4JFMA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 2-(3,4-dimethoxyphenoxy)ethyl (2s)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfmA00
4LAWA 1B6CA 2XP7A 1T11A 3UQBA 4LAVA 3UI6A 1QPFA 1FD9A 4O2TA 3TC5A 3KAIA 3MDYB 3IKGA 1J4HA 4W9OA 4TW8A 2AWGA 2RUQA 1HXVA 4IPXA 4DH0A 3TDBA 2MPHA 1FKIA 3NRKA 2ZR6A 1FKFA 4LAYA 4DRIA 2M1IA 2K8IA 3O5FA 1JNSA 2DG9A 2F2DA 3NI6A 4QT2A 4TNSA 1D6OA 1ZK6A 1QZ2A 1D7JA 1TCOC 1NMVA 1W26A 2XPAA 2ZR5A 5HW8A 3OOBA 4C02B 2F21A 2XP8A 3UI4A 4NNRA 1P5QA 2XP5A 4ODQA 3O5OA 4JFIA 5D75A 2ZQTA 2M2AA 2VN1A 1A7XA 3JXVA 1J6YA 4W9QA 4DZ2A 4LAXA 2KI3A 5HWBA 2FAPA 4G2PA 2ZQUA 3JYJA 1FKHA 3KAHA 3IK8A 2XP9A 4DRMA 2Q5AA 3O5RA 2MLZA 4DROA 1J4IA 1JNTA 2RUCA 2KGJA 3CGMA 3KADA 4ODNA 5BXJA 5HUAA 3O5DA 3IKDA 4U84A 1KT1A 2JZVA 2XP4A 4JYSA 2XP6A 4G50A 4DRNA 1ROTA 4JFMA 1Q6UA 2PPOA 3O5LA 5HKGA 5DIVA 5DITA 2VCDA 1FKRA 2IF4A 2KFWA 2ZR4A 1Q1CA 4JFKA 1FKBA 4TW7A 1EYMA 4ODOA 1Q6IA 4TYOA 2MNTA 3UQIA 3IHZA 4IQ2A 5HT1A 4IQCA 5DIUA 5HW7A 3CGNA 3KZ7A 4TW6A 4DT4A 3O5MA 3O5KA 3B7XA 3WH0A 2M08A 2ZQSA 2L2SA 1EQ3A 2N87A 1R9HA 4ODMA 1J4RA 3UF8A 3NTPA 3LUOA 1L1PA 1YW5A 2RURA 1BKFA 1D7HA 2DG3A 4ITZA 1U79A 3I6CA 2MF9A 3TCZA 3KCEA 4DRKA 2F4EA 2LJ4A 1FKLA 1C9HA 1FJDA 2PPPA 4DIPA 4MSPA 1BL4A 4J4OA 3PRBA 4JFLA 3FAPA 4FN2A 2Y78A 3KAFA 4QIBA 2LKNA 2XPBA 3O5EA 4DRJA 1ZCNA 2PV2A 3GPKA 4QT3A 2PV1A 1M5YA 4GIVA 1D7IA 4U85A 5I98A 4MGVA 3O5IA 5HTGA 3PRDA 4DZ3A 1FKDA 2RUDA 3EY6A 1KT0A 4DRHA 2XP3A 4N19A 1FKJA 5GPGA 3O5JA 1FKGA 2KE0A 3UI5A 5J6EA 3O5GA 2FKEA 4DRQA 4DRPA 4FAPA 2ZQVA 1FKKA 1YATA 1FKTA 4R0XA 3KABA 4U86A 3O5PA 3RGCA 1PBKA 3KACA 4TX0A 2D9FA 5B8IC 1QPLA 4JFJA 2RSEA 4W9PA 2RQSA 2DG4A 4BF8A 3H9RB 1PINA 2LGOA 3ODKA 4GGQA 1NSGA 1ROUA 4ODRA 5HW6A 1N1AA 1Q6HA 1JVWA 3PA7A 1NMWA 2KO7A 4ODLA 1F40A 4J4NA 3RFWA 3UQAA 2PBCA 2MLYA 2UZ5A 5HWCA 2LPVA 2PV3A 2KR7A 2OFNA 4ODPA 4ODKA 3KAGA 3O5QA 2PPNA 1FAPA 1Y0OA 2ITKA 3JYMA 2MLXA 1F8AB 1FKSA 3VAWA
chains in the Genus database with same CATH superfamily
2YBUA 4IT6A 3UI6A 4O2TA 4WK9A 1LG1A 1ZB5A 4UDMA 1HXVA 1HKIA 1E9LA 4LAYA 1LJYA 1NWUA 4KQZA 2DT1A 4QT2A 4DWSC 1ZK6A 2EULA 1HJXA 1OWQA 1ZBCA 2F21A 2XP8A 3UI4A 2XP5A 1K9TA 4MPKA 1RD6A 5D75A 2ZQTA 3CHFA 1J6YA 4W9QA 4DZ2A 3PRAA 2KI3A 3BMBA 3B9EA 3O5RA 4ODNA 5GQBA 1IX5A 3O5DA 4JYSA 3CHEA 4MNLA 2XP6A 4DRNA 4L3NA 2PPOA 1W9PA 3ARQA 1GOIA 2ZR4A 4JFKA 1FKBA 1OGGA 4TYOA 1W9UA 2MNTA 3UQIA 4PTMA 4IQCA 5DIUA 5HW7A 3CGNA 2DT3A 3GU0A 3WH0A 1XHGA 2ZQSA 3AS1A 2L2SA 1SYTA 1EQ3A 1J4RA 3LUOA 1YW5A 2WK2A 1D7HA 4ITZA 3I6CA 2MF9A 2WLYA 4WKHA 3WD1A 2DT2A 4MNMA 2G8ZA 2PI6A 1JNDA 2LKNA 2XPBA 4DRJA 4R5EA 4QT3A 4U85A 5HTGA 1FKDA 1KT0A 4N19A 5HBFA 4FAPA 1E6ZA 1YATA 4U86A 1LL4A 3ARSA 4TX0A 4JFJA 1H0IA 4W9PA 2RQSA 3AQUA 1WB0A 3H9RB 1E6NA 1PINA 3ODKA 4GGQA 1NSGA 1ROUA 4ODRA 1N1AA 2PN0A 1W1PA 4J4NA 1GRJA 3RFWA 2MLYA 2KR7A 2OFNA 2DSUA 3B9DA 3G6LA 5HKGA 4DZ3A 1EDQA 1B6CA 2XP7A 3WQWA 2WLZA 3KAIA 3IKGA 4W9OA 1H0GA 4Q7NA 1LQ0A 2RUQA 1E6RA 1ZBVA 1FKFA 2A3AA 4Z2JA 2F23A 2DG9A 3RM8A 1D6OA 3CHCA 4DWSD 1NMVA 1W26A 3W4RA 5HW8A 4C02B 3WD4A 4NNRA 1LL6A 1ITXA 1LL7A 4LGXA 3JXVA 2VN1A 3BXWA 4LAXA 2FAPA 2ZQUA 3JYJA 3KAHA 5BXJA 1JNTA 1KT1A 3B9AA 2JZVA 4G50A 3FXYA 4JFMA 1Q6UA 2WM0A 5DEZA 5DIVA 1JNEA 1KFWA 2VCDA 4P8UA 5HT1A 2DSWA 2DSZA 4MNJA 4TW6A 4DT4A 1LG2A 3AS0A 1GUVA 2ETNA 1HJWA 1W1YA 3TCZA 2F4EA 1FKLA 2PPPA 4DIPA 1BL4A 3RM4A 2ESCA 3FAPA 4DWSA 3B8SA 1ZCNA 2PV2A 3GPKA 4P8VA 2PV1A 1M5YA 4GIVA 3O5IA 3EY6A 4DRHA 1ZL1A 3ARWA 1FKGA 3GTYX 3UI5A 1ZBKA 3O5GA 2FKEA 4DRQA 4DRPA 4HBOA 2A3EA 1FKTA 3O5PA 3RGCA 1PBKA 3RM9A 3KACA 1XRVA 5B8IC 4HBEA 1NMWA 4L72B 4ZPVR 2MLXA 1F8AB 5HW6A 2AOSA 3VAWA 1X6LA 3RMEA 1T11A 3UQBA 4LAVA 1J4HA 2AWGA 1HKJA 3TDBA 3NRKA 2ZR6A 4DRIA 2M1IA 1JNSA 2F2DA 1EIBA 1HJVA 3NI6A 4TNSA 1CTNA 4Z2IA 4WKAA 2XPAA 2ZR5A 4Z2KA 3AS3A 2DSVA 1ZU8A 4ODQA 3O5OA 4JFIA 4P8WA 2M2AA 5HWBA 1FKHA 2XP9A 3CH9A 4DROA 1E15A 3G6MA 1WNOA 3KADA 4S3KA 1W9VA 5HUAA 1W1VA 2XP4A 2FDMA 1FKRA 4TW7A 4ODOA 1GPFA 1Q6IA 4IT4A 4IQ2A 4NSBA 3ALGA 3KZ7A 3ARVA 2DT0A 3O5MA 1X6NA 2M08A 4P8XA 4QZVB 1R9HA 4ODMA 4ZPTR 1JCHB 4S3JA 4ZS6A 2RURA 1HKKA 1BKFA 4NZCA 2DG3A 2A3CA 3WD3A 2YBTA 3WL1A 4MSPA 4Z2LA 5JH8A 2P4VA 4JFLA 2OLHA 2Y78A 4QIBA 1EHNA 3AS2A 4URIA 1SR0A 4HARA 4MNKA 4MGVA 3PRDA 3QOKA 1FKJA 3O5JA 2KE0A 1TFVA 2ZQVA 4Z2GA 1OGBA 3CHDA 1QPLA 2QF8A 2RSEA 2DG4A 4BF8A 3ARXA 3CZ8A 2LGOA 1JVWA 3PA7A 4ODLA 3EIPA 5DF0A 1F40A 1NWSA 3AROA 2UZ5A 5HWCA 2LPVA 5GPGA 3O5QA 2PPNA 1FAPA 3WKZA 1FKSA 1UR8A 4LAWA 1UR9A 1QPFA 1WAWA 1FD9A 3TC5A 3MDYB 5GPRA 1VF8A 4TW8A 4IPXA 4DH0A 2MPHA 3PR9A 1FKIA 2K8IA 3O5FA 3ARYA 1QZ2A 1D7JA 1TCOC 3ALFA 4WKFA 1ZBWA 3OOBA 3WQVA 1P5QA 2DPEA 3FY1A 1A7XA 1NWTA 4G2PA 4DRMA 3IK8A 1L1PA 2Q5AA 2MLZA 1J4IA 2IUZA 2KGJA 2RUCA 3CGMA 3IKDA 1D2KA 1ROTA 3ARRA 3WL0A 3O5LA 5DITA 2G41A 2IF4A 2O9OA 2B31A 2KFWA 1Q1CA 4KR0B 1EYMA 3ARZA 3IHZA 4WJXA 1E44A 1W1TA 3ARPA 3O5KA 3B7XA 4Z2HA 1HKMA 2N87A 3UF8A 3NTPA 3WD2A 3OA5A 1U79A 5DO2A 3KCEA 4DRKA 2LJ4A 1C9HA 3ARTA 3WIJA 2A3BA 4WIWA 1FJDA 4J4OA 3PRBA 4FN2A 3KAFA 1NWRA 3O5EA 1D7IA 5I98A 1NH6A 2B5UB 2RUDA 2XP3A 1FFQA 4MTVA 5J6EA 4XAKA 1FKKA 4AY1A 4R0XA 3KABA 1FFRA 4MAVA 2O92A 2D9FA 4ML4A 1O6IA 4W5UA 1E6PA 1Q6HA 2KO7A 4Q22A 3WD0A 3UQAA 3ARUA 2PBCA 2PV3A 4ODPA 4ODKA 4U84A 4ZPWR 3KAGA 1Y0OA 2ITKA 3JYMA 4DWSB
chains in the Genus database with same CATH topology
2YBUA 4IT6A 3UI6A 4O2TA 4WK9A 1LG1A 1ZB5A 1HXVA 1HKIA 1E9LA 4LAYA 1LJYA 1NWUA 4KQZA 2DT1A 4QT2A 4DWSC 1ZK6A 1HJXA 1OWQA 1ZBCA 2F21A 2XP8A 3UI4A 2XP5A 1K9TA 4MPKA 1RD6A 5D75A 2ZQTA 3CHFA 1J6YA 4W9QA 4DZ2A 3PRAA 2KI3A 3B9EA 3O5RA 4ODNA 5GQBA 1IX5A 3O5DA 4JYSA 3CHEA 4MNLA 2XP6A 4DRNA 4L3NA 2PPOA 1W9PA 3ARQA 1GOIA 2ZR4A 4JFKA 1FKBA 1OGGA 4TYOA 1W9UA 2MNTA 3UQIA 4PTMA 4IQCA 5DIUA 5HW7A 3CGNA 2DT3A 3WH0A 1XHGA 2ZQSA 3AS1A 2L2SA 1SYTA 1EQ3A 1J4RA 3LUOA 1YW5A 2WK2A 1D7HA 4ITZA 3I6CA 2MF9A 2WLYA 4WKHA 3WD1A 2DT2A 4MNMA 2G8ZA 2PI6A 1JNDA 2LKNA 2XPBA 4DRJA 4R5EA 4QT3A 4U85A 5HTGA 1FKDA 1KT0A 4N19A 5HBFA 4FAPA 1E6ZA 1YATA 4U86A 1LL4A 3ARSA 4TX0A 4JFJA 1H0IA 4W9PA 2RQSA 3AQUA 1WB0A 3H9RB 1E6NA 1PINA 3ODKA 4GGQA 1NSGA 1ROUA 4ODRA 1N1AA 1W1PA 4J4NA 3RFWA 2MLYA 2KR7A 2OFNA 2DSUA 3B9DA 3G6LA 5HKGA 4DZ3A 1EDQA 1B6CA 2XP7A 3WQWA 2WLZA 3KAIA 3IKGA 4W9OA 1H0GA 4Q7NA 1LQ0A 2RUQA 1E6RA 1ZBVA 1FKFA 2A3AA 4Z2JA 2DG9A 3RM8A 1D6OA 3CHCA 4DWSD 1NMVA 1W26A 3W4RA 5HW8A 4C02B 3WD4A 4NNRA 1LL6A 1ITXA 1LL7A 4LGXA 3JXVA 2VN1A 3BXWA 4LAXA 2FAPA 2ZQUA 3JYJA 3KAHA 5BXJA 1JNTA 1KT1A 3B9AA 2JZVA 4G50A 3FXYA 4JFMA 1Q6UA 2WM0A 5DEZA 5DIVA 1JNEA 1KFWA 2VCDA 4P8UA 5HT1A 2DSWA 2DSZA 4MNJA 4TW6A 4DT4A 1LG2A 3AS0A 1GUVA 1HJWA 1W1YA 3TCZA 2F4EA 1FKLA 2PPPA 4DIPA 1BL4A 3RM4A 2ESCA 3FAPA 4DWSA 3B8SA 1ZCNA 2PV2A 3GPKA 4P8VA 2PV1A 1M5YA 4GIVA 3O5IA 3EY6A 4DRHA 1ZL1A 3ARWA 1FKGA 3UI5A 1ZBKA 3O5GA 2FKEA 4DRQA 4DRPA 4HBOA 2A3EA 1FKTA 3O5PA 3RGCA 1PBKA 3RM9A 3KACA 1XRVA 5B8IC 4HBEA 1NMWA 4L72B 4ZPVR 2MLXA 1F8AB 5HW6A 2AOSA 3VAWA 1X6LA 3RMEA 1T11A 3UQBA 4LAVA 1J4HA 2AWGA 1HKJA 3TDBA 3NRKA 2ZR6A 4DRIA 2M1IA 1JNSA 2F2DA 1EIBA 1HJVA 3NI6A 4TNSA 1CTNA 4Z2IA 4WKAA 2XPAA 2ZR5A 4Z2KA 3AS3A 2DSVA 1ZU8A 4ODQA 3O5OA 4JFIA 4P8WA 2M2AA 5HWBA 1FKHA 2XP9A 3CH9A 4DROA 1E15A 3G6MA 1WNOA 3KADA 4S3KA 1W9VA 5HUAA 1W1VA 2XP4A 2FDMA 1FKRA 4TW7A 4ODOA 1GPFA 1Q6IA 4IT4A 4IQ2A 4NSBA 3ALGA 3KZ7A 3ARVA 2DT0A 3O5MA 1X6NA 2M08A 4P8XA 4QZVB 1R9HA 4ODMA 4ZPTR 4S3JA 4ZS6A 2RURA 1HKKA 1BKFA 4NZCA 2DG3A 2A3CA 3WD3A 2YBTA 3WL1A 4MSPA 4Z2LA 5JH8A 4JFLA 2OLHA 2Y78A 4QIBA 1EHNA 3AS2A 4URIA 1SR0A 4HARA 4MNKA 4MGVA 3PRDA 3QOKA 1FKJA 3O5JA 2KE0A 1TFVA 2ZQVA 4Z2GA 1OGBA 3CHDA 1QPLA 2QF8A 2RSEA 2DG4A 4BF8A 3ARXA 3CZ8A 2LGOA 1JVWA 3PA7A 4ODLA 5DF0A 1F40A 1NWSA 3AROA 2UZ5A 5HWCA 2LPVA 5GPGA 3O5QA 2PPNA 1FAPA 3WKZA 1FKSA 1UR8A 4LAWA 1UR9A 1QPFA 1WAWA 1FD9A 3TC5A 3MDYB 5GPRA 1VF8A 4TW8A 4IPXA 4DH0A 2MPHA 3PR9A 1FKIA 2K8IA 3O5FA 3ARYA 1QZ2A 1D7JA 1TCOC 3ALFA 4WKFA 1ZBWA 3OOBA 3WQVA 1P5QA 2DPEA 3FY1A 1A7XA 1NWTA 4G2PA 4DRMA 3IK8A 1L1PA 2Q5AA 2MLZA 1J4IA 2IUZA 2KGJA 2RUCA 3CGMA 3IKDA 1D2KA 1ROTA 3ARRA 3WL0A 3O5LA 5DITA 2G41A 2IF4A 2O9OA 2B31A 2KFWA 1Q1CA 4KR0B 1EYMA 3ARZA 3IHZA 4WJXA 1W1TA 3ARPA 3O5KA 3B7XA 4Z2HA 1HKMA 2N87A 3UF8A 3NTPA 3WD2A 3OA5A 1U79A 5DO2A 3KCEA 4DRKA 2LJ4A 1C9HA 3ARTA 3WIJA 2A3BA 4WIWA 1FJDA 4J4OA 3PRBA 4FN2A 3KAFA 1NWRA 3O5EA 1D7IA 5I98A 1NH6A 2RUDA 2XP3A 1FFQA 4MTVA 5J6EA 4XAKA 1FKKA 4AY1A 4R0XA 3KABA 1FFRA 4MAVA 2O92A 2D9FA 4ML4A 1O6IA 4W5UA 1E6PA 1Q6HA 2KO7A 4Q22A 3WD0A 3UQAA 3ARUA 2PBCA 2PV3A 4ODPA 4ODKA 4U84A 4ZPWR 3KAGA 1Y0OA 2ITKA 3JYMA 4DWSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAW A;  1B6C A;  2XP7 A;  1T11 A;  3UQB A;  4LAV A;  3UI6 A;  1QPF A;  1FD9 A;  4O2T A;  3TC5 A;  3KAI A;  3MDY B;  3IKG A;  1J4H A;  4W9O A;  4TW8 A;  2AWG A;  2RUQ A;  1HXV A;  4IPX A;  4DH0 A;  3TDB A;  2MPH A;  1FKI A;  3NRK A;  2ZR6 A;  1FKF A;  4LAY A;  4DRI A;  2M1I A;  2K8I A;  3O5F A;  1JNS A;  2DG9 A;  2F2D A;  3NI6 A;  4QT2 A;  4TNS A;  1D6O A;  1ZK6 A;  1QZ2 A;  1D7J A;  1TCO C;  1NMV A;  1W26 A;  2XPA A;  2ZR5 A;  5HW8 A;  3OOB A;  4C02 B;  2F21 A;  2XP8 A;  3UI4 A;  4NNR A;  1P5Q A;  2XP5 A;  4ODQ A;  3O5O A;  4JFI A;  5D75 A;  2ZQT A;  2M2A A;  2VN1 A;  1A7X A;  3JXV A;  1J6Y A;  4W9Q A;  4DZ2 A;  4LAX A;  2KI3 A;  5HWB A;  2FAP A;  4G2P A;  2ZQU A;  3JYJ A;  1FKH A;  3KAH A;  3IK8 A;  2XP9 A;  4DRM A;  2Q5A A;  3O5R A;  2MLZ A;  4DRO A;  1J4I A;  1JNT A;  2RUC A;  2KGJ A;  3CGM A;  3KAD A;  4ODN A;  5BXJ A;  5HUA A;  3O5D A;  3IKD A;  4U84 A;  1KT1 A;  2JZV A;  2XP4 A;  4JYS A;  2XP6 A;  4G50 A;  4DRN A;  1ROT A;  4JFM A;  1Q6U A;  2PPO A;  3O5L A;  5HKG A;  5DIV A;  5DIT A;  2VCD A;  1FKR A;  2IF4 A;  2KFW A;  2ZR4 A;  1Q1C A;  4JFK A;  1FKB A;  4TW7 A;  1EYM A;  4ODO A;  1Q6I A;  4TYO A;  2MNT A;  3UQI A;  3IHZ A;  4IQ2 A;  5HT1 A;  4IQC A;  5DIU A;  5HW7 A;  3CGN A;  3KZ7 A;  4TW6 A;  4DT4 A;  3O5M A;  3O5K A;  3B7X A;  3WH0 A;  2M08 A;  2ZQS A;  2L2S A;  1EQ3 A;  2N87 A;  1R9H A;  4ODM A;  1J4R A;  3UF8 A;  3NTP A;  3LUO A;  1L1P A;  1YW5 A;  2RUR A;  1BKF A;  1D7H A;  2DG3 A;  4ITZ A;  1U79 A;  3I6C A;  2MF9 A;  3TCZ A;  3KCE A;  4DRK A;  2F4E A;  2LJ4 A;  1FKL A;  1C9H A;  1FJD A;  2PPP A;  4DIP A;  4MSP A;  1BL4 A;  4J4O A;  3PRB A;  4JFL A;  3FAP A;  4FN2 A;  2Y78 A;  3KAF A;  4QIB A;  2LKN A;  2XPB A;  3O5E A;  4DRJ A;  1ZCN A;  2PV2 A;  3GPK A;  4QT3 A;  2PV1 A;  1M5Y A;  4GIV A;  1D7I A;  4U85 A;  5I98 A;  4MGV A;  3O5I A;  5HTG A;  3PRD A;  4DZ3 A;  1FKD A;  2RUD A;  3EY6 A;  1KT0 A;  4DRH A;  2XP3 A;  4N19 A;  1FKJ A;  5GPG A;  3O5J A;  1FKG A;  2KE0 A;  3UI5 A;  5J6E A;  3O5G A;  2FKE A;  4DRQ A;  4DRP A;  4FAP A;  2ZQV A;  1FKK A;  1YAT A;  1FKT A;  4R0X A;  3KAB A;  4U86 A;  3O5P A;  3RGC A;  1PBK A;  3KAC A;  4TX0 A;  2D9F A;  5B8I C;  1QPL A;  4JFJ A;  2RSE A;  4W9P A;  2RQS A;  2DG4 A;  4BF8 A;  3H9R B;  1PIN A;  2LGO A;  3ODK A;  4GGQ A;  1NSG A;  1ROU A;  4ODR A;  5HW6 A;  1N1A A;  1Q6H A;  1JVW A;  3PA7 A;  1NMW A;  2KO7 A;  4ODL A;  1F40 A;  4J4N A;  3RFW A;  3UQA A;  2PBC A;  2MLY A;  2UZ5 A;  5HWC A;  2LPV A;  2PV3 A;  2KR7 A;  2OFN A;  4ODP A;  4ODK A;  3KAG A;  3O5Q A;  2PPN A;  1FAP A;  1Y0O A;  2ITK A;  3JYM A;  2MLX A;  1F8A B;  1FKS A;  3VAW A; 
#chains in the Genus database with same CATH topology
 2YBU A;  4IT6 A;  3UI6 A;  4O2T A;  4WK9 A;  1LG1 A;  1ZB5 A;  4UDM A;  1HXV A;  1HKI A;  1E9L A;  4LAY A;  1LJY A;  1NWU A;  4KQZ A;  2DT1 A;  4QT2 A;  4DWS C;  1ZK6 A;  2EUL A;  1HJX A;  1OWQ A;  1ZBC A;  2F21 A;  2XP8 A;  3UI4 A;  2XP5 A;  1K9T A;  4MPK A;  1RD6 A;  5D75 A;  2ZQT A;  3CHF A;  1J6Y A;  4W9Q A;  4DZ2 A;  3PRA A;  2KI3 A;  3BMB A;  3B9E A;  3O5R A;  4ODN A;  5GQB A;  1IX5 A;  3O5D A;  4JYS A;  3CHE A;  4MNL A;  2XP6 A;  4DRN A;  4L3N A;  2PPO A;  1W9P A;  3ARQ A;  1GOI A;  2ZR4 A;  4JFK A;  1FKB A;  1OGG A;  4TYO A;  1W9U A;  2MNT A;  3UQI A;  4PTM A;  4IQC A;  5DIU A;  5HW7 A;  3CGN A;  2DT3 A;  3GU0 A;  3WH0 A;  1XHG A;  2ZQS A;  3AS1 A;  2L2S A;  1SYT A;  1EQ3 A;  1J4R A;  3LUO A;  1YW5 A;  2WK2 A;  1D7H A;  4ITZ A;  3I6C A;  2MF9 A;  2WLY A;  4WKH A;  3WD1 A;  2DT2 A;  4MNM A;  2G8Z A;  2PI6 A;  1JND A;  2LKN A;  2XPB A;  4DRJ A;  4R5E A;  4QT3 A;  4U85 A;  5HTG A;  1FKD A;  1KT0 A;  4N19 A;  5HBF A;  4FAP A;  1E6Z A;  1YAT A;  4U86 A;  1LL4 A;  3ARS A;  4TX0 A;  4JFJ A;  1H0I A;  4W9P A;  2RQS A;  3AQU A;  1WB0 A;  3H9R B;  1E6N A;  1PIN A;  3ODK A;  4GGQ A;  1NSG A;  1ROU A;  4ODR A;  1N1A A;  2PN0 A;  1W1P A;  4J4N A;  1GRJ A;  3RFW A;  2MLY A;  2KR7 A;  2OFN A;  2DSU A;  3B9D A;  3G6L A;  5HKG A;  4DZ3 A;  1EDQ A;  1B6C A;  2XP7 A;  3WQW A;  2WLZ A;  3KAI A;  3IKG A;  4W9O A;  1H0G A;  4Q7N A;  1LQ0 A;  2RUQ A;  1E6R A;  1ZBV A;  1FKF A;  2A3A A;  4Z2J A;  2F23 A;  2DG9 A;  3RM8 A;  1D6O A;  3CHC A;  4DWS D;  1NMV A;  1W26 A;  3W4R A;  5HW8 A;  4C02 B;  3WD4 A;  4NNR A;  1LL6 A;  1ITX A;  1LL7 A;  4LGX A;  3JXV A;  2VN1 A;  3BXW A;  4LAX A;  2FAP A;  2ZQU A;  3JYJ A;  3KAH A;  5BXJ A;  1JNT A;  1KT1 A;  3B9A A;  2JZV A;  4G50 A;  3FXY A;  4JFM A;  1Q6U A;  2WM0 A;  5DEZ A;  5DIV A;  1JNE A;  1KFW A;  2VCD A;  4P8U A;  5HT1 A;  2DSW A;  2DSZ A;  4MNJ A;  4TW6 A;  4DT4 A;  1LG2 A;  3AS0 A;  1GUV A;  2ETN A;  1HJW A;  1W1Y A;  3TCZ A;  2F4E A;  1FKL A;  2PPP A;  4DIP A;  1BL4 A;  3RM4 A;  2ESC A;  3FAP A;  4DWS A;  3B8S A;  1ZCN A;  2PV2 A;  3GPK A;  4P8V A;  2PV1 A;  1M5Y A;  4GIV A;  3O5I A;  3EY6 A;  4DRH A;  1ZL1 A;  3ARW A;  1FKG A;  3GTY X;  3UI5 A;  1ZBK A;  3O5G A;  2FKE A;  4DRQ A;  4DRP A;  4HBO A;  2A3E A;  1FKT A;  3O5P A;  3RGC A;  1PBK A;  3RM9 A;  3KAC A;  1XRV A;  5B8I C;  4HBE A;  1NMW A;  4L72 B;  4ZPV R;  2MLX A;  1F8A B;  5HW6 A;  2AOS A;  3VAW A;  1X6L A;  3RME A;  1T11 A;  3UQB A;  4LAV A;  1J4H A;  2AWG A;  1HKJ A;  3TDB A;  3NRK A;  2ZR6 A;  4DRI A;  2M1I A;  1JNS A;  2F2D A;  1EIB A;  1HJV A;  3NI6 A;  4TNS A;  1CTN A;  4Z2I A;  4WKA A;  2XPA A;  2ZR5 A;  4Z2K A;  3AS3 A;  2DSV A;  1ZU8 A;  4ODQ A;  3O5O A;  4JFI A;  4P8W A;  2M2A A;  5HWB A;  1FKH A;  2XP9 A;  3CH9 A;  4DRO A;  1E15 A;  3G6M A;  1WNO A;  3KAD A;  4S3K A;  1W9V A;  5HUA A;  1W1V A;  2XP4 A;  2FDM A;  1FKR A;  4TW7 A;  4ODO A;  1GPF A;  1Q6I A;  4IT4 A;  4IQ2 A;  4NSB A;  3ALG A;  3KZ7 A;  3ARV A;  2DT0 A;  3O5M A;  1X6N A;  2M08 A;  4P8X A;  4QZV B;  1R9H A;  4ODM A;  4ZPT R;  1JCH B;  4S3J A;  4ZS6 A;  2RUR A;  1HKK A;  1BKF A;  4NZC A;  2DG3 A;  2A3C A;  3WD3 A;  2YBT A;  3WL1 A;  4MSP A;  4Z2L A;  5JH8 A;  2P4V A;  4JFL A;  2OLH A;  2Y78 A;  4QIB A;  1EHN A;  3AS2 A;  4URI A;  1SR0 A;  4HAR A;  4MNK A;  4MGV A;  3PRD A;  3QOK A;  1FKJ A;  3O5J A;  2KE0 A;  1TFV A;  2ZQV A;  4Z2G A;  1OGB A;  3CHD A;  1QPL A;  2QF8 A;  2RSE A;  2DG4 A;  4BF8 A;  3ARX A;  3CZ8 A;  2LGO A;  1JVW A;  3PA7 A;  4ODL A;  3EIP A;  5DF0 A;  1F40 A;  1NWS A;  3ARO A;  2UZ5 A;  5HWC A;  2LPV A;  5GPG A;  3O5Q A;  2PPN A;  1FAP A;  3WKZ A;  1FKS A;  1UR8 A;  4LAW A;  1UR9 A;  1QPF A;  1WAW A;  1FD9 A;  3TC5 A;  3MDY B;  5GPR A;  1VF8 A;  4TW8 A;  4IPX A;  4DH0 A;  2MPH A;  3PR9 A;  1FKI A;  2K8I A;  3O5F A;  3ARY A;  1QZ2 A;  1D7J A;  1TCO C;  3ALF A;  4WKF A;  1ZBW A;  3OOB A;  3WQV A;  1P5Q A;  2DPE A;  3FY1 A;  1A7X A;  1NWT A;  4G2P A;  4DRM A;  3IK8 A;  1L1P A;  2Q5A A;  2MLZ A;  1J4I A;  2IUZ A;  2KGJ A;  2RUC A;  3CGM A;  3IKD A;  1D2K A;  1ROT A;  3ARR A;  3WL0 A;  3O5L A;  5DIT A;  2G41 A;  2IF4 A;  2O9O A;  2B31 A;  2KFW A;  1Q1C A;  4KR0 B;  1EYM A;  3ARZ A;  3IHZ A;  4WJX A;  1E44 A;  1W1T A;  3ARP A;  3O5K A;  3B7X A;  4Z2H A;  1HKM A;  2N87 A;  3UF8 A;  3NTP A;  3WD2 A;  3OA5 A;  1U79 A;  5DO2 A;  3KCE A;  4DRK A;  2LJ4 A;  1C9H A;  3ART A;  3WIJ A;  2A3B A;  4WIW A;  1FJD A;  4J4O A;  3PRB A;  4FN2 A;  3KAF A;  1NWR A;  3O5E A;  1D7I A;  5I98 A;  1NH6 A;  2B5U B;  2RUD A;  2XP3 A;  1FFQ A;  4MTV A;  5J6E A;  4XAK A;  1FKK A;  4AY1 A;  4R0X A;  3KAB A;  1FFR A;  4MAV A;  2O92 A;  2D9F A;  4ML4 A;  1O6I A;  4W5U A;  1E6P A;  1Q6H A;  2KO7 A;  4Q22 A;  3WD0 A;  3UQA A;  3ARU A;  2PBC A;  2PV3 A;  4ODP A;  4ODK A;  4U84 A;  4ZPW R;  3KAG A;  1Y0O A;  2ITK A;  3JYM A;  4DWS B; 
#chains in the Genus database with same CATH homology
 2YBU A;  4IT6 A;  3UI6 A;  4O2T A;  4WK9 A;  1LG1 A;  1ZB5 A;  1HXV A;  1HKI A;  1E9L A;  4LAY A;  1LJY A;  1NWU A;  4KQZ A;  2DT1 A;  4QT2 A;  4DWS C;  1ZK6 A;  1HJX A;  1OWQ A;  1ZBC A;  2F21 A;  2XP8 A;  3UI4 A;  2XP5 A;  1K9T A;  4MPK A;  1RD6 A;  5D75 A;  2ZQT A;  3CHF A;  1J6Y A;  4W9Q A;  4DZ2 A;  3PRA A;  2KI3 A;  3B9E A;  3O5R A;  4ODN A;  5GQB A;  1IX5 A;  3O5D A;  4JYS A;  3CHE A;  4MNL A;  2XP6 A;  4DRN A;  4L3N A;  2PPO A;  1W9P A;  3ARQ A;  1GOI A;  2ZR4 A;  4JFK A;  1FKB A;  1OGG A;  4TYO A;  1W9U A;  2MNT A;  3UQI A;  4PTM A;  4IQC A;  5DIU A;  5HW7 A;  3CGN A;  2DT3 A;  3WH0 A;  1XHG A;  2ZQS A;  3AS1 A;  2L2S A;  1SYT A;  1EQ3 A;  1J4R A;  3LUO A;  1YW5 A;  2WK2 A;  1D7H A;  4ITZ A;  3I6C A;  2MF9 A;  2WLY A;  4WKH A;  3WD1 A;  2DT2 A;  4MNM A;  2G8Z A;  2PI6 A;  1JND A;  2LKN A;  2XPB A;  4DRJ A;  4R5E A;  4QT3 A;  4U85 A;  5HTG A;  1FKD A;  1KT0 A;  4N19 A;  5HBF A;  4FAP A;  1E6Z A;  1YAT A;  4U86 A;  1LL4 A;  3ARS A;  4TX0 A;  4JFJ A;  1H0I A;  4W9P A;  2RQS A;  3AQU A;  1WB0 A;  3H9R B;  1E6N A;  1PIN A;  3ODK A;  4GGQ A;  1NSG A;  1ROU A;  4ODR A;  1N1A A;  1W1P A;  4J4N A;  3RFW A;  2MLY A;  2KR7 A;  2OFN A;  2DSU A;  3B9D A;  3G6L A;  5HKG A;  4DZ3 A;  1EDQ A;  1B6C A;  2XP7 A;  3WQW A;  2WLZ A;  3KAI A;  3IKG A;  4W9O A;  1H0G A;  4Q7N A;  1LQ0 A;  2RUQ A;  1E6R A;  1ZBV A;  1FKF A;  2A3A A;  4Z2J A;  2DG9 A;  3RM8 A;  1D6O A;  3CHC A;  4DWS D;  1NMV A;  1W26 A;  3W4R A;  5HW8 A;  4C02 B;  3WD4 A;  4NNR A;  1LL6 A;  1ITX A;  1LL7 A;  4LGX A;  3JXV A;  2VN1 A;  3BXW A;  4LAX A;  2FAP A;  2ZQU A;  3JYJ A;  3KAH A;  5BXJ A;  1JNT A;  1KT1 A;  3B9A A;  2JZV A;  4G50 A;  3FXY A;  4JFM A;  1Q6U A;  2WM0 A;  5DEZ A;  5DIV A;  1JNE A;  1KFW A;  2VCD A;  4P8U A;  5HT1 A;  2DSW A;  2DSZ A;  4MNJ A;  4TW6 A;  4DT4 A;  1LG2 A;  3AS0 A;  1GUV A;  1HJW A;  1W1Y A;  3TCZ A;  2F4E A;  1FKL A;  2PPP A;  4DIP A;  1BL4 A;  3RM4 A;  2ESC A;  3FAP A;  4DWS A;  3B8S A;  1ZCN A;  2PV2 A;  3GPK A;  4P8V A;  2PV1 A;  1M5Y A;  4GIV A;  3O5I A;  3EY6 A;  4DRH A;  1ZL1 A;  3ARW A;  1FKG A;  3UI5 A;  1ZBK A;  3O5G A;  2FKE A;  4DRQ A;  4DRP A;  4HBO A;  2A3E A;  1FKT A;  3O5P A;  3RGC A;  1PBK A;  3RM9 A;  3KAC A;  1XRV A;  5B8I C;  4HBE A;  1NMW A;  4L72 B;  4ZPV R;  2MLX A;  1F8A B;  5HW6 A;  2AOS A;  3VAW A;  1X6L A;  3RME A;  1T11 A;  3UQB A;  4LAV A;  1J4H A;  2AWG A;  1HKJ A;  3TDB A;  3NRK A;  2ZR6 A;  4DRI A;  2M1I A;  1JNS A;  2F2D A;  1EIB A;  1HJV A;  3NI6 A;  4TNS A;  1CTN A;  4Z2I A;  4WKA A;  2XPA A;  2ZR5 A;  4Z2K A;  3AS3 A;  2DSV A;  1ZU8 A;  4ODQ A;  3O5O A;  4JFI A;  4P8W A;  2M2A A;  5HWB A;  1FKH A;  2XP9 A;  3CH9 A;  4DRO A;  1E15 A;  3G6M A;  1WNO A;  3KAD A;  4S3K A;  1W9V A;  5HUA A;  1W1V A;  2XP4 A;  2FDM A;  1FKR A;  4TW7 A;  4ODO A;  1GPF A;  1Q6I A;  4IT4 A;  4IQ2 A;  4NSB A;  3ALG A;  3KZ7 A;  3ARV A;  2DT0 A;  3O5M A;  1X6N A;  2M08 A;  4P8X A;  4QZV B;  1R9H A;  4ODM A;  4ZPT R;  4S3J A;  4ZS6 A;  2RUR A;  1HKK A;  1BKF A;  4NZC A;  2DG3 A;  2A3C A;  3WD3 A;  2YBT A;  3WL1 A;  4MSP A;  4Z2L A;  5JH8 A;  4JFL A;  2OLH A;  2Y78 A;  4QIB A;  1EHN A;  3AS2 A;  4URI A;  1SR0 A;  4HAR A;  4MNK A;  4MGV A;  3PRD A;  3QOK A;  1FKJ A;  3O5J A;  2KE0 A;  1TFV A;  2ZQV A;  4Z2G A;  1OGB A;  3CHD A;  1QPL A;  2QF8 A;  2RSE A;  2DG4 A;  4BF8 A;  3ARX A;  3CZ8 A;  2LGO A;  1JVW A;  3PA7 A;  4ODL A;  5DF0 A;  1F40 A;  1NWS A;  3ARO A;  2UZ5 A;  5HWC A;  2LPV A;  5GPG A;  3O5Q A;  2PPN A;  1FAP A;  3WKZ A;  1FKS A;  1UR8 A;  4LAW A;  1UR9 A;  1QPF A;  1WAW A;  1FD9 A;  3TC5 A;  3MDY B;  5GPR A;  1VF8 A;  4TW8 A;  4IPX A;  4DH0 A;  2MPH A;  3PR9 A;  1FKI A;  2K8I A;  3O5F A;  3ARY A;  1QZ2 A;  1D7J A;  1TCO C;  3ALF A;  4WKF A;  1ZBW A;  3OOB A;  3WQV A;  1P5Q A;  2DPE A;  3FY1 A;  1A7X A;  1NWT A;  4G2P A;  4DRM A;  3IK8 A;  1L1P A;  2Q5A A;  2MLZ A;  1J4I A;  2IUZ A;  2KGJ A;  2RUC A;  3CGM A;  3IKD A;  1D2K A;  1ROT A;  3ARR A;  3WL0 A;  3O5L A;  5DIT A;  2G41 A;  2IF4 A;  2O9O A;  2B31 A;  2KFW A;  1Q1C A;  4KR0 B;  1EYM A;  3ARZ A;  3IHZ A;  4WJX A;  1W1T A;  3ARP A;  3O5K A;  3B7X A;  4Z2H A;  1HKM A;  2N87 A;  3UF8 A;  3NTP A;  3WD2 A;  3OA5 A;  1U79 A;  5DO2 A;  3KCE A;  4DRK A;  2LJ4 A;  1C9H A;  3ART A;  3WIJ A;  2A3B A;  4WIW A;  1FJD A;  4J4O A;  3PRB A;  4FN2 A;  3KAF A;  1NWR A;  3O5E A;  1D7I A;  5I98 A;  1NH6 A;  2RUD A;  2XP3 A;  1FFQ A;  4MTV A;  5J6E A;  4XAK A;  1FKK A;  4AY1 A;  4R0X A;  3KAB A;  1FFR A;  4MAV A;  2O92 A;  2D9F A;  4ML4 A;  1O6I A;  4W5U A;  1E6P A;  1Q6H A;  2KO7 A;  4Q22 A;  3WD0 A;  3UQA A;  3ARU A;  2PBC A;  2PV3 A;  4ODP A;  4ODK A;  4U84 A;  4ZPW R;  3KAG A;  1Y0O A;  2ITK A;  3JYM A;  4DWS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...