACA 3ARWA 4W5UA 5HWBA 1GUVA 3H9RB 1FKDA 3KAHA 1K9TA 2MLXA 1QZ2A 4P8UA 1Q1CA 3ARRA 1WNOA 4NZCA 1GPFA 4DWSC 4LAVA 1E6RA 2FKEA 3UQAA 2DT0A 4QT2A 4GGQA 1ZU8A 4Z2LA 2MNTA 1U79A 1TCOC 3WD2A 4S3JA 2RUDA 1JNTA 3CH9A 3O5KA 2Y78A 3KCEA 2Q5AA 2ZQVA 4DT4A 2PV2A 2ZR5A 4ODMA 5J6EA 1WB0A 1ZBKA 1E44A 5DIUA 2F23A 3EY6A 1YATA 5GPGA 1OWQA 2XP7A 2FAPA 5I98A 2WM0A 2XP8A 4JFLA 4JFJA 3GTYX 3WH0A 2XP6A 3PA7A 1Q6HA 1HKJA 3O5MA 4U84A 2F2DA 4WK9A 1W1PA 2KGJA 3RMEA 4MGVA 1J6YA 2ETNA 2A3CA 1FKJA 1NWUA 2N87A 5HUAA 2KI3A 3ARSA 3WQWA 1SR0A 1NWRA 4DWSA 5DEZA 4PTMA 4Z2GA 3CHCA 4W9PA 3TDBA 1FFQA 1EHNA 4FAPA 5DITA 3IKGA 2IUZA 2YBUA 5HT1A 1TFVA 3KZ7A 4IPXA 1H0GA 2OLHA 2DG9A 2G41A 4ODKA 1FD9A 1OGGA 4KQZA 1R9HA 1KT1A 1FKTA 3JXVA 3WL1A 2DSUA 3BMBA 4DROA 4Z2JA 4J4OA 1M5YA 1PINA 3QOKA 1EQ3A 4DZ2A 2VN1A 3WD3A 4LAXA 1HKIA 1NWSA 1UR9A 3O5FA 4DRHA 3WQVA 2ZR4A 2M1IA 3CHDA 3EIPA 4TYOA 1HXVA 4DIPA 2KFWA 1T11A 5HWCA 1EYMA 2DT3A 3TC5A 1A7XA 1NH6A 1O6IA 1RD6A 3WD0A 2LJ4A 2RUCA 2L2SA 1ZBWA 2XP9A 4IT4A 4WJXA 4LAWA 3JYMA 1FKFA 1BKFA 4ZPWR 3ALGA 1EDQA 1X6LA 2MF9A 4DRQA 1F8AB 4MAVA 5HTGA 4BF8A 3CGMA 4NSBA 4JFMA 4P8VA 2PPNA 1W9PA 1WAWA 1J4HA 3ARPA 4ZPVR 4JFKA 4XAKA 5GQBA 4QZVB 3O5JA 4J4NA 2ZQUA 3CHFA 4LAYA 3KAIA 1FKIA 2DG4A 1Q6IA 1ROUA 1W26A 2P4VA 3O5GA 2KO7A 4UDMA 1N1AA 4DWSD 4MSPA 3ARQA 4JYSA 3G6LA 4HBOA 3O5EA 4P8XA 2XP4A 3UF8A 2AWGA 4GIVA 3WL0A 2KE0A 1FKRA 4ODOA 3KAGA 1E6NA 3NTPA 2WLZA 2PPOA 2A3AA 1D7IA 1LL4A 1FJDA 1PBKA 2LKNA 5HW6A 4IQ2A 1CTNA 4Z2IA 4Z2KA 4MNKA 3RFWA 3RM8A 4U85A 2JZVA 5HBFA 2PI6A 1W9UA 3LUOA 4JFIA 1KFWA 5HW8A 4R0XA 2XP3A 1C9HA 1E9LA 2XPAA 4MNLA 1JVWA 1FKLA 4P8WA 5BXJA 1LG2A 4ZPTR 2XPBA 2FDMA 2WLYA 1BL4A 4AY1A 4TW6A 1HJXA 2ZQSA 2MPHA 3O5RA 1QPLA 1QPFA 2DSWA 1D2KA 2LGOA 2PBCA 4KR0B 1UR8A 2ZQTA 2VCDA 2KR7A 4DRPA 5JH8A 3O5LA 5HW7A 3ARUA 2DSZA 4DWSB 3WIJA 1L1PA 3RM9A 4W9OA 1HKMA 3KAFA 5DF0A 3JYJA 2M08A 4Z2HA 1GOIA 4WKAA 3AROA 3OOBA 2RQSA 1D7HA 3O5IA 4MPKA 4URIA 3RGCA 2XP5A
chains in the Genus database with same CATH topology
2F4EA 3B9DA 2QF8A 1D6OA 2MLYA 3G6MA 2A3EA 2G8ZA 3ARTA 1FKKA 4ODRA 1ZBCA 4N19A 1E6PA 1FAPA 2O92A 2IF4A 1W1VA 2B31A 3ALFA 1W9VA 2ITKA 3B9AA 3TCZA 2A3BA 4ODQA 3NRKA 4ITZA 5DIVA 4Q7NA 1B6CA 1NMVA 4DRMA 1NWTA 2DT1A 2WK2A 1HJVA 3AS0A 1J4IA 1P5QA 1HKKA 2K8IA 3WKZA 3IHZA 4DRNA 3ARYA 1JNSA 1LG1A 1LL6A 3O5PA 4ODLA 1FKBA 3WD1A 2RUQA 3PRBA 4LGXA 2DPEA 3UI5A 3I6CA 3UQIA 1F40A 4L3NA 3W4RA 4HBEA 3PR9A 4FN2A 2MLZA 1W1TA 4MNJA 4L72B 2D9FA 3KABA 1ZCNA 4DRKA 1FFRA 4G2PA 4TNSA 1NSGA 4R5EA 4QT3A 4WKHA 3RM4A 2RSEA 5DO2A 1JNDA 3AS3A 3PRAA 3B9EA 4G50A 1IX5A 1FKGA 3AS2A 3IKDA 1HJWA 2UZ5A 5D75A 4HARA 4DRIA 3B8SA 1FKHA 1LJYA 4ODPA 3UI4A 2AOSA 1XHGA 4C02B 1FKSA 3AS1A 1KT0A 3NI6A 4DH0A 4TW7A 4IQCA 1ROTA 3ARXA 3O5OA 1D7JA 3MDYB 1H0IA 2M2AA 3FAPA 3ARVA 1W1YA 1ITXA 3UI6A 5HKGA 1Y0OA 3FY1A 1J4RA 3ARZA 3ODKA 2RURA 3BXWA 4DZ3A 4TX0A 1LQ0A 4NNRA 4ODNA 2ZR6A 1EIBA 1NMWA 1SYTA 4QIBA 1X6NA 4U86A 2DT2A 3CZ8A 2DSVA 4IT6A 1YW5A 3IK8A 2LPVA 3KADA 5B8IC 4Q22A 2PV3A 2PPPA 1OGBA 3O5DA 1ZK6A 4W9QA 2DG3A 3FXYA 4MNMA 1XRVA 3CGNA 3VAWA 3O5QA 1E6ZA 1JNEA 1LL7A 1VF8A 3OA5A 1ZB5A 4ZS6A 3WD4A 2ESCA 4S3KA 1ZL1A 3B7XA 4DRJA 4WIWA 4O2TA 4TW8A 2O9OA 5GPRA 3PRDA 1E15A 2YBTA 3AQUA 4WKFA 2OFNA 2F21A 2PV1A 3UQBA 3GPKA 1ZBVA 1Q6UA 4ML4A 3CHEA 4MTVA 3KACA 3ARWA 4W5UA 5HWBA 1GUVA 3H9RB 1FKDA 3KAHA 1K9TA 2MLXA 1QZ2A 4P8UA 1Q1CA 3ARRA 1WNOA 4NZCA 1GPFA 4DWSC 4LAVA 1E6RA 2FKEA 3UQAA 2DT0A 4QT2A 4GGQA 1ZU8A 4Z2LA 2MNTA 1U79A 1TCOC 3WD2A 4S3JA 2RUDA 1JNTA 3CH9A 3O5KA 2Y78A 3KCEA 2Q5AA 2ZQVA 4DT4A 2PV2A 2ZR5A 4ODMA 5J6EA 1WB0A 1ZBKA 5DIUA 3EY6A 1YATA 5GPGA 1OWQA 2XP7A 2FAPA 5I98A 2WM0A 2XP8A 4JFLA 4JFJA 3WH0A 2XP6A 3PA7A 1Q6HA 1HKJA 3O5MA 4U84A 2F2DA 4WK9A 1W1PA 2KGJA 3RMEA 4MGVA 1J6YA 2A3CA 1FKJA 1NWUA 2N87A 5HUAA 2KI3A 3ARSA 3WQWA 1SR0A 1NWRA 4DWSA 5DEZA 4PTMA 4Z2GA 3CHCA 4W9PA 3TDBA 1FFQA 1EHNA 4FAPA 5DITA 3IKGA 2IUZA 2YBUA 5HT1A 1TFVA 3KZ7A 4IPXA 1H0GA 2OLHA 2DG9A 2G41A 4ODKA 1FD9A 1OGGA 4KQZA 1R9HA 1KT1A 1FKTA 3JXVA 3WL1A 2DSUA 4DROA 4Z2JA 4J4OA 1M5YA 1PINA 3QOKA 1EQ3A 4DZ2A 2VN1A 3WD3A 4LAXA 1HKIA 1NWSA 1UR9A 3O5FA 4DRHA 3WQVA 2ZR4A 2M1IA 3CHDA 4TYOA 1HXVA 4DIPA 2KFWA 1T11A 5HWCA 1EYMA 2DT3A 3TC5A 1A7XA 1NH6A 1O6IA 1RD6A 3WD0A 2LJ4A 2RUCA 2L2SA 1ZBWA 2XP9A 4IT4A 4WJXA 4LAWA 3JYMA 1FKFA 1BKFA 4ZPWR 3ALGA 1EDQA 1X6LA 2MF9A 4DRQA 1F8AB 4MAVA 5HTGA 4BF8A 3CGMA 4NSBA 4JFMA 4P8VA 2PPNA 1W9PA 1WAWA 1J4HA 3ARPA 4ZPVR 4JFKA 4XAKA 5GQBA 4QZVB 3O5JA 4J4NA 2ZQUA 3CHFA 4LAYA 3KAIA 1FKIA 2DG4A 1Q6IA 1ROUA 1W26A 3O5GA 2KO7A 1N1AA 4DWSD 4MSPA 3ARQA 4JYSA 3G6LA 4HBOA 3O5EA 4P8XA 2XP4A 3UF8A 2AWGA 4GIVA 3WL0A 2KE0A 1FKRA 4ODOA 3KAGA 1E6NA 3NTPA 2WLZA 2PPOA 2A3AA 1D7IA 1LL4A 1FJDA 1PBKA 2LKNA 5HW6A 4IQ2A 1CTNA 4Z2IA 4Z2KA 4MNKA 3RFWA 3RM8A 4U85A 2JZVA 5HBFA 2PI6A 1W9UA 3LUOA 4JFIA 1KFWA 5HW8A 4R0XA 2XP3A 1C9HA 1E9LA 2XPAA 4MNLA 1JVWA 1FKLA 4P8WA 5BXJA 1LG2A 4ZPTR 2XPBA 2FDMA 2WLYA 1BL4A 4AY1A 4TW6A 1HJXA 2ZQSA 2MPHA 3O5RA 1QPLA 1QPFA 2DSWA 1D2KA 2LGOA 2PBCA 4KR0B 1UR8A 2ZQTA 2VCDA 2KR7A 4DRPA 5JH8A 3O5LA 5HW7A 3ARUA 2DSZA 4DWSB 3WIJA 1L1PA 3RM9A 4W9OA 1HKMA 3KAFA 5DF0A 3JYJA 2M08A 4Z2HA 1GOIA 4WKAA 3AROA 3OOBA 2RQSA 1D7HA 3O5IA 4MPKA 4URIA 3RGCA 2XP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4E A;  3O5J A;  3WH0 A;  4J4N A;  2XP6 A;  1D6O A;  2ZQU A;  4LAY A;  3PA7 A;  4NNR A;  3KAI A;  1FKI A;  2MLY A;  2ZR6 A;  1Q6H A;  2DG4 A;  4ODN A;  1Q6I A;  3O5M A;  4U84 A;  1ROU A;  1W26 A;  1FKK A;  2F2D A;  1NMW A;  3O5G A;  4ODR A;  2KGJ A;  2KO7 A;  1FAP A;  4N19 A;  4QIB A;  1N1A A;  4MSP A;  4MGV A;  1J6Y A;  4JFL A;  2IF4 A;  4JYS A;  4U86 A;  1FKJ A;  2ITK A;  3O5E A;  2N87 A;  2XP4 A;  3TCZ A;  3UF8 A;  1YW5 A;  2AWG A;  3IK8 A;  4GIV A;  2LPV A;  2KI3 A;  2KE0 A;  4ODQ A;  3KAD A;  5HUA A;  3NRK A;  4ITZ A;  5B8I C;  4ODO A;  3KAG A;  3NTP A;  5DIV A;  1FKR A;  2PV3 A;  1B6C A;  1NMV A;  2PPO A;  2PPP A;  1D7I A;  3O5D A;  1ZK6 A;  1FJD A;  1PBK A;  2LKN A;  4DRM A;  5HW6 A;  4IQ2 A;  4W9Q A;  2DG3 A;  4W9P A;  3TDB A;  3CGN A;  5DIT A;  4FAP A;  1J4I A;  3IKG A;  3VAW A;  3O5Q A;  1P5Q A;  2K8I A;  5HT1 A;  3IHZ A;  4DRN A;  3KZ7 A;  4IPX A;  3RFW A;  1JNS A;  4U85 A;  2JZV A;  3O5P A;  3B7X A;  4ODL A;  2DG9 A;  4DRJ A;  4ODK A;  1FD9 A;  1FKB A;  3LUO A;  4JFI A;  2RUQ A;  3PRB A;  1R9H A;  1KT1 A;  5HW8 A;  1FKT A;  3JXV A;  2XP3 A;  4R0X A;  4O2T A;  3UI5 A;  3I6C A;  4TW8 A;  3UQI A;  1C9H A;  4DRO A;  1F40 A;  2XPA A;  4J4O A;  3PRD A;  1JVW A;  1M5Y A;  1PIN A;  1EQ3 A;  4DZ2 A;  1FKL A;  4FN2 A;  2VN1 A;  2MLZ A;  2OFN A;  2F21 A;  2D9F A;  2PV1 A;  3O5F A;  4LAX A;  4DRH A;  3KAB A;  5BXJ A;  1ZCN A;  3UQB A;  3GPK A;  4DRK A;  4G2P A;  1Q6U A;  4TNS A;  1NSG A;  2ZR4 A;  2M1I A;  2XPB A;  3KAC A;  4TYO A;  1HXV A;  4DIP A;  2KFW A;  1BL4 A;  4QT3 A;  2RSE A;  5HWB A;  4TW6 A;  3H9R B;  1FKD A;  3KAH A;  1T11 A;  5HWC A;  2MLX A;  1EYM A;  1QZ2 A;  2ZQS A;  4G50 A;  2MPH A;  3O5R A;  1FKG A;  1QPL A;  1A7X A;  1Q1C A;  3IKD A;  3TC5 A;  1QPF A;  4LAV A;  2LGO A;  2UZ5 A;  5D75 A;  2FKE A;  2PBC A;  3UQA A;  2LJ4 A;  4QT2 A;  4GGQ A;  2RUC A;  2ZQT A;  2L2S A;  2VCD A;  2KR7 A;  1FKH A;  2MNT A;  2XP9 A;  4ODP A;  1U79 A;  1TCO C;  3UI4 A;  4DRI A;  4DRP A;  3O5L A;  5HW7 A;  4LAW A;  2RUD A;  1JNT A;  3JYM A;  1FKF A;  4C02 B;  3O5K A;  1L1P A;  2Y78 A;  3KCE A;  1BKF A;  2Q5A A;  2ZQV A;  4DT4 A;  1FKS A;  4W9O A;  1KT0 A;  3NI6 A;  2PV2 A;  3KAF A;  2ZR5 A;  4IQC A;  1ROT A;  2MF9 A;  4TW7 A;  1F8A B;  4DH0 A;  4DRQ A;  3O5O A;  3JYJ A;  1D7J A;  3MDY B;  2M08 A;  4ODM A;  5J6E A;  2M2A A;  5HTG A;  4BF8 A;  3CGM A;  3FAP A;  5DIU A;  4JFM A;  3OOB A;  3UI6 A;  5HKG A;  2RQS A;  2PPN A;  1Y0O A;  1YAT A;  3EY6 A;  5GPG A;  1D7H A;  1J4H A;  1J4R A;  3O5I A;  2XP7 A;  3ODK A;  2FAP A;  2RUR A;  5I98 A;  4JFK A;  3RGC A;  2XP8 A;  4JFJ A;  2XP5 A;  4DZ3 A;  4TX0 A; 
#chains in the Genus database with same CATH topology
 2F4E A;  3B9D A;  2QF8 A;  1D6O A;  2MLY A;  3G6M A;  2A3E A;  2G8Z A;  3ART A;  2PN0 A;  1FKK A;  4ODR A;  1ZBC A;  4N19 A;  1E6P A;  1FAP A;  2O92 A;  2IF4 A;  1W1V A;  2B31 A;  3ALF A;  1W9V A;  2ITK A;  3B9A A;  3TCZ A;  2A3B A;  4ODQ A;  3NRK A;  4ITZ A;  5DIV A;  4Q7N A;  1B6C A;  1NMV A;  4DRM A;  2B5U B;  1NWT A;  2DT1 A;  2WK2 A;  1HJV A;  3AS0 A;  1J4I A;  1JCH B;  1P5Q A;  1HKK A;  2K8I A;  3WKZ A;  3IHZ A;  4DRN A;  3ARY A;  1JNS A;  1LG1 A;  1LL6 A;  3O5P A;  4ODL A;  1FKB A;  3WD1 A;  2RUQ A;  3PRB A;  4LGX A;  2DPE A;  3UI5 A;  3I6C A;  3UQI A;  1F40 A;  4L3N A;  3W4R A;  4HBE A;  3PR9 A;  4FN2 A;  2MLZ A;  1W1T A;  4MNJ A;  4L72 B;  2D9F A;  1GRJ A;  3KAB A;  1ZCN A;  4DRK A;  1FFR A;  4G2P A;  4TNS A;  1NSG A;  4R5E A;  4QT3 A;  4WKH A;  3RM4 A;  2RSE A;  5DO2 A;  1JND A;  3AS3 A;  3PRA A;  3B9E A;  4G50 A;  1IX5 A;  1FKG A;  3AS2 A;  3IKD A;  1HJW A;  2UZ5 A;  5D75 A;  4HAR A;  4DRI A;  3B8S A;  1FKH A;  1LJY A;  4ODP A;  3UI4 A;  2AOS A;  1XHG A;  4C02 B;  3GU0 A;  1FKS A;  3AS1 A;  1KT0 A;  3NI6 A;  4DH0 A;  4TW7 A;  4IQC A;  1ROT A;  3ARX A;  3O5O A;  1D7J A;  3MDY B;  1H0I A;  2M2A A;  3FAP A;  3ARV A;  1W1Y A;  1ITX A;  3UI6 A;  5HKG A;  1Y0O A;  3FY1 A;  1J4R A;  3ARZ A;  3ODK A;  2RUR A;  3BXW A;  2EUL A;  4DZ3 A;  4TX0 A;  1LQ0 A;  4NNR A;  4ODN A;  2ZR6 A;  1EIB A;  1NMW A;  1SYT A;  4QIB A;  1X6N A;  4U86 A;  2DT2 A;  3CZ8 A;  2DSV A;  4IT6 A;  1YW5 A;  3IK8 A;  2LPV A;  3KAD A;  5B8I C;  4Q22 A;  2PV3 A;  2PPP A;  1OGB A;  3O5D A;  1ZK6 A;  4W9Q A;  2DG3 A;  3FXY A;  4MNM A;  1XRV A;  3CGN A;  3VAW A;  3O5Q A;  1E6Z A;  1JNE A;  1LL7 A;  1VF8 A;  3OA5 A;  1ZB5 A;  4ZS6 A;  3WD4 A;  2ESC A;  4S3K A;  1ZL1 A;  3B7X A;  4DRJ A;  4WIW A;  4O2T A;  4TW8 A;  2O9O A;  5GPR A;  3PRD A;  1E15 A;  2YBT A;  3AQU A;  4WKF A;  2OFN A;  2F21 A;  2PV1 A;  3UQB A;  3GPK A;  1ZBV A;  1Q6U A;  4ML4 A;  3CHE A;  4MTV A;  3KAC A;  3ARW A;  4W5U A;  5HWB A;  1GUV A;  3H9R B;  1FKD A;  3KAH A;  1K9T A;  2MLX A;  1QZ2 A;  4P8U A;  1Q1C A;  3ARR A;  1WNO A;  4NZC A;  1GPF A;  4DWS C;  4LAV A;  1E6R A;  2FKE A;  3UQA A;  2DT0 A;  4QT2 A;  4GGQ A;  1ZU8 A;  4Z2L A;  2MNT A;  1U79 A;  1TCO C;  3WD2 A;  4S3J A;  2RUD A;  1JNT A;  3CH9 A;  3O5K A;  2Y78 A;  3KCE A;  2Q5A A;  2ZQV A;  4DT4 A;  2PV2 A;  2ZR5 A;  4ODM A;  5J6E A;  1WB0 A;  1ZBK A;  1E44 A;  5DIU A;  2F23 A;  3EY6 A;  1YAT A;  5GPG A;  1OWQ A;  2XP7 A;  2FAP A;  5I98 A;  2WM0 A;  2XP8 A;  4JFL A;  4JFJ A;  3GTY X;  3WH0 A;  2XP6 A;  3PA7 A;  1Q6H A;  1HKJ A;  3O5M A;  4U84 A;  2F2D A;  4WK9 A;  1W1P A;  2KGJ A;  3RME A;  4MGV A;  1J6Y A;  2ETN A;  2A3C A;  1FKJ A;  1NWU A;  2N87 A;  5HUA A;  2KI3 A;  3ARS A;  3WQW A;  1SR0 A;  1NWR A;  4DWS A;  5DEZ A;  4PTM A;  4Z2G A;  3CHC A;  4W9P A;  3TDB A;  1FFQ A;  1EHN A;  4FAP A;  5DIT A;  3IKG A;  2IUZ A;  2YBU A;  5HT1 A;  1TFV A;  3KZ7 A;  4IPX A;  1H0G A;  2OLH A;  2DG9 A;  2G41 A;  4ODK A;  1FD9 A;  1OGG A;  4KQZ A;  1R9H A;  1KT1 A;  1FKT A;  3JXV A;  3WL1 A;  2DSU A;  3BMB A;  4DRO A;  4Z2J A;  4J4O A;  1M5Y A;  1PIN A;  3QOK A;  1EQ3 A;  4DZ2 A;  2VN1 A;  3WD3 A;  4LAX A;  1HKI A;  1NWS A;  1UR9 A;  3O5F A;  4DRH A;  3WQV A;  2ZR4 A;  2M1I A;  3CHD A;  3EIP A;  4TYO A;  1HXV A;  4DIP A;  2KFW A;  1T11 A;  5HWC A;  1EYM A;  2DT3 A;  3TC5 A;  1A7X A;  1NH6 A;  1O6I A;  1RD6 A;  3WD0 A;  2LJ4 A;  2RUC A;  2L2S A;  1ZBW A;  2XP9 A;  4IT4 A;  4WJX A;  4LAW A;  3JYM A;  1FKF A;  1BKF A;  4ZPW R;  3ALG A;  1EDQ A;  1X6L A;  2MF9 A;  4DRQ A;  1F8A B;  4MAV A;  5HTG A;  4BF8 A;  3CGM A;  4NSB A;  4JFM A;  4P8V A;  2PPN A;  1W9P A;  1WAW A;  1J4H A;  3ARP A;  4ZPV R;  4JFK A;  4XAK A;  5GQB A;  4QZV B;  3O5J A;  4J4N A;  2ZQU A;  3CHF A;  4LAY A;  3KAI A;  1FKI A;  2DG4 A;  1Q6I A;  1ROU A;  1W26 A;  2P4V A;  3O5G A;  2KO7 A;  4UDM A;  1N1A A;  4DWS D;  4MSP A;  3ARQ A;  4JYS A;  3G6L A;  4HBO A;  3O5E A;  4P8X A;  2XP4 A;  3UF8 A;  2AWG A;  4GIV A;  3WL0 A;  2KE0 A;  1FKR A;  4ODO A;  3KAG A;  1E6N A;  3NTP A;  2WLZ A;  2PPO A;  2A3A A;  1D7I A;  1LL4 A;  1FJD A;  1PBK A;  2LKN A;  5HW6 A;  4IQ2 A;  1CTN A;  4Z2I A;  4Z2K A;  4MNK A;  3RFW A;  3RM8 A;  4U85 A;  2JZV A;  5HBF A;  2PI6 A;  1W9U A;  3LUO A;  4JFI A;  1KFW A;  5HW8 A;  4R0X A;  2XP3 A;  1C9H A;  1E9L A;  2XPA A;  4MNL A;  1JVW A;  1FKL A;  4P8W A;  5BXJ A;  1LG2 A;  4ZPT R;  2XPB A;  2FDM A;  2WLY A;  1BL4 A;  4AY1 A;  4TW6 A;  1HJX A;  2ZQS A;  2MPH A;  3O5R A;  1QPL A;  1QPF A;  2DSW A;  1D2K A;  2LGO A;  2PBC A;  4KR0 B;  1UR8 A;  2ZQT A;  2VCD A;  2KR7 A;  4DRP A;  5JH8 A;  3O5L A;  5HW7 A;  3ARU A;  2DSZ A;  4DWS B;  3WIJ A;  1L1P A;  3RM9 A;  4W9O A;  1HKM A;  3KAF A;  5DF0 A;  3JYJ A;  2M08 A;  4Z2H A;  1GOI A;  4WKA A;  3ARO A;  3OOB A;  2RQS A;  1D7H A;  3O5I A;  4MPK A;  4URI A;  3RGC A;  2XP5 A; 
#chains in the Genus database with same CATH homology
 2F4E A;  3B9D A;  2QF8 A;  1D6O A;  2MLY A;  3G6M A;  2A3E A;  2G8Z A;  3ART A;  1FKK A;  4ODR A;  1ZBC A;  4N19 A;  1E6P A;  1FAP A;  2O92 A;  2IF4 A;  1W1V A;  2B31 A;  3ALF A;  1W9V A;  2ITK A;  3B9A A;  3TCZ A;  2A3B A;  4ODQ A;  3NRK A;  4ITZ A;  5DIV A;  4Q7N A;  1B6C A;  1NMV A;  4DRM A;  1NWT A;  2DT1 A;  2WK2 A;  1HJV A;  3AS0 A;  1J4I A;  1P5Q A;  1HKK A;  2K8I A;  3WKZ A;  3IHZ A;  4DRN A;  3ARY A;  1JNS A;  1LG1 A;  1LL6 A;  3O5P A;  4ODL A;  1FKB A;  3WD1 A;  2RUQ A;  3PRB A;  4LGX A;  2DPE A;  3UI5 A;  3I6C A;  3UQI A;  1F40 A;  4L3N A;  3W4R A;  4HBE A;  3PR9 A;  4FN2 A;  2MLZ A;  1W1T A;  4MNJ A;  4L72 B;  2D9F A;  3KAB A;  1ZCN A;  4DRK A;  1FFR A;  4G2P A;  4TNS A;  1NSG A;  4R5E A;  4QT3 A;  4WKH A;  3RM4 A;  2RSE A;  5DO2 A;  1JND A;  3AS3 A;  3PRA A;  3B9E A;  4G50 A;  1IX5 A;  1FKG A;  3AS2 A;  3IKD A;  1HJW A;  2UZ5 A;  5D75 A;  4HAR A;  4DRI A;  3B8S A;  1FKH A;  1LJY A;  4ODP A;  3UI4 A;  2AOS A;  1XHG A;  4C02 B;  1FKS A;  3AS1 A;  1KT0 A;  3NI6 A;  4DH0 A;  4TW7 A;  4IQC A;  1ROT A;  3ARX A;  3O5O A;  1D7J A;  3MDY B;  1H0I A;  2M2A A;  3FAP A;  3ARV A;  1W1Y A;  1ITX A;  3UI6 A;  5HKG A;  1Y0O A;  3FY1 A;  1J4R A;  3ARZ A;  3ODK A;  2RUR A;  3BXW A;  4DZ3 A;  4TX0 A;  1LQ0 A;  4NNR A;  4ODN A;  2ZR6 A;  1EIB A;  1NMW A;  1SYT A;  4QIB A;  1X6N A;  4U86 A;  2DT2 A;  3CZ8 A;  2DSV A;  4IT6 A;  1YW5 A;  3IK8 A;  2LPV A;  3KAD A;  5B8I C;  4Q22 A;  2PV3 A;  2PPP A;  1OGB A;  3O5D A;  1ZK6 A;  4W9Q A;  2DG3 A;  3FXY A;  4MNM A;  1XRV A;  3CGN A;  3VAW A;  3O5Q A;  1E6Z A;  1JNE A;  1LL7 A;  1VF8 A;  3OA5 A;  1ZB5 A;  4ZS6 A;  3WD4 A;  2ESC A;  4S3K A;  1ZL1 A;  3B7X A;  4DRJ A;  4WIW A;  4O2T A;  4TW8 A;  2O9O A;  5GPR A;  3PRD A;  1E15 A;  2YBT A;  3AQU A;  4WKF A;  2OFN A;  2F21 A;  2PV1 A;  3UQB A;  3GPK A;  1ZBV A;  1Q6U A;  4ML4 A;  3CHE A;  4MTV A;  3KAC A;  3ARW A;  4W5U A;  5HWB A;  1GUV A;  3H9R B;  1FKD A;  3KAH A;  1K9T A;  2MLX A;  1QZ2 A;  4P8U A;  1Q1C A;  3ARR A;  1WNO A;  4NZC A;  1GPF A;  4DWS C;  4LAV A;  1E6R A;  2FKE A;  3UQA A;  2DT0 A;  4QT2 A;  4GGQ A;  1ZU8 A;  4Z2L A;  2MNT A;  1U79 A;  1TCO C;  3WD2 A;  4S3J A;  2RUD A;  1JNT A;  3CH9 A;  3O5K A;  2Y78 A;  3KCE A;  2Q5A A;  2ZQV A;  4DT4 A;  2PV2 A;  2ZR5 A;  4ODM A;  5J6E A;  1WB0 A;  1ZBK A;  5DIU A;  3EY6 A;  1YAT A;  5GPG A;  1OWQ A;  2XP7 A;  2FAP A;  5I98 A;  2WM0 A;  2XP8 A;  4JFL A;  4JFJ A;  3WH0 A;  2XP6 A;  3PA7 A;  1Q6H A;  1HKJ A;  3O5M A;  4U84 A;  2F2D A;  4WK9 A;  1W1P A;  2KGJ A;  3RME A;  4MGV A;  1J6Y A;  2A3C A;  1FKJ A;  1NWU A;  2N87 A;  5HUA A;  2KI3 A;  3ARS A;  3WQW A;  1SR0 A;  1NWR A;  4DWS A;  5DEZ A;  4PTM A;  4Z2G A;  3CHC A;  4W9P A;  3TDB A;  1FFQ A;  1EHN A;  4FAP A;  5DIT A;  3IKG A;  2IUZ A;  2YBU A;  5HT1 A;  1TFV A;  3KZ7 A;  4IPX A;  1H0G A;  2OLH A;  2DG9 A;  2G41 A;  4ODK A;  1FD9 A;  1OGG A;  4KQZ A;  1R9H A;  1KT1 A;  1FKT A;  3JXV A;  3WL1 A;  2DSU A;  4DRO A;  4Z2J A;  4J4O A;  1M5Y A;  1PIN A;  3QOK A;  1EQ3 A;  4DZ2 A;  2VN1 A;  3WD3 A;  4LAX A;  1HKI A;  1NWS A;  1UR9 A;  3O5F A;  4DRH A;  3WQV A;  2ZR4 A;  2M1I A;  3CHD A;  4TYO A;  1HXV A;  4DIP A;  2KFW A;  1T11 A;  5HWC A;  1EYM A;  2DT3 A;  3TC5 A;  1A7X A;  1NH6 A;  1O6I A;  1RD6 A;  3WD0 A;  2LJ4 A;  2RUC A;  2L2S A;  1ZBW A;  2XP9 A;  4IT4 A;  4WJX A;  4LAW A;  3JYM A;  1FKF A;  1BKF A;  4ZPW R;  3ALG A;  1EDQ A;  1X6L A;  2MF9 A;  4DRQ A;  1F8A B;  4MAV A;  5HTG A;  4BF8 A;  3CGM A;  4NSB A;  4JFM A;  4P8V A;  2PPN A;  1W9P A;  1WAW A;  1J4H A;  3ARP A;  4ZPV R;  4JFK A;  4XAK A;  5GQB A;  4QZV B;  3O5J A;  4J4N A;  2ZQU A;  3CHF A;  4LAY A;  3KAI A;  1FKI A;  2DG4 A;  1Q6I A;  1ROU A;  1W26 A;  3O5G A;  2KO7 A;  1N1A A;  4DWS D;  4MSP A;  3ARQ A;  4JYS A;  3G6L A;  4HBO A;  3O5E A;  4P8X A;  2XP4 A;  3UF8 A;  2AWG A;  4GIV A;  3WL0 A;  2KE0 A;  1FKR A;  4ODO A;  3KAG A;  1E6N A;  3NTP A;  2WLZ A;  2PPO A;  2A3A A;  1D7I A;  1LL4 A;  1FJD A;  1PBK A;  2LKN A;  5HW6 A;  4IQ2 A;  1CTN A;  4Z2I A;  4Z2K A;  4MNK A;  3RFW A;  3RM8 A;  4U85 A;  2JZV A;  5HBF A;  2PI6 A;  1W9U A;  3LUO A;  4JFI A;  1KFW A;  5HW8 A;  4R0X A;  2XP3 A;  1C9H A;  1E9L A;  2XPA A;  4MNL A;  1JVW A;  1FKL A;  4P8W A;  5BXJ A;  1LG2 A;  4ZPT R;  2XPB A;  2FDM A;  2WLY A;  1BL4 A;  4AY1 A;  4TW6 A;  1HJX A;  2ZQS A;  2MPH A;  3O5R A;  1QPL A;  1QPF A;  2DSW A;  1D2K A;  2LGO A;  2PBC A;  4KR0 B;  1UR8 A;  2ZQT A;  2VCD A;  2KR7 A;  4DRP A;  5JH8 A;  3O5L A;  5HW7 A;  3ARU A;  2DSZ A;  4DWS B;  3WIJ A;  1L1P A;  3RM9 A;  4W9O A;  1HKM A;  3KAF A;  5DF0 A;  3JYJ A;  2M08 A;  4Z2H A;  1GOI A;  4WKA A;  3ARO A;  3OOB A;  2RQS A;  1D7H A;  3O5I A;  4MPK A;  4URI A;  3RGC A;  2XP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...