1NMWA

Solution structure of the ppiase domain of human pin1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
GEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Mitotic Regulator hPin1 in Solution: INSIGHTS INTO DOMAIN ARCHITECTURE AND SUBSTRATE BINDING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 27
structure length 114
sequence length 114
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nmwA00
1M5YA 4DROA 5HW7A 3O5QA 4MGVA 1EYMA 3KABA 3O5FA 4TNSA 4W9PA 5HTGA 2Q5AA 2XP5A 2KGJA 2PPOA 5HW8A 2KR7A 3IKDA 1BKFA 3JYMA 4MSPA 3KZ7A 4ODPA 5DIUA 1W26A 4G50A 3I6CA 2OFNA 4W9OA 2VN1A 2KFWA 1U79A 4DZ2A 5GPGA 1L1PA 5HW6A 2FAPA 2DG4A 4ODQA 3RFWA 1FKKA 3IKGA 1FAPA 4DRIA 2AWGA 1HXVA 3MDYB 2F21A 2UZ5A 1FKLA 3EY6A 2XPAA 4JFLA 4GIVA 3IHZA 4C02B 2ITKA 2ZQSA 2XP8A 3JXVA 2FKEA 2L2SA 2ZQVA 1ZK6A 4QT2A 3NTPA 4DRMA 1F40A 4R0XA 3KAFA 4ODRA 3UI4A 4DRQA 2RUQA 4TX0A 4DRHA 2KO7A 1JNSA 2XP6A 5HKGA 4GGQA 2N87A 3PRBA 4JFIA 1QPLA 1QPFA 4ITZA 1D7IA 2ZR6A 2M1IA 4DH0A 4DRJA 1Q6UA 3H9RB 3UI6A 1TCOC 4DT4A 2PV2A 3O5IA 1N1AA 2XP9A 1P5QA 2ZQTA 1FKFA 2MLXA 1D7JA 3KAIA 1Y0OA 3KADA 4TYOA 1R9HA 2ZQUA 1Q1CA 2M08A 1QZ2A 3O5JA 1FKJA 4JYSA 3RGCA 4FAPA 4JFKA 2RQSA 5HUAA 5B8IC 1FD9A 1ROUA 1PBKA 2PPPA 2XP4A 3NRKA 3O5PA 2PV1A 2MPHA 3TDBA 3UQIA 4IQ2A 2RURA 1J6YA 3O5EA 2MNTA 3O5MA 1PINA 1D7HA 4DRPA 1NMWA 4LAYA 4U85A 1Q6HA 3KACA 4ODOA 2ZR5A 3O5DA 2JZVA 2RUDA 4J4OA 4JFJA 4QT3A 1J4HA 1F8AB 2F2DA 5DITA 3UF8A 3VAWA 1J4RA 1FKIA 3CGNA 3O5RA 3UI5A 3JYJA 1C9HA 4W9QA 3IK8A 2PPNA 4DIPA 1YATA 1FKBA 4DRNA 5I98A 3KCEA 3TC5A 1Q6IA 1FKGA 2LGOA 3TCZA 4J4NA 1FKDA 2PV3A 3ODKA 2IF4A 4O2TA 2DG3A 2Y78A 4ODLA 3O5KA 1JNTA 1NMVA 2KI3A 2PBCA 1FKSA 2MLZA 2XP3A 4ODKA 2F4EA 4TW8A 2RUCA 3KAGA 3O5GA 4LAXA 4N19A 4TW6A 4U84A 5D75A 3WH0A 4LAWA 1JVWA 2D9FA 1B6CA 3FAPA 2KE0A 3O5LA 4ODNA 2LJ4A 1KT1A 4IQCA 5HWCA 2M2AA 4JFMA 1KT0A 3CGMA 1FJDA 4G2PA 3KAHA 2VCDA 1NSGA 3OOBA 4BF8A 3LUOA 1A7XA 4LAVA 2K8IA 4U86A 5HWBA 1FKRA 1YW5A 1ZCNA 1J4IA 2XP7A 3PRDA 2RSEA 2ZR4A 5J6EA 1FKTA 1ROTA 1EQ3A 3GPKA 3B7XA 4NNRA 4ODMA 4DZ3A 3O5OA 4TW7A 2XPBA 3PA7A 2LPVA 1BL4A 4FN2A 5DIVA 3UQAA 3UQBA 2MF9A 3NI6A 5BXJA 4QIBA 1T11A 1FKHA 2DG9A 4IPXA 2LKNA 2MLYA 5HT1A 4DRKA 1D6OA
chains in the Genus database with same CATH superfamily
1M5YA 3CZ8A 4IT6A 4MNJA 1EYMA 2Q5AA 2PPOA 5HW8A 3IKDA 3JYMA 1HKMA 1ZL1A 1RD6A 4G50A 3I6CA 1HKIA 2KFWA 3ARUA 4DZ2A 3WL0A 5HW6A 4WIWA 1FKKA 3WD0A 2P4VA 1HXVA 4L3NA 4NSBA 4XAKA 4DWSA 4DWSD 4WKHA 3KAFA 1JNEA 4DRHA 2KO7A 1NWRA 1QPLA 4JFIA 4WKFA 4DH0A 4DRJA 3H9RB 1XHGA 1TCOC 1JNDA 4IT4A 1FKFA 1Y0OA 2ZQUA 2M08A 1QZ2A 3ARQA 1FKJA 4JYSA 3QOKA 1W1TA 4HARA 1PBKA 3NRKA 2MPHA 4DRPA 1PINA 4LAYA 1Q6HA 3PR9A 1VF8A 3B9DA 4JFJA 1J4RA 3UI5A 3PRAA 3JYJA 3WD4A 5GPRA 2IUZA 1YATA 1FKBA 4HBOA 3CH9A 3KCEA 3TC5A 2WLZA 1HJWA 2XP3A 3WQVA 5D75A 3WH0A 4WJXA 1ZBVA 1JVWA 1ZBCA 2D9FA 4ZPVR 2O92A 1LQ0A 5HWCA 4L72B 2WLYA 1ZU8A 4U86A 4P8VA 1LJYA 2ZR4A 5J6EA 3FXYA 3CHCA 1EIBA 3ARYA 3BMBA 5JH8A 4DZ3A 1LG2A 1OGBA 1E6RA 3O5OA 4FN2A 3UQAA 1E9LA 2ETNA 4LGXA 2F4EA 1LL7A 3W4RA 1X6LA 2PI6A 4Z2IA 2KR7A 1GUVA 4ODPA 5DIUA 1W26A 4W9OA 2VN1A 1U79A 5GPGA 1L1PA 1E6PA 3RFWA 3IKGA 2DT2A 2FDMA 4DRIA 4ZPTR 3EY6A 2XPAA 3OA5A 3ARVA 3WKZA 2ZQSA 1HKKA 3JXVA 1W1YA 4DRMA 1F40A 3NTPA 3WD3A 4R0XA 2DT0A 2RUQA 4TX0A 5DF0A 5HKGA 4AY1A 2N87A 4ZS6A 1H0IA 1QPFA 2ZR6A 1OWQA 3WL1A 2MLXA 4DWSB 1H0GA 2XP4A 3O5PA 2PV1A 3TDBA 3WD2A 4PTMA 1J6YA 3O5MA 1NMWA 4U85A 1E6NA 2A3BA 3KACA 4ODOA 1KFWA 4ZPWR 2OLHA 3O5DA 4S3KA 1HJXA 1J4HA 1W9UA 5DITA 3O5RA 1FFQA 3IK8A 4DIPA 4KR0B 1FKGA 1UR8A 2LGOA 4J4NA 3ODKA 2DG3A 4ODLA 3AS2A 2KI3A 4TW8A 3O5GA 1TFVA 4TW6A 4LAWA 1B6CA 2KE0A 1KT1A 4JFMA 3CGMA 3CHEA 2WK2A 3OOBA 4BF8A 1NWUA 5HWBA 1A7XA 1FKRA 1YW5A 1ZCNA 3AS1A 2RSEA 1FKTA 1EQ3A 2DSWA 4ODMA 1EDQA 4TW7A 1IX5A 2LPVA 3FY1A 5DIVA 4MNKA 1W9PA 2G8ZA 2MF9A 5BXJA 4Q22A 1FKHA 4IPXA 2LKNA 2XP9A 2MLYA 2PN0A 3EIPA 3RM8A 3KABA 3O5FA 4TNSA 2XP5A 2KGJA 4ML4A 4MSPA 1HJVA 4Z2KA 2FAPA 2DG4A 4ODQA 1FAPA 1E15A 2AWGA 2F21A 1CTNA 2UZ5A 4GIVA 3IHZA 4C02B 3ARPA 2ITKA 2L2SA 4QT2A 1ZK6A 4NZCA 3UI4A 1ZB5A 3ALFA 1JNSA 2XP6A 4GGQA 3WQWA 3PRBA 4HBEA 1D7IA 2WM0A 3UI6A 2PV2A 3O5IA 1N1AA 3RM9A 2ZQTA 1D7JA 4WKAA 1Q1CA 4Z2JA 4MNLA 4FAPA 2RQSA 5HUAA 5B8IC 1GPFA 2PPPA 2DPEA 4DWSC 1D7HA 1K9TA 1D2KA 1NWSA 1ZBWA 1LG1A 2ZR5A 2RUDA 1F8AB 2F2DA 3BXWA 3VAWA 3CGNA 3CHFA 4W9QA 4QZVB 4MPKA 5I98A 1Q6IA 3ARRA 3AS3A 2IF4A 2Y78A 4Q7NA 3O5KA 1NMVA 2MLZA 5DEZA 2RUCA 4LAXA 4U84A 3FAPA 1JCHB 3AROA 1W1VA 1SYTA 3O5LA 2LJ4A 4IQCA 2M2AA 4G2PA 3KAHA 4Z2HA 5HBFA 3AS0A 3LUOA 4LAVA 3PRDA 1HKJA 4MNMA 1ROTA 1GOIA 2DT3A 2DSUA 3B7XA 4NNRA 2F23A 2DSVA 2XPBA 1BL4A 1FFRA 2O9OA 2EULA 4DRKA 2DG9A 4URIA 3WIJA 1WAWA 2G41A 5HT1A 1W9VA 2A3CA 4DROA 1E6ZA 5HW7A 3O5QA 4MGVA 2B31A 5HTGA 4W9PA 4MAVA 1BKFA 3KZ7A 3G6MA 2OFNA 1UR9A 3RMEA 4Z2LA 3ARXA 1WB0A 3MDYB 1EHNA 1FKLA 4JFLA 1WNOA 4P8WA 1NH6A 2XP8A 2FKEA 2ZQVA 4ODRA 4DRQA 3CHDA 4WK9A 4ITZA 2M1IA 3ARTA 1Q6UA 3G6LA 4DT4A 2A3AA 1XRVA 1P5QA 4KQZA 1GRJA 3KAIA 4TYOA 2DSZA 3KADA 4P8UA 1R9HA 2A3EA 3B8SA 3O5JA 5DO2A 3RGCA 4JFKA 1FD9A 1ROUA 3UQIA 4IQ2A 2RURA 1O6IA 3RM4A 3O5EA 2MNTA 3GTYX 3GU0A 1ITXA 3B9AA 2JZVA 2AOSA 4J4OA 4QT3A 3UF8A 1FKIA 4W5UA 1C9HA 2PPNA 4DRNA 1LL6A 2B5UB 3TCZA 2YBUA 1FKDA 2PV3A 4O2TA 5GQBA 1W1PA 2ESCA 1JNTA 1X6NA 2PBCA 3AQUA 1FKSA 4ODKA 4UDMA 3ARZA 3KAGA 4N19A 4P8XA 1NWTA 3B9EA 4ODNA 3ARSA 3WD1A 1KT0A 1OGGA 1FJDA 4MTVA 1E44A 2VCDA 1NSGA 3ARWA 2K8IA 4R5EA 1J4IA 2DT1A 2XP7A 3GPKA 1ZBKA 1SR0A 3ALGA 3PA7A 4S3JA 4Z2GA 3UQBA 3NI6A 4QIBA 1T11A 1LL4A 2QF8A 1D6OA 2YBTA
chains in the Genus database with same CATH topology
1M5YA 3CZ8A 4IT6A 4MNJA 1EYMA 2Q5AA 2PPOA 5HW8A 3IKDA 3JYMA 1HKMA 1ZL1A 1RD6A 4G50A 3I6CA 1HKIA 2KFWA 3ARUA 4DZ2A 3WL0A 5HW6A 4WIWA 1FKKA 3WD0A 1HXVA 4L3NA 4NSBA 4XAKA 4DWSA 4DWSD 4WKHA 3KAFA 1JNEA 4DRHA 2KO7A 1NWRA 1QPLA 4JFIA 4WKFA 4DH0A 4DRJA 3H9RB 1XHGA 1TCOC 1JNDA 4IT4A 1FKFA 1Y0OA 2ZQUA 2M08A 1QZ2A 3ARQA 1FKJA 4JYSA 3QOKA 1W1TA 4HARA 1PBKA 3NRKA 2MPHA 4DRPA 1PINA 4LAYA 1Q6HA 3PR9A 1VF8A 3B9DA 4JFJA 1J4RA 3UI5A 3PRAA 3JYJA 3WD4A 5GPRA 2IUZA 1YATA 1FKBA 4HBOA 3CH9A 3KCEA 3TC5A 2WLZA 1HJWA 2XP3A 3WQVA 5D75A 3WH0A 4WJXA 1ZBVA 1JVWA 1ZBCA 2D9FA 4ZPVR 2O92A 1LQ0A 5HWCA 4L72B 2WLYA 1ZU8A 4U86A 4P8VA 1LJYA 2ZR4A 5J6EA 3FXYA 1EIBA 3CHCA 3ARYA 5JH8A 4DZ3A 1LG2A 1OGBA 1E6RA 3O5OA 4FN2A 3UQAA 1E9LA 4LGXA 2F4EA 1LL7A 3W4RA 1X6LA 2PI6A 4Z2IA 2KR7A 1GUVA 4ODPA 5DIUA 1W26A 4W9OA 2VN1A 1U79A 5GPGA 1L1PA 1E6PA 3RFWA 3IKGA 2DT2A 2FDMA 4DRIA 4ZPTR 3EY6A 2XPAA 3OA5A 3ARVA 3WKZA 2ZQSA 1HKKA 3JXVA 1W1YA 4DRMA 1F40A 3NTPA 3WD3A 4R0XA 2DT0A 2RUQA 4TX0A 5DF0A 5HKGA 4AY1A 2N87A 4ZS6A 1H0IA 1QPFA 2ZR6A 1OWQA 3WL1A 2MLXA 4DWSB 1H0GA 2XP4A 3O5PA 2PV1A 3TDBA 3WD2A 4PTMA 1J6YA 3O5MA 1NMWA 4U85A 1E6NA 2A3BA 3KACA 4ODOA 1KFWA 4ZPWR 2OLHA 3O5DA 4S3KA 1HJXA 1J4HA 1W9UA 5DITA 3O5RA 1FFQA 3IK8A 4DIPA 4KR0B 1FKGA 1UR8A 2LGOA 4J4NA 3ODKA 2DG3A 4ODLA 3AS2A 2KI3A 4TW8A 3O5GA 1TFVA 4TW6A 4LAWA 1B6CA 2KE0A 1KT1A 4JFMA 3CGMA 3CHEA 2WK2A 3OOBA 4BF8A 1NWUA 5HWBA 1A7XA 1FKRA 1YW5A 1ZCNA 3AS1A 2RSEA 1FKTA 1EQ3A 2DSWA 4ODMA 1EDQA 4TW7A 1IX5A 2LPVA 3FY1A 5DIVA 4MNKA 1W9PA 2G8ZA 2MF9A 5BXJA 4Q22A 1FKHA 4IPXA 2LKNA 2XP9A 2MLYA 3RM8A 3KABA 3O5FA 4TNSA 2XP5A 2KGJA 4ML4A 4MSPA 1HJVA 4Z2KA 2FAPA 2DG4A 4ODQA 1FAPA 1E15A 2AWGA 2F21A 1CTNA 2UZ5A 4GIVA 3IHZA 4C02B 3ARPA 2ITKA 2L2SA 4QT2A 1ZK6A 4NZCA 3UI4A 1ZB5A 3ALFA 1JNSA 2XP6A 4GGQA 3WQWA 3PRBA 4HBEA 1D7IA 2WM0A 3UI6A 2PV2A 3O5IA 1N1AA 3RM9A 2ZQTA 1D7JA 4WKAA 1Q1CA 4Z2JA 4MNLA 4FAPA 2RQSA 5HUAA 5B8IC 1GPFA 2PPPA 2DPEA 4DWSC 1D7HA 1K9TA 1D2KA 1NWSA 1ZBWA 1LG1A 2ZR5A 2RUDA 1F8AB 2F2DA 3BXWA 3VAWA 3CGNA 3CHFA 4W9QA 4QZVB 4MPKA 5I98A 1Q6IA 3ARRA 3AS3A 2IF4A 2Y78A 4Q7NA 3O5KA 1NMVA 2MLZA 5DEZA 2RUCA 4LAXA 4U84A 3FAPA 3AROA 1W1VA 1SYTA 3O5LA 2LJ4A 4IQCA 2M2AA 4G2PA 3KAHA 4Z2HA 5HBFA 3AS0A 3LUOA 4LAVA 3PRDA 1HKJA 4MNMA 1ROTA 1GOIA 2DT3A 2DSUA 3B7XA 4NNRA 2DSVA 2XPBA 1BL4A 1FFRA 2O9OA 4DRKA 2DG9A 4URIA 3WIJA 1WAWA 2G41A 5HT1A 1W9VA 2A3CA 4DROA 1E6ZA 5HW7A 3O5QA 4MGVA 2B31A 5HTGA 4W9PA 4MAVA 1BKFA 3KZ7A 3G6MA 2OFNA 1UR9A 3RMEA 4Z2LA 3ARXA 1WB0A 3MDYB 1EHNA 1FKLA 4JFLA 1WNOA 4P8WA 1NH6A 2XP8A 2FKEA 2ZQVA 4ODRA 4DRQA 3CHDA 4WK9A 4ITZA 2M1IA 3ARTA 1Q6UA 3G6LA 4DT4A 2A3AA 1XRVA 1P5QA 4KQZA 3KAIA 4TYOA 2DSZA 3KADA 4P8UA 1R9HA 2A3EA 3B8SA 3O5JA 5DO2A 3RGCA 4JFKA 1FD9A 1ROUA 3UQIA 4IQ2A 2RURA 1O6IA 3RM4A 3O5EA 2MNTA 1ITXA 3B9AA 2JZVA 2AOSA 4J4OA 4QT3A 3UF8A 1FKIA 4W5UA 1C9HA 2PPNA 4DRNA 1LL6A 3TCZA 2YBUA 1FKDA 2PV3A 4O2TA 5GQBA 1W1PA 2ESCA 1JNTA 1X6NA 2PBCA 3AQUA 1FKSA 4ODKA 3ARZA 3KAGA 4N19A 4P8XA 1NWTA 3B9EA 4ODNA 3ARSA 3WD1A 1KT0A 1OGGA 1FJDA 4MTVA 2VCDA 1NSGA 3ARWA 2K8IA 4R5EA 1J4IA 2DT1A 2XP7A 3GPKA 1ZBKA 1SR0A 3ALGA 3PA7A 4S3JA 4Z2GA 3UQBA 3NI6A 4QIBA 1T11A 1LL4A 2QF8A 1D6OA 2YBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5Y A;  4DRO A;  5HW7 A;  3O5Q A;  4MGV A;  1EYM A;  3KAB A;  3O5F A;  4TNS A;  4W9P A;  5HTG A;  2Q5A A;  2XP5 A;  2KGJ A;  2PPO A;  5HW8 A;  2KR7 A;  3IKD A;  1BKF A;  3JYM A;  4MSP A;  3KZ7 A;  4ODP A;  5DIU A;  1W26 A;  4G50 A;  3I6C A;  2OFN A;  4W9O A;  2VN1 A;  2KFW A;  1U79 A;  4DZ2 A;  5GPG A;  1L1P A;  5HW6 A;  2FAP A;  2DG4 A;  4ODQ A;  3RFW A;  1FKK A;  3IKG A;  1FAP A;  4DRI A;  2AWG A;  1HXV A;  3MDY B;  2F21 A;  2UZ5 A;  1FKL A;  3EY6 A;  2XPA A;  4JFL A;  4GIV A;  3IHZ A;  4C02 B;  2ITK A;  2ZQS A;  2XP8 A;  3JXV A;  2FKE A;  2L2S A;  2ZQV A;  1ZK6 A;  4QT2 A;  3NTP A;  4DRM A;  1F40 A;  4R0X A;  3KAF A;  4ODR A;  3UI4 A;  4DRQ A;  2RUQ A;  4TX0 A;  4DRH A;  2KO7 A;  1JNS A;  2XP6 A;  5HKG A;  4GGQ A;  2N87 A;  3PRB A;  4JFI A;  1QPL A;  1QPF A;  4ITZ A;  1D7I A;  2ZR6 A;  2M1I A;  4DH0 A;  4DRJ A;  1Q6U A;  3H9R B;  3UI6 A;  1TCO C;  4DT4 A;  2PV2 A;  3O5I A;  1N1A A;  2XP9 A;  1P5Q A;  2ZQT A;  1FKF A;  2MLX A;  1D7J A;  3KAI A;  1Y0O A;  3KAD A;  4TYO A;  1R9H A;  2ZQU A;  1Q1C A;  2M08 A;  1QZ2 A;  3O5J A;  1FKJ A;  4JYS A;  3RGC A;  4FAP A;  4JFK A;  2RQS A;  5HUA A;  5B8I C;  1FD9 A;  1ROU A;  1PBK A;  2PPP A;  2XP4 A;  3NRK A;  3O5P A;  2PV1 A;  2MPH A;  3TDB A;  3UQI A;  4IQ2 A;  2RUR A;  1J6Y A;  3O5E A;  2MNT A;  3O5M A;  1PIN A;  1D7H A;  4DRP A;  1NMW A;  4LAY A;  4U85 A;  1Q6H A;  3KAC A;  4ODO A;  2ZR5 A;  3O5D A;  2JZV A;  2RUD A;  4J4O A;  4JFJ A;  4QT3 A;  1J4H A;  1F8A B;  2F2D A;  5DIT A;  3UF8 A;  3VAW A;  1J4R A;  1FKI A;  3CGN A;  3O5R A;  3UI5 A;  3JYJ A;  1C9H A;  4W9Q A;  3IK8 A;  2PPN A;  4DIP A;  1YAT A;  1FKB A;  4DRN A;  5I98 A;  3KCE A;  3TC5 A;  1Q6I A;  1FKG A;  2LGO A;  3TCZ A;  4J4N A;  1FKD A;  2PV3 A;  3ODK A;  2IF4 A;  4O2T A;  2DG3 A;  2Y78 A;  4ODL A;  3O5K A;  1JNT A;  1NMV A;  2KI3 A;  2PBC A;  1FKS A;  2MLZ A;  2XP3 A;  4ODK A;  2F4E A;  4TW8 A;  2RUC A;  3KAG A;  3O5G A;  4LAX A;  4N19 A;  4TW6 A;  4U84 A;  5D75 A;  3WH0 A;  4LAW A;  1JVW A;  2D9F A;  1B6C A;  3FAP A;  2KE0 A;  3O5L A;  4ODN A;  2LJ4 A;  1KT1 A;  4IQC A;  5HWC A;  2M2A A;  4JFM A;  1KT0 A;  3CGM A;  1FJD A;  4G2P A;  3KAH A;  2VCD A;  1NSG A;  3OOB A;  4BF8 A;  3LUO A;  1A7X A;  4LAV A;  2K8I A;  4U86 A;  5HWB A;  1FKR A;  1YW5 A;  1ZCN A;  1J4I A;  2XP7 A;  3PRD A;  2RSE A;  2ZR4 A;  5J6E A;  1FKT A;  1ROT A;  1EQ3 A;  3GPK A;  3B7X A;  4NNR A;  4ODM A;  4DZ3 A;  3O5O A;  4TW7 A;  2XPB A;  3PA7 A;  2LPV A;  1BL4 A;  4FN2 A;  5DIV A;  3UQA A;  3UQB A;  2MF9 A;  3NI6 A;  5BXJ A;  4QIB A;  1T11 A;  1FKH A;  2DG9 A;  4IPX A;  2LKN A;  2MLY A;  5HT1 A;  4DRK A;  1D6O A; 
#chains in the Genus database with same CATH topology
 1M5Y A;  3CZ8 A;  4IT6 A;  4MNJ A;  1EYM A;  2Q5A A;  2PPO A;  5HW8 A;  3IKD A;  3JYM A;  1HKM A;  1ZL1 A;  1RD6 A;  4G50 A;  3I6C A;  1HKI A;  2KFW A;  3ARU A;  4DZ2 A;  3WL0 A;  5HW6 A;  4WIW A;  1FKK A;  3WD0 A;  2P4V A;  1HXV A;  4L3N A;  4NSB A;  4XAK A;  4DWS A;  4DWS D;  4WKH A;  3KAF A;  1JNE A;  4DRH A;  2KO7 A;  1NWR A;  1QPL A;  4JFI A;  4WKF A;  4DH0 A;  4DRJ A;  3H9R B;  1XHG A;  1TCO C;  1JND A;  4IT4 A;  1FKF A;  1Y0O A;  2ZQU A;  2M08 A;  1QZ2 A;  3ARQ A;  1FKJ A;  4JYS A;  3QOK A;  1W1T A;  4HAR A;  1PBK A;  3NRK A;  2MPH A;  4DRP A;  1PIN A;  4LAY A;  1Q6H A;  3PR9 A;  1VF8 A;  3B9D A;  4JFJ A;  1J4R A;  3UI5 A;  3PRA A;  3JYJ A;  3WD4 A;  5GPR A;  2IUZ A;  1YAT A;  1FKB A;  4HBO A;  3CH9 A;  3KCE A;  3TC5 A;  2WLZ A;  1HJW A;  2XP3 A;  3WQV A;  5D75 A;  3WH0 A;  4WJX A;  1ZBV A;  1JVW A;  1ZBC A;  2D9F A;  4ZPV R;  2O92 A;  1LQ0 A;  5HWC A;  4L72 B;  2WLY A;  1ZU8 A;  4U86 A;  4P8V A;  1LJY A;  2ZR4 A;  5J6E A;  3FXY A;  3CHC A;  1EIB A;  3ARY A;  3BMB A;  5JH8 A;  4DZ3 A;  1LG2 A;  1OGB A;  1E6R A;  3O5O A;  4FN2 A;  3UQA A;  1E9L A;  2ETN A;  4LGX A;  2F4E A;  1LL7 A;  3W4R A;  1X6L A;  2PI6 A;  4Z2I A;  2KR7 A;  1GUV A;  4ODP A;  5DIU A;  1W26 A;  4W9O A;  2VN1 A;  1U79 A;  5GPG A;  1L1P A;  1E6P A;  3RFW A;  3IKG A;  2DT2 A;  2FDM A;  4DRI A;  4ZPT R;  3EY6 A;  2XPA A;  3OA5 A;  3ARV A;  3WKZ A;  2ZQS A;  1HKK A;  3JXV A;  1W1Y A;  4DRM A;  1F40 A;  3NTP A;  3WD3 A;  4R0X A;  2DT0 A;  2RUQ A;  4TX0 A;  5DF0 A;  5HKG A;  4AY1 A;  2N87 A;  4ZS6 A;  1H0I A;  1QPF A;  2ZR6 A;  1OWQ A;  3WL1 A;  2MLX A;  4DWS B;  1H0G A;  2XP4 A;  3O5P A;  2PV1 A;  3TDB A;  3WD2 A;  4PTM A;  1J6Y A;  3O5M A;  1NMW A;  4U85 A;  1E6N A;  2A3B A;  3KAC A;  4ODO A;  1KFW A;  4ZPW R;  2OLH A;  3O5D A;  4S3K A;  1HJX A;  1J4H A;  1W9U A;  5DIT A;  3O5R A;  1FFQ A;  3IK8 A;  4DIP A;  4KR0 B;  1FKG A;  1UR8 A;  2LGO A;  4J4N A;  3ODK A;  2DG3 A;  4ODL A;  3AS2 A;  2KI3 A;  4TW8 A;  3O5G A;  1TFV A;  4TW6 A;  4LAW A;  1B6C A;  2KE0 A;  1KT1 A;  4JFM A;  3CGM A;  3CHE A;  2WK2 A;  3OOB A;  4BF8 A;  1NWU A;  5HWB A;  1A7X A;  1FKR A;  1YW5 A;  1ZCN A;  3AS1 A;  2RSE A;  1FKT A;  1EQ3 A;  2DSW A;  4ODM A;  1EDQ A;  4TW7 A;  1IX5 A;  2LPV A;  3FY1 A;  5DIV A;  4MNK A;  1W9P A;  2G8Z A;  2MF9 A;  5BXJ A;  4Q22 A;  1FKH A;  4IPX A;  2LKN A;  2XP9 A;  2MLY A;  2PN0 A;  3EIP A;  3RM8 A;  3KAB A;  3O5F A;  4TNS A;  2XP5 A;  2KGJ A;  4ML4 A;  4MSP A;  1HJV A;  4Z2K A;  2FAP A;  2DG4 A;  4ODQ A;  1FAP A;  1E15 A;  2AWG A;  2F21 A;  1CTN A;  2UZ5 A;  4GIV A;  3IHZ A;  4C02 B;  3ARP A;  2ITK A;  2L2S A;  4QT2 A;  1ZK6 A;  4NZC A;  3UI4 A;  1ZB5 A;  3ALF A;  1JNS A;  2XP6 A;  4GGQ A;  3WQW A;  3PRB A;  4HBE A;  1D7I A;  2WM0 A;  3UI6 A;  2PV2 A;  3O5I A;  1N1A A;  3RM9 A;  2ZQT A;  1D7J A;  4WKA A;  1Q1C A;  4Z2J A;  4MNL A;  4FAP A;  2RQS A;  5HUA A;  5B8I C;  1GPF A;  2PPP A;  2DPE A;  4DWS C;  1D7H A;  1K9T A;  1D2K A;  1NWS A;  1ZBW A;  1LG1 A;  2ZR5 A;  2RUD A;  1F8A B;  2F2D A;  3BXW A;  3VAW A;  3CGN A;  3CHF A;  4W9Q A;  4QZV B;  4MPK A;  5I98 A;  1Q6I A;  3ARR A;  3AS3 A;  2IF4 A;  2Y78 A;  4Q7N A;  3O5K A;  1NMV A;  2MLZ A;  5DEZ A;  2RUC A;  4LAX A;  4U84 A;  3FAP A;  1JCH B;  3ARO A;  1W1V A;  1SYT A;  3O5L A;  2LJ4 A;  4IQC A;  2M2A A;  4G2P A;  3KAH A;  4Z2H A;  5HBF A;  3AS0 A;  3LUO A;  4LAV A;  3PRD A;  1HKJ A;  4MNM A;  1ROT A;  1GOI A;  2DT3 A;  2DSU A;  3B7X A;  4NNR A;  2F23 A;  2DSV A;  2XPB A;  1BL4 A;  1FFR A;  2O9O A;  2EUL A;  4DRK A;  2DG9 A;  4URI A;  3WIJ A;  1WAW A;  2G41 A;  5HT1 A;  1W9V A;  2A3C A;  4DRO A;  1E6Z A;  5HW7 A;  3O5Q A;  4MGV A;  2B31 A;  5HTG A;  4W9P A;  4MAV A;  1BKF A;  3KZ7 A;  3G6M A;  2OFN A;  1UR9 A;  3RME A;  4Z2L A;  3ARX A;  1WB0 A;  3MDY B;  1EHN A;  1FKL A;  4JFL A;  1WNO A;  4P8W A;  1NH6 A;  2XP8 A;  2FKE A;  2ZQV A;  4ODR A;  4DRQ A;  3CHD A;  4WK9 A;  4ITZ A;  2M1I A;  3ART A;  1Q6U A;  3G6L A;  4DT4 A;  2A3A A;  1XRV A;  1P5Q A;  4KQZ A;  1GRJ A;  3KAI A;  4TYO A;  2DSZ A;  3KAD A;  4P8U A;  1R9H A;  2A3E A;  3B8S A;  3O5J A;  5DO2 A;  3RGC A;  4JFK A;  1FD9 A;  1ROU A;  3UQI A;  4IQ2 A;  2RUR A;  1O6I A;  3RM4 A;  3O5E A;  2MNT A;  3GTY X;  3GU0 A;  1ITX A;  3B9A A;  2JZV A;  2AOS A;  4J4O A;  4QT3 A;  3UF8 A;  1FKI A;  4W5U A;  1C9H A;  2PPN A;  4DRN A;  1LL6 A;  2B5U B;  3TCZ A;  2YBU A;  1FKD A;  2PV3 A;  4O2T A;  5GQB A;  1W1P A;  2ESC A;  1JNT A;  1X6N A;  2PBC A;  3AQU A;  1FKS A;  4ODK A;  4UDM A;  3ARZ A;  3KAG A;  4N19 A;  4P8X A;  1NWT A;  3B9E A;  4ODN A;  3ARS A;  3WD1 A;  1KT0 A;  1OGG A;  1FJD A;  4MTV A;  1E44 A;  2VCD A;  1NSG A;  3ARW A;  2K8I A;  4R5E A;  1J4I A;  2DT1 A;  2XP7 A;  3GPK A;  1ZBK A;  1SR0 A;  3ALG A;  3PA7 A;  4S3J A;  4Z2G A;  3UQB A;  3NI6 A;  4QIB A;  1T11 A;  1LL4 A;  2QF8 A;  1D6O A;  2YBT A; 
#chains in the Genus database with same CATH homology
 1M5Y A;  3CZ8 A;  4IT6 A;  4MNJ A;  1EYM A;  2Q5A A;  2PPO A;  5HW8 A;  3IKD A;  3JYM A;  1HKM A;  1ZL1 A;  1RD6 A;  4G50 A;  3I6C A;  1HKI A;  2KFW A;  3ARU A;  4DZ2 A;  3WL0 A;  5HW6 A;  4WIW A;  1FKK A;  3WD0 A;  1HXV A;  4L3N A;  4NSB A;  4XAK A;  4DWS A;  4DWS D;  4WKH A;  3KAF A;  1JNE A;  4DRH A;  2KO7 A;  1NWR A;  1QPL A;  4JFI A;  4WKF A;  4DH0 A;  4DRJ A;  3H9R B;  1XHG A;  1TCO C;  1JND A;  4IT4 A;  1FKF A;  1Y0O A;  2ZQU A;  2M08 A;  1QZ2 A;  3ARQ A;  1FKJ A;  4JYS A;  3QOK A;  1W1T A;  4HAR A;  1PBK A;  3NRK A;  2MPH A;  4DRP A;  1PIN A;  4LAY A;  1Q6H A;  3PR9 A;  1VF8 A;  3B9D A;  4JFJ A;  1J4R A;  3UI5 A;  3PRA A;  3JYJ A;  3WD4 A;  5GPR A;  2IUZ A;  1YAT A;  1FKB A;  4HBO A;  3CH9 A;  3KCE A;  3TC5 A;  2WLZ A;  1HJW A;  2XP3 A;  3WQV A;  5D75 A;  3WH0 A;  4WJX A;  1ZBV A;  1JVW A;  1ZBC A;  2D9F A;  4ZPV R;  2O92 A;  1LQ0 A;  5HWC A;  4L72 B;  2WLY A;  1ZU8 A;  4U86 A;  4P8V A;  1LJY A;  2ZR4 A;  5J6E A;  3FXY A;  1EIB A;  3CHC A;  3ARY A;  5JH8 A;  4DZ3 A;  1LG2 A;  1OGB A;  1E6R A;  3O5O A;  4FN2 A;  3UQA A;  1E9L A;  4LGX A;  2F4E A;  1LL7 A;  3W4R A;  1X6L A;  2PI6 A;  4Z2I A;  2KR7 A;  1GUV A;  4ODP A;  5DIU A;  1W26 A;  4W9O A;  2VN1 A;  1U79 A;  5GPG A;  1L1P A;  1E6P A;  3RFW A;  3IKG A;  2DT2 A;  2FDM A;  4DRI A;  4ZPT R;  3EY6 A;  2XPA A;  3OA5 A;  3ARV A;  3WKZ A;  2ZQS A;  1HKK A;  3JXV A;  1W1Y A;  4DRM A;  1F40 A;  3NTP A;  3WD3 A;  4R0X A;  2DT0 A;  2RUQ A;  4TX0 A;  5DF0 A;  5HKG A;  4AY1 A;  2N87 A;  4ZS6 A;  1H0I A;  1QPF A;  2ZR6 A;  1OWQ A;  3WL1 A;  2MLX A;  4DWS B;  1H0G A;  2XP4 A;  3O5P A;  2PV1 A;  3TDB A;  3WD2 A;  4PTM A;  1J6Y A;  3O5M A;  1NMW A;  4U85 A;  1E6N A;  2A3B A;  3KAC A;  4ODO A;  1KFW A;  4ZPW R;  2OLH A;  3O5D A;  4S3K A;  1HJX A;  1J4H A;  1W9U A;  5DIT A;  3O5R A;  1FFQ A;  3IK8 A;  4DIP A;  4KR0 B;  1FKG A;  1UR8 A;  2LGO A;  4J4N A;  3ODK A;  2DG3 A;  4ODL A;  3AS2 A;  2KI3 A;  4TW8 A;  3O5G A;  1TFV A;  4TW6 A;  4LAW A;  1B6C A;  2KE0 A;  1KT1 A;  4JFM A;  3CGM A;  3CHE A;  2WK2 A;  3OOB A;  4BF8 A;  1NWU A;  5HWB A;  1A7X A;  1FKR A;  1YW5 A;  1ZCN A;  3AS1 A;  2RSE A;  1FKT A;  1EQ3 A;  2DSW A;  4ODM A;  1EDQ A;  4TW7 A;  1IX5 A;  2LPV A;  3FY1 A;  5DIV A;  4MNK A;  1W9P A;  2G8Z A;  2MF9 A;  5BXJ A;  4Q22 A;  1FKH A;  4IPX A;  2LKN A;  2XP9 A;  2MLY A;  3RM8 A;  3KAB A;  3O5F A;  4TNS A;  2XP5 A;  2KGJ A;  4ML4 A;  4MSP A;  1HJV A;  4Z2K A;  2FAP A;  2DG4 A;  4ODQ A;  1FAP A;  1E15 A;  2AWG A;  2F21 A;  1CTN A;  2UZ5 A;  4GIV A;  3IHZ A;  4C02 B;  3ARP A;  2ITK A;  2L2S A;  4QT2 A;  1ZK6 A;  4NZC A;  3UI4 A;  1ZB5 A;  3ALF A;  1JNS A;  2XP6 A;  4GGQ A;  3WQW A;  3PRB A;  4HBE A;  1D7I A;  2WM0 A;  3UI6 A;  2PV2 A;  3O5I A;  1N1A A;  3RM9 A;  2ZQT A;  1D7J A;  4WKA A;  1Q1C A;  4Z2J A;  4MNL A;  4FAP A;  2RQS A;  5HUA A;  5B8I C;  1GPF A;  2PPP A;  2DPE A;  4DWS C;  1D7H A;  1K9T A;  1D2K A;  1NWS A;  1ZBW A;  1LG1 A;  2ZR5 A;  2RUD A;  1F8A B;  2F2D A;  3BXW A;  3VAW A;  3CGN A;  3CHF A;  4W9Q A;  4QZV B;  4MPK A;  5I98 A;  1Q6I A;  3ARR A;  3AS3 A;  2IF4 A;  2Y78 A;  4Q7N A;  3O5K A;  1NMV A;  2MLZ A;  5DEZ A;  2RUC A;  4LAX A;  4U84 A;  3FAP A;  3ARO A;  1W1V A;  1SYT A;  3O5L A;  2LJ4 A;  4IQC A;  2M2A A;  4G2P A;  3KAH A;  4Z2H A;  5HBF A;  3AS0 A;  3LUO A;  4LAV A;  3PRD A;  1HKJ A;  4MNM A;  1ROT A;  1GOI A;  2DT3 A;  2DSU A;  3B7X A;  4NNR A;  2DSV A;  2XPB A;  1BL4 A;  1FFR A;  2O9O A;  4DRK A;  2DG9 A;  4URI A;  3WIJ A;  1WAW A;  2G41 A;  5HT1 A;  1W9V A;  2A3C A;  4DRO A;  1E6Z A;  5HW7 A;  3O5Q A;  4MGV A;  2B31 A;  5HTG A;  4W9P A;  4MAV A;  1BKF A;  3KZ7 A;  3G6M A;  2OFN A;  1UR9 A;  3RME A;  4Z2L A;  3ARX A;  1WB0 A;  3MDY B;  1EHN A;  1FKL A;  4JFL A;  1WNO A;  4P8W A;  1NH6 A;  2XP8 A;  2FKE A;  2ZQV A;  4ODR A;  4DRQ A;  3CHD A;  4WK9 A;  4ITZ A;  2M1I A;  3ART A;  1Q6U A;  3G6L A;  4DT4 A;  2A3A A;  1XRV A;  1P5Q A;  4KQZ A;  3KAI A;  4TYO A;  2DSZ A;  3KAD A;  4P8U A;  1R9H A;  2A3E A;  3B8S A;  3O5J A;  5DO2 A;  3RGC A;  4JFK A;  1FD9 A;  1ROU A;  3UQI A;  4IQ2 A;  2RUR A;  1O6I A;  3RM4 A;  3O5E A;  2MNT A;  1ITX A;  3B9A A;  2JZV A;  2AOS A;  4J4O A;  4QT3 A;  3UF8 A;  1FKI A;  4W5U A;  1C9H A;  2PPN A;  4DRN A;  1LL6 A;  3TCZ A;  2YBU A;  1FKD A;  2PV3 A;  4O2T A;  5GQB A;  1W1P A;  2ESC A;  1JNT A;  1X6N A;  2PBC A;  3AQU A;  1FKS A;  4ODK A;  3ARZ A;  3KAG A;  4N19 A;  4P8X A;  1NWT A;  3B9E A;  4ODN A;  3ARS A;  3WD1 A;  1KT0 A;  1OGG A;  1FJD A;  4MTV A;  2VCD A;  1NSG A;  3ARW A;  2K8I A;  4R5E A;  1J4I A;  2DT1 A;  2XP7 A;  3GPK A;  1ZBK A;  1SR0 A;  3ALG A;  3PA7 A;  4S3J A;  4Z2G A;  3UQB A;  3NI6 A;  4QIB A;  1T11 A;  1LL4 A;  2QF8 A;  1D6O A;  2YBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...