1NMWA

Solution structure of the ppiase domain of human pin1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
GEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Mitotic Regulator hPin1 in Solution: INSIGHTS INTO DOMAIN ARCHITECTURE AND SUBSTRATE BINDING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 27
structure length 114
sequence length 114
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nmwA00
2XP5A 1FKGA 4IQ2A 4LAYA 3MDYB 3O5IA 1Q6UA 1Q6HA 2MNTA 2Q5AA 2XPAA 3GPKA 4DIPA 1PINA 2PV1A 2JZVA 3O5GA 4G50A 1FKRA 1ROUA 2ZR6A 2RSEA 4J4OA 3O5LA 2RQSA 3O5QA 4MGVA 2LPVA 4TW8A 4TYOA 3O5MA 2MF9A 4BF8A 1NMWA 2KGJA 2MLYA 2RUDA 1C9HA 2ZQSA 1FD9A 1YW5A 4ODRA 5J6EA 1JNTA 1NMVA 4IPXA 4ODPA 2PPNA 2DG3A 4LAWA 1KT1A 4ODMA 4DRNA 2RUQA 4FAPA 1F8AB 5HWCA 2VN1A 3UF8A 1A7XA 2KR7A 5HT1A 1EQ3A 4W9PA 3OOBA 1QPFA 3ODKA 3PA7A 3RFWA 4W9OA 1D7HA 4JFMA 4GIVA 2XP4A 2UZ5A 4JYSA 2XP8A 3KADA 1YATA 2M1IA 1QZ2A 4J4NA 3JYJA 4TW6A 4MSPA 3B7XA 4DRHA 3PRDA 2ZR4A 4DRPA 2LKNA 4JFKA 1BKFA 3KABA 4TX0A 2OFNA 2M2AA 3O5FA 2MLXA 3H9RB 4LAVA 4O2TA 4ODLA 4JFLA 3CGMA 4G2PA 4DRJA 2PV3A 5DIUA 1F40A 2PPPA 2N87A 2MPHA 2PPOA 1J4RA 3O5JA 1FAPA 5GPGA 3IHZA 1JVWA 3FAPA 4FN2A 3UQAA 4DRQA 3EY6A 4DT4A 2Y78A 3CGNA 1N1AA 1D7IA 2KI3A 3O5DA 2ZQVA 4GGQA 2D9FA 5HWBA 4U86A 1FKTA 3RGCA 3O5PA 4IQCA 1ZK6A 2XP7A 1HXVA 3IKGA 1W26A 3UQIA 2F2DA 3LUOA 2XP9A 4DZ2A 2ZQTA 4DRMA 3NI6A 3TDBA 2DG4A 2KE0A 1D6OA 1J4HA 1FKDA 3NRKA 3WH0A 2MLZA 3NTPA 1D7JA 1FKJA 3TC5A 4C02B 4U85A 3KAGA 4ODOA 1FKKA 1EYMA 2RURA 4W9QA 3I6CA 2VCDA 1Q1CA 3JXVA 4TW7A 2KFWA 3UI5A 4QT2A 1QPLA 2PBCA 3KAFA 1BL4A 2FKEA 5HTGA 5B8IC 2IF4A 3O5EA 1FKFA 3O5KA 4JFJA 5BXJA 4QIBA 3VAWA 2FAPA 4DROA 3JYMA 2DG9A 2LJ4A 1Y0OA 2RUCA 1PBKA 3O5OA 1FKIA 2XP6A 4ODNA 5DITA 3KCEA 4DH0A 3IK8A 5HW7A 4JFIA 4R0XA 2F4EA 1B6CA 1FKBA 4LAXA 5HW6A 1JNSA 1R9HA 1NSGA 5D75A 3IKDA 3KACA 1FKHA 1Q6IA 2PV2A 1T11A 4DRKA 1J4IA 2K8IA 2LGOA 2XPBA 3KZ7A 3PRBA 5HW8A 3KAIA 5HUAA 3TCZA 5I98A 1M5YA 1FJDA 5DIVA 1FKLA 4N19A 2ZR5A 3O5RA 4TNSA 2AWGA 2F21A 4U84A 1FKSA 1KT0A 2ZQUA 4DRIA 1ZCNA 2L2SA 4ODKA 2ITKA 4DZ3A 1J6YA 4ODQA 1P5QA 2XP3A 4QT3A 3UI4A 5HKGA 3UQBA 2M08A 3KAHA 4ITZA 1L1PA 4NNRA 3UI6A 1U79A 1TCOC 1ROTA 2KO7A
chains in the Genus database with same CATH superfamily
2XP5A 4LGXA 2DT3A 4DIPA 2DT0A 2JZVA 3WQWA 4BF8A 2MF9A 1NMWA 1YW5A 5HBFA 2YBUA 1NH6A 5HWCA 1W1TA 2VN1A 1WB0A 1A7XA 1QPFA 3ODKA 3AS2A 1D7HA 4JFMA 1XRVA 1E44A 1KFWA 1YATA 4J4NA 2A3EA 4MSPA 2ZR4A 3WD4A 4DRPA 2LKNA 2B31A 1E6NA 2OFNA 1CTNA 4LAVA 4JFLA 3CGMA 4G2PA 3O5JA 3ARUA 1FAPA 3FAPA 3AQUA 1OWQA 3O5DA 2ZQVA 4GGQA 2D9FA 5HWBA 1GRJA 4HBOA 1ITXA 3RGCA 3CH9A 2A3CA 1HXVA 1H0GA 2XP9A 3ARRA 3WQVA 2KE0A 1J4HA 1FKDA 3NRKA 1VF8A 3ARYA 3RM8A 3NTPA 1W9VA 1D7JA 1HKKA 4W5UA 3KAGA 4P8UA 2VCDA 1Q1CA 1OGBA 1E9LA 2G41A 2KFWA 2PBCA 1E6PA 4QZVB 1BL4A 4ZPWR 1JNEA 3ARTA 3O5EA 3ARPA 4QIBA 1D2KA 4MNJA 1TFVA 2FAPA 4DROA 4MNKA 2RUCA 3VAWA 1PBKA 1FKIA 2XP6A 5HW7A 4LAXA 1LL4A 1LJYA 3IKDA 1UR9A 1W9PA 3FXYA 1LL7A 3KACA 1FKHA 2PV2A 3KZ7A 4WKAA 2DSUA 5HUAA 5I98A 4MNMA 1M5YA 3OA5A 3AROA 1KT0A 2ZQUA 3CHEA 3RM9A 2ESCA 4Z2HA 2DSWA 4P8XA 3UQBA 1FFQA 4URIA 1UR8A 1Q6HA 1HJXA 3MDYB 5DO2A 2RSEA 3B9AA 1ZBCA 3O5QA 1RD6A 4MGVA 4TW8A 2KGJA 2MLYA 1FD9A 5J6EA 1NMVA 4IPXA 4ODPA 4Z2GA 2DG3A 4LAWA 4FAPA 1ZBWA 5DF0A 3RMEA 4Z2KA 1W1VA 4Q7NA 4W9PA 2O92A 3RFWA 2XP4A 2UZ5A 4TW6A 4AY1A 1QZ2A 3B7XA 4JFKA 1BKFA 3KABA 2MLXA 4DWSC 3H9RB 1HKMA 4ODLA 4DRJA 5DIUA 2PPPA 2MPHA 3WL1A 1J4RA 4DRQA 3ARSA 3EY6A 1NWTA 2Y78A 4KQZA 1D7IA 1NWRA 1ZK6A 2A3BA 1W26A 2F2DA 3G6MA 4DWSA 3TDBA 2DG4A 1D6OA 4NSBA 4NZCA 2DT1A 4S3KA 1EYMA 2RURA 1X6NA 4XAKA 1QPLA 2YBTA 1LG1A 3GU0A 3WIJA 1HJWA 2IF4A 1FKFA 3FY1A 4Z2LA 4DH0A 4UDMA 5DITA 3KCEA 1NWSA 1B6CA 1FKBA 4PTMA 5HW6A 1JCHB 2OLHA 1NSGA 5D75A 2FDMA 2P4VA 4Q22A 1J4IA 2K8IA 2XPBA 5HW8A 2WK2A 1FJDA 1LL6A 5DIVA 4N19A 4HBEA 4U84A 1FKSA 4WKFA 4DRIA 2L2SA 2QF8A 4WK9A 1E6RA 2XP3A 3UI4A 1L1PA 2A3AA 4ITZA 1ROTA 2MLZA 2KO7A 4IQ2A 1Q6UA 2XPAA 2G8ZA 4MTVA 3O5GA 4G50A 2ZR6A 3O5LA 2RQSA 4WKHA 4TYOA 4ZS6A 2ZQSA 1C9HA 4ODRA 1KT1A 4DRNA 2RUQA 2KR7A 5HT1A 3OOBA 2DPEA 4W9OA 3RM4A 4GIVA 4Z2IA 2IUZA 3PR9A 2XP8A 3KADA 3JYJA 3WD1A 1SR0A 4WIWA 3GTYX 3O5FA 4O2TA 1HKJA 1HJVA 2F23A 1ZB5A 2N87A 1GUVA 1ZBKA 5GPGA 1JVWA 4FN2A 4DT4A 1O6IA 3CGNA 1N1AA 3PRAA 3EIPA 3O5PA 4DWSB 3UQIA 2ZQTA 3G6LA 3NI6A 1IX5A 2WM0A 3BMBA 3TC5A 4U85A 4KR0B 4ODOA 3WD0A 2DT2A 1LQ0A 3I6CA 3JXVA 4TW7A 2AOSA 4QT2A 3KAFA 2DSZA 5HTGA 4R5EA 1K9TA 5BXJA 3O5KA 4JFJA 3ARZA 2DG9A 1Y0OA 3JYMA 3O5OA 1LG2A 1EHNA 3IK8A 2F4EA 1NWUA 1GPFA 2ETNA 4DRKA 1E15A 2LGOA 1JNDA 3PRBA 4ML4A 1W1PA 3TCZA 4MPKA 1ZCNA 3AS0A 3BXWA 4DZ3A 3B9DA 4ODQA 2WLZA 3KAHA 4NNRA 1W1YA 3CHFA 2PN0A 1FKGA 4LAYA 3O5IA 1E6ZA 2MNTA 4IT4A 2Q5AA 3GPKA 1PINA 2PV1A 1W9UA 1FKRA 1ROUA 4J4OA 2LPVA 4DWSD 1OGGA 3O5MA 2RUDA 1JNTA 2PPNA 3ARWA 4ODMA 1ZU8A 1F8AB 3ALGA 1EDQA 3UF8A 1EQ3A 1X6LA 4Z2JA 3PA7A 4P8VA 1ZL1A 4MAVA 1HKIA 4JYSA 4L72B 4HARA 2B5UB 2M1IA 3WL0A 3QOKA 4DRHA 3PRDA 4TX0A 4S3JA 4MNLA 2M2AA 3ALFA 3B8SA 2PV3A 3CHCA 1F40A 3CHDA 2PPOA 3WD3A 3IHZA 3W4RA 1WNOA 2KI3A 4U86A 1FKTA 4IQCA 2XP7A 3IKGA 3AS3A 1ZBVA 2WLYA 3LUOA 4WJXA 4DZ2A 4DRMA 5JH8A 4P8WA 3WH0A 3AS1A 1FKJA 4C02B 1FKKA 2DSVA 4W9QA 1SYTA 1H0IA 1GOIA 4IT6A 3B9EA 4ZPTR 5GPRA 3UI5A 2FKEA 5B8IC 2O9OA 4L3NA 1JNSA 4ODNA 2LJ4A 3UQAA 5DEZA 3ARXA 4JFIA 5GQBA 4R0XA 3WD2A 1R9HA 1XHGA 1Q6IA 1EIBA 1T11A 3CZ8A 3KAIA 1FKLA 2ZR5A 3WKZA 2PI6A 3O5RA 2AWGA 2F21A 4TNSA 4ODKA 2ITKA 1FFRA 3ARVA 1J6YA 1P5QA 1WAWA 4QT3A 4ZPVR 5HKGA 2M08A 2EULA 3UI6A 1U79A 1TCOC 3ARQA
chains in the Genus database with same CATH topology
2XP5A 4LGXA 2DT3A 4DIPA 2DT0A 2JZVA 3WQWA 4BF8A 2MF9A 1NMWA 1YW5A 5HBFA 2YBUA 1NH6A 5HWCA 1W1TA 2VN1A 1WB0A 1A7XA 1QPFA 3ODKA 3AS2A 1D7HA 4JFMA 1XRVA 1KFWA 1YATA 4J4NA 2A3EA 4MSPA 2ZR4A 3WD4A 4DRPA 2LKNA 2B31A 1E6NA 2OFNA 1CTNA 4LAVA 4JFLA 3CGMA 4G2PA 3O5JA 3ARUA 1FAPA 3FAPA 3AQUA 1OWQA 3O5DA 2ZQVA 4GGQA 2D9FA 5HWBA 4HBOA 1ITXA 3RGCA 3CH9A 2A3CA 1HXVA 1H0GA 2XP9A 3ARRA 3WQVA 2KE0A 1J4HA 1FKDA 3NRKA 1VF8A 3ARYA 3RM8A 3NTPA 1W9VA 1D7JA 1HKKA 4W5UA 3KAGA 4P8UA 2VCDA 1Q1CA 1OGBA 1E9LA 2G41A 2KFWA 2PBCA 1E6PA 4QZVB 1BL4A 4ZPWR 1JNEA 3ARTA 3O5EA 3ARPA 4QIBA 1D2KA 4MNJA 1TFVA 2FAPA 4DROA 4MNKA 2RUCA 3VAWA 1PBKA 1FKIA 2XP6A 5HW7A 4LAXA 1LL4A 1LJYA 3IKDA 1UR9A 1W9PA 3FXYA 1LL7A 3KACA 1FKHA 2PV2A 3KZ7A 4WKAA 2DSUA 5HUAA 5I98A 4MNMA 1M5YA 3OA5A 3AROA 1KT0A 2ZQUA 3CHEA 3RM9A 2ESCA 4Z2HA 2DSWA 4P8XA 3UQBA 1FFQA 4URIA 1UR8A 1Q6HA 1HJXA 3MDYB 5DO2A 2RSEA 3B9AA 1ZBCA 3O5QA 1RD6A 4MGVA 4TW8A 2KGJA 2MLYA 1FD9A 5J6EA 1NMVA 4IPXA 4ODPA 4Z2GA 2DG3A 4LAWA 4FAPA 1ZBWA 5DF0A 3RMEA 4Z2KA 1W1VA 4Q7NA 4W9PA 2O92A 3RFWA 2XP4A 2UZ5A 4TW6A 4AY1A 1QZ2A 3B7XA 4JFKA 1BKFA 3KABA 2MLXA 4DWSC 3H9RB 1HKMA 4ODLA 4DRJA 5DIUA 2PPPA 2MPHA 3WL1A 1J4RA 4DRQA 3ARSA 3EY6A 1NWTA 2Y78A 4KQZA 1D7IA 1NWRA 1ZK6A 2A3BA 1W26A 2F2DA 3G6MA 4DWSA 3TDBA 2DG4A 1D6OA 4NSBA 4NZCA 2DT1A 4S3KA 1EYMA 2RURA 1X6NA 4XAKA 1QPLA 2YBTA 1LG1A 3WIJA 1HJWA 2IF4A 1FKFA 3FY1A 4Z2LA 4DH0A 5DITA 3KCEA 1NWSA 1B6CA 1FKBA 4PTMA 5HW6A 2OLHA 1NSGA 5D75A 2FDMA 4Q22A 1J4IA 2K8IA 2XPBA 5HW8A 2WK2A 1FJDA 1LL6A 5DIVA 4N19A 4HBEA 4U84A 1FKSA 4WKFA 4DRIA 2L2SA 2QF8A 4WK9A 1E6RA 2XP3A 3UI4A 1L1PA 2A3AA 4ITZA 1ROTA 2MLZA 2KO7A 4IQ2A 1Q6UA 2XPAA 2G8ZA 4MTVA 3O5GA 4G50A 2ZR6A 3O5LA 2RQSA 4WKHA 4TYOA 4ZS6A 2ZQSA 1C9HA 4ODRA 1KT1A 4DRNA 2RUQA 2KR7A 5HT1A 3OOBA 2DPEA 4W9OA 3RM4A 4GIVA 4Z2IA 2IUZA 3PR9A 2XP8A 3KADA 3JYJA 3WD1A 1SR0A 4WIWA 3O5FA 4O2TA 1HKJA 1HJVA 1ZB5A 2N87A 1GUVA 1ZBKA 5GPGA 1JVWA 4FN2A 4DT4A 1O6IA 3CGNA 1N1AA 3PRAA 3O5PA 4DWSB 3UQIA 2ZQTA 3G6LA 3NI6A 1IX5A 2WM0A 3TC5A 4U85A 4KR0B 4ODOA 3WD0A 2DT2A 1LQ0A 3I6CA 3JXVA 4TW7A 2AOSA 4QT2A 3KAFA 2DSZA 5HTGA 4R5EA 1K9TA 5BXJA 3O5KA 4JFJA 3ARZA 2DG9A 1Y0OA 3JYMA 3O5OA 1LG2A 1EHNA 3IK8A 2F4EA 1NWUA 1GPFA 4DRKA 1E15A 2LGOA 1JNDA 3PRBA 4ML4A 1W1PA 3TCZA 4MPKA 1ZCNA 3AS0A 3BXWA 4DZ3A 3B9DA 4ODQA 2WLZA 3KAHA 4NNRA 1W1YA 3CHFA 1FKGA 4LAYA 3O5IA 1E6ZA 2MNTA 4IT4A 2Q5AA 3GPKA 1PINA 2PV1A 1W9UA 1FKRA 1ROUA 4J4OA 2LPVA 4DWSD 1OGGA 3O5MA 2RUDA 1JNTA 2PPNA 3ARWA 4ODMA 1ZU8A 1F8AB 3ALGA 1EDQA 3UF8A 1EQ3A 1X6LA 4Z2JA 3PA7A 4P8VA 1ZL1A 4MAVA 1HKIA 4JYSA 4L72B 2M1IA 4HARA 3WL0A 3QOKA 4DRHA 3PRDA 4TX0A 4S3JA 4MNLA 2M2AA 3ALFA 3B8SA 2PV3A 3CHCA 1F40A 3CHDA 2PPOA 3WD3A 3IHZA 3W4RA 1WNOA 2KI3A 4U86A 1FKTA 4IQCA 2XP7A 3IKGA 3AS3A 1ZBVA 2WLYA 3LUOA 4WJXA 4DZ2A 4DRMA 5JH8A 4P8WA 3WH0A 3AS1A 1FKJA 4C02B 1FKKA 2DSVA 4W9QA 1SYTA 1H0IA 1GOIA 4IT6A 3B9EA 4ZPTR 5GPRA 3UI5A 2FKEA 5B8IC 2O9OA 4L3NA 1JNSA 4ODNA 2LJ4A 3UQAA 5DEZA 3ARXA 4JFIA 5GQBA 4R0XA 3WD2A 1R9HA 1XHGA 1Q6IA 1EIBA 1T11A 3CZ8A 3KAIA 1FKLA 2ZR5A 3WKZA 2PI6A 3O5RA 2AWGA 2F21A 4TNSA 4ODKA 2ITKA 1FFRA 3ARVA 1J6YA 1P5QA 1WAWA 4QT3A 4ZPVR 5HKGA 2M08A 3UI6A 1U79A 1TCOC 3ARQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP5 A;  1FKG A;  4IQ2 A;  4LAY A;  3MDY B;  3O5I A;  1Q6U A;  1Q6H A;  2MNT A;  2Q5A A;  2XPA A;  3GPK A;  4DIP A;  1PIN A;  2PV1 A;  2JZV A;  3O5G A;  4G50 A;  1FKR A;  1ROU A;  2ZR6 A;  2RSE A;  4J4O A;  3O5L A;  2RQS A;  3O5Q A;  4MGV A;  2LPV A;  4TW8 A;  4TYO A;  3O5M A;  2MF9 A;  4BF8 A;  1NMW A;  2KGJ A;  2MLY A;  2RUD A;  1C9H A;  2ZQS A;  1FD9 A;  1YW5 A;  4ODR A;  5J6E A;  1JNT A;  1NMV A;  4IPX A;  4ODP A;  2PPN A;  2DG3 A;  4LAW A;  1KT1 A;  4ODM A;  4DRN A;  2RUQ A;  4FAP A;  1F8A B;  5HWC A;  2VN1 A;  3UF8 A;  1A7X A;  2KR7 A;  5HT1 A;  1EQ3 A;  4W9P A;  3OOB A;  1QPF A;  3ODK A;  3PA7 A;  3RFW A;  4W9O A;  1D7H A;  4JFM A;  4GIV A;  2XP4 A;  2UZ5 A;  4JYS A;  2XP8 A;  3KAD A;  1YAT A;  2M1I A;  1QZ2 A;  4J4N A;  3JYJ A;  4TW6 A;  4MSP A;  3B7X A;  4DRH A;  3PRD A;  2ZR4 A;  4DRP A;  2LKN A;  4JFK A;  1BKF A;  3KAB A;  4TX0 A;  2OFN A;  2M2A A;  3O5F A;  2MLX A;  3H9R B;  4LAV A;  4O2T A;  4ODL A;  4JFL A;  3CGM A;  4G2P A;  4DRJ A;  2PV3 A;  5DIU A;  1F40 A;  2PPP A;  2N87 A;  2MPH A;  2PPO A;  1J4R A;  3O5J A;  1FAP A;  5GPG A;  3IHZ A;  1JVW A;  3FAP A;  4FN2 A;  3UQA A;  4DRQ A;  3EY6 A;  4DT4 A;  2Y78 A;  3CGN A;  1N1A A;  1D7I A;  2KI3 A;  3O5D A;  2ZQV A;  4GGQ A;  2D9F A;  5HWB A;  4U86 A;  1FKT A;  3RGC A;  3O5P A;  4IQC A;  1ZK6 A;  2XP7 A;  1HXV A;  3IKG A;  1W26 A;  3UQI A;  2F2D A;  3LUO A;  2XP9 A;  4DZ2 A;  2ZQT A;  4DRM A;  3NI6 A;  3TDB A;  2DG4 A;  2KE0 A;  1D6O A;  1J4H A;  1FKD A;  3NRK A;  3WH0 A;  2MLZ A;  3NTP A;  1D7J A;  1FKJ A;  3TC5 A;  4C02 B;  4U85 A;  3KAG A;  4ODO A;  1FKK A;  1EYM A;  2RUR A;  4W9Q A;  3I6C A;  2VCD A;  1Q1C A;  3JXV A;  4TW7 A;  2KFW A;  3UI5 A;  4QT2 A;  1QPL A;  2PBC A;  3KAF A;  1BL4 A;  2FKE A;  5HTG A;  5B8I C;  2IF4 A;  3O5E A;  1FKF A;  3O5K A;  4JFJ A;  5BXJ A;  4QIB A;  3VAW A;  2FAP A;  4DRO A;  3JYM A;  2DG9 A;  2LJ4 A;  1Y0O A;  2RUC A;  1PBK A;  3O5O A;  1FKI A;  2XP6 A;  4ODN A;  5DIT A;  3KCE A;  4DH0 A;  3IK8 A;  5HW7 A;  4JFI A;  4R0X A;  2F4E A;  1B6C A;  1FKB A;  4LAX A;  5HW6 A;  1JNS A;  1R9H A;  1NSG A;  5D75 A;  3IKD A;  3KAC A;  1FKH A;  1Q6I A;  2PV2 A;  1T11 A;  4DRK A;  1J4I A;  2K8I A;  2LGO A;  2XPB A;  3KZ7 A;  3PRB A;  5HW8 A;  3KAI A;  5HUA A;  3TCZ A;  5I98 A;  1M5Y A;  1FJD A;  5DIV A;  1FKL A;  4N19 A;  2ZR5 A;  3O5R A;  4TNS A;  2AWG A;  2F21 A;  4U84 A;  1FKS A;  1KT0 A;  2ZQU A;  4DRI A;  1ZCN A;  2L2S A;  4ODK A;  2ITK A;  4DZ3 A;  1J6Y A;  4ODQ A;  1P5Q A;  2XP3 A;  4QT3 A;  3UI4 A;  5HKG A;  3UQB A;  2M08 A;  3KAH A;  4ITZ A;  1L1P A;  4NNR A;  3UI6 A;  1U79 A;  1TCO C;  1ROT A;  2KO7 A; 
#chains in the Genus database with same CATH topology
 2XP5 A;  4LGX A;  2DT3 A;  4DIP A;  2DT0 A;  2JZV A;  3WQW A;  4BF8 A;  2MF9 A;  1NMW A;  1YW5 A;  5HBF A;  2YBU A;  1NH6 A;  5HWC A;  1W1T A;  2VN1 A;  1WB0 A;  1A7X A;  1QPF A;  3ODK A;  3AS2 A;  1D7H A;  4JFM A;  1XRV A;  1E44 A;  1KFW A;  1YAT A;  4J4N A;  2A3E A;  4MSP A;  2ZR4 A;  3WD4 A;  4DRP A;  2LKN A;  2B31 A;  1E6N A;  2OFN A;  1CTN A;  4LAV A;  4JFL A;  3CGM A;  4G2P A;  3O5J A;  3ARU A;  1FAP A;  3FAP A;  3AQU A;  1OWQ A;  3O5D A;  2ZQV A;  4GGQ A;  2D9F A;  5HWB A;  1GRJ A;  4HBO A;  1ITX A;  3RGC A;  3CH9 A;  2A3C A;  1HXV A;  1H0G A;  2XP9 A;  3ARR A;  3WQV A;  2KE0 A;  1J4H A;  1FKD A;  3NRK A;  1VF8 A;  3ARY A;  3RM8 A;  3NTP A;  1W9V A;  1D7J A;  1HKK A;  4W5U A;  3KAG A;  4P8U A;  2VCD A;  1Q1C A;  1OGB A;  1E9L A;  2G41 A;  2KFW A;  2PBC A;  1E6P A;  4QZV B;  1BL4 A;  4ZPW R;  1JNE A;  3ART A;  3O5E A;  3ARP A;  4QIB A;  1D2K A;  4MNJ A;  1TFV A;  2FAP A;  4DRO A;  4MNK A;  2RUC A;  3VAW A;  1PBK A;  1FKI A;  2XP6 A;  5HW7 A;  4LAX A;  1LL4 A;  1LJY A;  3IKD A;  1UR9 A;  1W9P A;  3FXY A;  1LL7 A;  3KAC A;  1FKH A;  2PV2 A;  3KZ7 A;  4WKA A;  2DSU A;  5HUA A;  5I98 A;  4MNM A;  1M5Y A;  3OA5 A;  3ARO A;  1KT0 A;  2ZQU A;  3CHE A;  3RM9 A;  2ESC A;  4Z2H A;  2DSW A;  4P8X A;  3UQB A;  1FFQ A;  4URI A;  1UR8 A;  1Q6H A;  1HJX A;  3MDY B;  5DO2 A;  2RSE A;  3B9A A;  1ZBC A;  3O5Q A;  1RD6 A;  4MGV A;  4TW8 A;  2KGJ A;  2MLY A;  1FD9 A;  5J6E A;  1NMV A;  4IPX A;  4ODP A;  4Z2G A;  2DG3 A;  4LAW A;  4FAP A;  1ZBW A;  5DF0 A;  3RME A;  4Z2K A;  1W1V A;  4Q7N A;  4W9P A;  2O92 A;  3RFW A;  2XP4 A;  2UZ5 A;  4TW6 A;  4AY1 A;  1QZ2 A;  3B7X A;  4JFK A;  1BKF A;  3KAB A;  2MLX A;  4DWS C;  3H9R B;  1HKM A;  4ODL A;  4DRJ A;  5DIU A;  2PPP A;  2MPH A;  3WL1 A;  1J4R A;  4DRQ A;  3ARS A;  3EY6 A;  1NWT A;  2Y78 A;  4KQZ A;  1D7I A;  1NWR A;  1ZK6 A;  2A3B A;  1W26 A;  2F2D A;  3G6M A;  4DWS A;  3TDB A;  2DG4 A;  1D6O A;  4NSB A;  4NZC A;  2DT1 A;  4S3K A;  1EYM A;  2RUR A;  1X6N A;  4XAK A;  1QPL A;  2YBT A;  1LG1 A;  3GU0 A;  3WIJ A;  1HJW A;  2IF4 A;  1FKF A;  3FY1 A;  4Z2L A;  4DH0 A;  4UDM A;  5DIT A;  3KCE A;  1NWS A;  1B6C A;  1FKB A;  4PTM A;  5HW6 A;  1JCH B;  2OLH A;  1NSG A;  5D75 A;  2FDM A;  2P4V A;  4Q22 A;  1J4I A;  2K8I A;  2XPB A;  5HW8 A;  2WK2 A;  1FJD A;  1LL6 A;  5DIV A;  4N19 A;  4HBE A;  4U84 A;  1FKS A;  4WKF A;  4DRI A;  2L2S A;  2QF8 A;  4WK9 A;  1E6R A;  2XP3 A;  3UI4 A;  1L1P A;  2A3A A;  4ITZ A;  1ROT A;  2MLZ A;  2KO7 A;  4IQ2 A;  1Q6U A;  2XPA A;  2G8Z A;  4MTV A;  3O5G A;  4G50 A;  2ZR6 A;  3O5L A;  2RQS A;  4WKH A;  4TYO A;  4ZS6 A;  2ZQS A;  1C9H A;  4ODR A;  1KT1 A;  4DRN A;  2RUQ A;  2KR7 A;  5HT1 A;  3OOB A;  2DPE A;  4W9O A;  3RM4 A;  4GIV A;  4Z2I A;  2IUZ A;  3PR9 A;  2XP8 A;  3KAD A;  3JYJ A;  3WD1 A;  1SR0 A;  4WIW A;  3GTY X;  3O5F A;  4O2T A;  1HKJ A;  1HJV A;  2F23 A;  1ZB5 A;  2N87 A;  1GUV A;  1ZBK A;  5GPG A;  1JVW A;  4FN2 A;  4DT4 A;  1O6I A;  3CGN A;  1N1A A;  3PRA A;  3EIP A;  3O5P A;  4DWS B;  3UQI A;  2ZQT A;  3G6L A;  3NI6 A;  1IX5 A;  2WM0 A;  3BMB A;  3TC5 A;  4U85 A;  4KR0 B;  4ODO A;  3WD0 A;  2DT2 A;  1LQ0 A;  3I6C A;  3JXV A;  4TW7 A;  2AOS A;  4QT2 A;  3KAF A;  2DSZ A;  5HTG A;  4R5E A;  1K9T A;  5BXJ A;  3O5K A;  4JFJ A;  3ARZ A;  2DG9 A;  1Y0O A;  3JYM A;  3O5O A;  1LG2 A;  1EHN A;  3IK8 A;  2F4E A;  1NWU A;  1GPF A;  2ETN A;  4DRK A;  1E15 A;  2LGO A;  1JND A;  3PRB A;  4ML4 A;  1W1P A;  3TCZ A;  4MPK A;  1ZCN A;  3AS0 A;  3BXW A;  4DZ3 A;  3B9D A;  4ODQ A;  2WLZ A;  3KAH A;  4NNR A;  1W1Y A;  3CHF A;  2PN0 A;  1FKG A;  4LAY A;  3O5I A;  1E6Z A;  2MNT A;  4IT4 A;  2Q5A A;  3GPK A;  1PIN A;  2PV1 A;  1W9U A;  1FKR A;  1ROU A;  4J4O A;  2LPV A;  4DWS D;  1OGG A;  3O5M A;  2RUD A;  1JNT A;  2PPN A;  3ARW A;  4ODM A;  1ZU8 A;  1F8A B;  3ALG A;  1EDQ A;  3UF8 A;  1EQ3 A;  1X6L A;  4Z2J A;  3PA7 A;  4P8V A;  1ZL1 A;  4MAV A;  1HKI A;  4JYS A;  4L72 B;  4HAR A;  2B5U B;  2M1I A;  3WL0 A;  3QOK A;  4DRH A;  3PRD A;  4TX0 A;  4S3J A;  4MNL A;  2M2A A;  3ALF A;  3B8S A;  2PV3 A;  3CHC A;  1F40 A;  3CHD A;  2PPO A;  3WD3 A;  3IHZ A;  3W4R A;  1WNO A;  2KI3 A;  4U86 A;  1FKT A;  4IQC A;  2XP7 A;  3IKG A;  3AS3 A;  1ZBV A;  2WLY A;  3LUO A;  4WJX A;  4DZ2 A;  4DRM A;  5JH8 A;  4P8W A;  3WH0 A;  3AS1 A;  1FKJ A;  4C02 B;  1FKK A;  2DSV A;  4W9Q A;  1SYT A;  1H0I A;  1GOI A;  4IT6 A;  3B9E A;  4ZPT R;  5GPR A;  3UI5 A;  2FKE A;  5B8I C;  2O9O A;  4L3N A;  1JNS A;  4ODN A;  2LJ4 A;  3UQA A;  5DEZ A;  3ARX A;  4JFI A;  5GQB A;  4R0X A;  3WD2 A;  1R9H A;  1XHG A;  1Q6I A;  1EIB A;  1T11 A;  3CZ8 A;  3KAI A;  1FKL A;  2ZR5 A;  3WKZ A;  2PI6 A;  3O5R A;  2AWG A;  2F21 A;  4TNS A;  4ODK A;  2ITK A;  1FFR A;  3ARV A;  1J6Y A;  1P5Q A;  1WAW A;  4QT3 A;  4ZPV R;  5HKG A;  2M08 A;  2EUL A;  3UI6 A;  1U79 A;  1TCO C;  3ARQ A; 
#chains in the Genus database with same CATH homology
 2XP5 A;  4LGX A;  2DT3 A;  4DIP A;  2DT0 A;  2JZV A;  3WQW A;  4BF8 A;  2MF9 A;  1NMW A;  1YW5 A;  5HBF A;  2YBU A;  1NH6 A;  5HWC A;  1W1T A;  2VN1 A;  1WB0 A;  1A7X A;  1QPF A;  3ODK A;  3AS2 A;  1D7H A;  4JFM A;  1XRV A;  1KFW A;  1YAT A;  4J4N A;  2A3E A;  4MSP A;  2ZR4 A;  3WD4 A;  4DRP A;  2LKN A;  2B31 A;  1E6N A;  2OFN A;  1CTN A;  4LAV A;  4JFL A;  3CGM A;  4G2P A;  3O5J A;  3ARU A;  1FAP A;  3FAP A;  3AQU A;  1OWQ A;  3O5D A;  2ZQV A;  4GGQ A;  2D9F A;  5HWB A;  4HBO A;  1ITX A;  3RGC A;  3CH9 A;  2A3C A;  1HXV A;  1H0G A;  2XP9 A;  3ARR A;  3WQV A;  2KE0 A;  1J4H A;  1FKD A;  3NRK A;  1VF8 A;  3ARY A;  3RM8 A;  3NTP A;  1W9V A;  1D7J A;  1HKK A;  4W5U A;  3KAG A;  4P8U A;  2VCD A;  1Q1C A;  1OGB A;  1E9L A;  2G41 A;  2KFW A;  2PBC A;  1E6P A;  4QZV B;  1BL4 A;  4ZPW R;  1JNE A;  3ART A;  3O5E A;  3ARP A;  4QIB A;  1D2K A;  4MNJ A;  1TFV A;  2FAP A;  4DRO A;  4MNK A;  2RUC A;  3VAW A;  1PBK A;  1FKI A;  2XP6 A;  5HW7 A;  4LAX A;  1LL4 A;  1LJY A;  3IKD A;  1UR9 A;  1W9P A;  3FXY A;  1LL7 A;  3KAC A;  1FKH A;  2PV2 A;  3KZ7 A;  4WKA A;  2DSU A;  5HUA A;  5I98 A;  4MNM A;  1M5Y A;  3OA5 A;  3ARO A;  1KT0 A;  2ZQU A;  3CHE A;  3RM9 A;  2ESC A;  4Z2H A;  2DSW A;  4P8X A;  3UQB A;  1FFQ A;  4URI A;  1UR8 A;  1Q6H A;  1HJX A;  3MDY B;  5DO2 A;  2RSE A;  3B9A A;  1ZBC A;  3O5Q A;  1RD6 A;  4MGV A;  4TW8 A;  2KGJ A;  2MLY A;  1FD9 A;  5J6E A;  1NMV A;  4IPX A;  4ODP A;  4Z2G A;  2DG3 A;  4LAW A;  4FAP A;  1ZBW A;  5DF0 A;  3RME A;  4Z2K A;  1W1V A;  4Q7N A;  4W9P A;  2O92 A;  3RFW A;  2XP4 A;  2UZ5 A;  4TW6 A;  4AY1 A;  1QZ2 A;  3B7X A;  4JFK A;  1BKF A;  3KAB A;  2MLX A;  4DWS C;  3H9R B;  1HKM A;  4ODL A;  4DRJ A;  5DIU A;  2PPP A;  2MPH A;  3WL1 A;  1J4R A;  4DRQ A;  3ARS A;  3EY6 A;  1NWT A;  2Y78 A;  4KQZ A;  1D7I A;  1NWR A;  1ZK6 A;  2A3B A;  1W26 A;  2F2D A;  3G6M A;  4DWS A;  3TDB A;  2DG4 A;  1D6O A;  4NSB A;  4NZC A;  2DT1 A;  4S3K A;  1EYM A;  2RUR A;  1X6N A;  4XAK A;  1QPL A;  2YBT A;  1LG1 A;  3WIJ A;  1HJW A;  2IF4 A;  1FKF A;  3FY1 A;  4Z2L A;  4DH0 A;  5DIT A;  3KCE A;  1NWS A;  1B6C A;  1FKB A;  4PTM A;  5HW6 A;  2OLH A;  1NSG A;  5D75 A;  2FDM A;  4Q22 A;  1J4I A;  2K8I A;  2XPB A;  5HW8 A;  2WK2 A;  1FJD A;  1LL6 A;  5DIV A;  4N19 A;  4HBE A;  4U84 A;  1FKS A;  4WKF A;  4DRI A;  2L2S A;  2QF8 A;  4WK9 A;  1E6R A;  2XP3 A;  3UI4 A;  1L1P A;  2A3A A;  4ITZ A;  1ROT A;  2MLZ A;  2KO7 A;  4IQ2 A;  1Q6U A;  2XPA A;  2G8Z A;  4MTV A;  3O5G A;  4G50 A;  2ZR6 A;  3O5L A;  2RQS A;  4WKH A;  4TYO A;  4ZS6 A;  2ZQS A;  1C9H A;  4ODR A;  1KT1 A;  4DRN A;  2RUQ A;  2KR7 A;  5HT1 A;  3OOB A;  2DPE A;  4W9O A;  3RM4 A;  4GIV A;  4Z2I A;  2IUZ A;  3PR9 A;  2XP8 A;  3KAD A;  3JYJ A;  3WD1 A;  1SR0 A;  4WIW A;  3O5F A;  4O2T A;  1HKJ A;  1HJV A;  1ZB5 A;  2N87 A;  1GUV A;  1ZBK A;  5GPG A;  1JVW A;  4FN2 A;  4DT4 A;  1O6I A;  3CGN A;  1N1A A;  3PRA A;  3O5P A;  4DWS B;  3UQI A;  2ZQT A;  3G6L A;  3NI6 A;  1IX5 A;  2WM0 A;  3TC5 A;  4U85 A;  4KR0 B;  4ODO A;  3WD0 A;  2DT2 A;  1LQ0 A;  3I6C A;  3JXV A;  4TW7 A;  2AOS A;  4QT2 A;  3KAF A;  2DSZ A;  5HTG A;  4R5E A;  1K9T A;  5BXJ A;  3O5K A;  4JFJ A;  3ARZ A;  2DG9 A;  1Y0O A;  3JYM A;  3O5O A;  1LG2 A;  1EHN A;  3IK8 A;  2F4E A;  1NWU A;  1GPF A;  4DRK A;  1E15 A;  2LGO A;  1JND A;  3PRB A;  4ML4 A;  1W1P A;  3TCZ A;  4MPK A;  1ZCN A;  3AS0 A;  3BXW A;  4DZ3 A;  3B9D A;  4ODQ A;  2WLZ A;  3KAH A;  4NNR A;  1W1Y A;  3CHF A;  1FKG A;  4LAY A;  3O5I A;  1E6Z A;  2MNT A;  4IT4 A;  2Q5A A;  3GPK A;  1PIN A;  2PV1 A;  1W9U A;  1FKR A;  1ROU A;  4J4O A;  2LPV A;  4DWS D;  1OGG A;  3O5M A;  2RUD A;  1JNT A;  2PPN A;  3ARW A;  4ODM A;  1ZU8 A;  1F8A B;  3ALG A;  1EDQ A;  3UF8 A;  1EQ3 A;  1X6L A;  4Z2J A;  3PA7 A;  4P8V A;  1ZL1 A;  4MAV A;  1HKI A;  4JYS A;  4L72 B;  2M1I A;  4HAR A;  3WL0 A;  3QOK A;  4DRH A;  3PRD A;  4TX0 A;  4S3J A;  4MNL A;  2M2A A;  3ALF A;  3B8S A;  2PV3 A;  3CHC A;  1F40 A;  3CHD A;  2PPO A;  3WD3 A;  3IHZ A;  3W4R A;  1WNO A;  2KI3 A;  4U86 A;  1FKT A;  4IQC A;  2XP7 A;  3IKG A;  3AS3 A;  1ZBV A;  2WLY A;  3LUO A;  4WJX A;  4DZ2 A;  4DRM A;  5JH8 A;  4P8W A;  3WH0 A;  3AS1 A;  1FKJ A;  4C02 B;  1FKK A;  2DSV A;  4W9Q A;  1SYT A;  1H0I A;  1GOI A;  4IT6 A;  3B9E A;  4ZPT R;  5GPR A;  3UI5 A;  2FKE A;  5B8I C;  2O9O A;  4L3N A;  1JNS A;  4ODN A;  2LJ4 A;  3UQA A;  5DEZ A;  3ARX A;  4JFI A;  5GQB A;  4R0X A;  3WD2 A;  1R9H A;  1XHG A;  1Q6I A;  1EIB A;  1T11 A;  3CZ8 A;  3KAI A;  1FKL A;  2ZR5 A;  3WKZ A;  2PI6 A;  3O5R A;  2AWG A;  2F21 A;  4TNS A;  4ODK A;  2ITK A;  1FFR A;  3ARV A;  1J6Y A;  1P5Q A;  1WAW A;  4QT3 A;  4ZPV R;  5HKG A;  2M08 A;  3UI6 A;  1U79 A;  1TCO C;  3ARQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...