3O5KA

Fk1 domain of fkbp51, crystal form viii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5kA00
4TW6A 1BL4A 4ODMA 1Q1CA 3IKDA 1FKFA 5HW8A 4ITZA 2AWGA 2VN1A 2MLXA 2DG4A 2PV1A 1FKGA 1Q6IA 2XPAA 1FJDA 2LJ4A 5GPGA 5B8IC 3UQIA 4ODOA 1FKLA 2F21A 5J6EA 1JNSA 4GIVA 1C9HA 1PINA 2RQSA 1J4IA 2KR7A 2KI3A 3O5LA 4BF8A 5HW7A 4ODNA 1R9HA 1P5QA 1BKFA 5HKGA 4G2PA 3O5KA 1EQ3A 2PBCA 3VAWA 3UF8A 1FKJA 2XP5A 2XP9A 4TYOA 2ZR5A 1N1AA 4LAXA 4DRPA 1A7XA 1FKSA 3KAGA 1Y0OA 1Q6HA 4ODKA 4DZ3A 5HWCA 2KE0A 2F2DA 3NRKA 5DIVA 2LKNA 4R0XA 4DRHA 5I98A 3ODKA 3NTPA 2UZ5A 3I6CA 5D75A 4O2TA 4DRMA 1ROTA 3UQBA 4ODRA 2M1IA 3GPKA 2KGJA 4LAYA 5HT1A 1T11A 4MGVA 3H9RB 3UQAA 3PRDA 4DZ2A 1ZK6A 2FKEA 1QPLA 2DG9A 2ZR6A 3JYJA 2KFWA 4IQCA 2ZR4A 4J4OA 4ODLA 1FKRA 2K8IA 1NMVA 3OOBA 4FN2A 3O5QA 1W26A 2RUCA 3KZ7A 3JXVA 1ZCNA 2IF4A 3O5OA 2LGOA 4NNRA 4DRJA 1PBKA 3LUOA 4TNSA 4DRIA 4W9QA 2N87A 5DIUA 4DRQA 1JVWA 2DG3A 3KABA 3MDYB 3KACA 4DT4A 4JYSA 5HWBA 2MLYA 4LAWA 1FAPA 3O5PA 1FKBA 2KO7A 3O5FA 3O5GA 4N19A 1YATA 4MSPA 5HW6A 2MPHA 4IPXA 1Q6UA 3RFWA 1QPFA 3CGMA 3KADA 4FAPA 4JFMA 2Y78A 3FAPA 4U85A 4DROA 1FKDA 2MLZA 3UI6A 2MF9A 3O5DA 3PRBA 1FKTA 4JFJA 2RURA 3KCEA 2ITKA 1FKIA 5HUAA 3CGNA 3O5JA 1FD9A 1ROUA 2FAPA 2M2AA 3RGCA 1FKHA 5BXJA 2L2SA 2XP7A 4GGQA 3KAFA 2JZVA 1J4RA 1D7IA 3IKGA 4ODPA 1D6OA 4LAVA 4DRNA 4JFLA 1KT1A 3IHZA 3O5MA 2XP8A 3O5RA 1EYMA 2PPOA 2RSEA 1YW5A 3NI6A 4ODQA 2D9FA 1M5YA 3IK8A 2PV2A 4W9OA 4U84A 4W9PA 2MNTA 1QZ2A 3O5EA 2ZQTA 4IQ2A 2RUDA 4J4NA 4C02B 2M08A 1F8AB 2PV3A 3B7XA 4DIPA 4JFIA 5HTGA 1D7JA 3O5IA 2PPNA 1NMWA 2XP4A 4JFKA 4G50A 3TCZA 1L1PA 2VCDA 4DRKA 2Q5AA 4QT3A 2RUQA 2ZQUA 2XPBA 2PPPA 3UI4A 2F4EA 2OFNA 1JNTA 2XP6A 3PA7A 1HXVA 4QT2A 2ZQSA 2LPVA 2ZQVA 4TW8A 1KT0A 4U86A 1F40A 1U79A 4QIBA 1B6CA 4TW7A 1J6YA 1TCOC 3EY6A 1J4HA 2XP3A 3KAIA 5DITA 3TC5A 3UI5A 4TX0A 1D7HA 3WH0A 1NSGA 3KAHA 4DH0A 1FKKA 3TDBA 3JYMA
chains in the Genus database with same CATH superfamily
3B9AA 1FKFA 2DG4A 1FKGA 1FJDA 1FKLA 1JNSA 3WKZA 4GIVA 4HBEA 1SR0A 1LG2A 1J4IA 4NSBA 1R9HA 5HKGA 2EULA 1RD6A 3UF8A 1N1AA 1Y0OA 5HWCA 4ODKA 2F2DA 4R0XA 1EIBA 3WD0A 3ODKA 3NTPA 3I6CA 5D75A 1ROTA 1JNEA 5JH8A 1E9LA 3PRDA 2ZR6A 1NMVA 2WK2A 3G6LA 1ZCNA 2IF4A 3ARPA 1LL4A 3ARUA 4TNSA 4Z2IA 4DRQA 1SYTA 2DSZA 1E44A 4NZCA 1FKBA 1CTNA 4Z2JA 2FDMA 1LJYA 1YATA 5HW6A 1W9PA 2MPHA 3ARWA 1Q6UA 3RFWA 4DROA 2MF9A 2A3BA 1W1TA 1WB0A 4Z2LA 4UDMA 2ITKA 3W4RA 1GUVA 1FFRA 5BXJA 1WNOA 1K9TA 2PI6A 4L3NA 1J4RA 1D7IA 4LAVA 4JFLA 1W1VA 3O5MA 2XP8A 2WM0A 3NI6A 2D9FA 2DSVA 3O5EA 2ZQTA 4C02B 3B7XA 5HTGA 2PPNA 1NMWA 1L1PA 2WLYA 2ZQUA 4KQZA 1NWTA 1HJXA 3WQWA 2ZQSA 2A3EA 4TW8A 1D2KA 3WD1A 2XP3A 3KAIA 3PR9A 3TC5A 3WD2A 4DWSC 1FKKA 5I98A 1LL7A 4ODMA 2AWGA 2XPAA 1HKJA 1ZBWA 4DWSD 2LJ4A 5GPGA 3UQIA 1HJVA 1PINA 1H0IA 1GOIA 3WD4A 2KI3A 1O6IA 2DSUA 1W1PA 1P5QA 4IT4A 4G2PA 2ESCA 4DZ3A 2KE0A 5DIVA 3NRKA 3BMBA 4DRHA 2OLHA 2F23A 3UQBA 4ODRA 5HT1A 1HKKA 2B5UB 4MGVA 1LL6A 1GPFA 4DWSB 1QPLA 4MNJA 2KFWA 3ARZA 4ODLA 4QZVB 3AS2A 2K8IA 4FN2A 3ARVA 3OOBA 3O5OA 4NNRA 4DRIA 4W9QA 4ZPVR 1JVWA 3KABA 4DT4A 2KO7A 3O5FA 3PRAA 2O92A 4MSPA 4URIA 4JFMA 4U85A 1NWUA 1ZBKA 1W9VA 3CH9A 3O5DA 1FKTA 4JFJA 2A3AA 1EHNA 4Z2HA 1W9UA 1GRJA 1FKHA 2L2SA 2XP7A 5GPRA 3ARTA 3KAFA 2JZVA 4S3KA 1KT1A 3IHZA 1W1YA 2RSEA 1YW5A 1HJWA 4P8WA 1ZBCA 1KFWA 3IK8A 4IT6A 2DSWA 1QZ2A 4J4NA 2DT2A 4IQ2A 4ZPTR 4DIPA 2M08A 3TCZA 2XP4A 3OA5A 1E6PA 4DRKA 2Q5AA 1E6NA 4QT3A 4WJXA 2OFNA 1JNTA 2XP6A 3PA7A 3AQUA 4PTMA 4QT2A 4XAKA 2LPVA 1KT0A 1TCOC 1X6NA 1J4HA 5DITA 4HARA 4ZPWR 3WH0A 1NSGA 3KAHA 2AOSA 4TW6A 1Q1CA 5HW8A 4ITZA 4MNMA 2MLXA 1Q6IA 4WKFA 5B8IC 4ODOA 5J6EA 2P4VA 2DT1A 2RQSA 3O5LA 1NWRA 2A3CA 3O5KA 1OGGA 2PBCA 2XP5A 4P8VA 2ZR5A 4DRPA 4LAXA 1HKMA 1A7XA 1FKSA 1Q6HA 3WQVA 2O9OA 2UZ5A 3CHEA 2M1IA 3GPKA 2KGJA 1T11A 4Q22A 3H9RB 3AS0A 2FKEA 3ARQA 3GU0A 3JYJA 4IQCA 4J4OA 1FKRA 1E6ZA 3O5QA 1W26A 3KZ7A 3RMEA 3JXVA 4S3JA 1PBKA 2N87A 4WKAA 2DPEA 4JYSA 2MLYA 4LAWA 3B9DA 1FAPA 3O5GA 3EIPA 3B8SA 4MTVA 1LQ0A 4MNLA 3ARYA 3KADA 2Y78A 1X6LA 2MLZA 3AROA 2G8ZA 1ZBVA 2PN0A 3KCEA 4HBOA 1FKIA 1IX5A 1ZU8A 3O5JA 1FD9A 5DO2A 4LGXA 4WIWA 4DRNA 1FFQA 3CZ8A 4DWSA 1EDQA 3RM4A 2PV2A 4U84A 4W5UA 2MNTA 3WD3A 4L72B 3B9EA 1ZL1A 4G50A 3FY1A 2VCDA 2RUQA 3UI4A 2DT0A 2PPPA 2XPBA 2F4EA 1HXVA 1NWSA 1XRVA 5DEZA 4AY1A 4U86A 4Q7NA 3AS1A 4QIBA 1B6CA 1J6YA 1NH6A 3RM8A 3EY6A 3UI5A 3WIJA 1D7HA 4P8UA 1H0GA 1BL4A 3IKDA 2VN1A 2PV1A 3ARSA 1ITXA 5HBFA 2F21A 3CHDA 1C9HA 3RM9A 5HW7A 2KR7A 4BF8A 4ODNA 2G41A 1BKFA 4ML4A 1JNDA 1XHGA 1EQ3A 4Z2KA 3VAWA 1FKJA 3ALFA 2XP9A 4TYOA 3KAGA 2ETNA 1UR9A 2LKNA 1JCHB 3CHFA 2DT3A 5GQBA 4O2TA 4DRMA 4Z2GA 4LAYA 1E6RA 1OWQA 3UQAA 4KR0B 4DZ2A 1ZK6A 2DG9A 2ZR4A 3ALGA 1OGBA 2RUCA 4DRJA 2LGOA 3LUOA 5DIUA 2DG3A 3MDYB 3KACA 5HWBA 2YBUA 1ZB5A 3O5PA 3ARRA 4WKHA 4N19A 3FXYA 4IPXA 1QPFA 3CGMA 4FAPA 3FAPA 4P8XA 1UR8A 1FKDA 3UI6A 3BXWA 3PRBA 2B31A 2RURA 4MNKA 5HUAA 3CHCA 3CGNA 3G6MA 1HKIA 1ROUA 2FAPA 2M2AA 3RGCA 4R5EA 4GGQA 4ODPA 1D6OA 4MAVA 3O5RA 1EYMA 2PPOA 4ODQA 1M5YA 4W9OA 1LG1A 4W9PA 1VF8A 2RUDA 2IUZA 1F8AB 2PV3A 4JFIA 1D7JA 3O5IA 4JFKA 2YBTA 1TFVA 3ARXA 3QOKA 1WAWA 4MPKA 3WL0A 4WK9A 2ZQVA 2QF8A 1E15A 1F40A 1U79A 2WLZA 4TW7A 3AS3A 3GTYX 4TX0A 4ZS6A 3WL1A 4DH0A 3IKGA 5DF0A 3TDBA 3JYMA
chains in the Genus database with same CATH topology
3B9AA 1FKFA 2DG4A 1FKGA 1FJDA 1FKLA 1JNSA 3WKZA 4GIVA 4HBEA 1SR0A 1LG2A 1J4IA 4NSBA 1R9HA 5HKGA 1RD6A 3UF8A 1N1AA 1Y0OA 5HWCA 4ODKA 2F2DA 4R0XA 1EIBA 3WD0A 3ODKA 3NTPA 3I6CA 5D75A 1ROTA 1JNEA 5JH8A 1E9LA 3PRDA 2ZR6A 1NMVA 2WK2A 3G6LA 1ZCNA 2IF4A 3ARPA 1LL4A 3ARUA 4TNSA 4Z2IA 4DRQA 1SYTA 2DSZA 4NZCA 1FKBA 1CTNA 4Z2JA 2FDMA 1LJYA 1YATA 5HW6A 1W9PA 2MPHA 3ARWA 1Q6UA 3RFWA 4DROA 2MF9A 2A3BA 1W1TA 1WB0A 4Z2LA 2ITKA 3W4RA 1GUVA 1FFRA 5BXJA 1WNOA 1K9TA 2PI6A 4L3NA 1J4RA 1D7IA 4LAVA 4JFLA 1W1VA 3O5MA 2XP8A 2WM0A 3NI6A 2D9FA 2DSVA 3O5EA 2ZQTA 4C02B 3B7XA 5HTGA 2PPNA 1NMWA 1L1PA 2WLYA 2ZQUA 4KQZA 1NWTA 1HJXA 3WQWA 2ZQSA 2A3EA 4TW8A 1D2KA 3WD1A 2XP3A 3KAIA 3PR9A 3TC5A 3WD2A 4DWSC 1FKKA 5I98A 1LL7A 4ODMA 2AWGA 2XPAA 1HKJA 1ZBWA 4DWSD 2LJ4A 5GPGA 3UQIA 1HJVA 1PINA 1H0IA 1GOIA 3WD4A 2KI3A 1O6IA 2DSUA 1W1PA 1P5QA 4IT4A 4G2PA 2ESCA 4DZ3A 2KE0A 5DIVA 3NRKA 4DRHA 2OLHA 3UQBA 4ODRA 5HT1A 1HKKA 4MGVA 1LL6A 1GPFA 4DWSB 1QPLA 4MNJA 2KFWA 3ARZA 4ODLA 4QZVB 3AS2A 2K8IA 4FN2A 3ARVA 3OOBA 3O5OA 4NNRA 4DRIA 4W9QA 4ZPVR 1JVWA 3KABA 4DT4A 2KO7A 3O5FA 3PRAA 2O92A 4MSPA 4URIA 4JFMA 4U85A 1NWUA 1ZBKA 1W9VA 3CH9A 3O5DA 1FKTA 4JFJA 2A3AA 1EHNA 4Z2HA 1W9UA 1FKHA 2L2SA 2XP7A 5GPRA 3ARTA 3KAFA 2JZVA 4S3KA 1KT1A 3IHZA 1W1YA 2RSEA 1YW5A 1HJWA 4P8WA 1ZBCA 1KFWA 3IK8A 4IT6A 2DSWA 1QZ2A 4J4NA 2DT2A 4IQ2A 4ZPTR 4DIPA 2M08A 3TCZA 2XP4A 3OA5A 1E6PA 4DRKA 2Q5AA 1E6NA 4QT3A 4WJXA 2OFNA 1JNTA 2XP6A 3PA7A 3AQUA 4PTMA 4QT2A 4XAKA 2LPVA 1KT0A 1TCOC 1X6NA 1J4HA 5DITA 4HARA 4ZPWR 3WH0A 1NSGA 3KAHA 2AOSA 4TW6A 1Q1CA 5HW8A 4ITZA 4MNMA 2MLXA 1Q6IA 4WKFA 5B8IC 4ODOA 5J6EA 2DT1A 2RQSA 3O5LA 1NWRA 2A3CA 3O5KA 1OGGA 2PBCA 2XP5A 4P8VA 2ZR5A 4DRPA 4LAXA 1HKMA 1A7XA 1FKSA 1Q6HA 3WQVA 2O9OA 2UZ5A 3CHEA 2M1IA 3GPKA 2KGJA 1T11A 4Q22A 3H9RB 3AS0A 2FKEA 3ARQA 3JYJA 4IQCA 4J4OA 1FKRA 1E6ZA 3O5QA 1W26A 3KZ7A 3RMEA 3JXVA 4S3JA 1PBKA 2N87A 4WKAA 2DPEA 4JYSA 2MLYA 4LAWA 3B9DA 1FAPA 3O5GA 3B8SA 4MTVA 1LQ0A 4MNLA 3ARYA 3KADA 2Y78A 1X6LA 2MLZA 3AROA 2G8ZA 1ZBVA 3KCEA 4HBOA 1FKIA 1IX5A 1ZU8A 3O5JA 1FD9A 5DO2A 4LGXA 4WIWA 4DRNA 1FFQA 3CZ8A 4DWSA 1EDQA 3RM4A 2PV2A 4U84A 4W5UA 2MNTA 3WD3A 4L72B 3B9EA 1ZL1A 4G50A 3FY1A 2VCDA 2RUQA 3UI4A 2DT0A 2PPPA 2XPBA 2F4EA 1HXVA 1NWSA 1XRVA 5DEZA 4AY1A 4U86A 4Q7NA 3AS1A 4QIBA 1B6CA 1J6YA 1NH6A 3RM8A 3EY6A 3UI5A 3WIJA 1D7HA 4P8UA 1H0GA 1BL4A 3IKDA 2VN1A 2PV1A 3ARSA 1ITXA 5HBFA 2F21A 3CHDA 1C9HA 3RM9A 5HW7A 2KR7A 4BF8A 4ODNA 2G41A 1BKFA 4ML4A 1JNDA 1XHGA 1EQ3A 4Z2KA 3VAWA 1FKJA 3ALFA 2XP9A 4TYOA 3KAGA 1UR9A 2LKNA 3CHFA 2DT3A 5GQBA 4O2TA 4DRMA 4Z2GA 4LAYA 1E6RA 1OWQA 3UQAA 4KR0B 4DZ2A 1ZK6A 2DG9A 2ZR4A 3ALGA 1OGBA 2RUCA 4DRJA 2LGOA 3LUOA 5DIUA 2DG3A 3MDYB 3KACA 5HWBA 2YBUA 1ZB5A 3O5PA 3ARRA 4WKHA 4N19A 3FXYA 4IPXA 1QPFA 3CGMA 4FAPA 3FAPA 4P8XA 1UR8A 1FKDA 3UI6A 3BXWA 3PRBA 2B31A 2RURA 4MNKA 5HUAA 3CHCA 3CGNA 3G6MA 1HKIA 1ROUA 2FAPA 2M2AA 3RGCA 4R5EA 4GGQA 4ODPA 1D6OA 4MAVA 3O5RA 1EYMA 2PPOA 4ODQA 1M5YA 4W9OA 1LG1A 4W9PA 1VF8A 2RUDA 2IUZA 1F8AB 2PV3A 4JFIA 1D7JA 3O5IA 4JFKA 2YBTA 1TFVA 3ARXA 3QOKA 1WAWA 4MPKA 3WL0A 4WK9A 2ZQVA 2QF8A 1E15A 1F40A 1U79A 2WLZA 4TW7A 3AS3A 4TX0A 4ZS6A 3WL1A 4DH0A 3IKGA 5DF0A 3TDBA 3JYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW6 A;  1BL4 A;  4ODM A;  1Q1C A;  3IKD A;  1FKF A;  5HW8 A;  4ITZ A;  2AWG A;  2VN1 A;  2MLX A;  2DG4 A;  2PV1 A;  1FKG A;  1Q6I A;  2XPA A;  1FJD A;  2LJ4 A;  5GPG A;  5B8I C;  3UQI A;  4ODO A;  1FKL A;  2F21 A;  5J6E A;  1JNS A;  4GIV A;  1C9H A;  1PIN A;  2RQS A;  1J4I A;  2KR7 A;  2KI3 A;  3O5L A;  4BF8 A;  5HW7 A;  4ODN A;  1R9H A;  1P5Q A;  1BKF A;  5HKG A;  4G2P A;  3O5K A;  1EQ3 A;  2PBC A;  3VAW A;  3UF8 A;  1FKJ A;  2XP5 A;  2XP9 A;  4TYO A;  2ZR5 A;  1N1A A;  4LAX A;  4DRP A;  1A7X A;  1FKS A;  3KAG A;  1Y0O A;  1Q6H A;  4ODK A;  4DZ3 A;  5HWC A;  2KE0 A;  2F2D A;  3NRK A;  5DIV A;  2LKN A;  4R0X A;  4DRH A;  5I98 A;  3ODK A;  3NTP A;  2UZ5 A;  3I6C A;  5D75 A;  4O2T A;  4DRM A;  1ROT A;  3UQB A;  4ODR A;  2M1I A;  3GPK A;  2KGJ A;  4LAY A;  5HT1 A;  1T11 A;  4MGV A;  3H9R B;  3UQA A;  3PRD A;  4DZ2 A;  1ZK6 A;  2FKE A;  1QPL A;  2DG9 A;  2ZR6 A;  3JYJ A;  2KFW A;  4IQC A;  2ZR4 A;  4J4O A;  4ODL A;  1FKR A;  2K8I A;  1NMV A;  3OOB A;  4FN2 A;  3O5Q A;  1W26 A;  2RUC A;  3KZ7 A;  3JXV A;  1ZCN A;  2IF4 A;  3O5O A;  2LGO A;  4NNR A;  4DRJ A;  1PBK A;  3LUO A;  4TNS A;  4DRI A;  4W9Q A;  2N87 A;  5DIU A;  4DRQ A;  1JVW A;  2DG3 A;  3KAB A;  3MDY B;  3KAC A;  4DT4 A;  4JYS A;  5HWB A;  2MLY A;  4LAW A;  1FAP A;  3O5P A;  1FKB A;  2KO7 A;  3O5F A;  3O5G A;  4N19 A;  1YAT A;  4MSP A;  5HW6 A;  2MPH A;  4IPX A;  1Q6U A;  3RFW A;  1QPF A;  3CGM A;  3KAD A;  4FAP A;  4JFM A;  2Y78 A;  3FAP A;  4U85 A;  4DRO A;  1FKD A;  2MLZ A;  3UI6 A;  2MF9 A;  3O5D A;  3PRB A;  1FKT A;  4JFJ A;  2RUR A;  3KCE A;  2ITK A;  1FKI A;  5HUA A;  3CGN A;  3O5J A;  1FD9 A;  1ROU A;  2FAP A;  2M2A A;  3RGC A;  1FKH A;  5BXJ A;  2L2S A;  2XP7 A;  4GGQ A;  3KAF A;  2JZV A;  1J4R A;  1D7I A;  3IKG A;  4ODP A;  1D6O A;  4LAV A;  4DRN A;  4JFL A;  1KT1 A;  3IHZ A;  3O5M A;  2XP8 A;  3O5R A;  1EYM A;  2PPO A;  2RSE A;  1YW5 A;  3NI6 A;  4ODQ A;  2D9F A;  1M5Y A;  3IK8 A;  2PV2 A;  4W9O A;  4U84 A;  4W9P A;  2MNT A;  1QZ2 A;  3O5E A;  2ZQT A;  4IQ2 A;  2RUD A;  4J4N A;  4C02 B;  2M08 A;  1F8A B;  2PV3 A;  3B7X A;  4DIP A;  4JFI A;  5HTG A;  1D7J A;  3O5I A;  2PPN A;  1NMW A;  2XP4 A;  4JFK A;  4G50 A;  3TCZ A;  1L1P A;  2VCD A;  4DRK A;  2Q5A A;  4QT3 A;  2RUQ A;  2ZQU A;  2XPB A;  2PPP A;  3UI4 A;  2F4E A;  2OFN A;  1JNT A;  2XP6 A;  3PA7 A;  1HXV A;  4QT2 A;  2ZQS A;  2LPV A;  2ZQV A;  4TW8 A;  1KT0 A;  4U86 A;  1F40 A;  1U79 A;  4QIB A;  1B6C A;  4TW7 A;  1J6Y A;  1TCO C;  3EY6 A;  1J4H A;  2XP3 A;  3KAI A;  5DIT A;  3TC5 A;  3UI5 A;  4TX0 A;  1D7H A;  3WH0 A;  1NSG A;  3KAH A;  4DH0 A;  1FKK A;  3TDB A;  3JYM A; 
#chains in the Genus database with same CATH topology
 3B9A A;  1FKF A;  2DG4 A;  1FKG A;  1FJD A;  1FKL A;  1JNS A;  3WKZ A;  4GIV A;  4HBE A;  1SR0 A;  1LG2 A;  1J4I A;  4NSB A;  1R9H A;  5HKG A;  2EUL A;  1RD6 A;  3UF8 A;  1N1A A;  1Y0O A;  5HWC A;  4ODK A;  2F2D A;  4R0X A;  1EIB A;  3WD0 A;  3ODK A;  3NTP A;  3I6C A;  5D75 A;  1ROT A;  1JNE A;  5JH8 A;  1E9L A;  3PRD A;  2ZR6 A;  1NMV A;  2WK2 A;  3G6L A;  1ZCN A;  2IF4 A;  3ARP A;  1LL4 A;  3ARU A;  4TNS A;  4Z2I A;  4DRQ A;  1SYT A;  2DSZ A;  1E44 A;  4NZC A;  1FKB A;  1CTN A;  4Z2J A;  2FDM A;  1LJY A;  1YAT A;  5HW6 A;  1W9P A;  2MPH A;  3ARW A;  1Q6U A;  3RFW A;  4DRO A;  2MF9 A;  2A3B A;  1W1T A;  1WB0 A;  4Z2L A;  4UDM A;  2ITK A;  3W4R A;  1GUV A;  1FFR A;  5BXJ A;  1WNO A;  1K9T A;  2PI6 A;  4L3N A;  1J4R A;  1D7I A;  4LAV A;  4JFL A;  1W1V A;  3O5M A;  2XP8 A;  2WM0 A;  3NI6 A;  2D9F A;  2DSV A;  3O5E A;  2ZQT A;  4C02 B;  3B7X A;  5HTG A;  2PPN A;  1NMW A;  1L1P A;  2WLY A;  2ZQU A;  4KQZ A;  1NWT A;  1HJX A;  3WQW A;  2ZQS A;  2A3E A;  4TW8 A;  1D2K A;  3WD1 A;  2XP3 A;  3KAI A;  3PR9 A;  3TC5 A;  3WD2 A;  4DWS C;  1FKK A;  5I98 A;  1LL7 A;  4ODM A;  2AWG A;  2XPA A;  1HKJ A;  1ZBW A;  4DWS D;  2LJ4 A;  5GPG A;  3UQI A;  1HJV A;  1PIN A;  1H0I A;  1GOI A;  3WD4 A;  2KI3 A;  1O6I A;  2DSU A;  1W1P A;  1P5Q A;  4IT4 A;  4G2P A;  2ESC A;  4DZ3 A;  2KE0 A;  5DIV A;  3NRK A;  3BMB A;  4DRH A;  2OLH A;  2F23 A;  3UQB A;  4ODR A;  5HT1 A;  1HKK A;  2B5U B;  4MGV A;  1LL6 A;  1GPF A;  4DWS B;  1QPL A;  4MNJ A;  2KFW A;  3ARZ A;  4ODL A;  4QZV B;  3AS2 A;  2K8I A;  4FN2 A;  3ARV A;  3OOB A;  3O5O A;  4NNR A;  4DRI A;  4W9Q A;  4ZPV R;  1JVW A;  3KAB A;  4DT4 A;  2KO7 A;  3O5F A;  3PRA A;  2O92 A;  4MSP A;  4URI A;  4JFM A;  4U85 A;  1NWU A;  1ZBK A;  1W9V A;  3CH9 A;  3O5D A;  1FKT A;  4JFJ A;  2A3A A;  1EHN A;  4Z2H A;  1W9U A;  1GRJ A;  1FKH A;  2L2S A;  2XP7 A;  5GPR A;  3ART A;  3KAF A;  2JZV A;  4S3K A;  1KT1 A;  3IHZ A;  1W1Y A;  2RSE A;  1YW5 A;  1HJW A;  4P8W A;  1ZBC A;  1KFW A;  3IK8 A;  4IT6 A;  2DSW A;  1QZ2 A;  4J4N A;  2DT2 A;  4IQ2 A;  4ZPT R;  4DIP A;  2M08 A;  3TCZ A;  2XP4 A;  3OA5 A;  1E6P A;  4DRK A;  2Q5A A;  1E6N A;  4QT3 A;  4WJX A;  2OFN A;  1JNT A;  2XP6 A;  3PA7 A;  3AQU A;  4PTM A;  4QT2 A;  4XAK A;  2LPV A;  1KT0 A;  1TCO C;  1X6N A;  1J4H A;  5DIT A;  4HAR A;  4ZPW R;  3WH0 A;  1NSG A;  3KAH A;  2AOS A;  4TW6 A;  1Q1C A;  5HW8 A;  4ITZ A;  4MNM A;  2MLX A;  1Q6I A;  4WKF A;  5B8I C;  4ODO A;  5J6E A;  2P4V A;  2DT1 A;  2RQS A;  3O5L A;  1NWR A;  2A3C A;  3O5K A;  1OGG A;  2PBC A;  2XP5 A;  4P8V A;  2ZR5 A;  4DRP A;  4LAX A;  1HKM A;  1A7X A;  1FKS A;  1Q6H A;  3WQV A;  2O9O A;  2UZ5 A;  3CHE A;  2M1I A;  3GPK A;  2KGJ A;  1T11 A;  4Q22 A;  3H9R B;  3AS0 A;  2FKE A;  3ARQ A;  3GU0 A;  3JYJ A;  4IQC A;  4J4O A;  1FKR A;  1E6Z A;  3O5Q A;  1W26 A;  3KZ7 A;  3RME A;  3JXV A;  4S3J A;  1PBK A;  2N87 A;  4WKA A;  2DPE A;  4JYS A;  2MLY A;  4LAW A;  3B9D A;  1FAP A;  3O5G A;  3EIP A;  3B8S A;  4MTV A;  1LQ0 A;  4MNL A;  3ARY A;  3KAD A;  2Y78 A;  1X6L A;  2MLZ A;  3ARO A;  2G8Z A;  1ZBV A;  2PN0 A;  3KCE A;  4HBO A;  1FKI A;  1IX5 A;  1ZU8 A;  3O5J A;  1FD9 A;  5DO2 A;  4LGX A;  4WIW A;  4DRN A;  1FFQ A;  3CZ8 A;  4DWS A;  1EDQ A;  3RM4 A;  2PV2 A;  4U84 A;  4W5U A;  2MNT A;  3WD3 A;  4L72 B;  3B9E A;  1ZL1 A;  4G50 A;  3FY1 A;  2VCD A;  2RUQ A;  3UI4 A;  2DT0 A;  2PPP A;  2XPB A;  2F4E A;  1HXV A;  1NWS A;  1XRV A;  5DEZ A;  4AY1 A;  4U86 A;  4Q7N A;  3AS1 A;  4QIB A;  1B6C A;  1J6Y A;  1NH6 A;  3RM8 A;  3EY6 A;  3UI5 A;  3WIJ A;  1D7H A;  4P8U A;  1H0G A;  1BL4 A;  3IKD A;  2VN1 A;  2PV1 A;  3ARS A;  1ITX A;  5HBF A;  2F21 A;  3CHD A;  1C9H A;  3RM9 A;  5HW7 A;  2KR7 A;  4BF8 A;  4ODN A;  2G41 A;  1BKF A;  4ML4 A;  1JND A;  1XHG A;  1EQ3 A;  4Z2K A;  3VAW A;  1FKJ A;  3ALF A;  2XP9 A;  4TYO A;  3KAG A;  2ETN A;  1UR9 A;  2LKN A;  1JCH B;  3CHF A;  2DT3 A;  5GQB A;  4O2T A;  4DRM A;  4Z2G A;  4LAY A;  1E6R A;  1OWQ A;  3UQA A;  4KR0 B;  4DZ2 A;  1ZK6 A;  2DG9 A;  2ZR4 A;  3ALG A;  1OGB A;  2RUC A;  4DRJ A;  2LGO A;  3LUO A;  5DIU A;  2DG3 A;  3MDY B;  3KAC A;  5HWB A;  2YBU A;  1ZB5 A;  3O5P A;  3ARR A;  4WKH A;  4N19 A;  3FXY A;  4IPX A;  1QPF A;  3CGM A;  4FAP A;  3FAP A;  4P8X A;  1UR8 A;  1FKD A;  3UI6 A;  3BXW A;  3PRB A;  2B31 A;  2RUR A;  4MNK A;  5HUA A;  3CHC A;  3CGN A;  3G6M A;  1HKI A;  1ROU A;  2FAP A;  2M2A A;  3RGC A;  4R5E A;  4GGQ A;  4ODP A;  1D6O A;  4MAV A;  3O5R A;  1EYM A;  2PPO A;  4ODQ A;  1M5Y A;  4W9O A;  1LG1 A;  4W9P A;  1VF8 A;  2RUD A;  2IUZ A;  1F8A B;  2PV3 A;  4JFI A;  1D7J A;  3O5I A;  4JFK A;  2YBT A;  1TFV A;  3ARX A;  3QOK A;  1WAW A;  4MPK A;  3WL0 A;  4WK9 A;  2ZQV A;  2QF8 A;  1E15 A;  1F40 A;  1U79 A;  2WLZ A;  4TW7 A;  3AS3 A;  3GTY X;  4TX0 A;  4ZS6 A;  3WL1 A;  4DH0 A;  3IKG A;  5DF0 A;  3TDB A;  3JYM A; 
#chains in the Genus database with same CATH homology
 3B9A A;  1FKF A;  2DG4 A;  1FKG A;  1FJD A;  1FKL A;  1JNS A;  3WKZ A;  4GIV A;  4HBE A;  1SR0 A;  1LG2 A;  1J4I A;  4NSB A;  1R9H A;  5HKG A;  1RD6 A;  3UF8 A;  1N1A A;  1Y0O A;  5HWC A;  4ODK A;  2F2D A;  4R0X A;  1EIB A;  3WD0 A;  3ODK A;  3NTP A;  3I6C A;  5D75 A;  1ROT A;  1JNE A;  5JH8 A;  1E9L A;  3PRD A;  2ZR6 A;  1NMV A;  2WK2 A;  3G6L A;  1ZCN A;  2IF4 A;  3ARP A;  1LL4 A;  3ARU A;  4TNS A;  4Z2I A;  4DRQ A;  1SYT A;  2DSZ A;  4NZC A;  1FKB A;  1CTN A;  4Z2J A;  2FDM A;  1LJY A;  1YAT A;  5HW6 A;  1W9P A;  2MPH A;  3ARW A;  1Q6U A;  3RFW A;  4DRO A;  2MF9 A;  2A3B A;  1W1T A;  1WB0 A;  4Z2L A;  2ITK A;  3W4R A;  1GUV A;  1FFR A;  5BXJ A;  1WNO A;  1K9T A;  2PI6 A;  4L3N A;  1J4R A;  1D7I A;  4LAV A;  4JFL A;  1W1V A;  3O5M A;  2XP8 A;  2WM0 A;  3NI6 A;  2D9F A;  2DSV A;  3O5E A;  2ZQT A;  4C02 B;  3B7X A;  5HTG A;  2PPN A;  1NMW A;  1L1P A;  2WLY A;  2ZQU A;  4KQZ A;  1NWT A;  1HJX A;  3WQW A;  2ZQS A;  2A3E A;  4TW8 A;  1D2K A;  3WD1 A;  2XP3 A;  3KAI A;  3PR9 A;  3TC5 A;  3WD2 A;  4DWS C;  1FKK A;  5I98 A;  1LL7 A;  4ODM A;  2AWG A;  2XPA A;  1HKJ A;  1ZBW A;  4DWS D;  2LJ4 A;  5GPG A;  3UQI A;  1HJV A;  1PIN A;  1H0I A;  1GOI A;  3WD4 A;  2KI3 A;  1O6I A;  2DSU A;  1W1P A;  1P5Q A;  4IT4 A;  4G2P A;  2ESC A;  4DZ3 A;  2KE0 A;  5DIV A;  3NRK A;  4DRH A;  2OLH A;  3UQB A;  4ODR A;  5HT1 A;  1HKK A;  4MGV A;  1LL6 A;  1GPF A;  4DWS B;  1QPL A;  4MNJ A;  2KFW A;  3ARZ A;  4ODL A;  4QZV B;  3AS2 A;  2K8I A;  4FN2 A;  3ARV A;  3OOB A;  3O5O A;  4NNR A;  4DRI A;  4W9Q A;  4ZPV R;  1JVW A;  3KAB A;  4DT4 A;  2KO7 A;  3O5F A;  3PRA A;  2O92 A;  4MSP A;  4URI A;  4JFM A;  4U85 A;  1NWU A;  1ZBK A;  1W9V A;  3CH9 A;  3O5D A;  1FKT A;  4JFJ A;  2A3A A;  1EHN A;  4Z2H A;  1W9U A;  1FKH A;  2L2S A;  2XP7 A;  5GPR A;  3ART A;  3KAF A;  2JZV A;  4S3K A;  1KT1 A;  3IHZ A;  1W1Y A;  2RSE A;  1YW5 A;  1HJW A;  4P8W A;  1ZBC A;  1KFW A;  3IK8 A;  4IT6 A;  2DSW A;  1QZ2 A;  4J4N A;  2DT2 A;  4IQ2 A;  4ZPT R;  4DIP A;  2M08 A;  3TCZ A;  2XP4 A;  3OA5 A;  1E6P A;  4DRK A;  2Q5A A;  1E6N A;  4QT3 A;  4WJX A;  2OFN A;  1JNT A;  2XP6 A;  3PA7 A;  3AQU A;  4PTM A;  4QT2 A;  4XAK A;  2LPV A;  1KT0 A;  1TCO C;  1X6N A;  1J4H A;  5DIT A;  4HAR A;  4ZPW R;  3WH0 A;  1NSG A;  3KAH A;  2AOS A;  4TW6 A;  1Q1C A;  5HW8 A;  4ITZ A;  4MNM A;  2MLX A;  1Q6I A;  4WKF A;  5B8I C;  4ODO A;  5J6E A;  2DT1 A;  2RQS A;  3O5L A;  1NWR A;  2A3C A;  3O5K A;  1OGG A;  2PBC A;  2XP5 A;  4P8V A;  2ZR5 A;  4DRP A;  4LAX A;  1HKM A;  1A7X A;  1FKS A;  1Q6H A;  3WQV A;  2O9O A;  2UZ5 A;  3CHE A;  2M1I A;  3GPK A;  2KGJ A;  1T11 A;  4Q22 A;  3H9R B;  3AS0 A;  2FKE A;  3ARQ A;  3JYJ A;  4IQC A;  4J4O A;  1FKR A;  1E6Z A;  3O5Q A;  1W26 A;  3KZ7 A;  3RME A;  3JXV A;  4S3J A;  1PBK A;  2N87 A;  4WKA A;  2DPE A;  4JYS A;  2MLY A;  4LAW A;  3B9D A;  1FAP A;  3O5G A;  3B8S A;  4MTV A;  1LQ0 A;  4MNL A;  3ARY A;  3KAD A;  2Y78 A;  1X6L A;  2MLZ A;  3ARO A;  2G8Z A;  1ZBV A;  3KCE A;  4HBO A;  1FKI A;  1IX5 A;  1ZU8 A;  3O5J A;  1FD9 A;  5DO2 A;  4LGX A;  4WIW A;  4DRN A;  1FFQ A;  3CZ8 A;  4DWS A;  1EDQ A;  3RM4 A;  2PV2 A;  4U84 A;  4W5U A;  2MNT A;  3WD3 A;  4L72 B;  3B9E A;  1ZL1 A;  4G50 A;  3FY1 A;  2VCD A;  2RUQ A;  3UI4 A;  2DT0 A;  2PPP A;  2XPB A;  2F4E A;  1HXV A;  1NWS A;  1XRV A;  5DEZ A;  4AY1 A;  4U86 A;  4Q7N A;  3AS1 A;  4QIB A;  1B6C A;  1J6Y A;  1NH6 A;  3RM8 A;  3EY6 A;  3UI5 A;  3WIJ A;  1D7H A;  4P8U A;  1H0G A;  1BL4 A;  3IKD A;  2VN1 A;  2PV1 A;  3ARS A;  1ITX A;  5HBF A;  2F21 A;  3CHD A;  1C9H A;  3RM9 A;  5HW7 A;  2KR7 A;  4BF8 A;  4ODN A;  2G41 A;  1BKF A;  4ML4 A;  1JND A;  1XHG A;  1EQ3 A;  4Z2K A;  3VAW A;  1FKJ A;  3ALF A;  2XP9 A;  4TYO A;  3KAG A;  1UR9 A;  2LKN A;  3CHF A;  2DT3 A;  5GQB A;  4O2T A;  4DRM A;  4Z2G A;  4LAY A;  1E6R A;  1OWQ A;  3UQA A;  4KR0 B;  4DZ2 A;  1ZK6 A;  2DG9 A;  2ZR4 A;  3ALG A;  1OGB A;  2RUC A;  4DRJ A;  2LGO A;  3LUO A;  5DIU A;  2DG3 A;  3MDY B;  3KAC A;  5HWB A;  2YBU A;  1ZB5 A;  3O5P A;  3ARR A;  4WKH A;  4N19 A;  3FXY A;  4IPX A;  1QPF A;  3CGM A;  4FAP A;  3FAP A;  4P8X A;  1UR8 A;  1FKD A;  3UI6 A;  3BXW A;  3PRB A;  2B31 A;  2RUR A;  4MNK A;  5HUA A;  3CHC A;  3CGN A;  3G6M A;  1HKI A;  1ROU A;  2FAP A;  2M2A A;  3RGC A;  4R5E A;  4GGQ A;  4ODP A;  1D6O A;  4MAV A;  3O5R A;  1EYM A;  2PPO A;  4ODQ A;  1M5Y A;  4W9O A;  1LG1 A;  4W9P A;  1VF8 A;  2RUD A;  2IUZ A;  1F8A B;  2PV3 A;  4JFI A;  1D7J A;  3O5I A;  4JFK A;  2YBT A;  1TFV A;  3ARX A;  3QOK A;  1WAW A;  4MPK A;  3WL0 A;  4WK9 A;  2ZQV A;  2QF8 A;  1E15 A;  1F40 A;  1U79 A;  2WLZ A;  4TW7 A;  3AS3 A;  4TX0 A;  4ZS6 A;  3WL1 A;  4DH0 A;  3IKG A;  5DF0 A;  3TDB A;  3JYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...