3PRAA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 33
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3praA00
3PRAA 3PR9A 1IX5A
chains in the Genus database with same CATH superfamily
2M1IA 2MLXA 3I6CA 1D7HA 3RMEA 4WJXA 1WAWA 3AROA 4P8UA 1E6RA 2N87A 4ODQA 4HBEA 2XP5A 3WD1A 5HWBA 1LL4A 3JYJA 4ODNA 1LJYA 4Z2LA 3PRBA 1FJDA 2IUZA 1E6PA 4W9OA 1FKLA 3FY1A 4S3KA 1RD6A 3ARZA 4DRHA 3AQUA 4WIWA 2AOSA 4QIBA 4JFLA 1GRJA 1NMVA 1HKIA 4Z2IA 3UI4A 1FKFA 3ARRA 4KR0B 4Z2GA 5GPRA 1D2KA 2B31A 2ETNA 3RM4A 4DWSC 2RUCA 3RFWA 1FFQA 1EIBA 2ZQTA 4MAVA 2PI6A 4DRKA 3O5MA 1NWSA 3KZ7A 3BMBA 2F21A 1JVWA 3MDYB 4ML4A 2RUDA 3RM9A 4URIA 4MGVA 4G2PA 1YW5A 3OA5A 3O5RA 4ODMA 2PBCA 2XP3A 4GIVA 5GQBA 2YBTA 4R5EA 1CTNA 3CGMA 1KT1A 4L3NA 4C02B 2ZQUA 3KACA 1HKKA 1YATA 1J4HA 4FN2A 1W9UA 1ZBKA 4UDMA 4GGQA 2DG4A 2PN0A 1ZBCA 2OFNA 4W9QA 2M2AA 3B7XA 1WB0A 4JFJA 2PV1A 3UI6A 2L2SA 4DRMA 1OWQA 3KAIA 1LQ0A 3TC5A 3TDBA 2F23A 1HJWA 1P5QA 2ESCA 1EHNA 4ZPVR 4WK9A 1ZL1A 1L1PA 1Q6UA 2WLZA 3W4RA 4LAWA 4Q7NA 1X6NA 1W26A 4WKFA 2WK2A 2F2DA 4BF8A 1Q1CA 4XAKA 4WKAA 2VCDA 1VF8A 2ZR5A 1UR9A 3ARPA 3ARUA 1HJVA 4DROA 1FKRA 2DT0A 2MLZA 3ARYA 2ZR4A 2D9FA 2FKEA 3ARWA 1KT0A 4ZS6A 1J4IA 3WD0A 1KFWA 1HXVA 2KI3A 3BXWA 1C9HA 1Y0OA 2LGOA 3AS1A 5HTGA 1SYTA 4Z2HA 2DG9A 2MNTA 1ZK6A 5HW8A 3GU0A 4DWSA 3RM8A 4U86A 1F8AB 3CHFA 1A7XA 3AS0A 4NNRA 3ODKA 3O5FA 1FD9A 3IK8A 5HUAA 2RSEA 2RURA 4J4OA 3PRDA 1UR8A 3RGCA 1EDQA 1FAPA 4NSBA 3VAWA 3NI6A 2MPHA 1BKFA 3KAFA 1OGBA 3UQBA 2XPAA 3GTYX 4QZVB 2DSZA 2XP8A 4WKHA 2P4VA 1D7IA 2DSUA 4LAYA 1E6ZA 4P8VA 1XRVA 3O5PA 3UF8A 4KQZA 4W9PA 5DEZA 3KAGA 4MTVA 3CZ8A 3CH9A 1E44A 2DSVA 3H9RB 4JFKA 1PINA 4DWSD 3O5KA 2ZQSA 5HW6A 3KCEA 3OOBA 1FFRA 3LUOA 2RQSA 3IKGA 2AWGA 4U84A 5DIVA 3JYMA 1TFVA 2ITKA 3WD4A 4U85A 4JFIA 5DO2A 4AY1A 2IF4A 3KABA 1GUVA 4IPXA 4TYOA 1BL4A 1ITXA 4ODKA 1W1TA 2WM0A 3B9DA 3WQVA 4DH0A 3PRAA 4QT2A 3B9EA 3QOKA 1LL6A 2G8ZA 2LPVA 2PV2A 3ARXA 1W1PA 4TW6A 4Q22A 1F40A 3WD3A 2Y78A 4N19A 2VN1A 5D75A 3WQWA 5J6EA 4PTMA 1EQ3A 3ARTA 4W5UA 5HT1A 2EULA 2K8IA 4ITZA 3TCZA 4LGXA 2FAPA 1PBKA 3PR9A 4MNKA 2XP4A 3O5JA 3FAPA 4L72B 3UQAA 1ZB5A 4ODPA 2KO7A 2YBUA 3O5OA 4DRIA 4DZ3A 1EYMA 2XPBA 1NWUA 4P8XA 2A3EA 3ARSA 1FKKA 5DIUA 4DRPA 4IT4A 4DT4A 1GPFA 1W1VA 3CGNA 1FKHA 2OLHA 3UQIA 1K9TA 3WKZA 1O6IA 2Q5AA 4DWSB 1FKIA 2O92A 3WL0A 3KAHA 2KFWA 3O5DA 4DZ2A 2LKNA 2PPNA 3WL1A 3O5QA 1H0IA 4MNLA 1FKBA 1QZ2A 5I98A 3ALGA 3IKDA 2RUQA 2DT3A 4MSPA 4NZCA 1LG2A 1D6OA 1ZBWA 3B8SA 4ZPTR 1T11A 5JH8A 3WH0A 5HW7A 1W9VA 3CHCA 2UZ5A 3ALFA 1W1YA 4TX0A 4MNJA 1U79A 2F4EA 3O5GA 2DPEA 3JXVA 3UI5A 4DRNA 4JFMA 4ZPWR 4IQCA 4R0XA 1HKJA 1LL7A 1NSGA 4ODLA 4TW8A 1H0GA 2PPPA 3CHEA 1W9PA 2A3AA 1R9HA 1E15A 4MNMA 1E9LA 4ODRA 4G50A 4J4NA 4MPKA 1J6YA 1ROTA 1Q6HA 2XP7A 1IX5A 4JYSA 5BXJA 3EY6A 2DT2A 4TW7A 3O5EA 2M08A 4TNSA 5DITA 3IHZA 5B8IC 3G6LA 4HARA 3O5LA 5HBFA 3PA7A 1QPFA 2A3BA 1HJXA 1NMWA 2LJ4A 4DIPA 2WLYA 1N1AA 1JCHB 1NH6A 3O5IA 1JNDA 4ODOA 2XP9A 2PV3A 4DRJA 4IQ2A 3EIPA 5HKGA 3NTPA 1GOIA 2ZQVA 1NWRA 1HKMA 1Q6IA 1LG1A 1FKSA 1D7JA 4IT6A 1E6NA 1XHGA 1SR0A 4Z2KA 3GPKA 1M5YA 5GPGA 3KADA 4QT3A 3ARQA 2ZR6A 4P8WA 3CHDA 2DG3A 3FXYA 1OGGA 2PPOA 4O2TA 4LAXA 1ZCNA 5DF0A 2O9OA 3ARVA 2MLYA 1FKTA 1ROUA 1ZBVA 3B9AA 3G6MA 3NRKA 1JNEA 1WNOA 3WIJA 1FKGA 2G41A 1TCOC 1JNSA 4LAVA 4S3JA 5HWCA 2QF8A 2B5UB 2XP6A 4HBOA 1B6CA 3AS2A 2JZVA 1J4RA 2DT1A 1JNTA 1FKDA 1QPLA 1ZU8A 1X6LA 4FAPA 2KGJA 4Z2JA 4DRQA 3AS3A 2KR7A 1NWTA 2FDMA 2MF9A 3WD2A 2KE0A 2DSWA 1FKJA 2A3CA
chains in the Genus database with same CATH topology
2M1IA 2MLXA 3I6CA 1D7HA 3RMEA 4WJXA 1WAWA 3AROA 4P8UA 1E6RA 2N87A 4ODQA 4HBEA 2XP5A 3WD1A 5HWBA 1LL4A 3JYJA 4ODNA 1LJYA 4Z2LA 3PRBA 1FJDA 2IUZA 1E6PA 4W9OA 1FKLA 3FY1A 4S3KA 1RD6A 3ARZA 4DRHA 3AQUA 4WIWA 2AOSA 4QIBA 4JFLA 1NMVA 1HKIA 4Z2IA 3UI4A 1FKFA 3ARRA 4KR0B 4Z2GA 5GPRA 1D2KA 2B31A 3RM4A 4DWSC 2RUCA 3RFWA 1FFQA 1EIBA 2ZQTA 4MAVA 2PI6A 4DRKA 3O5MA 1NWSA 3KZ7A 2F21A 1JVWA 3MDYB 4ML4A 2RUDA 3RM9A 4URIA 4MGVA 4G2PA 1YW5A 3OA5A 3O5RA 4ODMA 2PBCA 2XP3A 4GIVA 5GQBA 2YBTA 4R5EA 1CTNA 3CGMA 1KT1A 4L3NA 4C02B 2ZQUA 3KACA 1HKKA 1YATA 1J4HA 4FN2A 1W9UA 1ZBKA 4GGQA 2DG4A 1ZBCA 2OFNA 4W9QA 2M2AA 3B7XA 1WB0A 4JFJA 2PV1A 3UI6A 2L2SA 4DRMA 1OWQA 3KAIA 1LQ0A 3TC5A 3TDBA 1HJWA 1P5QA 2ESCA 1EHNA 4ZPVR 4WK9A 1ZL1A 1L1PA 1Q6UA 2WLZA 3W4RA 4LAWA 4Q7NA 1X6NA 1W26A 4WKFA 2WK2A 2F2DA 4BF8A 1Q1CA 4XAKA 4WKAA 2VCDA 1VF8A 2ZR5A 1UR9A 3ARPA 3ARUA 1HJVA 4DROA 1FKRA 2DT0A 2MLZA 3ARYA 2ZR4A 2D9FA 2FKEA 3ARWA 1KT0A 4ZS6A 1J4IA 3WD0A 1KFWA 1HXVA 2KI3A 3BXWA 1C9HA 1Y0OA 2LGOA 3AS1A 5HTGA 1SYTA 4Z2HA 2DG9A 2MNTA 1ZK6A 5HW8A 4DWSA 3RM8A 4U86A 1F8AB 3CHFA 1A7XA 3AS0A 4NNRA 3ODKA 3O5FA 1FD9A 3IK8A 5HUAA 2RSEA 2RURA 4J4OA 3PRDA 1UR8A 3RGCA 1EDQA 1FAPA 4NSBA 3VAWA 3NI6A 2MPHA 1BKFA 3KAFA 1OGBA 3UQBA 2XPAA 4QZVB 2DSZA 2XP8A 4WKHA 1D7IA 2DSUA 4LAYA 1E6ZA 4P8VA 1XRVA 3O5PA 3UF8A 4KQZA 4W9PA 5DEZA 3KAGA 4MTVA 3CZ8A 3CH9A 2DSVA 3H9RB 4JFKA 1PINA 4DWSD 3O5KA 2ZQSA 5HW6A 3KCEA 3OOBA 1FFRA 3LUOA 2RQSA 3IKGA 2AWGA 4U84A 5DIVA 3JYMA 1TFVA 2ITKA 3WD4A 4U85A 4JFIA 5DO2A 4AY1A 2IF4A 3KABA 1GUVA 4IPXA 4TYOA 1BL4A 1ITXA 4ODKA 1W1TA 2WM0A 3B9DA 3WQVA 4DH0A 3PRAA 4QT2A 3B9EA 3QOKA 1LL6A 2G8ZA 2LPVA 2PV2A 3ARXA 1W1PA 4TW6A 4Q22A 1F40A 3WD3A 2Y78A 4N19A 2VN1A 5D75A 3WQWA 5J6EA 4PTMA 1EQ3A 3ARTA 4W5UA 5HT1A 2K8IA 4ITZA 3TCZA 4LGXA 2FAPA 1PBKA 3PR9A 4MNKA 2XP4A 3O5JA 3FAPA 4L72B 3UQAA 1ZB5A 4ODPA 2KO7A 2YBUA 3O5OA 4DRIA 4DZ3A 1EYMA 2XPBA 1NWUA 4P8XA 2A3EA 3ARSA 1FKKA 5DIUA 4DRPA 4IT4A 4DT4A 1GPFA 1W1VA 3CGNA 1FKHA 2OLHA 3UQIA 1K9TA 3WKZA 1O6IA 2Q5AA 4DWSB 1FKIA 2O92A 3WL0A 3KAHA 2KFWA 3O5DA 4DZ2A 2LKNA 2PPNA 3WL1A 3O5QA 1H0IA 4MNLA 1FKBA 1QZ2A 5I98A 3ALGA 3IKDA 2RUQA 2DT3A 4MSPA 4NZCA 1LG2A 1D6OA 1ZBWA 3B8SA 4ZPTR 1T11A 5JH8A 3WH0A 5HW7A 1W9VA 3CHCA 2UZ5A 3ALFA 1W1YA 4TX0A 4MNJA 1U79A 2F4EA 3O5GA 2DPEA 3JXVA 3UI5A 4DRNA 4JFMA 4ZPWR 4IQCA 4R0XA 1HKJA 1LL7A 1NSGA 4ODLA 4TW8A 1H0GA 2PPPA 3CHEA 1W9PA 2A3AA 1R9HA 1E15A 4MNMA 1E9LA 4ODRA 4G50A 4J4NA 4MPKA 1J6YA 1ROTA 1Q6HA 2XP7A 1IX5A 4JYSA 5BXJA 3EY6A 2DT2A 4TW7A 3O5EA 2M08A 4TNSA 5DITA 3IHZA 5B8IC 3G6LA 4HARA 3O5LA 5HBFA 3PA7A 1QPFA 2A3BA 1HJXA 1NMWA 2LJ4A 4DIPA 2WLYA 1N1AA 1NH6A 3O5IA 1JNDA 4ODOA 2XP9A 2PV3A 4DRJA 4IQ2A 5HKGA 3NTPA 1GOIA 2ZQVA 1NWRA 1HKMA 1Q6IA 1LG1A 1FKSA 1D7JA 4IT6A 1E6NA 1XHGA 1SR0A 4Z2KA 3GPKA 1M5YA 5GPGA 3KADA 4QT3A 3ARQA 2ZR6A 4P8WA 3CHDA 2DG3A 3FXYA 1OGGA 2PPOA 4O2TA 4LAXA 1ZCNA 5DF0A 2O9OA 3ARVA 2MLYA 1FKTA 1ROUA 1ZBVA 3B9AA 3G6MA 3NRKA 1JNEA 1WNOA 3WIJA 1FKGA 2G41A 1TCOC 1JNSA 4LAVA 4S3JA 5HWCA 2QF8A 2XP6A 4HBOA 1B6CA 3AS2A 2JZVA 1J4RA 2DT1A 1JNTA 1FKDA 1QPLA 1ZU8A 1X6LA 4FAPA 2KGJA 4Z2JA 4DRQA 3AS3A 2KR7A 1NWTA 2FDMA 2MF9A 3WD2A 2KE0A 2DSWA 1FKJA 2A3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRA A;  3PR9 A;  1IX5 A; 
#chains in the Genus database with same CATH topology
 2M1I A;  2MLX A;  3I6C A;  1D7H A;  3RME A;  4WJX A;  1WAW A;  3ARO A;  4P8U A;  1E6R A;  2N87 A;  4ODQ A;  4HBE A;  2XP5 A;  3WD1 A;  5HWB A;  1LL4 A;  3JYJ A;  4ODN A;  1LJY A;  4Z2L A;  3PRB A;  1FJD A;  2IUZ A;  1E6P A;  4W9O A;  1FKL A;  3FY1 A;  4S3K A;  1RD6 A;  3ARZ A;  4DRH A;  3AQU A;  4WIW A;  2AOS A;  4QIB A;  4JFL A;  1GRJ A;  1NMV A;  1HKI A;  4Z2I A;  3UI4 A;  1FKF A;  3ARR A;  4KR0 B;  4Z2G A;  5GPR A;  1D2K A;  2B31 A;  2ETN A;  3RM4 A;  4DWS C;  2RUC A;  3RFW A;  1FFQ A;  1EIB A;  2ZQT A;  4MAV A;  2PI6 A;  4DRK A;  3O5M A;  1NWS A;  3KZ7 A;  3BMB A;  2F21 A;  1JVW A;  3MDY B;  4ML4 A;  2RUD A;  3RM9 A;  4URI A;  4MGV A;  4G2P A;  1YW5 A;  3OA5 A;  3O5R A;  4ODM A;  2PBC A;  2XP3 A;  4GIV A;  5GQB A;  2YBT A;  4R5E A;  1CTN A;  3CGM A;  1KT1 A;  4L3N A;  4C02 B;  2ZQU A;  3KAC A;  1HKK A;  1YAT A;  1J4H A;  4FN2 A;  1W9U A;  1ZBK A;  4UDM A;  4GGQ A;  2DG4 A;  2PN0 A;  1ZBC A;  2OFN A;  4W9Q A;  2M2A A;  3B7X A;  1WB0 A;  4JFJ A;  2PV1 A;  3UI6 A;  2L2S A;  4DRM A;  1OWQ A;  3KAI A;  1LQ0 A;  3TC5 A;  3TDB A;  2F23 A;  1HJW A;  1P5Q A;  2ESC A;  1EHN A;  4ZPV R;  4WK9 A;  1ZL1 A;  1L1P A;  1Q6U A;  2WLZ A;  3W4R A;  4LAW A;  4Q7N A;  1X6N A;  1W26 A;  4WKF A;  2WK2 A;  2F2D A;  4BF8 A;  1Q1C A;  4XAK A;  4WKA A;  2VCD A;  1VF8 A;  2ZR5 A;  1UR9 A;  3ARP A;  3ARU A;  1HJV A;  4DRO A;  1FKR A;  2DT0 A;  2MLZ A;  3ARY A;  2ZR4 A;  2D9F A;  2FKE A;  3ARW A;  1KT0 A;  4ZS6 A;  1J4I A;  3WD0 A;  1KFW A;  1HXV A;  2KI3 A;  3BXW A;  1C9H A;  1Y0O A;  2LGO A;  3AS1 A;  5HTG A;  1SYT A;  4Z2H A;  2DG9 A;  2MNT A;  1ZK6 A;  5HW8 A;  3GU0 A;  4DWS A;  3RM8 A;  4U86 A;  1F8A B;  3CHF A;  1A7X A;  3AS0 A;  4NNR A;  3ODK A;  3O5F A;  1FD9 A;  3IK8 A;  5HUA A;  2RSE A;  2RUR A;  4J4O A;  3PRD A;  1UR8 A;  3RGC A;  1EDQ A;  1FAP A;  4NSB A;  3VAW A;  3NI6 A;  2MPH A;  1BKF A;  3KAF A;  1OGB A;  3UQB A;  2XPA A;  3GTY X;  4QZV B;  2DSZ A;  2XP8 A;  4WKH A;  2P4V A;  1D7I A;  2DSU A;  4LAY A;  1E6Z A;  4P8V A;  1XRV A;  3O5P A;  3UF8 A;  4KQZ A;  4W9P A;  5DEZ A;  3KAG A;  4MTV A;  3CZ8 A;  3CH9 A;  1E44 A;  2DSV A;  3H9R B;  4JFK A;  1PIN A;  4DWS D;  3O5K A;  2ZQS A;  5HW6 A;  3KCE A;  3OOB A;  1FFR A;  3LUO A;  2RQS A;  3IKG A;  2AWG A;  4U84 A;  5DIV A;  3JYM A;  1TFV A;  2ITK A;  3WD4 A;  4U85 A;  4JFI A;  5DO2 A;  4AY1 A;  2IF4 A;  3KAB A;  1GUV A;  4IPX A;  4TYO A;  1BL4 A;  1ITX A;  4ODK A;  1W1T A;  2WM0 A;  3B9D A;  3WQV A;  4DH0 A;  3PRA A;  4QT2 A;  3B9E A;  3QOK A;  1LL6 A;  2G8Z A;  2LPV A;  2PV2 A;  3ARX A;  1W1P A;  4TW6 A;  4Q22 A;  1F40 A;  3WD3 A;  2Y78 A;  4N19 A;  2VN1 A;  5D75 A;  3WQW A;  5J6E A;  4PTM A;  1EQ3 A;  3ART A;  4W5U A;  5HT1 A;  2EUL A;  2K8I A;  4ITZ A;  3TCZ A;  4LGX A;  2FAP A;  1PBK A;  3PR9 A;  4MNK A;  2XP4 A;  3O5J A;  3FAP A;  4L72 B;  3UQA A;  1ZB5 A;  4ODP A;  2KO7 A;  2YBU A;  3O5O A;  4DRI A;  4DZ3 A;  1EYM A;  2XPB A;  1NWU A;  4P8X A;  2A3E A;  3ARS A;  1FKK A;  5DIU A;  4DRP A;  4IT4 A;  4DT4 A;  1GPF A;  1W1V A;  3CGN A;  1FKH A;  2OLH A;  3UQI A;  1K9T A;  3WKZ A;  1O6I A;  2Q5A A;  4DWS B;  1FKI A;  2O92 A;  3WL0 A;  3KAH A;  2KFW A;  3O5D A;  4DZ2 A;  2LKN A;  2PPN A;  3WL1 A;  3O5Q A;  1H0I A;  4MNL A;  1FKB A;  1QZ2 A;  5I98 A;  3ALG A;  3IKD A;  2RUQ A;  2DT3 A;  4MSP A;  4NZC A;  1LG2 A;  1D6O A;  1ZBW A;  3B8S A;  4ZPT R;  1T11 A;  5JH8 A;  3WH0 A;  5HW7 A;  1W9V A;  3CHC A;  2UZ5 A;  3ALF A;  1W1Y A;  4TX0 A;  4MNJ A;  1U79 A;  2F4E A;  3O5G A;  2DPE A;  3JXV A;  3UI5 A;  4DRN A;  4JFM A;  4ZPW R;  4IQC A;  4R0X A;  1HKJ A;  1LL7 A;  1NSG A;  4ODL A;  4TW8 A;  1H0G A;  2PPP A;  3CHE A;  1W9P A;  2A3A A;  1R9H A;  1E15 A;  4MNM A;  1E9L A;  4ODR A;  4G50 A;  4J4N A;  4MPK A;  1J6Y A;  1ROT A;  1Q6H A;  2XP7 A;  1IX5 A;  4JYS A;  5BXJ A;  3EY6 A;  2DT2 A;  4TW7 A;  3O5E A;  2M08 A;  4TNS A;  5DIT A;  3IHZ A;  5B8I C;  3G6L A;  4HAR A;  3O5L A;  5HBF A;  3PA7 A;  1QPF A;  2A3B A;  1HJX A;  1NMW A;  2LJ4 A;  4DIP A;  2WLY A;  1N1A A;  1JCH B;  1NH6 A;  3O5I A;  1JND A;  4ODO A;  2XP9 A;  2PV3 A;  4DRJ A;  4IQ2 A;  3EIP A;  5HKG A;  3NTP A;  1GOI A;  2ZQV A;  1NWR A;  1HKM A;  1Q6I A;  1LG1 A;  1FKS A;  1D7J A;  4IT6 A;  1E6N A;  1XHG A;  1SR0 A;  4Z2K A;  3GPK A;  1M5Y A;  5GPG A;  3KAD A;  4QT3 A;  3ARQ A;  2ZR6 A;  4P8W A;  3CHD A;  2DG3 A;  3FXY A;  1OGG A;  2PPO A;  4O2T A;  4LAX A;  1ZCN A;  5DF0 A;  2O9O A;  3ARV A;  2MLY A;  1FKT A;  1ROU A;  1ZBV A;  3B9A A;  3G6M A;  3NRK A;  1JNE A;  1WNO A;  3WIJ A;  1FKG A;  2G41 A;  1TCO C;  1JNS A;  4LAV A;  4S3J A;  5HWC A;  2QF8 A;  2B5U B;  2XP6 A;  4HBO A;  1B6C A;  3AS2 A;  2JZV A;  1J4R A;  2DT1 A;  1JNT A;  1FKD A;  1QPL A;  1ZU8 A;  1X6L A;  4FAP A;  2KGJ A;  4Z2J A;  4DRQ A;  3AS3 A;  2KR7 A;  1NWT A;  2FDM A;  2MF9 A;  3WD2 A;  2KE0 A;  2DSW A;  1FKJ A;  2A3C A; 
#chains in the Genus database with same CATH homology
 2M1I A;  2MLX A;  3I6C A;  1D7H A;  3RME A;  4WJX A;  1WAW A;  3ARO A;  4P8U A;  1E6R A;  2N87 A;  4ODQ A;  4HBE A;  2XP5 A;  3WD1 A;  5HWB A;  1LL4 A;  3JYJ A;  4ODN A;  1LJY A;  4Z2L A;  3PRB A;  1FJD A;  2IUZ A;  1E6P A;  4W9O A;  1FKL A;  3FY1 A;  4S3K A;  1RD6 A;  3ARZ A;  4DRH A;  3AQU A;  4WIW A;  2AOS A;  4QIB A;  4JFL A;  1NMV A;  1HKI A;  4Z2I A;  3UI4 A;  1FKF A;  3ARR A;  4KR0 B;  4Z2G A;  5GPR A;  1D2K A;  2B31 A;  3RM4 A;  4DWS C;  2RUC A;  3RFW A;  1FFQ A;  1EIB A;  2ZQT A;  4MAV A;  2PI6 A;  4DRK A;  3O5M A;  1NWS A;  3KZ7 A;  2F21 A;  1JVW A;  3MDY B;  4ML4 A;  2RUD A;  3RM9 A;  4URI A;  4MGV A;  4G2P A;  1YW5 A;  3OA5 A;  3O5R A;  4ODM A;  2PBC A;  2XP3 A;  4GIV A;  5GQB A;  2YBT A;  4R5E A;  1CTN A;  3CGM A;  1KT1 A;  4L3N A;  4C02 B;  2ZQU A;  3KAC A;  1HKK A;  1YAT A;  1J4H A;  4FN2 A;  1W9U A;  1ZBK A;  4GGQ A;  2DG4 A;  1ZBC A;  2OFN A;  4W9Q A;  2M2A A;  3B7X A;  1WB0 A;  4JFJ A;  2PV1 A;  3UI6 A;  2L2S A;  4DRM A;  1OWQ A;  3KAI A;  1LQ0 A;  3TC5 A;  3TDB A;  1HJW A;  1P5Q A;  2ESC A;  1EHN A;  4ZPV R;  4WK9 A;  1ZL1 A;  1L1P A;  1Q6U A;  2WLZ A;  3W4R A;  4LAW A;  4Q7N A;  1X6N A;  1W26 A;  4WKF A;  2WK2 A;  2F2D A;  4BF8 A;  1Q1C A;  4XAK A;  4WKA A;  2VCD A;  1VF8 A;  2ZR5 A;  1UR9 A;  3ARP A;  3ARU A;  1HJV A;  4DRO A;  1FKR A;  2DT0 A;  2MLZ A;  3ARY A;  2ZR4 A;  2D9F A;  2FKE A;  3ARW A;  1KT0 A;  4ZS6 A;  1J4I A;  3WD0 A;  1KFW A;  1HXV A;  2KI3 A;  3BXW A;  1C9H A;  1Y0O A;  2LGO A;  3AS1 A;  5HTG A;  1SYT A;  4Z2H A;  2DG9 A;  2MNT A;  1ZK6 A;  5HW8 A;  4DWS A;  3RM8 A;  4U86 A;  1F8A B;  3CHF A;  1A7X A;  3AS0 A;  4NNR A;  3ODK A;  3O5F A;  1FD9 A;  3IK8 A;  5HUA A;  2RSE A;  2RUR A;  4J4O A;  3PRD A;  1UR8 A;  3RGC A;  1EDQ A;  1FAP A;  4NSB A;  3VAW A;  3NI6 A;  2MPH A;  1BKF A;  3KAF A;  1OGB A;  3UQB A;  2XPA A;  4QZV B;  2DSZ A;  2XP8 A;  4WKH A;  1D7I A;  2DSU A;  4LAY A;  1E6Z A;  4P8V A;  1XRV A;  3O5P A;  3UF8 A;  4KQZ A;  4W9P A;  5DEZ A;  3KAG A;  4MTV A;  3CZ8 A;  3CH9 A;  2DSV A;  3H9R B;  4JFK A;  1PIN A;  4DWS D;  3O5K A;  2ZQS A;  5HW6 A;  3KCE A;  3OOB A;  1FFR A;  3LUO A;  2RQS A;  3IKG A;  2AWG A;  4U84 A;  5DIV A;  3JYM A;  1TFV A;  2ITK A;  3WD4 A;  4U85 A;  4JFI A;  5DO2 A;  4AY1 A;  2IF4 A;  3KAB A;  1GUV A;  4IPX A;  4TYO A;  1BL4 A;  1ITX A;  4ODK A;  1W1T A;  2WM0 A;  3B9D A;  3WQV A;  4DH0 A;  3PRA A;  4QT2 A;  3B9E A;  3QOK A;  1LL6 A;  2G8Z A;  2LPV A;  2PV2 A;  3ARX A;  1W1P A;  4TW6 A;  4Q22 A;  1F40 A;  3WD3 A;  2Y78 A;  4N19 A;  2VN1 A;  5D75 A;  3WQW A;  5J6E A;  4PTM A;  1EQ3 A;  3ART A;  4W5U A;  5HT1 A;  2K8I A;  4ITZ A;  3TCZ A;  4LGX A;  2FAP A;  1PBK A;  3PR9 A;  4MNK A;  2XP4 A;  3O5J A;  3FAP A;  4L72 B;  3UQA A;  1ZB5 A;  4ODP A;  2KO7 A;  2YBU A;  3O5O A;  4DRI A;  4DZ3 A;  1EYM A;  2XPB A;  1NWU A;  4P8X A;  2A3E A;  3ARS A;  1FKK A;  5DIU A;  4DRP A;  4IT4 A;  4DT4 A;  1GPF A;  1W1V A;  3CGN A;  1FKH A;  2OLH A;  3UQI A;  1K9T A;  3WKZ A;  1O6I A;  2Q5A A;  4DWS B;  1FKI A;  2O92 A;  3WL0 A;  3KAH A;  2KFW A;  3O5D A;  4DZ2 A;  2LKN A;  2PPN A;  3WL1 A;  3O5Q A;  1H0I A;  4MNL A;  1FKB A;  1QZ2 A;  5I98 A;  3ALG A;  3IKD A;  2RUQ A;  2DT3 A;  4MSP A;  4NZC A;  1LG2 A;  1D6O A;  1ZBW A;  3B8S A;  4ZPT R;  1T11 A;  5JH8 A;  3WH0 A;  5HW7 A;  1W9V A;  3CHC A;  2UZ5 A;  3ALF A;  1W1Y A;  4TX0 A;  4MNJ A;  1U79 A;  2F4E A;  3O5G A;  2DPE A;  3JXV A;  3UI5 A;  4DRN A;  4JFM A;  4ZPW R;  4IQC A;  4R0X A;  1HKJ A;  1LL7 A;  1NSG A;  4ODL A;  4TW8 A;  1H0G A;  2PPP A;  3CHE A;  1W9P A;  2A3A A;  1R9H A;  1E15 A;  4MNM A;  1E9L A;  4ODR A;  4G50 A;  4J4N A;  4MPK A;  1J6Y A;  1ROT A;  1Q6H A;  2XP7 A;  1IX5 A;  4JYS A;  5BXJ A;  3EY6 A;  2DT2 A;  4TW7 A;  3O5E A;  2M08 A;  4TNS A;  5DIT A;  3IHZ A;  5B8I C;  3G6L A;  4HAR A;  3O5L A;  5HBF A;  3PA7 A;  1QPF A;  2A3B A;  1HJX A;  1NMW A;  2LJ4 A;  4DIP A;  2WLY A;  1N1A A;  1NH6 A;  3O5I A;  1JND A;  4ODO A;  2XP9 A;  2PV3 A;  4DRJ A;  4IQ2 A;  5HKG A;  3NTP A;  1GOI A;  2ZQV A;  1NWR A;  1HKM A;  1Q6I A;  1LG1 A;  1FKS A;  1D7J A;  4IT6 A;  1E6N A;  1XHG A;  1SR0 A;  4Z2K A;  3GPK A;  1M5Y A;  5GPG A;  3KAD A;  4QT3 A;  3ARQ A;  2ZR6 A;  4P8W A;  3CHD A;  2DG3 A;  3FXY A;  1OGG A;  2PPO A;  4O2T A;  4LAX A;  1ZCN A;  5DF0 A;  2O9O A;  3ARV A;  2MLY A;  1FKT A;  1ROU A;  1ZBV A;  3B9A A;  3G6M A;  3NRK A;  1JNE A;  1WNO A;  3WIJ A;  1FKG A;  2G41 A;  1TCO C;  1JNS A;  4LAV A;  4S3J A;  5HWC A;  2QF8 A;  2XP6 A;  4HBO A;  1B6C A;  3AS2 A;  2JZV A;  1J4R A;  2DT1 A;  1JNT A;  1FKD A;  1QPL A;  1ZU8 A;  1X6L A;  4FAP A;  2KGJ A;  4Z2J A;  4DRQ A;  3AS3 A;  2KR7 A;  1NWT A;  2FDM A;  2MF9 A;  3WD2 A;  2KE0 A;  2DSW A;  1FKJ A;  2A3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...