4JFMA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 2-(3,4-dimethoxyphenoxy)ethyl (2s)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfmA00
3O5KA 4IPXA 1J4IA 2XP6A 2ZQUA 4DZ2A 3OOBA 1P5QA 2M1IA 4DIPA 1F40A 3IK8A 4R0XA 3UI4A 2FAPA 3JYMA 4DRIA 1EYMA 4JYSA 1TCOC 1FKKA 3TC5A 4DT4A 5B8IC 2RSEA 2ZQTA 1U79A 2RUQA 3NRKA 5HWBA 2DG3A 2VCDA 4MSPA 4C02B 2KR7A 1PBKA 1FKHA 1J4HA 1NSGA 4GIVA 5I98A 1FKSA 2XPBA 2F4EA 1KT1A 1FAPA 3UI6A 5HKGA 3PA7A 3IKGA 3WH0A 3O5PA 1FKGA 2DG9A 1FJDA 2FKEA 2VN1A 4U85A 4ODLA 1J4RA 4JFJA 4N19A 2K8IA 2DG4A 2ZQVA 2LKNA 3GPKA 1FKIA 1KT0A 1EQ3A 4ITZA 2KI3A 2ZR4A 2RUDA 3O5OA 3KADA 2IF4A 4TX0A 1ZCNA 1HXVA 3I6CA 1ZK6A 2LPVA 1FKTA 1YW5A 4W9OA 2XP9A 4JFMA 2KFWA 1JNTA 5HW7A 1FKJA 2KGJA 3O5GA 2ZR6A 3H9RB 3UQBA 2MLZA 4ODPA 4DRPA 2ITKA 2PPPA 4TNSA 4O2TA 2XP4A 4U86A 3O5DA 2LGOA 3ODKA 5BXJA 3EY6A 3O5JA 2MPHA 3KAGA 1T11A 2MLYA 4TW7A 4DRNA 5HW6A 5HWCA 1BL4A 3MDYB 2L2SA 3TCZA 1FD9A 1L1PA 3KAHA 2ZR5A 3NTPA 4FN2A 2PV2A 2PV1A 2KE0A 4W9PA 2MF9A 3CGMA 3LUOA 1QZ2A 4QT2A 4W9QA 5DIVA 4IQCA 4TW6A 4DH0A 2M2AA 4DRJA 1FKLA 4J4NA 4ODRA 1ROTA 2RUCA 1ROUA 2XP5A 3JXVA 1N1AA 3KCEA 3O5QA 4LAVA 4MGVA 1QPLA 5HUAA 3TDBA 1J6YA 1D7JA 2D9FA 1Q6IA 4ODQA 3UI5A 3CGNA 2AWGA 3O5MA 4LAWA 2ZQSA 2LJ4A 2RQSA 3PRBA 3O5FA 2PPOA 5D75A 2OFNA 5HTGA 5GPGA 1FKDA 2XP8A 1Q6UA 4DROA 5HT1A 2RURA 2PPNA 4J4OA 3KAFA 3PRDA 4ODNA 2N87A 5J6EA 1D7HA 2MLXA 2Y78A 3UQIA 1Q1CA 1W26A 3JYJA 1QPFA 4IQ2A 4ODKA 5DITA 2PV3A 1A7XA 5DIUA 3KABA 3NI6A 4QIBA 3RFWA 1BKFA 4DZ3A 1FKRA 1JNSA 1B6CA 1M5YA 2KO7A 3KACA 4DRQA 4JFIA 1FKBA 3O5RA 4QT3A 4TYOA 4JFKA 4DRKA 3UQAA 4LAXA 4TW8A 4FAPA 4DRMA 2F2DA 1JVWA 1FKFA 3KZ7A 4U84A 1NMVA 3FAPA 1C9HA 4LAYA 4DRHA 2PBCA 1YATA 2M08A 1D7IA 2XP3A 2MNTA 3O5EA 4G2PA 1D6OA 2XP7A 3KAIA 4GGQA 4JFLA 3B7XA 3RGCA 3UF8A 5HW8A 4NNRA 3IKDA 3O5LA 1Q6HA 3O5IA 2UZ5A 1NMWA 1PINA 1Y0OA 2XPAA 3IHZA 4BF8A 2F21A 3VAWA 4ODMA 1R9HA 1F8AB 2JZVA 4G50A 4ODOA 2Q5AA
chains in the Genus database with same CATH superfamily
3O5KA 2ZQUA 3ARRA 4DZ2A 2DT1A 4HBOA 2OLHA 4DIPA 3IK8A 1E9LA 2A3BA 3WD0A 5JH8A 1TCOC 4DT4A 3TC5A 4ZPVR 2RSEA 3CHEA 3NRKA 4R5EA 5HWBA 1FKHA 4AY1A 3IKGA 3GTYX 1NWUA 3O5PA 4U85A 3WD4A 4MTVA 3B9AA 1FKIA 1GUVA 3B8SA 4TX0A 2IF4A 2A3AA 1HXVA 3I6CA 3WIJA 1FKTA 4UDMA 1JNTA 2KGJA 3H9RB 4W5UA 4ODPA 2ITKA 2PPPA 4P8UA 3ALFA 5BXJA 1OGGA 2MPHA 5HWCA 1T11A 2F23A 4DRNA 4Z2JA 1BL4A 4ZPTR 3LUOA 1OGBA 2B5UB 3JXVA 1WAWA 1ROUA 2XP5A 3CHFA 4LAVA 4MGVA 1Q6IA 3WQWA 4MAVA 3ARUA 5D75A 2OFNA 2DSWA 5GPGA 2PPNA 4J4OA 4ODNA 2Y78A 2MLXA 3UQIA 1W26A 1HJWA 3ARZA 1A7XA 4MNLA 1FFRA 1W1PA 3NI6A 4DWSB 1D2KA 1LL7A 1M5YA 3WL0A 4ML4A 4Z2KA 4JFIA 4QT3A 2G41A 2DPEA 3CHCA 4TW8A 1ZU8A 1NMVA 3BMBA 4LAYA 4DRHA 2PBCA 1D7IA 3RGCA 3O5IA 3AS2A 2XPAA 1ZBVA 4S3KA 4G50A 3ARYA 1JNEA 1F40A 1RD6A 4KQZA 1OWQA 4MNJA 4WKFA 3AROA 4NSBA 1FKKA 2ZQTA 1W9VA 3AS1A 5I98A 1HJXA 5HKGA 2G8ZA 3PA7A 2DG9A 3ARSA 1FJDA 2ESCA 2EULA 1JCHB 4JFJA 4N19A 2FDMA 1W9UA 2DG4A 2DSZA 2ZQVA 4LGXA 4ZS6A 3GPKA 1KT0A 1GOIA 1EQ3A 1HJVA 1ZCNA 2DT2A 1H0GA 2LPVA 3G6MA 4JFMA 4WJXA 2ZR6A 2MLZA 4DRPA 2XP4A 3ALGA 3EY6A 3O5JA 1NWTA 5HW6A 1W1VA 2ZR5A 3WQVA 4DWSD 4FN2A 2PV1A 2A3CA 4WK9A 2O92A 4IQCA 3ARQA 4TW6A 2WK2A 2RUCA 5HUAA 1UR8A 2AOSA 3O5MA 4LAWA 1ZBKA 2ZQSA 4Q7NA 4IT4A 4MNMA 2XP8A 2YBTA 1Q6UA 1H0IA 4HBEA 3PRDA 2N87A 1D7HA 4ODKA 3KABA 4QIBA 1BKFA 4DZ3A 3ARXA 1JNSA 1B6CA 3KACA 4DRQA 4Z2GA 4LAXA 4WKAA 1JVWA 2B31A 3KZ7A 4U84A 3GU0A 4XAKA 2M08A 3WD1A 2MNTA 4G2PA 4JFLA 3B7XA 1E6ZA 4NNRA 3O5LA 4WIWA 1PINA 3RM4A 2F21A 3VAWA 1R9HA 1NWRA 1HKJA 4IPXA 2XP6A 4P8XA 1P5QA 2M1IA 4R0XA 1HKKA 2FAPA 4JYSA 1LG1A 5B8IC 1SR0A 2RUQA 4P8WA 4HARA 4MSPA 3AQUA 1PBKA 3CH9A 4GIVA 1J4HA 2XPBA 1NWSA 2F4EA 1KT1A 5GQBA 1XHGA 5HBFA 1FKGA 3CZ8A 1X6LA 1J4RA 4ITZA 2KI3A 3O5OA 3KADA 3OA5A 1LJYA 1VF8A 1ZK6A 1TFVA 2PI6A 2XP9A 1FKJA 4O2TA 1HKMA 3CHDA 4U86A 3O5DA 2LGOA 3ODKA 1W1YA 2MLYA 1HKIA 3MDYB 3ARTA 2L2SA 3TCZA 1FD9A 3KAHA 1LG2A 3NTPA 2KE0A 1O6IA 4MNKA 4W9PA 4QT2A 4W9QA 5DIVA 1GRJA 2DT3A 2M2AA 1FKLA 4ODRA 4QZVB 3KCEA 3AS3A 4DRJA 1N1AA 1QPLA 1J6YA 1D7JA 3UI5A 3CGNA 2AWGA 3B9DA 3O5FA 2PPOA 4DROA 1X6NA 1ZB5A 3KAFA 2WLZA 4WKHA 3JYJA 5DITA 4IQ2A 2PV3A 5DIUA 4L72B 3RFWA 3BXWA 2KO7A 3FY1A 5DO2A 1FKBA 3O5RA 4DRKA 1IX5A 1EIBA 4P8VA 2F2DA 1ZBCA 3FAPA 3B9EA 2QF8A 1CTNA 2XP3A 5HW8A 1D6OA 2XP7A 4GGQA 3UF8A 3IKDA 1E6NA 2UZ5A 1NMWA 4BF8A 1E6PA 4ODMA 2WM0A 2JZVA 4ODOA 5DEZA 1J4IA 2DSUA 3OOBA 1ZL1A 3UI4A 3JYMA 4DRIA 3AS0A 1WB0A 1EYMA 4Z2HA 1EHNA 3RM8A 1U79A 2DSVA 2DG3A 1LQ0A 2VCDA 4S3JA 4C02B 2KR7A 1NSGA 1FKSA 1FAPA 1LL6A 3UI6A 5GPRA 3WH0A 4MPKA 2FKEA 2VN1A 2WLYA 4L3NA 4ODLA 4URIA 4Z2IA 2K8IA 1XRVA 2LKNA 4PTMA 3RMEA 3WD3A 4IT6A 1WNOA 2ZR4A 2RUDA 2IUZA 1YW5A 2PN0A 4W9OA 5HW7A 3ARVA 2KFWA 3O5GA 3UQBA 2O9OA 1W9PA 3WD2A 1EDQA 4TNSA 2A3EA 1LL4A 1NH6A 4DWSC 3KAGA 4TW7A 4Q22A 3W4RA 3EIPA 1L1PA 1UR9A 1E44A 3WL1A 2PV2A 2MF9A 4ZPWR 3CGMA 3ARWA 1QZ2A 2YBUA 3G6LA 3ARPA 1E15A 3FXYA 4DH0A 2DT0A 2P4VA 4J4NA 1ROTA 3O5QA 3TDBA 1E6RA 2D9FA 4ODQA 4DWSA 2LJ4A 2RQSA 1ITXA 3PRBA 5DF0A 5HTGA 3QOKA 1FKDA 5HT1A 2RURA 4Z2LA 5J6EA 4FAPA 4KR0B 1Q1CA 1QPFA 1KFWA 3PRAA 1JNDA 1FKRA 1GPFA 3PR9A 3RM9A 4TYOA 4JFKA 4DRMA 1FKFA 1K9TA 1C9HA 1FFQA 1YATA 1W1TA 4NZCA 3O5EA 3KAIA 1ZBWA 1Q6HA 3IHZA 1Y0OA 2ETNA 3WKZA 1SYTA 1F8AB 3UQAA 2Q5AA
chains in the Genus database with same CATH topology
3O5KA 2ZQUA 3ARRA 4DZ2A 2DT1A 4HBOA 2OLHA 4DIPA 3IK8A 1E9LA 2A3BA 3WD0A 5JH8A 1TCOC 4DT4A 3TC5A 4ZPVR 2RSEA 3CHEA 3NRKA 4R5EA 5HWBA 1FKHA 4AY1A 3IKGA 1NWUA 3O5PA 4U85A 3WD4A 4MTVA 3B9AA 1FKIA 1GUVA 3B8SA 4TX0A 2IF4A 2A3AA 1HXVA 3I6CA 3WIJA 1FKTA 1JNTA 2KGJA 3H9RB 4W5UA 4ODPA 2ITKA 2PPPA 4P8UA 3ALFA 5BXJA 1OGGA 2MPHA 5HWCA 1T11A 4DRNA 4Z2JA 1BL4A 4ZPTR 3LUOA 1OGBA 3JXVA 1WAWA 1ROUA 2XP5A 3CHFA 4LAVA 4MGVA 1Q6IA 3WQWA 4MAVA 3ARUA 5D75A 2OFNA 2DSWA 5GPGA 2PPNA 4J4OA 4ODNA 2Y78A 2MLXA 3UQIA 1W26A 1HJWA 3ARZA 1A7XA 4MNLA 1FFRA 1W1PA 3NI6A 4DWSB 1D2KA 1LL7A 1M5YA 3WL0A 4ML4A 4Z2KA 4JFIA 4QT3A 2G41A 2DPEA 3CHCA 4TW8A 1ZU8A 1NMVA 4LAYA 4DRHA 2PBCA 1D7IA 3RGCA 3O5IA 3AS2A 2XPAA 1ZBVA 4S3KA 4G50A 3ARYA 1JNEA 1F40A 1RD6A 4KQZA 1OWQA 4MNJA 4WKFA 3AROA 4NSBA 1FKKA 2ZQTA 1W9VA 3AS1A 5I98A 1HJXA 5HKGA 2G8ZA 3PA7A 2DG9A 3ARSA 1FJDA 2ESCA 4JFJA 4N19A 2FDMA 1W9UA 2DG4A 2DSZA 2ZQVA 4LGXA 4ZS6A 3GPKA 1KT0A 1GOIA 1EQ3A 1HJVA 1ZCNA 2DT2A 1H0GA 2LPVA 3G6MA 4JFMA 4WJXA 2ZR6A 2MLZA 4DRPA 2XP4A 3ALGA 3EY6A 3O5JA 1NWTA 5HW6A 1W1VA 2ZR5A 3WQVA 4DWSD 4FN2A 2PV1A 2A3CA 4WK9A 2O92A 4IQCA 3ARQA 4TW6A 2WK2A 2RUCA 5HUAA 1UR8A 2AOSA 3O5MA 4LAWA 1ZBKA 2ZQSA 4Q7NA 4IT4A 4MNMA 2XP8A 2YBTA 1Q6UA 1H0IA 4HBEA 3PRDA 2N87A 1D7HA 4ODKA 3KABA 4QIBA 1BKFA 4DZ3A 3ARXA 1JNSA 1B6CA 3KACA 4DRQA 4Z2GA 4LAXA 4WKAA 1JVWA 2B31A 3KZ7A 4U84A 4XAKA 2M08A 3WD1A 2MNTA 4G2PA 4JFLA 3B7XA 1E6ZA 4NNRA 3O5LA 4WIWA 1PINA 3RM4A 2F21A 3VAWA 1R9HA 1HKJA 1NWRA 4IPXA 2XP6A 4P8XA 1P5QA 2M1IA 4R0XA 1HKKA 2FAPA 4JYSA 1LG1A 5B8IC 1SR0A 2RUQA 4P8WA 4HARA 4MSPA 3AQUA 1PBKA 3CH9A 4GIVA 1J4HA 2XPBA 1NWSA 2F4EA 1KT1A 5GQBA 1XHGA 5HBFA 1FKGA 3CZ8A 1X6LA 1J4RA 4ITZA 2KI3A 3O5OA 3KADA 3OA5A 1LJYA 1VF8A 1ZK6A 1TFVA 2PI6A 2XP9A 1FKJA 4O2TA 1HKMA 3CHDA 4U86A 3O5DA 2LGOA 3ODKA 1W1YA 2MLYA 1HKIA 3MDYB 3ARTA 2L2SA 3TCZA 1FD9A 3KAHA 1LG2A 3NTPA 2KE0A 1O6IA 4MNKA 4W9PA 4QT2A 4W9QA 5DIVA 2M2AA 2DT3A 4DRJA 1FKLA 4ODRA 4QZVB 3KCEA 3AS3A 1N1AA 1QPLA 1J6YA 1D7JA 3UI5A 3CGNA 2AWGA 3B9DA 3O5FA 2PPOA 4DROA 1X6NA 1ZB5A 3KAFA 2WLZA 4WKHA 3JYJA 5DITA 4IQ2A 2PV3A 5DIUA 4L72B 3RFWA 3BXWA 2KO7A 3FY1A 5DO2A 1FKBA 3O5RA 4DRKA 1IX5A 1EIBA 4P8VA 2F2DA 1ZBCA 3FAPA 3B9EA 2QF8A 1CTNA 2XP3A 5HW8A 1D6OA 2XP7A 4GGQA 3UF8A 3IKDA 1E6NA 2UZ5A 1NMWA 4BF8A 1E6PA 4ODMA 2WM0A 2JZVA 4ODOA 5DEZA 1J4IA 2DSUA 3OOBA 1ZL1A 3UI4A 3JYMA 4DRIA 3AS0A 1WB0A 1EYMA 4Z2HA 1EHNA 3RM8A 1U79A 2DSVA 2DG3A 1LQ0A 2VCDA 4S3JA 4C02B 2KR7A 1NSGA 1FKSA 1FAPA 1LL6A 3UI6A 5GPRA 3WH0A 4MPKA 2FKEA 2VN1A 2WLYA 4L3NA 4ODLA 4URIA 4Z2IA 2K8IA 1XRVA 2LKNA 4PTMA 3RMEA 3WD3A 4IT6A 1WNOA 2ZR4A 2RUDA 2IUZA 1YW5A 4W9OA 5HW7A 3ARVA 2KFWA 3O5GA 3UQBA 2O9OA 1W9PA 3WD2A 1EDQA 4TNSA 2A3EA 1LL4A 1NH6A 4DWSC 3KAGA 4TW7A 4Q22A 3W4RA 1L1PA 1UR9A 3WL1A 2PV2A 2MF9A 4ZPWR 3CGMA 3ARWA 1QZ2A 2YBUA 3G6LA 3ARPA 1E15A 3FXYA 4DH0A 2DT0A 4J4NA 1ROTA 3O5QA 3TDBA 1E6RA 2D9FA 4ODQA 4DWSA 2LJ4A 2RQSA 1ITXA 3PRBA 5DF0A 5HTGA 3QOKA 1FKDA 5HT1A 2RURA 4Z2LA 5J6EA 4FAPA 4KR0B 1Q1CA 1QPFA 1KFWA 3PRAA 1JNDA 1FKRA 1GPFA 3PR9A 3RM9A 4TYOA 4JFKA 4DRMA 1FKFA 1K9TA 1C9HA 1FFQA 1YATA 1W1TA 4NZCA 3O5EA 3KAIA 1ZBWA 1Q6HA 3IHZA 1Y0OA 3WKZA 1SYTA 1F8AB 3UQAA 2Q5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5K A;  4IPX A;  1J4I A;  2XP6 A;  2ZQU A;  4DZ2 A;  3OOB A;  1P5Q A;  2M1I A;  4DIP A;  1F40 A;  3IK8 A;  4R0X A;  3UI4 A;  2FAP A;  3JYM A;  4DRI A;  1EYM A;  4JYS A;  1TCO C;  1FKK A;  3TC5 A;  4DT4 A;  5B8I C;  2RSE A;  2ZQT A;  1U79 A;  2RUQ A;  3NRK A;  5HWB A;  2DG3 A;  2VCD A;  4MSP A;  4C02 B;  2KR7 A;  1PBK A;  1FKH A;  1J4H A;  1NSG A;  4GIV A;  5I98 A;  1FKS A;  2XPB A;  2F4E A;  1KT1 A;  1FAP A;  3UI6 A;  5HKG A;  3PA7 A;  3IKG A;  3WH0 A;  3O5P A;  1FKG A;  2DG9 A;  1FJD A;  2FKE A;  2VN1 A;  4U85 A;  4ODL A;  1J4R A;  4JFJ A;  4N19 A;  2K8I A;  2DG4 A;  2ZQV A;  2LKN A;  3GPK A;  1FKI A;  1KT0 A;  1EQ3 A;  4ITZ A;  2KI3 A;  2ZR4 A;  2RUD A;  3O5O A;  3KAD A;  2IF4 A;  4TX0 A;  1ZCN A;  1HXV A;  3I6C A;  1ZK6 A;  2LPV A;  1FKT A;  1YW5 A;  4W9O A;  2XP9 A;  4JFM A;  2KFW A;  1JNT A;  5HW7 A;  1FKJ A;  2KGJ A;  3O5G A;  2ZR6 A;  3H9R B;  3UQB A;  2MLZ A;  4ODP A;  4DRP A;  2ITK A;  2PPP A;  4TNS A;  4O2T A;  2XP4 A;  4U86 A;  3O5D A;  2LGO A;  3ODK A;  5BXJ A;  3EY6 A;  3O5J A;  2MPH A;  3KAG A;  1T11 A;  2MLY A;  4TW7 A;  4DRN A;  5HW6 A;  5HWC A;  1BL4 A;  3MDY B;  2L2S A;  3TCZ A;  1FD9 A;  1L1P A;  3KAH A;  2ZR5 A;  3NTP A;  4FN2 A;  2PV2 A;  2PV1 A;  2KE0 A;  4W9P A;  2MF9 A;  3CGM A;  3LUO A;  1QZ2 A;  4QT2 A;  4W9Q A;  5DIV A;  4IQC A;  4TW6 A;  4DH0 A;  2M2A A;  4DRJ A;  1FKL A;  4J4N A;  4ODR A;  1ROT A;  2RUC A;  1ROU A;  2XP5 A;  3JXV A;  1N1A A;  3KCE A;  3O5Q A;  4LAV A;  4MGV A;  1QPL A;  5HUA A;  3TDB A;  1J6Y A;  1D7J A;  2D9F A;  1Q6I A;  4ODQ A;  3UI5 A;  3CGN A;  2AWG A;  3O5M A;  4LAW A;  2ZQS A;  2LJ4 A;  2RQS A;  3PRB A;  3O5F A;  2PPO A;  5D75 A;  2OFN A;  5HTG A;  5GPG A;  1FKD A;  2XP8 A;  1Q6U A;  4DRO A;  5HT1 A;  2RUR A;  2PPN A;  4J4O A;  3KAF A;  3PRD A;  4ODN A;  2N87 A;  5J6E A;  1D7H A;  2MLX A;  2Y78 A;  3UQI A;  1Q1C A;  1W26 A;  3JYJ A;  1QPF A;  4IQ2 A;  4ODK A;  5DIT A;  2PV3 A;  1A7X A;  5DIU A;  3KAB A;  3NI6 A;  4QIB A;  3RFW A;  1BKF A;  4DZ3 A;  1FKR A;  1JNS A;  1B6C A;  1M5Y A;  2KO7 A;  3KAC A;  4DRQ A;  4JFI A;  1FKB A;  3O5R A;  4QT3 A;  4TYO A;  4JFK A;  4DRK A;  3UQA A;  4LAX A;  4TW8 A;  4FAP A;  4DRM A;  2F2D A;  1JVW A;  1FKF A;  3KZ7 A;  4U84 A;  1NMV A;  3FAP A;  1C9H A;  4LAY A;  4DRH A;  2PBC A;  1YAT A;  2M08 A;  1D7I A;  2XP3 A;  2MNT A;  3O5E A;  4G2P A;  1D6O A;  2XP7 A;  3KAI A;  4GGQ A;  4JFL A;  3B7X A;  3RGC A;  3UF8 A;  5HW8 A;  4NNR A;  3IKD A;  3O5L A;  1Q6H A;  3O5I A;  2UZ5 A;  1NMW A;  1PIN A;  1Y0O A;  2XPA A;  3IHZ A;  4BF8 A;  2F21 A;  3VAW A;  4ODM A;  1R9H A;  1F8A B;  2JZV A;  4G50 A;  4ODO A;  2Q5A A; 
#chains in the Genus database with same CATH topology
 3O5K A;  2ZQU A;  3ARR A;  4DZ2 A;  2DT1 A;  4HBO A;  2OLH A;  4DIP A;  3IK8 A;  1E9L A;  2A3B A;  3WD0 A;  5JH8 A;  1TCO C;  4DT4 A;  3TC5 A;  4ZPV R;  2RSE A;  3CHE A;  3NRK A;  4R5E A;  5HWB A;  1FKH A;  4AY1 A;  3IKG A;  3GTY X;  1NWU A;  3O5P A;  4U85 A;  3WD4 A;  4MTV A;  3B9A A;  1FKI A;  1GUV A;  3B8S A;  4TX0 A;  2IF4 A;  2A3A A;  1HXV A;  3I6C A;  3WIJ A;  1FKT A;  4UDM A;  1JNT A;  2KGJ A;  3H9R B;  4W5U A;  4ODP A;  2ITK A;  2PPP A;  4P8U A;  3ALF A;  5BXJ A;  1OGG A;  2MPH A;  5HWC A;  1T11 A;  2F23 A;  4DRN A;  4Z2J A;  1BL4 A;  4ZPT R;  3LUO A;  1OGB A;  2B5U B;  3JXV A;  1WAW A;  1ROU A;  2XP5 A;  3CHF A;  4LAV A;  4MGV A;  1Q6I A;  3WQW A;  4MAV A;  3ARU A;  5D75 A;  2OFN A;  2DSW A;  5GPG A;  2PPN A;  4J4O A;  4ODN A;  2Y78 A;  2MLX A;  3UQI A;  1W26 A;  1HJW A;  3ARZ A;  1A7X A;  4MNL A;  1FFR A;  1W1P A;  3NI6 A;  4DWS B;  1D2K A;  1LL7 A;  1M5Y A;  3WL0 A;  4ML4 A;  4Z2K A;  4JFI A;  4QT3 A;  2G41 A;  2DPE A;  3CHC A;  4TW8 A;  1ZU8 A;  1NMV A;  3BMB A;  4LAY A;  4DRH A;  2PBC A;  1D7I A;  3RGC A;  3O5I A;  3AS2 A;  2XPA A;  1ZBV A;  4S3K A;  4G50 A;  3ARY A;  1JNE A;  1F40 A;  1RD6 A;  4KQZ A;  1OWQ A;  4MNJ A;  4WKF A;  3ARO A;  4NSB A;  1FKK A;  2ZQT A;  1W9V A;  3AS1 A;  5I98 A;  1HJX A;  5HKG A;  2G8Z A;  3PA7 A;  2DG9 A;  3ARS A;  1FJD A;  2ESC A;  2EUL A;  1JCH B;  4JFJ A;  4N19 A;  2FDM A;  1W9U A;  2DG4 A;  2DSZ A;  2ZQV A;  4LGX A;  4ZS6 A;  3GPK A;  1KT0 A;  1GOI A;  1EQ3 A;  1HJV A;  1ZCN A;  2DT2 A;  1H0G A;  2LPV A;  3G6M A;  4JFM A;  4WJX A;  2ZR6 A;  2MLZ A;  4DRP A;  2XP4 A;  3ALG A;  3EY6 A;  3O5J A;  1NWT A;  5HW6 A;  1W1V A;  2ZR5 A;  3WQV A;  4DWS D;  4FN2 A;  2PV1 A;  2A3C A;  4WK9 A;  2O92 A;  4IQC A;  3ARQ A;  4TW6 A;  2WK2 A;  2RUC A;  5HUA A;  1UR8 A;  2AOS A;  3O5M A;  4LAW A;  1ZBK A;  2ZQS A;  4Q7N A;  4IT4 A;  4MNM A;  2XP8 A;  2YBT A;  1Q6U A;  1H0I A;  4HBE A;  3PRD A;  2N87 A;  1D7H A;  4ODK A;  3KAB A;  4QIB A;  1BKF A;  4DZ3 A;  3ARX A;  1JNS A;  1B6C A;  3KAC A;  4DRQ A;  4Z2G A;  4LAX A;  4WKA A;  1JVW A;  2B31 A;  3KZ7 A;  4U84 A;  3GU0 A;  4XAK A;  2M08 A;  3WD1 A;  2MNT A;  4G2P A;  4JFL A;  3B7X A;  1E6Z A;  4NNR A;  3O5L A;  4WIW A;  1PIN A;  3RM4 A;  2F21 A;  3VAW A;  1R9H A;  1NWR A;  1HKJ A;  4IPX A;  2XP6 A;  4P8X A;  1P5Q A;  2M1I A;  4R0X A;  1HKK A;  2FAP A;  4JYS A;  1LG1 A;  5B8I C;  1SR0 A;  2RUQ A;  4P8W A;  4HAR A;  4MSP A;  3AQU A;  1PBK A;  3CH9 A;  4GIV A;  1J4H A;  2XPB A;  1NWS A;  2F4E A;  1KT1 A;  5GQB A;  1XHG A;  5HBF A;  1FKG A;  3CZ8 A;  1X6L A;  1J4R A;  4ITZ A;  2KI3 A;  3O5O A;  3KAD A;  3OA5 A;  1LJY A;  1VF8 A;  1ZK6 A;  1TFV A;  2PI6 A;  2XP9 A;  1FKJ A;  4O2T A;  1HKM A;  3CHD A;  4U86 A;  3O5D A;  2LGO A;  3ODK A;  1W1Y A;  2MLY A;  1HKI A;  3MDY B;  3ART A;  2L2S A;  3TCZ A;  1FD9 A;  3KAH A;  1LG2 A;  3NTP A;  2KE0 A;  1O6I A;  4MNK A;  4W9P A;  4QT2 A;  4W9Q A;  5DIV A;  1GRJ A;  2DT3 A;  2M2A A;  1FKL A;  4ODR A;  4QZV B;  3KCE A;  3AS3 A;  4DRJ A;  1N1A A;  1QPL A;  1J6Y A;  1D7J A;  3UI5 A;  3CGN A;  2AWG A;  3B9D A;  3O5F A;  2PPO A;  4DRO A;  1X6N A;  1ZB5 A;  3KAF A;  2WLZ A;  4WKH A;  3JYJ A;  5DIT A;  4IQ2 A;  2PV3 A;  5DIU A;  4L72 B;  3RFW A;  3BXW A;  2KO7 A;  3FY1 A;  5DO2 A;  1FKB A;  3O5R A;  4DRK A;  1IX5 A;  1EIB A;  4P8V A;  2F2D A;  1ZBC A;  3FAP A;  3B9E A;  2QF8 A;  1CTN A;  2XP3 A;  5HW8 A;  1D6O A;  2XP7 A;  4GGQ A;  3UF8 A;  3IKD A;  1E6N A;  2UZ5 A;  1NMW A;  4BF8 A;  1E6P A;  4ODM A;  2WM0 A;  2JZV A;  4ODO A;  5DEZ A;  1J4I A;  2DSU A;  3OOB A;  1ZL1 A;  3UI4 A;  3JYM A;  4DRI A;  3AS0 A;  1WB0 A;  1EYM A;  4Z2H A;  1EHN A;  3RM8 A;  1U79 A;  2DSV A;  2DG3 A;  1LQ0 A;  2VCD A;  4S3J A;  4C02 B;  2KR7 A;  1NSG A;  1FKS A;  1FAP A;  1LL6 A;  3UI6 A;  5GPR A;  3WH0 A;  4MPK A;  2FKE A;  2VN1 A;  2WLY A;  4L3N A;  4ODL A;  4URI A;  4Z2I A;  2K8I A;  1XRV A;  2LKN A;  4PTM A;  3RME A;  3WD3 A;  4IT6 A;  1WNO A;  2ZR4 A;  2RUD A;  2IUZ A;  1YW5 A;  2PN0 A;  4W9O A;  5HW7 A;  3ARV A;  2KFW A;  3O5G A;  3UQB A;  2O9O A;  1W9P A;  3WD2 A;  1EDQ A;  4TNS A;  2A3E A;  1LL4 A;  1NH6 A;  4DWS C;  3KAG A;  4TW7 A;  4Q22 A;  3W4R A;  3EIP A;  1L1P A;  1UR9 A;  1E44 A;  3WL1 A;  2PV2 A;  2MF9 A;  4ZPW R;  3CGM A;  3ARW A;  1QZ2 A;  2YBU A;  3G6L A;  3ARP A;  1E15 A;  3FXY A;  4DH0 A;  2DT0 A;  2P4V A;  4J4N A;  1ROT A;  3O5Q A;  3TDB A;  1E6R A;  2D9F A;  4ODQ A;  4DWS A;  2LJ4 A;  2RQS A;  1ITX A;  3PRB A;  5DF0 A;  5HTG A;  3QOK A;  1FKD A;  5HT1 A;  2RUR A;  4Z2L A;  5J6E A;  4FAP A;  4KR0 B;  1Q1C A;  1QPF A;  1KFW A;  3PRA A;  1JND A;  1FKR A;  1GPF A;  3PR9 A;  3RM9 A;  4TYO A;  4JFK A;  4DRM A;  1FKF A;  1K9T A;  1C9H A;  1FFQ A;  1YAT A;  1W1T A;  4NZC A;  3O5E A;  3KAI A;  1ZBW A;  1Q6H A;  3IHZ A;  1Y0O A;  2ETN A;  3WKZ A;  1SYT A;  1F8A B;  3UQA A;  2Q5A A; 
#chains in the Genus database with same CATH homology
 3O5K A;  2ZQU A;  3ARR A;  4DZ2 A;  2DT1 A;  4HBO A;  2OLH A;  4DIP A;  3IK8 A;  1E9L A;  2A3B A;  3WD0 A;  5JH8 A;  1TCO C;  4DT4 A;  3TC5 A;  4ZPV R;  2RSE A;  3CHE A;  3NRK A;  4R5E A;  5HWB A;  1FKH A;  4AY1 A;  3IKG A;  1NWU A;  3O5P A;  4U85 A;  3WD4 A;  4MTV A;  3B9A A;  1FKI A;  1GUV A;  3B8S A;  4TX0 A;  2IF4 A;  2A3A A;  1HXV A;  3I6C A;  3WIJ A;  1FKT A;  1JNT A;  2KGJ A;  3H9R B;  4W5U A;  4ODP A;  2ITK A;  2PPP A;  4P8U A;  3ALF A;  5BXJ A;  1OGG A;  2MPH A;  5HWC A;  1T11 A;  4DRN A;  4Z2J A;  1BL4 A;  4ZPT R;  3LUO A;  1OGB A;  3JXV A;  1WAW A;  1ROU A;  2XP5 A;  3CHF A;  4LAV A;  4MGV A;  1Q6I A;  3WQW A;  4MAV A;  3ARU A;  5D75 A;  2OFN A;  2DSW A;  5GPG A;  2PPN A;  4J4O A;  4ODN A;  2Y78 A;  2MLX A;  3UQI A;  1W26 A;  1HJW A;  3ARZ A;  1A7X A;  4MNL A;  1FFR A;  1W1P A;  3NI6 A;  4DWS B;  1D2K A;  1LL7 A;  1M5Y A;  3WL0 A;  4ML4 A;  4Z2K A;  4JFI A;  4QT3 A;  2G41 A;  2DPE A;  3CHC A;  4TW8 A;  1ZU8 A;  1NMV A;  4LAY A;  4DRH A;  2PBC A;  1D7I A;  3RGC A;  3O5I A;  3AS2 A;  2XPA A;  1ZBV A;  4S3K A;  4G50 A;  3ARY A;  1JNE A;  1F40 A;  1RD6 A;  4KQZ A;  1OWQ A;  4MNJ A;  4WKF A;  3ARO A;  4NSB A;  1FKK A;  2ZQT A;  1W9V A;  3AS1 A;  5I98 A;  1HJX A;  5HKG A;  2G8Z A;  3PA7 A;  2DG9 A;  3ARS A;  1FJD A;  2ESC A;  4JFJ A;  4N19 A;  2FDM A;  1W9U A;  2DG4 A;  2DSZ A;  2ZQV A;  4LGX A;  4ZS6 A;  3GPK A;  1KT0 A;  1GOI A;  1EQ3 A;  1HJV A;  1ZCN A;  2DT2 A;  1H0G A;  2LPV A;  3G6M A;  4JFM A;  4WJX A;  2ZR6 A;  2MLZ A;  4DRP A;  2XP4 A;  3ALG A;  3EY6 A;  3O5J A;  1NWT A;  5HW6 A;  1W1V A;  2ZR5 A;  3WQV A;  4DWS D;  4FN2 A;  2PV1 A;  2A3C A;  4WK9 A;  2O92 A;  4IQC A;  3ARQ A;  4TW6 A;  2WK2 A;  2RUC A;  5HUA A;  1UR8 A;  2AOS A;  3O5M A;  4LAW A;  1ZBK A;  2ZQS A;  4Q7N A;  4IT4 A;  4MNM A;  2XP8 A;  2YBT A;  1Q6U A;  1H0I A;  4HBE A;  3PRD A;  2N87 A;  1D7H A;  4ODK A;  3KAB A;  4QIB A;  1BKF A;  4DZ3 A;  3ARX A;  1JNS A;  1B6C A;  3KAC A;  4DRQ A;  4Z2G A;  4LAX A;  4WKA A;  1JVW A;  2B31 A;  3KZ7 A;  4U84 A;  4XAK A;  2M08 A;  3WD1 A;  2MNT A;  4G2P A;  4JFL A;  3B7X A;  1E6Z A;  4NNR A;  3O5L A;  4WIW A;  1PIN A;  3RM4 A;  2F21 A;  3VAW A;  1R9H A;  1HKJ A;  1NWR A;  4IPX A;  2XP6 A;  4P8X A;  1P5Q A;  2M1I A;  4R0X A;  1HKK A;  2FAP A;  4JYS A;  1LG1 A;  5B8I C;  1SR0 A;  2RUQ A;  4P8W A;  4HAR A;  4MSP A;  3AQU A;  1PBK A;  3CH9 A;  4GIV A;  1J4H A;  2XPB A;  1NWS A;  2F4E A;  1KT1 A;  5GQB A;  1XHG A;  5HBF A;  1FKG A;  3CZ8 A;  1X6L A;  1J4R A;  4ITZ A;  2KI3 A;  3O5O A;  3KAD A;  3OA5 A;  1LJY A;  1VF8 A;  1ZK6 A;  1TFV A;  2PI6 A;  2XP9 A;  1FKJ A;  4O2T A;  1HKM A;  3CHD A;  4U86 A;  3O5D A;  2LGO A;  3ODK A;  1W1Y A;  2MLY A;  1HKI A;  3MDY B;  3ART A;  2L2S A;  3TCZ A;  1FD9 A;  3KAH A;  1LG2 A;  3NTP A;  2KE0 A;  1O6I A;  4MNK A;  4W9P A;  4QT2 A;  4W9Q A;  5DIV A;  2M2A A;  2DT3 A;  4DRJ A;  1FKL A;  4ODR A;  4QZV B;  3KCE A;  3AS3 A;  1N1A A;  1QPL A;  1J6Y A;  1D7J A;  3UI5 A;  3CGN A;  2AWG A;  3B9D A;  3O5F A;  2PPO A;  4DRO A;  1X6N A;  1ZB5 A;  3KAF A;  2WLZ A;  4WKH A;  3JYJ A;  5DIT A;  4IQ2 A;  2PV3 A;  5DIU A;  4L72 B;  3RFW A;  3BXW A;  2KO7 A;  3FY1 A;  5DO2 A;  1FKB A;  3O5R A;  4DRK A;  1IX5 A;  1EIB A;  4P8V A;  2F2D A;  1ZBC A;  3FAP A;  3B9E A;  2QF8 A;  1CTN A;  2XP3 A;  5HW8 A;  1D6O A;  2XP7 A;  4GGQ A;  3UF8 A;  3IKD A;  1E6N A;  2UZ5 A;  1NMW A;  4BF8 A;  1E6P A;  4ODM A;  2WM0 A;  2JZV A;  4ODO A;  5DEZ A;  1J4I A;  2DSU A;  3OOB A;  1ZL1 A;  3UI4 A;  3JYM A;  4DRI A;  3AS0 A;  1WB0 A;  1EYM A;  4Z2H A;  1EHN A;  3RM8 A;  1U79 A;  2DSV A;  2DG3 A;  1LQ0 A;  2VCD A;  4S3J A;  4C02 B;  2KR7 A;  1NSG A;  1FKS A;  1FAP A;  1LL6 A;  3UI6 A;  5GPR A;  3WH0 A;  4MPK A;  2FKE A;  2VN1 A;  2WLY A;  4L3N A;  4ODL A;  4URI A;  4Z2I A;  2K8I A;  1XRV A;  2LKN A;  4PTM A;  3RME A;  3WD3 A;  4IT6 A;  1WNO A;  2ZR4 A;  2RUD A;  2IUZ A;  1YW5 A;  4W9O A;  5HW7 A;  3ARV A;  2KFW A;  3O5G A;  3UQB A;  2O9O A;  1W9P A;  3WD2 A;  1EDQ A;  4TNS A;  2A3E A;  1LL4 A;  1NH6 A;  4DWS C;  3KAG A;  4TW7 A;  4Q22 A;  3W4R A;  1L1P A;  1UR9 A;  3WL1 A;  2PV2 A;  2MF9 A;  4ZPW R;  3CGM A;  3ARW A;  1QZ2 A;  2YBU A;  3G6L A;  3ARP A;  1E15 A;  3FXY A;  4DH0 A;  2DT0 A;  4J4N A;  1ROT A;  3O5Q A;  3TDB A;  1E6R A;  2D9F A;  4ODQ A;  4DWS A;  2LJ4 A;  2RQS A;  1ITX A;  3PRB A;  5DF0 A;  5HTG A;  3QOK A;  1FKD A;  5HT1 A;  2RUR A;  4Z2L A;  5J6E A;  4FAP A;  4KR0 B;  1Q1C A;  1QPF A;  1KFW A;  3PRA A;  1JND A;  1FKR A;  1GPF A;  3PR9 A;  3RM9 A;  4TYO A;  4JFK A;  4DRM A;  1FKF A;  1K9T A;  1C9H A;  1FFQ A;  1YAT A;  1W1T A;  4NZC A;  3O5E A;  3KAI A;  1ZBW A;  1Q6H A;  3IHZ A;  1Y0O A;  3WKZ A;  1SYT A;  1F8A B;  3UQA A;  2Q5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...