1NMWA

Solution structure of the ppiase domain of human pin1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
GEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural Analysis of the Mitotic Regulator hPin1 in Solution: INSIGHTS INTO DOMAIN ARCHITECTURE AND SUBSTRATE BINDING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 114
sequence length 114
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nmwA00
2XPBA 4TW6A 3TC5A 3RGCA 4ODOA 2L2SA 3KAGA 4ODKA 3WH0A 1P5QA 4IQ2A 4W9OA 3H9RB 1FKLA 3CGNA 3UQIA 1ZK6A 2LKNA 1R9HA 3KAIA 3IKGA 4LAWA 3UI6A 4DRHA 5I98A 3TCZA 1EQ3A 1Y0OA 2RQSA 4ODMA 1L1PA 4DT4A 1D7IA 1QPFA 4U85A 2PV2A 4IPXA 1HXVA 3UF8A 1J4RA 3B7XA 1PBKA 1NMWA 1YATA 2JZVA 4ODPA 3IHZA 5HT1A 4DRMA 2ZQUA 2KFWA 2KO7A 2RUQA 2XP8A 4J4OA 3O5GA 4LAYA 2KR7A 1C9HA 4NNRA 3VAWA 1D7JA 4ITZA 1NSGA 3O5PA 3JYMA 3KADA 5DIVA 1NMVA 2ZR5A 4G2PA 1FKJA 1J4HA 4ODRA 2KE0A 1Q6HA 1FKGA 1ZCNA 4FAPA 3KCEA 5HW8A 2PV3A 4FN2A 5DITA 1KT1A 2PPOA 2K8IA 4TW7A 3RFWA 2ZQSA 4LAXA 4U86A 3NRKA 2MLXA 3O5MA 2MLZA 3EY6A 4U84A 4DRJA 4QIBA 4W9QA 3UI4A 4TX0A 4IQCA 3IKDA 4GGQA 5HKGA 4G50A 3O5IA 2VN1A 2DG4A 2F21A 1W26A 5HTGA 3UQAA 1ROTA 1Q6IA 1FKHA 5HW7A 3OOBA 2RUDA 2F4EA 4TYOA 1YW5A 2UZ5A 4DRNA 4DH0A 4JFJA 1FKBA 2N87A 2Y78A 3ODKA 3PRBA 4DRPA 1Q6UA 4TW8A 2KI3A 4JFKA 1T11A 1BKFA 1J4IA 3LUOA 1KT0A 1FKSA 3O5LA 5D75A 3KAFA 4DRIA 1FKRA 1B6CA 5HW6A 2LPVA 3JXVA 3O5FA 2LGOA 5B8IC 2Q5AA 1D7HA 3KZ7A 4ODLA 3O5QA 3KABA 3O5OA 4JFMA 1U79A 3UI5A 2XP9A 3O5JA 3UQBA 1A7XA 3PRDA 1JVWA 2FAPA 1D6OA 2MPHA 2ZQTA 1J6YA 3GPKA 1FKTA 4DRKA 2M08A 3O5DA 1Q1CA 1TCOC 2PV1A 1FJDA 2D9FA 2OFNA 1FD9A 1JNSA 1FAPA 1F40A 2DG3A 2LJ4A 4DZ3A 2M2AA 2VCDA 4MSPA 2RURA 1QZ2A 3O5KA 1FKIA 4DROA 3TDBA 2M1IA 3I6CA 3IK8A 4DIPA 3KACA 4DRQA 5BXJA 1FKKA 3O5RA 4BF8A 1ROUA 3NTPA 1QPLA 2AWGA 4MGVA 3CGMA 5DIUA 1N1AA 2RSEA 3JYJA 2ITKA 1FKFA 1JNTA 2FKEA 4QT2A 5GPGA 4DZ2A 1F8AB 2MF9A 2MLYA 2PBCA 4ODQA 5J6EA 2ZQVA 2ZR4A 2F2DA 1EYMA 1FKDA 1PINA 2RUCA 2XP3A 3FAPA 3O5EA 2KGJA 2MNTA 5HWBA 3KAHA 4TNSA 4J4NA 1BL4A 2PPPA 2XP7A 3NI6A 3PA7A 4N19A 4W9PA 2PPNA 4GIVA 2IF4A 2DG9A 4JYSA 4O2TA 2XP5A 2ZR6A 4C02B 4JFLA 4R0XA 4ODNA 5HUAA 3MDYB 4QT3A 2XPAA 4JFIA 5HWCA 1M5YA 2XP4A 2XP6A 4LAVA
chains in the Genus database with same CATH superfamily
2XPBA 3WD3A 2L2SA 3W4RA 4ODKA 4IQ2A 3WQWA 3CHCA 1O6IA 1EQ3A 2B5UB 4LAWA 3WKZA 2RQSA 4L72B 4AY1A 4U85A 2PV2A 3ARRA 1NH6A 1PBKA 4MNKA 2ZQUA 2KFWA 5DO2A 3O5GA 2KR7A 4WIWA 2WLZA 1W9PA 3WD1A 1FKGA 5DITA 3WL0A 3O5MA 4DRJA 3ALFA 3UI4A 1HJXA 3UQAA 1ROTA 4W5UA 3GU0A 2RUDA 1YW5A 1IX5A 1W9UA 1FKBA 3ODKA 2Y78A 3PRBA 4DRPA 4TW8A 4Z2JA 2IUZA 5D75A 3LUOA 1KT0A 2O9OA 3O5LA 3KAFA 3ARYA 1B6CA 4DWSD 3CZ8A 2LGOA 4WKHA 2XP9A 3UQBA 1A7XA 3PRDA 2FAPA 2MPHA 3GPKA 3ARWA 1TCOC 1FJDA 2D9FA 2OFNA 1F40A 2LJ4A 3ALGA 4DZ3A 2M2AA 2WK2A 1ZL1A 2DT0A 3KACA 3WD4A 3ARQA 2A3AA 4WK9A 2WLYA 2ITKA 1FKFA 2FKEA 3OA5A 4DZ2A 2PBCA 4ZPTR 3B8SA 4MNJA 2ZR4A 2F23A 1FKDA 1W1YA 2G41A 3FAPA 4DRHA 1BL4A 2PPPA 3NI6A 2PPNA 2IF4A 4NSBA 4URIA 4Q22A 5HUAA 2FDMA 1ZU8A 2XP6A 3TC5A 1RD6A 4ODOA 4ZS6A 3AS3A 2EULA 3UQIA 1NWTA 1R9HA 3KAIA 3IKGA 3ARUA 4P8WA 3TCZA 1Y0OA 1CTNA 4ODMA 3UF8A 1J4RA 3ARVA 1NMWA 4WKFA 2KO7A 2RUQA 2XP8A 3CHEA 4NNRA 1H0GA 4ITZA 3O5PA 1LL4A 1ZBCA 2ZR5A 3KCEA 4FN2A 1EHNA 2PI6A 2PPOA 3RFWA 2ZQSA 3EY6A 1XHGA 3PR9A 3PRAA 4IQCA 3FXYA 4GGQA 5HKGA 1E6NA 3O5IA 2DG4A 5HTGA 1W26A 4MPKA 3OOBA 2UZ5A 4MAVA 1K9TA 4JFJA 4JFKA 5DF0A 3CHDA 2DT3A 3JXVA 5B8IC 3KZ7A 4ODLA 3O5QA 3KABA 3O5OA 4JFMA 2DT1A 3WIJA 1E44A 4MNMA 1D6OA 2ESCA 1J6YA 4DRKA 3O5DA 1Q1CA 1E9LA 1E15A 1JNSA 1E6PA 2YBTA 2RURA 4IT6A 1FKIA 3I6CA 1EDQA 4DIPA 1FKKA 1ROUA 1LG1A 1QPLA 4MGVA 4R5EA 4P8UA 4MNLA 2A3BA 1JNTA 4QT2A 5GPGA 4Z2LA 1F8AB 2MF9A 5J6EA 2RUCA 2MNTA 5HWBA 1HKIA 1HKMA 4W9PA 4N19A 3B9AA 4GIVA 2DG9A 3AS0A 4JYSA 1ZBKA 2XPAA 1M5YA 4Z2HA 2PN0A 1FFRA 4TW6A 3RGCA 4Q7NA 3KAGA 3WH0A 4P8VA 1FKLA 2LKNA 1LL6A 3UI6A 1HKJA 1VF8A 4DT4A 1X6LA 1E6ZA 5GPRA 3AQUA 1TFVA 5JH8A 2DSZA 1WB0A 1GUVA 1KFWA 4Z2IA 4DRMA 1NWUA 4Z2GA 3ARSA 1LQ0A 1C9HA 4DWSC 2G8ZA 3VAWA 4XAKA 1NSGA 1JNEA 3JYMA 5DIVA 1FKJA 1J4HA 1OGBA 2KE0A 1Q6HA 4NZCA 2PV3A 3EIPA 5DEZA 2K8IA 4WJXA 4U84A 4QIBA 4W9QA 4TX0A 3IKDA 4P8XA 4G50A 2VN1A 1Q6IA 4L3NA 5HW7A 4TYOA 3AROA 1E6RA 1Q6UA 1XRVA 2KI3A 3BMBA 1BKFA 4DWSA 1J4IA 4LGXA 1FKSA 4HBOA 1SYTA 5HW6A 2LPVA 4QZVB 3ARXA 3O5FA 1D7HA 3UI5A 3O5JA 1EIBA 2ZQTA 1FKTA 2PV1A 2P4VA 1FD9A 4KR0B 4MSPA 3B9DA 3CH9A 3IK8A 4DRQA 5BXJA 3WQVA 3NTPA 3WL1A 2AWGA 3CGMA 5DIUA 3ARPA 2RSEA 2AOSA 4ZPVR 1GOIA 2F2DA 1PINA 3O5EA 1H0IA 4ZPWR 3G6MA 4O2TA 4Z2KA 2XP5A 4C02B 4JFLA 3GTYX 3MDYB 4JFIA 5HWCA 2XP4A 4LAVA 1FFQA 2DSWA 2ETNA 1X6NA 1P5QA 4W9OA 3H9RB 3CGNA 1ZK6A 2O92A 2OLHA 4PTMA 5I98A 2DT2A 2DSUA 1D7IA 1QPFA 1WAWA 4IPXA 1HXVA 4HBEA 3B7XA 1JNDA 2JZVA 1YATA 4ODPA 3IHZA 5HT1A 2QF8A 1L1PA 4J4OA 1HJVA 4LAYA 5HBFA 1D7JA 2DSVA 1LL7A 3KADA 1NMVA 4G2PA 1GPFA 4ODRA 1JCHB 2YBUA 3ARTA 1GRJA 1ZCNA 5HW8A 4FAPA 1KT1A 4S3KA 4TW7A 3RM8A 4LAXA 4U86A 3NRKA 2MLXA 3G6LA 2MLZA 3RM4A 1W1PA 2F21A 3RMEA 3BXWA 1OGGA 1FKHA 1OWQA 1UR8A 1WNOA 3B9EA 4MTVA 2F4EA 4DRNA 4DH0A 3FY1A 2N87A 1ITXA 1T11A 3WD2A 1W1VA 4DRIA 1FKRA 2A3CA 4ML4A 2Q5AA 3CHFA 4KQZA 3ARZA 1W1TA 1U79A 4HARA 3WD0A 1JVWA 4IT4A 2M08A 1NWRA 1ZBWA 1W9VA 1FAPA 2DG3A 2WM0A 3RM9A 1ZB5A 2VCDA 1QZ2A 3O5KA 4DROA 3TDBA 2M1IA 4S3JA 1HKKA 3O5RA 3QOKA 4BF8A 1UR9A 3AS2A 1N1AA 2DPEA 3JYJA 2MLYA 4ODQA 3AS1A 1D2KA 2ZQVA 2B31A 1EYMA 1SR0A 1LG2A 1LJYA 2XP3A 2KGJA 3KAHA 4TNSA 4J4NA 3PA7A 2XP7A 4WKAA 4DWSB 5GQBA 1NWSA 2A3EA 2ZR6A 4R0XA 4ODNA 1ZBVA 4QT3A 1HJWA 4UDMA
chains in the Genus database with same CATH topology
2XPBA 3WD3A 2L2SA 3W4RA 4ODKA 4IQ2A 3WQWA 3CHCA 1O6IA 1EQ3A 4LAWA 3WKZA 2RQSA 4L72B 4AY1A 4U85A 2PV2A 3ARRA 1NH6A 1PBKA 4MNKA 2ZQUA 2KFWA 5DO2A 3O5GA 2KR7A 4WIWA 2WLZA 1W9PA 3WD1A 1FKGA 5DITA 3WL0A 3O5MA 4DRJA 3ALFA 3UI4A 1HJXA 3UQAA 1ROTA 4W5UA 2RUDA 1YW5A 1IX5A 1W9UA 1FKBA 3ODKA 2Y78A 3PRBA 4DRPA 4TW8A 4Z2JA 2IUZA 5D75A 3LUOA 1KT0A 2O9OA 3O5LA 3KAFA 3ARYA 1B6CA 4DWSD 3CZ8A 2LGOA 4WKHA 2XP9A 3UQBA 1A7XA 3PRDA 2FAPA 2MPHA 3GPKA 3ARWA 1TCOC 1FJDA 2D9FA 2OFNA 1F40A 2LJ4A 3ALGA 4DZ3A 2M2AA 2WK2A 1ZL1A 2DT0A 3KACA 3WD4A 3ARQA 2A3AA 4WK9A 2WLYA 2ITKA 1FKFA 2FKEA 3OA5A 4DZ2A 2PBCA 4ZPTR 3B8SA 4MNJA 2ZR4A 1FKDA 1W1YA 2G41A 3FAPA 4DRHA 1BL4A 2PPPA 3NI6A 2PPNA 2IF4A 4NSBA 4URIA 4Q22A 5HUAA 2FDMA 1ZU8A 2XP6A 3TC5A 1RD6A 4ODOA 4ZS6A 3AS3A 3UQIA 1NWTA 1R9HA 3KAIA 3IKGA 3ARUA 4P8WA 3TCZA 1Y0OA 1CTNA 4ODMA 3UF8A 1J4RA 3ARVA 1NMWA 4WKFA 2KO7A 2RUQA 2XP8A 3CHEA 4NNRA 1H0GA 4ITZA 3O5PA 1LL4A 1ZBCA 2ZR5A 3KCEA 4FN2A 1EHNA 2PI6A 2PPOA 3RFWA 2ZQSA 3EY6A 1XHGA 3PR9A 3PRAA 4IQCA 3FXYA 4GGQA 5HKGA 1E6NA 3O5IA 2DG4A 5HTGA 1W26A 4MPKA 3OOBA 2UZ5A 4MAVA 1K9TA 4JFJA 4JFKA 5DF0A 3CHDA 2DT3A 3JXVA 5B8IC 3KZ7A 4ODLA 3O5QA 3KABA 3O5OA 4JFMA 2DT1A 3WIJA 4MNMA 1D6OA 2ESCA 1J6YA 4DRKA 3O5DA 1Q1CA 1E9LA 1E15A 1JNSA 1E6PA 2YBTA 2RURA 4IT6A 1FKIA 3I6CA 1EDQA 4DIPA 1FKKA 1ROUA 1LG1A 1QPLA 4MGVA 4R5EA 4P8UA 4MNLA 2A3BA 1JNTA 4QT2A 5GPGA 4Z2LA 1F8AB 2MF9A 5J6EA 2RUCA 2MNTA 5HWBA 1HKIA 1HKMA 4W9PA 4N19A 3B9AA 4GIVA 2DG9A 3AS0A 4JYSA 1ZBKA 2XPAA 1M5YA 4Z2HA 1FFRA 4TW6A 3RGCA 4Q7NA 3KAGA 3WH0A 4P8VA 1FKLA 2LKNA 1LL6A 3UI6A 1HKJA 1VF8A 4DT4A 1X6LA 1E6ZA 5GPRA 3AQUA 1TFVA 5JH8A 2DSZA 1WB0A 1GUVA 1KFWA 4Z2IA 4DRMA 1NWUA 4Z2GA 3ARSA 1LQ0A 1C9HA 4DWSC 2G8ZA 3VAWA 4XAKA 1NSGA 1JNEA 3JYMA 5DIVA 1FKJA 1J4HA 1OGBA 2KE0A 1Q6HA 4NZCA 2PV3A 5DEZA 2K8IA 4WJXA 4U84A 4QIBA 4W9QA 4TX0A 3IKDA 4P8XA 4G50A 2VN1A 1Q6IA 4L3NA 5HW7A 4TYOA 3AROA 1E6RA 1Q6UA 1XRVA 2KI3A 1BKFA 4DWSA 1J4IA 4LGXA 1FKSA 4HBOA 1SYTA 5HW6A 2LPVA 4QZVB 3ARXA 3O5FA 1D7HA 3UI5A 3O5JA 1EIBA 2ZQTA 1FKTA 2PV1A 1FD9A 4KR0B 4MSPA 3B9DA 3CH9A 3IK8A 4DRQA 5BXJA 3WQVA 3NTPA 3WL1A 2AWGA 3CGMA 5DIUA 3ARPA 2RSEA 2AOSA 4ZPVR 1GOIA 2F2DA 1PINA 3O5EA 1H0IA 4ZPWR 3G6MA 4O2TA 4Z2KA 2XP5A 4C02B 4JFLA 3MDYB 4JFIA 5HWCA 2XP4A 4LAVA 1FFQA 2DSWA 1X6NA 1P5QA 4W9OA 3H9RB 3CGNA 1ZK6A 2O92A 2OLHA 4PTMA 5I98A 2DT2A 2DSUA 1D7IA 1QPFA 1WAWA 4IPXA 1HXVA 4HBEA 3B7XA 1JNDA 2JZVA 1YATA 4ODPA 3IHZA 5HT1A 2QF8A 1L1PA 4J4OA 1HJVA 4LAYA 5HBFA 1D7JA 2DSVA 1LL7A 3KADA 1NMVA 4G2PA 1GPFA 4ODRA 2YBUA 3ARTA 1ZCNA 5HW8A 4FAPA 1KT1A 4S3KA 4TW7A 3RM8A 4LAXA 4U86A 3NRKA 2MLXA 3G6LA 2MLZA 3RM4A 1W1PA 2F21A 3RMEA 3BXWA 1OGGA 1FKHA 1OWQA 1UR8A 1WNOA 3B9EA 4MTVA 2F4EA 4DRNA 4DH0A 3FY1A 2N87A 1ITXA 1T11A 3WD2A 1W1VA 4DRIA 1FKRA 2A3CA 4ML4A 2Q5AA 3CHFA 4KQZA 3ARZA 1W1TA 1U79A 4HARA 3WD0A 1JVWA 4IT4A 2M08A 1NWRA 1ZBWA 1W9VA 1FAPA 2DG3A 2WM0A 3RM9A 1ZB5A 2VCDA 1QZ2A 3O5KA 4DROA 3TDBA 2M1IA 4S3JA 1HKKA 3O5RA 3QOKA 4BF8A 1UR9A 3AS2A 1N1AA 2DPEA 3JYJA 2MLYA 4ODQA 3AS1A 1D2KA 2ZQVA 2B31A 1EYMA 1SR0A 1LG2A 1LJYA 2XP3A 2KGJA 3KAHA 4TNSA 4J4NA 3PA7A 2XP7A 4WKAA 4DWSB 5GQBA 1NWSA 2A3EA 2ZR6A 4R0XA 4ODNA 1ZBVA 4QT3A 1HJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPB A;  4TW6 A;  3TC5 A;  3RGC A;  4ODO A;  2L2S A;  3KAG A;  4ODK A;  3WH0 A;  1P5Q A;  4IQ2 A;  4W9O A;  3H9R B;  1FKL A;  3CGN A;  3UQI A;  1ZK6 A;  2LKN A;  1R9H A;  3KAI A;  3IKG A;  4LAW A;  3UI6 A;  4DRH A;  5I98 A;  3TCZ A;  1EQ3 A;  1Y0O A;  2RQS A;  4ODM A;  1L1P A;  4DT4 A;  1D7I A;  1QPF A;  4U85 A;  2PV2 A;  4IPX A;  1HXV A;  3UF8 A;  1J4R A;  3B7X A;  1PBK A;  1NMW A;  1YAT A;  2JZV A;  4ODP A;  3IHZ A;  5HT1 A;  4DRM A;  2ZQU A;  2KFW A;  2KO7 A;  2RUQ A;  2XP8 A;  4J4O A;  3O5G A;  4LAY A;  2KR7 A;  1C9H A;  4NNR A;  3VAW A;  1D7J A;  4ITZ A;  1NSG A;  3O5P A;  3JYM A;  3KAD A;  5DIV A;  1NMV A;  2ZR5 A;  4G2P A;  1FKJ A;  1J4H A;  4ODR A;  2KE0 A;  1Q6H A;  1FKG A;  1ZCN A;  4FAP A;  3KCE A;  5HW8 A;  2PV3 A;  4FN2 A;  5DIT A;  1KT1 A;  2PPO A;  2K8I A;  4TW7 A;  3RFW A;  2ZQS A;  4LAX A;  4U86 A;  3NRK A;  2MLX A;  3O5M A;  2MLZ A;  3EY6 A;  4U84 A;  4DRJ A;  4QIB A;  4W9Q A;  3UI4 A;  4TX0 A;  4IQC A;  3IKD A;  4GGQ A;  5HKG A;  4G50 A;  3O5I A;  2VN1 A;  2DG4 A;  2F21 A;  1W26 A;  5HTG A;  3UQA A;  1ROT A;  1Q6I A;  1FKH A;  5HW7 A;  3OOB A;  2RUD A;  2F4E A;  4TYO A;  1YW5 A;  2UZ5 A;  4DRN A;  4DH0 A;  4JFJ A;  1FKB A;  2N87 A;  2Y78 A;  3ODK A;  3PRB A;  4DRP A;  1Q6U A;  4TW8 A;  2KI3 A;  4JFK A;  1T11 A;  1BKF A;  1J4I A;  3LUO A;  1KT0 A;  1FKS A;  3O5L A;  5D75 A;  3KAF A;  4DRI A;  1FKR A;  1B6C A;  5HW6 A;  2LPV A;  3JXV A;  3O5F A;  2LGO A;  5B8I C;  2Q5A A;  1D7H A;  3KZ7 A;  4ODL A;  3O5Q A;  3KAB A;  3O5O A;  4JFM A;  1U79 A;  3UI5 A;  2XP9 A;  3O5J A;  3UQB A;  1A7X A;  3PRD A;  1JVW A;  2FAP A;  1D6O A;  2MPH A;  2ZQT A;  1J6Y A;  3GPK A;  1FKT A;  4DRK A;  2M08 A;  3O5D A;  1Q1C A;  1TCO C;  2PV1 A;  1FJD A;  2D9F A;  2OFN A;  1FD9 A;  1JNS A;  1FAP A;  1F40 A;  2DG3 A;  2LJ4 A;  4DZ3 A;  2M2A A;  2VCD A;  4MSP A;  2RUR A;  1QZ2 A;  3O5K A;  1FKI A;  4DRO A;  3TDB A;  2M1I A;  3I6C A;  3IK8 A;  4DIP A;  3KAC A;  4DRQ A;  5BXJ A;  1FKK A;  3O5R A;  4BF8 A;  1ROU A;  3NTP A;  1QPL A;  2AWG A;  4MGV A;  3CGM A;  5DIU A;  1N1A A;  2RSE A;  3JYJ A;  2ITK A;  1FKF A;  1JNT A;  2FKE A;  4QT2 A;  5GPG A;  4DZ2 A;  1F8A B;  2MF9 A;  2MLY A;  2PBC A;  4ODQ A;  5J6E A;  2ZQV A;  2ZR4 A;  2F2D A;  1EYM A;  1FKD A;  1PIN A;  2RUC A;  2XP3 A;  3FAP A;  3O5E A;  2KGJ A;  2MNT A;  5HWB A;  3KAH A;  4TNS A;  4J4N A;  1BL4 A;  2PPP A;  2XP7 A;  3NI6 A;  3PA7 A;  4N19 A;  4W9P A;  2PPN A;  4GIV A;  2IF4 A;  2DG9 A;  4JYS A;  4O2T A;  2XP5 A;  2ZR6 A;  4C02 B;  4JFL A;  4R0X A;  4ODN A;  5HUA A;  3MDY B;  4QT3 A;  2XPA A;  4JFI A;  5HWC A;  1M5Y A;  2XP4 A;  2XP6 A;  4LAV A; 
#chains in the Genus database with same CATH topology
 2XPB A;  3WD3 A;  2L2S A;  3W4R A;  4ODK A;  4IQ2 A;  3WQW A;  3CHC A;  1O6I A;  1EQ3 A;  2B5U B;  4LAW A;  3WKZ A;  2RQS A;  4L72 B;  4AY1 A;  4U85 A;  2PV2 A;  3ARR A;  1NH6 A;  1PBK A;  4MNK A;  2ZQU A;  2KFW A;  5DO2 A;  3O5G A;  2KR7 A;  4WIW A;  2WLZ A;  1W9P A;  3WD1 A;  1FKG A;  5DIT A;  3WL0 A;  3O5M A;  4DRJ A;  3ALF A;  3UI4 A;  1HJX A;  3UQA A;  1ROT A;  4W5U A;  3GU0 A;  2RUD A;  1YW5 A;  1IX5 A;  1W9U A;  1FKB A;  3ODK A;  2Y78 A;  3PRB A;  4DRP A;  4TW8 A;  4Z2J A;  2IUZ A;  5D75 A;  3LUO A;  1KT0 A;  2O9O A;  3O5L A;  3KAF A;  3ARY A;  1B6C A;  4DWS D;  3CZ8 A;  2LGO A;  4WKH A;  2XP9 A;  3UQB A;  1A7X A;  3PRD A;  2FAP A;  2MPH A;  3GPK A;  3ARW A;  1TCO C;  1FJD A;  2D9F A;  2OFN A;  1F40 A;  2LJ4 A;  3ALG A;  4DZ3 A;  2M2A A;  2WK2 A;  1ZL1 A;  2DT0 A;  3KAC A;  3WD4 A;  3ARQ A;  2A3A A;  4WK9 A;  2WLY A;  2ITK A;  1FKF A;  2FKE A;  3OA5 A;  4DZ2 A;  2PBC A;  4ZPT R;  3B8S A;  4MNJ A;  2ZR4 A;  2F23 A;  1FKD A;  1W1Y A;  2G41 A;  3FAP A;  4DRH A;  1BL4 A;  2PPP A;  3NI6 A;  2PPN A;  2IF4 A;  4NSB A;  4URI A;  4Q22 A;  5HUA A;  2FDM A;  1ZU8 A;  2XP6 A;  3TC5 A;  1RD6 A;  4ODO A;  4ZS6 A;  3AS3 A;  2EUL A;  3UQI A;  1NWT A;  1R9H A;  3KAI A;  3IKG A;  3ARU A;  4P8W A;  3TCZ A;  1Y0O A;  1CTN A;  4ODM A;  3UF8 A;  1J4R A;  3ARV A;  1NMW A;  4WKF A;  2KO7 A;  2RUQ A;  2XP8 A;  3CHE A;  4NNR A;  1H0G A;  4ITZ A;  3O5P A;  1LL4 A;  1ZBC A;  2ZR5 A;  3KCE A;  4FN2 A;  1EHN A;  2PI6 A;  2PPO A;  3RFW A;  2ZQS A;  3EY6 A;  1XHG A;  3PR9 A;  3PRA A;  4IQC A;  3FXY A;  4GGQ A;  5HKG A;  1E6N A;  3O5I A;  2DG4 A;  5HTG A;  1W26 A;  4MPK A;  3OOB A;  2UZ5 A;  4MAV A;  1K9T A;  4JFJ A;  4JFK A;  5DF0 A;  3CHD A;  2DT3 A;  3JXV A;  5B8I C;  3KZ7 A;  4ODL A;  3O5Q A;  3KAB A;  3O5O A;  4JFM A;  2DT1 A;  3WIJ A;  1E44 A;  4MNM A;  1D6O A;  2ESC A;  1J6Y A;  4DRK A;  3O5D A;  1Q1C A;  1E9L A;  1E15 A;  1JNS A;  1E6P A;  2YBT A;  2RUR A;  4IT6 A;  1FKI A;  3I6C A;  1EDQ A;  4DIP A;  1FKK A;  1ROU A;  1LG1 A;  1QPL A;  4MGV A;  4R5E A;  4P8U A;  4MNL A;  2A3B A;  1JNT A;  4QT2 A;  5GPG A;  4Z2L A;  1F8A B;  2MF9 A;  5J6E A;  2RUC A;  2MNT A;  5HWB A;  1HKI A;  1HKM A;  4W9P A;  4N19 A;  3B9A A;  4GIV A;  2DG9 A;  3AS0 A;  4JYS A;  1ZBK A;  2XPA A;  1M5Y A;  4Z2H A;  2PN0 A;  1FFR A;  4TW6 A;  3RGC A;  4Q7N A;  3KAG A;  3WH0 A;  4P8V A;  1FKL A;  2LKN A;  1LL6 A;  3UI6 A;  1HKJ A;  1VF8 A;  4DT4 A;  1X6L A;  1E6Z A;  5GPR A;  3AQU A;  1TFV A;  5JH8 A;  2DSZ A;  1WB0 A;  1GUV A;  1KFW A;  4Z2I A;  4DRM A;  1NWU A;  4Z2G A;  3ARS A;  1LQ0 A;  1C9H A;  4DWS C;  2G8Z A;  3VAW A;  4XAK A;  1NSG A;  1JNE A;  3JYM A;  5DIV A;  1FKJ A;  1J4H A;  1OGB A;  2KE0 A;  1Q6H A;  4NZC A;  2PV3 A;  3EIP A;  5DEZ A;  2K8I A;  4WJX A;  4U84 A;  4QIB A;  4W9Q A;  4TX0 A;  3IKD A;  4P8X A;  4G50 A;  2VN1 A;  1Q6I A;  4L3N A;  5HW7 A;  4TYO A;  3ARO A;  1E6R A;  1Q6U A;  1XRV A;  2KI3 A;  3BMB A;  1BKF A;  4DWS A;  1J4I A;  4LGX A;  1FKS A;  4HBO A;  1SYT A;  5HW6 A;  2LPV A;  4QZV B;  3ARX A;  3O5F A;  1D7H A;  3UI5 A;  3O5J A;  1EIB A;  2ZQT A;  1FKT A;  2PV1 A;  2P4V A;  1FD9 A;  4KR0 B;  4MSP A;  3B9D A;  3CH9 A;  3IK8 A;  4DRQ A;  5BXJ A;  3WQV A;  3NTP A;  3WL1 A;  2AWG A;  3CGM A;  5DIU A;  3ARP A;  2RSE A;  2AOS A;  4ZPV R;  1GOI A;  2F2D A;  1PIN A;  3O5E A;  1H0I A;  4ZPW R;  3G6M A;  4O2T A;  4Z2K A;  2XP5 A;  4C02 B;  4JFL A;  3GTY X;  3MDY B;  4JFI A;  5HWC A;  2XP4 A;  4LAV A;  1FFQ A;  2DSW A;  2ETN A;  1X6N A;  1P5Q A;  4W9O A;  3H9R B;  3CGN A;  1ZK6 A;  2O92 A;  2OLH A;  4PTM A;  5I98 A;  2DT2 A;  2DSU A;  1D7I A;  1QPF A;  1WAW A;  4IPX A;  1HXV A;  4HBE A;  3B7X A;  1JND A;  2JZV A;  1YAT A;  4ODP A;  3IHZ A;  5HT1 A;  2QF8 A;  1L1P A;  4J4O A;  1HJV A;  4LAY A;  5HBF A;  1D7J A;  2DSV A;  1LL7 A;  3KAD A;  1NMV A;  4G2P A;  1GPF A;  4ODR A;  1JCH B;  2YBU A;  3ART A;  1GRJ A;  1ZCN A;  5HW8 A;  4FAP A;  1KT1 A;  4S3K A;  4TW7 A;  3RM8 A;  4LAX A;  4U86 A;  3NRK A;  2MLX A;  3G6L A;  2MLZ A;  3RM4 A;  1W1P A;  2F21 A;  3RME A;  3BXW A;  1OGG A;  1FKH A;  1OWQ A;  1UR8 A;  1WNO A;  3B9E A;  4MTV A;  2F4E A;  4DRN A;  4DH0 A;  3FY1 A;  2N87 A;  1ITX A;  1T11 A;  3WD2 A;  1W1V A;  4DRI A;  1FKR A;  2A3C A;  4ML4 A;  2Q5A A;  3CHF A;  4KQZ A;  3ARZ A;  1W1T A;  1U79 A;  4HAR A;  3WD0 A;  1JVW A;  4IT4 A;  2M08 A;  1NWR A;  1ZBW A;  1W9V A;  1FAP A;  2DG3 A;  2WM0 A;  3RM9 A;  1ZB5 A;  2VCD A;  1QZ2 A;  3O5K A;  4DRO A;  3TDB A;  2M1I A;  4S3J A;  1HKK A;  3O5R A;  3QOK A;  4BF8 A;  1UR9 A;  3AS2 A;  1N1A A;  2DPE A;  3JYJ A;  2MLY A;  4ODQ A;  3AS1 A;  1D2K A;  2ZQV A;  2B31 A;  1EYM A;  1SR0 A;  1LG2 A;  1LJY A;  2XP3 A;  2KGJ A;  3KAH A;  4TNS A;  4J4N A;  3PA7 A;  2XP7 A;  4WKA A;  4DWS B;  5GQB A;  1NWS A;  2A3E A;  2ZR6 A;  4R0X A;  4ODN A;  1ZBV A;  4QT3 A;  1HJW A;  4UDM A; 
#chains in the Genus database with same CATH homology
 2XPB A;  3WD3 A;  2L2S A;  3W4R A;  4ODK A;  4IQ2 A;  3WQW A;  3CHC A;  1O6I A;  1EQ3 A;  4LAW A;  3WKZ A;  2RQS A;  4L72 B;  4AY1 A;  4U85 A;  2PV2 A;  3ARR A;  1NH6 A;  1PBK A;  4MNK A;  2ZQU A;  2KFW A;  5DO2 A;  3O5G A;  2KR7 A;  4WIW A;  2WLZ A;  1W9P A;  3WD1 A;  1FKG A;  5DIT A;  3WL0 A;  3O5M A;  4DRJ A;  3ALF A;  3UI4 A;  1HJX A;  3UQA A;  1ROT A;  4W5U A;  2RUD A;  1YW5 A;  1IX5 A;  1W9U A;  1FKB A;  3ODK A;  2Y78 A;  3PRB A;  4DRP A;  4TW8 A;  4Z2J A;  2IUZ A;  5D75 A;  3LUO A;  1KT0 A;  2O9O A;  3O5L A;  3KAF A;  3ARY A;  1B6C A;  4DWS D;  3CZ8 A;  2LGO A;  4WKH A;  2XP9 A;  3UQB A;  1A7X A;  3PRD A;  2FAP A;  2MPH A;  3GPK A;  3ARW A;  1TCO C;  1FJD A;  2D9F A;  2OFN A;  1F40 A;  2LJ4 A;  3ALG A;  4DZ3 A;  2M2A A;  2WK2 A;  1ZL1 A;  2DT0 A;  3KAC A;  3WD4 A;  3ARQ A;  2A3A A;  4WK9 A;  2WLY A;  2ITK A;  1FKF A;  2FKE A;  3OA5 A;  4DZ2 A;  2PBC A;  4ZPT R;  3B8S A;  4MNJ A;  2ZR4 A;  1FKD A;  1W1Y A;  2G41 A;  3FAP A;  4DRH A;  1BL4 A;  2PPP A;  3NI6 A;  2PPN A;  2IF4 A;  4NSB A;  4URI A;  4Q22 A;  5HUA A;  2FDM A;  1ZU8 A;  2XP6 A;  3TC5 A;  1RD6 A;  4ODO A;  4ZS6 A;  3AS3 A;  3UQI A;  1NWT A;  1R9H A;  3KAI A;  3IKG A;  3ARU A;  4P8W A;  3TCZ A;  1Y0O A;  1CTN A;  4ODM A;  3UF8 A;  1J4R A;  3ARV A;  1NMW A;  4WKF A;  2KO7 A;  2RUQ A;  2XP8 A;  3CHE A;  4NNR A;  1H0G A;  4ITZ A;  3O5P A;  1LL4 A;  1ZBC A;  2ZR5 A;  3KCE A;  4FN2 A;  1EHN A;  2PI6 A;  2PPO A;  3RFW A;  2ZQS A;  3EY6 A;  1XHG A;  3PR9 A;  3PRA A;  4IQC A;  3FXY A;  4GGQ A;  5HKG A;  1E6N A;  3O5I A;  2DG4 A;  5HTG A;  1W26 A;  4MPK A;  3OOB A;  2UZ5 A;  4MAV A;  1K9T A;  4JFJ A;  4JFK A;  5DF0 A;  3CHD A;  2DT3 A;  3JXV A;  5B8I C;  3KZ7 A;  4ODL A;  3O5Q A;  3KAB A;  3O5O A;  4JFM A;  2DT1 A;  3WIJ A;  4MNM A;  1D6O A;  2ESC A;  1J6Y A;  4DRK A;  3O5D A;  1Q1C A;  1E9L A;  1E15 A;  1JNS A;  1E6P A;  2YBT A;  2RUR A;  4IT6 A;  1FKI A;  3I6C A;  1EDQ A;  4DIP A;  1FKK A;  1ROU A;  1LG1 A;  1QPL A;  4MGV A;  4R5E A;  4P8U A;  4MNL A;  2A3B A;  1JNT A;  4QT2 A;  5GPG A;  4Z2L A;  1F8A B;  2MF9 A;  5J6E A;  2RUC A;  2MNT A;  5HWB A;  1HKI A;  1HKM A;  4W9P A;  4N19 A;  3B9A A;  4GIV A;  2DG9 A;  3AS0 A;  4JYS A;  1ZBK A;  2XPA A;  1M5Y A;  4Z2H A;  1FFR A;  4TW6 A;  3RGC A;  4Q7N A;  3KAG A;  3WH0 A;  4P8V A;  1FKL A;  2LKN A;  1LL6 A;  3UI6 A;  1HKJ A;  1VF8 A;  4DT4 A;  1X6L A;  1E6Z A;  5GPR A;  3AQU A;  1TFV A;  5JH8 A;  2DSZ A;  1WB0 A;  1GUV A;  1KFW A;  4Z2I A;  4DRM A;  1NWU A;  4Z2G A;  3ARS A;  1LQ0 A;  1C9H A;  4DWS C;  2G8Z A;  3VAW A;  4XAK A;  1NSG A;  1JNE A;  3JYM A;  5DIV A;  1FKJ A;  1J4H A;  1OGB A;  2KE0 A;  1Q6H A;  4NZC A;  2PV3 A;  5DEZ A;  2K8I A;  4WJX A;  4U84 A;  4QIB A;  4W9Q A;  4TX0 A;  3IKD A;  4P8X A;  4G50 A;  2VN1 A;  1Q6I A;  4L3N A;  5HW7 A;  4TYO A;  3ARO A;  1E6R A;  1Q6U A;  1XRV A;  2KI3 A;  1BKF A;  4DWS A;  1J4I A;  4LGX A;  1FKS A;  4HBO A;  1SYT A;  5HW6 A;  2LPV A;  4QZV B;  3ARX A;  3O5F A;  1D7H A;  3UI5 A;  3O5J A;  1EIB A;  2ZQT A;  1FKT A;  2PV1 A;  1FD9 A;  4KR0 B;  4MSP A;  3B9D A;  3CH9 A;  3IK8 A;  4DRQ A;  5BXJ A;  3WQV A;  3NTP A;  3WL1 A;  2AWG A;  3CGM A;  5DIU A;  3ARP A;  2RSE A;  2AOS A;  4ZPV R;  1GOI A;  2F2D A;  1PIN A;  3O5E A;  1H0I A;  4ZPW R;  3G6M A;  4O2T A;  4Z2K A;  2XP5 A;  4C02 B;  4JFL A;  3MDY B;  4JFI A;  5HWC A;  2XP4 A;  4LAV A;  1FFQ A;  2DSW A;  1X6N A;  1P5Q A;  4W9O A;  3H9R B;  3CGN A;  1ZK6 A;  2O92 A;  2OLH A;  4PTM A;  5I98 A;  2DT2 A;  2DSU A;  1D7I A;  1QPF A;  1WAW A;  4IPX A;  1HXV A;  4HBE A;  3B7X A;  1JND A;  2JZV A;  1YAT A;  4ODP A;  3IHZ A;  5HT1 A;  2QF8 A;  1L1P A;  4J4O A;  1HJV A;  4LAY A;  5HBF A;  1D7J A;  2DSV A;  1LL7 A;  3KAD A;  1NMV A;  4G2P A;  1GPF A;  4ODR A;  2YBU A;  3ART A;  1ZCN A;  5HW8 A;  4FAP A;  1KT1 A;  4S3K A;  4TW7 A;  3RM8 A;  4LAX A;  4U86 A;  3NRK A;  2MLX A;  3G6L A;  2MLZ A;  3RM4 A;  1W1P A;  2F21 A;  3RME A;  3BXW A;  1OGG A;  1FKH A;  1OWQ A;  1UR8 A;  1WNO A;  3B9E A;  4MTV A;  2F4E A;  4DRN A;  4DH0 A;  3FY1 A;  2N87 A;  1ITX A;  1T11 A;  3WD2 A;  1W1V A;  4DRI A;  1FKR A;  2A3C A;  4ML4 A;  2Q5A A;  3CHF A;  4KQZ A;  3ARZ A;  1W1T A;  1U79 A;  4HAR A;  3WD0 A;  1JVW A;  4IT4 A;  2M08 A;  1NWR A;  1ZBW A;  1W9V A;  1FAP A;  2DG3 A;  2WM0 A;  3RM9 A;  1ZB5 A;  2VCD A;  1QZ2 A;  3O5K A;  4DRO A;  3TDB A;  2M1I A;  4S3J A;  1HKK A;  3O5R A;  3QOK A;  4BF8 A;  1UR9 A;  3AS2 A;  1N1A A;  2DPE A;  3JYJ A;  2MLY A;  4ODQ A;  3AS1 A;  1D2K A;  2ZQV A;  2B31 A;  1EYM A;  1SR0 A;  1LG2 A;  1LJY A;  2XP3 A;  2KGJ A;  3KAH A;  4TNS A;  4J4N A;  3PA7 A;  2XP7 A;  4WKA A;  4DWS B;  5GQB A;  1NWS A;  2A3E A;  2ZR6 A;  4R0X A;  4ODN A;  1ZBV A;  4QT3 A;  1HJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...