3O5KA

Fk1 domain of fkbp51, crystal form viii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5kA00
2RUDA 2LKNA 5HTGA 3O5RA 1KT0A 2XP3A 3TDBA 3JYMA 2MNTA 1JVWA 2XPAA 4G2PA 4DRPA 3B7XA 2F21A 5J6EA 2Y78A 4GIVA 4U85A 4DIPA 3H9RB 4LAXA 4ODQA 5DIVA 5GPGA 1KT1A 4DRNA 1Q6UA 4JFLA 3UI4A 5I98A 2LPVA 4DRKA 3KABA 1EYMA 3UI5A 3KAIA 4DROA 1ZK6A 3O5EA 3IK8A 1C9HA 3MDYB 1F8AB 3IKGA 2PPOA 4DH0A 3VAWA 3TCZA 2PV2A 4FAPA 1FD9A 4N19A 2FKEA 2VCDA 2MLZA 3RFWA 3OOBA 2MLXA 3O5KA 4TW7A 2M08A 3I6CA 5HW7A 4ODKA 2IF4A 4ODLA 1TCOC 2XP5A 3TC5A 3UF8A 2ZR6A 1J4HA 1FKSA 2PPNA 4IQ2A 4C02B 2ZR4A 4G50A 3CGMA 4JFIA 1P5QA 3PRBA 4W9OA 2ITKA 3O5IA 2XP8A 3O5GA 3UQBA 1N1AA 3NI6A 2UZ5A 4J4OA 3KADA 4IQCA 3NRKA 1U79A 1FAPA 1FKDA 4DRHA 1D6OA 2Q5AA 4DT4A 1FJDA 2KFWA 1Q6IA 4DRIA 1ROUA 2PV3A 2MPHA 3O5DA 4QT3A 4JFMA 3UQIA 2PV1A 2L2SA 1BL4A 2XPBA 2K8IA 3O5JA 4O2TA 1FKGA 1NSGA 1L1PA 1FKKA 3ODKA 1ZCNA 5HWBA 3O5OA 2VN1A 4FN2A 2RUCA 1T11A 4W9QA 2OFNA 1FKFA 4NNRA 3O5MA 1J4RA 1QPLA 4GGQA 4JFJA 3KAFA 2RUQA 4LAYA 4J4NA 1J6YA 5DITA 4DZ2A 1D7IA 2ZQVA 1YW5A 3KZ7A 3O5FA 1ROTA 2F2DA 2LGOA 4ODRA 4QT2A 4U84A 1YATA 3IKDA 2DG9A 3O5QA 1FKTA 3IHZA 1FKBA 1JNTA 1QZ2A 3PA7A 1R9HA 3JYJA 1FKJA 4ODMA 5HUAA 2KGJA 5B8IC 2N87A 1W26A 3EY6A 4LAWA 3LUOA 1NMWA 2M2AA 3KACA 1A7XA 2PPPA 2RSEA 2XP6A 4TNSA 5HWCA 2KO7A 3GPKA 1B6CA 1Q1CA 2XP4A 4BF8A 1FKLA 2ZQUA 4MGVA 3JXVA 2DG4A 1BKFA 3KAHA 4LAVA 3UI6A 1D7HA 2RQSA 3UQAA 2MLYA 4JFKA 2FAPA 1FKHA 4TX0A 1PBKA 4DRJA 4JYSA 4W9PA 3PRDA 4DRMA 1JNSA 3WH0A 2ZQSA 4ODPA 3RGCA 1M5YA 2XP9A 4U86A 4TW8A 5BXJA 1QPFA 2MF9A 2RURA 3KAGA 4IPXA 2D9FA 1FKIA 2KI3A 4QIBA 1EQ3A 2KE0A 2DG3A 4ODOA 4TYOA 2PBCA 5HW8A 1D7JA 2ZQTA 2AWGA 1J4IA 2JZVA 2XP7A 5HT1A 3O5PA 4MSPA 2KR7A 3NTPA 5HKGA 1NMVA 1F40A 5D75A 3O5LA 4ITZA 3KCEA 1HXVA 4ODNA 1Y0OA 2F4EA 2M1IA 2ZR5A 4DRQA 5HW6A 1FKRA 4DZ3A 1PINA 3CGNA 4R0XA 5DIUA 2LJ4A 3FAPA 4TW6A 1Q6HA
chains in the Genus database with same CATH superfamily
2LKNA 2WLZA 2XP3A 2A3CA 3JYMA 2MNTA 4ML4A 4GIVA 1E44A 1OWQA 2PN0A 3H9RB 4U85A 5GPGA 1KT1A 4R5EA 4WKAA 3FXYA 4DRNA 2B5UB 4JFLA 3UI4A 2LPVA 3UI5A 4DROA 1ZK6A 3O5EA 3IK8A 2ETNA 1W1YA 2PPOA 4FAPA 4N19A 2O92A 3WQVA 4WK9A 3I6CA 1TCOC 3UF8A 1J4HA 1FKSA 1XRVA 2PPNA 2ZR4A 4G50A 3PR9A 2QF8A 3PRBA 4AY1A 4MPKA 1ITXA 3O5IA 2XP8A 3RM8A 4J4OA 3KADA 1NWRA 1FJDA 1CTNA 2KFWA 1ROUA 2YBTA 1EIBA 1EDQA 2A3EA 2PV1A 1WAWA 4O2TA 2IUZA 1FKKA 1ZCNA 3O5OA 1GRJA 2RUCA 1T11A 2WM0A 4L3NA 2G41A 2DT2A 3O5MA 1QPLA 1J6YA 1HKKA 1W9UA 3B9EA 1D7IA 3O5FA 3KZ7A 2O9OA 1ROTA 2F2DA 4ODRA 1YATA 3CH9A 4Z2HA 3O5QA 1JNTA 1QZ2A 1R9HA 4LGXA 1FKJA 1EHNA 5B8IC 1E15A 3EY6A 1NMWA 5HWCA 1NWTA 1O6IA 1GPFA 2XP4A 1ZU8A 1FKLA 4URIA 3B8SA 1D7HA 1LG1A 4TX0A 2A3BA 2ZQSA 4U86A 4TW8A 2RURA 4IT6A 2KE0A 2DG3A 1HKMA 2YBUA 3CHDA 4MNMA 3O5PA 3NTPA 3WKZA 4MAVA 1F40A 3GU0A 1E6PA 3O5LA 4S3JA 4UDMA 3RM4A 1HJVA 1LL7A 3BMBA 1FKRA 3FAPA 4TW6A 2RUDA 1W9VA 4DRKA 4Z2JA 3QOKA 3TDBA 4G2PA 3AS1A 1LL4A 2F21A 4ODQA 2LJ4A 1Q6UA 1ZBWA 1C9HA 4MNLA 1F8AB 1IX5A 2PV2A 2FKEA 2VCDA 3O5KA 1UR8A 2M08A 4MNKA 4WIWA 4C02B 1NWUA 2DT3A 1W9PA 3ARTA 2ITKA 4NZCA 3AROA 3NI6A 4IQCA 1JNDA 4S3KA 4ZPWR 4IT4A 4DRIA 2PV3A 4DWSC 4QT3A 4MTVA 4HARA 1ZBVA 2ESCA 2G8ZA 4Q22A 1ZBKA 3O5JA 1FKGA 1NSGA 2PI6A 2VN1A 1FFRA 3G6MA 4W9QA 1LG2A 4QZVB 4Z2GA 2ZQVA 3CZ8A 2DG9A 3G6LA 1FKTA 4HBOA 1JNEA 2DT0A 2N87A 1W26A 1JCHB 2M2AA 3WQWA 1A7XA 3GPKA 1B6CA 1Q1CA 1K9TA 3AS3A 1LQ0A 3RM9A 4MGVA 2EULA 2RQSA 4JFKA 4NSBA 4W9PA 3WH0A 3RGCA 3ARWA 2MF9A 2D9FA 1FKIA 2KI3A 2DSZA 1EQ3A 4ODOA 1HKIA 1LJYA 4ODNA 1Y0OA 1JVWA 5J6EA 4DIPA 1X6NA 4LAXA 5DIVA 3RMEA 4P8VA 3MDYB 3VAWA 3WD1A 3B9AA 1FD9A 3OOBA 4TW7A 5HW7A 4ODKA 3ARRA 3TC5A 2ZR6A 3ARYA 2OLHA 3AS2A 1P5QA 2WLYA 5DF0A 4ZPTR 4Z2KA 4DWSA 3WL0A 1W1TA 4W5UA 3O5GA 5DO2A 3PRAA 1FAPA 1FKDA 4DRHA 1D6OA 2Q5AA 3WD2A 4Z2LA 3O5DA 5GQBA 4JFMA 4P8WA 1L1PA 5DEZA 4Z2IA 4FN2A 1FKFA 4NNRA 1J4RA 3EIPA 3KAFA 1WB0A 4J4NA 5DITA 3ARPA 1YW5A 4P8UA 1FKBA 2DT1A 3ARVA 2DPEA 2DSVA 1E9LA 2KGJA 5HUAA 3LUOA 4TNSA 3KACA 2P4VA 2XP6A 2KO7A 4BF8A 1H0IA 2ZQUA 1E6ZA 3KAHA 4LAVA 1VF8A 1ZB5A 4KQZA 5HBFA 3AS0A 2FAPA 3ALFA 4DRMA 1JNSA 3PRDA 3ARQA 4ODPA 2XP9A 5BXJA 1QPFA 1KFWA 3ARUA 4IPXA 2B31A 3GTYX 2PBCA 1D7JA 2AWGA 4ZPVR 5HT1A 1SYTA 3B9DA 5JH8A 4ITZA 1XHGA 3KCEA 1WNOA 2F4EA 2ZR5A 1ZBCA 5HW6A 4R0XA 1E6RA 2DSWA 5DIUA 2MLXA 4ZS6A 1TFVA 3WD3A 5HTGA 1GUVA 1SR0A 3O5RA 1KT0A 4HBEA 4DRPA 2XPAA 2WK2A 1E6NA 1LL6A 3B7XA 1NH6A 2Y78A 4PTMA 1GOIA 5GPRA 1HKJA 4WKHA 5I98A 1NWSA 3KABA 1EYMA 3KAIA 3BXWA 3IKGA 4DH0A 3TCZA 2MLZA 3RFWA 1D2KA 3W4RA 1H0GA 2IF4A 4ODLA 2XP5A 4IQ2A 1OGBA 3CGMA 3ARXA 1OGGA 3ALGA 4JFIA 3CHFA 4W9OA 3CHEA 3UQBA 1N1AA 2UZ5A 1X6LA 3NRKA 1U79A 4DT4A 1Q6IA 2MPHA 4WKFA 3UQIA 2L2SA 4L72B 3WL1A 1BL4A 2XPBA 2K8IA 3FY1A 3ODKA 5HWBA 2OFNA 4GGQA 4JFJA 3ARZA 4LAYA 2RUQA 4WJXA 4DZ2A 2FDMA 2LGOA 4QT2A 4U84A 1HJXA 4DWSB 3IKDA 4MNJA 3IHZA 3PA7A 1RD6A 3JYJA 4ODMA 4LAWA 2PPPA 2RSEA 2AOSA 3WIJA 1W1PA 2DSUA 3AQUA 3WD4A 1FFQA 3JXVA 2DG4A 4KR0B 1BKFA 4XAKA 3OA5A 3UI6A 3UQAA 2MLYA 1FKHA 1PBKA 4Q7NA 4JYSA 4DRJA 1M5YA 2A3AA 3WD0A 1W1VA 3KAGA 4QIBA 4DWSD 1ZL1A 1UR9A 4TYOA 5HW8A 2ZQTA 2JZVA 1J4IA 3ARSA 2XP7A 5HKGA 4MSPA 2KR7A 1NMVA 5D75A 1HXVA 2M1IA 4P8XA 1HJWA 2F23A 4DRQA 4DZ3A 1PINA 3CGNA 3CHCA 1Q6HA
chains in the Genus database with same CATH topology
2LKNA 2WLZA 2XP3A 2A3CA 3JYMA 2MNTA 4ML4A 4GIVA 1OWQA 4U85A 3H9RB 5GPGA 1KT1A 4R5EA 4WKAA 3FXYA 4DRNA 4JFLA 3UI4A 2LPVA 3UI5A 4DROA 1ZK6A 3O5EA 3IK8A 1W1YA 2PPOA 4FAPA 4N19A 2O92A 3WQVA 4WK9A 3I6CA 1TCOC 3UF8A 1J4HA 1FKSA 1XRVA 2PPNA 2ZR4A 4G50A 3PR9A 2QF8A 3PRBA 4AY1A 4MPKA 1ITXA 3O5IA 2XP8A 3RM8A 4J4OA 3KADA 1NWRA 1FJDA 1CTNA 2KFWA 1ROUA 2YBTA 1EIBA 1EDQA 2A3EA 2PV1A 1WAWA 4O2TA 2IUZA 1FKKA 1ZCNA 3O5OA 2RUCA 1T11A 2WM0A 4L3NA 2G41A 2DT2A 3O5MA 1QPLA 1J6YA 1HKKA 1W9UA 3B9EA 1D7IA 3O5FA 3KZ7A 2O9OA 1ROTA 2F2DA 4ODRA 1YATA 3CH9A 4Z2HA 3O5QA 1JNTA 1QZ2A 1R9HA 4LGXA 1FKJA 1EHNA 5B8IC 1E15A 3EY6A 1NMWA 5HWCA 1NWTA 1O6IA 1GPFA 2XP4A 1ZU8A 1FKLA 4URIA 3B8SA 1D7HA 1LG1A 4TX0A 2A3BA 2ZQSA 4U86A 4TW8A 2RURA 4IT6A 2KE0A 2DG3A 1HKMA 2YBUA 3CHDA 4MNMA 3O5PA 3NTPA 3WKZA 4MAVA 1F40A 1E6PA 3O5LA 4S3JA 3RM4A 1HJVA 1LL7A 1FKRA 3FAPA 4TW6A 2RUDA 1W9VA 4DRKA 4Z2JA 3QOKA 3TDBA 4G2PA 3AS1A 1LL4A 2F21A 4ODQA 2LJ4A 1Q6UA 1ZBWA 1C9HA 4MNLA 1F8AB 1IX5A 2PV2A 2FKEA 2VCDA 3O5KA 1UR8A 2M08A 4MNKA 4WIWA 4C02B 1NWUA 2DT3A 1W9PA 3ARTA 2ITKA 4NZCA 3AROA 3NI6A 4IQCA 1JNDA 4S3KA 4ZPWR 4IT4A 4DRIA 2PV3A 4DWSC 4QT3A 4MTVA 4HARA 1ZBVA 2ESCA 2G8ZA 4Q22A 1ZBKA 3O5JA 1FKGA 1NSGA 2PI6A 2VN1A 1FFRA 3G6MA 4W9QA 1LG2A 4QZVB 4Z2GA 2ZQVA 3CZ8A 2DG9A 3G6LA 1FKTA 4HBOA 1JNEA 2DT0A 2N87A 1W26A 2M2AA 3WQWA 1A7XA 3GPKA 1B6CA 1Q1CA 1K9TA 3AS3A 1LQ0A 3RM9A 4MGVA 2RQSA 4JFKA 4NSBA 4W9PA 3WH0A 3RGCA 3ARWA 2MF9A 2D9FA 1FKIA 2KI3A 2DSZA 1EQ3A 4ODOA 1HKIA 1LJYA 4ODNA 1Y0OA 1JVWA 5J6EA 4DIPA 1X6NA 4LAXA 5DIVA 3RMEA 4P8VA 3MDYB 3VAWA 3WD1A 3B9AA 1FD9A 3OOBA 4TW7A 5HW7A 4ODKA 3ARRA 3TC5A 2ZR6A 3ARYA 2OLHA 3AS2A 1P5QA 2WLYA 5DF0A 4ZPTR 4Z2KA 4DWSA 3WL0A 1W1TA 4W5UA 3O5GA 5DO2A 3PRAA 1FAPA 1FKDA 4DRHA 1D6OA 2Q5AA 3WD2A 4Z2LA 3O5DA 5GQBA 4JFMA 4P8WA 1L1PA 5DEZA 4Z2IA 4FN2A 1FKFA 4NNRA 1J4RA 3KAFA 1WB0A 4J4NA 5DITA 3ARPA 1YW5A 4P8UA 1FKBA 2DT1A 3ARVA 2DPEA 2DSVA 1E9LA 2KGJA 5HUAA 3LUOA 4TNSA 3KACA 2XP6A 2KO7A 4BF8A 1H0IA 2ZQUA 1E6ZA 3KAHA 4LAVA 1VF8A 1ZB5A 4KQZA 5HBFA 3AS0A 2FAPA 3ALFA 4DRMA 1JNSA 3PRDA 3ARQA 4ODPA 2XP9A 5BXJA 1QPFA 1KFWA 3ARUA 4IPXA 2B31A 2PBCA 1D7JA 2AWGA 4ZPVR 5HT1A 1SYTA 3B9DA 5JH8A 4ITZA 1XHGA 3KCEA 1WNOA 2F4EA 2ZR5A 1ZBCA 5HW6A 4R0XA 1E6RA 2DSWA 5DIUA 2MLXA 4ZS6A 1TFVA 3WD3A 5HTGA 1GUVA 1SR0A 3O5RA 1KT0A 4HBEA 4DRPA 2XPAA 2WK2A 1E6NA 1LL6A 3B7XA 1NH6A 2Y78A 4PTMA 1GOIA 5GPRA 1HKJA 4WKHA 5I98A 1NWSA 3KABA 1EYMA 3KAIA 3BXWA 3IKGA 4DH0A 3TCZA 2MLZA 3RFWA 1D2KA 3W4RA 1H0GA 2IF4A 4ODLA 2XP5A 4IQ2A 1OGBA 3CGMA 3ARXA 1OGGA 3ALGA 4JFIA 3CHFA 4W9OA 3CHEA 3UQBA 1N1AA 2UZ5A 1X6LA 3NRKA 1U79A 4DT4A 1Q6IA 2MPHA 4WKFA 3UQIA 2L2SA 4L72B 3WL1A 1BL4A 2XPBA 2K8IA 3FY1A 3ODKA 5HWBA 2OFNA 4GGQA 4JFJA 3ARZA 4LAYA 2RUQA 4WJXA 4DZ2A 2FDMA 2LGOA 4QT2A 4U84A 1HJXA 4DWSB 3IKDA 4MNJA 3IHZA 3PA7A 1RD6A 3JYJA 4ODMA 4LAWA 2PPPA 2RSEA 2AOSA 3WIJA 1W1PA 2DSUA 3AQUA 3WD4A 1FFQA 3JXVA 2DG4A 4KR0B 1BKFA 4XAKA 3OA5A 3UI6A 3UQAA 2MLYA 1FKHA 1PBKA 4Q7NA 4JYSA 4DRJA 1M5YA 2A3AA 3WD0A 1W1VA 3KAGA 4QIBA 4DWSD 1ZL1A 1UR9A 4TYOA 5HW8A 2ZQTA 2JZVA 1J4IA 3ARSA 2XP7A 5HKGA 4MSPA 2KR7A 1NMVA 5D75A 1HXVA 2M1IA 4P8XA 1HJWA 4DRQA 4DZ3A 1PINA 3CGNA 3CHCA 1Q6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUD A;  2LKN A;  5HTG A;  3O5R A;  1KT0 A;  2XP3 A;  3TDB A;  3JYM A;  2MNT A;  1JVW A;  2XPA A;  4G2P A;  4DRP A;  3B7X A;  2F21 A;  5J6E A;  2Y78 A;  4GIV A;  4U85 A;  4DIP A;  3H9R B;  4LAX A;  4ODQ A;  5DIV A;  5GPG A;  1KT1 A;  4DRN A;  1Q6U A;  4JFL A;  3UI4 A;  5I98 A;  2LPV A;  4DRK A;  3KAB A;  1EYM A;  3UI5 A;  3KAI A;  4DRO A;  1ZK6 A;  3O5E A;  3IK8 A;  1C9H A;  3MDY B;  1F8A B;  3IKG A;  2PPO A;  4DH0 A;  3VAW A;  3TCZ A;  2PV2 A;  4FAP A;  1FD9 A;  4N19 A;  2FKE A;  2VCD A;  2MLZ A;  3RFW A;  3OOB A;  2MLX A;  3O5K A;  4TW7 A;  2M08 A;  3I6C A;  5HW7 A;  4ODK A;  2IF4 A;  4ODL A;  1TCO C;  2XP5 A;  3TC5 A;  3UF8 A;  2ZR6 A;  1J4H A;  1FKS A;  2PPN A;  4IQ2 A;  4C02 B;  2ZR4 A;  4G50 A;  3CGM A;  4JFI A;  1P5Q A;  3PRB A;  4W9O A;  2ITK A;  3O5I A;  2XP8 A;  3O5G A;  3UQB A;  1N1A A;  3NI6 A;  2UZ5 A;  4J4O A;  3KAD A;  4IQC A;  3NRK A;  1U79 A;  1FAP A;  1FKD A;  4DRH A;  1D6O A;  2Q5A A;  4DT4 A;  1FJD A;  2KFW A;  1Q6I A;  4DRI A;  1ROU A;  2PV3 A;  2MPH A;  3O5D A;  4QT3 A;  4JFM A;  3UQI A;  2PV1 A;  2L2S A;  1BL4 A;  2XPB A;  2K8I A;  3O5J A;  4O2T A;  1FKG A;  1NSG A;  1L1P A;  1FKK A;  3ODK A;  1ZCN A;  5HWB A;  3O5O A;  2VN1 A;  4FN2 A;  2RUC A;  1T11 A;  4W9Q A;  2OFN A;  1FKF A;  4NNR A;  3O5M A;  1J4R A;  1QPL A;  4GGQ A;  4JFJ A;  3KAF A;  2RUQ A;  4LAY A;  4J4N A;  1J6Y A;  5DIT A;  4DZ2 A;  1D7I A;  2ZQV A;  1YW5 A;  3KZ7 A;  3O5F A;  1ROT A;  2F2D A;  2LGO A;  4ODR A;  4QT2 A;  4U84 A;  1YAT A;  3IKD A;  2DG9 A;  3O5Q A;  1FKT A;  3IHZ A;  1FKB A;  1JNT A;  1QZ2 A;  3PA7 A;  1R9H A;  3JYJ A;  1FKJ A;  4ODM A;  5HUA A;  2KGJ A;  5B8I C;  2N87 A;  1W26 A;  3EY6 A;  4LAW A;  3LUO A;  1NMW A;  2M2A A;  3KAC A;  1A7X A;  2PPP A;  2RSE A;  2XP6 A;  4TNS A;  5HWC A;  2KO7 A;  3GPK A;  1B6C A;  1Q1C A;  2XP4 A;  4BF8 A;  1FKL A;  2ZQU A;  4MGV A;  3JXV A;  2DG4 A;  1BKF A;  3KAH A;  4LAV A;  3UI6 A;  1D7H A;  2RQS A;  3UQA A;  2MLY A;  4JFK A;  2FAP A;  1FKH A;  4TX0 A;  1PBK A;  4DRJ A;  4JYS A;  4W9P A;  3PRD A;  4DRM A;  1JNS A;  3WH0 A;  2ZQS A;  4ODP A;  3RGC A;  1M5Y A;  2XP9 A;  4U86 A;  4TW8 A;  5BXJ A;  1QPF A;  2MF9 A;  2RUR A;  3KAG A;  4IPX A;  2D9F A;  1FKI A;  2KI3 A;  4QIB A;  1EQ3 A;  2KE0 A;  2DG3 A;  4ODO A;  4TYO A;  2PBC A;  5HW8 A;  1D7J A;  2ZQT A;  2AWG A;  1J4I A;  2JZV A;  2XP7 A;  5HT1 A;  3O5P A;  4MSP A;  2KR7 A;  3NTP A;  5HKG A;  1NMV A;  1F40 A;  5D75 A;  3O5L A;  4ITZ A;  3KCE A;  1HXV A;  4ODN A;  1Y0O A;  2F4E A;  2M1I A;  2ZR5 A;  4DRQ A;  5HW6 A;  1FKR A;  4DZ3 A;  1PIN A;  3CGN A;  4R0X A;  5DIU A;  2LJ4 A;  3FAP A;  4TW6 A;  1Q6H A; 
#chains in the Genus database with same CATH topology
 2LKN A;  2WLZ A;  2XP3 A;  2A3C A;  3JYM A;  2MNT A;  4ML4 A;  4GIV A;  1E44 A;  1OWQ A;  2PN0 A;  3H9R B;  4U85 A;  5GPG A;  1KT1 A;  4R5E A;  4WKA A;  3FXY A;  4DRN A;  2B5U B;  4JFL A;  3UI4 A;  2LPV A;  3UI5 A;  4DRO A;  1ZK6 A;  3O5E A;  3IK8 A;  2ETN A;  1W1Y A;  2PPO A;  4FAP A;  4N19 A;  2O92 A;  3WQV A;  4WK9 A;  3I6C A;  1TCO C;  3UF8 A;  1J4H A;  1FKS A;  1XRV A;  2PPN A;  2ZR4 A;  4G50 A;  3PR9 A;  2QF8 A;  3PRB A;  4AY1 A;  4MPK A;  1ITX A;  3O5I A;  2XP8 A;  3RM8 A;  4J4O A;  3KAD A;  1NWR A;  1FJD A;  1CTN A;  2KFW A;  1ROU A;  2YBT A;  1EIB A;  1EDQ A;  2A3E A;  2PV1 A;  1WAW A;  4O2T A;  2IUZ A;  1FKK A;  1ZCN A;  3O5O A;  1GRJ A;  2RUC A;  1T11 A;  2WM0 A;  4L3N A;  2G41 A;  2DT2 A;  3O5M A;  1QPL A;  1J6Y A;  1HKK A;  1W9U A;  3B9E A;  1D7I A;  3O5F A;  3KZ7 A;  2O9O A;  1ROT A;  2F2D A;  4ODR A;  1YAT A;  3CH9 A;  4Z2H A;  3O5Q A;  1JNT A;  1QZ2 A;  1R9H A;  4LGX A;  1FKJ A;  1EHN A;  5B8I C;  1E15 A;  3EY6 A;  1NMW A;  5HWC A;  1NWT A;  1O6I A;  1GPF A;  2XP4 A;  1ZU8 A;  1FKL A;  4URI A;  3B8S A;  1D7H A;  1LG1 A;  4TX0 A;  2A3B A;  2ZQS A;  4U86 A;  4TW8 A;  2RUR A;  4IT6 A;  2KE0 A;  2DG3 A;  1HKM A;  2YBU A;  3CHD A;  4MNM A;  3O5P A;  3NTP A;  3WKZ A;  4MAV A;  1F40 A;  3GU0 A;  1E6P A;  3O5L A;  4S3J A;  4UDM A;  3RM4 A;  1HJV A;  1LL7 A;  3BMB A;  1FKR A;  3FAP A;  4TW6 A;  2RUD A;  1W9V A;  4DRK A;  4Z2J A;  3QOK A;  3TDB A;  4G2P A;  3AS1 A;  1LL4 A;  2F21 A;  4ODQ A;  2LJ4 A;  1Q6U A;  1ZBW A;  1C9H A;  4MNL A;  1F8A B;  1IX5 A;  2PV2 A;  2FKE A;  2VCD A;  3O5K A;  1UR8 A;  2M08 A;  4MNK A;  4WIW A;  4C02 B;  1NWU A;  2DT3 A;  1W9P A;  3ART A;  2ITK A;  4NZC A;  3ARO A;  3NI6 A;  4IQC A;  1JND A;  4S3K A;  4ZPW R;  4IT4 A;  4DRI A;  2PV3 A;  4DWS C;  4QT3 A;  4MTV A;  4HAR A;  1ZBV A;  2ESC A;  2G8Z A;  4Q22 A;  1ZBK A;  3O5J A;  1FKG A;  1NSG A;  2PI6 A;  2VN1 A;  1FFR A;  3G6M A;  4W9Q A;  1LG2 A;  4QZV B;  4Z2G A;  2ZQV A;  3CZ8 A;  2DG9 A;  3G6L A;  1FKT A;  4HBO A;  1JNE A;  2DT0 A;  2N87 A;  1W26 A;  1JCH B;  2M2A A;  3WQW A;  1A7X A;  3GPK A;  1B6C A;  1Q1C A;  1K9T A;  3AS3 A;  1LQ0 A;  3RM9 A;  4MGV A;  2EUL A;  2RQS A;  4JFK A;  4NSB A;  4W9P A;  3WH0 A;  3RGC A;  3ARW A;  2MF9 A;  2D9F A;  1FKI A;  2KI3 A;  2DSZ A;  1EQ3 A;  4ODO A;  1HKI A;  1LJY A;  4ODN A;  1Y0O A;  1JVW A;  5J6E A;  4DIP A;  1X6N A;  4LAX A;  5DIV A;  3RME A;  4P8V A;  3MDY B;  3VAW A;  3WD1 A;  3B9A A;  1FD9 A;  3OOB A;  4TW7 A;  5HW7 A;  4ODK A;  3ARR A;  3TC5 A;  2ZR6 A;  3ARY A;  2OLH A;  3AS2 A;  1P5Q A;  2WLY A;  5DF0 A;  4ZPT R;  4Z2K A;  4DWS A;  3WL0 A;  1W1T A;  4W5U A;  3O5G A;  5DO2 A;  3PRA A;  1FAP A;  1FKD A;  4DRH A;  1D6O A;  2Q5A A;  3WD2 A;  4Z2L A;  3O5D A;  5GQB A;  4JFM A;  4P8W A;  1L1P A;  5DEZ A;  4Z2I A;  4FN2 A;  1FKF A;  4NNR A;  1J4R A;  3EIP A;  3KAF A;  1WB0 A;  4J4N A;  5DIT A;  3ARP A;  1YW5 A;  4P8U A;  1FKB A;  2DT1 A;  3ARV A;  2DPE A;  2DSV A;  1E9L A;  2KGJ A;  5HUA A;  3LUO A;  4TNS A;  3KAC A;  2P4V A;  2XP6 A;  2KO7 A;  4BF8 A;  1H0I A;  2ZQU A;  1E6Z A;  3KAH A;  4LAV A;  1VF8 A;  1ZB5 A;  4KQZ A;  5HBF A;  3AS0 A;  2FAP A;  3ALF A;  4DRM A;  1JNS A;  3PRD A;  3ARQ A;  4ODP A;  2XP9 A;  5BXJ A;  1QPF A;  1KFW A;  3ARU A;  4IPX A;  2B31 A;  3GTY X;  2PBC A;  1D7J A;  2AWG A;  4ZPV R;  5HT1 A;  1SYT A;  3B9D A;  5JH8 A;  4ITZ A;  1XHG A;  3KCE A;  1WNO A;  2F4E A;  2ZR5 A;  1ZBC A;  5HW6 A;  4R0X A;  1E6R A;  2DSW A;  5DIU A;  2MLX A;  4ZS6 A;  1TFV A;  3WD3 A;  5HTG A;  1GUV A;  1SR0 A;  3O5R A;  1KT0 A;  4HBE A;  4DRP A;  2XPA A;  2WK2 A;  1E6N A;  1LL6 A;  3B7X A;  1NH6 A;  2Y78 A;  4PTM A;  1GOI A;  5GPR A;  1HKJ A;  4WKH A;  5I98 A;  1NWS A;  3KAB A;  1EYM A;  3KAI A;  3BXW A;  3IKG A;  4DH0 A;  3TCZ A;  2MLZ A;  3RFW A;  1D2K A;  3W4R A;  1H0G A;  2IF4 A;  4ODL A;  2XP5 A;  4IQ2 A;  1OGB A;  3CGM A;  3ARX A;  1OGG A;  3ALG A;  4JFI A;  3CHF A;  4W9O A;  3CHE A;  3UQB A;  1N1A A;  2UZ5 A;  1X6L A;  3NRK A;  1U79 A;  4DT4 A;  1Q6I A;  2MPH A;  4WKF A;  3UQI A;  2L2S A;  4L72 B;  3WL1 A;  1BL4 A;  2XPB A;  2K8I A;  3FY1 A;  3ODK A;  5HWB A;  2OFN A;  4GGQ A;  4JFJ A;  3ARZ A;  4LAY A;  2RUQ A;  4WJX A;  4DZ2 A;  2FDM A;  2LGO A;  4QT2 A;  4U84 A;  1HJX A;  4DWS B;  3IKD A;  4MNJ A;  3IHZ A;  3PA7 A;  1RD6 A;  3JYJ A;  4ODM A;  4LAW A;  2PPP A;  2RSE A;  2AOS A;  3WIJ A;  1W1P A;  2DSU A;  3AQU A;  3WD4 A;  1FFQ A;  3JXV A;  2DG4 A;  4KR0 B;  1BKF A;  4XAK A;  3OA5 A;  3UI6 A;  3UQA A;  2MLY A;  1FKH A;  1PBK A;  4Q7N A;  4JYS A;  4DRJ A;  1M5Y A;  2A3A A;  3WD0 A;  1W1V A;  3KAG A;  4QIB A;  4DWS D;  1ZL1 A;  1UR9 A;  4TYO A;  5HW8 A;  2ZQT A;  2JZV A;  1J4I A;  3ARS A;  2XP7 A;  5HKG A;  4MSP A;  2KR7 A;  1NMV A;  5D75 A;  1HXV A;  2M1I A;  4P8X A;  1HJW A;  2F23 A;  4DRQ A;  4DZ3 A;  1PIN A;  3CGN A;  3CHC A;  1Q6H A; 
#chains in the Genus database with same CATH homology
 2LKN A;  2WLZ A;  2XP3 A;  2A3C A;  3JYM A;  2MNT A;  4ML4 A;  4GIV A;  1OWQ A;  4U85 A;  3H9R B;  5GPG A;  1KT1 A;  4R5E A;  4WKA A;  3FXY A;  4DRN A;  4JFL A;  3UI4 A;  2LPV A;  3UI5 A;  4DRO A;  1ZK6 A;  3O5E A;  3IK8 A;  1W1Y A;  2PPO A;  4FAP A;  4N19 A;  2O92 A;  3WQV A;  4WK9 A;  3I6C A;  1TCO C;  3UF8 A;  1J4H A;  1FKS A;  1XRV A;  2PPN A;  2ZR4 A;  4G50 A;  3PR9 A;  2QF8 A;  3PRB A;  4AY1 A;  4MPK A;  1ITX A;  3O5I A;  2XP8 A;  3RM8 A;  4J4O A;  3KAD A;  1NWR A;  1FJD A;  1CTN A;  2KFW A;  1ROU A;  2YBT A;  1EIB A;  1EDQ A;  2A3E A;  2PV1 A;  1WAW A;  4O2T A;  2IUZ A;  1FKK A;  1ZCN A;  3O5O A;  2RUC A;  1T11 A;  2WM0 A;  4L3N A;  2G41 A;  2DT2 A;  3O5M A;  1QPL A;  1J6Y A;  1HKK A;  1W9U A;  3B9E A;  1D7I A;  3O5F A;  3KZ7 A;  2O9O A;  1ROT A;  2F2D A;  4ODR A;  1YAT A;  3CH9 A;  4Z2H A;  3O5Q A;  1JNT A;  1QZ2 A;  1R9H A;  4LGX A;  1FKJ A;  1EHN A;  5B8I C;  1E15 A;  3EY6 A;  1NMW A;  5HWC A;  1NWT A;  1O6I A;  1GPF A;  2XP4 A;  1ZU8 A;  1FKL A;  4URI A;  3B8S A;  1D7H A;  1LG1 A;  4TX0 A;  2A3B A;  2ZQS A;  4U86 A;  4TW8 A;  2RUR A;  4IT6 A;  2KE0 A;  2DG3 A;  1HKM A;  2YBU A;  3CHD A;  4MNM A;  3O5P A;  3NTP A;  3WKZ A;  4MAV A;  1F40 A;  1E6P A;  3O5L A;  4S3J A;  3RM4 A;  1HJV A;  1LL7 A;  1FKR A;  3FAP A;  4TW6 A;  2RUD A;  1W9V A;  4DRK A;  4Z2J A;  3QOK A;  3TDB A;  4G2P A;  3AS1 A;  1LL4 A;  2F21 A;  4ODQ A;  2LJ4 A;  1Q6U A;  1ZBW A;  1C9H A;  4MNL A;  1F8A B;  1IX5 A;  2PV2 A;  2FKE A;  2VCD A;  3O5K A;  1UR8 A;  2M08 A;  4MNK A;  4WIW A;  4C02 B;  1NWU A;  2DT3 A;  1W9P A;  3ART A;  2ITK A;  4NZC A;  3ARO A;  3NI6 A;  4IQC A;  1JND A;  4S3K A;  4ZPW R;  4IT4 A;  4DRI A;  2PV3 A;  4DWS C;  4QT3 A;  4MTV A;  4HAR A;  1ZBV A;  2ESC A;  2G8Z A;  4Q22 A;  1ZBK A;  3O5J A;  1FKG A;  1NSG A;  2PI6 A;  2VN1 A;  1FFR A;  3G6M A;  4W9Q A;  1LG2 A;  4QZV B;  4Z2G A;  2ZQV A;  3CZ8 A;  2DG9 A;  3G6L A;  1FKT A;  4HBO A;  1JNE A;  2DT0 A;  2N87 A;  1W26 A;  2M2A A;  3WQW A;  1A7X A;  3GPK A;  1B6C A;  1Q1C A;  1K9T A;  3AS3 A;  1LQ0 A;  3RM9 A;  4MGV A;  2RQS A;  4JFK A;  4NSB A;  4W9P A;  3WH0 A;  3RGC A;  3ARW A;  2MF9 A;  2D9F A;  1FKI A;  2KI3 A;  2DSZ A;  1EQ3 A;  4ODO A;  1HKI A;  1LJY A;  4ODN A;  1Y0O A;  1JVW A;  5J6E A;  4DIP A;  1X6N A;  4LAX A;  5DIV A;  3RME A;  4P8V A;  3MDY B;  3VAW A;  3WD1 A;  3B9A A;  1FD9 A;  3OOB A;  4TW7 A;  5HW7 A;  4ODK A;  3ARR A;  3TC5 A;  2ZR6 A;  3ARY A;  2OLH A;  3AS2 A;  1P5Q A;  2WLY A;  5DF0 A;  4ZPT R;  4Z2K A;  4DWS A;  3WL0 A;  1W1T A;  4W5U A;  3O5G A;  5DO2 A;  3PRA A;  1FAP A;  1FKD A;  4DRH A;  1D6O A;  2Q5A A;  3WD2 A;  4Z2L A;  3O5D A;  5GQB A;  4JFM A;  4P8W A;  1L1P A;  5DEZ A;  4Z2I A;  4FN2 A;  1FKF A;  4NNR A;  1J4R A;  3KAF A;  1WB0 A;  4J4N A;  5DIT A;  3ARP A;  1YW5 A;  4P8U A;  1FKB A;  2DT1 A;  3ARV A;  2DPE A;  2DSV A;  1E9L A;  2KGJ A;  5HUA A;  3LUO A;  4TNS A;  3KAC A;  2XP6 A;  2KO7 A;  4BF8 A;  1H0I A;  2ZQU A;  1E6Z A;  3KAH A;  4LAV A;  1VF8 A;  1ZB5 A;  4KQZ A;  5HBF A;  3AS0 A;  2FAP A;  3ALF A;  4DRM A;  1JNS A;  3PRD A;  3ARQ A;  4ODP A;  2XP9 A;  5BXJ A;  1QPF A;  1KFW A;  3ARU A;  4IPX A;  2B31 A;  2PBC A;  1D7J A;  2AWG A;  4ZPV R;  5HT1 A;  1SYT A;  3B9D A;  5JH8 A;  4ITZ A;  1XHG A;  3KCE A;  1WNO A;  2F4E A;  2ZR5 A;  1ZBC A;  5HW6 A;  4R0X A;  1E6R A;  2DSW A;  5DIU A;  2MLX A;  4ZS6 A;  1TFV A;  3WD3 A;  5HTG A;  1GUV A;  1SR0 A;  3O5R A;  1KT0 A;  4HBE A;  4DRP A;  2XPA A;  2WK2 A;  1E6N A;  1LL6 A;  3B7X A;  1NH6 A;  2Y78 A;  4PTM A;  1GOI A;  5GPR A;  1HKJ A;  4WKH A;  5I98 A;  1NWS A;  3KAB A;  1EYM A;  3KAI A;  3BXW A;  3IKG A;  4DH0 A;  3TCZ A;  2MLZ A;  3RFW A;  1D2K A;  3W4R A;  1H0G A;  2IF4 A;  4ODL A;  2XP5 A;  4IQ2 A;  1OGB A;  3CGM A;  3ARX A;  1OGG A;  3ALG A;  4JFI A;  3CHF A;  4W9O A;  3CHE A;  3UQB A;  1N1A A;  2UZ5 A;  1X6L A;  3NRK A;  1U79 A;  4DT4 A;  1Q6I A;  2MPH A;  4WKF A;  3UQI A;  2L2S A;  4L72 B;  3WL1 A;  1BL4 A;  2XPB A;  2K8I A;  3FY1 A;  3ODK A;  5HWB A;  2OFN A;  4GGQ A;  4JFJ A;  3ARZ A;  4LAY A;  2RUQ A;  4WJX A;  4DZ2 A;  2FDM A;  2LGO A;  4QT2 A;  4U84 A;  1HJX A;  4DWS B;  3IKD A;  4MNJ A;  3IHZ A;  3PA7 A;  1RD6 A;  3JYJ A;  4ODM A;  4LAW A;  2PPP A;  2RSE A;  2AOS A;  3WIJ A;  1W1P A;  2DSU A;  3AQU A;  3WD4 A;  1FFQ A;  3JXV A;  2DG4 A;  4KR0 B;  1BKF A;  4XAK A;  3OA5 A;  3UI6 A;  3UQA A;  2MLY A;  1FKH A;  1PBK A;  4Q7N A;  4JYS A;  4DRJ A;  1M5Y A;  2A3A A;  3WD0 A;  1W1V A;  3KAG A;  4QIB A;  4DWS D;  1ZL1 A;  1UR9 A;  4TYO A;  5HW8 A;  2ZQT A;  2JZV A;  1J4I A;  3ARS A;  2XP7 A;  5HKG A;  4MSP A;  2KR7 A;  1NMV A;  5D75 A;  1HXV A;  2M1I A;  4P8X A;  1HJW A;  4DRQ A;  4DZ3 A;  1PIN A;  3CGN A;  3CHC A;  1Q6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...