3O5KA

Fk1 domain of fkbp51, crystal form viii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
127
structure length
127
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5kA00
2LKNA 2DG9A 4FAPA 2RURA 1FKLA 1FAPA 1QPLA 5HW8A 4TW8A 4JYSA 2LPVA 3UQBA 1Q1CA 2UZ5A 1P5QA 2D9FA 4J4OA 1FKDA 4ITZA 1EYMA 1BL4A 3LUOA 3O5KA 4FN2A 4DRHA 2RUQA 2VCDA 4N19A 2IF4A 1FKGA 3O5MA 3UI5A 2KR7A 2MF9A 2M08A 4NNRA 1B6CA 1Q6IA 1FD9A 3EY6A 3H9RB 3O5IA 4MGVA 4ODQA 2FAPA 1FKJA 2RSEA 3FAPA 4W9OA 1QPFA 3KZ7A 5GPGA 5HUAA 2K8IA 2MLZA 3KAGA 2MLXA 4QT3A 4DROA 4DRKA 1JNTA 2MNTA 4DH0A 4U85A 4QIBA 3UI4A 3O5LA 2ITKA 2F4EA 1FKFA 3PRBA 3UQIA 4JFKA 2ZQVA 4DRPA 3RFWA 5HKGA 1Y0OA 4JFLA 4ODLA 3PRDA 4R0XA 1EQ3A 2M1IA 3RGCA 2FKEA 3I6CA 1FKRA 2F21A 2F2DA 4DRIA 2ZQSA 4JFIA 1ZCNA 5D75A 1F8AB 3KABA 5BXJA 1L1PA 3KAFA 2KO7A 4G50A 2XP5A 5DIVA 1FKHA 4MSPA 2ZQTA 4U86A 2PPPA 1D7IA 2XP4A 3IKDA 1Q6HA 2RUDA 3JXVA 4G2PA 5DITA 4ODRA 3VAWA 2PV3A 3O5JA 3O5OA 4DT4A 1ZK6A 1NMVA 1NMWA 1M5YA 2JZVA 2ZR6A 2Q5AA 3IKGA 3KAHA 3TC5A 4W9QA 4BF8A 3GPKA 4LAWA 1FJDA 4GIVA 4O2TA 1NSGA 4ODMA 2MPHA 5HWBA 1YW5A 1TCOC 1W26A 1D7JA 4TX0A 3TDBA 4JFJA 2VN1A 3MDYB 3TCZA 2KGJA 2PPOA 2XPAA 2XP6A 3OOBA 2ZR4A 4LAYA 5B8IC 3NRKA 4IPXA 3JYMA 2OFNA 3IHZA 5HT1A 2PV2A 4IQ2A 1D6OA 2LGOA 1KT0A 2PPNA 3CGMA 4U84A 2RQSA 1HXVA 3JYJA 4LAXA 5HW6A 3O5PA 3UF8A 4DRJA 3PA7A 5J6EA 3KAIA 3UI6A 1T11A 5HTGA 2KI3A 3KCEA 2PV1A 5DIUA 3NTPA 1QZ2A 3O5DA 3ODKA 1KT1A 1R9HA 3B7XA 1YATA 4ODPA 2MLYA 4LAVA 1F40A 4W9PA 3KACA 4DRNA 1A7XA 3IK8A 1U79A 4TYOA 1J6YA 1J4RA 2L2SA 1PINA 3WH0A 4C02B 2XP3A 3UQAA 1FKKA 1ROUA 2DG3A 4IQCA 1J4HA 1FKBA 2ZQUA 2KFWA 1JVWA 5HWCA 1FKSA 1N1AA 2Y78A 1FKTA 2KE0A 2N87A 3O5RA 2XP9A 3O5GA 1BKFA 3CGNA 4J4NA 2AWGA 4TW6A 2DG4A 4ODKA 4DRQA 2PBCA 4QT2A 4DZ2A 1ROTA 2XP8A 4ODOA 4TNSA 3O5FA 4DZ3A 2M2AA 5I98A 4ODNA 2ZR5A 3O5EA 1FKIA 3KADA 1JNSA 2RUCA 3O5QA 1C9HA 1Q6UA 2LJ4A 1J4IA 3NI6A 5HW7A 4JFMA 4DRMA 1D7HA 1PBKA 2XP7A 2XPBA 4DIPA 4GGQA 4TW7A
chains in the Genus database with same CATH superfamily
3CHCA 1FKLA 2UZ5A 1E6ZA 2RUQA 2IF4A 1FKGA 3UI5A 2ETNA 2MF9A 1JNEA 1NWUA 2FAPA 3FAPA 4Z2HA 1E44A 4DRKA 1JNTA 3BMBA 4U85A 4W5UA 4QIBA 3WIJA 3O5LA 3ALGA 4JFKA 1JCHB 1Y0OA 4ODLA 4R0XA 2F21A 4DRIA 1ZCNA 1TFVA 2PI6A 1VF8A 4G50A 1FFRA 2ZQTA 3AROA 4U86A 2WLZA 2XP4A 4LGXA 4ML4A 3O5JA 1ZK6A 3GPKA 4Z2IA 4GIVA 4DWSC 5HWBA 4KR0B 1W26A 4IT4A 3TDBA 1E15A 1ZBVA 2WK2A 1ZBKA 3ARWA 3AQUA 3CZ8A 3OOBA 2XPAA 3CH9A 1LJYA 3WL1A 4IQ2A 2OLHA 2DSWA 2LGOA 3CGMA 3B8SA 4LAXA 1W1VA 3PA7A 3UI6A 3AS2A 2F23A 2G41A 4Z2KA 1R9HA 4P8XA 4LAVA 1NWRA 3KACA 1A7XA 3EIPA 2L2SA 3WH0A 2XP3A 3ARTA 1FKKA 1ROUA 2DG3A 1J4HA 1FKBA 2ZQUA 4MAVA 1N1AA 2Y78A 4NZCA 1BKFA 3CGNA 2DPEA 2DG4A 4ODKA 4ODOA 1ZB5A 3O5FA 1K9TA 1SYTA 2ZR5A 1FKIA 3KADA 1JNSA 2RUCA 1Q6UA 3NI6A 1J4IA 1D7HA 4DIPA 2XP7A 4UDMA 4Z2GA 3RM8A 2WLYA 1QPLA 2DT0A 4MNLA 3UQBA 1FFQA 2D9FA 4J4OA 1FKDA 4ITZA 1EYMA 1GUVA 3WL0A 3OA5A 2VCDA 4N19A 1OGBA 2M08A 3ARXA 3H9RB 1OWQA 1FKJA 5GPGA 4DWSB 5HUAA 2K8IA 2MLXA 2WM0A 4IT6A 4DROA 4HBOA 4DH0A 1OGGA 3PRBA 1X6LA 3WQWA 3UQIA 4DRPA 3RFWA 4JFLA 1EQ3A 3RGCA 4ZS6A 2EULA 5D75A 3KABA 5BXJA 3KAFA 3AS3A 2RUDA 4P8WA 1W1YA 3W4RA 4DT4A 3O5OA 1NMVA 1ITXA 1NMWA 2JZVA 1W9VA 2A3BA 2G8ZA 1HKKA 3TC5A 1FJDA 1NSGA 4WK9A 3CHFA 1E9LA 1D7JA 1HKIA 2A3CA 3TCZA 5GQBA 2PPOA 4LAYA 5GPRA 5B8IC 4WKFA 4ZPVR 1D6OA 3O5PA 3G6LA 3KAIA 1HKMA 5HTGA 5DO2A 3O5DA 1W9PA 1HJXA 3GTYX 1W1PA 3FXYA 4ODPA 3ARUA 1ZBCA 3ALFA 4C02B 5JH8A 2DSZA 3UQAA 4IQCA 4DWSD 5HWCA 1KFWA 2KE0A 4Q22A 2XP9A 2AWGA 4DRQA 4DZ2A 2M2AA 4ODNA 3ARQA 3AS1A 3O5QA 2LJ4A 4TW8A 3QOKA 1Q1CA 2IUZA 1P5QA 1BL4A 4FN2A 3O5MA 2KR7A 4NNRA 1B6CA 4PTMA 3EY6A 2RSEA 1QPFA 3KZ7A 1ZBWA 2MLZA 2PN0A 5HBFA 4DWSA 1XHGA 3B9EA 2MNTA 1FKFA 3ARVA 2ZQVA 1W9UA 4WKAA 1HXVA 1FKRA 2M1IA 2P4VA 1ZL1A 2F2DA 1F8AB 2KO7A 2XP5A 5DEZA 1FKHA 1JNDA 2PPPA 3AS0A 1D7IA 4G2PA 2YBUA 3IKDA 3JXVA 3PRAA 4HARA 3WQVA 4ODRA 2PV3A 1E6NA 4MTVA 4Z2JA 1LL6A 1X6NA 3IKGA 3KAHA 4W9QA 1RD6A 4ODMA 2MPHA 1SR0A 4JFJA 3MDYB 3B9AA 4WJXA 2YBTA 2KGJA 3GU0A 3ARZA 2ZR4A 3NRKA 4IPXA 4AY1A 3JYMA 2OFNA 2PV2A 3JYJA 1ZU8A 5HW6A 2FDMA 1D2KA 4P8VA 5J6EA 3ARSA 3B9DA 3WD0A 1WAWA 1QZ2A 2AOSA 4P8UA 1KT1A 4URIA 3FY1A 3B7XA 1YATA 2MLYA 1F40A 1UR8A 4S3JA 4DRNA 4R5EA 3IK8A 2DT2A 1IX5A 1U79A 4TYOA 4Q7NA 1J4RA 1J6YA 1PINA 3CHDA 1NWTA 2KFWA 1JVWA 1WNOA 1FKSA 1WB0A 2B5UB 4J4NA 3O5RA 4TW6A 1LQ0A 2PBCA 4KQZA 4QT2A 2XP8A 4QZVB 5I98A 3CHEA 1C9HA 5HW7A 4JFMA 4DRMA 1PBKA 2XPBA 4TW7A 2LKNA 2DG9A 4FAPA 2RURA 1FAPA 5HW8A 1LG1A 2O9OA 2LPVA 4JYSA 4S3KA 4ZPWR 4MPKA 2B31A 3LUOA 3O5KA 2A3AA 4DRHA 1E6RA 1UR9A 2ESCA 3WD3A 3G6MA 1Q6IA 2A3EA 1FD9A 3O5IA 4MGVA 4ODQA 3ARYA 4W9OA 3KAGA 4QT3A 4ZPTR 4NSBA 1LL4A 2DT3A 3RMEA 3UI4A 2ITKA 2F4EA 1CTNA 1EDQA 5HKGA 3PRDA 1LG2A 2FKEA 3I6CA 2ZQSA 4JFIA 4WKHA 1L1PA 5DIVA 4WIWA 4MSPA 1NWSA 1GOIA 1Q6HA 3RM4A 4MNKA 5DITA 3VAWA 1M5YA 1EHNA 2QF8A 2Q5AA 2ZR6A 3PR9A 4XAKA 1XRVA 4BF8A 4LAWA 4HBEA 4O2TA 1YW5A 1TCOC 4TX0A 3WD2A 1E6PA 3WD1A 2VN1A 1H0GA 1NH6A 2XP6A 2O92A 3ARRA 3IHZA 5HT1A 1HJVA 3BXWA 2DT1A 1KT0A 1HKJA 2PPNA 4U84A 2RQSA 3WD4A 1HJWA 3UF8A 4DRJA 3RM9A 1T11A 2KI3A 3KCEA 2PV1A 5DF0A 3NTPA 1H0IA 2DSVA 4L72B 3ODKA 1LL7A 2DSUA 4W9PA 1GPFA 1O6IA 3ARPA 3WKZA 4MNMA 1W1TA 1FKTA 4L3NA 2N87A 4Z2LA 3O5GA 4MNJA 1ROTA 4DZ3A 1EIBA 4TNSA 3O5EA 1GRJA 4GGQA 5DIUA
chains in the Genus database with same CATH topology
3CHCA 1FKLA 2UZ5A 1E6ZA 2RUQA 2IF4A 1FKGA 3UI5A 2MF9A 1JNEA 1NWUA 2FAPA 3FAPA 4Z2HA 4DRKA 1JNTA 4U85A 4W5UA 4QIBA 3WIJA 3O5LA 3ALGA 4JFKA 1Y0OA 4ODLA 4R0XA 2F21A 4DRIA 1ZCNA 1TFVA 2PI6A 1VF8A 4G50A 1FFRA 2ZQTA 3AROA 4U86A 2WLZA 2XP4A 4LGXA 4ML4A 3O5JA 1ZK6A 3GPKA 4Z2IA 4GIVA 4DWSC 5HWBA 4KR0B 1W26A 4IT4A 3TDBA 1E15A 1ZBVA 2WK2A 1ZBKA 3ARWA 3AQUA 3CZ8A 3OOBA 2XPAA 3CH9A 1LJYA 3WL1A 4IQ2A 2OLHA 2DSWA 2LGOA 3CGMA 3B8SA 4LAXA 1W1VA 3PA7A 3UI6A 3AS2A 2G41A 4Z2KA 1R9HA 4P8XA 4LAVA 1NWRA 3KACA 1A7XA 2L2SA 3WH0A 2XP3A 3ARTA 1FKKA 1ROUA 2DG3A 1J4HA 1FKBA 2ZQUA 4MAVA 1N1AA 2Y78A 4NZCA 1BKFA 3CGNA 2DPEA 2DG4A 4ODKA 4ODOA 1ZB5A 3O5FA 1K9TA 1SYTA 2ZR5A 1FKIA 3KADA 1JNSA 2RUCA 1Q6UA 3NI6A 1J4IA 1D7HA 4DIPA 2XP7A 4Z2GA 3RM8A 2WLYA 1QPLA 2DT0A 4MNLA 3UQBA 1FFQA 2D9FA 4J4OA 1FKDA 4ITZA 1EYMA 1GUVA 3WL0A 3OA5A 2VCDA 4N19A 1OGBA 2M08A 3ARXA 3H9RB 1OWQA 1FKJA 5GPGA 4DWSB 5HUAA 2K8IA 2MLXA 2WM0A 4IT6A 4DROA 4HBOA 4DH0A 1OGGA 3PRBA 1X6LA 3WQWA 3UQIA 4DRPA 3RFWA 4JFLA 1EQ3A 3RGCA 4ZS6A 5D75A 3KABA 5BXJA 3KAFA 3AS3A 2RUDA 4P8WA 1W1YA 3W4RA 4DT4A 3O5OA 1NMVA 1ITXA 1NMWA 2JZVA 1W9VA 2A3BA 2G8ZA 1HKKA 3TC5A 1FJDA 1NSGA 4WK9A 3CHFA 1E9LA 1D7JA 1HKIA 2A3CA 3TCZA 5GQBA 2PPOA 4LAYA 5GPRA 5B8IC 4WKFA 4ZPVR 1D6OA 3O5PA 3G6LA 3KAIA 1HKMA 5HTGA 5DO2A 3O5DA 1W9PA 1HJXA 1W1PA 3FXYA 4ODPA 3ARUA 1ZBCA 3ALFA 4C02B 5JH8A 2DSZA 3UQAA 4IQCA 4DWSD 5HWCA 1KFWA 2KE0A 4Q22A 2XP9A 2AWGA 4DRQA 4DZ2A 2M2AA 4ODNA 3ARQA 3AS1A 3O5QA 2LJ4A 4TW8A 3QOKA 1Q1CA 2IUZA 1P5QA 1BL4A 4FN2A 3O5MA 2KR7A 4NNRA 1B6CA 4PTMA 3EY6A 2RSEA 1QPFA 3KZ7A 1ZBWA 2MLZA 5HBFA 4DWSA 1XHGA 3B9EA 2MNTA 1FKFA 3ARVA 2ZQVA 1W9UA 4WKAA 1HXVA 1FKRA 2M1IA 1ZL1A 2F2DA 1F8AB 2KO7A 2XP5A 5DEZA 1FKHA 1JNDA 2PPPA 3AS0A 1D7IA 4G2PA 2YBUA 3IKDA 3JXVA 3PRAA 4HARA 3WQVA 4ODRA 2PV3A 1E6NA 4MTVA 4Z2JA 1LL6A 1X6NA 3IKGA 3KAHA 4W9QA 1RD6A 4ODMA 2MPHA 1SR0A 4JFJA 3MDYB 3B9AA 4WJXA 2YBTA 2KGJA 3ARZA 2ZR4A 3NRKA 4IPXA 4AY1A 3JYMA 2OFNA 2PV2A 3JYJA 1ZU8A 5HW6A 2FDMA 1D2KA 4P8VA 5J6EA 3ARSA 3B9DA 3WD0A 1WAWA 1QZ2A 2AOSA 4P8UA 1KT1A 4URIA 3FY1A 3B7XA 1YATA 2MLYA 1F40A 1UR8A 4S3JA 4DRNA 4R5EA 3IK8A 2DT2A 1IX5A 1U79A 4TYOA 4Q7NA 1J4RA 1J6YA 1PINA 3CHDA 1NWTA 2KFWA 1JVWA 1WNOA 1FKSA 1WB0A 4J4NA 3O5RA 4TW6A 1LQ0A 2PBCA 4KQZA 4QT2A 2XP8A 4QZVB 5I98A 3CHEA 1C9HA 5HW7A 4JFMA 4DRMA 1PBKA 2XPBA 4TW7A 2LKNA 2DG9A 4FAPA 2RURA 1FAPA 5HW8A 1LG1A 2O9OA 2LPVA 4JYSA 4S3KA 4ZPWR 4MPKA 2B31A 3LUOA 3O5KA 2A3AA 4DRHA 1E6RA 1UR9A 2ESCA 3WD3A 3G6MA 1Q6IA 2A3EA 1FD9A 3O5IA 4MGVA 4ODQA 3ARYA 4W9OA 3KAGA 4QT3A 4ZPTR 4NSBA 1LL4A 2DT3A 3RMEA 3UI4A 2ITKA 2F4EA 1CTNA 1EDQA 5HKGA 3PRDA 1LG2A 2FKEA 3I6CA 2ZQSA 4JFIA 4WKHA 1L1PA 5DIVA 4WIWA 4MSPA 1NWSA 1GOIA 1Q6HA 3RM4A 4MNKA 5DITA 3VAWA 1M5YA 1EHNA 2QF8A 2Q5AA 2ZR6A 3PR9A 4XAKA 1XRVA 4BF8A 4LAWA 4HBEA 4O2TA 1YW5A 1TCOC 4TX0A 3WD2A 1E6PA 3WD1A 2VN1A 1H0GA 1NH6A 2XP6A 2O92A 3ARRA 3IHZA 5HT1A 1HJVA 3BXWA 2DT1A 1KT0A 1HKJA 2PPNA 4U84A 2RQSA 3WD4A 1HJWA 3UF8A 4DRJA 3RM9A 1T11A 2KI3A 3KCEA 2PV1A 5DF0A 3NTPA 1H0IA 2DSVA 4L72B 3ODKA 1LL7A 2DSUA 4W9PA 1GPFA 1O6IA 3ARPA 3WKZA 4MNMA 1W1TA 1FKTA 4L3NA 2N87A 4Z2LA 3O5GA 4MNJA 1ROTA 4DZ3A 1EIBA 4TNSA 3O5EA 4GGQA 5DIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKN A;  2DG9 A;  4FAP A;  2RUR A;  1FKL A;  1FAP A;  1QPL A;  5HW8 A;  4TW8 A;  4JYS A;  2LPV A;  3UQB A;  1Q1C A;  2UZ5 A;  1P5Q A;  2D9F A;  4J4O A;  1FKD A;  4ITZ A;  1EYM A;  1BL4 A;  3LUO A;  3O5K A;  4FN2 A;  4DRH A;  2RUQ A;  2VCD A;  4N19 A;  2IF4 A;  1FKG A;  3O5M A;  3UI5 A;  2KR7 A;  2MF9 A;  2M08 A;  4NNR A;  1B6C A;  1Q6I A;  1FD9 A;  3EY6 A;  3H9R B;  3O5I A;  4MGV A;  4ODQ A;  2FAP A;  1FKJ A;  2RSE A;  3FAP A;  4W9O A;  1QPF A;  3KZ7 A;  5GPG A;  5HUA A;  2K8I A;  2MLZ A;  3KAG A;  2MLX A;  4QT3 A;  4DRO A;  4DRK A;  1JNT A;  2MNT A;  4DH0 A;  4U85 A;  4QIB A;  3UI4 A;  3O5L A;  2ITK A;  2F4E A;  1FKF A;  3PRB A;  3UQI A;  4JFK A;  2ZQV A;  4DRP A;  3RFW A;  5HKG A;  1Y0O A;  4JFL A;  4ODL A;  3PRD A;  4R0X A;  1EQ3 A;  2M1I A;  3RGC A;  2FKE A;  3I6C A;  1FKR A;  2F21 A;  2F2D A;  4DRI A;  2ZQS A;  4JFI A;  1ZCN A;  5D75 A;  1F8A B;  3KAB A;  5BXJ A;  1L1P A;  3KAF A;  2KO7 A;  4G50 A;  2XP5 A;  5DIV A;  1FKH A;  4MSP A;  2ZQT A;  4U86 A;  2PPP A;  1D7I A;  2XP4 A;  3IKD A;  1Q6H A;  2RUD A;  3JXV A;  4G2P A;  5DIT A;  4ODR A;  3VAW A;  2PV3 A;  3O5J A;  3O5O A;  4DT4 A;  1ZK6 A;  1NMV A;  1NMW A;  1M5Y A;  2JZV A;  2ZR6 A;  2Q5A A;  3IKG A;  3KAH A;  3TC5 A;  4W9Q A;  4BF8 A;  3GPK A;  4LAW A;  1FJD A;  4GIV A;  4O2T A;  1NSG A;  4ODM A;  2MPH A;  5HWB A;  1YW5 A;  1TCO C;  1W26 A;  1D7J A;  4TX0 A;  3TDB A;  4JFJ A;  2VN1 A;  3MDY B;  3TCZ A;  2KGJ A;  2PPO A;  2XPA A;  2XP6 A;  3OOB A;  2ZR4 A;  4LAY A;  5B8I C;  3NRK A;  4IPX A;  3JYM A;  2OFN A;  3IHZ A;  5HT1 A;  2PV2 A;  4IQ2 A;  1D6O A;  2LGO A;  1KT0 A;  2PPN A;  3CGM A;  4U84 A;  2RQS A;  1HXV A;  3JYJ A;  4LAX A;  5HW6 A;  3O5P A;  3UF8 A;  4DRJ A;  3PA7 A;  5J6E A;  3KAI A;  3UI6 A;  1T11 A;  5HTG A;  2KI3 A;  3KCE A;  2PV1 A;  5DIU A;  3NTP A;  1QZ2 A;  3O5D A;  3ODK A;  1KT1 A;  1R9H A;  3B7X A;  1YAT A;  4ODP A;  2MLY A;  4LAV A;  1F40 A;  4W9P A;  3KAC A;  4DRN A;  1A7X A;  3IK8 A;  1U79 A;  4TYO A;  1J6Y A;  1J4R A;  2L2S A;  1PIN A;  3WH0 A;  4C02 B;  2XP3 A;  3UQA A;  1FKK A;  1ROU A;  2DG3 A;  4IQC A;  1J4H A;  1FKB A;  2ZQU A;  2KFW A;  1JVW A;  5HWC A;  1FKS A;  1N1A A;  2Y78 A;  1FKT A;  2KE0 A;  2N87 A;  3O5R A;  2XP9 A;  3O5G A;  1BKF A;  3CGN A;  4J4N A;  2AWG A;  4TW6 A;  2DG4 A;  4ODK A;  4DRQ A;  2PBC A;  4QT2 A;  4DZ2 A;  1ROT A;  2XP8 A;  4ODO A;  4TNS A;  3O5F A;  4DZ3 A;  2M2A A;  5I98 A;  4ODN A;  2ZR5 A;  3O5E A;  1FKI A;  3KAD A;  1JNS A;  2RUC A;  3O5Q A;  1C9H A;  1Q6U A;  2LJ4 A;  1J4I A;  3NI6 A;  5HW7 A;  4JFM A;  4DRM A;  1D7H A;  1PBK A;  2XP7 A;  2XPB A;  4DIP A;  4GGQ A;  4TW7 A; 
#chains in the Genus database with same CATH topology
 3CHC A;  1FKL A;  2UZ5 A;  1E6Z A;  2RUQ A;  2IF4 A;  1FKG A;  3UI5 A;  2ETN A;  2MF9 A;  1JNE A;  1NWU A;  2FAP A;  3FAP A;  4Z2H A;  1E44 A;  4DRK A;  1JNT A;  3BMB A;  4U85 A;  4W5U A;  4QIB A;  3WIJ A;  3O5L A;  3ALG A;  4JFK A;  1JCH B;  1Y0O A;  4ODL A;  4R0X A;  2F21 A;  4DRI A;  1ZCN A;  1TFV A;  2PI6 A;  1VF8 A;  4G50 A;  1FFR A;  2ZQT A;  3ARO A;  4U86 A;  2WLZ A;  2XP4 A;  4LGX A;  4ML4 A;  3O5J A;  1ZK6 A;  3GPK A;  4Z2I A;  4GIV A;  4DWS C;  5HWB A;  4KR0 B;  1W26 A;  4IT4 A;  3TDB A;  1E15 A;  1ZBV A;  2WK2 A;  1ZBK A;  3ARW A;  3AQU A;  3CZ8 A;  3OOB A;  2XPA A;  3CH9 A;  1LJY A;  3WL1 A;  4IQ2 A;  2OLH A;  2DSW A;  2LGO A;  3CGM A;  3B8S A;  4LAX A;  1W1V A;  3PA7 A;  3UI6 A;  3AS2 A;  2F23 A;  2G41 A;  4Z2K A;  1R9H A;  4P8X A;  4LAV A;  1NWR A;  3KAC A;  1A7X A;  3EIP A;  2L2S A;  3WH0 A;  2XP3 A;  3ART A;  1FKK A;  1ROU A;  2DG3 A;  1J4H A;  1FKB A;  2ZQU A;  4MAV A;  1N1A A;  2Y78 A;  4NZC A;  1BKF A;  3CGN A;  2DPE A;  2DG4 A;  4ODK A;  4ODO A;  1ZB5 A;  3O5F A;  1K9T A;  1SYT A;  2ZR5 A;  1FKI A;  3KAD A;  1JNS A;  2RUC A;  1Q6U A;  3NI6 A;  1J4I A;  1D7H A;  4DIP A;  2XP7 A;  4UDM A;  4Z2G A;  3RM8 A;  2WLY A;  1QPL A;  2DT0 A;  4MNL A;  3UQB A;  1FFQ A;  2D9F A;  4J4O A;  1FKD A;  4ITZ A;  1EYM A;  1GUV A;  3WL0 A;  3OA5 A;  2VCD A;  4N19 A;  1OGB A;  2M08 A;  3ARX A;  3H9R B;  1OWQ A;  1FKJ A;  5GPG A;  4DWS B;  5HUA A;  2K8I A;  2MLX A;  2WM0 A;  4IT6 A;  4DRO A;  4HBO A;  4DH0 A;  1OGG A;  3PRB A;  1X6L A;  3WQW A;  3UQI A;  4DRP A;  3RFW A;  4JFL A;  1EQ3 A;  3RGC A;  4ZS6 A;  2EUL A;  5D75 A;  3KAB A;  5BXJ A;  3KAF A;  3AS3 A;  2RUD A;  4P8W A;  1W1Y A;  3W4R A;  4DT4 A;  3O5O A;  1NMV A;  1ITX A;  1NMW A;  2JZV A;  1W9V A;  2A3B A;  2G8Z A;  1HKK A;  3TC5 A;  1FJD A;  1NSG A;  4WK9 A;  3CHF A;  1E9L A;  1D7J A;  1HKI A;  2A3C A;  3TCZ A;  5GQB A;  2PPO A;  4LAY A;  5GPR A;  5B8I C;  4WKF A;  4ZPV R;  1D6O A;  3O5P A;  3G6L A;  3KAI A;  1HKM A;  5HTG A;  5DO2 A;  3O5D A;  1W9P A;  1HJX A;  3GTY X;  1W1P A;  3FXY A;  4ODP A;  3ARU A;  1ZBC A;  3ALF A;  4C02 B;  5JH8 A;  2DSZ A;  3UQA A;  4IQC A;  4DWS D;  5HWC A;  1KFW A;  2KE0 A;  4Q22 A;  2XP9 A;  2AWG A;  4DRQ A;  4DZ2 A;  2M2A A;  4ODN A;  3ARQ A;  3AS1 A;  3O5Q A;  2LJ4 A;  4TW8 A;  3QOK A;  1Q1C A;  2IUZ A;  1P5Q A;  1BL4 A;  4FN2 A;  3O5M A;  2KR7 A;  4NNR A;  1B6C A;  4PTM A;  3EY6 A;  2RSE A;  1QPF A;  3KZ7 A;  1ZBW A;  2MLZ A;  2PN0 A;  5HBF A;  4DWS A;  1XHG A;  3B9E A;  2MNT A;  1FKF A;  3ARV A;  2ZQV A;  1W9U A;  4WKA A;  1HXV A;  1FKR A;  2M1I A;  2P4V A;  1ZL1 A;  2F2D A;  1F8A B;  2KO7 A;  2XP5 A;  5DEZ A;  1FKH A;  1JND A;  2PPP A;  3AS0 A;  1D7I A;  4G2P A;  2YBU A;  3IKD A;  3JXV A;  3PRA A;  4HAR A;  3WQV A;  4ODR A;  2PV3 A;  1E6N A;  4MTV A;  4Z2J A;  1LL6 A;  1X6N A;  3IKG A;  3KAH A;  4W9Q A;  1RD6 A;  4ODM A;  2MPH A;  1SR0 A;  4JFJ A;  3MDY B;  3B9A A;  4WJX A;  2YBT A;  2KGJ A;  3GU0 A;  3ARZ A;  2ZR4 A;  3NRK A;  4IPX A;  4AY1 A;  3JYM A;  2OFN A;  2PV2 A;  3JYJ A;  1ZU8 A;  5HW6 A;  2FDM A;  1D2K A;  4P8V A;  5J6E A;  3ARS A;  3B9D A;  3WD0 A;  1WAW A;  1QZ2 A;  2AOS A;  4P8U A;  1KT1 A;  4URI A;  3FY1 A;  3B7X A;  1YAT A;  2MLY A;  1F40 A;  1UR8 A;  4S3J A;  4DRN A;  4R5E A;  3IK8 A;  2DT2 A;  1IX5 A;  1U79 A;  4TYO A;  4Q7N A;  1J4R A;  1J6Y A;  1PIN A;  3CHD A;  1NWT A;  2KFW A;  1JVW A;  1WNO A;  1FKS A;  1WB0 A;  2B5U B;  4J4N A;  3O5R A;  4TW6 A;  1LQ0 A;  2PBC A;  4KQZ A;  4QT2 A;  2XP8 A;  4QZV B;  5I98 A;  3CHE A;  1C9H A;  5HW7 A;  4JFM A;  4DRM A;  1PBK A;  2XPB A;  4TW7 A;  2LKN A;  2DG9 A;  4FAP A;  2RUR A;  1FAP A;  5HW8 A;  1LG1 A;  2O9O A;  2LPV A;  4JYS A;  4S3K A;  4ZPW R;  4MPK A;  2B31 A;  3LUO A;  3O5K A;  2A3A A;  4DRH A;  1E6R A;  1UR9 A;  2ESC A;  3WD3 A;  3G6M A;  1Q6I A;  2A3E A;  1FD9 A;  3O5I A;  4MGV A;  4ODQ A;  3ARY A;  4W9O A;  3KAG A;  4QT3 A;  4ZPT R;  4NSB A;  1LL4 A;  2DT3 A;  3RME A;  3UI4 A;  2ITK A;  2F4E A;  1CTN A;  1EDQ A;  5HKG A;  3PRD A;  1LG2 A;  2FKE A;  3I6C A;  2ZQS A;  4JFI A;  4WKH A;  1L1P A;  5DIV A;  4WIW A;  4MSP A;  1NWS A;  1GOI A;  1Q6H A;  3RM4 A;  4MNK A;  5DIT A;  3VAW A;  1M5Y A;  1EHN A;  2QF8 A;  2Q5A A;  2ZR6 A;  3PR9 A;  4XAK A;  1XRV A;  4BF8 A;  4LAW A;  4HBE A;  4O2T A;  1YW5 A;  1TCO C;  4TX0 A;  3WD2 A;  1E6P A;  3WD1 A;  2VN1 A;  1H0G A;  1NH6 A;  2XP6 A;  2O92 A;  3ARR A;  3IHZ A;  5HT1 A;  1HJV A;  3BXW A;  2DT1 A;  1KT0 A;  1HKJ A;  2PPN A;  4U84 A;  2RQS A;  3WD4 A;  1HJW A;  3UF8 A;  4DRJ A;  3RM9 A;  1T11 A;  2KI3 A;  3KCE A;  2PV1 A;  5DF0 A;  3NTP A;  1H0I A;  2DSV A;  4L72 B;  3ODK A;  1LL7 A;  2DSU A;  4W9P A;  1GPF A;  1O6I A;  3ARP A;  3WKZ A;  4MNM A;  1W1T A;  1FKT A;  4L3N A;  2N87 A;  4Z2L A;  3O5G A;  4MNJ A;  1ROT A;  4DZ3 A;  1EIB A;  4TNS A;  3O5E A;  1GRJ A;  4GGQ A;  5DIU A; 
#chains in the Genus database with same CATH homology
 3CHC A;  1FKL A;  2UZ5 A;  1E6Z A;  2RUQ A;  2IF4 A;  1FKG A;  3UI5 A;  2MF9 A;  1JNE A;  1NWU A;  2FAP A;  3FAP A;  4Z2H A;  4DRK A;  1JNT A;  4U85 A;  4W5U A;  4QIB A;  3WIJ A;  3O5L A;  3ALG A;  4JFK A;  1Y0O A;  4ODL A;  4R0X A;  2F21 A;  4DRI A;  1ZCN A;  1TFV A;  2PI6 A;  1VF8 A;  4G50 A;  1FFR A;  2ZQT A;  3ARO A;  4U86 A;  2WLZ A;  2XP4 A;  4LGX A;  4ML4 A;  3O5J A;  1ZK6 A;  3GPK A;  4Z2I A;  4GIV A;  4DWS C;  5HWB A;  4KR0 B;  1W26 A;  4IT4 A;  3TDB A;  1E15 A;  1ZBV A;  2WK2 A;  1ZBK A;  3ARW A;  3AQU A;  3CZ8 A;  3OOB A;  2XPA A;  3CH9 A;  1LJY A;  3WL1 A;  4IQ2 A;  2OLH A;  2DSW A;  2LGO A;  3CGM A;  3B8S A;  4LAX A;  1W1V A;  3PA7 A;  3UI6 A;  3AS2 A;  2G41 A;  4Z2K A;  1R9H A;  4P8X A;  4LAV A;  1NWR A;  3KAC A;  1A7X A;  2L2S A;  3WH0 A;  2XP3 A;  3ART A;  1FKK A;  1ROU A;  2DG3 A;  1J4H A;  1FKB A;  2ZQU A;  4MAV A;  1N1A A;  2Y78 A;  4NZC A;  1BKF A;  3CGN A;  2DPE A;  2DG4 A;  4ODK A;  4ODO A;  1ZB5 A;  3O5F A;  1K9T A;  1SYT A;  2ZR5 A;  1FKI A;  3KAD A;  1JNS A;  2RUC A;  1Q6U A;  3NI6 A;  1J4I A;  1D7H A;  4DIP A;  2XP7 A;  4Z2G A;  3RM8 A;  2WLY A;  1QPL A;  2DT0 A;  4MNL A;  3UQB A;  1FFQ A;  2D9F A;  4J4O A;  1FKD A;  4ITZ A;  1EYM A;  1GUV A;  3WL0 A;  3OA5 A;  2VCD A;  4N19 A;  1OGB A;  2M08 A;  3ARX A;  3H9R B;  1OWQ A;  1FKJ A;  5GPG A;  4DWS B;  5HUA A;  2K8I A;  2MLX A;  2WM0 A;  4IT6 A;  4DRO A;  4HBO A;  4DH0 A;  1OGG A;  3PRB A;  1X6L A;  3WQW A;  3UQI A;  4DRP A;  3RFW A;  4JFL A;  1EQ3 A;  3RGC A;  4ZS6 A;  5D75 A;  3KAB A;  5BXJ A;  3KAF A;  3AS3 A;  2RUD A;  4P8W A;  1W1Y A;  3W4R A;  4DT4 A;  3O5O A;  1NMV A;  1ITX A;  1NMW A;  2JZV A;  1W9V A;  2A3B A;  2G8Z A;  1HKK A;  3TC5 A;  1FJD A;  1NSG A;  4WK9 A;  3CHF A;  1E9L A;  1D7J A;  1HKI A;  2A3C A;  3TCZ A;  5GQB A;  2PPO A;  4LAY A;  5GPR A;  5B8I C;  4WKF A;  4ZPV R;  1D6O A;  3O5P A;  3G6L A;  3KAI A;  1HKM A;  5HTG A;  5DO2 A;  3O5D A;  1W9P A;  1HJX A;  1W1P A;  3FXY A;  4ODP A;  3ARU A;  1ZBC A;  3ALF A;  4C02 B;  5JH8 A;  2DSZ A;  3UQA A;  4IQC A;  4DWS D;  5HWC A;  1KFW A;  2KE0 A;  4Q22 A;  2XP9 A;  2AWG A;  4DRQ A;  4DZ2 A;  2M2A A;  4ODN A;  3ARQ A;  3AS1 A;  3O5Q A;  2LJ4 A;  4TW8 A;  3QOK A;  1Q1C A;  2IUZ A;  1P5Q A;  1BL4 A;  4FN2 A;  3O5M A;  2KR7 A;  4NNR A;  1B6C A;  4PTM A;  3EY6 A;  2RSE A;  1QPF A;  3KZ7 A;  1ZBW A;  2MLZ A;  5HBF A;  4DWS A;  1XHG A;  3B9E A;  2MNT A;  1FKF A;  3ARV A;  2ZQV A;  1W9U A;  4WKA A;  1HXV A;  1FKR A;  2M1I A;  1ZL1 A;  2F2D A;  1F8A B;  2KO7 A;  2XP5 A;  5DEZ A;  1FKH A;  1JND A;  2PPP A;  3AS0 A;  1D7I A;  4G2P A;  2YBU A;  3IKD A;  3JXV A;  3PRA A;  4HAR A;  3WQV A;  4ODR A;  2PV3 A;  1E6N A;  4MTV A;  4Z2J A;  1LL6 A;  1X6N A;  3IKG A;  3KAH A;  4W9Q A;  1RD6 A;  4ODM A;  2MPH A;  1SR0 A;  4JFJ A;  3MDY B;  3B9A A;  4WJX A;  2YBT A;  2KGJ A;  3ARZ A;  2ZR4 A;  3NRK A;  4IPX A;  4AY1 A;  3JYM A;  2OFN A;  2PV2 A;  3JYJ A;  1ZU8 A;  5HW6 A;  2FDM A;  1D2K A;  4P8V A;  5J6E A;  3ARS A;  3B9D A;  3WD0 A;  1WAW A;  1QZ2 A;  2AOS A;  4P8U A;  1KT1 A;  4URI A;  3FY1 A;  3B7X A;  1YAT A;  2MLY A;  1F40 A;  1UR8 A;  4S3J A;  4DRN A;  4R5E A;  3IK8 A;  2DT2 A;  1IX5 A;  1U79 A;  4TYO A;  4Q7N A;  1J4R A;  1J6Y A;  1PIN A;  3CHD A;  1NWT A;  2KFW A;  1JVW A;  1WNO A;  1FKS A;  1WB0 A;  4J4N A;  3O5R A;  4TW6 A;  1LQ0 A;  2PBC A;  4KQZ A;  4QT2 A;  2XP8 A;  4QZV B;  5I98 A;  3CHE A;  1C9H A;  5HW7 A;  4JFM A;  4DRM A;  1PBK A;  2XPB A;  4TW7 A;  2LKN A;  2DG9 A;  4FAP A;  2RUR A;  1FAP A;  5HW8 A;  1LG1 A;  2O9O A;  2LPV A;  4JYS A;  4S3K A;  4ZPW R;  4MPK A;  2B31 A;  3LUO A;  3O5K A;  2A3A A;  4DRH A;  1E6R A;  1UR9 A;  2ESC A;  3WD3 A;  3G6M A;  1Q6I A;  2A3E A;  1FD9 A;  3O5I A;  4MGV A;  4ODQ A;  3ARY A;  4W9O A;  3KAG A;  4QT3 A;  4ZPT R;  4NSB A;  1LL4 A;  2DT3 A;  3RME A;  3UI4 A;  2ITK A;  2F4E A;  1CTN A;  1EDQ A;  5HKG A;  3PRD A;  1LG2 A;  2FKE A;  3I6C A;  2ZQS A;  4JFI A;  4WKH A;  1L1P A;  5DIV A;  4WIW A;  4MSP A;  1NWS A;  1GOI A;  1Q6H A;  3RM4 A;  4MNK A;  5DIT A;  3VAW A;  1M5Y A;  1EHN A;  2QF8 A;  2Q5A A;  2ZR6 A;  3PR9 A;  4XAK A;  1XRV A;  4BF8 A;  4LAW A;  4HBE A;  4O2T A;  1YW5 A;  1TCO C;  4TX0 A;  3WD2 A;  1E6P A;  3WD1 A;  2VN1 A;  1H0G A;  1NH6 A;  2XP6 A;  2O92 A;  3ARR A;  3IHZ A;  5HT1 A;  1HJV A;  3BXW A;  2DT1 A;  1KT0 A;  1HKJ A;  2PPN A;  4U84 A;  2RQS A;  3WD4 A;  1HJW A;  3UF8 A;  4DRJ A;  3RM9 A;  1T11 A;  2KI3 A;  3KCE A;  2PV1 A;  5DF0 A;  3NTP A;  1H0I A;  2DSV A;  4L72 B;  3ODK A;  1LL7 A;  2DSU A;  4W9P A;  1GPF A;  1O6I A;  3ARP A;  3WKZ A;  4MNM A;  1W1T A;  1FKT A;  4L3N A;  2N87 A;  4Z2L A;  3O5G A;  4MNJ A;  1ROT A;  4DZ3 A;  1EIB A;  4TNS A;  3O5E A;  4GGQ A;  5DIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...