1NMWA

Solution structure of the ppiase domain of human pin1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
GEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural Analysis of the Mitotic Regulator hPin1 in Solution: INSIGHTS INTO DOMAIN ARCHITECTURE AND SUBSTRATE BINDING.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 114
sequence length 114
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nmwA00
2PV2A 2PV3A 2RQSA 4GIVA 3UF8A 1JNSA 1Q6IA 4DRKA 1Y0OA 3JXVA 3KACA 4DRNA 3IKDA 1JNTA 5HW6A 4C02B 4ODMA 4MGVA 1P5QA 1J4HA 4TX0A 1J6YA 4TYOA 2ZQTA 1ZCNA 1QZ2A 2LPVA 2ZR4A 3KZ7A 2KR7A 2RUDA 3FAPA 3TC5A 2KI3A 2KO7A 4JFIA 4DRIA 5HKGA 2DG3A 2RSEA 4FAPA 1ROUA 3O5DA 4ODNA 2RUCA 1YATA 2MF9A 1C9HA 4IPXA 1Q6HA 3RFWA 3O5KA 2FKEA 4LAXA 4U84A 1W26A 5B8IC 5DIVA 3CGMA 1FKFA 4LAYA 2Y78A 3O5OA 5HW8A 1J4RA 1QPFA 3B7XA 3UI4A 1A7XA 1FKIA 1KT1A 1EYMA 2M08A 3NI6A 4IQ2A 3O5RA 2Q5AA 3NTPA 4ODQA 4TW8A 4DT4A 4DRPA 3O5QA 2VN1A 4IQCA 3O5GA 1ROTA 2KGJA 1BKFA 2ZQSA 2PV1A 1FKSA 2FAPA 4DZ3A 1EQ3A 4TNSA 5GPGA 1NSGA 4DRHA 3IHZA 1D6OA 2L2SA 2K8IA 2M1IA 3I6CA 4ODLA 3RGCA 3O5LA 3WH0A 4DRQA 4BF8A 3O5FA 1L1PA 4U85A 4TW6A 2PPPA 3UI5A 3O5JA 4GGQA 1NMWA 4O2TA 1N1AA 1Q6UA 1FKLA 2N87A 2XPBA 1FKDA 3KADA 1R9HA 4LAWA 5HW7A 3TCZA 1BL4A 5HWBA 2XP3A 2IF4A 4J4OA 1F40A 2MLXA 4QT3A 3KCEA 3NRKA 1JVWA 5HWCA 1FKKA 3KAFA 5BXJA 1FKTA 3UQAA 3JYJA 1B6CA 2AWGA 3KAIA 3PA7A 3O5MA 2F4EA 1D7JA 4G2PA 4N19A 2DG9A 2PBCA 3PRBA 1FD9A 1Q1CA 1M5YA 2XP9A 4J4NA 2M2AA 4ODKA 3EY6A 4DROA 3OOBA 3CGNA 2PPOA 1U79A 3LUOA 4DRMA 4JFLA 1FKRA 1NMVA 4G50A 4ODRA 2MPHA 2RUQA 3VAWA 1J4IA 2XP4A 4ODOA 4DH0A 1FAPA 1FKGA 2XP7A 5HUAA 2LKNA 2D9FA 3ODKA 2LJ4A 1KT0A 2JZVA 2MLZA 4JFKA 2VCDA 2ZR5A 4W9PA 3TDBA 3UI6A 3UQIA 5HT1A 3O5PA 4W9QA 2LGOA 3O5EA 2OFNA 4ODPA 2ZQVA 1TCOC 4TW7A 4ITZA 1FKJA 5DITA 4U86A 4R0XA 4DRJA 5HTGA 1FKBA 3JYMA 3UQBA 1T11A 4JYSA 5J6EA 2F21A 1YW5A 2RURA 3KAHA 4JFMA 2XP5A 1F8AB 1PINA 4JFJA 1FJDA 2XPAA 3H9RB 4MSPA 2UZ5A 3KAGA 4QIBA 1D7IA 1FKHA 5D75A 4NNRA 1D7HA 5DIUA 1QPLA 3GPKA 4QT2A 2ITKA 3PRDA 2XP6A 5I98A 3MDYB 2MLYA 3O5IA 4DIPA 2ZQUA 1HXVA 4FN2A 2XP8A 2DG4A 3IKGA 3KABA 4LAVA 3IK8A 1PBKA 4W9OA 4DZ2A 1ZK6A 2F2DA 2ZR6A 2PPNA 2MNTA 2KFWA 2KE0A
chains in the Genus database with same CATH superfamily
1W1VA 2PV2A 3JXVA 3B9DA 1LL4A 1EIBA 2LPVA 2ZR4A 4L3NA 1CTNA 3WL0A 3B9AA 2DG3A 4WKFA 4FAPA 1ROUA 3FY1A 2RUCA 3ARSA 1ZBVA 3O5KA 4U84A 5DIVA 1FKFA 2Y78A 1ZU8A 1VF8A 4ZS6A 1FKIA 2M08A 1JNEA 3O5RA 3ARZA 4LGXA 1BKFA 4P8WA 2PV1A 3WKZA 1NSGA 4DRHA 3GTYX 3RGCA 3CHDA 4WIWA 3O5FA 4U85A 4TW6A 1ZL1A 4GGQA 1NMWA 1NWUA 1W9PA 2XPBA 1FKDA 1RD6A 1EHNA 4P8XA 1W9UA 2IUZA 2IF4A 1OWQA 1UR8A 3KCEA 1JVWA 1JNDA 5HWCA 1NH6A 1FKTA 1O6IA 4N19A 3O5MA 1D7JA 1X6LA 2DG9A 3PRBA 5DF0A 2PPOA 3CHEA 2ESCA 1JCHB 1GOIA 1FKRA 1NMVA 4ODRA 3B8SA 4QZVB 3VAWA 2WM0A 3ARVA 3WD1A 1FKGA 3ODKA 3WD2A 4W5UA 1KT0A 2MLZA 3TDBA 4W9PA 3UQIA 4W9QA 1W9VA 2OFNA 2DT3A 4U86A 5DEZA 3UQBA 4R5EA 1D2KA 2F21A 3KAHA 4JFMA 2XP5A 2A3EA 2DPEA 1X6NA 2XPAA 3WL1A 4DWSD 1D7IA 1LJYA 5D75A 3WD4A 4UDMA 4QT2A 2ITKA 2XP6A 2XP8A 4WJXA 3IK8A 4MNLA 1HKJA 2KFWA 2PV3A 2RQSA 4Z2HA 4HBOA 4URIA 1JNSA 1Q6IA 1SR0A 1GPFA 4DRNA 4ODMA 1P5QA 1J4HA 2DT0A 4TYOA 2ZQTA 1NWTA 1ZCNA 5HKGA 2KR7A 2RUDA 2B5UB 2KI3A 3W4RA 1WAWA 4JFIA 1NWSA 3O5DA 1YATA 2MF9A 4IPXA 2WLZA 2FKEA 4LAXA 5B8IC 3CGMA 1J4RA 1QPFA 3UI4A 1A7XA 3NI6A 1WB0A 3NTPA 4ODQA 2DSZA 1E6ZA 3O5GA 4L72B 1ITXA 1E6NA 5HBFA 1EQ3A 4TNSA 1WNOA 5GPGA 2DSUA 2L2SA 2K8IA 4MNKA 3WQVA 4BF8A 1L1PA 2O92A 1LG2A 1SYTA 4O2TA 1N1AA 2F23A 3KADA 5HW7A 2XP3A 3NRKA 3KAFA 3UQAA 1B6CA 1XHGA 1Q1CA 1M5YA 4J4NA 3AROA 2M2AA 4XAKA 4ODKA 3EY6A 3OOBA 3CGNA 2YBTA 1U79A 1TFVA 3G6MA 3ALFA 1J4IA 2DT1A 4ODOA 1FAPA 5HUAA 2D9FA 1W1PA 1E9LA 3UI6A 3RMEA 1TCOC 2G41A 4R0XA 5GPRA 5HTGA 4ML4A 4Z2JA 1FKBA 3JYMA 4WKAA 1T11A 4JYSA 5J6EA 2A3CA 2RURA 1F8AB 4AY1A 2FDMA 1PINA 4JFJA 1FJDA 3H9RB 4MSPA 2UZ5A 1LL6A 1D7HA 3BMBA 1QPLA 3GPKA 2MLYA 3ARPA 3O5IA 4FN2A 3RM8A 1PBKA 1HJWA 3OA5A 4W9OA 1ZK6A 2F2DA 3FXYA 2O9OA 5DIUA 2KE0A 1Y0OA 4Q7NA 3IKDA 1JNTA 5HW6A 4C02B 4MGVA 4MNJA 3ARWA 3TC5A 2KO7A 4KQZA 2RSEA 3EIPA 2EULA 3ALGA 1W26A 3WD0A 3AS1A 4LAYA 1XRVA 3O5OA 5HW8A 1OGGA 1UR9A 3CHCA 2WLYA 1EYMA 1LL7A 3CHFA 2YBUA 4P8VA 2Q5AA 4TW8A 4DWSC 3O5QA 2VN1A 3PRAA 2ZQSA 4HARA 2PN0A 3AQUA 3I6CA 3WH0A 4DRQA 1E15A 4WKHA 3UI5A 1Q6UA 1NWRA 1R9HA 3CH9A 5HWBA 3WQWA 4PTMA 3GU0A 1F40A 1LQ0A 4S3KA 4MAVA 1E6PA 2WK2A 4Z2KA 1FKKA 4Z2GA 2AWGA 3KAIA 3PA7A 4G2PA 3ARTA 2PBCA 1FD9A 2XP9A 3AS3A 4ZPWR 4DROA 1W1YA 4HBEA 5DO2A 4G50A 2MPHA 2RUQA 1EDQA 3ARXA 2QF8A 2XP4A 4IT4A 2LKNA 4WK9A 1GRJA 2JZVA 4JFKA 1IX5A 2ZR5A 4IT6A 5HT1A 3O5PA 2LGOA 4TW7A 4ITZA 1FKJA 2DSVA 5DITA 2P4VA 4DRJA 1FFRA 4S3JA 2ETNA 1ZB5A 1GUVA 3ARYA 1FKHA 1HKKA 4NSBA 1H0GA 3PRDA 5I98A 3MDYB 1HXVA 2ZQUA 3IKGA 3KABA 1FFQA 2ZR6A 2PPNA 2MNTA 3RM4A 3WD3A 4GIVA 1HJXA 4MPKA 1H0IA 1HJVA 3UF8A 4DRKA 3KACA 2AOSA 4NZCA 4TX0A 1J6YA 2OLHA 1QZ2A 3KZ7A 3AS2A 4DRIA 3FAPA 1E6RA 1W1TA 4ODNA 1E44A 1C9HA 3RFWA 1Q6HA 3QOKA 4DWSB 4MNMA 2PI6A 3PR9A 3B7XA 1KT1A 4DWSA 5JH8A 4IQ2A 4DT4A 4DRPA 1K9TA 4IQCA 3RM9A 1ROTA 2KGJA 1FKSA 2FAPA 4DZ3A 1ZBWA 3IHZA 1D6OA 2M1IA 3O5LA 3AS0A 2PPPA 3O5JA 5GQBA 2N87A 1FKLA 4LAWA 3TCZA 1BL4A 1HKMA 4P8UA 4J4OA 3ARUA 3G6LA 2MLXA 4QT3A 2A3BA 2DSWA 5BXJA 3JYJA 2F4EA 1HKIA 3LUOA 3BXWA 4DRMA 4JFLA 3WIJA 4KR0B 1KFWA 1OGBA 1ZBCA 4ZPTR 4DH0A 4Z2LA 3ARQA 2XP7A 2LJ4A 1ZBKA 2VCDA 4ZPVR 3O5EA 4ODPA 2ZQVA 2DT2A 2G8ZA 1YW5A 3ARRA 3B9EA 4Q22A 4Z2IA 3KAGA 4QIBA 4NNRA 1LG1A 4MTVA 4DIPA 2B31A 2DG4A 3CZ8A 4LAVA 4DZ2A 2A3AA 4ODLA
chains in the Genus database with same CATH topology
1W1VA 2PV2A 3JXVA 3B9DA 1LL4A 1EIBA 2LPVA 2ZR4A 4L3NA 1CTNA 3WL0A 3B9AA 2DG3A 4WKFA 4FAPA 1ROUA 3FY1A 2RUCA 3ARSA 1ZBVA 3O5KA 4U84A 5DIVA 1FKFA 2Y78A 1ZU8A 1VF8A 4ZS6A 1FKIA 2M08A 1JNEA 3O5RA 3ARZA 4LGXA 1BKFA 4P8WA 2PV1A 3WKZA 1NSGA 4DRHA 3RGCA 3CHDA 4WIWA 3O5FA 4U85A 4TW6A 1ZL1A 4GGQA 1NMWA 1NWUA 1W9PA 2XPBA 1FKDA 1RD6A 1EHNA 4P8XA 1W9UA 2IUZA 2IF4A 1OWQA 1UR8A 3KCEA 1JVWA 1JNDA 5HWCA 1NH6A 1FKTA 1O6IA 4N19A 3O5MA 1D7JA 1X6LA 2DG9A 3PRBA 5DF0A 2PPOA 3CHEA 2ESCA 1GOIA 1FKRA 1NMVA 4ODRA 3B8SA 4QZVB 3VAWA 2WM0A 3ARVA 3WD1A 1FKGA 3ODKA 3WD2A 4W5UA 1KT0A 2MLZA 3TDBA 4W9PA 3UQIA 4W9QA 1W9VA 2OFNA 2DT3A 4U86A 5DEZA 3UQBA 4R5EA 1D2KA 2F21A 3KAHA 4JFMA 2XP5A 2A3EA 2DPEA 1X6NA 2XPAA 3WL1A 4DWSD 1D7IA 1LJYA 5D75A 3WD4A 4QT2A 2ITKA 2XP6A 2XP8A 4WJXA 3IK8A 4MNLA 1HKJA 2KFWA 2PV3A 2RQSA 4Z2HA 4HBOA 4URIA 1JNSA 1Q6IA 1SR0A 1GPFA 4DRNA 4ODMA 1P5QA 1J4HA 2DT0A 4TYOA 2ZQTA 1NWTA 1ZCNA 5HKGA 2KR7A 2RUDA 2KI3A 3W4RA 1WAWA 4JFIA 1NWSA 3O5DA 1YATA 2MF9A 4IPXA 2WLZA 2FKEA 4LAXA 5B8IC 3CGMA 1J4RA 1QPFA 3UI4A 1A7XA 3NI6A 1WB0A 3NTPA 4ODQA 2DSZA 1E6ZA 3O5GA 4L72B 1ITXA 1E6NA 5HBFA 1EQ3A 4TNSA 1WNOA 5GPGA 2DSUA 2L2SA 2K8IA 4MNKA 3WQVA 4BF8A 1L1PA 2O92A 1LG2A 1SYTA 4O2TA 1N1AA 3KADA 5HW7A 2XP3A 3NRKA 3KAFA 3UQAA 1B6CA 1XHGA 1Q1CA 1M5YA 4J4NA 3AROA 2M2AA 4XAKA 4ODKA 3EY6A 3OOBA 3CGNA 2YBTA 1U79A 1TFVA 3G6MA 3ALFA 1J4IA 2DT1A 4ODOA 1FAPA 5HUAA 2D9FA 1W1PA 1E9LA 3UI6A 3RMEA 1TCOC 2G41A 4R0XA 5GPRA 5HTGA 4ML4A 4Z2JA 1FKBA 3JYMA 4WKAA 1T11A 4JYSA 5J6EA 2A3CA 2RURA 1F8AB 4AY1A 2FDMA 1PINA 4JFJA 1FJDA 3H9RB 4MSPA 2UZ5A 1LL6A 1D7HA 1QPLA 3GPKA 2MLYA 3ARPA 3O5IA 4FN2A 3RM8A 1PBKA 1HJWA 3OA5A 4W9OA 1ZK6A 2F2DA 3FXYA 2O9OA 5DIUA 2KE0A 1Y0OA 4Q7NA 3IKDA 1JNTA 5HW6A 4C02B 4MGVA 4MNJA 3ARWA 3TC5A 2KO7A 4KQZA 2RSEA 3ALGA 1W26A 3WD0A 3AS1A 4LAYA 1XRVA 3O5OA 5HW8A 1OGGA 1UR9A 3CHCA 2WLYA 1EYMA 1LL7A 3CHFA 2YBUA 4P8VA 2Q5AA 4TW8A 4DWSC 3O5QA 2VN1A 3PRAA 2ZQSA 4HARA 3AQUA 3I6CA 3WH0A 4DRQA 1E15A 4WKHA 3UI5A 1Q6UA 1NWRA 1R9HA 3CH9A 5HWBA 3WQWA 4PTMA 1F40A 1LQ0A 4S3KA 4MAVA 1E6PA 2WK2A 4Z2KA 1FKKA 4Z2GA 2AWGA 3KAIA 3PA7A 4G2PA 3ARTA 2PBCA 1FD9A 2XP9A 3AS3A 4ZPWR 4DROA 1W1YA 4HBEA 5DO2A 4G50A 2MPHA 2RUQA 1EDQA 3ARXA 2QF8A 2XP4A 4IT4A 2LKNA 4WK9A 2JZVA 4JFKA 1IX5A 2ZR5A 4IT6A 5HT1A 3O5PA 2LGOA 4TW7A 4ITZA 1FKJA 2DSVA 5DITA 4DRJA 1FFRA 4S3JA 1ZB5A 1GUVA 3ARYA 1FKHA 1HKKA 4NSBA 1H0GA 3PRDA 5I98A 3MDYB 1HXVA 2ZQUA 3IKGA 3KABA 1FFQA 2ZR6A 2PPNA 2MNTA 3RM4A 3WD3A 4GIVA 1HJXA 4MPKA 1H0IA 1HJVA 3UF8A 4DRKA 3KACA 2AOSA 4NZCA 4TX0A 1J6YA 2OLHA 1QZ2A 3KZ7A 3AS2A 4DRIA 3FAPA 1E6RA 1W1TA 4ODNA 1C9HA 3RFWA 1Q6HA 3QOKA 4DWSB 4MNMA 2PI6A 3PR9A 3B7XA 1KT1A 4DWSA 5JH8A 4IQ2A 4DT4A 4DRPA 1K9TA 4IQCA 3RM9A 1ROTA 2KGJA 1FKSA 2FAPA 4DZ3A 1ZBWA 3IHZA 1D6OA 2M1IA 3O5LA 3AS0A 2PPPA 3O5JA 5GQBA 2N87A 1FKLA 4LAWA 3TCZA 1BL4A 1HKMA 4P8UA 4J4OA 3ARUA 3G6LA 2MLXA 4QT3A 2A3BA 2DSWA 5BXJA 3JYJA 2F4EA 1HKIA 3LUOA 3BXWA 4DRMA 4JFLA 3WIJA 4KR0B 1KFWA 1OGBA 1ZBCA 4ZPTR 4DH0A 4Z2LA 3ARQA 2XP7A 2LJ4A 1ZBKA 2VCDA 4ZPVR 3O5EA 4ODPA 2ZQVA 2DT2A 2G8ZA 1YW5A 3ARRA 3B9EA 4Q22A 4Z2IA 3KAGA 4QIBA 4NNRA 1LG1A 4MTVA 4DIPA 2B31A 2DG4A 3CZ8A 4LAVA 4DZ2A 2A3AA 4ODLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  2PV3 A;  2RQS A;  4GIV A;  3UF8 A;  1JNS A;  1Q6I A;  4DRK A;  1Y0O A;  3JXV A;  3KAC A;  4DRN A;  3IKD A;  1JNT A;  5HW6 A;  4C02 B;  4ODM A;  4MGV A;  1P5Q A;  1J4H A;  4TX0 A;  1J6Y A;  4TYO A;  2ZQT A;  1ZCN A;  1QZ2 A;  2LPV A;  2ZR4 A;  3KZ7 A;  2KR7 A;  2RUD A;  3FAP A;  3TC5 A;  2KI3 A;  2KO7 A;  4JFI A;  4DRI A;  5HKG A;  2DG3 A;  2RSE A;  4FAP A;  1ROU A;  3O5D A;  4ODN A;  2RUC A;  1YAT A;  2MF9 A;  1C9H A;  4IPX A;  1Q6H A;  3RFW A;  3O5K A;  2FKE A;  4LAX A;  4U84 A;  1W26 A;  5B8I C;  5DIV A;  3CGM A;  1FKF A;  4LAY A;  2Y78 A;  3O5O A;  5HW8 A;  1J4R A;  1QPF A;  3B7X A;  3UI4 A;  1A7X A;  1FKI A;  1KT1 A;  1EYM A;  2M08 A;  3NI6 A;  4IQ2 A;  3O5R A;  2Q5A A;  3NTP A;  4ODQ A;  4TW8 A;  4DT4 A;  4DRP A;  3O5Q A;  2VN1 A;  4IQC A;  3O5G A;  1ROT A;  2KGJ A;  1BKF A;  2ZQS A;  2PV1 A;  1FKS A;  2FAP A;  4DZ3 A;  1EQ3 A;  4TNS A;  5GPG A;  1NSG A;  4DRH A;  3IHZ A;  1D6O A;  2L2S A;  2K8I A;  2M1I A;  3I6C A;  4ODL A;  3RGC A;  3O5L A;  3WH0 A;  4DRQ A;  4BF8 A;  3O5F A;  1L1P A;  4U85 A;  4TW6 A;  2PPP A;  3UI5 A;  3O5J A;  4GGQ A;  1NMW A;  4O2T A;  1N1A A;  1Q6U A;  1FKL A;  2N87 A;  2XPB A;  1FKD A;  3KAD A;  1R9H A;  4LAW A;  5HW7 A;  3TCZ A;  1BL4 A;  5HWB A;  2XP3 A;  2IF4 A;  4J4O A;  1F40 A;  2MLX A;  4QT3 A;  3KCE A;  3NRK A;  1JVW A;  5HWC A;  1FKK A;  3KAF A;  5BXJ A;  1FKT A;  3UQA A;  3JYJ A;  1B6C A;  2AWG A;  3KAI A;  3PA7 A;  3O5M A;  2F4E A;  1D7J A;  4G2P A;  4N19 A;  2DG9 A;  2PBC A;  3PRB A;  1FD9 A;  1Q1C A;  1M5Y A;  2XP9 A;  4J4N A;  2M2A A;  4ODK A;  3EY6 A;  4DRO A;  3OOB A;  3CGN A;  2PPO A;  1U79 A;  3LUO A;  4DRM A;  4JFL A;  1FKR A;  1NMV A;  4G50 A;  4ODR A;  2MPH A;  2RUQ A;  3VAW A;  1J4I A;  2XP4 A;  4ODO A;  4DH0 A;  1FAP A;  1FKG A;  2XP7 A;  5HUA A;  2LKN A;  2D9F A;  3ODK A;  2LJ4 A;  1KT0 A;  2JZV A;  2MLZ A;  4JFK A;  2VCD A;  2ZR5 A;  4W9P A;  3TDB A;  3UI6 A;  3UQI A;  5HT1 A;  3O5P A;  4W9Q A;  2LGO A;  3O5E A;  2OFN A;  4ODP A;  2ZQV A;  1TCO C;  4TW7 A;  4ITZ A;  1FKJ A;  5DIT A;  4U86 A;  4R0X A;  4DRJ A;  5HTG A;  1FKB A;  3JYM A;  3UQB A;  1T11 A;  4JYS A;  5J6E A;  2F21 A;  1YW5 A;  2RUR A;  3KAH A;  4JFM A;  2XP5 A;  1F8A B;  1PIN A;  4JFJ A;  1FJD A;  2XPA A;  3H9R B;  4MSP A;  2UZ5 A;  3KAG A;  4QIB A;  1D7I A;  1FKH A;  5D75 A;  4NNR A;  1D7H A;  5DIU A;  1QPL A;  3GPK A;  4QT2 A;  2ITK A;  3PRD A;  2XP6 A;  5I98 A;  3MDY B;  2MLY A;  3O5I A;  4DIP A;  2ZQU A;  1HXV A;  4FN2 A;  2XP8 A;  2DG4 A;  3IKG A;  3KAB A;  4LAV A;  3IK8 A;  1PBK A;  4W9O A;  4DZ2 A;  1ZK6 A;  2F2D A;  2ZR6 A;  2PPN A;  2MNT A;  2KFW A;  2KE0 A; 
#chains in the Genus database with same CATH topology
 1W1V A;  2PV2 A;  3JXV A;  3B9D A;  1LL4 A;  1EIB A;  2LPV A;  2ZR4 A;  4L3N A;  1CTN A;  3WL0 A;  3B9A A;  2DG3 A;  4WKF A;  4FAP A;  1ROU A;  3FY1 A;  2RUC A;  3ARS A;  1ZBV A;  3O5K A;  4U84 A;  5DIV A;  1FKF A;  2Y78 A;  1ZU8 A;  1VF8 A;  4ZS6 A;  1FKI A;  2M08 A;  1JNE A;  3O5R A;  3ARZ A;  4LGX A;  1BKF A;  4P8W A;  2PV1 A;  3WKZ A;  1NSG A;  4DRH A;  3GTY X;  3RGC A;  3CHD A;  4WIW A;  3O5F A;  4U85 A;  4TW6 A;  1ZL1 A;  4GGQ A;  1NMW A;  1NWU A;  1W9P A;  2XPB A;  1FKD A;  1RD6 A;  1EHN A;  4P8X A;  1W9U A;  2IUZ A;  2IF4 A;  1OWQ A;  1UR8 A;  3KCE A;  1JVW A;  1JND A;  5HWC A;  1NH6 A;  1FKT A;  1O6I A;  4N19 A;  3O5M A;  1D7J A;  1X6L A;  2DG9 A;  3PRB A;  5DF0 A;  2PPO A;  3CHE A;  2ESC A;  1JCH B;  1GOI A;  1FKR A;  1NMV A;  4ODR A;  3B8S A;  4QZV B;  3VAW A;  2WM0 A;  3ARV A;  3WD1 A;  1FKG A;  3ODK A;  3WD2 A;  4W5U A;  1KT0 A;  2MLZ A;  3TDB A;  4W9P A;  3UQI A;  4W9Q A;  1W9V A;  2OFN A;  2DT3 A;  4U86 A;  5DEZ A;  3UQB A;  4R5E A;  1D2K A;  2F21 A;  3KAH A;  4JFM A;  2XP5 A;  2A3E A;  2DPE A;  1X6N A;  2XPA A;  3WL1 A;  4DWS D;  1D7I A;  1LJY A;  5D75 A;  3WD4 A;  4UDM A;  4QT2 A;  2ITK A;  2XP6 A;  2XP8 A;  4WJX A;  3IK8 A;  4MNL A;  1HKJ A;  2KFW A;  2PV3 A;  2RQS A;  4Z2H A;  4HBO A;  4URI A;  1JNS A;  1Q6I A;  1SR0 A;  1GPF A;  4DRN A;  4ODM A;  1P5Q A;  1J4H A;  2DT0 A;  4TYO A;  2ZQT A;  1NWT A;  1ZCN A;  5HKG A;  2KR7 A;  2RUD A;  2B5U B;  2KI3 A;  3W4R A;  1WAW A;  4JFI A;  1NWS A;  3O5D A;  1YAT A;  2MF9 A;  4IPX A;  2WLZ A;  2FKE A;  4LAX A;  5B8I C;  3CGM A;  1J4R A;  1QPF A;  3UI4 A;  1A7X A;  3NI6 A;  1WB0 A;  3NTP A;  4ODQ A;  2DSZ A;  1E6Z A;  3O5G A;  4L72 B;  1ITX A;  1E6N A;  5HBF A;  1EQ3 A;  4TNS A;  1WNO A;  5GPG A;  2DSU A;  2L2S A;  2K8I A;  4MNK A;  3WQV A;  4BF8 A;  1L1P A;  2O92 A;  1LG2 A;  1SYT A;  4O2T A;  1N1A A;  2F23 A;  3KAD A;  5HW7 A;  2XP3 A;  3NRK A;  3KAF A;  3UQA A;  1B6C A;  1XHG A;  1Q1C A;  1M5Y A;  4J4N A;  3ARO A;  2M2A A;  4XAK A;  4ODK A;  3EY6 A;  3OOB A;  3CGN A;  2YBT A;  1U79 A;  1TFV A;  3G6M A;  3ALF A;  1J4I A;  2DT1 A;  4ODO A;  1FAP A;  5HUA A;  2D9F A;  1W1P A;  1E9L A;  3UI6 A;  3RME A;  1TCO C;  2G41 A;  4R0X A;  5GPR A;  5HTG A;  4ML4 A;  4Z2J A;  1FKB A;  3JYM A;  4WKA A;  1T11 A;  4JYS A;  5J6E A;  2A3C A;  2RUR A;  1F8A B;  4AY1 A;  2FDM A;  1PIN A;  4JFJ A;  1FJD A;  3H9R B;  4MSP A;  2UZ5 A;  1LL6 A;  1D7H A;  3BMB A;  1QPL A;  3GPK A;  2MLY A;  3ARP A;  3O5I A;  4FN2 A;  3RM8 A;  1PBK A;  1HJW A;  3OA5 A;  4W9O A;  1ZK6 A;  2F2D A;  3FXY A;  2O9O A;  5DIU A;  2KE0 A;  1Y0O A;  4Q7N A;  3IKD A;  1JNT A;  5HW6 A;  4C02 B;  4MGV A;  4MNJ A;  3ARW A;  3TC5 A;  2KO7 A;  4KQZ A;  2RSE A;  3EIP A;  2EUL A;  3ALG A;  1W26 A;  3WD0 A;  3AS1 A;  4LAY A;  1XRV A;  3O5O A;  5HW8 A;  1OGG A;  1UR9 A;  3CHC A;  2WLY A;  1EYM A;  1LL7 A;  3CHF A;  2YBU A;  4P8V A;  2Q5A A;  4TW8 A;  4DWS C;  3O5Q A;  2VN1 A;  3PRA A;  2ZQS A;  4HAR A;  2PN0 A;  3AQU A;  3I6C A;  3WH0 A;  4DRQ A;  1E15 A;  4WKH A;  3UI5 A;  1Q6U A;  1NWR A;  1R9H A;  3CH9 A;  5HWB A;  3WQW A;  4PTM A;  3GU0 A;  1F40 A;  1LQ0 A;  4S3K A;  4MAV A;  1E6P A;  2WK2 A;  4Z2K A;  1FKK A;  4Z2G A;  2AWG A;  3KAI A;  3PA7 A;  4G2P A;  3ART A;  2PBC A;  1FD9 A;  2XP9 A;  3AS3 A;  4ZPW R;  4DRO A;  1W1Y A;  4HBE A;  5DO2 A;  4G50 A;  2MPH A;  2RUQ A;  1EDQ A;  3ARX A;  2QF8 A;  2XP4 A;  4IT4 A;  2LKN A;  4WK9 A;  1GRJ A;  2JZV A;  4JFK A;  1IX5 A;  2ZR5 A;  4IT6 A;  5HT1 A;  3O5P A;  2LGO A;  4TW7 A;  4ITZ A;  1FKJ A;  2DSV A;  5DIT A;  2P4V A;  4DRJ A;  1FFR A;  4S3J A;  2ETN A;  1ZB5 A;  1GUV A;  3ARY A;  1FKH A;  1HKK A;  4NSB A;  1H0G A;  3PRD A;  5I98 A;  3MDY B;  1HXV A;  2ZQU A;  3IKG A;  3KAB A;  1FFQ A;  2ZR6 A;  2PPN A;  2MNT A;  3RM4 A;  3WD3 A;  4GIV A;  1HJX A;  4MPK A;  1H0I A;  1HJV A;  3UF8 A;  4DRK A;  3KAC A;  2AOS A;  4NZC A;  4TX0 A;  1J6Y A;  2OLH A;  1QZ2 A;  3KZ7 A;  3AS2 A;  4DRI A;  3FAP A;  1E6R A;  1W1T A;  4ODN A;  1E44 A;  1C9H A;  3RFW A;  1Q6H A;  3QOK A;  4DWS B;  4MNM A;  2PI6 A;  3PR9 A;  3B7X A;  1KT1 A;  4DWS A;  5JH8 A;  4IQ2 A;  4DT4 A;  4DRP A;  1K9T A;  4IQC A;  3RM9 A;  1ROT A;  2KGJ A;  1FKS A;  2FAP A;  4DZ3 A;  1ZBW A;  3IHZ A;  1D6O A;  2M1I A;  3O5L A;  3AS0 A;  2PPP A;  3O5J A;  5GQB A;  2N87 A;  1FKL A;  4LAW A;  3TCZ A;  1BL4 A;  1HKM A;  4P8U A;  4J4O A;  3ARU A;  3G6L A;  2MLX A;  4QT3 A;  2A3B A;  2DSW A;  5BXJ A;  3JYJ A;  2F4E A;  1HKI A;  3LUO A;  3BXW A;  4DRM A;  4JFL A;  3WIJ A;  4KR0 B;  1KFW A;  1OGB A;  1ZBC A;  4ZPT R;  4DH0 A;  4Z2L A;  3ARQ A;  2XP7 A;  2LJ4 A;  1ZBK A;  2VCD A;  4ZPV R;  3O5E A;  4ODP A;  2ZQV A;  2DT2 A;  2G8Z A;  1YW5 A;  3ARR A;  3B9E A;  4Q22 A;  4Z2I A;  3KAG A;  4QIB A;  4NNR A;  1LG1 A;  4MTV A;  4DIP A;  2B31 A;  2DG4 A;  3CZ8 A;  4LAV A;  4DZ2 A;  2A3A A;  4ODL A; 
#chains in the Genus database with same CATH homology
 1W1V A;  2PV2 A;  3JXV A;  3B9D A;  1LL4 A;  1EIB A;  2LPV A;  2ZR4 A;  4L3N A;  1CTN A;  3WL0 A;  3B9A A;  2DG3 A;  4WKF A;  4FAP A;  1ROU A;  3FY1 A;  2RUC A;  3ARS A;  1ZBV A;  3O5K A;  4U84 A;  5DIV A;  1FKF A;  2Y78 A;  1ZU8 A;  1VF8 A;  4ZS6 A;  1FKI A;  2M08 A;  1JNE A;  3O5R A;  3ARZ A;  4LGX A;  1BKF A;  4P8W A;  2PV1 A;  3WKZ A;  1NSG A;  4DRH A;  3RGC A;  3CHD A;  4WIW A;  3O5F A;  4U85 A;  4TW6 A;  1ZL1 A;  4GGQ A;  1NMW A;  1NWU A;  1W9P A;  2XPB A;  1FKD A;  1RD6 A;  1EHN A;  4P8X A;  1W9U A;  2IUZ A;  2IF4 A;  1OWQ A;  1UR8 A;  3KCE A;  1JVW A;  1JND A;  5HWC A;  1NH6 A;  1FKT A;  1O6I A;  4N19 A;  3O5M A;  1D7J A;  1X6L A;  2DG9 A;  3PRB A;  5DF0 A;  2PPO A;  3CHE A;  2ESC A;  1GOI A;  1FKR A;  1NMV A;  4ODR A;  3B8S A;  4QZV B;  3VAW A;  2WM0 A;  3ARV A;  3WD1 A;  1FKG A;  3ODK A;  3WD2 A;  4W5U A;  1KT0 A;  2MLZ A;  3TDB A;  4W9P A;  3UQI A;  4W9Q A;  1W9V A;  2OFN A;  2DT3 A;  4U86 A;  5DEZ A;  3UQB A;  4R5E A;  1D2K A;  2F21 A;  3KAH A;  4JFM A;  2XP5 A;  2A3E A;  2DPE A;  1X6N A;  2XPA A;  3WL1 A;  4DWS D;  1D7I A;  1LJY A;  5D75 A;  3WD4 A;  4QT2 A;  2ITK A;  2XP6 A;  2XP8 A;  4WJX A;  3IK8 A;  4MNL A;  1HKJ A;  2KFW A;  2PV3 A;  2RQS A;  4Z2H A;  4HBO A;  4URI A;  1JNS A;  1Q6I A;  1SR0 A;  1GPF A;  4DRN A;  4ODM A;  1P5Q A;  1J4H A;  2DT0 A;  4TYO A;  2ZQT A;  1NWT A;  1ZCN A;  5HKG A;  2KR7 A;  2RUD A;  2KI3 A;  3W4R A;  1WAW A;  4JFI A;  1NWS A;  3O5D A;  1YAT A;  2MF9 A;  4IPX A;  2WLZ A;  2FKE A;  4LAX A;  5B8I C;  3CGM A;  1J4R A;  1QPF A;  3UI4 A;  1A7X A;  3NI6 A;  1WB0 A;  3NTP A;  4ODQ A;  2DSZ A;  1E6Z A;  3O5G A;  4L72 B;  1ITX A;  1E6N A;  5HBF A;  1EQ3 A;  4TNS A;  1WNO A;  5GPG A;  2DSU A;  2L2S A;  2K8I A;  4MNK A;  3WQV A;  4BF8 A;  1L1P A;  2O92 A;  1LG2 A;  1SYT A;  4O2T A;  1N1A A;  3KAD A;  5HW7 A;  2XP3 A;  3NRK A;  3KAF A;  3UQA A;  1B6C A;  1XHG A;  1Q1C A;  1M5Y A;  4J4N A;  3ARO A;  2M2A A;  4XAK A;  4ODK A;  3EY6 A;  3OOB A;  3CGN A;  2YBT A;  1U79 A;  1TFV A;  3G6M A;  3ALF A;  1J4I A;  2DT1 A;  4ODO A;  1FAP A;  5HUA A;  2D9F A;  1W1P A;  1E9L A;  3UI6 A;  3RME A;  1TCO C;  2G41 A;  4R0X A;  5GPR A;  5HTG A;  4ML4 A;  4Z2J A;  1FKB A;  3JYM A;  4WKA A;  1T11 A;  4JYS A;  5J6E A;  2A3C A;  2RUR A;  1F8A B;  4AY1 A;  2FDM A;  1PIN A;  4JFJ A;  1FJD A;  3H9R B;  4MSP A;  2UZ5 A;  1LL6 A;  1D7H A;  1QPL A;  3GPK A;  2MLY A;  3ARP A;  3O5I A;  4FN2 A;  3RM8 A;  1PBK A;  1HJW A;  3OA5 A;  4W9O A;  1ZK6 A;  2F2D A;  3FXY A;  2O9O A;  5DIU A;  2KE0 A;  1Y0O A;  4Q7N A;  3IKD A;  1JNT A;  5HW6 A;  4C02 B;  4MGV A;  4MNJ A;  3ARW A;  3TC5 A;  2KO7 A;  4KQZ A;  2RSE A;  3ALG A;  1W26 A;  3WD0 A;  3AS1 A;  4LAY A;  1XRV A;  3O5O A;  5HW8 A;  1OGG A;  1UR9 A;  3CHC A;  2WLY A;  1EYM A;  1LL7 A;  3CHF A;  2YBU A;  4P8V A;  2Q5A A;  4TW8 A;  4DWS C;  3O5Q A;  2VN1 A;  3PRA A;  2ZQS A;  4HAR A;  3AQU A;  3I6C A;  3WH0 A;  4DRQ A;  1E15 A;  4WKH A;  3UI5 A;  1Q6U A;  1NWR A;  1R9H A;  3CH9 A;  5HWB A;  3WQW A;  4PTM A;  1F40 A;  1LQ0 A;  4S3K A;  4MAV A;  1E6P A;  2WK2 A;  4Z2K A;  1FKK A;  4Z2G A;  2AWG A;  3KAI A;  3PA7 A;  4G2P A;  3ART A;  2PBC A;  1FD9 A;  2XP9 A;  3AS3 A;  4ZPW R;  4DRO A;  1W1Y A;  4HBE A;  5DO2 A;  4G50 A;  2MPH A;  2RUQ A;  1EDQ A;  3ARX A;  2QF8 A;  2XP4 A;  4IT4 A;  2LKN A;  4WK9 A;  2JZV A;  4JFK A;  1IX5 A;  2ZR5 A;  4IT6 A;  5HT1 A;  3O5P A;  2LGO A;  4TW7 A;  4ITZ A;  1FKJ A;  2DSV A;  5DIT A;  4DRJ A;  1FFR A;  4S3J A;  1ZB5 A;  1GUV A;  3ARY A;  1FKH A;  1HKK A;  4NSB A;  1H0G A;  3PRD A;  5I98 A;  3MDY B;  1HXV A;  2ZQU A;  3IKG A;  3KAB A;  1FFQ A;  2ZR6 A;  2PPN A;  2MNT A;  3RM4 A;  3WD3 A;  4GIV A;  1HJX A;  4MPK A;  1H0I A;  1HJV A;  3UF8 A;  4DRK A;  3KAC A;  2AOS A;  4NZC A;  4TX0 A;  1J6Y A;  2OLH A;  1QZ2 A;  3KZ7 A;  3AS2 A;  4DRI A;  3FAP A;  1E6R A;  1W1T A;  4ODN A;  1C9H A;  3RFW A;  1Q6H A;  3QOK A;  4DWS B;  4MNM A;  2PI6 A;  3PR9 A;  3B7X A;  1KT1 A;  4DWS A;  5JH8 A;  4IQ2 A;  4DT4 A;  4DRP A;  1K9T A;  4IQC A;  3RM9 A;  1ROT A;  2KGJ A;  1FKS A;  2FAP A;  4DZ3 A;  1ZBW A;  3IHZ A;  1D6O A;  2M1I A;  3O5L A;  3AS0 A;  2PPP A;  3O5J A;  5GQB A;  2N87 A;  1FKL A;  4LAW A;  3TCZ A;  1BL4 A;  1HKM A;  4P8U A;  4J4O A;  3ARU A;  3G6L A;  2MLX A;  4QT3 A;  2A3B A;  2DSW A;  5BXJ A;  3JYJ A;  2F4E A;  1HKI A;  3LUO A;  3BXW A;  4DRM A;  4JFL A;  3WIJ A;  4KR0 B;  1KFW A;  1OGB A;  1ZBC A;  4ZPT R;  4DH0 A;  4Z2L A;  3ARQ A;  2XP7 A;  2LJ4 A;  1ZBK A;  2VCD A;  4ZPV R;  3O5E A;  4ODP A;  2ZQV A;  2DT2 A;  2G8Z A;  1YW5 A;  3ARR A;  3B9E A;  4Q22 A;  4Z2I A;  3KAG A;  4QIB A;  4NNR A;  1LG1 A;  4MTV A;  4DIP A;  2B31 A;  2DG4 A;  3CZ8 A;  4LAV A;  4DZ2 A;  2A3A A;  4ODL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...