4JFMA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 2-(3,4-dimethoxyphenoxy)ethyl (2s)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfmA00
1P5QA 2F2DA 3JYMA 1R9HA 3O5JA 2PV3A 4LAYA 3UQAA 2N87A 2RSEA 1EYMA 3CGNA 3UI5A 2LGOA 1TCOC 2M08A 4MSPA 3TC5A 4DRJA 4LAXA 3TCZA 3UF8A 2RUCA 1KT0A 2XP8A 4DZ3A 3IKDA 5GPGA 2ZQTA 1F40A 1BKFA 2ZQVA 1FKLA 1NSGA 3H9RB 3PA7A 1D7JA 4TW7A 5HW7A 3KZ7A 3O5DA 1L1PA 4TW6A 4DIPA 2M1IA 3JYJA 1JNSA 2MLZA 3OOBA 4ITZA 1YW5A 5I98A 3I6CA 1F8AB 3O5PA 1FKBA 2L2SA 3B7XA 2RUQA 2DG4A 4JFKA 1EQ3A 1QPFA 1A7XA 3O5LA 2PPNA 4J4OA 2KFWA 4W9QA 4DRPA 4G50A 4GGQA 3TDBA 4C02B 4GIVA 3KCEA 1FKTA 1FKDA 1J4IA 1Q6IA 1YATA 2VCDA 2XP4A 2PPPA 3O5EA 4FN2A 3KAIA 2KO7A 2MF9A 3PRDA 3KADA 4O2TA 1PINA 4W9PA 3UQIA 4QIBA 2IF4A 4ODPA 2M2AA 2MLXA 2XP9A 3O5IA 3O5OA 2ITKA 3O5FA 3WH0A 1NMWA 1T11A 4DRKA 3EY6A 2DG3A 5HWBA 1JNTA 2D9FA 4DRHA 1FKFA 4TX0A 2K8IA 1FD9A 3RFWA 3RGCA 4DH0A 2PV1A 1BL4A 1ROUA 4JFIA 5HT1A 3UQBA 3MDYB 1FKSA 2VN1A 1KT1A 1QPLA 2DG9A 4DZ2A 1FKKA 2XP7A 2ZQUA 1JVWA 2ZR6A 4TW8A 4DT4A 2FKEA 5DITA 2F4EA 2ZR4A 1ZCNA 4MGVA 4U85A 5HTGA 1Y0OA 2XP6A 2OFNA 2RQSA 2JZVA 2LJ4A 2Y78A 3IHZA 4DRIA 4FAPA 1QZ2A 2ZR5A 3O5MA 2XP5A 2F21A 4IPXA 2XPAA 3UI6A 3CGMA 3UI4A 3PRBA 4LAVA 1B6CA 4W9OA 2MPHA 2PBCA 3IK8A 4TNSA 5BXJA 3KAFA 1FKRA 2PPOA 2Q5AA 4DRNA 4BF8A 2PV2A 4JFLA 1D6OA 5HKGA 5HW6A 5J6EA 3NRKA 2XPBA 2LPVA 4DROA 1NMVA 3O5QA 4NNRA 1D7IA 3NTPA 2XP3A 5DIVA 5HUAA 3KABA 1M5YA 4ODOA 5DIUA 3LUOA 2RUDA 4N19A 4ODQA 3VAWA 4IQCA 3GPKA 3O5RA 4DRQA 3JXVA 4R0XA 1N1AA 4JFJA 4IQ2A 1D7HA 1ZK6A 2KGJA 4QT3A 4ODRA 2AWGA 2MNTA 1U79A 5HWCA 5D75A 1J4RA 1PBKA 4JFMA 4J4NA 2LKNA 2ZQSA 4LAWA 4TYOA 2FAPA 1FKIA 3KACA 5B8IC 4DRMA 4ODNA 1Q6HA 4G2PA 1FKJA 1FKGA 4U84A 5HW8A 1Q1CA 2KE0A 4ODKA 1FAPA 2MLYA 3KAGA 4JYSA 3FAPA 3IKGA 1W26A 4ODMA 1J6YA 3KAHA 1FJDA 3ODKA 2RURA 4U86A 4ODLA 3NI6A 1C9HA 1J4HA 1FKHA 1ROTA 2KI3A 4QT2A 3O5KA 2KR7A 3O5GA 1HXVA 2UZ5A 1Q6UA
chains in the Genus database with same CATH superfamily
5DEZA 2M08A 3PRAA 4MSPA 3G6LA 4LAXA 5HBFA 3WQWA 1XHGA 1HKKA 1BKFA 1D7JA 5HW7A 2DT3A 3RM4A 3JYJA 1YW5A 3FXYA 3O5PA 2RUQA 3WD2A 1A7XA 3CHCA 4P8XA 1E6ZA 4Z2LA 4GGQA 3WD3A 3TDBA 4GIVA 1FKRA 1YATA 1Q6IA 4DRHA 3CHEA 4O2TA 1X6NA 1PINA 4QIBA 3WD1A 1OGGA 3RM9A 2XP9A 1NMWA 2DSVA 2DG3A 2D9FA 4ZS6A 1FKFA 3GU0A 1FD9A 1GRJA 1ZB5A 2DSUA 4WKHA 4AY1A 1GOIA 1FKKA 2ZQUA 4Z2HA 4HARA 2ZR4A 2OFNA 2Y78A 2LJ4A 1W9UA 2ZR5A 2XP5A 3RM8A 1H0GA 4IPXA 2B31A 4ZPWR 1B6CA 2MPHA 1GUVA 2PPOA 4DRNA 5DO2A 3B9DA 4LGXA 4NNRA 3KABA 3W4RA 3AQUA 5DIUA 4ODQA 1E9LA 3AS1A 3JXVA 3AROA 1N1AA 1JNEA 4IQ2A 2KGJA 4ODRA 4Q7NA 3CZ8A 1PBKA 3ARPA 1WB0A 4NZCA 4S3JA 4G2PA 3WD4A 1JCHB 3ARTA 4JYSA 1K9TA 5GQBA 3IKGA 1W26A 3ODKA 4U86A 3NI6A 1C9HA 3B9EA 1E6NA 1FKHA 3ARZA 3O5KA 3WD0A 2UZ5A 3ARRA 1Q6UA 4MNJA 3JYMA 2N87A 2AOSA 2RSEA 3UI5A 3WKZA 2LGOA 4R5EA 2ZQTA 1F40A 2ZQVA 1W1PA 3KZ7A 4PTMA 2PI6A 4Z2JA 2M1IA 3OOBA 4ITZA 2L2SA 1NWUA 1EQ3A 1QPFA 2WK2A 3ARQA 3G6MA 4J4OA 1NWRA 4W9QA 3OA5A 4DWSB 4G50A 2ETNA 4C02B 1EIBA 1HKMA 1FKDA 2VCDA 3QOKA 2PPPA 1IX5A 2MF9A 3KADA 4W9PA 2IF4A 1UR8A 4ODPA 2A3BA 3B9AA 3O5IA 3O5OA 2FDMA 3WH0A 1T11A 5DF0A 2A3AA 1W1TA 1ZU8A 5HWBA 1NH6A 4UDMA 2DSWA 3RFWA 1BL4A 3WIJA 4JFIA 5HT1A 3MDYB 1LL7A 2G41A 4DZ2A 1E44A 1JVWA 2FKEA 2ESCA 3ARXA 4L3NA 4P8UA 4MAVA 4WKFA 1QZ2A 1W1YA 1W9VA 1LG1A 4S3KA 3UI6A 3CGMA 3UI4A 3PRBA 3IK8A 3KAFA 4JFLA 1D6OA 5J6EA 1W9PA 3BXWA 1CTNA 3ARVA 4DROA 3O5QA 3NTPA 5DIVA 5HUAA 3WQVA 3VAWA 2RUDA 4N19A 2YBTA 4DWSD 1ZK6A 3GTYX 1TFVA 4P8WA 3ARSA 4J4NA 2LKNA 2ZQSA 4LAWA 2FAPA 2A3CA 4DRMA 1GPFA 1FFQA 1FFRA 2DT2A 1FKGA 2KE0A 4ODKA 3KAGA 4WJXA 4DWSC 1J6YA 4TW7A 1J4HA 4Q22A 4QT2A 4IT6A 1ZBCA 1LL4A 1P5QA 3CHDA 1R9HA 2PV3A 4LAYA 1EYMA 1WAWA 1HKIA 1ZBKA 2OLHA 3UF8A 1KT0A 2XP8A 3CH9A 3WL0A 3AS0A 1FKLA 1NSGA 3H9RB 1E6RA 3O5DA 2A3EA 5I98A 3I6CA 4MPKA 3B7XA 4HBEA 4DRPA 3KCEA 1FKTA 1J4IA 4ODNA 3PRDA 2KO7A 2M2AA 2MLXA 3EY6A 2DPEA 4WIWA 1JNTA 1EHNA 4DH0A 2PV1A 3PR9A 3UQBA 4Z2GA 1ZBVA 2VN1A 2WM0A 1WNOA 2XP7A 1LG2A 4DT4A 2EULA 2F4EA 5DITA 1HJXA 4U85A 5HTGA 5GPRA 1Y0OA 2XP6A 2JZVA 1HJVA 4DRIA 4KR0B 4FAPA 2O9OA 2G8ZA 4KQZA 3ARUA 4LAVA 4W9OA 4TNSA 5BXJA 1UR9A 4MNLA 2PV2A 5HW6A 2XPBA 2DT0A 1D7IA 1SR0A 1M5YA 4URIA 2WLYA 3B8SA 4MNMA 4IQCA 3GPKA 3O5RA 1HJWA 4R0XA 1OWQA 1NWTA 4JFJA 2AWGA 3AS2A 1XRVA 5D75A 4MNKA 4JFMA 3ALFA 4ML4A 1FKIA 5B8IC 3FY1A 4XAKA 1Q6HA 4U84A 4WKAA 5HW8A 2MLYA 3AS3A 3FAPA 3KAHA 2IUZA 2RURA 4DIPA 1ROTA 2QF8A 2KR7A 4BF8A 2B5UB 2F2DA 4IT4A 3O5JA 3UQAA 1ZL1A 3CGNA 4QZVB 1ITXA 3TC5A 1TCOC 4L72B 4DRJA 3TCZA 2RUCA 4P8VA 4DZ3A 3IKDA 4WK9A 5GPGA 3PA7A 2O92A 2DT1A 4ZPTR 1L1PA 4TW6A 2WLZA 2MLZA 1F8AB 1FKBA 1ZBWA 2DG4A 4JFKA 3O5LA 2PPNA 3CHFA 2KFWA 2DSZA 2XP4A 3ARWA 3O5EA 4MGVA 2PN0A 4FN2A 3KAIA 4W5UA 3ARYA 3UQIA 1NWSA 1EDQA 2ITKA 3O5FA 1OGBA 1E6PA 4DRKA 1D2KA 1HKJA 1LL6A 5JH8A 4ZPVR 4TX0A 2K8IA 3RGCA 1ROUA 4MTVA 1FKSA 1E15A 1KT1A 1QPLA 2DG9A 2ZR6A 4TW8A 1ZCNA 3IHZA 2RQSA 3EIPA 3O5MA 4DWSA 2F21A 2XPAA 2P4VA 2F23A 2YBUA 1O6IA 2PBCA 2Q5AA 4Z2KA 5HKGA 3WL1A 3NRKA 1X6LA 1LJYA 2LPVA 3ALGA 1NMVA 4HBOA 2XP3A 1JNDA 4ODOA 3LUOA 3BMBA 4DRQA 1VF8A 1H0IA 1W1VA 1D7HA 1SYTA 1KFWA 4QT3A 3RMEA 2MNTA 5HWCA 1U79A 1J4RA 1RD6A 4TYOA 4Z2IA 3KACA 4NSBA 1LQ0A 1FKJA 1Q1CA 1FAPA 4ODMA 1FJDA 1JNSA 4ODLA 2KI3A 3O5GA 1HXVA
chains in the Genus database with same CATH topology
5DEZA 2M08A 3PRAA 4MSPA 3G6LA 4LAXA 5HBFA 3WQWA 1XHGA 1HKKA 1BKFA 1D7JA 5HW7A 2DT3A 3RM4A 3JYJA 1YW5A 3FXYA 3O5PA 2RUQA 3WD2A 1A7XA 3CHCA 4P8XA 1E6ZA 4Z2LA 4GGQA 3WD3A 3TDBA 4GIVA 1FKRA 1YATA 1Q6IA 4DRHA 3CHEA 4O2TA 1X6NA 1PINA 4QIBA 3WD1A 1OGGA 3RM9A 2XP9A 1NMWA 2DSVA 2DG3A 2D9FA 4ZS6A 1FKFA 1FD9A 2DSUA 1ZB5A 4WKHA 4AY1A 1GOIA 1FKKA 2ZQUA 4Z2HA 4HARA 2ZR4A 2OFNA 2Y78A 2LJ4A 1W9UA 2ZR5A 2XP5A 3RM8A 1H0GA 4IPXA 2B31A 4ZPWR 1B6CA 2MPHA 1GUVA 2PPOA 4DRNA 5DO2A 3B9DA 4LGXA 4NNRA 3KABA 3W4RA 3AQUA 5DIUA 4ODQA 1E9LA 3AS1A 3JXVA 3AROA 1N1AA 1JNEA 4IQ2A 2KGJA 4ODRA 4Q7NA 3CZ8A 1PBKA 3ARPA 1WB0A 4NZCA 4S3JA 4G2PA 3WD4A 3ARTA 4JYSA 1K9TA 5GQBA 3IKGA 1W26A 3ODKA 4U86A 3NI6A 1C9HA 3B9EA 1E6NA 1FKHA 3ARZA 3O5KA 3WD0A 2UZ5A 3ARRA 1Q6UA 4MNJA 3JYMA 2N87A 2AOSA 2RSEA 3UI5A 3WKZA 2LGOA 4R5EA 2ZQTA 1F40A 2ZQVA 1W1PA 3KZ7A 4PTMA 2PI6A 4Z2JA 2M1IA 3OOBA 4ITZA 2L2SA 1NWUA 1EQ3A 1QPFA 2WK2A 3ARQA 3G6MA 4J4OA 1NWRA 4W9QA 3OA5A 4DWSB 4G50A 4C02B 1EIBA 1HKMA 1FKDA 2VCDA 3QOKA 2PPPA 1IX5A 2MF9A 3KADA 4W9PA 2IF4A 1UR8A 4ODPA 2A3BA 3B9AA 3O5IA 3O5OA 2FDMA 3WH0A 1T11A 5DF0A 2A3AA 1W1TA 1ZU8A 5HWBA 1NH6A 2DSWA 3RFWA 1BL4A 3WIJA 4JFIA 5HT1A 3MDYB 1LL7A 2G41A 4DZ2A 1JVWA 2FKEA 2ESCA 3ARXA 4L3NA 4P8UA 4MAVA 4WKFA 1QZ2A 1W1YA 1W9VA 1LG1A 4S3KA 3UI6A 3CGMA 3UI4A 3PRBA 3IK8A 3KAFA 4JFLA 1D6OA 5J6EA 1W9PA 3BXWA 1CTNA 3ARVA 4DROA 3O5QA 3NTPA 5DIVA 5HUAA 3WQVA 3VAWA 2RUDA 4N19A 2YBTA 4DWSD 1ZK6A 1TFVA 4P8WA 3ARSA 4J4NA 2LKNA 2ZQSA 4LAWA 2FAPA 2A3CA 4DRMA 1GPFA 1FFQA 1FFRA 2DT2A 1FKGA 2KE0A 4ODKA 3KAGA 4WJXA 4DWSC 1J6YA 4TW7A 1J4HA 4Q22A 4QT2A 4IT6A 1ZBCA 1LL4A 1P5QA 3CHDA 1R9HA 2PV3A 4LAYA 1EYMA 1WAWA 1HKIA 1ZBKA 2OLHA 3UF8A 1KT0A 2XP8A 3CH9A 3WL0A 3AS0A 1FKLA 1NSGA 3H9RB 1E6RA 3O5DA 2A3EA 5I98A 3I6CA 4MPKA 3B7XA 4HBEA 4DRPA 3KCEA 1FKTA 1J4IA 4ODNA 3PRDA 2KO7A 2M2AA 2MLXA 3EY6A 2DPEA 4WIWA 1JNTA 1EHNA 4DH0A 2PV1A 3PR9A 3UQBA 4Z2GA 1ZBVA 2VN1A 2WM0A 1WNOA 2XP7A 1LG2A 4DT4A 5DITA 2F4EA 1HJXA 4U85A 5HTGA 5GPRA 1Y0OA 2XP6A 2JZVA 1HJVA 4DRIA 4KR0B 4FAPA 2O9OA 2G8ZA 4KQZA 3ARUA 4LAVA 4W9OA 4TNSA 5BXJA 1UR9A 4MNLA 2PV2A 5HW6A 2XPBA 2DT0A 1D7IA 1SR0A 1M5YA 4URIA 2WLYA 3B8SA 4MNMA 4IQCA 3GPKA 3O5RA 1HJWA 4R0XA 1OWQA 1NWTA 4JFJA 2AWGA 3AS2A 1XRVA 5D75A 4MNKA 4JFMA 3ALFA 4ML4A 1FKIA 5B8IC 3FY1A 4XAKA 1Q6HA 4U84A 4WKAA 5HW8A 2MLYA 3AS3A 3FAPA 3KAHA 2IUZA 2RURA 4DIPA 1ROTA 2QF8A 2KR7A 4BF8A 2F2DA 4IT4A 3O5JA 3UQAA 1ZL1A 3CGNA 4QZVB 1ITXA 3TC5A 1TCOC 4L72B 4DRJA 3TCZA 2RUCA 4P8VA 4DZ3A 3IKDA 4WK9A 5GPGA 3PA7A 2O92A 2DT1A 4ZPTR 1L1PA 4TW6A 2WLZA 2MLZA 1F8AB 1FKBA 1ZBWA 2DG4A 4JFKA 3O5LA 2PPNA 3CHFA 2KFWA 2DSZA 2XP4A 3ARWA 3O5EA 4MGVA 4FN2A 3KAIA 4W5UA 3ARYA 3UQIA 1NWSA 1EDQA 2ITKA 3O5FA 1OGBA 1E6PA 4DRKA 1D2KA 1HKJA 1LL6A 5JH8A 4ZPVR 4TX0A 2K8IA 3RGCA 1ROUA 4MTVA 1FKSA 1E15A 1KT1A 1QPLA 2DG9A 2ZR6A 4TW8A 1ZCNA 3IHZA 2RQSA 3O5MA 4DWSA 2F21A 2XPAA 2YBUA 1O6IA 2PBCA 2Q5AA 4Z2KA 5HKGA 3WL1A 3NRKA 1X6LA 1LJYA 2LPVA 3ALGA 1NMVA 4HBOA 2XP3A 1JNDA 4ODOA 3LUOA 4DRQA 1VF8A 1H0IA 1W1VA 1D7HA 1SYTA 1KFWA 4QT3A 3RMEA 2MNTA 5HWCA 1U79A 1J4RA 1RD6A 4TYOA 4Z2IA 3KACA 4NSBA 1LQ0A 1FKJA 1Q1CA 1FAPA 4ODMA 1FJDA 1JNSA 4ODLA 2KI3A 3O5GA 1HXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P5Q A;  2F2D A;  3JYM A;  1R9H A;  3O5J A;  2PV3 A;  4LAY A;  3UQA A;  2N87 A;  2RSE A;  1EYM A;  3CGN A;  3UI5 A;  2LGO A;  1TCO C;  2M08 A;  4MSP A;  3TC5 A;  4DRJ A;  4LAX A;  3TCZ A;  3UF8 A;  2RUC A;  1KT0 A;  2XP8 A;  4DZ3 A;  3IKD A;  5GPG A;  2ZQT A;  1F40 A;  1BKF A;  2ZQV A;  1FKL A;  1NSG A;  3H9R B;  3PA7 A;  1D7J A;  4TW7 A;  5HW7 A;  3KZ7 A;  3O5D A;  1L1P A;  4TW6 A;  4DIP A;  2M1I A;  3JYJ A;  1JNS A;  2MLZ A;  3OOB A;  4ITZ A;  1YW5 A;  5I98 A;  3I6C A;  1F8A B;  3O5P A;  1FKB A;  2L2S A;  3B7X A;  2RUQ A;  2DG4 A;  4JFK A;  1EQ3 A;  1QPF A;  1A7X A;  3O5L A;  2PPN A;  4J4O A;  2KFW A;  4W9Q A;  4DRP A;  4G50 A;  4GGQ A;  3TDB A;  4C02 B;  4GIV A;  3KCE A;  1FKT A;  1FKD A;  1J4I A;  1Q6I A;  1YAT A;  2VCD A;  2XP4 A;  2PPP A;  3O5E A;  4FN2 A;  3KAI A;  2KO7 A;  2MF9 A;  3PRD A;  3KAD A;  4O2T A;  1PIN A;  4W9P A;  3UQI A;  4QIB A;  2IF4 A;  4ODP A;  2M2A A;  2MLX A;  2XP9 A;  3O5I A;  3O5O A;  2ITK A;  3O5F A;  3WH0 A;  1NMW A;  1T11 A;  4DRK A;  3EY6 A;  2DG3 A;  5HWB A;  1JNT A;  2D9F A;  4DRH A;  1FKF A;  4TX0 A;  2K8I A;  1FD9 A;  3RFW A;  3RGC A;  4DH0 A;  2PV1 A;  1BL4 A;  1ROU A;  4JFI A;  5HT1 A;  3UQB A;  3MDY B;  1FKS A;  2VN1 A;  1KT1 A;  1QPL A;  2DG9 A;  4DZ2 A;  1FKK A;  2XP7 A;  2ZQU A;  1JVW A;  2ZR6 A;  4TW8 A;  4DT4 A;  2FKE A;  5DIT A;  2F4E A;  2ZR4 A;  1ZCN A;  4MGV A;  4U85 A;  5HTG A;  1Y0O A;  2XP6 A;  2OFN A;  2RQS A;  2JZV A;  2LJ4 A;  2Y78 A;  3IHZ A;  4DRI A;  4FAP A;  1QZ2 A;  2ZR5 A;  3O5M A;  2XP5 A;  2F21 A;  4IPX A;  2XPA A;  3UI6 A;  3CGM A;  3UI4 A;  3PRB A;  4LAV A;  1B6C A;  4W9O A;  2MPH A;  2PBC A;  3IK8 A;  4TNS A;  5BXJ A;  3KAF A;  1FKR A;  2PPO A;  2Q5A A;  4DRN A;  4BF8 A;  2PV2 A;  4JFL A;  1D6O A;  5HKG A;  5HW6 A;  5J6E A;  3NRK A;  2XPB A;  2LPV A;  4DRO A;  1NMV A;  3O5Q A;  4NNR A;  1D7I A;  3NTP A;  2XP3 A;  5DIV A;  5HUA A;  3KAB A;  1M5Y A;  4ODO A;  5DIU A;  3LUO A;  2RUD A;  4N19 A;  4ODQ A;  3VAW A;  4IQC A;  3GPK A;  3O5R A;  4DRQ A;  3JXV A;  4R0X A;  1N1A A;  4JFJ A;  4IQ2 A;  1D7H A;  1ZK6 A;  2KGJ A;  4QT3 A;  4ODR A;  2AWG A;  2MNT A;  1U79 A;  5HWC A;  5D75 A;  1J4R A;  1PBK A;  4JFM A;  4J4N A;  2LKN A;  2ZQS A;  4LAW A;  4TYO A;  2FAP A;  1FKI A;  3KAC A;  5B8I C;  4DRM A;  4ODN A;  1Q6H A;  4G2P A;  1FKJ A;  1FKG A;  4U84 A;  5HW8 A;  1Q1C A;  2KE0 A;  4ODK A;  1FAP A;  2MLY A;  3KAG A;  4JYS A;  3FAP A;  3IKG A;  1W26 A;  4ODM A;  1J6Y A;  3KAH A;  1FJD A;  3ODK A;  2RUR A;  4U86 A;  4ODL A;  3NI6 A;  1C9H A;  1J4H A;  1FKH A;  1ROT A;  2KI3 A;  4QT2 A;  3O5K A;  2KR7 A;  3O5G A;  1HXV A;  2UZ5 A;  1Q6U A; 
#chains in the Genus database with same CATH topology
 5DEZ A;  2M08 A;  3PRA A;  4MSP A;  3G6L A;  4LAX A;  5HBF A;  3WQW A;  1XHG A;  1HKK A;  1BKF A;  1D7J A;  5HW7 A;  2DT3 A;  3RM4 A;  3JYJ A;  1YW5 A;  3FXY A;  3O5P A;  2RUQ A;  3WD2 A;  1A7X A;  3CHC A;  4P8X A;  1E6Z A;  4Z2L A;  4GGQ A;  3WD3 A;  3TDB A;  4GIV A;  1FKR A;  1YAT A;  1Q6I A;  4DRH A;  3CHE A;  4O2T A;  1X6N A;  1PIN A;  4QIB A;  3WD1 A;  1OGG A;  3RM9 A;  2XP9 A;  1NMW A;  2DSV A;  2DG3 A;  2D9F A;  4ZS6 A;  1FKF A;  3GU0 A;  1FD9 A;  1GRJ A;  1ZB5 A;  2DSU A;  4WKH A;  4AY1 A;  1GOI A;  1FKK A;  2ZQU A;  4Z2H A;  4HAR A;  2ZR4 A;  2OFN A;  2Y78 A;  2LJ4 A;  1W9U A;  2ZR5 A;  2XP5 A;  3RM8 A;  1H0G A;  4IPX A;  2B31 A;  4ZPW R;  1B6C A;  2MPH A;  1GUV A;  2PPO A;  4DRN A;  5DO2 A;  3B9D A;  4LGX A;  4NNR A;  3KAB A;  3W4R A;  3AQU A;  5DIU A;  4ODQ A;  1E9L A;  3AS1 A;  3JXV A;  3ARO A;  1N1A A;  1JNE A;  4IQ2 A;  2KGJ A;  4ODR A;  4Q7N A;  3CZ8 A;  1PBK A;  3ARP A;  1WB0 A;  4NZC A;  4S3J A;  4G2P A;  3WD4 A;  1JCH B;  3ART A;  4JYS A;  1K9T A;  5GQB A;  3IKG A;  1W26 A;  3ODK A;  4U86 A;  3NI6 A;  1C9H A;  3B9E A;  1E6N A;  1FKH A;  3ARZ A;  3O5K A;  3WD0 A;  2UZ5 A;  3ARR A;  1Q6U A;  4MNJ A;  3JYM A;  2N87 A;  2AOS A;  2RSE A;  3UI5 A;  3WKZ A;  2LGO A;  4R5E A;  2ZQT A;  1F40 A;  2ZQV A;  1W1P A;  3KZ7 A;  4PTM A;  2PI6 A;  4Z2J A;  2M1I A;  3OOB A;  4ITZ A;  2L2S A;  1NWU A;  1EQ3 A;  1QPF A;  2WK2 A;  3ARQ A;  3G6M A;  4J4O A;  1NWR A;  4W9Q A;  3OA5 A;  4DWS B;  4G50 A;  2ETN A;  4C02 B;  1EIB A;  1HKM A;  1FKD A;  2VCD A;  3QOK A;  2PPP A;  1IX5 A;  2MF9 A;  3KAD A;  4W9P A;  2IF4 A;  1UR8 A;  4ODP A;  2A3B A;  3B9A A;  3O5I A;  3O5O A;  2FDM A;  3WH0 A;  1T11 A;  5DF0 A;  2A3A A;  1W1T A;  1ZU8 A;  5HWB A;  1NH6 A;  4UDM A;  2DSW A;  3RFW A;  1BL4 A;  3WIJ A;  4JFI A;  5HT1 A;  3MDY B;  1LL7 A;  2G41 A;  4DZ2 A;  1E44 A;  1JVW A;  2FKE A;  2ESC A;  3ARX A;  4L3N A;  4P8U A;  4MAV A;  4WKF A;  1QZ2 A;  1W1Y A;  1W9V A;  1LG1 A;  4S3K A;  3UI6 A;  3CGM A;  3UI4 A;  3PRB A;  3IK8 A;  3KAF A;  4JFL A;  1D6O A;  5J6E A;  1W9P A;  3BXW A;  1CTN A;  3ARV A;  4DRO A;  3O5Q A;  3NTP A;  5DIV A;  5HUA A;  3WQV A;  3VAW A;  2RUD A;  4N19 A;  2YBT A;  4DWS D;  1ZK6 A;  3GTY X;  1TFV A;  4P8W A;  3ARS A;  4J4N A;  2LKN A;  2ZQS A;  4LAW A;  2FAP A;  2A3C A;  4DRM A;  1GPF A;  1FFQ A;  1FFR A;  2DT2 A;  1FKG A;  2KE0 A;  4ODK A;  3KAG A;  4WJX A;  4DWS C;  1J6Y A;  4TW7 A;  1J4H A;  4Q22 A;  4QT2 A;  4IT6 A;  1ZBC A;  1LL4 A;  1P5Q A;  3CHD A;  1R9H A;  2PV3 A;  4LAY A;  1EYM A;  1WAW A;  1HKI A;  1ZBK A;  2OLH A;  3UF8 A;  1KT0 A;  2XP8 A;  3CH9 A;  3WL0 A;  3AS0 A;  1FKL A;  1NSG A;  3H9R B;  1E6R A;  3O5D A;  2A3E A;  5I98 A;  3I6C A;  4MPK A;  3B7X A;  4HBE A;  4DRP A;  3KCE A;  1FKT A;  1J4I A;  4ODN A;  3PRD A;  2KO7 A;  2M2A A;  2MLX A;  3EY6 A;  2DPE A;  4WIW A;  1JNT A;  1EHN A;  4DH0 A;  2PV1 A;  3PR9 A;  3UQB A;  4Z2G A;  1ZBV A;  2VN1 A;  2WM0 A;  1WNO A;  2XP7 A;  1LG2 A;  4DT4 A;  2EUL A;  2F4E A;  5DIT A;  1HJX A;  4U85 A;  5HTG A;  5GPR A;  1Y0O A;  2XP6 A;  2JZV A;  1HJV A;  4DRI A;  4KR0 B;  4FAP A;  2O9O A;  2G8Z A;  4KQZ A;  3ARU A;  4LAV A;  4W9O A;  4TNS A;  5BXJ A;  1UR9 A;  4MNL A;  2PV2 A;  5HW6 A;  2XPB A;  2DT0 A;  1D7I A;  1SR0 A;  1M5Y A;  4URI A;  2WLY A;  3B8S A;  4MNM A;  4IQC A;  3GPK A;  3O5R A;  1HJW A;  4R0X A;  1OWQ A;  1NWT A;  4JFJ A;  2AWG A;  3AS2 A;  1XRV A;  5D75 A;  4MNK A;  4JFM A;  3ALF A;  4ML4 A;  1FKI A;  5B8I C;  3FY1 A;  4XAK A;  1Q6H A;  4U84 A;  4WKA A;  5HW8 A;  2MLY A;  3AS3 A;  3FAP A;  3KAH A;  2IUZ A;  2RUR A;  4DIP A;  1ROT A;  2QF8 A;  2KR7 A;  4BF8 A;  2B5U B;  2F2D A;  4IT4 A;  3O5J A;  3UQA A;  1ZL1 A;  3CGN A;  4QZV B;  1ITX A;  3TC5 A;  1TCO C;  4L72 B;  4DRJ A;  3TCZ A;  2RUC A;  4P8V A;  4DZ3 A;  3IKD A;  4WK9 A;  5GPG A;  3PA7 A;  2O92 A;  2DT1 A;  4ZPT R;  1L1P A;  4TW6 A;  2WLZ A;  2MLZ A;  1F8A B;  1FKB A;  1ZBW A;  2DG4 A;  4JFK A;  3O5L A;  2PPN A;  3CHF A;  2KFW A;  2DSZ A;  2XP4 A;  3ARW A;  3O5E A;  4MGV A;  2PN0 A;  4FN2 A;  3KAI A;  4W5U A;  3ARY A;  3UQI A;  1NWS A;  1EDQ A;  2ITK A;  3O5F A;  1OGB A;  1E6P A;  4DRK A;  1D2K A;  1HKJ A;  1LL6 A;  5JH8 A;  4ZPV R;  4TX0 A;  2K8I A;  3RGC A;  1ROU A;  4MTV A;  1FKS A;  1E15 A;  1KT1 A;  1QPL A;  2DG9 A;  2ZR6 A;  4TW8 A;  1ZCN A;  3IHZ A;  2RQS A;  3EIP A;  3O5M A;  4DWS A;  2F21 A;  2XPA A;  2P4V A;  2F23 A;  2YBU A;  1O6I A;  2PBC A;  2Q5A A;  4Z2K A;  5HKG A;  3WL1 A;  3NRK A;  1X6L A;  1LJY A;  2LPV A;  3ALG A;  1NMV A;  4HBO A;  2XP3 A;  1JND A;  4ODO A;  3LUO A;  3BMB A;  4DRQ A;  1VF8 A;  1H0I A;  1W1V A;  1D7H A;  1SYT A;  1KFW A;  4QT3 A;  3RME A;  2MNT A;  5HWC A;  1U79 A;  1J4R A;  1RD6 A;  4TYO A;  4Z2I A;  3KAC A;  4NSB A;  1LQ0 A;  1FKJ A;  1Q1C A;  1FAP A;  4ODM A;  1FJD A;  1JNS A;  4ODL A;  2KI3 A;  3O5G A;  1HXV A; 
#chains in the Genus database with same CATH homology
 5DEZ A;  2M08 A;  3PRA A;  4MSP A;  3G6L A;  4LAX A;  5HBF A;  3WQW A;  1XHG A;  1HKK A;  1BKF A;  1D7J A;  5HW7 A;  2DT3 A;  3RM4 A;  3JYJ A;  1YW5 A;  3FXY A;  3O5P A;  2RUQ A;  3WD2 A;  1A7X A;  3CHC A;  4P8X A;  1E6Z A;  4Z2L A;  4GGQ A;  3WD3 A;  3TDB A;  4GIV A;  1FKR A;  1YAT A;  1Q6I A;  4DRH A;  3CHE A;  4O2T A;  1X6N A;  1PIN A;  4QIB A;  3WD1 A;  1OGG A;  3RM9 A;  2XP9 A;  1NMW A;  2DSV A;  2DG3 A;  2D9F A;  4ZS6 A;  1FKF A;  1FD9 A;  2DSU A;  1ZB5 A;  4WKH A;  4AY1 A;  1GOI A;  1FKK A;  2ZQU A;  4Z2H A;  4HAR A;  2ZR4 A;  2OFN A;  2Y78 A;  2LJ4 A;  1W9U A;  2ZR5 A;  2XP5 A;  3RM8 A;  1H0G A;  4IPX A;  2B31 A;  4ZPW R;  1B6C A;  2MPH A;  1GUV A;  2PPO A;  4DRN A;  5DO2 A;  3B9D A;  4LGX A;  4NNR A;  3KAB A;  3W4R A;  3AQU A;  5DIU A;  4ODQ A;  1E9L A;  3AS1 A;  3JXV A;  3ARO A;  1N1A A;  1JNE A;  4IQ2 A;  2KGJ A;  4ODR A;  4Q7N A;  3CZ8 A;  1PBK A;  3ARP A;  1WB0 A;  4NZC A;  4S3J A;  4G2P A;  3WD4 A;  3ART A;  4JYS A;  1K9T A;  5GQB A;  3IKG A;  1W26 A;  3ODK A;  4U86 A;  3NI6 A;  1C9H A;  3B9E A;  1E6N A;  1FKH A;  3ARZ A;  3O5K A;  3WD0 A;  2UZ5 A;  3ARR A;  1Q6U A;  4MNJ A;  3JYM A;  2N87 A;  2AOS A;  2RSE A;  3UI5 A;  3WKZ A;  2LGO A;  4R5E A;  2ZQT A;  1F40 A;  2ZQV A;  1W1P A;  3KZ7 A;  4PTM A;  2PI6 A;  4Z2J A;  2M1I A;  3OOB A;  4ITZ A;  2L2S A;  1NWU A;  1EQ3 A;  1QPF A;  2WK2 A;  3ARQ A;  3G6M A;  4J4O A;  1NWR A;  4W9Q A;  3OA5 A;  4DWS B;  4G50 A;  4C02 B;  1EIB A;  1HKM A;  1FKD A;  2VCD A;  3QOK A;  2PPP A;  1IX5 A;  2MF9 A;  3KAD A;  4W9P A;  2IF4 A;  1UR8 A;  4ODP A;  2A3B A;  3B9A A;  3O5I A;  3O5O A;  2FDM A;  3WH0 A;  1T11 A;  5DF0 A;  2A3A A;  1W1T A;  1ZU8 A;  5HWB A;  1NH6 A;  2DSW A;  3RFW A;  1BL4 A;  3WIJ A;  4JFI A;  5HT1 A;  3MDY B;  1LL7 A;  2G41 A;  4DZ2 A;  1JVW A;  2FKE A;  2ESC A;  3ARX A;  4L3N A;  4P8U A;  4MAV A;  4WKF A;  1QZ2 A;  1W1Y A;  1W9V A;  1LG1 A;  4S3K A;  3UI6 A;  3CGM A;  3UI4 A;  3PRB A;  3IK8 A;  3KAF A;  4JFL A;  1D6O A;  5J6E A;  1W9P A;  3BXW A;  1CTN A;  3ARV A;  4DRO A;  3O5Q A;  3NTP A;  5DIV A;  5HUA A;  3WQV A;  3VAW A;  2RUD A;  4N19 A;  2YBT A;  4DWS D;  1ZK6 A;  1TFV A;  4P8W A;  3ARS A;  4J4N A;  2LKN A;  2ZQS A;  4LAW A;  2FAP A;  2A3C A;  4DRM A;  1GPF A;  1FFQ A;  1FFR A;  2DT2 A;  1FKG A;  2KE0 A;  4ODK A;  3KAG A;  4WJX A;  4DWS C;  1J6Y A;  4TW7 A;  1J4H A;  4Q22 A;  4QT2 A;  4IT6 A;  1ZBC A;  1LL4 A;  1P5Q A;  3CHD A;  1R9H A;  2PV3 A;  4LAY A;  1EYM A;  1WAW A;  1HKI A;  1ZBK A;  2OLH A;  3UF8 A;  1KT0 A;  2XP8 A;  3CH9 A;  3WL0 A;  3AS0 A;  1FKL A;  1NSG A;  3H9R B;  1E6R A;  3O5D A;  2A3E A;  5I98 A;  3I6C A;  4MPK A;  3B7X A;  4HBE A;  4DRP A;  3KCE A;  1FKT A;  1J4I A;  4ODN A;  3PRD A;  2KO7 A;  2M2A A;  2MLX A;  3EY6 A;  2DPE A;  4WIW A;  1JNT A;  1EHN A;  4DH0 A;  2PV1 A;  3PR9 A;  3UQB A;  4Z2G A;  1ZBV A;  2VN1 A;  2WM0 A;  1WNO A;  2XP7 A;  1LG2 A;  4DT4 A;  5DIT A;  2F4E A;  1HJX A;  4U85 A;  5HTG A;  5GPR A;  1Y0O A;  2XP6 A;  2JZV A;  1HJV A;  4DRI A;  4KR0 B;  4FAP A;  2O9O A;  2G8Z A;  4KQZ A;  3ARU A;  4LAV A;  4W9O A;  4TNS A;  5BXJ A;  1UR9 A;  4MNL A;  2PV2 A;  5HW6 A;  2XPB A;  2DT0 A;  1D7I A;  1SR0 A;  1M5Y A;  4URI A;  2WLY A;  3B8S A;  4MNM A;  4IQC A;  3GPK A;  3O5R A;  1HJW A;  4R0X A;  1OWQ A;  1NWT A;  4JFJ A;  2AWG A;  3AS2 A;  1XRV A;  5D75 A;  4MNK A;  4JFM A;  3ALF A;  4ML4 A;  1FKI A;  5B8I C;  3FY1 A;  4XAK A;  1Q6H A;  4U84 A;  4WKA A;  5HW8 A;  2MLY A;  3AS3 A;  3FAP A;  3KAH A;  2IUZ A;  2RUR A;  4DIP A;  1ROT A;  2QF8 A;  2KR7 A;  4BF8 A;  2F2D A;  4IT4 A;  3O5J A;  3UQA A;  1ZL1 A;  3CGN A;  4QZV B;  1ITX A;  3TC5 A;  1TCO C;  4L72 B;  4DRJ A;  3TCZ A;  2RUC A;  4P8V A;  4DZ3 A;  3IKD A;  4WK9 A;  5GPG A;  3PA7 A;  2O92 A;  2DT1 A;  4ZPT R;  1L1P A;  4TW6 A;  2WLZ A;  2MLZ A;  1F8A B;  1FKB A;  1ZBW A;  2DG4 A;  4JFK A;  3O5L A;  2PPN A;  3CHF A;  2KFW A;  2DSZ A;  2XP4 A;  3ARW A;  3O5E A;  4MGV A;  4FN2 A;  3KAI A;  4W5U A;  3ARY A;  3UQI A;  1NWS A;  1EDQ A;  2ITK A;  3O5F A;  1OGB A;  1E6P A;  4DRK A;  1D2K A;  1HKJ A;  1LL6 A;  5JH8 A;  4ZPV R;  4TX0 A;  2K8I A;  3RGC A;  1ROU A;  4MTV A;  1FKS A;  1E15 A;  1KT1 A;  1QPL A;  2DG9 A;  2ZR6 A;  4TW8 A;  1ZCN A;  3IHZ A;  2RQS A;  3O5M A;  4DWS A;  2F21 A;  2XPA A;  2YBU A;  1O6I A;  2PBC A;  2Q5A A;  4Z2K A;  5HKG A;  3WL1 A;  3NRK A;  1X6L A;  1LJY A;  2LPV A;  3ALG A;  1NMV A;  4HBO A;  2XP3 A;  1JND A;  4ODO A;  3LUO A;  4DRQ A;  1VF8 A;  1H0I A;  1W1V A;  1D7H A;  1SYT A;  1KFW A;  4QT3 A;  3RME A;  2MNT A;  5HWC A;  1U79 A;  1J4R A;  1RD6 A;  4TYO A;  4Z2I A;  3KAC A;  4NSB A;  1LQ0 A;  1FKJ A;  1Q1C A;  1FAP A;  4ODM A;  1FJD A;  1JNS A;  4ODL A;  2KI3 A;  3O5G A;  1HXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...