3PRAA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
total genus 33
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3praA00
1IX5A 3PR9A 3PRAA
chains in the Genus database with same CATH superfamily
1Q6HA 1FFRA 1ITXA 3B7XA 1GOIA 3ARXA 4DRJA 4IQCA 3AS2A 2D9FA 1HKKA 2XP8A 2RSEA 2FKEA 2YBUA 4HBOA 2F4EA 4MSPA 4S3JA 3W4RA 2ITKA 4DRPA 4MNLA 1OGGA 3KAHA 3WKZA 1W9PA 5JH8A 2UZ5A 1NSGA 3IK8A 2ZR4A 2ZR5A 1FKDA 3G6LA 4KQZA 3ALGA 3IKDA 1HJVA 1F40A 2OLHA 4Z2LA 1LG1A 1FKFA 1E15A 3B9AA 1ZBWA 2F21A 2M1IA 2RQSA 4P8UA 5HBFA 3LUOA 3RMEA 1GRJA 4LAWA 3ARUA 1FKSA 3CH9A 4KR0B 1ZBCA 3GU0A 4GGQA 1WB0A 1P5QA 3O5KA 2P4VA 4JFJA 1JNSA 3O5QA 4W9PA 1ZK6A 5BXJA 1NH6A 3O5FA 4QT3A 1HKIA 4LGXA 1XRVA 5HW7A 3O5OA 1JVWA 4IQ2A 3ARYA 1JNTA 4UDMA 3PRDA 1EDQA 3B8SA 3RM8A 3PRBA 3BXWA 2DPEA 2XP7A 4MNKA 1J6YA 4G50A 4JFKA 2KE0A 3CHCA 1UR9A 4TNSA 1OWQA 4W9OA 1E44A 3TDBA 1FAPA 2PV2A 4ML4A 1SYTA 1ZBKA 2KGJA 1W1TA 4NNRA 3FAPA 4ITZA 3AS3A 4JFIA 1BKFA 4DRHA 3O5DA 3PR9A 1EHNA 3KABA 5DIUA 3UI6A 3BMBA 1FKJA 4TX0A 4W9QA 4PTMA 4TW7A 4C02B 2PV3A 1NWRA 4JFLA 2ZR6A 2RUDA 2F2DA 1NMVA 4MTVA 2DT0A 1H0IA 1FKRA 2MF9A 1D2KA 1YATA 4DT4A 4DWSD 1NWTA 2IUZA 1FD9A 1T11A 4ZPWR 1CTNA 2B5UB 2WK2A 3ARZA 1LL6A 3EY6A 5DEZA 3WD3A 3WD1A 3H9RB 1H0GA 1PBKA 4ZPTR 3O5GA 1NWSA 2DSWA 2XP5A 5I98A 1W1YA 2XP9A 4GIVA 4W5UA 4DRKA 2QF8A 4R5EA 3WH0A 1E6PA 2KO7A 5HKGA 2M08A 1NMWA 1JCHB 4LAXA 3O5EA 4DIPA 1QPFA 2WM0A 1Q1CA 2RURA 1B6CA 3O5IA 1JNEA 2MLYA 4NSBA 3PRAA 3UQAA 4QIBA 3JXVA 4DZ3A 4DWSB 4JYSA 1GPFA 4Q7NA 1X6LA 2AOSA 1E6RA 3UF8A 4IT4A 1D7HA 4MPKA 3AROA 3CGMA 3TC5A 2PPOA 1EIBA 1LQ0A 1F8AB 1HJWA 2WLZA 3WD4A 3RFWA 1M5YA 1E6ZA 2L2SA 1HXVA 1UR8A 4ODRA 2G41A 1RD6A 2KR7A 3ARVA 4ODMA 2PPPA 3TCZA 1QPLA 3O5MA 2K8IA 4DZ2A 4G2PA 4FAPA 5J6EA 3CZ8A 4HARA 1EYMA 3WIJA 1LJYA 2F23A 1KT1A 2PV1A 1FKTA 4ODQA 3UI4A 2FDMA 3EIPA 3FY1A 2RUQA 1NWUA 1FJDA 4L3NA 4DRNA 3RM9A 3WL1A 2DG9A 3UI5A 3GPKA 4U85A 3QOKA 4MNMA 4MAVA 2DSUA 5D75A 2DSVA 2DG3A 1W9VA 4DROA 2LPVA 1HJXA 4QZVB 2VN1A 4LAVA 2DT2A 2A3EA 3NI6A 3ARPA 1LL7A 1HKJA 3ARSA 1W26A 2N87A 1Y0OA 2PN0A 3B9DA 1IX5A 4WJXA 2MLZA 4TW8A 1SR0A 3CGNA 4N19A 2A3BA 2A3AA 4NZCA 1D6OA 4P8WA 3KAFA 1D7IA 2O92A 3G6MA 5HUAA 3VAWA 2WLYA 5DIVA 1W1VA 4P8XA 4QT2A 3JYJA 3CHFA 4URIA 1LL4A 4ZPVR 2IF4A 5HWCA 2PBCA 2B31A 3RM4A 1HKMA 1FKHA 1A7XA 2Y78A 1N1AA 5GPGA 4ZS6A 3O5PA 2PI6A 1EQ3A 1D7JA 2DSZA 3IKGA 2FAPA 5GQBA 4WK9A 2YBTA 2XPAA 1J4IA 3ARQA 4WKHA 5B8IC 2DT1A 3CHDA 4J4OA 4AY1A 1KFWA 3ODKA 4LAYA 3AS1A 1Q6UA 1C9HA 2MLXA 3WD0A 2ZQSA 3ARTA 1ROUA 2ETNA 4Q22A 3KACA 2DG4A 1ROTA 3WL0A 3WQWA 1WAWA 2AWGA 3B9EA 1FKLA 2ESCA 1X6NA 3ALFA 2ZQUA 2G8ZA 3AS0A 4FN2A 1ZBVA 3KADA 1WNOA 5HWBA 2M2AA 2A3CA 1K9TA 3NTPA 4U84A 1ZB5A 4JFMA 4P8VA 4ODNA 3UQIA 3RGCA 2PPNA 3NRKA 4DWSC 1E9LA 4Z2JA 4Z2HA 1L1PA 1JNDA 5HTGA 1J4HA 4DRQA 1ZU8A 3PA7A 4O2TA 3WQVA 4IPXA 2XPBA 2RUCA 3O5LA 4WKAA 1KT0A 4XAKA 1U79A 3ARRA 3KCEA 1FKBA 4U86A 1FKKA 4WIWA 2OFNA 1VF8A 5GPRA 3O5RA 4ODKA 1LG2A 1FKGA 2ZQTA 2Q5AA 3GTYX 3OA5A 4HBEA 5DO2A 1R9HA 4ODLA 2ZQVA 2LKNA 2XP6A 4DWSA 4J4NA 1W1PA 4MNJA 4DRIA 2EULA 1O6IA 1PINA 4R0XA 5HT1A 1FFQA 1XHGA 3OOBA 4ODOA 4S3KA 3UQBA 3KZ7A 2KI3A 2MPHA 3JYMA 3FXYA 4DH0A 1QZ2A 3ARWA 2LJ4A 1W9UA 3CHEA 2LGOA 5DITA 4WKFA 3KAIA 1BL4A 3O5JA 3KAGA 4DRMA 1OGBA 1TCOC 2JZVA 1J4RA 4BF8A 5HW6A 2KFWA 4MGVA 3AQUA 4TW6A 1YW5A 1GUVA 3MDYB 1ZCNA 4IT6A 4Z2GA 1FKIA 3WD2A 2XP3A 3I6CA 1TFVA 2DT3A 5DF0A 4Z2KA 4Z2IA 5HW8A 4TYOA 2VCDA 2O9OA 1E6NA 2MNTA 4ODPA 1Q6IA 1ZL1A 2XP4A 4L72B 3IHZA
chains in the Genus database with same CATH topology
1Q6HA 1FFRA 1ITXA 3B7XA 1GOIA 3ARXA 4DRJA 4IQCA 3AS2A 2D9FA 1HKKA 2XP8A 2RSEA 2FKEA 2YBUA 4HBOA 2F4EA 4MSPA 4S3JA 3W4RA 2ITKA 4DRPA 4MNLA 1OGGA 3KAHA 3WKZA 1W9PA 5JH8A 2UZ5A 1NSGA 3IK8A 2ZR4A 2ZR5A 1FKDA 3G6LA 4KQZA 3ALGA 3IKDA 1HJVA 1F40A 2OLHA 4Z2LA 1LG1A 1FKFA 1E15A 3B9AA 1ZBWA 2F21A 2M1IA 2RQSA 4P8UA 5HBFA 3LUOA 3RMEA 4LAWA 3ARUA 1FKSA 3CH9A 4KR0B 1ZBCA 4GGQA 1WB0A 1P5QA 3O5KA 4JFJA 1JNSA 3O5QA 4W9PA 1ZK6A 5BXJA 1NH6A 3O5FA 4QT3A 1HKIA 4LGXA 1XRVA 5HW7A 3O5OA 1JVWA 4IQ2A 3ARYA 1JNTA 3PRDA 1EDQA 3B8SA 3RM8A 3PRBA 3BXWA 2DPEA 2XP7A 4MNKA 1J6YA 4G50A 4JFKA 2KE0A 3CHCA 1UR9A 4TNSA 1OWQA 4W9OA 3TDBA 1FAPA 2PV2A 4ML4A 1SYTA 1ZBKA 2KGJA 1W1TA 4NNRA 3FAPA 4ITZA 3AS3A 4JFIA 1BKFA 4DRHA 3O5DA 3PR9A 1EHNA 3KABA 5DIUA 3UI6A 1FKJA 4TX0A 4W9QA 4PTMA 4TW7A 4C02B 2PV3A 1NWRA 4JFLA 2ZR6A 2RUDA 2F2DA 1NMVA 4MTVA 2DT0A 1H0IA 1FKRA 2MF9A 1D2KA 1YATA 4DT4A 4DWSD 1NWTA 2IUZA 1FD9A 1T11A 4ZPWR 1CTNA 2WK2A 3ARZA 3EY6A 1LL6A 5DEZA 3WD3A 3WD1A 3H9RB 1H0GA 1PBKA 4ZPTR 3O5GA 1NWSA 2DSWA 2XP5A 5I98A 1W1YA 2XP9A 4GIVA 4W5UA 4DRKA 2QF8A 4R5EA 3WH0A 1E6PA 2KO7A 5HKGA 2M08A 1NMWA 4LAXA 3O5EA 4DIPA 1QPFA 2WM0A 1Q1CA 2RURA 1B6CA 3O5IA 1JNEA 2MLYA 4NSBA 3PRAA 3UQAA 4QIBA 3JXVA 4DZ3A 4DWSB 4JYSA 1GPFA 4Q7NA 1X6LA 2AOSA 1E6RA 3UF8A 4IT4A 1D7HA 4MPKA 3AROA 3CGMA 3TC5A 2PPOA 1EIBA 1LQ0A 1F8AB 1HJWA 2WLZA 3WD4A 3RFWA 1M5YA 1E6ZA 2L2SA 1HXVA 1UR8A 4ODRA 2G41A 1RD6A 2KR7A 3ARVA 4ODMA 2PPPA 3TCZA 1QPLA 3O5MA 2K8IA 4DZ2A 4G2PA 4FAPA 5J6EA 3CZ8A 4HARA 1EYMA 3WIJA 1LJYA 1KT1A 2PV1A 1FKTA 4ODQA 3UI4A 2FDMA 3FY1A 2RUQA 1NWUA 1FJDA 4L3NA 4DRNA 3RM9A 3WL1A 2DG9A 3UI5A 3GPKA 4U85A 3QOKA 4MNMA 4MAVA 2DSUA 5D75A 2DSVA 2DG3A 1W9VA 4DROA 2LPVA 1HJXA 4QZVB 2VN1A 4LAVA 2DT2A 2A3EA 3NI6A 3ARPA 1LL7A 1HKJA 3ARSA 1W26A 2N87A 1Y0OA 3B9DA 1IX5A 4WJXA 2MLZA 4TW8A 1SR0A 3CGNA 4N19A 2A3BA 2A3AA 4NZCA 1D6OA 4P8WA 3KAFA 1D7IA 2O92A 3G6MA 5HUAA 3VAWA 2WLYA 5DIVA 1W1VA 4P8XA 4QT2A 3JYJA 3CHFA 4URIA 1LL4A 4ZPVR 2IF4A 5HWCA 2PBCA 2B31A 3RM4A 1HKMA 1FKHA 1A7XA 2Y78A 1N1AA 5GPGA 4ZS6A 3O5PA 2PI6A 1EQ3A 1D7JA 2DSZA 3IKGA 2FAPA 5GQBA 4WK9A 2YBTA 2XPAA 1J4IA 3ARQA 4WKHA 5B8IC 2DT1A 3CHDA 4J4OA 4AY1A 1KFWA 3ODKA 4LAYA 3AS1A 1Q6UA 1C9HA 2MLXA 3WD0A 2ZQSA 3ARTA 1ROUA 4Q22A 3KACA 2DG4A 1ROTA 3WL0A 3WQWA 1WAWA 2AWGA 3B9EA 1FKLA 2ESCA 1X6NA 3ALFA 2ZQUA 2G8ZA 3AS0A 4FN2A 1ZBVA 3KADA 1WNOA 5HWBA 2M2AA 2A3CA 1K9TA 3NTPA 4U84A 1ZB5A 4JFMA 4P8VA 4ODNA 3UQIA 3RGCA 2PPNA 3NRKA 4DWSC 1E9LA 4Z2JA 4Z2HA 1L1PA 1JNDA 5HTGA 1J4HA 4DRQA 1ZU8A 3PA7A 4O2TA 3WQVA 4IPXA 2XPBA 2RUCA 3O5LA 4WKAA 1KT0A 4XAKA 1U79A 3ARRA 3KCEA 1FKBA 4U86A 1FKKA 4WIWA 2OFNA 1VF8A 5GPRA 3O5RA 4ODKA 1LG2A 1FKGA 2ZQTA 2Q5AA 3OA5A 4HBEA 5DO2A 1R9HA 4ODLA 2ZQVA 2LKNA 2XP6A 4DWSA 4J4NA 1W1PA 4MNJA 4DRIA 1O6IA 1PINA 4R0XA 5HT1A 1FFQA 1XHGA 3OOBA 4ODOA 4S3KA 3UQBA 3KZ7A 2KI3A 2MPHA 3JYMA 3FXYA 4DH0A 1QZ2A 3ARWA 2LJ4A 1W9UA 3CHEA 2LGOA 5DITA 4WKFA 3KAIA 1BL4A 3O5JA 3KAGA 4DRMA 1OGBA 1TCOC 2JZVA 1J4RA 4BF8A 5HW6A 2KFWA 4MGVA 3AQUA 4TW6A 1YW5A 1GUVA 3MDYB 1ZCNA 4IT6A 4Z2GA 1FKIA 3WD2A 2XP3A 3I6CA 1TFVA 2DT3A 5DF0A 4Z2KA 4Z2IA 5HW8A 4TYOA 2VCDA 2O9OA 1E6NA 2MNTA 4ODPA 1Q6IA 1ZL1A 2XP4A 4L72B 3IHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX5 A;  3PR9 A;  3PRA A; 
#chains in the Genus database with same CATH topology
 1Q6H A;  1FFR A;  1ITX A;  3B7X A;  1GOI A;  3ARX A;  4DRJ A;  4IQC A;  3AS2 A;  2D9F A;  1HKK A;  2XP8 A;  2RSE A;  2FKE A;  2YBU A;  4HBO A;  2F4E A;  4MSP A;  4S3J A;  3W4R A;  2ITK A;  4DRP A;  4MNL A;  1OGG A;  3KAH A;  3WKZ A;  1W9P A;  5JH8 A;  2UZ5 A;  1NSG A;  3IK8 A;  2ZR4 A;  2ZR5 A;  1FKD A;  3G6L A;  4KQZ A;  3ALG A;  3IKD A;  1HJV A;  1F40 A;  2OLH A;  4Z2L A;  1LG1 A;  1FKF A;  1E15 A;  3B9A A;  1ZBW A;  2F21 A;  2M1I A;  2RQS A;  4P8U A;  5HBF A;  3LUO A;  3RME A;  1GRJ A;  4LAW A;  3ARU A;  1FKS A;  3CH9 A;  4KR0 B;  1ZBC A;  3GU0 A;  4GGQ A;  1WB0 A;  1P5Q A;  3O5K A;  2P4V A;  4JFJ A;  1JNS A;  3O5Q A;  4W9P A;  1ZK6 A;  5BXJ A;  1NH6 A;  3O5F A;  4QT3 A;  1HKI A;  4LGX A;  1XRV A;  5HW7 A;  3O5O A;  1JVW A;  4IQ2 A;  3ARY A;  1JNT A;  4UDM A;  3PRD A;  1EDQ A;  3B8S A;  3RM8 A;  3PRB A;  3BXW A;  2DPE A;  2XP7 A;  4MNK A;  1J6Y A;  4G50 A;  4JFK A;  2KE0 A;  3CHC A;  1UR9 A;  4TNS A;  1OWQ A;  4W9O A;  1E44 A;  3TDB A;  1FAP A;  2PV2 A;  4ML4 A;  1SYT A;  1ZBK A;  2KGJ A;  1W1T A;  4NNR A;  3FAP A;  4ITZ A;  3AS3 A;  4JFI A;  1BKF A;  4DRH A;  3O5D A;  3PR9 A;  1EHN A;  3KAB A;  5DIU A;  3UI6 A;  3BMB A;  1FKJ A;  4TX0 A;  4W9Q A;  4PTM A;  4TW7 A;  4C02 B;  2PV3 A;  1NWR A;  4JFL A;  2ZR6 A;  2RUD A;  2F2D A;  1NMV A;  4MTV A;  2DT0 A;  1H0I A;  1FKR A;  2MF9 A;  1D2K A;  1YAT A;  4DT4 A;  4DWS D;  1NWT A;  2IUZ A;  1FD9 A;  1T11 A;  4ZPW R;  1CTN A;  2B5U B;  2WK2 A;  3ARZ A;  1LL6 A;  3EY6 A;  5DEZ A;  3WD3 A;  3WD1 A;  3H9R B;  1H0G A;  1PBK A;  4ZPT R;  3O5G A;  1NWS A;  2DSW A;  2XP5 A;  5I98 A;  1W1Y A;  2XP9 A;  4GIV A;  4W5U A;  4DRK A;  2QF8 A;  4R5E A;  3WH0 A;  1E6P A;  2KO7 A;  5HKG A;  2M08 A;  1NMW A;  1JCH B;  4LAX A;  3O5E A;  4DIP A;  1QPF A;  2WM0 A;  1Q1C A;  2RUR A;  1B6C A;  3O5I A;  1JNE A;  2MLY A;  4NSB A;  3PRA A;  3UQA A;  4QIB A;  3JXV A;  4DZ3 A;  4DWS B;  4JYS A;  1GPF A;  4Q7N A;  1X6L A;  2AOS A;  1E6R A;  3UF8 A;  4IT4 A;  1D7H A;  4MPK A;  3ARO A;  3CGM A;  3TC5 A;  2PPO A;  1EIB A;  1LQ0 A;  1F8A B;  1HJW A;  2WLZ A;  3WD4 A;  3RFW A;  1M5Y A;  1E6Z A;  2L2S A;  1HXV A;  1UR8 A;  4ODR A;  2G41 A;  1RD6 A;  2KR7 A;  3ARV A;  4ODM A;  2PPP A;  3TCZ A;  1QPL A;  3O5M A;  2K8I A;  4DZ2 A;  4G2P A;  4FAP A;  5J6E A;  3CZ8 A;  4HAR A;  1EYM A;  3WIJ A;  1LJY A;  2F23 A;  1KT1 A;  2PV1 A;  1FKT A;  4ODQ A;  3UI4 A;  2FDM A;  3EIP A;  3FY1 A;  2RUQ A;  1NWU A;  1FJD A;  4L3N A;  4DRN A;  3RM9 A;  3WL1 A;  2DG9 A;  3UI5 A;  3GPK A;  4U85 A;  3QOK A;  4MNM A;  4MAV A;  2DSU A;  5D75 A;  2DSV A;  2DG3 A;  1W9V A;  4DRO A;  2LPV A;  1HJX A;  4QZV B;  2VN1 A;  4LAV A;  2DT2 A;  2A3E A;  3NI6 A;  3ARP A;  1LL7 A;  1HKJ A;  3ARS A;  1W26 A;  2N87 A;  1Y0O A;  2PN0 A;  3B9D A;  1IX5 A;  4WJX A;  2MLZ A;  4TW8 A;  1SR0 A;  3CGN A;  4N19 A;  2A3B A;  2A3A A;  4NZC A;  1D6O A;  4P8W A;  3KAF A;  1D7I A;  2O92 A;  3G6M A;  5HUA A;  3VAW A;  2WLY A;  5DIV A;  1W1V A;  4P8X A;  4QT2 A;  3JYJ A;  3CHF A;  4URI A;  1LL4 A;  4ZPV R;  2IF4 A;  5HWC A;  2PBC A;  2B31 A;  3RM4 A;  1HKM A;  1FKH A;  1A7X A;  2Y78 A;  1N1A A;  5GPG A;  4ZS6 A;  3O5P A;  2PI6 A;  1EQ3 A;  1D7J A;  2DSZ A;  3IKG A;  2FAP A;  5GQB A;  4WK9 A;  2YBT A;  2XPA A;  1J4I A;  3ARQ A;  4WKH A;  5B8I C;  2DT1 A;  3CHD A;  4J4O A;  4AY1 A;  1KFW A;  3ODK A;  4LAY A;  3AS1 A;  1Q6U A;  1C9H A;  2MLX A;  3WD0 A;  2ZQS A;  3ART A;  1ROU A;  2ETN A;  4Q22 A;  3KAC A;  2DG4 A;  1ROT A;  3WL0 A;  3WQW A;  1WAW A;  2AWG A;  3B9E A;  1FKL A;  2ESC A;  1X6N A;  3ALF A;  2ZQU A;  2G8Z A;  3AS0 A;  4FN2 A;  1ZBV A;  3KAD A;  1WNO A;  5HWB A;  2M2A A;  2A3C A;  1K9T A;  3NTP A;  4U84 A;  1ZB5 A;  4JFM A;  4P8V A;  4ODN A;  3UQI A;  3RGC A;  2PPN A;  3NRK A;  4DWS C;  1E9L A;  4Z2J A;  4Z2H A;  1L1P A;  1JND A;  5HTG A;  1J4H A;  4DRQ A;  1ZU8 A;  3PA7 A;  4O2T A;  3WQV A;  4IPX A;  2XPB A;  2RUC A;  3O5L A;  4WKA A;  1KT0 A;  4XAK A;  1U79 A;  3ARR A;  3KCE A;  1FKB A;  4U86 A;  1FKK A;  4WIW A;  2OFN A;  1VF8 A;  5GPR A;  3O5R A;  4ODK A;  1LG2 A;  1FKG A;  2ZQT A;  2Q5A A;  3GTY X;  3OA5 A;  4HBE A;  5DO2 A;  1R9H A;  4ODL A;  2ZQV A;  2LKN A;  2XP6 A;  4DWS A;  4J4N A;  1W1P A;  4MNJ A;  4DRI A;  2EUL A;  1O6I A;  1PIN A;  4R0X A;  5HT1 A;  1FFQ A;  1XHG A;  3OOB A;  4ODO A;  4S3K A;  3UQB A;  3KZ7 A;  2KI3 A;  2MPH A;  3JYM A;  3FXY A;  4DH0 A;  1QZ2 A;  3ARW A;  2LJ4 A;  1W9U A;  3CHE A;  2LGO A;  5DIT A;  4WKF A;  3KAI A;  1BL4 A;  3O5J A;  3KAG A;  4DRM A;  1OGB A;  1TCO C;  2JZV A;  1J4R A;  4BF8 A;  5HW6 A;  2KFW A;  4MGV A;  3AQU A;  4TW6 A;  1YW5 A;  1GUV A;  3MDY B;  1ZCN A;  4IT6 A;  4Z2G A;  1FKI A;  3WD2 A;  2XP3 A;  3I6C A;  1TFV A;  2DT3 A;  5DF0 A;  4Z2K A;  4Z2I A;  5HW8 A;  4TYO A;  2VCD A;  2O9O A;  1E6N A;  2MNT A;  4ODP A;  1Q6I A;  1ZL1 A;  2XP4 A;  4L72 B;  3IHZ A; 
#chains in the Genus database with same CATH homology
 1Q6H A;  1FFR A;  1ITX A;  3B7X A;  1GOI A;  3ARX A;  4DRJ A;  4IQC A;  3AS2 A;  2D9F A;  1HKK A;  2XP8 A;  2RSE A;  2FKE A;  2YBU A;  4HBO A;  2F4E A;  4MSP A;  4S3J A;  3W4R A;  2ITK A;  4DRP A;  4MNL A;  1OGG A;  3KAH A;  3WKZ A;  1W9P A;  5JH8 A;  2UZ5 A;  1NSG A;  3IK8 A;  2ZR4 A;  2ZR5 A;  1FKD A;  3G6L A;  4KQZ A;  3ALG A;  3IKD A;  1HJV A;  1F40 A;  2OLH A;  4Z2L A;  1LG1 A;  1FKF A;  1E15 A;  3B9A A;  1ZBW A;  2F21 A;  2M1I A;  2RQS A;  4P8U A;  5HBF A;  3LUO A;  3RME A;  4LAW A;  3ARU A;  1FKS A;  3CH9 A;  4KR0 B;  1ZBC A;  4GGQ A;  1WB0 A;  1P5Q A;  3O5K A;  4JFJ A;  1JNS A;  3O5Q A;  4W9P A;  1ZK6 A;  5BXJ A;  1NH6 A;  3O5F A;  4QT3 A;  1HKI A;  4LGX A;  1XRV A;  5HW7 A;  3O5O A;  1JVW A;  4IQ2 A;  3ARY A;  1JNT A;  3PRD A;  1EDQ A;  3B8S A;  3RM8 A;  3PRB A;  3BXW A;  2DPE A;  2XP7 A;  4MNK A;  1J6Y A;  4G50 A;  4JFK A;  2KE0 A;  3CHC A;  1UR9 A;  4TNS A;  1OWQ A;  4W9O A;  3TDB A;  1FAP A;  2PV2 A;  4ML4 A;  1SYT A;  1ZBK A;  2KGJ A;  1W1T A;  4NNR A;  3FAP A;  4ITZ A;  3AS3 A;  4JFI A;  1BKF A;  4DRH A;  3O5D A;  3PR9 A;  1EHN A;  3KAB A;  5DIU A;  3UI6 A;  1FKJ A;  4TX0 A;  4W9Q A;  4PTM A;  4TW7 A;  4C02 B;  2PV3 A;  1NWR A;  4JFL A;  2ZR6 A;  2RUD A;  2F2D A;  1NMV A;  4MTV A;  2DT0 A;  1H0I A;  1FKR A;  2MF9 A;  1D2K A;  1YAT A;  4DT4 A;  4DWS D;  1NWT A;  2IUZ A;  1FD9 A;  1T11 A;  4ZPW R;  1CTN A;  2WK2 A;  3ARZ A;  3EY6 A;  1LL6 A;  5DEZ A;  3WD3 A;  3WD1 A;  3H9R B;  1H0G A;  1PBK A;  4ZPT R;  3O5G A;  1NWS A;  2DSW A;  2XP5 A;  5I98 A;  1W1Y A;  2XP9 A;  4GIV A;  4W5U A;  4DRK A;  2QF8 A;  4R5E A;  3WH0 A;  1E6P A;  2KO7 A;  5HKG A;  2M08 A;  1NMW A;  4LAX A;  3O5E A;  4DIP A;  1QPF A;  2WM0 A;  1Q1C A;  2RUR A;  1B6C A;  3O5I A;  1JNE A;  2MLY A;  4NSB A;  3PRA A;  3UQA A;  4QIB A;  3JXV A;  4DZ3 A;  4DWS B;  4JYS A;  1GPF A;  4Q7N A;  1X6L A;  2AOS A;  1E6R A;  3UF8 A;  4IT4 A;  1D7H A;  4MPK A;  3ARO A;  3CGM A;  3TC5 A;  2PPO A;  1EIB A;  1LQ0 A;  1F8A B;  1HJW A;  2WLZ A;  3WD4 A;  3RFW A;  1M5Y A;  1E6Z A;  2L2S A;  1HXV A;  1UR8 A;  4ODR A;  2G41 A;  1RD6 A;  2KR7 A;  3ARV A;  4ODM A;  2PPP A;  3TCZ A;  1QPL A;  3O5M A;  2K8I A;  4DZ2 A;  4G2P A;  4FAP A;  5J6E A;  3CZ8 A;  4HAR A;  1EYM A;  3WIJ A;  1LJY A;  1KT1 A;  2PV1 A;  1FKT A;  4ODQ A;  3UI4 A;  2FDM A;  3FY1 A;  2RUQ A;  1NWU A;  1FJD A;  4L3N A;  4DRN A;  3RM9 A;  3WL1 A;  2DG9 A;  3UI5 A;  3GPK A;  4U85 A;  3QOK A;  4MNM A;  4MAV A;  2DSU A;  5D75 A;  2DSV A;  2DG3 A;  1W9V A;  4DRO A;  2LPV A;  1HJX A;  4QZV B;  2VN1 A;  4LAV A;  2DT2 A;  2A3E A;  3NI6 A;  3ARP A;  1LL7 A;  1HKJ A;  3ARS A;  1W26 A;  2N87 A;  1Y0O A;  3B9D A;  1IX5 A;  4WJX A;  2MLZ A;  4TW8 A;  1SR0 A;  3CGN A;  4N19 A;  2A3B A;  2A3A A;  4NZC A;  1D6O A;  4P8W A;  3KAF A;  1D7I A;  2O92 A;  3G6M A;  5HUA A;  3VAW A;  2WLY A;  5DIV A;  1W1V A;  4P8X A;  4QT2 A;  3JYJ A;  3CHF A;  4URI A;  1LL4 A;  4ZPV R;  2IF4 A;  5HWC A;  2PBC A;  2B31 A;  3RM4 A;  1HKM A;  1FKH A;  1A7X A;  2Y78 A;  1N1A A;  5GPG A;  4ZS6 A;  3O5P A;  2PI6 A;  1EQ3 A;  1D7J A;  2DSZ A;  3IKG A;  2FAP A;  5GQB A;  4WK9 A;  2YBT A;  2XPA A;  1J4I A;  3ARQ A;  4WKH A;  5B8I C;  2DT1 A;  3CHD A;  4J4O A;  4AY1 A;  1KFW A;  3ODK A;  4LAY A;  3AS1 A;  1Q6U A;  1C9H A;  2MLX A;  3WD0 A;  2ZQS A;  3ART A;  1ROU A;  4Q22 A;  3KAC A;  2DG4 A;  1ROT A;  3WL0 A;  3WQW A;  1WAW A;  2AWG A;  3B9E A;  1FKL A;  2ESC A;  1X6N A;  3ALF A;  2ZQU A;  2G8Z A;  3AS0 A;  4FN2 A;  1ZBV A;  3KAD A;  1WNO A;  5HWB A;  2M2A A;  2A3C A;  1K9T A;  3NTP A;  4U84 A;  1ZB5 A;  4JFM A;  4P8V A;  4ODN A;  3UQI A;  3RGC A;  2PPN A;  3NRK A;  4DWS C;  1E9L A;  4Z2J A;  4Z2H A;  1L1P A;  1JND A;  5HTG A;  1J4H A;  4DRQ A;  1ZU8 A;  3PA7 A;  4O2T A;  3WQV A;  4IPX A;  2XPB A;  2RUC A;  3O5L A;  4WKA A;  1KT0 A;  4XAK A;  1U79 A;  3ARR A;  3KCE A;  1FKB A;  4U86 A;  1FKK A;  4WIW A;  2OFN A;  1VF8 A;  5GPR A;  3O5R A;  4ODK A;  1LG2 A;  1FKG A;  2ZQT A;  2Q5A A;  3OA5 A;  4HBE A;  5DO2 A;  1R9H A;  4ODL A;  2ZQV A;  2LKN A;  2XP6 A;  4DWS A;  4J4N A;  1W1P A;  4MNJ A;  4DRI A;  1O6I A;  1PIN A;  4R0X A;  5HT1 A;  1FFQ A;  1XHG A;  3OOB A;  4ODO A;  4S3K A;  3UQB A;  3KZ7 A;  2KI3 A;  2MPH A;  3JYM A;  3FXY A;  4DH0 A;  1QZ2 A;  3ARW A;  2LJ4 A;  1W9U A;  3CHE A;  2LGO A;  5DIT A;  4WKF A;  3KAI A;  1BL4 A;  3O5J A;  3KAG A;  4DRM A;  1OGB A;  1TCO C;  2JZV A;  1J4R A;  4BF8 A;  5HW6 A;  2KFW A;  4MGV A;  3AQU A;  4TW6 A;  1YW5 A;  1GUV A;  3MDY B;  1ZCN A;  4IT6 A;  4Z2G A;  1FKI A;  3WD2 A;  2XP3 A;  3I6C A;  1TFV A;  2DT3 A;  5DF0 A;  4Z2K A;  4Z2I A;  5HW8 A;  4TYO A;  2VCD A;  2O9O A;  1E6N A;  2MNT A;  4ODP A;  1Q6I A;  1ZL1 A;  2XP4 A;  4L72 B;  3IHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...