3O5KA

Fk1 domain of fkbp51, crystal form viii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5kA00
3O5QA 4DRJA 1BL4A 4MSPA 4J4OA 4IPXA 3O5KA 4TW7A 4TYOA 1KT0A 4C02B 1Q1CA 1Q6UA 3UI6A 2ZQVA 4LAXA 1YATA 1JVWA 2F4EA 3UI5A 3O5JA 4ODPA 2UZ5A 5HW8A 1PINA 4G50A 4W9PA 1T11A 3WH0A 4DIPA 3KADA 2ZQTA 4U84A 5HW7A 1L1PA 4O2TA 2MLXA 3O5IA 1ZCNA 1FKBA 4IQCA 4TW6A 4ODKA 4TNSA 1M5YA 3ODKA 3PRDA 2PV1A 2RQSA 4NNRA 4DRIA 2F21A 3IKDA 3IK8A 4JFMA 1JNTA 1FKGA 3KAHA 3O5RA 3NI6A 2XPBA 2RSEA 2K8IA 3IHZA 3VAWA 1JNSA 1D7IA 3LUOA 2RUQA 1TCOC 4JFKA 1ROUA 5DITA 3TDBA 1C9HA 1QPFA 5GPGA 1J4HA 4DRMA 2PV3A 3B7XA 2M08A 3O5GA 4GGQA 4U86A 2LGOA 3UF8A 4LAYA 2D9FA 4R0XA 1B6CA 2KFWA 1QZ2A 5HTGA 4ITZA 1YW5A 4ODOA 2KE0A 2L2SA 3KABA 2RURA 1KT1A 3I6CA 3O5PA 1U79A 2KO7A 2RUDA 2ZR6A 4DRKA 3O5EA 1F40A 4LAWA 2N87A 4TW8A 2Y78A 3PRBA 4IQ2A 5J6EA 4ODMA 5HW6A 2XPAA 2KI3A 2IF4A 1NSGA 3UQAA 1D7HA 1Q6IA 2MLYA 4FN2A 4DT4A 3NTPA 1HXVA 1ZK6A 1FKLA 2PPNA 1FKKA 2ZR4A 1FJDA 3EY6A 2M1IA 4JFJA 1FAPA 2AWGA 1W26A 5I98A 4G2PA 2FAPA 1J4IA 2MNTA 4QT2A 5HWBA 3KAIA 4W9QA 4TX0A 4DRHA 1R9HA 3KAFA 1BKFA 2XP6A 2XP7A 1J4RA 4J4NA 2M2AA 2ZQSA 3PA7A 3KACA 2VN1A 1Y0OA 3KCEA 3RFWA 3UQBA 5HWCA 5DIVA 3IKGA 1ROTA 1FKSA 3O5OA 5B8IC 1PBKA 3CGNA 3TCZA 1FKTA 5DIUA 1FKIA 2LJ4A 1EQ3A 2Q5AA 4W9OA 3RGCA 4ODLA 2MPHA 2PBCA 3KAGA 1D7JA 4JFIA 2XP5A 3KZ7A 4MGVA 1NMWA 3CGMA 3O5MA 3O5DA 4DRNA 4JYSA 2ZR5A 1A7XA 1Q6HA 2DG4A 2XP3A 3JYJA 3JXVA 5HKGA 1P5QA 1QPLA 2PPOA 2PV2A 2DG3A 2FKEA 4U85A 3NRKA 2OFNA 3UQIA 2PPPA 3JYMA 1NMVA 1D6OA 2DG9A 3O5LA 4FAPA 5BXJA 1J6YA 4DROA 4DH0A 2RUCA 2XP8A 3H9RB 4LAVA 4QIBA 5D75A 2LKNA 1EYMA 3GPKA 2MF9A 3TC5A 4BF8A 2XP9A 4ODRA 2ITKA 2XP4A 4QT3A 5HUAA 1N1AA 1FKDA 2F2DA 2VCDA 1FKFA 2JZVA 1F8AB 5HT1A 2MLZA 1FKJA 2LPVA 2ZQUA 4DRQA 4ODQA 3OOBA 3FAPA 1FKHA 4DRPA 4JFLA 4ODNA 3O5FA 4DZ2A 2KR7A 3MDYB 4N19A 4GIVA 4DZ3A 1FKRA 3UI4A 1FD9A 2KGJA
chains in the Genus database with same CATH superfamily
1LL4A 4DRJA 4J4OA 1W1PA 5GQBA 3OA5A 1Q1CA 1XHGA 1EIBA 3RMEA 2G41A 3CHEA 3PR9A 4S3KA 2F4EA 3FY1A 1E6NA 1W9VA 3O5JA 1PINA 4G50A 4DIPA 1SR0A 2ZQTA 5HW7A 1EDQA 4TW6A 3CHFA 3ODKA 3PRDA 2RQSA 3AQUA 4NNRA 4DRIA 1TFVA 2G8ZA 2K8IA 3IHZA 1D7IA 2RUQA 3GU0A 1HJXA 3UF8A 1W1YA 5HTGA 4LAYA 2D9FA 4R0XA 4WIWA 4ODOA 2KE0A 1RD6A 1VF8A 2WK2A 3KABA 3AS1A 1H0GA 4QZVB 4AY1A 4TW8A 2Y78A 4P8VA 2XPAA 4WK9A 4R5EA 4DT4A 5DF0A 3EY6A 2M1IA 2AWGA 4IT6A 2FAPA 1J4IA 4Q22A 3KAIA 3RM9A 1R9HA 1LG1A 1FFRA 2ZQSA 3PA7A 4MPKA 2VN1A 3RFWA 1IX5A 5DIVA 1PBKA 1WNOA 3WQWA 4W9OA 3RGCA 1NH6A 2O9OA 3ARTA 3KAGA 4XAKA 4MGVA 3KZ7A 2EULA 4DRNA 4JYSA 1P5QA 1QPLA 2DG3A 1D2KA 3BMBA 3O5LA 4DWSA 4HARA 1X6LA 4LAVA 4QIBA 1EYMA 2MF9A 3WIJA 2DT3A 1WAWA 2XP4A 5HT1A 3ALGA 3ALFA 3WQVA 2LPVA 2ZQUA 4DRQA 3FAPA 1E6RA 1EHNA 1GPFA 4DZ2A 3MDYB 4GIVA 4DZ3A 1ZCNA 4IPXA 3O5KA 4TW7A 2DT0A 4MNMA 1JVWA 1T11A 1NWTA 1HKMA 1L1PA 4O2TA 2MLXA 4IQCA 4KQZA 3B9DA 2O92A 4ZPWR 2B31A 2F21A 3ARXA 3IK8A 1HKIA 1JNTA 4P8XA 4Z2KA 2XPBA 3VAWA 3LUOA 2A3EA 1TCOC 4JFKA 5GPGA 3B9EA 2PV3A 1E15A 4DWSB 1QZ2A 4ITZA 2L2SA 2RURA 3B8SA 5HBFA 1KT1A 2ESCA 3I6CA 2KO7A 4S3JA 1H0IA 1ZU8A 4MNJA 1NSGA 3WL1A 4UDMA 4ZS6A 3AS2A 1E6ZA 3NTPA 1HXVA 1FKLA 1FKKA 2ZR4A 4JFJA 1FAPA 3BXWA 4G2PA 1ZL1A 3CHCA 4QT2A 4MTVA 2DT1A 1BKFA 2XP6A 2M2AA 2AOSA 1ROTA 4L3NA 3O5OA 1W9PA 4ZPTR 5DIUA 1K9TA 1OGBA 4Z2IA 2Q5AA 1HKKA 4ZPVR 4JFIA 1D7JA 2DSVA 3O5DA 1A7XA 5HKGA 3JXVA 2PPOA 2IUZA 3UQIA 3NRKA 2OFNA 2PPPA 1D6OA 1J6YA 4LGXA 3TC5A 2ITKA 5HUAA 1N1AA 2F2DA 2MLZA 2PI6A 3OOBA 4URIA 4DRPA 4JFLA 2KR7A 1FKRA 2WM0A 1BL4A 4TYOA 1KT0A 3PRAA 1Q6UA 2ZQVA 4LAXA 1YATA 3UI5A 1UR9A 1LL6A 2OLHA 2UZ5A 2A3AA 3ARVA 4WKFA 2PN0A 4U84A 3CHDA 4TNSA 2PV1A 5DO2A 3IKDA 4JFMA 3ARQA 1FKGA 5GPRA 3O5RA 2RSEA 1JNSA 1ROUA 5DITA 1J4HA 2M08A 4U86A 1ZBVA 2KFWA 1YW5A 3WD1A 1U79A 2RUDA 2ZR6A 3WD3A 1F40A 3O5EA 1ZBCA 2N87A 1XRVA 1UR8A 2QF8A 3ARSA 3WL0A 3UQAA 2IF4A 1D7HA 1Q6IA 2MLYA 4FN2A 3CZ8A 1ZK6A 2PPNA 4Z2LA 1FJDA 4MNKA 2F23A 5I98A 1E6PA 2MNTA 4TX0A 2DPEA 1ZBKA 1ZBWA 1CTNA 3AS0A 1J4RA 1Y0OA 1W9UA 3WKZA 1ITXA 5HWCA 5JH8A 2B5UB 1FKSA 1W1TA 3CGNA 1HJWA 3TCZA 1OGGA 1FKTA 4Z2GA 3QOKA 4ODLA 4DWSC 2XP5A 1NMWA 3JYJA 2XP3A 3B9AA 3ARPA 1GUVA 1FFQA 2PV2A 3JYMA 2DG9A 1E44A 1O6IA 4Q7NA 3H9RB 2LKNA 4ODRA 3RM4A 1FKDA 2VCDA 1F8AB 2FDMA 1FKJA 4ODQA 4L72B 1FKHA 1LJYA 1GOIA 4ODNA 3WD4A 4DWSD 3O5FA 4N19A 1JCHB 3UI4A 1FD9A 2KGJA 3GTYX 3O5QA 4MSPA 4KR0B 4C02B 2DSUA 4P8WA 1HKJA 3UI6A 1ZB5A 4NSBA 1GRJA 2WLZA 4ODPA 5HW8A 4IT4A 4W9PA 3WH0A 3KADA 3FXYA 4Z2JA 3O5IA 1FKBA 1LG2A 4ODKA 4HBOA 1M5YA 3KAHA 4ML4A 3NI6A 1E9LA 2YBUA 1LQ0A 1W1VA 3TDBA 1C9HA 1QPFA 4DRMA 4NZCA 2DSZA 3B7XA 3O5GA 4GGQA 2P4VA 2LGOA 1B6CA 3ARYA 1KFWA 1WB0A 3O5PA 2DSWA 1NWSA 4DRKA 4WKHA 3WD2A 4LAWA 3PRBA 4IQ2A 5J6EA 4ODMA 3AS3A 5HW6A 3AROA 2KI3A 2A3BA 2ETNA 1NWRA 5DEZA 3G6MA 1W26A 1JNEA 3CH9A 4HBEA 4WKAA 5HWBA 2WLYA 4P8UA 4W9QA 4DRHA 1SYTA 3KAFA 4J4NA 2XP7A 4MNLA 3ARRA 3KACA 3KCEA 3UQBA 3IKGA 1X6NA 5B8IC 2DT2A 1FKIA 2LJ4A 1EQ3A 3ARWA 1HJVA 2MPHA 2PBCA 4WJXA 3RM8A 3G6LA 3ARZA 3CGMA 3O5MA 1JNDA 2ZR5A 3EIPA 1LL7A 1Q6HA 2DG4A 1OWQA 4PTMA 3W4RA 4U85A 2FKEA 4FAPA 1NMVA 5BXJA 4W5UA 3WD0A 4DROA 4DH0A 2RUCA 2XP8A 5D75A 2YBTA 3GPKA 4BF8A 2XP9A 4QT3A 1FKFA 2JZVA 4MAVA 2A3CA 1NWUA 3ARUA 4Z2HA
chains in the Genus database with same CATH topology
1LL4A 4DRJA 4J4OA 1W1PA 5GQBA 3OA5A 1Q1CA 1XHGA 1EIBA 3RMEA 2G41A 3CHEA 3PR9A 4S3KA 2F4EA 3FY1A 1E6NA 1W9VA 3O5JA 1PINA 4G50A 4DIPA 1SR0A 2ZQTA 5HW7A 1EDQA 4TW6A 3CHFA 3ODKA 3PRDA 2RQSA 3AQUA 4NNRA 4DRIA 1TFVA 2G8ZA 2K8IA 3IHZA 1D7IA 2RUQA 1HJXA 3UF8A 1W1YA 5HTGA 4LAYA 2D9FA 4R0XA 4WIWA 4ODOA 2KE0A 1RD6A 1VF8A 2WK2A 3KABA 3AS1A 1H0GA 4QZVB 4AY1A 4TW8A 2Y78A 4P8VA 2XPAA 4WK9A 4R5EA 4DT4A 5DF0A 3EY6A 2M1IA 2AWGA 4IT6A 2FAPA 1J4IA 4Q22A 3KAIA 3RM9A 1R9HA 1LG1A 1FFRA 2ZQSA 3PA7A 4MPKA 2VN1A 3RFWA 1IX5A 5DIVA 1PBKA 1WNOA 3WQWA 4W9OA 3RGCA 1NH6A 2O9OA 3ARTA 3KAGA 4XAKA 4MGVA 3KZ7A 4DRNA 4JYSA 1P5QA 1QPLA 2DG3A 1D2KA 3O5LA 4DWSA 4HARA 1X6LA 4LAVA 4QIBA 1EYMA 2MF9A 3WIJA 2DT3A 1WAWA 2XP4A 5HT1A 3ALGA 3ALFA 3WQVA 2LPVA 2ZQUA 4DRQA 3FAPA 1E6RA 1EHNA 1GPFA 4DZ2A 3MDYB 4GIVA 4DZ3A 1ZCNA 4IPXA 3O5KA 4TW7A 2DT0A 4MNMA 1JVWA 1T11A 1NWTA 1HKMA 1L1PA 4O2TA 2MLXA 4IQCA 4KQZA 3B9DA 2O92A 4ZPWR 2B31A 2F21A 3ARXA 3IK8A 1HKIA 1JNTA 4P8XA 4Z2KA 2XPBA 3VAWA 3LUOA 2A3EA 1TCOC 4JFKA 5GPGA 3B9EA 2PV3A 1E15A 4DWSB 1QZ2A 4ITZA 2L2SA 2RURA 3B8SA 5HBFA 1KT1A 2ESCA 3I6CA 2KO7A 4S3JA 1H0IA 1ZU8A 4MNJA 1NSGA 3WL1A 4ZS6A 3AS2A 1E6ZA 3NTPA 1HXVA 1FKLA 1FKKA 2ZR4A 4JFJA 1FAPA 3BXWA 4G2PA 1ZL1A 3CHCA 4QT2A 4MTVA 2DT1A 1BKFA 2XP6A 2M2AA 2AOSA 1ROTA 4L3NA 3O5OA 1W9PA 4ZPTR 5DIUA 1K9TA 1OGBA 4Z2IA 2Q5AA 1HKKA 4ZPVR 4JFIA 1D7JA 2DSVA 3O5DA 1A7XA 5HKGA 3JXVA 2PPOA 2IUZA 3UQIA 3NRKA 2OFNA 2PPPA 1D6OA 1J6YA 4LGXA 3TC5A 2ITKA 5HUAA 1N1AA 2F2DA 2MLZA 2PI6A 3OOBA 4URIA 4DRPA 4JFLA 2KR7A 1FKRA 2WM0A 1BL4A 4TYOA 1KT0A 3PRAA 1Q6UA 2ZQVA 4LAXA 1YATA 3UI5A 1UR9A 1LL6A 2OLHA 2UZ5A 2A3AA 3ARVA 4WKFA 4U84A 3CHDA 4TNSA 2PV1A 5DO2A 3IKDA 4JFMA 3ARQA 1FKGA 5GPRA 3O5RA 2RSEA 1JNSA 1ROUA 5DITA 1J4HA 2M08A 4U86A 1ZBVA 2KFWA 1YW5A 3WD1A 1U79A 2RUDA 2ZR6A 3WD3A 1F40A 3O5EA 1ZBCA 2N87A 1XRVA 1UR8A 2QF8A 3ARSA 3WL0A 3UQAA 2IF4A 1D7HA 1Q6IA 2MLYA 4FN2A 3CZ8A 1ZK6A 2PPNA 4Z2LA 1FJDA 4MNKA 5I98A 1E6PA 2MNTA 4TX0A 2DPEA 1ZBKA 1ZBWA 1CTNA 3AS0A 1J4RA 1Y0OA 1W9UA 3WKZA 1ITXA 5HWCA 5JH8A 1FKSA 1W1TA 3CGNA 1HJWA 3TCZA 1OGGA 1FKTA 4Z2GA 3QOKA 4ODLA 4DWSC 2XP5A 1NMWA 3JYJA 2XP3A 3B9AA 3ARPA 1GUVA 1FFQA 2PV2A 3JYMA 2DG9A 1O6IA 4Q7NA 3H9RB 2LKNA 4ODRA 3RM4A 1FKDA 2VCDA 1F8AB 2FDMA 1FKJA 4ODQA 4L72B 1FKHA 1LJYA 1GOIA 4ODNA 3WD4A 4DWSD 3O5FA 4N19A 3UI4A 1FD9A 2KGJA 3O5QA 4MSPA 4KR0B 4C02B 2DSUA 4P8WA 1HKJA 3UI6A 1ZB5A 4NSBA 2WLZA 4ODPA 5HW8A 4IT4A 4W9PA 3WH0A 3KADA 3FXYA 4Z2JA 3O5IA 1FKBA 1LG2A 4ODKA 4HBOA 1M5YA 3KAHA 4ML4A 3NI6A 1E9LA 2YBUA 1LQ0A 1W1VA 3TDBA 1C9HA 1QPFA 4DRMA 4NZCA 2DSZA 3B7XA 3O5GA 4GGQA 2LGOA 1B6CA 3ARYA 1KFWA 1WB0A 3O5PA 2DSWA 1NWSA 4DRKA 4WKHA 3WD2A 4LAWA 3PRBA 4IQ2A 5J6EA 4ODMA 3AS3A 5HW6A 3AROA 2KI3A 2A3BA 1NWRA 5DEZA 3G6MA 1W26A 1JNEA 3CH9A 4HBEA 4WKAA 5HWBA 2WLYA 4P8UA 4W9QA 4DRHA 1SYTA 3KAFA 4J4NA 2XP7A 4MNLA 3ARRA 3KACA 3KCEA 3UQBA 3IKGA 1X6NA 5B8IC 2DT2A 1FKIA 2LJ4A 1EQ3A 3ARWA 1HJVA 2MPHA 2PBCA 4WJXA 3RM8A 3G6LA 3ARZA 3CGMA 3O5MA 1JNDA 2ZR5A 1LL7A 1Q6HA 2DG4A 1OWQA 4PTMA 3W4RA 4U85A 2FKEA 4FAPA 1NMVA 5BXJA 4W5UA 3WD0A 4DROA 4DH0A 2RUCA 2XP8A 5D75A 2YBTA 3GPKA 4BF8A 2XP9A 4QT3A 1FKFA 2JZVA 4MAVA 2A3CA 1NWUA 3ARUA 4Z2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5Q A;  4DRJ A;  1BL4 A;  4MSP A;  4J4O A;  4IPX A;  3O5K A;  4TW7 A;  4TYO A;  1KT0 A;  4C02 B;  1Q1C A;  1Q6U A;  3UI6 A;  2ZQV A;  4LAX A;  1YAT A;  1JVW A;  2F4E A;  3UI5 A;  3O5J A;  4ODP A;  2UZ5 A;  5HW8 A;  1PIN A;  4G50 A;  4W9P A;  1T11 A;  3WH0 A;  4DIP A;  3KAD A;  2ZQT A;  4U84 A;  5HW7 A;  1L1P A;  4O2T A;  2MLX A;  3O5I A;  1ZCN A;  1FKB A;  4IQC A;  4TW6 A;  4ODK A;  4TNS A;  1M5Y A;  3ODK A;  3PRD A;  2PV1 A;  2RQS A;  4NNR A;  4DRI A;  2F21 A;  3IKD A;  3IK8 A;  4JFM A;  1JNT A;  1FKG A;  3KAH A;  3O5R A;  3NI6 A;  2XPB A;  2RSE A;  2K8I A;  3IHZ A;  3VAW A;  1JNS A;  1D7I A;  3LUO A;  2RUQ A;  1TCO C;  4JFK A;  1ROU A;  5DIT A;  3TDB A;  1C9H A;  1QPF A;  5GPG A;  1J4H A;  4DRM A;  2PV3 A;  3B7X A;  2M08 A;  3O5G A;  4GGQ A;  4U86 A;  2LGO A;  3UF8 A;  4LAY A;  2D9F A;  4R0X A;  1B6C A;  2KFW A;  1QZ2 A;  5HTG A;  4ITZ A;  1YW5 A;  4ODO A;  2KE0 A;  2L2S A;  3KAB A;  2RUR A;  1KT1 A;  3I6C A;  3O5P A;  1U79 A;  2KO7 A;  2RUD A;  2ZR6 A;  4DRK A;  3O5E A;  1F40 A;  4LAW A;  2N87 A;  4TW8 A;  2Y78 A;  3PRB A;  4IQ2 A;  5J6E A;  4ODM A;  5HW6 A;  2XPA A;  2KI3 A;  2IF4 A;  1NSG A;  3UQA A;  1D7H A;  1Q6I A;  2MLY A;  4FN2 A;  4DT4 A;  3NTP A;  1HXV A;  1ZK6 A;  1FKL A;  2PPN A;  1FKK A;  2ZR4 A;  1FJD A;  3EY6 A;  2M1I A;  4JFJ A;  1FAP A;  2AWG A;  1W26 A;  5I98 A;  4G2P A;  2FAP A;  1J4I A;  2MNT A;  4QT2 A;  5HWB A;  3KAI A;  4W9Q A;  4TX0 A;  4DRH A;  1R9H A;  3KAF A;  1BKF A;  2XP6 A;  2XP7 A;  1J4R A;  4J4N A;  2M2A A;  2ZQS A;  3PA7 A;  3KAC A;  2VN1 A;  1Y0O A;  3KCE A;  3RFW A;  3UQB A;  5HWC A;  5DIV A;  3IKG A;  1ROT A;  1FKS A;  3O5O A;  5B8I C;  1PBK A;  3CGN A;  3TCZ A;  1FKT A;  5DIU A;  1FKI A;  2LJ4 A;  1EQ3 A;  2Q5A A;  4W9O A;  3RGC A;  4ODL A;  2MPH A;  2PBC A;  3KAG A;  1D7J A;  4JFI A;  2XP5 A;  3KZ7 A;  4MGV A;  1NMW A;  3CGM A;  3O5M A;  3O5D A;  4DRN A;  4JYS A;  2ZR5 A;  1A7X A;  1Q6H A;  2DG4 A;  2XP3 A;  3JYJ A;  3JXV A;  5HKG A;  1P5Q A;  1QPL A;  2PPO A;  2PV2 A;  2DG3 A;  2FKE A;  4U85 A;  3NRK A;  2OFN A;  3UQI A;  2PPP A;  3JYM A;  1NMV A;  1D6O A;  2DG9 A;  3O5L A;  4FAP A;  5BXJ A;  1J6Y A;  4DRO A;  4DH0 A;  2RUC A;  2XP8 A;  3H9R B;  4LAV A;  4QIB A;  5D75 A;  2LKN A;  1EYM A;  3GPK A;  2MF9 A;  3TC5 A;  4BF8 A;  2XP9 A;  4ODR A;  2ITK A;  2XP4 A;  4QT3 A;  5HUA A;  1N1A A;  1FKD A;  2F2D A;  2VCD A;  1FKF A;  2JZV A;  1F8A B;  5HT1 A;  2MLZ A;  1FKJ A;  2LPV A;  2ZQU A;  4DRQ A;  4ODQ A;  3OOB A;  3FAP A;  1FKH A;  4DRP A;  4JFL A;  4ODN A;  3O5F A;  4DZ2 A;  2KR7 A;  3MDY B;  4N19 A;  4GIV A;  4DZ3 A;  1FKR A;  3UI4 A;  1FD9 A;  2KGJ A; 
#chains in the Genus database with same CATH topology
 1LL4 A;  4DRJ A;  4J4O A;  1W1P A;  5GQB A;  3OA5 A;  1Q1C A;  1XHG A;  1EIB A;  3RME A;  2G41 A;  3CHE A;  3PR9 A;  4S3K A;  2F4E A;  3FY1 A;  1E6N A;  1W9V A;  3O5J A;  1PIN A;  4G50 A;  4DIP A;  1SR0 A;  2ZQT A;  5HW7 A;  1EDQ A;  4TW6 A;  3CHF A;  3ODK A;  3PRD A;  2RQS A;  3AQU A;  4NNR A;  4DRI A;  1TFV A;  2G8Z A;  2K8I A;  3IHZ A;  1D7I A;  2RUQ A;  3GU0 A;  1HJX A;  3UF8 A;  1W1Y A;  5HTG A;  4LAY A;  2D9F A;  4R0X A;  4WIW A;  4ODO A;  2KE0 A;  1RD6 A;  1VF8 A;  2WK2 A;  3KAB A;  3AS1 A;  1H0G A;  4QZV B;  4AY1 A;  4TW8 A;  2Y78 A;  4P8V A;  2XPA A;  4WK9 A;  4R5E A;  4DT4 A;  5DF0 A;  3EY6 A;  2M1I A;  2AWG A;  4IT6 A;  2FAP A;  1J4I A;  4Q22 A;  3KAI A;  3RM9 A;  1R9H A;  1LG1 A;  1FFR A;  2ZQS A;  3PA7 A;  4MPK A;  2VN1 A;  3RFW A;  1IX5 A;  5DIV A;  1PBK A;  1WNO A;  3WQW A;  4W9O A;  3RGC A;  1NH6 A;  2O9O A;  3ART A;  3KAG A;  4XAK A;  4MGV A;  3KZ7 A;  2EUL A;  4DRN A;  4JYS A;  1P5Q A;  1QPL A;  2DG3 A;  1D2K A;  3BMB A;  3O5L A;  4DWS A;  4HAR A;  1X6L A;  4LAV A;  4QIB A;  1EYM A;  2MF9 A;  3WIJ A;  2DT3 A;  1WAW A;  2XP4 A;  5HT1 A;  3ALG A;  3ALF A;  3WQV A;  2LPV A;  2ZQU A;  4DRQ A;  3FAP A;  1E6R A;  1EHN A;  1GPF A;  4DZ2 A;  3MDY B;  4GIV A;  4DZ3 A;  1ZCN A;  4IPX A;  3O5K A;  4TW7 A;  2DT0 A;  4MNM A;  1JVW A;  1T11 A;  1NWT A;  1HKM A;  1L1P A;  4O2T A;  2MLX A;  4IQC A;  4KQZ A;  3B9D A;  2O92 A;  4ZPW R;  2B31 A;  2F21 A;  3ARX A;  3IK8 A;  1HKI A;  1JNT A;  4P8X A;  4Z2K A;  2XPB A;  3VAW A;  3LUO A;  2A3E A;  1TCO C;  4JFK A;  5GPG A;  3B9E A;  2PV3 A;  1E15 A;  4DWS B;  1QZ2 A;  4ITZ A;  2L2S A;  2RUR A;  3B8S A;  5HBF A;  1KT1 A;  2ESC A;  3I6C A;  2KO7 A;  4S3J A;  1H0I A;  1ZU8 A;  4MNJ A;  1NSG A;  3WL1 A;  4UDM A;  4ZS6 A;  3AS2 A;  1E6Z A;  3NTP A;  1HXV A;  1FKL A;  1FKK A;  2ZR4 A;  4JFJ A;  1FAP A;  3BXW A;  4G2P A;  1ZL1 A;  3CHC A;  4QT2 A;  4MTV A;  2DT1 A;  1BKF A;  2XP6 A;  2M2A A;  2AOS A;  1ROT A;  4L3N A;  3O5O A;  1W9P A;  4ZPT R;  5DIU A;  1K9T A;  1OGB A;  4Z2I A;  2Q5A A;  1HKK A;  4ZPV R;  4JFI A;  1D7J A;  2DSV A;  3O5D A;  1A7X A;  5HKG A;  3JXV A;  2PPO A;  2IUZ A;  3UQI A;  3NRK A;  2OFN A;  2PPP A;  1D6O A;  1J6Y A;  4LGX A;  3TC5 A;  2ITK A;  5HUA A;  1N1A A;  2F2D A;  2MLZ A;  2PI6 A;  3OOB A;  4URI A;  4DRP A;  4JFL A;  2KR7 A;  1FKR A;  2WM0 A;  1BL4 A;  4TYO A;  1KT0 A;  3PRA A;  1Q6U A;  2ZQV A;  4LAX A;  1YAT A;  3UI5 A;  1UR9 A;  1LL6 A;  2OLH A;  2UZ5 A;  2A3A A;  3ARV A;  4WKF A;  2PN0 A;  4U84 A;  3CHD A;  4TNS A;  2PV1 A;  5DO2 A;  3IKD A;  4JFM A;  3ARQ A;  1FKG A;  5GPR A;  3O5R A;  2RSE A;  1JNS A;  1ROU A;  5DIT A;  1J4H A;  2M08 A;  4U86 A;  1ZBV A;  2KFW A;  1YW5 A;  3WD1 A;  1U79 A;  2RUD A;  2ZR6 A;  3WD3 A;  1F40 A;  3O5E A;  1ZBC A;  2N87 A;  1XRV A;  1UR8 A;  2QF8 A;  3ARS A;  3WL0 A;  3UQA A;  2IF4 A;  1D7H A;  1Q6I A;  2MLY A;  4FN2 A;  3CZ8 A;  1ZK6 A;  2PPN A;  4Z2L A;  1FJD A;  4MNK A;  2F23 A;  5I98 A;  1E6P A;  2MNT A;  4TX0 A;  2DPE A;  1ZBK A;  1ZBW A;  1CTN A;  3AS0 A;  1J4R A;  1Y0O A;  1W9U A;  3WKZ A;  1ITX A;  5HWC A;  5JH8 A;  2B5U B;  1FKS A;  1W1T A;  3CGN A;  1HJW A;  3TCZ A;  1OGG A;  1FKT A;  4Z2G A;  3QOK A;  4ODL A;  4DWS C;  2XP5 A;  1NMW A;  3JYJ A;  2XP3 A;  3B9A A;  3ARP A;  1GUV A;  1FFQ A;  2PV2 A;  3JYM A;  2DG9 A;  1E44 A;  1O6I A;  4Q7N A;  3H9R B;  2LKN A;  4ODR A;  3RM4 A;  1FKD A;  2VCD A;  1F8A B;  2FDM A;  1FKJ A;  4ODQ A;  4L72 B;  1FKH A;  1LJY A;  1GOI A;  4ODN A;  3WD4 A;  4DWS D;  3O5F A;  4N19 A;  1JCH B;  3UI4 A;  1FD9 A;  2KGJ A;  3GTY X;  3O5Q A;  4MSP A;  4KR0 B;  4C02 B;  2DSU A;  4P8W A;  1HKJ A;  3UI6 A;  1ZB5 A;  4NSB A;  1GRJ A;  2WLZ A;  4ODP A;  5HW8 A;  4IT4 A;  4W9P A;  3WH0 A;  3KAD A;  3FXY A;  4Z2J A;  3O5I A;  1FKB A;  1LG2 A;  4ODK A;  4HBO A;  1M5Y A;  3KAH A;  4ML4 A;  3NI6 A;  1E9L A;  2YBU A;  1LQ0 A;  1W1V A;  3TDB A;  1C9H A;  1QPF A;  4DRM A;  4NZC A;  2DSZ A;  3B7X A;  3O5G A;  4GGQ A;  2P4V A;  2LGO A;  1B6C A;  3ARY A;  1KFW A;  1WB0 A;  3O5P A;  2DSW A;  1NWS A;  4DRK A;  4WKH A;  3WD2 A;  4LAW A;  3PRB A;  4IQ2 A;  5J6E A;  4ODM A;  3AS3 A;  5HW6 A;  3ARO A;  2KI3 A;  2A3B A;  2ETN A;  1NWR A;  5DEZ A;  3G6M A;  1W26 A;  1JNE A;  3CH9 A;  4HBE A;  4WKA A;  5HWB A;  2WLY A;  4P8U A;  4W9Q A;  4DRH A;  1SYT A;  3KAF A;  4J4N A;  2XP7 A;  4MNL A;  3ARR A;  3KAC A;  3KCE A;  3UQB A;  3IKG A;  1X6N A;  5B8I C;  2DT2 A;  1FKI A;  2LJ4 A;  1EQ3 A;  3ARW A;  1HJV A;  2MPH A;  2PBC A;  4WJX A;  3RM8 A;  3G6L A;  3ARZ A;  3CGM A;  3O5M A;  1JND A;  2ZR5 A;  3EIP A;  1LL7 A;  1Q6H A;  2DG4 A;  1OWQ A;  4PTM A;  3W4R A;  4U85 A;  2FKE A;  4FAP A;  1NMV A;  5BXJ A;  4W5U A;  3WD0 A;  4DRO A;  4DH0 A;  2RUC A;  2XP8 A;  5D75 A;  2YBT A;  3GPK A;  4BF8 A;  2XP9 A;  4QT3 A;  1FKF A;  2JZV A;  4MAV A;  2A3C A;  1NWU A;  3ARU A;  4Z2H A; 
#chains in the Genus database with same CATH homology
 1LL4 A;  4DRJ A;  4J4O A;  1W1P A;  5GQB A;  3OA5 A;  1Q1C A;  1XHG A;  1EIB A;  3RME A;  2G41 A;  3CHE A;  3PR9 A;  4S3K A;  2F4E A;  3FY1 A;  1E6N A;  1W9V A;  3O5J A;  1PIN A;  4G50 A;  4DIP A;  1SR0 A;  2ZQT A;  5HW7 A;  1EDQ A;  4TW6 A;  3CHF A;  3ODK A;  3PRD A;  2RQS A;  3AQU A;  4NNR A;  4DRI A;  1TFV A;  2G8Z A;  2K8I A;  3IHZ A;  1D7I A;  2RUQ A;  1HJX A;  3UF8 A;  1W1Y A;  5HTG A;  4LAY A;  2D9F A;  4R0X A;  4WIW A;  4ODO A;  2KE0 A;  1RD6 A;  1VF8 A;  2WK2 A;  3KAB A;  3AS1 A;  1H0G A;  4QZV B;  4AY1 A;  4TW8 A;  2Y78 A;  4P8V A;  2XPA A;  4WK9 A;  4R5E A;  4DT4 A;  5DF0 A;  3EY6 A;  2M1I A;  2AWG A;  4IT6 A;  2FAP A;  1J4I A;  4Q22 A;  3KAI A;  3RM9 A;  1R9H A;  1LG1 A;  1FFR A;  2ZQS A;  3PA7 A;  4MPK A;  2VN1 A;  3RFW A;  1IX5 A;  5DIV A;  1PBK A;  1WNO A;  3WQW A;  4W9O A;  3RGC A;  1NH6 A;  2O9O A;  3ART A;  3KAG A;  4XAK A;  4MGV A;  3KZ7 A;  4DRN A;  4JYS A;  1P5Q A;  1QPL A;  2DG3 A;  1D2K A;  3O5L A;  4DWS A;  4HAR A;  1X6L A;  4LAV A;  4QIB A;  1EYM A;  2MF9 A;  3WIJ A;  2DT3 A;  1WAW A;  2XP4 A;  5HT1 A;  3ALG A;  3ALF A;  3WQV A;  2LPV A;  2ZQU A;  4DRQ A;  3FAP A;  1E6R A;  1EHN A;  1GPF A;  4DZ2 A;  3MDY B;  4GIV A;  4DZ3 A;  1ZCN A;  4IPX A;  3O5K A;  4TW7 A;  2DT0 A;  4MNM A;  1JVW A;  1T11 A;  1NWT A;  1HKM A;  1L1P A;  4O2T A;  2MLX A;  4IQC A;  4KQZ A;  3B9D A;  2O92 A;  4ZPW R;  2B31 A;  2F21 A;  3ARX A;  3IK8 A;  1HKI A;  1JNT A;  4P8X A;  4Z2K A;  2XPB A;  3VAW A;  3LUO A;  2A3E A;  1TCO C;  4JFK A;  5GPG A;  3B9E A;  2PV3 A;  1E15 A;  4DWS B;  1QZ2 A;  4ITZ A;  2L2S A;  2RUR A;  3B8S A;  5HBF A;  1KT1 A;  2ESC A;  3I6C A;  2KO7 A;  4S3J A;  1H0I A;  1ZU8 A;  4MNJ A;  1NSG A;  3WL1 A;  4ZS6 A;  3AS2 A;  1E6Z A;  3NTP A;  1HXV A;  1FKL A;  1FKK A;  2ZR4 A;  4JFJ A;  1FAP A;  3BXW A;  4G2P A;  1ZL1 A;  3CHC A;  4QT2 A;  4MTV A;  2DT1 A;  1BKF A;  2XP6 A;  2M2A A;  2AOS A;  1ROT A;  4L3N A;  3O5O A;  1W9P A;  4ZPT R;  5DIU A;  1K9T A;  1OGB A;  4Z2I A;  2Q5A A;  1HKK A;  4ZPV R;  4JFI A;  1D7J A;  2DSV A;  3O5D A;  1A7X A;  5HKG A;  3JXV A;  2PPO A;  2IUZ A;  3UQI A;  3NRK A;  2OFN A;  2PPP A;  1D6O A;  1J6Y A;  4LGX A;  3TC5 A;  2ITK A;  5HUA A;  1N1A A;  2F2D A;  2MLZ A;  2PI6 A;  3OOB A;  4URI A;  4DRP A;  4JFL A;  2KR7 A;  1FKR A;  2WM0 A;  1BL4 A;  4TYO A;  1KT0 A;  3PRA A;  1Q6U A;  2ZQV A;  4LAX A;  1YAT A;  3UI5 A;  1UR9 A;  1LL6 A;  2OLH A;  2UZ5 A;  2A3A A;  3ARV A;  4WKF A;  4U84 A;  3CHD A;  4TNS A;  2PV1 A;  5DO2 A;  3IKD A;  4JFM A;  3ARQ A;  1FKG A;  5GPR A;  3O5R A;  2RSE A;  1JNS A;  1ROU A;  5DIT A;  1J4H A;  2M08 A;  4U86 A;  1ZBV A;  2KFW A;  1YW5 A;  3WD1 A;  1U79 A;  2RUD A;  2ZR6 A;  3WD3 A;  1F40 A;  3O5E A;  1ZBC A;  2N87 A;  1XRV A;  1UR8 A;  2QF8 A;  3ARS A;  3WL0 A;  3UQA A;  2IF4 A;  1D7H A;  1Q6I A;  2MLY A;  4FN2 A;  3CZ8 A;  1ZK6 A;  2PPN A;  4Z2L A;  1FJD A;  4MNK A;  5I98 A;  1E6P A;  2MNT A;  4TX0 A;  2DPE A;  1ZBK A;  1ZBW A;  1CTN A;  3AS0 A;  1J4R A;  1Y0O A;  1W9U A;  3WKZ A;  1ITX A;  5HWC A;  5JH8 A;  1FKS A;  1W1T A;  3CGN A;  1HJW A;  3TCZ A;  1OGG A;  1FKT A;  4Z2G A;  3QOK A;  4ODL A;  4DWS C;  2XP5 A;  1NMW A;  3JYJ A;  2XP3 A;  3B9A A;  3ARP A;  1GUV A;  1FFQ A;  2PV2 A;  3JYM A;  2DG9 A;  1O6I A;  4Q7N A;  3H9R B;  2LKN A;  4ODR A;  3RM4 A;  1FKD A;  2VCD A;  1F8A B;  2FDM A;  1FKJ A;  4ODQ A;  4L72 B;  1FKH A;  1LJY A;  1GOI A;  4ODN A;  3WD4 A;  4DWS D;  3O5F A;  4N19 A;  3UI4 A;  1FD9 A;  2KGJ A;  3O5Q A;  4MSP A;  4KR0 B;  4C02 B;  2DSU A;  4P8W A;  1HKJ A;  3UI6 A;  1ZB5 A;  4NSB A;  2WLZ A;  4ODP A;  5HW8 A;  4IT4 A;  4W9P A;  3WH0 A;  3KAD A;  3FXY A;  4Z2J A;  3O5I A;  1FKB A;  1LG2 A;  4ODK A;  4HBO A;  1M5Y A;  3KAH A;  4ML4 A;  3NI6 A;  1E9L A;  2YBU A;  1LQ0 A;  1W1V A;  3TDB A;  1C9H A;  1QPF A;  4DRM A;  4NZC A;  2DSZ A;  3B7X A;  3O5G A;  4GGQ A;  2LGO A;  1B6C A;  3ARY A;  1KFW A;  1WB0 A;  3O5P A;  2DSW A;  1NWS A;  4DRK A;  4WKH A;  3WD2 A;  4LAW A;  3PRB A;  4IQ2 A;  5J6E A;  4ODM A;  3AS3 A;  5HW6 A;  3ARO A;  2KI3 A;  2A3B A;  1NWR A;  5DEZ A;  3G6M A;  1W26 A;  1JNE A;  3CH9 A;  4HBE A;  4WKA A;  5HWB A;  2WLY A;  4P8U A;  4W9Q A;  4DRH A;  1SYT A;  3KAF A;  4J4N A;  2XP7 A;  4MNL A;  3ARR A;  3KAC A;  3KCE A;  3UQB A;  3IKG A;  1X6N A;  5B8I C;  2DT2 A;  1FKI A;  2LJ4 A;  1EQ3 A;  3ARW A;  1HJV A;  2MPH A;  2PBC A;  4WJX A;  3RM8 A;  3G6L A;  3ARZ A;  3CGM A;  3O5M A;  1JND A;  2ZR5 A;  1LL7 A;  1Q6H A;  2DG4 A;  1OWQ A;  4PTM A;  3W4R A;  4U85 A;  2FKE A;  4FAP A;  1NMV A;  5BXJ A;  4W5U A;  3WD0 A;  4DRO A;  4DH0 A;  2RUC A;  2XP8 A;  5D75 A;  2YBT A;  3GPK A;  4BF8 A;  2XP9 A;  4QT3 A;  1FKF A;  2JZV A;  4MAV A;  2A3C A;  1NWU A;  3ARU A;  4Z2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...