3O5KA

Fk1 domain of fkbp51, crystal form viii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
b'GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5kA00
1Q6UA 1F8AB 2M1IA 2LKNA 3MDYB 2ZQUA 1NMWA 2ZQVA 4TW8A 1Q1CA 5HTGA 5B8IC 4ODQA 2OFNA 3UQAA 2Y78A 3O5DA 4QT3A 2PPPA 2XP8A 1FKFA 3KADA 2ZR4A 3LUOA 4ODLA 5HT1A 3RFWA 4DRQA 5HWBA 4LAVA 1NSGA 3O5FA 2KR7A 4QT2A 4DT4A 2Q5AA 5HW8A 1F40A 1PINA 1R9HA 2KGJA 3GPKA 2LGOA 3IKDA 2KE0A 3RGCA 4DRNA 5BXJA 1JNSA 2RQSA 2MNTA 4O2TA 5HW6A 4DRPA 1T11A 1J6YA 2MLXA 4IQCA 4G2PA 4DRHA 2LJ4A 2PPNA 4G50A 4JFLA 1YATA 4ITZA 4MSPA 2VN1A 1D7IA 1W26A 3B7XA 2XP4A 2ITKA 1FKSA 4LAXA 4W9OA 1A7XA 2XP9A 2XP3A 2M08A 3KABA 3O5OA 2K8IA 1FKKA 3O5GA 4DRJA 2XP5A 4DZ3A 3FAPA 1QZ2A 1FKJA 2RUQA 3JXVA 1FKTA 4J4OA 5GPGA 5HW7A 3O5PA 1JVWA 2XPAA 3I6CA 3UI6A 5J6EA 4JFIA 2D9FA 3ODKA 4N19A 3EY6A 4ODKA 2ZR6A 3NRKA 4W9PA 3IHZA 1U79A 4U86A 1L1PA 5HKGA 3PA7A 1N1AA 4TYOA 3O5MA 1FKDA 2MPHA 5I98A 2L2SA 1BL4A 2ZQSA 3CGMA 2JZVA 2MLZA 4JFJA 2DG9A 1QPLA 4JFMA 3UQIA 4TX0A 2MF9A 3TDBA 2F21A 4IPXA 1ZCNA 3KAIA 3WH0A 1EQ3A 2PV3A 1PBKA 4C02B 1FKRA 1C9HA 2PV1A 4DIPA 4DRIA 2KFWA 4IQ2A 2RUCA 4TNSA 4DZ2A 2ZQTA 4FN2A 1JNTA 2PPOA 4GGQA 1FKLA 2UZ5A 4LAWA 4DRMA 1J4IA 1EYMA 2XPBA 4DH0A 2RURA 1Y0OA 3O5IA 3NI6A 5DITA 3UI5A 1HXVA 1ROUA 4W9QA 4NNRA 4J4NA 1B6CA 1FJDA 3O5KA 1FD9A 3O5EA 1Q6IA 3NTPA 1J4HA 3PRDA 1TCOC 3TC5A 4U85A 1YW5A 3KAHA 3KCEA 3O5RA 4GIVA 4ODRA 4ODOA 3UI4A 5HUAA 4JYSA 1NMVA 4ODPA 4QIBA 2KO7A 3KACA 3H9RB 3KAGA 4TW7A 5HWCA 1FKHA 1Q6HA 2XP6A 4LAYA 4ODNA 2ZR5A 3KZ7A 1FAPA 2PV2A 3O5LA 1J4RA 1KT1A 1D7HA 1BKFA 1ROTA 2DG3A 2MLYA 3IKGA 4MGVA 5DIUA 3IK8A 3KAFA 3UQBA 2DG4A 2XP7A 5D75A 1ZK6A 3UF8A 2KI3A 2AWGA 4TW6A 1P5QA 4DRKA 4ODMA 3VAWA 1FKIA 1D6OA 3CGNA 3JYJA 3PRBA 4JFKA 4R0XA 2LPVA 1FKGA 1QPFA 5DIVA 4DROA 4FAPA 3TCZA 1M5YA 2FKEA 1D7JA 2PBCA 2F2DA 4U84A 2M2AA 2RSEA 3O5JA 2IF4A 1FKBA 4BF8A 2N87A 2VCDA 1KT0A 3JYMA 2F4EA 3O5QA 2RUDA 2FAPA 3OOBA
chains in the Genus database with same CATH superfamily
1Q6UA 1HJXA 2M1IA 4HARA 1NMWA 4TW8A 5HTGA 4ODQA 3O5DA 4DT4A 1FKFA 3KADA 3LUOA 1NSGA 5HW8A 1F40A 1LG2A 3B8SA 1XHGA 4O2TA 1T11A 3B9EA 3ARQA 4P8XA 2LJ4A 2DT2A 3ARVA 2VN1A 1D7IA 2ITKA 1X6NA 4WJXA 2XP9A 4MAVA 4Z2HA 3JXVA 3RMEA 2YBUA 4L3NA 1JVWA 4JFIA 2D9FA 4N19A 3AQUA 2WK2A 4W9PA 1GOIA 1U79A 1L1PA 1N1AA 3WD4A 4P8VA 1E6ZA 1HKIA 2L2SA 2MLZA 4JFMA 1LL7A 2B31A 1LG1A 2PV3A 1NWUA 4IQ2A 2RUCA 2IUZA 2UZ5A 3FXYA 4LAWA 4HBEA 4Z2KA 3NI6A 4S3JA 5DITA 1E9LA 4NNRA 2F23A 3O5KA 3PRDA 3PR9A 4U85A 3UI4A 5HUAA 1SR0A 4QIBA 2OLHA 2KO7A 1UR8A 2XP6A 1ZBKA 1HKMA 3KZ7A 2PV2A 1D7HA 2MLYA 2DG4A 1W1YA 1EHNA 2AWGA 4TW6A 4MNKA 1P5QA 2DT3A 3VAWA 2LPVA 3GU0A 3ARXA 4U84A 1LJYA 4BF8A 3O5JA 2IF4A 3RM4A 3O5QA 2RUDA 1W1TA 3RM8A 4ZS6A 2ZQUA 2ZQVA 1W1VA 1Q1CA 3UQAA 2DSWA 3AS3A 3G6MA 2PPPA 5HT1A 2ZR4A 3RFWA 4QT2A 3O5FA 2KR7A 2Q5AA 2O92A 1H0GA 4L72B 3IKDA 3RGCA 2KE0A 2RQSA 1ITXA 3CZ8A 3GTYX 4MTVA 4IQCA 1E44A 1FFQA 1TFVA 1W26A 3B7XA 2XP4A 4LAXA 4Q22A 1A7XA 1K9TA 3EIPA 1O6IA 2K8IA 1FKKA 3WL0A 4Z2IA 4IT4A 1NWTA 2P4VA 2RUQA 1LQ0A 3I6CA 5J6EA 1HKKA 3PRAA 5JH8A 3NRKA 3IHZA 3WD0A 5HKGA 3O5MA 5I98A 2ZQSA 1BL4A 3ARSA 3CGMA 1QPLA 3UQIA 2F21A 4ZPWR 4ZPTR 4DWSC 3AS2A 3WH0A 1H0IA 3WQVA 1EQ3A 3AROA 1JNDA 3CH9A 4ZPVR 1C9HA 4DIPA 1ZBVA 1HJVA 1J4IA 1WB0A 4MPKA 3ARRA 1OGBA 2PI6A 1D2KA 4J4NA 4HBOA 1UR9A 1J4HA 3TC5A 1YW5A 2DSUA 4JYSA 4UDMA 3KACA 5HWCA 4TW7A 4AY1A 1GPFA 4ODNA 2DT0A 3AS1A 1J4RA 1KT1A 1ROTA 1XRVA 3B9DA 3IK8A 1HJWA 2G41A 3UF8A 2KI3A 4DRKA 1FKIA 2B5UB 1D6OA 3JYJA 4JFKA 4R0XA 4DROA 3TCZA 1CTNA 2PBCA 2F2DA 2RSEA 2N87A 2WLZA 5DEZA 3BMBA 2LKNA 2A3CA 3ARYA 3MDYB 1LL6A 3ARWA 4KQZA 2XP8A 5HWBA 4DRQA 3WKZA 1E15A 2WLYA 5DF0A 3ARTA 1PINA 4XAKA 3GPKA 4DRNA 1JNSA 2MNTA 5HW6A 1E6PA 4DRPA 1OWQA 1J6YA 2MLXA 4G2PA 4G50A 1YATA 4WIWA 1FKSA 4MNJA 2DT1A 2M08A 3O5OA 1WAWA 1WNOA 1QZ2A 1FKJA 1FKTA 2WM0A 2XPAA 3UI6A 3ODKA 3EY6A 4ODKA 3B9AA 3OA5A 4NZCA 4PTMA 2YBTA 3PA7A 3RM9A 3W4RA 3WL1A 4Z2JA 2JZVA 4P8WA 4JFJA 2DG9A 1E6NA 1JCHB 5GPRA 3WD3A 1JNEA 4C02B 1ZL1A 1FKRA 4URIA 4DRIA 2KFWA 4TNSA 4DZ2A 2ZQTA 4FN2A 4DWSB 4DRMA 1EYMA 2XPBA 1W1PA 4DH0A 2ESCA 1HXVA 1ROUA 1B6CA 1FJDA 3ARPA 1Q6IA 2EULA 3NTPA 3AS0A 3KCEA 4ODRA 4GIVA 1ZBWA 4ODPA 1NMVA 3CHEA 1FKHA 1Q6HA 4LAYA 4WKAA 1FAPA 1OGGA 1BKFA 2DG3A 3IKGA 1IX5A 5DIUA 2G8ZA 4ODMA 1HKJA 1ZU8A 2DSZA 1GRJA 1QPFA 4FAPA 1M5YA 2FKEA 4QZVB 1KFWA 2M2AA 1FKBA 1KT0A 2DSVA 3JYMA 2F4EA 3WQWA 2FAPA 3WD2A 1F8AB 3CHFA 2O9OA 5B8IC 2OFNA 1X6LA 2Y78A 4Q7NA 4QT3A 4ODLA 4LAVA 1EDQA 2KGJA 1R9HA 2LGOA 4LGXA 2A3EA 5BXJA 4P8UA 4W5UA 2DPEA 4KR0B 4S3KA 3FY1A 3ALFA 3G6LA 4DRHA 2PPNA 4Z2GA 4JFLA 4ITZA 1SYTA 4MSPA 4W9OA 2XP3A 2ETNA 3KABA 3O5GA 3ARZA 4DRJA 2XP5A 4WK9A 4DZ3A 3FAPA 4WKHA 4J4OA 5HW7A 5GPGA 3O5PA 3QOKA 1W9UA 2PN0A 3WIJA 2ZR6A 4U86A 4TYOA 1FKDA 4MNLA 2MPHA 4Z2LA 1VF8A 2AOSA 4TX0A 3CHCA 4ML4A 2MF9A 4DWSA 4WKFA 1E6RA 3TDBA 4IPXA 1ZCNA 3KAIA 1FFRA 3ARUA 2FDMA 1PBKA 3BXWA 2PV1A 1JNTA 2PPOA 4GGQA 1FKLA 2RURA 1Y0OA 3O5IA 1NWSA 4DWSD 3UI5A 4W9QA 1RD6A 4IT6A 5GQBA 1W9PA 1FD9A 3O5EA 1NH6A 1TCOC 3ALGA 3KAHA 3O5RA 4NSBA 4ODOA 5HBFA 2QF8A 3H9RB 3KAGA 3WD1A 2ZR5A 2A3BA 3CHDA 3O5LA 4MGVA 2A3AA 1ZBCA 3KAFA 3UQBA 5DO2A 2XP7A 5D75A 1ZK6A 4MNMA 3CGNA 3PRBA 1EIBA 5DIVA 1FKGA 1GUVA 1NWRA 1D7JA 1W9VA 1LL4A 2VCDA 1ZB5A 4R5EA 3OOBA
chains in the Genus database with same CATH topology
1Q6UA 1HJXA 2M1IA 4HARA 1NMWA 4TW8A 5HTGA 4ODQA 3O5DA 4DT4A 1FKFA 3KADA 3LUOA 1NSGA 5HW8A 1F40A 1LG2A 3B8SA 1XHGA 4O2TA 1T11A 3B9EA 3ARQA 4P8XA 2LJ4A 2DT2A 3ARVA 2VN1A 1D7IA 2ITKA 1X6NA 4WJXA 2XP9A 4MAVA 4Z2HA 3JXVA 3RMEA 2YBUA 4L3NA 1JVWA 4JFIA 2D9FA 4N19A 3AQUA 2WK2A 4W9PA 1GOIA 1U79A 1L1PA 1N1AA 3WD4A 4P8VA 1E6ZA 1HKIA 2L2SA 2MLZA 4JFMA 1LL7A 2B31A 1LG1A 2PV3A 1NWUA 4IQ2A 2RUCA 2IUZA 2UZ5A 3FXYA 4LAWA 4HBEA 4Z2KA 3NI6A 4S3JA 5DITA 1E9LA 4NNRA 3O5KA 3PRDA 3PR9A 4U85A 3UI4A 5HUAA 1SR0A 4QIBA 2OLHA 2KO7A 1UR8A 2XP6A 1ZBKA 1HKMA 3KZ7A 2PV2A 1D7HA 2MLYA 2DG4A 1W1YA 1EHNA 2AWGA 4TW6A 4MNKA 1P5QA 2DT3A 3VAWA 2LPVA 3ARXA 4U84A 1LJYA 4BF8A 3O5JA 2IF4A 3RM4A 3O5QA 2RUDA 1W1TA 3RM8A 4ZS6A 2ZQUA 2ZQVA 1W1VA 1Q1CA 3UQAA 2DSWA 3AS3A 3G6MA 2PPPA 5HT1A 2ZR4A 3RFWA 4QT2A 3O5FA 2KR7A 2Q5AA 2O92A 1H0GA 4L72B 3IKDA 3RGCA 2KE0A 2RQSA 1ITXA 3CZ8A 4MTVA 4IQCA 1FFQA 1TFVA 1W26A 3B7XA 2XP4A 4LAXA 4Q22A 1A7XA 1K9TA 1O6IA 2K8IA 1FKKA 3WL0A 4Z2IA 4IT4A 1NWTA 2RUQA 1LQ0A 3I6CA 5J6EA 1HKKA 3PRAA 5JH8A 3NRKA 3IHZA 3WD0A 5HKGA 3O5MA 5I98A 2ZQSA 1BL4A 3ARSA 3CGMA 1QPLA 3UQIA 2F21A 4ZPWR 4ZPTR 4DWSC 3AS2A 3WH0A 1H0IA 3WQVA 1EQ3A 3AROA 1JNDA 3CH9A 4ZPVR 1C9HA 4DIPA 1ZBVA 1HJVA 1J4IA 1WB0A 4MPKA 3ARRA 1OGBA 2PI6A 1D2KA 4J4NA 4HBOA 1UR9A 1J4HA 3TC5A 1YW5A 2DSUA 4JYSA 3KACA 5HWCA 4TW7A 4AY1A 1GPFA 4ODNA 2DT0A 3AS1A 1J4RA 1KT1A 1ROTA 1XRVA 3B9DA 3IK8A 1HJWA 2G41A 3UF8A 2KI3A 4DRKA 1FKIA 1D6OA 3JYJA 4JFKA 4R0XA 4DROA 3TCZA 1CTNA 2PBCA 2F2DA 2RSEA 2N87A 2WLZA 5DEZA 2LKNA 2A3CA 3ARYA 3MDYB 1LL6A 3ARWA 4KQZA 2XP8A 5HWBA 4DRQA 3WKZA 1E15A 2WLYA 5DF0A 3ARTA 1PINA 4XAKA 3GPKA 4DRNA 1JNSA 2MNTA 5HW6A 1E6PA 4DRPA 1OWQA 1J6YA 2MLXA 4G2PA 4G50A 1YATA 4WIWA 1FKSA 4MNJA 2DT1A 2M08A 3O5OA 1WAWA 1WNOA 1QZ2A 1FKJA 1FKTA 2WM0A 2XPAA 3UI6A 3ODKA 3EY6A 4ODKA 3B9AA 3OA5A 4NZCA 4PTMA 2YBTA 3PA7A 3RM9A 3W4RA 3WL1A 4Z2JA 2JZVA 4P8WA 4JFJA 2DG9A 1E6NA 5GPRA 3WD3A 1JNEA 4C02B 1ZL1A 1FKRA 4URIA 4DRIA 2KFWA 4TNSA 4DZ2A 2ZQTA 4FN2A 4DWSB 4DRMA 1EYMA 2XPBA 1W1PA 4DH0A 2ESCA 1HXVA 1ROUA 1B6CA 1FJDA 3ARPA 1Q6IA 3NTPA 3AS0A 3KCEA 4ODRA 4GIVA 1ZBWA 4ODPA 1NMVA 3CHEA 1FKHA 1Q6HA 4LAYA 4WKAA 1FAPA 1OGGA 1BKFA 2DG3A 3IKGA 1IX5A 5DIUA 2G8ZA 4ODMA 1HKJA 1ZU8A 2DSZA 1QPFA 4FAPA 1M5YA 2FKEA 4QZVB 1KFWA 2M2AA 1FKBA 1KT0A 2DSVA 3JYMA 2F4EA 3WQWA 2FAPA 3WD2A 1F8AB 3CHFA 2O9OA 5B8IC 2OFNA 1X6LA 2Y78A 4Q7NA 4QT3A 4ODLA 4LAVA 1EDQA 2KGJA 1R9HA 2LGOA 4LGXA 2A3EA 5BXJA 4P8UA 4W5UA 2DPEA 4KR0B 4S3KA 3FY1A 3ALFA 3G6LA 4DRHA 2PPNA 4Z2GA 4JFLA 4ITZA 1SYTA 4MSPA 4W9OA 2XP3A 3KABA 3O5GA 3ARZA 4DRJA 2XP5A 4WK9A 4DZ3A 3FAPA 4WKHA 4J4OA 5HW7A 5GPGA 3O5PA 3QOKA 1W9UA 3WIJA 2ZR6A 4U86A 4TYOA 1FKDA 4MNLA 2MPHA 4Z2LA 1VF8A 2AOSA 4TX0A 3CHCA 4ML4A 2MF9A 4DWSA 4WKFA 1E6RA 3TDBA 4IPXA 1ZCNA 3KAIA 1FFRA 3ARUA 2FDMA 1PBKA 3BXWA 2PV1A 1JNTA 2PPOA 4GGQA 1FKLA 2RURA 1Y0OA 3O5IA 1NWSA 4DWSD 3UI5A 4W9QA 1RD6A 4IT6A 5GQBA 1W9PA 1FD9A 3O5EA 1NH6A 1TCOC 3ALGA 3KAHA 3O5RA 4NSBA 4ODOA 5HBFA 2QF8A 3H9RB 3KAGA 3WD1A 2ZR5A 2A3BA 3CHDA 3O5LA 4MGVA 2A3AA 1ZBCA 3KAFA 3UQBA 5DO2A 2XP7A 5D75A 1ZK6A 4MNMA 3CGNA 3PRBA 1EIBA 5DIVA 1FKGA 1GUVA 1NWRA 1D7JA 1W9VA 1LL4A 2VCDA 1ZB5A 4R5EA 3OOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6U A;  1F8A B;  2M1I A;  2LKN A;  3MDY B;  2ZQU A;  1NMW A;  2ZQV A;  4TW8 A;  1Q1C A;  5HTG A;  5B8I C;  4ODQ A;  2OFN A;  3UQA A;  2Y78 A;  3O5D A;  4QT3 A;  2PPP A;  2XP8 A;  1FKF A;  3KAD A;  2ZR4 A;  3LUO A;  4ODL A;  5HT1 A;  3RFW A;  4DRQ A;  5HWB A;  4LAV A;  1NSG A;  3O5F A;  2KR7 A;  4QT2 A;  4DT4 A;  2Q5A A;  5HW8 A;  1F40 A;  1PIN A;  1R9H A;  2KGJ A;  3GPK A;  2LGO A;  3IKD A;  2KE0 A;  3RGC A;  4DRN A;  5BXJ A;  1JNS A;  2RQS A;  2MNT A;  4O2T A;  5HW6 A;  4DRP A;  1T11 A;  1J6Y A;  2MLX A;  4IQC A;  4G2P A;  4DRH A;  2LJ4 A;  2PPN A;  4G50 A;  4JFL A;  1YAT A;  4ITZ A;  4MSP A;  2VN1 A;  1D7I A;  1W26 A;  3B7X A;  2XP4 A;  2ITK A;  1FKS A;  4LAX A;  4W9O A;  1A7X A;  2XP9 A;  2XP3 A;  2M08 A;  3KAB A;  3O5O A;  2K8I A;  1FKK A;  3O5G A;  4DRJ A;  2XP5 A;  4DZ3 A;  3FAP A;  1QZ2 A;  1FKJ A;  2RUQ A;  3JXV A;  1FKT A;  4J4O A;  5GPG A;  5HW7 A;  3O5P A;  1JVW A;  2XPA A;  3I6C A;  3UI6 A;  5J6E A;  4JFI A;  2D9F A;  3ODK A;  4N19 A;  3EY6 A;  4ODK A;  2ZR6 A;  3NRK A;  4W9P A;  3IHZ A;  1U79 A;  4U86 A;  1L1P A;  5HKG A;  3PA7 A;  1N1A A;  4TYO A;  3O5M A;  1FKD A;  2MPH A;  5I98 A;  2L2S A;  1BL4 A;  2ZQS A;  3CGM A;  2JZV A;  2MLZ A;  4JFJ A;  2DG9 A;  1QPL A;  4JFM A;  3UQI A;  4TX0 A;  2MF9 A;  3TDB A;  2F21 A;  4IPX A;  1ZCN A;  3KAI A;  3WH0 A;  1EQ3 A;  2PV3 A;  1PBK A;  4C02 B;  1FKR A;  1C9H A;  2PV1 A;  4DIP A;  4DRI A;  2KFW A;  4IQ2 A;  2RUC A;  4TNS A;  4DZ2 A;  2ZQT A;  4FN2 A;  1JNT A;  2PPO A;  4GGQ A;  1FKL A;  2UZ5 A;  4LAW A;  4DRM A;  1J4I A;  1EYM A;  2XPB A;  4DH0 A;  2RUR A;  1Y0O A;  3O5I A;  3NI6 A;  5DIT A;  3UI5 A;  1HXV A;  1ROU A;  4W9Q A;  4NNR A;  4J4N A;  1B6C A;  1FJD A;  3O5K A;  1FD9 A;  3O5E A;  1Q6I A;  3NTP A;  1J4H A;  3PRD A;  1TCO C;  3TC5 A;  4U85 A;  1YW5 A;  3KAH A;  3KCE A;  3O5R A;  4GIV A;  4ODR A;  4ODO A;  3UI4 A;  5HUA A;  4JYS A;  1NMV A;  4ODP A;  4QIB A;  2KO7 A;  3KAC A;  3H9R B;  3KAG A;  4TW7 A;  5HWC A;  1FKH A;  1Q6H A;  2XP6 A;  4LAY A;  4ODN A;  2ZR5 A;  3KZ7 A;  1FAP A;  2PV2 A;  3O5L A;  1J4R A;  1KT1 A;  1D7H A;  1BKF A;  1ROT A;  2DG3 A;  2MLY A;  3IKG A;  4MGV A;  5DIU A;  3IK8 A;  3KAF A;  3UQB A;  2DG4 A;  2XP7 A;  5D75 A;  1ZK6 A;  3UF8 A;  2KI3 A;  2AWG A;  4TW6 A;  1P5Q A;  4DRK A;  4ODM A;  3VAW A;  1FKI A;  1D6O A;  3CGN A;  3JYJ A;  3PRB A;  4JFK A;  4R0X A;  2LPV A;  1FKG A;  1QPF A;  5DIV A;  4DRO A;  4FAP A;  3TCZ A;  1M5Y A;  2FKE A;  1D7J A;  2PBC A;  2F2D A;  4U84 A;  2M2A A;  2RSE A;  3O5J A;  2IF4 A;  1FKB A;  4BF8 A;  2N87 A;  2VCD A;  1KT0 A;  3JYM A;  2F4E A;  3O5Q A;  2RUD A;  2FAP A;  3OOB A; 
#chains in the Genus database with same CATH topology
 1Q6U A;  1HJX A;  2M1I A;  4HAR A;  1NMW A;  4TW8 A;  5HTG A;  4ODQ A;  3O5D A;  4DT4 A;  1FKF A;  3KAD A;  3LUO A;  1NSG A;  5HW8 A;  1F40 A;  1LG2 A;  3B8S A;  1XHG A;  4O2T A;  1T11 A;  3B9E A;  3ARQ A;  4P8X A;  2LJ4 A;  2DT2 A;  3ARV A;  2VN1 A;  1D7I A;  2ITK A;  1X6N A;  4WJX A;  2XP9 A;  4MAV A;  4Z2H A;  3JXV A;  3RME A;  2YBU A;  4L3N A;  1JVW A;  4JFI A;  2D9F A;  4N19 A;  3AQU A;  2WK2 A;  4W9P A;  1GOI A;  1U79 A;  1L1P A;  1N1A A;  3WD4 A;  4P8V A;  1E6Z A;  1HKI A;  2L2S A;  2MLZ A;  4JFM A;  1LL7 A;  2B31 A;  1LG1 A;  2PV3 A;  1NWU A;  4IQ2 A;  2RUC A;  2IUZ A;  2UZ5 A;  3FXY A;  4LAW A;  4HBE A;  4Z2K A;  3NI6 A;  4S3J A;  5DIT A;  1E9L A;  4NNR A;  2F23 A;  3O5K A;  3PRD A;  3PR9 A;  4U85 A;  3UI4 A;  5HUA A;  1SR0 A;  4QIB A;  2OLH A;  2KO7 A;  1UR8 A;  2XP6 A;  1ZBK A;  1HKM A;  3KZ7 A;  2PV2 A;  1D7H A;  2MLY A;  2DG4 A;  1W1Y A;  1EHN A;  2AWG A;  4TW6 A;  4MNK A;  1P5Q A;  2DT3 A;  3VAW A;  2LPV A;  3GU0 A;  3ARX A;  4U84 A;  1LJY A;  4BF8 A;  3O5J A;  2IF4 A;  3RM4 A;  3O5Q A;  2RUD A;  1W1T A;  3RM8 A;  4ZS6 A;  2ZQU A;  2ZQV A;  1W1V A;  1Q1C A;  3UQA A;  2DSW A;  3AS3 A;  3G6M A;  2PPP A;  5HT1 A;  2ZR4 A;  3RFW A;  4QT2 A;  3O5F A;  2KR7 A;  2Q5A A;  2O92 A;  1H0G A;  4L72 B;  3IKD A;  3RGC A;  2KE0 A;  2RQS A;  1ITX A;  3CZ8 A;  3GTY X;  4MTV A;  4IQC A;  1E44 A;  1FFQ A;  1TFV A;  1W26 A;  3B7X A;  2XP4 A;  4LAX A;  4Q22 A;  1A7X A;  1K9T A;  3EIP A;  1O6I A;  2K8I A;  1FKK A;  3WL0 A;  4Z2I A;  4IT4 A;  1NWT A;  2P4V A;  2RUQ A;  1LQ0 A;  3I6C A;  5J6E A;  1HKK A;  3PRA A;  5JH8 A;  3NRK A;  3IHZ A;  3WD0 A;  5HKG A;  3O5M A;  5I98 A;  2ZQS A;  1BL4 A;  3ARS A;  3CGM A;  1QPL A;  3UQI A;  2F21 A;  4ZPW R;  4ZPT R;  4DWS C;  3AS2 A;  3WH0 A;  1H0I A;  3WQV A;  1EQ3 A;  3ARO A;  1JND A;  3CH9 A;  4ZPV R;  1C9H A;  4DIP A;  1ZBV A;  1HJV A;  1J4I A;  1WB0 A;  4MPK A;  3ARR A;  1OGB A;  2PI6 A;  1D2K A;  4J4N A;  4HBO A;  1UR9 A;  1J4H A;  3TC5 A;  1YW5 A;  2DSU A;  4JYS A;  4UDM A;  3KAC A;  5HWC A;  4TW7 A;  4AY1 A;  1GPF A;  4ODN A;  2DT0 A;  3AS1 A;  1J4R A;  1KT1 A;  1ROT A;  1XRV A;  3B9D A;  3IK8 A;  1HJW A;  2G41 A;  3UF8 A;  2KI3 A;  4DRK A;  1FKI A;  2B5U B;  1D6O A;  3JYJ A;  4JFK A;  4R0X A;  4DRO A;  3TCZ A;  1CTN A;  2PBC A;  2F2D A;  2RSE A;  2N87 A;  2WLZ A;  5DEZ A;  3BMB A;  2LKN A;  2A3C A;  3ARY A;  3MDY B;  1LL6 A;  3ARW A;  4KQZ A;  2XP8 A;  5HWB A;  4DRQ A;  3WKZ A;  1E15 A;  2WLY A;  5DF0 A;  3ART A;  1PIN A;  4XAK A;  3GPK A;  4DRN A;  1JNS A;  2MNT A;  5HW6 A;  1E6P A;  4DRP A;  1OWQ A;  1J6Y A;  2MLX A;  4G2P A;  4G50 A;  1YAT A;  4WIW A;  1FKS A;  4MNJ A;  2DT1 A;  2M08 A;  3O5O A;  1WAW A;  1WNO A;  1QZ2 A;  1FKJ A;  1FKT A;  2WM0 A;  2XPA A;  3UI6 A;  3ODK A;  3EY6 A;  4ODK A;  3B9A A;  3OA5 A;  4NZC A;  4PTM A;  2YBT A;  3PA7 A;  3RM9 A;  3W4R A;  3WL1 A;  4Z2J A;  2JZV A;  4P8W A;  4JFJ A;  2DG9 A;  1E6N A;  1JCH B;  5GPR A;  3WD3 A;  1JNE A;  4C02 B;  1ZL1 A;  1FKR A;  4URI A;  4DRI A;  2KFW A;  4TNS A;  4DZ2 A;  2ZQT A;  4FN2 A;  4DWS B;  4DRM A;  1EYM A;  2XPB A;  1W1P A;  4DH0 A;  2ESC A;  1HXV A;  1ROU A;  1B6C A;  1FJD A;  3ARP A;  1Q6I A;  2EUL A;  3NTP A;  3AS0 A;  3KCE A;  4ODR A;  4GIV A;  1ZBW A;  4ODP A;  1NMV A;  3CHE A;  1FKH A;  1Q6H A;  4LAY A;  4WKA A;  1FAP A;  1OGG A;  1BKF A;  2DG3 A;  3IKG A;  1IX5 A;  5DIU A;  2G8Z A;  4ODM A;  1HKJ A;  1ZU8 A;  2DSZ A;  1GRJ A;  1QPF A;  4FAP A;  1M5Y A;  2FKE A;  4QZV B;  1KFW A;  2M2A A;  1FKB A;  1KT0 A;  2DSV A;  3JYM A;  2F4E A;  3WQW A;  2FAP A;  3WD2 A;  1F8A B;  3CHF A;  2O9O A;  5B8I C;  2OFN A;  1X6L A;  2Y78 A;  4Q7N A;  4QT3 A;  4ODL A;  4LAV A;  1EDQ A;  2KGJ A;  1R9H A;  2LGO A;  4LGX A;  2A3E A;  5BXJ A;  4P8U A;  4W5U A;  2DPE A;  4KR0 B;  4S3K A;  3FY1 A;  3ALF A;  3G6L A;  4DRH A;  2PPN A;  4Z2G A;  4JFL A;  4ITZ A;  1SYT A;  4MSP A;  4W9O A;  2XP3 A;  2ETN A;  3KAB A;  3O5G A;  3ARZ A;  4DRJ A;  2XP5 A;  4WK9 A;  4DZ3 A;  3FAP A;  4WKH A;  4J4O A;  5HW7 A;  5GPG A;  3O5P A;  3QOK A;  1W9U A;  2PN0 A;  3WIJ A;  2ZR6 A;  4U86 A;  4TYO A;  1FKD A;  4MNL A;  2MPH A;  4Z2L A;  1VF8 A;  2AOS A;  4TX0 A;  3CHC A;  4ML4 A;  2MF9 A;  4DWS A;  4WKF A;  1E6R A;  3TDB A;  4IPX A;  1ZCN A;  3KAI A;  1FFR A;  3ARU A;  2FDM A;  1PBK A;  3BXW A;  2PV1 A;  1JNT A;  2PPO A;  4GGQ A;  1FKL A;  2RUR A;  1Y0O A;  3O5I A;  1NWS A;  4DWS D;  3UI5 A;  4W9Q A;  1RD6 A;  4IT6 A;  5GQB A;  1W9P A;  1FD9 A;  3O5E A;  1NH6 A;  1TCO C;  3ALG A;  3KAH A;  3O5R A;  4NSB A;  4ODO A;  5HBF A;  2QF8 A;  3H9R B;  3KAG A;  3WD1 A;  2ZR5 A;  2A3B A;  3CHD A;  3O5L A;  4MGV A;  2A3A A;  1ZBC A;  3KAF A;  3UQB A;  5DO2 A;  2XP7 A;  5D75 A;  1ZK6 A;  4MNM A;  3CGN A;  3PRB A;  1EIB A;  5DIV A;  1FKG A;  1GUV A;  1NWR A;  1D7J A;  1W9V A;  1LL4 A;  2VCD A;  1ZB5 A;  4R5E A;  3OOB A; 
#chains in the Genus database with same CATH homology
 1Q6U A;  1HJX A;  2M1I A;  4HAR A;  1NMW A;  4TW8 A;  5HTG A;  4ODQ A;  3O5D A;  4DT4 A;  1FKF A;  3KAD A;  3LUO A;  1NSG A;  5HW8 A;  1F40 A;  1LG2 A;  3B8S A;  1XHG A;  4O2T A;  1T11 A;  3B9E A;  3ARQ A;  4P8X A;  2LJ4 A;  2DT2 A;  3ARV A;  2VN1 A;  1D7I A;  2ITK A;  1X6N A;  4WJX A;  2XP9 A;  4MAV A;  4Z2H A;  3JXV A;  3RME A;  2YBU A;  4L3N A;  1JVW A;  4JFI A;  2D9F A;  4N19 A;  3AQU A;  2WK2 A;  4W9P A;  1GOI A;  1U79 A;  1L1P A;  1N1A A;  3WD4 A;  4P8V A;  1E6Z A;  1HKI A;  2L2S A;  2MLZ A;  4JFM A;  1LL7 A;  2B31 A;  1LG1 A;  2PV3 A;  1NWU A;  4IQ2 A;  2RUC A;  2IUZ A;  2UZ5 A;  3FXY A;  4LAW A;  4HBE A;  4Z2K A;  3NI6 A;  4S3J A;  5DIT A;  1E9L A;  4NNR A;  3O5K A;  3PRD A;  3PR9 A;  4U85 A;  3UI4 A;  5HUA A;  1SR0 A;  4QIB A;  2OLH A;  2KO7 A;  1UR8 A;  2XP6 A;  1ZBK A;  1HKM A;  3KZ7 A;  2PV2 A;  1D7H A;  2MLY A;  2DG4 A;  1W1Y A;  1EHN A;  2AWG A;  4TW6 A;  4MNK A;  1P5Q A;  2DT3 A;  3VAW A;  2LPV A;  3ARX A;  4U84 A;  1LJY A;  4BF8 A;  3O5J A;  2IF4 A;  3RM4 A;  3O5Q A;  2RUD A;  1W1T A;  3RM8 A;  4ZS6 A;  2ZQU A;  2ZQV A;  1W1V A;  1Q1C A;  3UQA A;  2DSW A;  3AS3 A;  3G6M A;  2PPP A;  5HT1 A;  2ZR4 A;  3RFW A;  4QT2 A;  3O5F A;  2KR7 A;  2Q5A A;  2O92 A;  1H0G A;  4L72 B;  3IKD A;  3RGC A;  2KE0 A;  2RQS A;  1ITX A;  3CZ8 A;  4MTV A;  4IQC A;  1FFQ A;  1TFV A;  1W26 A;  3B7X A;  2XP4 A;  4LAX A;  4Q22 A;  1A7X A;  1K9T A;  1O6I A;  2K8I A;  1FKK A;  3WL0 A;  4Z2I A;  4IT4 A;  1NWT A;  2RUQ A;  1LQ0 A;  3I6C A;  5J6E A;  1HKK A;  3PRA A;  5JH8 A;  3NRK A;  3IHZ A;  3WD0 A;  5HKG A;  3O5M A;  5I98 A;  2ZQS A;  1BL4 A;  3ARS A;  3CGM A;  1QPL A;  3UQI A;  2F21 A;  4ZPW R;  4ZPT R;  4DWS C;  3AS2 A;  3WH0 A;  1H0I A;  3WQV A;  1EQ3 A;  3ARO A;  1JND A;  3CH9 A;  4ZPV R;  1C9H A;  4DIP A;  1ZBV A;  1HJV A;  1J4I A;  1WB0 A;  4MPK A;  3ARR A;  1OGB A;  2PI6 A;  1D2K A;  4J4N A;  4HBO A;  1UR9 A;  1J4H A;  3TC5 A;  1YW5 A;  2DSU A;  4JYS A;  3KAC A;  5HWC A;  4TW7 A;  4AY1 A;  1GPF A;  4ODN A;  2DT0 A;  3AS1 A;  1J4R A;  1KT1 A;  1ROT A;  1XRV A;  3B9D A;  3IK8 A;  1HJW A;  2G41 A;  3UF8 A;  2KI3 A;  4DRK A;  1FKI A;  1D6O A;  3JYJ A;  4JFK A;  4R0X A;  4DRO A;  3TCZ A;  1CTN A;  2PBC A;  2F2D A;  2RSE A;  2N87 A;  2WLZ A;  5DEZ A;  2LKN A;  2A3C A;  3ARY A;  3MDY B;  1LL6 A;  3ARW A;  4KQZ A;  2XP8 A;  5HWB A;  4DRQ A;  3WKZ A;  1E15 A;  2WLY A;  5DF0 A;  3ART A;  1PIN A;  4XAK A;  3GPK A;  4DRN A;  1JNS A;  2MNT A;  5HW6 A;  1E6P A;  4DRP A;  1OWQ A;  1J6Y A;  2MLX A;  4G2P A;  4G50 A;  1YAT A;  4WIW A;  1FKS A;  4MNJ A;  2DT1 A;  2M08 A;  3O5O A;  1WAW A;  1WNO A;  1QZ2 A;  1FKJ A;  1FKT A;  2WM0 A;  2XPA A;  3UI6 A;  3ODK A;  3EY6 A;  4ODK A;  3B9A A;  3OA5 A;  4NZC A;  4PTM A;  2YBT A;  3PA7 A;  3RM9 A;  3W4R A;  3WL1 A;  4Z2J A;  2JZV A;  4P8W A;  4JFJ A;  2DG9 A;  1E6N A;  5GPR A;  3WD3 A;  1JNE A;  4C02 B;  1ZL1 A;  1FKR A;  4URI A;  4DRI A;  2KFW A;  4TNS A;  4DZ2 A;  2ZQT A;  4FN2 A;  4DWS B;  4DRM A;  1EYM A;  2XPB A;  1W1P A;  4DH0 A;  2ESC A;  1HXV A;  1ROU A;  1B6C A;  1FJD A;  3ARP A;  1Q6I A;  3NTP A;  3AS0 A;  3KCE A;  4ODR A;  4GIV A;  1ZBW A;  4ODP A;  1NMV A;  3CHE A;  1FKH A;  1Q6H A;  4LAY A;  4WKA A;  1FAP A;  1OGG A;  1BKF A;  2DG3 A;  3IKG A;  1IX5 A;  5DIU A;  2G8Z A;  4ODM A;  1HKJ A;  1ZU8 A;  2DSZ A;  1QPF A;  4FAP A;  1M5Y A;  2FKE A;  4QZV B;  1KFW A;  2M2A A;  1FKB A;  1KT0 A;  2DSV A;  3JYM A;  2F4E A;  3WQW A;  2FAP A;  3WD2 A;  1F8A B;  3CHF A;  2O9O A;  5B8I C;  2OFN A;  1X6L A;  2Y78 A;  4Q7N A;  4QT3 A;  4ODL A;  4LAV A;  1EDQ A;  2KGJ A;  1R9H A;  2LGO A;  4LGX A;  2A3E A;  5BXJ A;  4P8U A;  4W5U A;  2DPE A;  4KR0 B;  4S3K A;  3FY1 A;  3ALF A;  3G6L A;  4DRH A;  2PPN A;  4Z2G A;  4JFL A;  4ITZ A;  1SYT A;  4MSP A;  4W9O A;  2XP3 A;  3KAB A;  3O5G A;  3ARZ A;  4DRJ A;  2XP5 A;  4WK9 A;  4DZ3 A;  3FAP A;  4WKH A;  4J4O A;  5HW7 A;  5GPG A;  3O5P A;  3QOK A;  1W9U A;  3WIJ A;  2ZR6 A;  4U86 A;  4TYO A;  1FKD A;  4MNL A;  2MPH A;  4Z2L A;  1VF8 A;  2AOS A;  4TX0 A;  3CHC A;  4ML4 A;  2MF9 A;  4DWS A;  4WKF A;  1E6R A;  3TDB A;  4IPX A;  1ZCN A;  3KAI A;  1FFR A;  3ARU A;  2FDM A;  1PBK A;  3BXW A;  2PV1 A;  1JNT A;  2PPO A;  4GGQ A;  1FKL A;  2RUR A;  1Y0O A;  3O5I A;  1NWS A;  4DWS D;  3UI5 A;  4W9Q A;  1RD6 A;  4IT6 A;  5GQB A;  1W9P A;  1FD9 A;  3O5E A;  1NH6 A;  1TCO C;  3ALG A;  3KAH A;  3O5R A;  4NSB A;  4ODO A;  5HBF A;  2QF8 A;  3H9R B;  3KAG A;  3WD1 A;  2ZR5 A;  2A3B A;  3CHD A;  3O5L A;  4MGV A;  2A3A A;  1ZBC A;  3KAF A;  3UQB A;  5DO2 A;  2XP7 A;  5D75 A;  1ZK6 A;  4MNM A;  3CGN A;  3PRB A;  1EIB A;  5DIV A;  1FKG A;  1GUV A;  1NWR A;  1D7J A;  1W9V A;  1LL4 A;  2VCD A;  1ZB5 A;  4R5E A;  3OOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...