3PRAA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 33
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3praA00
1IX5A 3PR9A 3PRAA
chains in the Genus database with same CATH superfamily
2JZVA 2MLZA 5HUAA 2KFWA 4IT6A 1D7JA 5HWBA 4DWSA 4G2PA 4UDMA 4JFLA 3WD0A 3GPKA 1ZB5A 1LG1A 2MLXA 2PPOA 2G41A 2DSUA 2DG9A 2WM0A 1EQ3A 2OFNA 3O5MA 3EY6A 4ITZA 4LAWA 4P8XA 3LUOA 5B8IC 4WJXA 1E6PA 3O5JA 3H9RB 3CZ8A 1T11A 4P8UA 3TDBA 3CGMA 4U84A 1QPFA 1NMWA 3O5IA 1FKDA 4J4OA 2ITKA 3CHDA 1Q1CA 3ARZA 1OGGA 1PINA 3OOBA 2PPPA 2ZR6A 3CHCA 4IQCA 2DT1A 5DF0A 3G6MA 1D7IA 2KE0A 2XP9A 3UQIA 4JFMA 1WAWA 3UI6A 3AQUA 1UR9A 2B31A 3IHZA 1W1PA 2A3CA 2DSVA 3WD1A 1HKIA 2LGOA 1B6CA 4Z2LA 2RURA 5GQBA 1E6ZA 4N19A 3O5GA 4HARA 4ODRA 2DT0A 4TYOA 3UI5A 1JNTA 3PA7A 2FKEA 1ZBCA 4TW8A 2M08A 1FKFA 4DRIA 1K9TA 4DRPA 3VAWA 1VF8A 3KAFA 4TX0A 1WNOA 2ZR5A 3AROA 1E15A 4DH0A 1Q6UA 1W26A 4DROA 3KADA 5GPRA 3ARQA 1HKMA 4URIA 3ODKA 3G6LA 1D2KA 3O5PA 1E9LA 4MSPA 3QOKA 3O5LA 4W9PA 4ZPTR 1LJYA 4Z2GA 1W9PA 3ARUA 1TCOC 5DO2A 3CHEA 2IF4A 1NWTA 3IKDA 2MF9A 4G50A 1GOIA 1QPLA 4S3KA 4L3NA 4Q7NA 1FKKA 4S3JA 2RUQA 2ZQSA 1D6OA 1J6YA 2RUDA 3B8SA 3RFWA 3ARYA 4JFIA 2B5UB 4WK9A 1Q6HA 4LAVA 4W5UA 2FAPA 2MNTA 1ROUA 1R9HA 1J4RA 1RD6A 4DRQA 4JFJA 4QZVB 3WD2A 4DRNA 1CTNA 1W1VA 3O5OA 1YW5A 1GRJA 1FAPA 3WIJA 4DWSB 4NNRA 3NI6A 1PBKA 1X6LA 1E6NA 2DT2A 3W4RA 5HWCA 2YBTA 3KABA 3AS2A 2ETNA 5HW7A 1E44A 4W9QA 3KAHA 2L2SA 2G8ZA 1P5QA 1LQ0A 1J4HA 4Z2HA 4BF8A 1KFWA 2DPEA 1HJVA 2ZR4A 3GTYX 5JH8A 1JNSA 1EYMA 1ZBWA 2Q5AA 2XP3A 4MNLA 3ARPA 2DG4A 3JYJA 4ODOA 4DRKA 2O9OA 1HJXA 2AOSA 2F4EA 4DZ3A 1J4IA 2PV1A 4Z2KA 2XP6A 4FAPA 2YBUA 2DSZA 3WH0A 1ZL1A 2XP4A 2O92A 3ARTA 3NTPA 4ODNA 1ZBKA 4MPKA 3TCZA 3KAGA 3PRAA 1NMVA 3UI4A 2KGJA 1FKLA 2UZ5A 1BKFA 2D9FA 3WQWA 1F8AB 3O5RA 2MLYA 3RMEA 5BXJA 2XP5A 1Y0OA 1W9UA 1UR8A 3AS3A 2PN0A 4JFKA 1JNDA 2M2AA 2RUCA 1FFQA 2KO7A 1QZ2A 1W9VA 4HBEA 2Y78A 3PR9A 4DZ2A 1X6NA 1JNEA 4Q22A 2PV3A 3FXYA 2ZQTA 4ZPVR 4QT3A 4J4NA 3CHFA 4WKFA 1Q6IA 5HW8A 1LL4A 4XAKA 5DEZA 3B9EA 5I98A 3WQVA 4ODPA 1M5YA 3ALFA 3I6CA 2LJ4A 4DRJA 4ODMA 3PRBA 3ALGA 5HKGA 3AS0A 1FKBA 1O6IA 1OWQA 3WL0A 4MNMA 3WD4A 4DT4A 4KR0B 3ARWA 3FY1A 2ESCA 1NWRA 4MGVA 2KI3A 2XP8A 2DSWA 4IT4A 1SYTA 1FKRA 4FN2A 4DRHA 2A3AA 3KACA 1W1TA 3IK8A 3EIPA 3PRDA 1NWUA 4GGQA 2VN1A 1N1AA 3O5EA 2IUZA 3O5QA 5HTGA 3WL1A 1HKJA 2WLZA 3OA5A 3MDYB 1HXVA 4DWSC 1ROTA 2MPHA 4WIWA 1TFVA 1W1YA 2K8IA 4MNKA 4DWSD 1EIBA 1JCHB 4GIVA 3RM8A 1BL4A 2RQSA 1FFRA 4O2TA 3FAPA 2F2DA 3KZ7A 5J6EA 4ML4A 1WB0A 1LL7A 4NSBA 1ZK6A 2PI6A 2LPVA 1ITXA 1IX5A 4DRMA 1NH6A 4U85A 1ZBVA 2EULA 3NRKA 2RSEA 1XRVA 3BMBA 3O5DA 2VCDA 4MTVA 4U86A 4WKAA 2M1IA 4IPXA 2KR7A 3UF8A 3KAIA 1GPFA 3CH9A 4NZCA 1A7XA 2QF8A 2WK2A 4TW6A 3RGCA 4QT2A 1U79A 5DIUA 2F21A 4MAVA 2PBCA 3O5FA 3AS1A 1F40A 4P8WA 2PPNA 5HT1A 1YATA 3RM4A 2XP7A 3WD3A 3B9AA 1FKJA 4ODQA 2LKNA 4TW7A 5GPGA 4Z2JA 4JYSA 1D7HA 1FKGA 1KT1A 1LG2A 3BXWA 1E6RA 4ZPWR 4L72B 5D75A 2WLYA 1GUVA 3B7XA 3CGNA 3UQAA 3TC5A 3B9DA 2DG3A 2AWGA 1FJDA 1FKSA 4HBOA 3WKZA 3GU0A 1EHNA 1FKHA 3JXVA 4IQ2A 2N87A 3JYMA 2A3EA 4AY1A 4DIPA 3ARRA 1ZU8A 1LL6A 3ARSA 4R5EA 4MNJA 1XHGA 4TNSA 1NWSA 2PV2A 3UQBA 1KT0A 1HKKA 1FKIA 2OLHA 1FD9A 4QIBA 4Z2IA 1NSGA 4ODKA 4P8VA 1L1PA 1H0GA 2ZQVA 2ZQUA 4LGXA 2F23A 1C9HA 1H0IA 1ZCNA 3O5KA 4WKHA 1OGBA 4C02B 5DIVA 3ARXA 4ODLA 4LAXA 1FKTA 2XPAA 5DITA 3RM9A 2DT3A 1SR0A 4KQZA 1JVWA 1EDQA 3IKGA 5HBFA 4W9OA 2XPBA 4ZS6A 1HJWA 3ARVA 2FDMA 4PTMA 3KCEA 2P4VA 4LAYA 4R0XA 5HW6A 2A3BA
chains in the Genus database with same CATH topology
2JZVA 2MLZA 5HUAA 2KFWA 4IT6A 1D7JA 5HWBA 4DWSA 4G2PA 4JFLA 3WD0A 3GPKA 1ZB5A 1LG1A 2MLXA 2PPOA 2G41A 2DSUA 2DG9A 2WM0A 1EQ3A 2OFNA 3O5MA 3EY6A 4ITZA 4LAWA 4P8XA 3LUOA 5B8IC 4WJXA 1E6PA 3O5JA 3H9RB 3CZ8A 1T11A 4P8UA 3TDBA 3CGMA 4U84A 1QPFA 1NMWA 3O5IA 1FKDA 4J4OA 2ITKA 3CHDA 1Q1CA 3ARZA 1OGGA 1PINA 3OOBA 2PPPA 2ZR6A 3CHCA 4IQCA 2DT1A 5DF0A 3G6MA 1D7IA 2KE0A 2XP9A 3UQIA 4JFMA 1WAWA 3UI6A 3AQUA 1UR9A 2B31A 3IHZA 1W1PA 2A3CA 2DSVA 3WD1A 1HKIA 2LGOA 1B6CA 4Z2LA 2RURA 5GQBA 1E6ZA 4N19A 3O5GA 4HARA 4ODRA 2DT0A 4TYOA 3UI5A 1JNTA 3PA7A 2FKEA 1ZBCA 4TW8A 2M08A 1FKFA 4DRIA 1K9TA 4DRPA 3VAWA 1VF8A 3KAFA 4TX0A 1WNOA 2ZR5A 3AROA 1E15A 4DH0A 1Q6UA 1W26A 4DROA 3KADA 5GPRA 3ARQA 1HKMA 4URIA 3ODKA 3G6LA 1D2KA 3O5PA 1E9LA 4MSPA 3QOKA 3O5LA 4W9PA 4ZPTR 1LJYA 4Z2GA 1W9PA 3ARUA 1TCOC 5DO2A 3CHEA 2IF4A 1NWTA 3IKDA 2MF9A 4G50A 1GOIA 1QPLA 4S3KA 4L3NA 4Q7NA 1FKKA 4S3JA 2RUQA 2ZQSA 1D6OA 1J6YA 2RUDA 3B8SA 3RFWA 3ARYA 4JFIA 4WK9A 1Q6HA 4LAVA 4W5UA 2FAPA 2MNTA 1ROUA 1R9HA 1J4RA 1RD6A 4DRQA 4JFJA 4QZVB 3WD2A 4DRNA 1CTNA 1W1VA 3O5OA 1YW5A 1FAPA 3WIJA 4DWSB 4NNRA 3NI6A 1PBKA 1X6LA 1E6NA 2DT2A 3W4RA 5HWCA 2YBTA 3KABA 3AS2A 5HW7A 4W9QA 3KAHA 2L2SA 2G8ZA 1P5QA 1LQ0A 1J4HA 4Z2HA 4BF8A 1KFWA 2DPEA 1HJVA 2ZR4A 5JH8A 1JNSA 1EYMA 1ZBWA 2Q5AA 2XP3A 4MNLA 3ARPA 2DG4A 3JYJA 4ODOA 4DRKA 2O9OA 1HJXA 2AOSA 2F4EA 4DZ3A 1J4IA 2PV1A 4Z2KA 2XP6A 4FAPA 2YBUA 2DSZA 3WH0A 1ZL1A 2XP4A 2O92A 3ARTA 3NTPA 4ODNA 1ZBKA 4MPKA 3TCZA 3KAGA 3PRAA 1NMVA 3UI4A 2KGJA 1FKLA 2UZ5A 1BKFA 2D9FA 3WQWA 1F8AB 3O5RA 2MLYA 3RMEA 5BXJA 2XP5A 1Y0OA 1W9UA 1UR8A 3AS3A 4JFKA 1JNDA 2M2AA 2RUCA 1FFQA 2KO7A 1QZ2A 1W9VA 4HBEA 2Y78A 3PR9A 4DZ2A 1X6NA 1JNEA 4Q22A 2PV3A 3FXYA 2ZQTA 4ZPVR 4QT3A 4J4NA 3CHFA 4WKFA 1Q6IA 5HW8A 1LL4A 4XAKA 5DEZA 3B9EA 5I98A 3WQVA 4ODPA 1M5YA 3ALFA 3I6CA 2LJ4A 4DRJA 4ODMA 3PRBA 3ALGA 5HKGA 3AS0A 1FKBA 1O6IA 1OWQA 3WL0A 4MNMA 3WD4A 4DT4A 4KR0B 3ARWA 3FY1A 2ESCA 1NWRA 4MGVA 2KI3A 2XP8A 2DSWA 4IT4A 1SYTA 1FKRA 4FN2A 4DRHA 2A3AA 3KACA 1W1TA 3IK8A 3PRDA 1NWUA 4GGQA 2VN1A 1N1AA 3O5EA 2IUZA 3O5QA 5HTGA 3WL1A 1HKJA 2WLZA 3OA5A 3MDYB 1HXVA 4DWSC 1ROTA 2MPHA 4WIWA 1TFVA 1W1YA 2K8IA 4MNKA 4DWSD 1EIBA 4GIVA 3RM8A 1BL4A 2RQSA 1FFRA 4O2TA 3FAPA 2F2DA 3KZ7A 5J6EA 4ML4A 1WB0A 1LL7A 4NSBA 1ZK6A 2PI6A 2LPVA 1ITXA 1IX5A 4DRMA 1NH6A 4U85A 1ZBVA 3NRKA 2RSEA 1XRVA 3O5DA 2VCDA 4MTVA 4U86A 4WKAA 2M1IA 4IPXA 2KR7A 3UF8A 3KAIA 1GPFA 3CH9A 4NZCA 1A7XA 2QF8A 2WK2A 4TW6A 3RGCA 4QT2A 1U79A 5DIUA 2F21A 4MAVA 2PBCA 3O5FA 3AS1A 1F40A 4P8WA 2PPNA 5HT1A 1YATA 3RM4A 2XP7A 3WD3A 3B9AA 1FKJA 4ODQA 2LKNA 4TW7A 5GPGA 4Z2JA 4JYSA 1D7HA 1FKGA 1KT1A 1LG2A 3BXWA 1E6RA 4ZPWR 4L72B 5D75A 2WLYA 1GUVA 3B7XA 3CGNA 3UQAA 3TC5A 3B9DA 2DG3A 2AWGA 1FJDA 1FKSA 4HBOA 3WKZA 1EHNA 1FKHA 3JXVA 4IQ2A 2N87A 3JYMA 2A3EA 4AY1A 4DIPA 3ARRA 1ZU8A 1LL6A 3ARSA 4R5EA 4MNJA 1XHGA 4TNSA 1NWSA 2PV2A 3UQBA 1KT0A 1HKKA 1FKIA 2OLHA 1FD9A 4QIBA 4Z2IA 1NSGA 4ODKA 4P8VA 1L1PA 1H0GA 2ZQVA 2ZQUA 4LGXA 1C9HA 1H0IA 1ZCNA 3O5KA 4WKHA 1OGBA 4C02B 5DIVA 3ARXA 4ODLA 4LAXA 1FKTA 2XPAA 5DITA 3RM9A 2DT3A 1SR0A 4KQZA 1JVWA 1EDQA 3IKGA 5HBFA 4W9OA 2XPBA 4ZS6A 1HJWA 3ARVA 2FDMA 4PTMA 3KCEA 4LAYA 4R0XA 5HW6A 2A3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX5 A;  3PR9 A;  3PRA A; 
#chains in the Genus database with same CATH topology
 2JZV A;  2MLZ A;  5HUA A;  2KFW A;  4IT6 A;  1D7J A;  5HWB A;  4DWS A;  4G2P A;  4UDM A;  4JFL A;  3WD0 A;  3GPK A;  1ZB5 A;  1LG1 A;  2MLX A;  2PPO A;  2G41 A;  2DSU A;  2DG9 A;  2WM0 A;  1EQ3 A;  2OFN A;  3O5M A;  3EY6 A;  4ITZ A;  4LAW A;  4P8X A;  3LUO A;  5B8I C;  4WJX A;  1E6P A;  3O5J A;  3H9R B;  3CZ8 A;  1T11 A;  4P8U A;  3TDB A;  3CGM A;  4U84 A;  1QPF A;  1NMW A;  3O5I A;  1FKD A;  4J4O A;  2ITK A;  3CHD A;  1Q1C A;  3ARZ A;  1OGG A;  1PIN A;  3OOB A;  2PPP A;  2ZR6 A;  3CHC A;  4IQC A;  2DT1 A;  5DF0 A;  3G6M A;  1D7I A;  2KE0 A;  2XP9 A;  3UQI A;  4JFM A;  1WAW A;  3UI6 A;  3AQU A;  1UR9 A;  2B31 A;  3IHZ A;  1W1P A;  2A3C A;  2DSV A;  3WD1 A;  1HKI A;  2LGO A;  1B6C A;  4Z2L A;  2RUR A;  5GQB A;  1E6Z A;  4N19 A;  3O5G A;  4HAR A;  4ODR A;  2DT0 A;  4TYO A;  3UI5 A;  1JNT A;  3PA7 A;  2FKE A;  1ZBC A;  4TW8 A;  2M08 A;  1FKF A;  4DRI A;  1K9T A;  4DRP A;  3VAW A;  1VF8 A;  3KAF A;  4TX0 A;  1WNO A;  2ZR5 A;  3ARO A;  1E15 A;  4DH0 A;  1Q6U A;  1W26 A;  4DRO A;  3KAD A;  5GPR A;  3ARQ A;  1HKM A;  4URI A;  3ODK A;  3G6L A;  1D2K A;  3O5P A;  1E9L A;  4MSP A;  3QOK A;  3O5L A;  4W9P A;  4ZPT R;  1LJY A;  4Z2G A;  1W9P A;  3ARU A;  1TCO C;  5DO2 A;  3CHE A;  2IF4 A;  1NWT A;  3IKD A;  2MF9 A;  4G50 A;  1GOI A;  1QPL A;  4S3K A;  4L3N A;  4Q7N A;  1FKK A;  4S3J A;  2RUQ A;  2ZQS A;  1D6O A;  1J6Y A;  2RUD A;  3B8S A;  3RFW A;  3ARY A;  4JFI A;  2B5U B;  4WK9 A;  1Q6H A;  4LAV A;  4W5U A;  2FAP A;  2MNT A;  1ROU A;  1R9H A;  1J4R A;  1RD6 A;  4DRQ A;  4JFJ A;  4QZV B;  3WD2 A;  4DRN A;  1CTN A;  1W1V A;  3O5O A;  1YW5 A;  1GRJ A;  1FAP A;  3WIJ A;  4DWS B;  4NNR A;  3NI6 A;  1PBK A;  1X6L A;  1E6N A;  2DT2 A;  3W4R A;  5HWC A;  2YBT A;  3KAB A;  3AS2 A;  2ETN A;  5HW7 A;  1E44 A;  4W9Q A;  3KAH A;  2L2S A;  2G8Z A;  1P5Q A;  1LQ0 A;  1J4H A;  4Z2H A;  4BF8 A;  1KFW A;  2DPE A;  1HJV A;  2ZR4 A;  3GTY X;  5JH8 A;  1JNS A;  1EYM A;  1ZBW A;  2Q5A A;  2XP3 A;  4MNL A;  3ARP A;  2DG4 A;  3JYJ A;  4ODO A;  4DRK A;  2O9O A;  1HJX A;  2AOS A;  2F4E A;  4DZ3 A;  1J4I A;  2PV1 A;  4Z2K A;  2XP6 A;  4FAP A;  2YBU A;  2DSZ A;  3WH0 A;  1ZL1 A;  2XP4 A;  2O92 A;  3ART A;  3NTP A;  4ODN A;  1ZBK A;  4MPK A;  3TCZ A;  3KAG A;  3PRA A;  1NMV A;  3UI4 A;  2KGJ A;  1FKL A;  2UZ5 A;  1BKF A;  2D9F A;  3WQW A;  1F8A B;  3O5R A;  2MLY A;  3RME A;  5BXJ A;  2XP5 A;  1Y0O A;  1W9U A;  1UR8 A;  3AS3 A;  2PN0 A;  4JFK A;  1JND A;  2M2A A;  2RUC A;  1FFQ A;  2KO7 A;  1QZ2 A;  1W9V A;  4HBE A;  2Y78 A;  3PR9 A;  4DZ2 A;  1X6N A;  1JNE A;  4Q22 A;  2PV3 A;  3FXY A;  2ZQT A;  4ZPV R;  4QT3 A;  4J4N A;  3CHF A;  4WKF A;  1Q6I A;  5HW8 A;  1LL4 A;  4XAK A;  5DEZ A;  3B9E A;  5I98 A;  3WQV A;  4ODP A;  1M5Y A;  3ALF A;  3I6C A;  2LJ4 A;  4DRJ A;  4ODM A;  3PRB A;  3ALG A;  5HKG A;  3AS0 A;  1FKB A;  1O6I A;  1OWQ A;  3WL0 A;  4MNM A;  3WD4 A;  4DT4 A;  4KR0 B;  3ARW A;  3FY1 A;  2ESC A;  1NWR A;  4MGV A;  2KI3 A;  2XP8 A;  2DSW A;  4IT4 A;  1SYT A;  1FKR A;  4FN2 A;  4DRH A;  2A3A A;  3KAC A;  1W1T A;  3IK8 A;  3EIP A;  3PRD A;  1NWU A;  4GGQ A;  2VN1 A;  1N1A A;  3O5E A;  2IUZ A;  3O5Q A;  5HTG A;  3WL1 A;  1HKJ A;  2WLZ A;  3OA5 A;  3MDY B;  1HXV A;  4DWS C;  1ROT A;  2MPH A;  4WIW A;  1TFV A;  1W1Y A;  2K8I A;  4MNK A;  4DWS D;  1EIB A;  1JCH B;  4GIV A;  3RM8 A;  1BL4 A;  2RQS A;  1FFR A;  4O2T A;  3FAP A;  2F2D A;  3KZ7 A;  5J6E A;  4ML4 A;  1WB0 A;  1LL7 A;  4NSB A;  1ZK6 A;  2PI6 A;  2LPV A;  1ITX A;  1IX5 A;  4DRM A;  1NH6 A;  4U85 A;  1ZBV A;  2EUL A;  3NRK A;  2RSE A;  1XRV A;  3BMB A;  3O5D A;  2VCD A;  4MTV A;  4U86 A;  4WKA A;  2M1I A;  4IPX A;  2KR7 A;  3UF8 A;  3KAI A;  1GPF A;  3CH9 A;  4NZC A;  1A7X A;  2QF8 A;  2WK2 A;  4TW6 A;  3RGC A;  4QT2 A;  1U79 A;  5DIU A;  2F21 A;  4MAV A;  2PBC A;  3O5F A;  3AS1 A;  1F40 A;  4P8W A;  2PPN A;  5HT1 A;  1YAT A;  3RM4 A;  2XP7 A;  3WD3 A;  3B9A A;  1FKJ A;  4ODQ A;  2LKN A;  4TW7 A;  5GPG A;  4Z2J A;  4JYS A;  1D7H A;  1FKG A;  1KT1 A;  1LG2 A;  3BXW A;  1E6R A;  4ZPW R;  4L72 B;  5D75 A;  2WLY A;  1GUV A;  3B7X A;  3CGN A;  3UQA A;  3TC5 A;  3B9D A;  2DG3 A;  2AWG A;  1FJD A;  1FKS A;  4HBO A;  3WKZ A;  3GU0 A;  1EHN A;  1FKH A;  3JXV A;  4IQ2 A;  2N87 A;  3JYM A;  2A3E A;  4AY1 A;  4DIP A;  3ARR A;  1ZU8 A;  1LL6 A;  3ARS A;  4R5E A;  4MNJ A;  1XHG A;  4TNS A;  1NWS A;  2PV2 A;  3UQB A;  1KT0 A;  1HKK A;  1FKI A;  2OLH A;  1FD9 A;  4QIB A;  4Z2I A;  1NSG A;  4ODK A;  4P8V A;  1L1P A;  1H0G A;  2ZQV A;  2ZQU A;  4LGX A;  2F23 A;  1C9H A;  1H0I A;  1ZCN A;  3O5K A;  4WKH A;  1OGB A;  4C02 B;  5DIV A;  3ARX A;  4ODL A;  4LAX A;  1FKT A;  2XPA A;  5DIT A;  3RM9 A;  2DT3 A;  1SR0 A;  4KQZ A;  1JVW A;  1EDQ A;  3IKG A;  5HBF A;  4W9O A;  2XPB A;  4ZS6 A;  1HJW A;  3ARV A;  2FDM A;  4PTM A;  3KCE A;  2P4V A;  4LAY A;  4R0X A;  5HW6 A;  2A3B A; 
#chains in the Genus database with same CATH homology
 2JZV A;  2MLZ A;  5HUA A;  2KFW A;  4IT6 A;  1D7J A;  5HWB A;  4DWS A;  4G2P A;  4JFL A;  3WD0 A;  3GPK A;  1ZB5 A;  1LG1 A;  2MLX A;  2PPO A;  2G41 A;  2DSU A;  2DG9 A;  2WM0 A;  1EQ3 A;  2OFN A;  3O5M A;  3EY6 A;  4ITZ A;  4LAW A;  4P8X A;  3LUO A;  5B8I C;  4WJX A;  1E6P A;  3O5J A;  3H9R B;  3CZ8 A;  1T11 A;  4P8U A;  3TDB A;  3CGM A;  4U84 A;  1QPF A;  1NMW A;  3O5I A;  1FKD A;  4J4O A;  2ITK A;  3CHD A;  1Q1C A;  3ARZ A;  1OGG A;  1PIN A;  3OOB A;  2PPP A;  2ZR6 A;  3CHC A;  4IQC A;  2DT1 A;  5DF0 A;  3G6M A;  1D7I A;  2KE0 A;  2XP9 A;  3UQI A;  4JFM A;  1WAW A;  3UI6 A;  3AQU A;  1UR9 A;  2B31 A;  3IHZ A;  1W1P A;  2A3C A;  2DSV A;  3WD1 A;  1HKI A;  2LGO A;  1B6C A;  4Z2L A;  2RUR A;  5GQB A;  1E6Z A;  4N19 A;  3O5G A;  4HAR A;  4ODR A;  2DT0 A;  4TYO A;  3UI5 A;  1JNT A;  3PA7 A;  2FKE A;  1ZBC A;  4TW8 A;  2M08 A;  1FKF A;  4DRI A;  1K9T A;  4DRP A;  3VAW A;  1VF8 A;  3KAF A;  4TX0 A;  1WNO A;  2ZR5 A;  3ARO A;  1E15 A;  4DH0 A;  1Q6U A;  1W26 A;  4DRO A;  3KAD A;  5GPR A;  3ARQ A;  1HKM A;  4URI A;  3ODK A;  3G6L A;  1D2K A;  3O5P A;  1E9L A;  4MSP A;  3QOK A;  3O5L A;  4W9P A;  4ZPT R;  1LJY A;  4Z2G A;  1W9P A;  3ARU A;  1TCO C;  5DO2 A;  3CHE A;  2IF4 A;  1NWT A;  3IKD A;  2MF9 A;  4G50 A;  1GOI A;  1QPL A;  4S3K A;  4L3N A;  4Q7N A;  1FKK A;  4S3J A;  2RUQ A;  2ZQS A;  1D6O A;  1J6Y A;  2RUD A;  3B8S A;  3RFW A;  3ARY A;  4JFI A;  4WK9 A;  1Q6H A;  4LAV A;  4W5U A;  2FAP A;  2MNT A;  1ROU A;  1R9H A;  1J4R A;  1RD6 A;  4DRQ A;  4JFJ A;  4QZV B;  3WD2 A;  4DRN A;  1CTN A;  1W1V A;  3O5O A;  1YW5 A;  1FAP A;  3WIJ A;  4DWS B;  4NNR A;  3NI6 A;  1PBK A;  1X6L A;  1E6N A;  2DT2 A;  3W4R A;  5HWC A;  2YBT A;  3KAB A;  3AS2 A;  5HW7 A;  4W9Q A;  3KAH A;  2L2S A;  2G8Z A;  1P5Q A;  1LQ0 A;  1J4H A;  4Z2H A;  4BF8 A;  1KFW A;  2DPE A;  1HJV A;  2ZR4 A;  5JH8 A;  1JNS A;  1EYM A;  1ZBW A;  2Q5A A;  2XP3 A;  4MNL A;  3ARP A;  2DG4 A;  3JYJ A;  4ODO A;  4DRK A;  2O9O A;  1HJX A;  2AOS A;  2F4E A;  4DZ3 A;  1J4I A;  2PV1 A;  4Z2K A;  2XP6 A;  4FAP A;  2YBU A;  2DSZ A;  3WH0 A;  1ZL1 A;  2XP4 A;  2O92 A;  3ART A;  3NTP A;  4ODN A;  1ZBK A;  4MPK A;  3TCZ A;  3KAG A;  3PRA A;  1NMV A;  3UI4 A;  2KGJ A;  1FKL A;  2UZ5 A;  1BKF A;  2D9F A;  3WQW A;  1F8A B;  3O5R A;  2MLY A;  3RME A;  5BXJ A;  2XP5 A;  1Y0O A;  1W9U A;  1UR8 A;  3AS3 A;  4JFK A;  1JND A;  2M2A A;  2RUC A;  1FFQ A;  2KO7 A;  1QZ2 A;  1W9V A;  4HBE A;  2Y78 A;  3PR9 A;  4DZ2 A;  1X6N A;  1JNE A;  4Q22 A;  2PV3 A;  3FXY A;  2ZQT A;  4ZPV R;  4QT3 A;  4J4N A;  3CHF A;  4WKF A;  1Q6I A;  5HW8 A;  1LL4 A;  4XAK A;  5DEZ A;  3B9E A;  5I98 A;  3WQV A;  4ODP A;  1M5Y A;  3ALF A;  3I6C A;  2LJ4 A;  4DRJ A;  4ODM A;  3PRB A;  3ALG A;  5HKG A;  3AS0 A;  1FKB A;  1O6I A;  1OWQ A;  3WL0 A;  4MNM A;  3WD4 A;  4DT4 A;  4KR0 B;  3ARW A;  3FY1 A;  2ESC A;  1NWR A;  4MGV A;  2KI3 A;  2XP8 A;  2DSW A;  4IT4 A;  1SYT A;  1FKR A;  4FN2 A;  4DRH A;  2A3A A;  3KAC A;  1W1T A;  3IK8 A;  3PRD A;  1NWU A;  4GGQ A;  2VN1 A;  1N1A A;  3O5E A;  2IUZ A;  3O5Q A;  5HTG A;  3WL1 A;  1HKJ A;  2WLZ A;  3OA5 A;  3MDY B;  1HXV A;  4DWS C;  1ROT A;  2MPH A;  4WIW A;  1TFV A;  1W1Y A;  2K8I A;  4MNK A;  4DWS D;  1EIB A;  4GIV A;  3RM8 A;  1BL4 A;  2RQS A;  1FFR A;  4O2T A;  3FAP A;  2F2D A;  3KZ7 A;  5J6E A;  4ML4 A;  1WB0 A;  1LL7 A;  4NSB A;  1ZK6 A;  2PI6 A;  2LPV A;  1ITX A;  1IX5 A;  4DRM A;  1NH6 A;  4U85 A;  1ZBV A;  3NRK A;  2RSE A;  1XRV A;  3O5D A;  2VCD A;  4MTV A;  4U86 A;  4WKA A;  2M1I A;  4IPX A;  2KR7 A;  3UF8 A;  3KAI A;  1GPF A;  3CH9 A;  4NZC A;  1A7X A;  2QF8 A;  2WK2 A;  4TW6 A;  3RGC A;  4QT2 A;  1U79 A;  5DIU A;  2F21 A;  4MAV A;  2PBC A;  3O5F A;  3AS1 A;  1F40 A;  4P8W A;  2PPN A;  5HT1 A;  1YAT A;  3RM4 A;  2XP7 A;  3WD3 A;  3B9A A;  1FKJ A;  4ODQ A;  2LKN A;  4TW7 A;  5GPG A;  4Z2J A;  4JYS A;  1D7H A;  1FKG A;  1KT1 A;  1LG2 A;  3BXW A;  1E6R A;  4ZPW R;  4L72 B;  5D75 A;  2WLY A;  1GUV A;  3B7X A;  3CGN A;  3UQA A;  3TC5 A;  3B9D A;  2DG3 A;  2AWG A;  1FJD A;  1FKS A;  4HBO A;  3WKZ A;  1EHN A;  1FKH A;  3JXV A;  4IQ2 A;  2N87 A;  3JYM A;  2A3E A;  4AY1 A;  4DIP A;  3ARR A;  1ZU8 A;  1LL6 A;  3ARS A;  4R5E A;  4MNJ A;  1XHG A;  4TNS A;  1NWS A;  2PV2 A;  3UQB A;  1KT0 A;  1HKK A;  1FKI A;  2OLH A;  1FD9 A;  4QIB A;  4Z2I A;  1NSG A;  4ODK A;  4P8V A;  1L1P A;  1H0G A;  2ZQV A;  2ZQU A;  4LGX A;  1C9H A;  1H0I A;  1ZCN A;  3O5K A;  4WKH A;  1OGB A;  4C02 B;  5DIV A;  3ARX A;  4ODL A;  4LAX A;  1FKT A;  2XPA A;  5DIT A;  3RM9 A;  2DT3 A;  1SR0 A;  4KQZ A;  1JVW A;  1EDQ A;  3IKG A;  5HBF A;  4W9O A;  2XPB A;  4ZS6 A;  1HJW A;  3ARV A;  2FDM A;  4PTM A;  3KCE A;  4LAY A;  4R0X A;  5HW6 A;  2A3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...