3PRAA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 33
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3praA00
3PR9A 1IX5A 3PRAA
chains in the Genus database with same CATH superfamily
4DZ2A 1BL4A 1EDQA 4DT4A 4KQZA 1LL4A 4PTMA 1J4RA 2A3EA 4WJXA 5DITA 4GGQA 2LPVA 4ZPWR 4DRPA 1FKDA 4Q22A 1LJYA 1E6PA 2DSZA 4GIVA 1ZK6A 2RSEA 4WKFA 3O5KA 4J4OA 2YBUA 2O9OA 3JXVA 4URIA 3O5LA 1NMWA 1M5YA 2KE0A 3CHFA 2DT2A 4ODOA 3WIJA 3WD4A 4WIWA 5HWBA 1WNOA 2WLYA 1J4IA 4MPKA 1W9PA 4XAKA 2G41A 2XPBA 3CHCA 4NZCA 2XP3A 4MGVA 2K8IA 1FAPA 3NI6A 1B6CA 3OOBA 1UR9A 4W9QA 1E44A 4JFIA 3EIPA 1YATA 4AY1A 3B9EA 2PN0A 3ARWA 1D7JA 1GPFA 4QT2A 4Z2KA 4DH0A 4ZPTR 2G8ZA 2DG4A 1U79A 3CGNA 1LQ0A 2EULA 4JFKA 3FAPA 4ODRA 3G6LA 4L3NA 4JFMA 4DRNA 5GQBA 2YBTA 4WK9A 3PRDA 1KT1A 3WL0A 4DZ3A 1OGBA 4L72B 3PRBA 3ARTA 4DRMA 1HXVA 1FJDA 3ARRA 1FD9A 2WLZA 2B5UB 1FKBA 3WD3A 1ZL1A 4DRKA 1ZBCA 1KT0A 1W9VA 2Q5AA 3KADA 2O92A 2ESCA 4LAXA 1LL7A 3NRKA 1E6ZA 2LJ4A 1FKRA 3ARZA 4LAWA 1Q6UA 4P8WA 1JNSA 1NSGA 1NMVA 1HJWA 4ODMA 3B8SA 2ZR5A 2L2SA 2KR7A 1D2KA 2A3CA 1ROUA 4UDMA 4W9OA 2XP7A 4G2PA 1L1PA 1QPLA 5HW6A 2IUZA 4NNRA 2PPOA 4DRQA 2F23A 1GRJA 1UR8A 2XP6A 1FKGA 2MLYA 3GTYX 3KAHA 4QZVB 2KI3A 3KCEA 1Q1CA 1WAWA 3H9RB 1ITXA 1ZCNA 1JNEA 1QZ2A 2DSVA 1W1YA 4JFLA 2MNTA 4BF8A 1E9LA 1J4HA 1FKLA 4ML4A 3WD1A 1FKKA 4MTVA 4U86A 3ALGA 2ITKA 4P8VA 1RD6A 3NTPA 2F4EA 5HTGA 2PV1A 3UI4A 3RM4A 2N87A 5JH8A 1GUVA 4Z2IA 3TC5A 5HBFA 1HKKA 5DIUA 4JYSA 3PR9A 3B9AA 1ZBKA 2ZR4A 2AOSA 1X6NA 3O5PA 3UQBA 1FKHA 1HKMA 4IT4A 4TW7A 2D9FA 2P4VA 1W1TA 2PV3A 1HJVA 3LUOA 4HBOA 2KO7A 4NSBA 4Z2JA 1JNDA 3WH0A 1HKJA 4TW8A 3UQIA 4DWSB 1NWSA 1TCOC 2M1IA 1SYTA 1ZBVA 5GPGA 3TDBA 1BKFA 3FY1A 3O5MA 1D7IA 1W1VA 1W26A 2WK2A 1E15A 4R0XA 1JCHB 3UI5A 1JNTA 1E6RA 4TYOA 1ZU8A 4J4NA 1EHNA 4MSPA 3B9DA 3W4RA 1QPFA 4DWSA 3UF8A 2PPNA 1F8AB 3ARVA 5D75A 2F2DA 2PPPA 4IPXA 3IKGA 3KABA 3VAWA 4IQCA 3O5RA 2KFWA 5DIVA 1LG1A 3FXYA 1OGGA 1D6OA 1FKSA 4IQ2A 2MLXA 3RFWA 3AS3A 4W5UA 1GOIA 3O5GA 2JZVA 3CH9A 5HWCA 3PRAA 1HJXA 1NWTA 1OWQA 3CZ8A 4HBEA 4ODNA 3WD0A 1J6YA 3GU0A 3IK8A 2XP9A 3WD2A 3WQVA 2LKNA 4DIPA 1LG2A 3CGMA 4ODQA 4U84A 4S3KA 4WKAA 1F40A 3RM9A 2FKEA 4MNJA 2RQSA 1JVWA 1ROTA 3ARQA 1PBKA 2VCDA 2FDMA 1A7XA 1T11A 3G6MA 4TW6A 2XP4A 3CHEA 3KAFA 4ZS6A 3O5FA 1ZB5A 2DSUA 3KAIA 2LGOA 1W9UA 1XHGA 1PINA 2DG9A 3O5EA 5HW7A 4ODPA 4ODLA 5BXJA 2FAPA 3WKZA 4DRJA 2XPAA 4MNKA 4Z2GA 2XP8A 3AS1A 3TCZA 3UQAA 3BMBA 1W1PA 2ZQVA 1TFVA 3OA5A 3QOKA 3RM8A 2ZQSA 4MNMA 4LAVA 2PI6A 4TNSA 4ODKA 3AQUA 3ARXA 1D7HA 2ZQTA 4MNLA 4QT3A 1FKTA 1C9HA 2DT3A 2B31A 1LL6A 4S3JA 3O5DA 4ITZA 3WQWA 3ARSA 4WKHA 1Q6HA 1KFWA 3BXWA 3O5QA 2OLHA 2MLZA 3I6CA 3O5OA 4HARA 4KR0B 4P8UA 3CHDA 3O5IA 5DF0A 5B8IC 1X6LA 4Z2HA 3ALFA 2QF8A 2RUDA 1FFRA 2A3AA 4LAYA 1Y0OA 5GPRA 1EYMA 4IT6A 1Q6IA 5J6EA 2F21A 2DSWA 2MPHA 1E6NA 4Q7NA 1EQ3A 1CTNA 2OFNA 2DPEA 1NH6A 5DO2A 3AROA 1FKIA 1FFQA 2ETNA 2A3BA 1O6IA 2PV2A 3IHZA 3PA7A 2UZ5A 4P8XA 2AWGA 1K9TA 3AS0A 4N19A 4O2TA 2Y78A 5HUAA 5I98A 1WB0A 3JYJA 5HT1A 1ZBWA 1FKJA 1SR0A 4DRHA 2DT1A 4DWSD 3ARPA 1H0GA 2XP5A 1YW5A 4G50A 3ARUA 4DWSC 2DT0A 2M08A 4FAPA 2VN1A 1HKIA 1P5QA 4FN2A 1VF8A 2PBCA 4MAVA 5HKGA 3UI6A 1IX5A 1NWRA 3ODKA 1XRVA 5DEZA 2RUCA 4ZPVR 1EIBA 4R5EA 3AS2A 3IKDA 3RMEA 4DROA 2RURA 4JFJA 4DRIA 3GPKA 2M2AA 4Z2LA 4TX0A 4LGXA 2MF9A 2ZR6A 4C02B 4QIBA 4W9PA 3EY6A 2WM0A 5HW8A 1R9HA 4U85A 3KAGA 3KZ7A 3RGCA 3WL1A 1NWUA 3B7XA 2RUQA 1FKFA 2ZQUA 3ARYA 3O5JA 1N1AA 1H0IA 2DG3A 3JYMA 2IF4A 3MDYB 2KGJA 3KACA
chains in the Genus database with same CATH topology
4DZ2A 1BL4A 1EDQA 4DT4A 4KQZA 1LL4A 4PTMA 1J4RA 2A3EA 4WJXA 5DITA 4GGQA 2LPVA 4ZPWR 4DRPA 1FKDA 4Q22A 1LJYA 1E6PA 2DSZA 4GIVA 1ZK6A 2RSEA 4WKFA 3O5KA 4J4OA 2YBUA 2O9OA 3JXVA 4URIA 3O5LA 1NMWA 1M5YA 2KE0A 3CHFA 2DT2A 4ODOA 3WIJA 3WD4A 4WIWA 5HWBA 1WNOA 2WLYA 1J4IA 4MPKA 1W9PA 4XAKA 2G41A 2XPBA 3CHCA 4NZCA 2XP3A 4MGVA 2K8IA 1FAPA 3NI6A 1B6CA 3OOBA 1UR9A 4W9QA 4JFIA 1YATA 4AY1A 3B9EA 3ARWA 1D7JA 1GPFA 4QT2A 4Z2KA 4DH0A 4ZPTR 2G8ZA 2DG4A 1U79A 3CGNA 1LQ0A 4ODRA 4JFKA 3FAPA 3G6LA 4L3NA 4JFMA 4DRNA 5GQBA 2YBTA 4WK9A 3PRDA 1KT1A 3WL0A 4DZ3A 1OGBA 4L72B 3PRBA 3ARTA 4DRMA 1HXVA 1FJDA 3ARRA 1FD9A 2WLZA 1FKBA 3WD3A 1ZL1A 4DRKA 1ZBCA 1KT0A 1W9VA 2Q5AA 3KADA 2O92A 2ESCA 4LAXA 1LL7A 3NRKA 1E6ZA 2LJ4A 1FKRA 3ARZA 4LAWA 1Q6UA 4P8WA 1JNSA 1NSGA 1NMVA 1HJWA 4ODMA 3B8SA 2ZR5A 2L2SA 2KR7A 1D2KA 2A3CA 1ROUA 4W9OA 2XP7A 4G2PA 1L1PA 1QPLA 5HW6A 2IUZA 4NNRA 2PPOA 4DRQA 1UR8A 2XP6A 1FKGA 2MLYA 3KAHA 4QZVB 2KI3A 3KCEA 1Q1CA 1WAWA 3H9RB 1ITXA 1ZCNA 1JNEA 1QZ2A 2DSVA 1W1YA 4JFLA 2MNTA 4BF8A 1E9LA 1J4HA 1FKLA 4ML4A 3WD1A 1FKKA 4MTVA 4U86A 3ALGA 2ITKA 4P8VA 1RD6A 3NTPA 2F4EA 5HTGA 2PV1A 3UI4A 3RM4A 2N87A 5JH8A 1GUVA 4Z2IA 3TC5A 5HBFA 1HKKA 5DIUA 4JYSA 3PR9A 3B9AA 1ZBKA 2ZR4A 2AOSA 1X6NA 3O5PA 3UQBA 1FKHA 1HKMA 4IT4A 4TW7A 2D9FA 1W1TA 2PV3A 1HJVA 3LUOA 4HBOA 2KO7A 4NSBA 4Z2JA 1JNDA 3WH0A 1HKJA 4TW8A 3UQIA 4DWSB 1NWSA 1TCOC 2M1IA 1SYTA 1ZBVA 5GPGA 3TDBA 1BKFA 3FY1A 3O5MA 1D7IA 1W1VA 1W26A 2WK2A 1E15A 4R0XA 3UI5A 1JNTA 1E6RA 4TYOA 1ZU8A 4J4NA 1EHNA 4MSPA 3B9DA 3W4RA 1QPFA 4DWSA 3UF8A 2PPNA 1F8AB 3ARVA 5D75A 2F2DA 2PPPA 4IPXA 3IKGA 3KABA 3VAWA 4IQCA 3O5RA 2KFWA 5DIVA 1LG1A 3FXYA 1OGGA 1D6OA 1FKSA 4IQ2A 2MLXA 3RFWA 3AS3A 4W5UA 1GOIA 3O5GA 2JZVA 3CH9A 5HWCA 3PRAA 1HJXA 1NWTA 1OWQA 3CZ8A 4HBEA 4ODNA 3WD0A 1J6YA 3IK8A 2XP9A 3WD2A 3WQVA 2LKNA 4DIPA 1LG2A 3CGMA 4ODQA 4U84A 4S3KA 4WKAA 1F40A 3RM9A 2FKEA 4MNJA 2RQSA 1JVWA 1ROTA 3ARQA 1PBKA 2VCDA 2FDMA 1A7XA 1T11A 3G6MA 4TW6A 2XP4A 3CHEA 3KAFA 4ZS6A 3O5FA 1ZB5A 2DSUA 3KAIA 2LGOA 1W9UA 1XHGA 1PINA 2DG9A 3O5EA 5HW7A 4ODPA 4ODLA 5BXJA 2FAPA 3WKZA 4DRJA 2XPAA 4MNKA 4Z2GA 2XP8A 3AS1A 3TCZA 3UQAA 1W1PA 2ZQVA 1TFVA 3OA5A 3QOKA 3RM8A 2ZQSA 4MNMA 4LAVA 2PI6A 4TNSA 4ODKA 3AQUA 3ARXA 1D7HA 2ZQTA 4MNLA 4QT3A 1FKTA 1C9HA 2DT3A 2B31A 1LL6A 4S3JA 3O5DA 4ITZA 3WQWA 3ARSA 4WKHA 1Q6HA 1KFWA 3BXWA 3O5QA 2OLHA 2MLZA 3I6CA 3O5OA 4HARA 4KR0B 4P8UA 3CHDA 3O5IA 5DF0A 5B8IC 1X6LA 4Z2HA 3ALFA 2QF8A 2RUDA 1FFRA 2A3AA 4LAYA 1Y0OA 5GPRA 1EYMA 4IT6A 1Q6IA 5J6EA 2F21A 2DSWA 2MPHA 1E6NA 4Q7NA 1EQ3A 1CTNA 2OFNA 2DPEA 1NH6A 5DO2A 3AROA 1FKIA 1FFQA 2A3BA 1O6IA 2PV2A 3IHZA 3PA7A 2UZ5A 4P8XA 2AWGA 1K9TA 3AS0A 4N19A 4O2TA 2Y78A 5HUAA 5I98A 1WB0A 3JYJA 5HT1A 1ZBWA 1FKJA 1SR0A 4DRHA 2DT1A 4DWSD 3ARPA 1H0GA 2XP5A 1YW5A 4G50A 3ARUA 4DWSC 2DT0A 2M08A 4FAPA 2VN1A 1HKIA 1P5QA 4FN2A 1VF8A 2PBCA 4MAVA 5HKGA 3UI6A 1IX5A 1NWRA 3ODKA 1XRVA 5DEZA 2RUCA 4ZPVR 1EIBA 4R5EA 3AS2A 3IKDA 3RMEA 4DROA 2RURA 4JFJA 4DRIA 3GPKA 2M2AA 4Z2LA 4TX0A 4LGXA 2MF9A 2ZR6A 4C02B 4QIBA 4W9PA 3EY6A 2WM0A 5HW8A 1R9HA 4U85A 3KAGA 3KZ7A 3RGCA 3WL1A 1NWUA 3B7XA 2RUQA 1FKFA 2ZQUA 3ARYA 3O5JA 1N1AA 1H0IA 2DG3A 3JYMA 2IF4A 3MDYB 2KGJA 3KACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PR9 A;  1IX5 A;  3PRA A; 
#chains in the Genus database with same CATH topology
 4DZ2 A;  1BL4 A;  1EDQ A;  4DT4 A;  4KQZ A;  1LL4 A;  4PTM A;  1J4R A;  2A3E A;  4WJX A;  5DIT A;  4GGQ A;  2LPV A;  4ZPW R;  4DRP A;  1FKD A;  4Q22 A;  1LJY A;  1E6P A;  2DSZ A;  4GIV A;  1ZK6 A;  2RSE A;  4WKF A;  3O5K A;  4J4O A;  2YBU A;  2O9O A;  3JXV A;  4URI A;  3O5L A;  1NMW A;  1M5Y A;  2KE0 A;  3CHF A;  2DT2 A;  4ODO A;  3WIJ A;  3WD4 A;  4WIW A;  5HWB A;  1WNO A;  2WLY A;  1J4I A;  4MPK A;  1W9P A;  4XAK A;  2G41 A;  2XPB A;  3CHC A;  4NZC A;  2XP3 A;  4MGV A;  2K8I A;  1FAP A;  3NI6 A;  1B6C A;  3OOB A;  1UR9 A;  4W9Q A;  1E44 A;  4JFI A;  3EIP A;  1YAT A;  4AY1 A;  3B9E A;  2PN0 A;  3ARW A;  1D7J A;  1GPF A;  4QT2 A;  4Z2K A;  4DH0 A;  4ZPT R;  2G8Z A;  2DG4 A;  1U79 A;  3CGN A;  1LQ0 A;  2EUL A;  4JFK A;  3FAP A;  4ODR A;  3G6L A;  4L3N A;  4JFM A;  4DRN A;  5GQB A;  2YBT A;  4WK9 A;  3PRD A;  1KT1 A;  3WL0 A;  4DZ3 A;  1OGB A;  4L72 B;  3PRB A;  3ART A;  4DRM A;  1HXV A;  1FJD A;  3ARR A;  1FD9 A;  2WLZ A;  2B5U B;  1FKB A;  3WD3 A;  1ZL1 A;  4DRK A;  1ZBC A;  1KT0 A;  1W9V A;  2Q5A A;  3KAD A;  2O92 A;  2ESC A;  4LAX A;  1LL7 A;  3NRK A;  1E6Z A;  2LJ4 A;  1FKR A;  3ARZ A;  4LAW A;  1Q6U A;  4P8W A;  1JNS A;  1NSG A;  1NMV A;  1HJW A;  4ODM A;  3B8S A;  2ZR5 A;  2L2S A;  2KR7 A;  1D2K A;  2A3C A;  1ROU A;  4UDM A;  4W9O A;  2XP7 A;  4G2P A;  1L1P A;  1QPL A;  5HW6 A;  2IUZ A;  4NNR A;  2PPO A;  4DRQ A;  2F23 A;  1GRJ A;  1UR8 A;  2XP6 A;  1FKG A;  2MLY A;  3GTY X;  3KAH A;  4QZV B;  2KI3 A;  3KCE A;  1Q1C A;  1WAW A;  3H9R B;  1ITX A;  1ZCN A;  1JNE A;  1QZ2 A;  2DSV A;  1W1Y A;  4JFL A;  2MNT A;  4BF8 A;  1E9L A;  1J4H A;  1FKL A;  4ML4 A;  3WD1 A;  1FKK A;  4MTV A;  4U86 A;  3ALG A;  2ITK A;  4P8V A;  1RD6 A;  3NTP A;  2F4E A;  5HTG A;  2PV1 A;  3UI4 A;  3RM4 A;  2N87 A;  5JH8 A;  1GUV A;  4Z2I A;  3TC5 A;  5HBF A;  1HKK A;  5DIU A;  4JYS A;  3PR9 A;  3B9A A;  1ZBK A;  2ZR4 A;  2AOS A;  1X6N A;  3O5P A;  3UQB A;  1FKH A;  1HKM A;  4IT4 A;  4TW7 A;  2D9F A;  2P4V A;  1W1T A;  2PV3 A;  1HJV A;  3LUO A;  4HBO A;  2KO7 A;  4NSB A;  4Z2J A;  1JND A;  3WH0 A;  1HKJ A;  4TW8 A;  3UQI A;  4DWS B;  1NWS A;  1TCO C;  2M1I A;  1SYT A;  1ZBV A;  5GPG A;  3TDB A;  1BKF A;  3FY1 A;  3O5M A;  1D7I A;  1W1V A;  1W26 A;  2WK2 A;  1E15 A;  4R0X A;  1JCH B;  3UI5 A;  1JNT A;  1E6R A;  4TYO A;  1ZU8 A;  4J4N A;  1EHN A;  4MSP A;  3B9D A;  3W4R A;  1QPF A;  4DWS A;  3UF8 A;  2PPN A;  1F8A B;  3ARV A;  5D75 A;  2F2D A;  2PPP A;  4IPX A;  3IKG A;  3KAB A;  3VAW A;  4IQC A;  3O5R A;  2KFW A;  5DIV A;  1LG1 A;  3FXY A;  1OGG A;  1D6O A;  1FKS A;  4IQ2 A;  2MLX A;  3RFW A;  3AS3 A;  4W5U A;  1GOI A;  3O5G A;  2JZV A;  3CH9 A;  5HWC A;  3PRA A;  1HJX A;  1NWT A;  1OWQ A;  3CZ8 A;  4HBE A;  4ODN A;  3WD0 A;  1J6Y A;  3GU0 A;  3IK8 A;  2XP9 A;  3WD2 A;  3WQV A;  2LKN A;  4DIP A;  1LG2 A;  3CGM A;  4ODQ A;  4U84 A;  4S3K A;  4WKA A;  1F40 A;  3RM9 A;  2FKE A;  4MNJ A;  2RQS A;  1JVW A;  1ROT A;  3ARQ A;  1PBK A;  2VCD A;  2FDM A;  1A7X A;  1T11 A;  3G6M A;  4TW6 A;  2XP4 A;  3CHE A;  3KAF A;  4ZS6 A;  3O5F A;  1ZB5 A;  2DSU A;  3KAI A;  2LGO A;  1W9U A;  1XHG A;  1PIN A;  2DG9 A;  3O5E A;  5HW7 A;  4ODP A;  4ODL A;  5BXJ A;  2FAP A;  3WKZ A;  4DRJ A;  2XPA A;  4MNK A;  4Z2G A;  2XP8 A;  3AS1 A;  3TCZ A;  3UQA A;  3BMB A;  1W1P A;  2ZQV A;  1TFV A;  3OA5 A;  3QOK A;  3RM8 A;  2ZQS A;  4MNM A;  4LAV A;  2PI6 A;  4TNS A;  4ODK A;  3AQU A;  3ARX A;  1D7H A;  2ZQT A;  4MNL A;  4QT3 A;  1FKT A;  1C9H A;  2DT3 A;  2B31 A;  1LL6 A;  4S3J A;  3O5D A;  4ITZ A;  3WQW A;  3ARS A;  4WKH A;  1Q6H A;  1KFW A;  3BXW A;  3O5Q A;  2OLH A;  2MLZ A;  3I6C A;  3O5O A;  4HAR A;  4KR0 B;  4P8U A;  3CHD A;  3O5I A;  5DF0 A;  5B8I C;  1X6L A;  4Z2H A;  3ALF A;  2QF8 A;  2RUD A;  1FFR A;  2A3A A;  4LAY A;  1Y0O A;  5GPR A;  1EYM A;  4IT6 A;  1Q6I A;  5J6E A;  2F21 A;  2DSW A;  2MPH A;  1E6N A;  4Q7N A;  1EQ3 A;  1CTN A;  2OFN A;  2DPE A;  1NH6 A;  5DO2 A;  3ARO A;  1FKI A;  1FFQ A;  2ETN A;  2A3B A;  1O6I A;  2PV2 A;  3IHZ A;  3PA7 A;  2UZ5 A;  4P8X A;  2AWG A;  1K9T A;  3AS0 A;  4N19 A;  4O2T A;  2Y78 A;  5HUA A;  5I98 A;  1WB0 A;  3JYJ A;  5HT1 A;  1ZBW A;  1FKJ A;  1SR0 A;  4DRH A;  2DT1 A;  4DWS D;  3ARP A;  1H0G A;  2XP5 A;  1YW5 A;  4G50 A;  3ARU A;  4DWS C;  2DT0 A;  2M08 A;  4FAP A;  2VN1 A;  1HKI A;  1P5Q A;  4FN2 A;  1VF8 A;  2PBC A;  4MAV A;  5HKG A;  3UI6 A;  1IX5 A;  1NWR A;  3ODK A;  1XRV A;  5DEZ A;  2RUC A;  4ZPV R;  1EIB A;  4R5E A;  3AS2 A;  3IKD A;  3RME A;  4DRO A;  2RUR A;  4JFJ A;  4DRI A;  3GPK A;  2M2A A;  4Z2L A;  4TX0 A;  4LGX A;  2MF9 A;  2ZR6 A;  4C02 B;  4QIB A;  4W9P A;  3EY6 A;  2WM0 A;  5HW8 A;  1R9H A;  4U85 A;  3KAG A;  3KZ7 A;  3RGC A;  3WL1 A;  1NWU A;  3B7X A;  2RUQ A;  1FKF A;  2ZQU A;  3ARY A;  3O5J A;  1N1A A;  1H0I A;  2DG3 A;  3JYM A;  2IF4 A;  3MDY B;  2KGJ A;  3KAC A; 
#chains in the Genus database with same CATH homology
 4DZ2 A;  1BL4 A;  1EDQ A;  4DT4 A;  4KQZ A;  1LL4 A;  4PTM A;  1J4R A;  2A3E A;  4WJX A;  5DIT A;  4GGQ A;  2LPV A;  4ZPW R;  4DRP A;  1FKD A;  4Q22 A;  1LJY A;  1E6P A;  2DSZ A;  4GIV A;  1ZK6 A;  2RSE A;  4WKF A;  3O5K A;  4J4O A;  2YBU A;  2O9O A;  3JXV A;  4URI A;  3O5L A;  1NMW A;  1M5Y A;  2KE0 A;  3CHF A;  2DT2 A;  4ODO A;  3WIJ A;  3WD4 A;  4WIW A;  5HWB A;  1WNO A;  2WLY A;  1J4I A;  4MPK A;  1W9P A;  4XAK A;  2G41 A;  2XPB A;  3CHC A;  4NZC A;  2XP3 A;  4MGV A;  2K8I A;  1FAP A;  3NI6 A;  1B6C A;  3OOB A;  1UR9 A;  4W9Q A;  4JFI A;  1YAT A;  4AY1 A;  3B9E A;  3ARW A;  1D7J A;  1GPF A;  4QT2 A;  4Z2K A;  4DH0 A;  4ZPT R;  2G8Z A;  2DG4 A;  1U79 A;  3CGN A;  1LQ0 A;  4ODR A;  4JFK A;  3FAP A;  3G6L A;  4L3N A;  4JFM A;  4DRN A;  5GQB A;  2YBT A;  4WK9 A;  3PRD A;  1KT1 A;  3WL0 A;  4DZ3 A;  1OGB A;  4L72 B;  3PRB A;  3ART A;  4DRM A;  1HXV A;  1FJD A;  3ARR A;  1FD9 A;  2WLZ A;  1FKB A;  3WD3 A;  1ZL1 A;  4DRK A;  1ZBC A;  1KT0 A;  1W9V A;  2Q5A A;  3KAD A;  2O92 A;  2ESC A;  4LAX A;  1LL7 A;  3NRK A;  1E6Z A;  2LJ4 A;  1FKR A;  3ARZ A;  4LAW A;  1Q6U A;  4P8W A;  1JNS A;  1NSG A;  1NMV A;  1HJW A;  4ODM A;  3B8S A;  2ZR5 A;  2L2S A;  2KR7 A;  1D2K A;  2A3C A;  1ROU A;  4W9O A;  2XP7 A;  4G2P A;  1L1P A;  1QPL A;  5HW6 A;  2IUZ A;  4NNR A;  2PPO A;  4DRQ A;  1UR8 A;  2XP6 A;  1FKG A;  2MLY A;  3KAH A;  4QZV B;  2KI3 A;  3KCE A;  1Q1C A;  1WAW A;  3H9R B;  1ITX A;  1ZCN A;  1JNE A;  1QZ2 A;  2DSV A;  1W1Y A;  4JFL A;  2MNT A;  4BF8 A;  1E9L A;  1J4H A;  1FKL A;  4ML4 A;  3WD1 A;  1FKK A;  4MTV A;  4U86 A;  3ALG A;  2ITK A;  4P8V A;  1RD6 A;  3NTP A;  2F4E A;  5HTG A;  2PV1 A;  3UI4 A;  3RM4 A;  2N87 A;  5JH8 A;  1GUV A;  4Z2I A;  3TC5 A;  5HBF A;  1HKK A;  5DIU A;  4JYS A;  3PR9 A;  3B9A A;  1ZBK A;  2ZR4 A;  2AOS A;  1X6N A;  3O5P A;  3UQB A;  1FKH A;  1HKM A;  4IT4 A;  4TW7 A;  2D9F A;  1W1T A;  2PV3 A;  1HJV A;  3LUO A;  4HBO A;  2KO7 A;  4NSB A;  4Z2J A;  1JND A;  3WH0 A;  1HKJ A;  4TW8 A;  3UQI A;  4DWS B;  1NWS A;  1TCO C;  2M1I A;  1SYT A;  1ZBV A;  5GPG A;  3TDB A;  1BKF A;  3FY1 A;  3O5M A;  1D7I A;  1W1V A;  1W26 A;  2WK2 A;  1E15 A;  4R0X A;  3UI5 A;  1JNT A;  1E6R A;  4TYO A;  1ZU8 A;  4J4N A;  1EHN A;  4MSP A;  3B9D A;  3W4R A;  1QPF A;  4DWS A;  3UF8 A;  2PPN A;  1F8A B;  3ARV A;  5D75 A;  2F2D A;  2PPP A;  4IPX A;  3IKG A;  3KAB A;  3VAW A;  4IQC A;  3O5R A;  2KFW A;  5DIV A;  1LG1 A;  3FXY A;  1OGG A;  1D6O A;  1FKS A;  4IQ2 A;  2MLX A;  3RFW A;  3AS3 A;  4W5U A;  1GOI A;  3O5G A;  2JZV A;  3CH9 A;  5HWC A;  3PRA A;  1HJX A;  1NWT A;  1OWQ A;  3CZ8 A;  4HBE A;  4ODN A;  3WD0 A;  1J6Y A;  3IK8 A;  2XP9 A;  3WD2 A;  3WQV A;  2LKN A;  4DIP A;  1LG2 A;  3CGM A;  4ODQ A;  4U84 A;  4S3K A;  4WKA A;  1F40 A;  3RM9 A;  2FKE A;  4MNJ A;  2RQS A;  1JVW A;  1ROT A;  3ARQ A;  1PBK A;  2VCD A;  2FDM A;  1A7X A;  1T11 A;  3G6M A;  4TW6 A;  2XP4 A;  3CHE A;  3KAF A;  4ZS6 A;  3O5F A;  1ZB5 A;  2DSU A;  3KAI A;  2LGO A;  1W9U A;  1XHG A;  1PIN A;  2DG9 A;  3O5E A;  5HW7 A;  4ODP A;  4ODL A;  5BXJ A;  2FAP A;  3WKZ A;  4DRJ A;  2XPA A;  4MNK A;  4Z2G A;  2XP8 A;  3AS1 A;  3TCZ A;  3UQA A;  1W1P A;  2ZQV A;  1TFV A;  3OA5 A;  3QOK A;  3RM8 A;  2ZQS A;  4MNM A;  4LAV A;  2PI6 A;  4TNS A;  4ODK A;  3AQU A;  3ARX A;  1D7H A;  2ZQT A;  4MNL A;  4QT3 A;  1FKT A;  1C9H A;  2DT3 A;  2B31 A;  1LL6 A;  4S3J A;  3O5D A;  4ITZ A;  3WQW A;  3ARS A;  4WKH A;  1Q6H A;  1KFW A;  3BXW A;  3O5Q A;  2OLH A;  2MLZ A;  3I6C A;  3O5O A;  4HAR A;  4KR0 B;  4P8U A;  3CHD A;  3O5I A;  5DF0 A;  5B8I C;  1X6L A;  4Z2H A;  3ALF A;  2QF8 A;  2RUD A;  1FFR A;  2A3A A;  4LAY A;  1Y0O A;  5GPR A;  1EYM A;  4IT6 A;  1Q6I A;  5J6E A;  2F21 A;  2DSW A;  2MPH A;  1E6N A;  4Q7N A;  1EQ3 A;  1CTN A;  2OFN A;  2DPE A;  1NH6 A;  5DO2 A;  3ARO A;  1FKI A;  1FFQ A;  2A3B A;  1O6I A;  2PV2 A;  3IHZ A;  3PA7 A;  2UZ5 A;  4P8X A;  2AWG A;  1K9T A;  3AS0 A;  4N19 A;  4O2T A;  2Y78 A;  5HUA A;  5I98 A;  1WB0 A;  3JYJ A;  5HT1 A;  1ZBW A;  1FKJ A;  1SR0 A;  4DRH A;  2DT1 A;  4DWS D;  3ARP A;  1H0G A;  2XP5 A;  1YW5 A;  4G50 A;  3ARU A;  4DWS C;  2DT0 A;  2M08 A;  4FAP A;  2VN1 A;  1HKI A;  1P5Q A;  4FN2 A;  1VF8 A;  2PBC A;  4MAV A;  5HKG A;  3UI6 A;  1IX5 A;  1NWR A;  3ODK A;  1XRV A;  5DEZ A;  2RUC A;  4ZPV R;  1EIB A;  4R5E A;  3AS2 A;  3IKD A;  3RME A;  4DRO A;  2RUR A;  4JFJ A;  4DRI A;  3GPK A;  2M2A A;  4Z2L A;  4TX0 A;  4LGX A;  2MF9 A;  2ZR6 A;  4C02 B;  4QIB A;  4W9P A;  3EY6 A;  2WM0 A;  5HW8 A;  1R9H A;  4U85 A;  3KAG A;  3KZ7 A;  3RGC A;  3WL1 A;  1NWU A;  3B7X A;  2RUQ A;  1FKF A;  2ZQU A;  3ARY A;  3O5J A;  1N1A A;  1H0I A;  2DG3 A;  3JYM A;  2IF4 A;  3MDY B;  2KGJ A;  3KAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...