2YBTA

Crystal structure of human acidic chitinase in complex with bisdionin c
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
377
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC MAMMALIAN CHITINASE
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 126
structure length 377
sequence length 377
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybtA01
4MPKA 4AXNA 1WZMA 1E5NA 1DTUA 3T09A 1XYFA 3CGTA 5A8OA 1WO2A 3QHNA 4BQ4A 1EOMA 1FP8A 2NT1A 3AZTA 2WANA 3RO8A 1V6UA 1CPUA 3PZIA 4H8VA 4WKHA 3WH7A 2WNWA 1HP4A 4CU7A 4P7LA 3WF4A 1KGWA 2WC4A 2OWCA 1R86A 4GI9A 3MUAA 4U3AA 3TONA 1E4LA 3OLEA 2Y5EA 1RP8A 3AXXA 3WF0A 4WSKA 3PZNA 4CVWA 4AZGA 4GZIA 2C8NA 3AOFA 1GQIA 1QNQA 1XSJA 4UFLA 2J62A 4K68A 1JNDA 4P7RA 3L4TA 1EHAA 3WQVA 3CUGA 5KZ6A 1L8NA 1B2YA 3PZQA 1CXLA 4BF7A 2GVYA 2VCAA 2YL6A 2GJPA 4PMOA 2FHCA 1LL6A 3AZSA 1VFFA 4IISA 1H49A 4M80A 3AXIA 3WIJA 4HU8A 4AIUA 2Y8KA 1V3IA 3CZEA 3OIHA 5DO8A 3POHA 3MV01 4JKKA 2VI0A 3ZQ9A 3VIKA 2VL4A 2J4GA 3PZVA 2DIJA 1H09A 2CPUA 4W7UA 3GH4A 3CHDA 1UD5A 4CD6A 1B31A 2WC7A 4UQEA 2WWDA 3CUJA 2WSKA 1FH9A 2XYLA 4P7OA 3W38A 2FH6A 4PMNA 3WY1A 4KGLA 1H0GA 4AC1X 2VNCA 5C8BB 3ZT7A 1WKYA 3VTRA 4W5ZA 3QHOA 4V2XA 2WWCA 4LGXA 1B90A 1ZJAA 5E70A 1B3WA 1W1YA 1M53A 4Z2JA 4H04A 4UCFA 4D6GA 2JIEA 1CLVA 2CBVA 4UZSA 3AHXA 1V08A 2PBGA 1V0MA 4UFMA 3T2PA 3WEOA 4TOQA 1FH7A 3A6OA 4TUFA 4H8HA 1JYNA 4M1RA 3WQ4A 3UETA 4DUVA 1ZBCA 3B8SA 3MMUA 3LPFA 4E8CA 1I1XA 3MS8A 4HU0A 4AZIA 1HKKA 1BVNP 3VVGA 2YA0A 2WMFA 1Q4NX 2DQXA 2O9TA 4NI3A 1CBGA 1QHPA 1GQJA 1G01A 1Y7VA 5A6KA 3W28A 1GOOA 1JZ5A 4CVUA 3KEHA 4JKMA 3ZIZA 4TVDA 1HF6A 3APGA 1W9DM 4Z2LA 2WCAA 5HOSA 3L4UA 1VRXA 2NT0A 2J7DA 3EDFA 1JF5A 3SCQA 3VMOA 2O9PA 4B3KA 5DEZA 1V3JA 5GNYA 3AROA 2QMJA 3BAKA 5ECUA 1E6NA 2ZIDA 2VJXA 4PSPA 3EMQA 2YKKA 3MMDA 4YHEA 5A6JA 1TG7A 2J74A 3CBWA 3WL1A 3T2OA 3CTTA 3F4VA 1E1FA 4TVUA 1Q6EA 5I79A 2Y24A 3LPPA 2VX7A 3POCA 2DSVA 1OIFA 2JIWA 4KWUA 1UOKA 3VOCA 1M01A 1M03A 1KQYA 2CBIA 1GOKA 3S6TA 2VX5A 2D3LA 1H41A 2ZXDA 1KWKA 2W62A 1LF1A 2VZUA 2Y2WA 5M03A 1BAGA 3WNMA 1ODUA 5I5RA 5DF0A 4OIFA 3UG4A 4PTXA 2YA1A 4AD0A 4Z2GA 1NWSA 2YDQA 2G3IA 3ZR5A 4JFVA 3M6DA 1QVBA 3WH9A 1OWQA 2CHOA 1GJUA 1KBBA 3PN8A 2QHAA 4UQDA 3MKKA 3U5UA 2G3JA 4W8LA 2WHKA 4XX6A 4YHGA 4CN1A 1JXJA 1KB3A 3AMCA 2QMKA 2D3NA 4ZE5A 3HMCA 3AIWA 5HPCA 4AZHA 5C70A 4W89A 3AMKA 4AWEA 4QCEA 3ARPA 8CGTA 4HMEA 1E73M 1D3CA 3WUEA 3NYDA 1BGGA 3N18A 4JHOA 1JYXA 1ZBKA 3ZO9A 3W4RA 3VPLA 1BQCA 2GJXA 3BLKA 4AW7A 2ZX5A 3VDAA 1PZ2A 4M82A 2NSXA 3WELA 1JFHA 1GJWA 2YOCA 3WQ8A 2WLYA 1UWIA 4AZ7A 1OSEA 4WLCA 2ZX6A 3EDDA 1A3HA 5HDRA 3L4YA 1NWUA 3WD3A 1GVIA 5LA1A 1V3MA 3VIFA 1DWJM 2JALA 5EB8A 2Z1KA 1ZJBA 5CPSA 1ZS2A 1XH2A 3BC9A 2EPLX 4MTVA 3VM7A 4GQQA 4HMCA 1M04A 3BAJA 1E6RA 3SCPA 1BG9A 3W6LA 1US3A 3GNRA 4W7WA 5EFDA 3ZT5A 1CZ1A 1HT6A 5FOOA 1K9DA 1E4MM 1G9HA 2OSYA 3W26A 1AQHA 1BHGA 1UR9A 1VF8A 3OB8A 3F5LA 2ZXBA 2YLAA 3MUY1 1DEDA 4NRSA 3GBEA 1UKTA 2X0YA 2WM0A 4DWSD 1EXPA 1CXHA 4ZFMA 3BAXA 5D9NA 3KWXA 4F79A 3WDPP 2DT0A 4AEEA 2CETA 1CNVA 1J10A 1Q6GA 3VINA 3OG2A 3W0KA 4JCLA 1E6ZA 2Y8VA 5A8QA 3RM4A 3AIRA 2VT0A 2VZOA 1C90A 4AZBA 4BS0A 3I3DA 4LYPA 2QPUA 1HKJA 1JAKA 3CHCA 3EYPA 3MSGA 4PSRA 4A3HA 5HNNA 5I78A 1C91A 3VD3A 1E40A 1BYCA 4KMQA 3TTOA 3ZSTA 1CGUA 1NQ6A 1JGIA 5IFTA 3WENA 3II1A 1V6XA 2GJRA 2UY5A 4PCTA 1FA2A 1UR2A 2QPSA 1PZ3A 2CXGA 2BFGA 1HJXA 3WH8A 3DYPA 1BFNA 2BY1A 4AY1A 1E55A 5AC4A 2CKRA 3GNOA 3KZSA 1VFUA 3OGSA 3AHZA 5E09A 4B9ZA 3A3HA 4XZBA 1MWOA 2ZWYA 4M56A 2WVSA 5FIPA 3VD5A 1QNSA 4AIOA 5M5DA 1AVAA 1JG9A 5CXPA 5BROA 2WVVB 5CSUA 5ABGA 3CZKA 4UZUA 3OBAA 3NDYA 4JFUA 1XSKA 2BHYA 3WNKA 1I1WA 1A47A 1W2VA 5ABFA 2W67A 5BRPA 1CGYA 3WH6A 3B9AA 4F9DA 1CEOA 3AIQA 2EEXA 3VNYA 1SR0A 4B16A 2BHZA 1JI2A 3CMJA 2BXZA 3N9KA 1E70M 5CPQA 5DMYA 5BXRA 2DSZA 3W81A 5JIWA 5EBAA 1GHRA 5CLTA 1E0VA 3EDJA 1VB9A 3SUSA 2AOSA 1C8XA 3NJ3A 1NOWA 4W87A 3CMGA 2CESA 2F2HA 2XM2A 3ARTA 1VBUA 1GOMA 1OB0A 4B15A 2CCRA 4PUEA 2ZUTA 1QBAA 1XD1A 1J0KA 4AZCB 2PC8A 3AHYA 3WDIA 1FHLA 3ZSSA 1XGZA 2ZUSA 1OINA 2WKLA 1JIBA 1UH2A 2J8GA 1W9UA 2WZEA 3BCFA 1QI0A 5FD0A 2WHLA 5A6AA 4AZ5A 3K4DA 1VJZA 1FHDA 3HU7A 3QHMA 5BRQA 1QNOA 1C93A 2D24A 1P6WA 2XSAA 4JL2A 3SCRA 4KRUA 1NWTA 2BVTA 2ESCA 2WVUA 4UOZA 3RJXA 1ITCA 2WLZA 5A6SA 5E9AA 1PIFA 1DWHM 1LWJA 1GOIA 5EMYA 1V6YA 1W91A 3K8LA 3GBDA 3RM8A 1BF2A 3W24A 2WMKA 1OT2A 6A3HA 4GZJA 1B9ZA 1TMQA 4GIAA 1V02A 3BMWA 5I6SA 3W25A 1FFRA 4PMVA 2CBJA 2DDXA 2EJ1A 3CH9A 3SCOA 3WDRA 3HJEA 1JDDA 1H0IA 4BCEA 1OGGA 1W1TA 2CNCA 1UD2A 1QBBA 1E1EA 3U5YA 3FAWA 1LJYA 1NOFA 4CU6A 2PBOA 1GQLA 1PIGA 1GOQA 1BYBA 3ARZA 3AICA 3SUWA 5IDIA 3WN6A 3QOKA 3OZPA 2MANA 2UY3A 3AXHA 1EDQA 3ARXA 2VZVA 3CO4A 1TUXA 5D9PA 2CHNA 4MADA 2J8FA 2ZUUA 4V27A 2CIPA 4RL3A 1EA9C 4ZXLA 2ZE0A 1CTNA 4W5UA 2WMHA 3SUUA 2EPNA 1HVXA 1R8LA 2FDMA 4GZEA 4FK9A 3NCOA 2F61A 2VTFA 2WMGA 4JFSA 3AS2A 1BPLB 5BXPA 4U31A 5A8PA 2G3NA 2VR5A 4J3UA 5DT7A 5JBDA 3IJ7A 1NP0A 3K4AA 3T0AA 5JBEA 2WZIA 4PMUA 2D1ZA 2WYSA 5HPOA 3FHQA 1VFMA 1WNOA 3A4AA 4PMXA 2ZOXA 3DHPA 1MW1A 3ARRA 2XGIA 1XHGA 2UWFA 1E71M 1HX0A 3QGVA 3SUTA 2XHYA 1XCWA 8A3HA 1AQMA 1CXIA 2CERA 4PMYA 1BG4A 2VR4A 1V6WA 4CD8A 1XCXA 4MAZA 1G94A 2IUZA 3N12A 3WEMA 3WNNA 1QPKA 3N15A 2IXUA 1IV8A 3GXMA 1KFWA 4CKQA 4PMZA 1SFSA 2F8QA 1PJ9A 2ZUVA 1EO5A 1WB0A 4AD3A 5LYRA 2G41A 1UWTA 4EK7A 3GYCA 1CXFA 2E3ZA 1VJSA 1GUVA 3JUGA 1SMAA 3AI0A 3OZOA 2DSUA 3RJYA 5E6YA 1H2JA 4XZWA 4P7QA 5IXEA 1BTCA 4D6CA 1UZ1A 4XUYA 4MJ2A 2BVYA 4ML4A 3VDBA 1XSIA 1IT0A 4CU8A 4LYQA 2WMJA 2QF8A 2XFFA 4W8AA 4C7GA 4R5EA 1QOXA 4AD2A 1E3XA 1GCYA 1MFVA 5D9MA 4PMRA 3FN9A 3W82A 3WDJA 2WBKA 1B3XA 1UD3A 2V38A 1ESWA 3PTKA 3A47A 3IAQA 4GPNA 2YL8A 3VD9A 1E6XM 1UH3A 2XFRA 4CN4A 2WCSA 4CD4A 3QR3A 2J7HA 2NW0A 5FL1A 4X0VA 4EE9A 1DP0A 1F4AA 2VVSA 4UQAA 3T0BA 2UY2A 3VILA 1J9YA 2PB1A 1ECEA 3GDBA 1E15A 3KL5A 1MYRA 2PWHA 4DUWA 2VURA 1BSIA 3WNPA 1WDQA 3WDQA 2VCBA 3M07A 2VCCA 1CDGA 3UR8A 2PF0A 3SCWA 3OGVA 3BSGA 3VIHA 3CUHA 2E8ZA 1OIMA 1AMYA 1H1NA 1W3LA 3MANA 4GXPA 2XG9A 3KL0A 1K9FA 1EH9A 4IM4A 3RILA 4MNMA 1KXHA 2EPOA 4YN5A 4GQRA 5FKYA 3MO4A 3WF1A 3A4XA 3VIGA 3A4WA 1GNXA 3AIEA 3WEZA 1FOBA 2G3MA 3AJ7A 1CECA 3L4WA 1W1VA 4U3CA 2E4TA 2WPGA 3TOPA 4H41A 4W8BA 1JI1A 3ZJKA 4EAMA 3SCVA 4W84A 3WKZA 3MUIA 4URIA 3L4XA 2PWFA 2RGMA 1E3ZA 3GXDA 4MB1A 2XIIA 1E6SM 4DUXA 4TX8A 2OYMA 4JCMA 5DT5A 2WK2A 1RPKA 3AHVA 3SUVA 2J79A 2WHJA 4OJYA 1QHOA 2O92A 1W1PA 3AISA 3SEPA 4QLKA 2BXYA 2E0PA 5BYWA 1UR4A 2FGZA 3TTYA 4LQ1A 3FXYA 3BAWA 3AYSA 2DIEA 3BGAA 3AFBA 4HOWA 3B9DA 1V3KA 2FHBA 3ALFA 1O7AA 1RD6A 4QLLA 2HVMA 2J7EA 3CHFA 3VGHA 5ABHA 5BXTA 4HTYA 3GXFA 3MMWA 3SIMA 1GVYA 3PHAA 3DECA 4PUDA 3IJ8A 1PEZA 1MW2A 4PTVA 1K9TA 1J0IA 3O2LA 1KR1A 4S3JA 7TAAA 2WBGA 1E9LA 5A2AA 2ZXAA 1OT1A 3DYMA 3ALGA 2CEQA 3VO0A 1EQPA 2VX6A 2OSWA 4F66A 1EQCA 1QNRA 5BXSA 4DWSB 1E43A 2WB5A 4MB5A 3EBVA 3U7BA 2BY2A 1EO7A 2HISA 1H11A 4JKLA 4UFIA 3SCUA 4ATLA 1HJUA 3VGFA 2WW5A 2ZICA 4MNJA 3L2MA 1E0XA 4OZOA 5GNXA 1QI2A 1KWGA 3W29A 4UFHA 1UR0A 3U7VA 1OM0A 4Q22A 2VRJA 3VM5A 1E0WA 1NWRA 1KCKA 2X1IA 3VUPA 1Q6DA 4UTFA 1H3GA 1V03A 4RE3A 3WFZA 3WF2A 2W66A 1TA3B 4P8XA 1E5JA 4NZCA 2GSJA 5AYBA 4HOXA 2YBUA 2OWXA 3FAXA 4LX4A 4JFTA 1JD7A 2J7BA 2EXOA 4XV0A 2Z1SA 2YA2A 4UQBA 4UNIA 4MJ4A 4J3XA 1WZKA 3RDKA 1WE5A 1TE1A 2DSKA 4KRTA 4AIEA 2PI6A 3GTNA 4AD1A 1C7SA 3VU2A 4A3YA 1R7OA 3AMDA 2ZUMA 4JAWA 1Q6FA 2E9BA 3WMSA 3MV11 2ZX8A 3FW6A 5FCZA 1WCGA 2YJQA 4W7VA 2PWDA 2BHUA 2XVPA 4MDPA 2E8YA 1EDTA 5A8NA 3FHAA 2BY0A 5I24A 2B31A 1HJQA 4CN6A 5D8WA 1ZBWA 4OBSA 3TA9A 4LYRA 2CKSA 2V3GA 1LWHA 2ZUNA 2WCGA 5A3HA 1GQKA 2WKGA 4PBGA 2AMGA 4W88A 1U30A 3AS3A 3BH4A 2C7FA 1QHZA 3VNZA 4L4PA 1UKSA 1CXKA 1UH4A 1K6AA 2ZUWA 1Z32X 5JBFA 5M17A 4KH2A 3B9EA 2DT3A 1XD0A 4E4PA 2GUYA 4J7RA 4V28A 4J3WA 5CSYA 1NH6A 2D0GA 2A3EA 2VZTA 3BAIA 4TVCA 2DH2A 1FH8A 4ZEPA 3UERA 3WBAA 4ZENA 3VMPA 4HA1A 4HMDA 1QI5A 3IANA 3HN3A 1IZJA 2WVVA 4MNKA 2BY3A 3GH7A 5CZKA 5A8MA 1JZ6A 1D7FA 1W9XA 5LA2A 4D6IA 1DWAM 2GK1B 1HN1A 4NSBA 2X09A 1W3KA 5D4YA 5EFFA 1TVPA 2GDVA 3WD2A 5A69A 4AEFA 1GONA 1EDGA 4RE2A 2GDUA 5A6BA 2BNJA 4EKJA 1HKMA 1BYAA 3KE0A 3RCNA 3VX1A 1VFOA 3AS0A 3WMCA 2FHFA 3WSUA 3W37A 1CGWA 2JFEX 3VGEA 1E4IA 1HXJA 3TTSA 1R87A 3SCNA 3CUFA 2PWEA 1EHNA 3AS1A 3L4VA 6CGTA 2ZXQA 5JIPA 3ZR6A 1V3LA 4B3LA 1LQ0A 4M29A 1GW1A 4AZCA 1C8QA 1EOKA 1PPIA 1CWYA 1WAWA 2YLLA 4IUGA 1JNEA 3BMVA 4ACZB 1W9PA 1WDRA 4JZ5A 1ISWA 4C7DA 1E6PA 2XTKA 1OD8A 3D5HA 2X05A 4PN2A 4D6HA 1OD0A 2WZHA 3CZJA 2VX4A 1SMDA 1QW9A 4WK9A 5I23A 1UKQA 1KGUA 4FLQA 4PYSA 3NDZA 1TZ7A 1GOWA 1WZLA 2XVNA 2V3EA 4PMQA 3M7SA 2W5FA 1L0PA 1VEMA 4CGTA 2DPEA 3DYOA 4MB3A 3VD4A 1XC6A 4WF7A 3VDHA 4MNLA 5I3DA 2EPKX 4JL1A 3WUBA 2GFTA 2EQDA 3CUIA 1JAEA 1N82A 1W3HA 3LMYA 3EMCA 3PZGA 4S3KA 3WD0A 1J0HA 2JEPA 1UR8A 1YHTA 3GNPA 4CCCA 1J0YA 3I3EA 2G4FA 1VENA 1NARA 1UYQA 1UWUA 1Q6CA 4N42A 3BSHA 4PMDA 4AD4A 1B3VA 2RGLA 2D2OA 4YPJA 3UEQA 5AYIA 3RM9A 2VRQA 2OWWA 1ISZA 3K1DA 3AIVA 1LG2A 1FFQA 3SCTA 1OBAA 1ISYA 3WD1A 3PBGA 1C92A 1E56A 3IJ9A 3BCDA 1UG6A 1JZ3A 3ZM8A 4NRRA 3ZMRA 1HL8A 2DGAA 5LA0A 2UY4A 5E6ZA 5E0CA 1NM9A 1CIUA 3CHEA 1ODZA 3BXWA 3BLPX 5I0DA 3DC0A 4NF7A 1W2PA 3AIBA 5A94A 2YIHA 3NUKA 3WBEA 3WUGA 5A2CA 1JZ2A 1X6NA 1W9BM 1J18A 3OLIA 2ZX9A 4HZ8A 1TFVA 4U5IA 1JDCA 4UQ9A 3UESA 2OSXA 1PX3A 2ZWZA 2XIBA 1UZ4A 1JYVA 2J47A 1BVZA 5JH8A 1VIWA 4HP5A 1J11A 2BV9A 2D20A 5TD4A 4DM2A 2XPKA 2X0HA 4CUCA 4PTMA 1KXQA 4D1JA 3IK2A 4GI8A 9CGTA 1UWRA 1JYWA 1VEPA 1V02E 3WNLA 4CCDA 2CBUA 4AISA 1B30A 1V3HA 4W86A 3VGBA 1UWQA 3T0DA 3ARWA 1MW0A 4CCEA 3U57A 3SURA 1V0LA 4W85A 4ZE4A 4WJXA 4HZ6A 5A95A 3MSDA 1GZJA 1XV8A 1NOUA 4R27A 1WP6A 1CGVA 3N17A 5IHRA 4ATWA 2DT2A 1WZAA 2VO5A 2WC3A 3W6MA 1I75A 2V3FA 1C3FA 2BS9A 3VIPA 3VGDA 3S2CA 1XRVA 1WDPA 1R7AA 2X2YA 2VQUA 1R85A 3N13A 4JIEA 3WQ6A 3UG3A 4D72A 4QLJA 3N1AA 1ZL1A 3UR7A 2XWDA 1JFXA 4Z2HA 3ARYA 3G6MA 1ITXA 2AAAA 3PZ9A 3E1F1 3KL3A 4WIWA 1E4NA 4L4OA 1UKOA 4D6EA 4JHZA 3WUFA 1VEOA 2O9RA 3ARUA 1S46A 4BZYA 3THCA 2VZSA 4N0RA 3UCQA 1JL8A 4BQ5A 3FNDA 3WFLA 3TTQA 7A3HA 1W3JA 3RMEA 1KBKA 4UQCA 4ATDA 4FLOA 1HP5A 2D22A 2VRKA 1TVNA 4IPNB 2V5DA 1HJWA 4WKFA 3VIMA 5C71A 4OUEA 6TAAA 1KCLA 4TTUA 5ABEA 4E2OA 2A3CA 1RP9A 4HPGA 3DHUA 5GNZA 2E40A 2W63A 4WKAA 1KXVA 1TCMA 2A3HA 3NSMA 2EO7A 4Y7EA 4XB3A 2WAGA 3AYRA 1HIZA 4MB4A 4D71A 4WSJA 1JF6A 1V0NA 1EIBA 4D6DA 3RPMA 2OLHA 1GPFA 4J3SA 4IPLA 3J7HA 1UQZA 2J77A 1B0IA 5CJ5A 2XGBA 3GZAA 5A6MA 2DH3A 4M24A 1UA7A 4U33A 4GO8A 2E9LA 1M7XA 2DSWA 4FLSA 4HZ7A 2XWEA 3VGGA 4D1IA 3ZJ8A 1UA3A 4FMVA 3PZUA 3OGRA 4Z2KA 1OCQA 4UOQA 1JZ8A 1XYZA 2PWGA 3QOMA 3K8MA 3ZJ7A 2FH8A 1V6VA 4QDMA 4QCFA 5A6LA 1HJSA 2A3AA 1CGTA 2JEQA 1W32A 1B3ZA 3VX0A 3CZGA 3ARQA 2YL9A 3ARVA 1UUQA 2EPMX 3GM8A 1XH0A 2D0HA 2Q8XA 1MQPA 1B3YA 2QLYA 1MXGA 3FY1A 2XUCA 3PTMA 1CYGA 1QNPA 4U5KA 4H7VA 4UFJA 3WH5A 4BQ2A 1KXTA 3WQ5A 2WMIA 4P8WA 2XVLA 3ZOAA 3PZTA 1LLOA 2J7FA 3CPUA 2WMIB 2XFYA 1US2A 4FLRA 5IHSA 2Y4SA 4AMCA 4DWSA 3AMGA 3CLWA 2W4XA 5F7UA 2W91A 1JD9A 1JZ4A 3WMBA 2FGLA 1SYTA 1NP2A 2WHMA 3RIKA 7CGTA 1CLXA 1BGAA 4U2ZA 3L2LA 4Z2IA 4ZXOA 5JUVA 3WD4A 1KR0A 2XVKA 5BWFA 4PTWA 1HVQA 3K46A 4HPHA 1O6IA 1J12A 2J25A 3ECQA 5FL0A 2EBNA 3ZJ6A 3ARSA 4QAWA 1DWFM 2C0HA 2A3BA 1TA3A 2IXVA 1GHSA 3WNOA 5CGMA 5IFPA 4CD5A 2GJXB 3M46A 1UKPA 3D3AA 2VQTA 4J3VA 1IZKA 1JZ7A 4H2CA 3WDHA 3W27A 2VUYA 3O9NA 1X1NA 2VVNA 1CENA 2J78A 1TR1A 3EMZA 4P8UA 5HBFA 1CXEA 3GH5A 3O6AA 2OYLA 1DWGM 1YQ2A 4B9YA 4X0NA 1U2YA 4AZ6A 3CZLA 5CGTA 4U2YA 1WDSA 4UOJA 1DHKA 1UHVA 3SCSA 1RH9A 2YL5A 1U33A 1G5AA 4PEEA 2VOTA 3K8KA 4J28A 4CD7A 3NIYA 4M8UA 1J0ZA 4F8XA 1KGXA 3VIOA 2D0FA 2VMFA 4F9JA 1G0CA 5E0FA 2G8ZA 4HOZA 5D9OA 1UD4A 4HA4A 4FF5A 2V5CA 1AQ0A 3THDA 3AMLA 4UR9A 2XM1A 4A4AA 4DM1A 1UQYA 4LPCA 1EGZA 4TTGA 1K9EA 1VBRA 2JF6A 1PX4A 1MQRA 2JF7A 2X8RA 4OOUA 1ZBVA 1PAMA 2J75A 4P7NA 3VKKA 1XH1A 2W92A 1V0KA 4AYSA 4X9YA 5DFAA 1PBGA 3WF3A 4DWSC 3MUZ1 5KEZA 3EDEA 4C7FA 4LXFA 3CIVA 4J3TA 1F4HA 2YBTA 3MU7A 1DWIM 3I3BA 1OGSA 1MW3A 3LPGA 3TP4A 1LL7A 3ZT6A 2GK1A 4OBRA 3VD7A 1H5VA 3GXIA 5GQBA 1UD6A 1UWSA 1MVYA 1B1YA 2XVGA 2ZX7A 1G1YA 4J27A 2TAAA 4P8VA 5AY7A 4ACYA 2CITA 2WVTA 2YDSA 4GI6A 1LG1A 4TXEA 2J7GA 4Q7NA 1ISVA 3VIIA 3AZRA 1JDAA 1UD8A 1D2KA 4GKLA 3AIUA 2VC9A 2YDRA 4MDOA 1HL9A 4TX6A 5BCAA 4D6JA 1VAHA 5CQ1A 5D8ZA 5ABFB 3VMNA 4PRWA 3EDKA 1CGXA 1KQZA 3F5KA 2WXDM 3AHTA 4ACZA 2DT1A 2DEPA 2OYKA 2CYGA 1E72M 1MXDA 3LPOA 3WL0A 4D6FA 2D23A 3VIJA 4BQ3A 2XSBA 3OLDA 4MAVA 3NSXA 2V3DA 1LL4A 5CG0A 1MFUA 1J01A 4OOZA 1MQQA 4H8UA 4BA0A 3UG5A 3W53A 4W93A 4GO9A 4QFUA 4AD5A 5M3WA 1PX8A 1W9VA 1GORA 1X6LA 3BAYA 1QI4A 3PTQA 4UFKA 3AQUA 4JFWA 1BYDA 1HJVA 4QP0A 4PCSA 3L4ZA 1H4PA 3OLGA 5AC5A 3N04A 4GINA 3T08A 5I77A 2WSPA 3NSNA 3VDCA 1ZB5A 3IAPA 5HXMA 2E9MA 3PZMA 1C7TA 2J7CA 4M81A 1J0JA 4KGJA 5I2UA 3OA5A 1WPCA 5A2BA 3G6LA 4E8DA 5A1AA 1FP9A 5A6BD 3CZ8A 3PZOA 1ZU8A 2W61A 5GPRA 5CLWA 1ISXA 1E6QM 2JE8A 2XJ7A 1UR1A 4RE4A 1BLIA 3N11A 2QV4A 4HA3A 1HKIA 1QI3A 3T2QA 2O9OA 1OGBA 5CPTA 3F5JA 1JXKA 2BVDA 4OKDA 1QW8A 1C8YA 4EANA 3WQWA 1HNYA
chains in the Genus database with same CATH superfamily
4AXNA 3T78A 1QW7A 1WO2A 1AH4A 1EOMA 1T5AA 4AQLA 4S3CA 3NL6A 3P82A 4WKHA 3WH7A 2WNWA 1HP4A 1Z3NA 1JGMA 3C2RA 3H2NA 2A6LA 3MUAA 3FIGA 4LUIA 3TONA 5F4XA 3OLEA 3LXBA 4AAJA 1YPIA 3EEGA 2Y6ZA 1XSJA 1Z6KA 2OEKA 1PVNA 2QS8A 3BTNA 1X1OA 4LVGA 1EHAA 1RHCA 5HUPA 4Y9OA 3CUGA 1R9XA 3FJ4A 3ORWA 4BF7A 1FAPA 4GRSA 1XRSA 2GJPA 3U0HA 3PAOA 4GMEA 1H7PA 4WXYA 4US5A 5CPLA 1H49A 3AXIA 2DZBA 3WIJA 2PGRA 4AIUA 1K70A 1GG1A 3PNUA 2Y8KA 3OIHA 3BQ6A 4ZO6A 1ICPA 2ZKMX 5HANA 4E4FA 3KADA 3W02A 1YLVA 4AVOA 3VUSA 3QFEA 3GDRA 3UU0A 3PZVA 2CZVA 4W7UA 2HXUA 2V63A 4H6RA 4Z0SA 3CHDA 2CZFA 3FGCB 2QCNA 3APTA 1RY0A 3WLKX 1B31A 2R82A 2YXXA 1JUEA 1D9EA 3QMSA 2DUZA 3CUJA 2WSKA 2XYLA 3VNMA 3B0UX 3G1XA 2FH6A 5LXXA 3LV5A 4KGLA 4AC1X 5BMXA 5C8BB 3QHOA 1NY1A 5J5RA 1FDJA 3M0JA 2Y7DA 4Q4SA 1JCYA 3FA3A 4H04A 3UY8A 1HTIA 1VFTA 2BGSA 1CLVA 1QMLA 3AHXA 2PBGA 1ZCCA 1MI3A 1VS1A 1EIXA 1EWEA 2XDFA 4GQ0A 5FEWA 1CT5A 4YVVA 5HR7A 1FH7A 4HPJA 1VYRA 4H8HA 4GJ1A 3E96A 2MLZA 3PVFA 4ZQRA 4E5TA 1I1XA 3VVGA 1ZAIA 3NZPA 3ATYA 3ABXA 4Y9PA 3AU2A 1W1A1 2CZ5A 3EX1A 1K8XA 3AUJA 3W1MA 5A6KA 2WZMA 1LRNA 5JVLA 3CH0A 3ZIZA 1LQ2A 2OO0A 1XLMA 3APGA 2BVWA 4XKYA 1QU4A 5HOSA 3LCHA 3F2DA 2FKPA 3L4UA 3CIWA 3AWNA 3VMOA 2ZRVA 1F07A 5AZ1A 4B3KA 5DEZA 2H6RA 4MWAC 3TDFA 5H8PA 4RXGA 5ECUA 2EF9A 1TG7A 3ITGA 3CBWA 3CTTA 4C6LA 3UWZA 2PDKA 1DYSA 5I79A 4R85A 3NQGA 2VX7A 2AL2A 2DSVA 1DE5A 1OIFA 4QG9A 1A0DA 1PKNA 2JIWA 4KCVA 4C91A 2QT3A 1J2WA 1S2AA 3NOEA 1B57A 1KQYA 3PBVA 1WA3A 3FK4A 3GY1A 4FIRA 4PC8A 2QEZA 3IVSA 2VZUA 1JJKA 4LAZA 2Y2WA 1YKWA 5M03A 1GKPA 4LNCA 2PDHA 1VCVA 2FGBA 5I5RA 4OIFA 2PMQA 2YA1A 3PR2A 4RNJA 3RGCA 3ZR5A 4XBSA 1GJUA 3QGKC 1KBBA 1VYSX 2FPYA 2QHAA 3U5UA 1L6YA 5H8UA 2AKMA 3TCZA 1R3WA 4NAEA 3N2OA 5FSEC 1A7XA 3AMCA 5CZTA 4HJWA 1OYBA 4IGNA 4S3DA 4B5TA 1OEPA 5FF4A 2PDFA 2G96A 3G18A 3L2IA 4IUOA 4DRIA 4QEEA 8CGTA 3LBCA 4JTIA 3W7HA 3O6YX 4HSHA 2DZTA 4NZJA 3IIPA 1ZBKA 3PTDA 3ZO9A 2QCCA 1F2JA 3MBDA 3S1UA 1BQCA 2QDDA 3KCOA 4E3VA 4K1GA 2ZX5A 3PG9A 3R6IA 3VDAA 5BMWA 1RXOB 1FWTA 2NSXA 4UTJA 4G7EA 3GG8A 1AH3A 3GX9A 1VFSA 3OODA 4JTQA 4WLCA 2PRHA 5DMLA 4Z1YA 1YE6A 2J88A 2YCEA 3EDDA 3QW4B 1SO3A 4V1XA 1P0DA 2J9ZA 1EJSC 1GVIA 1VIZA 4Q4KA 5LA1A 2RUCA 2QDGA 3L0GA 1BWVA 5A6TC 2KZHA 3QZ6A 4FX6M 5EB8A 1QO2A 4B5WA 1ZJBA 4IIDA 1XFCA 1XH2A 3BC9A 5I3KA 3B4YA 1IZCA 1ZY9A 3GNDA 4HMCA 4XKMA 4I9AA 3BAJA 3O1NA 1RVKA 3GTIA 1E4MM 1G9HA 3H2CA 1WYIA 2MUCA 1XF0A 3ABOA 1ONXA 3F5LA 3TMQA 3UZWA 3MUY1 1UKTA 1CXHA 1L2UA 2QCGA 2JQXA 3NQDA 1J96A 4JFKA 2ZE3A 4RZ4A 2PLCA 1Q7QA 4I8DA 1E6ZA 3FVDA 3LSCA 2VT0A 2QPUA 1ME7A 1PV8A 1JAKA 1RQBA 3C0LA 3GC4A 4PSRA 1I0BA 3JS3A 4JYFA 3HGJA 3EPMA 4QX4A 1FQ0A 2Y5SA 3I7QA 3TJIA 3TTOA 3AO0A 4ALDA 4IICA 3UVIA 3B8UA 5EBUA 5IFTA 3O5DA 4W9PA 2UY5A 5CSSA 5AKQA 1EA0A 1P5QA 4BK9A 2CXGA 1EXBA 2BFGA 1HJXA 1F9CA 3WH8A 3DYPA 4HB7A 3P0WA 2Z2UA 5AC4A 3MCNA 3M0LA 3GNOA 3KZSA 1VFUA 5E09A 2TSYA 3KOWA 5T8GA 4L9YA 3O3RA 4DHGA 4DB7A 4GC4A 3QVQA 3JXVA 5FIPA 1TQJA 4S3GA 3EXTA 3CZKA 3EX2A 3B97A 2PFHA 4R88A 1W3TA 3UWYA 3FOKA 4KCTA 3B9AA 4AHPA 1CEOA 2ISFA 1M5WA 1Y0OA 1JEZA 4OUIA 2EEXA 1SR0A 4B16A 1W3IA 3GTHA 2C15A 1T99A 4Q4RA 4PEKA 4FN2A 4RW5A 1FWWA 3M0VA 1ZAHA 3B8WA 4GUGA 5DRCA 5JIWA 1DQUA 1E0VA 3R4IA 4R7OA 1NOWA 2F2HA 2XM2A 3ARTA 4QZVB 4JTUA 4ZTXA 4OWGA 4B15A 4JTKA 4MG4A 4HSOA 4PUEA 1OFQA 1VHCA 2DW7A 2ZA2A 1FHLA 2O4QA 1ZK6A 1UH2A 3H7RA 4PZVA 2VC6A 1R38A 5FD0A 5A6AA 4AZ5A 3K4DA 3WG6A 5BRQA 4MZ8A 1KV5A 1QNOA 1WXJA 1XBZA 3OBKA 4JIIX 4GX9A 2WLZA 3N2CA 5JH2A 2GVGA 2PGFA 1XS2A 1BF2A 3R7MA 4DYKA 4G7FA 7ODCA 4E2BA 4GIAA 5BW6A 5I6SA 2YXGA 2CBJA 3CH9A 1H7OA 2XP7A 1SO4A 4A3QA 1Q45A 5FF3A 1O66A 3WDRA 3HJEA 1KM4A 1JDDA 3TLQA 2PPGA 4M0XA 1H7XA 4M19A 2HRWA 5FJRA 3W7DA 1RCQA 2YBVA 1E1EA 1UUOA 3U5YA 2HS8A 4TR9A 3EXSA 1NOFA 4CNOA 3GFXA 3IHZA 1GQLA 1EPXA 1BYBA 4DLFA 2A1YA 2OTDA 5HW6A 3SUWA 5IDIA 1NDZA 3HQPA 4B5NA 3WN6A 3LERA 1GOXA 1LWIA 5AFDA 4RR4A 4HNLA 2D69A 3T7VA 4AF0A 5CBBA 3LM3A 3FYPA 4W5UA 2WMHA 3SUUA 2EPNA 2ZA1A 4MFEA 1PTGA 1VKFA 4HK6A 4GZEA 5BNKA 3TH6A 3G3DA 3O5MA 2WMGA 2E7FA 1CW2A 2G3NA 4ZBCA 3BO9A 3LG3A 5DT7A 1K4HA 2XN2A 3K4AA 5AVNA 3N3MA 3EOOA 2D1ZA 1LUCB 4E3TA 3VNDA 4K36A 2PGWA 3H8AA 2FZNA 3ARRA 2VEKA 3F03K 3QGVA 5FF0A 2XHYA 4ZMGA 4ZB2A 2VR4A 1V6WA 1XCXA 2OX1A 1TIWA 3N15A 4O16A 3P81A 2XP6A 4CKQA 4ZOAA 2NUWA 2NX3A 3KDOA 2FZBA 2PLKA 2G41A 4RNIA 5AHLA 3AI0A 3OZOA 4K37A 3BCJA 3RJYA 4XZWA 2C19A 3NVDA 3LUOA 4EX4A 3I6TA 3IUDA 4O4WA 2Z29A 1EUNA 2BVYA 4JX6A 4ML4A 4ICMA 4IQ2A 2WMJA 4NXSA 3W1UA 2F2DA 1F73A 2XFFA 5DQPA 1E3XA 5C2CA 3RU8X 1GCYA 1GVRA 4FSAA 1MFVA 4NT0A 3VKBA 4PMRA 4TQTA 2E6DA 1LQAA 3ABSA 2V38A 4KT2A 1ESWA 1GWJA 3A47A 4US5D 4AY8A 2YL8A 1K1DA 4IPPA 3F4NA 4OFCA 3GC5A 1DE6A 3TC5A 5FL1A 1PS9A 4IX2A 4ODRA 2VVSA 4UQAA 3T0BA 1TO3A 3VILA 4NILA 1UWAA 2W27A 3QZAA 3IEBA 3B7XA 4CQ9A 3WNPA 1WDQA 3WDQA 4DRQA 3O5JA 3S5YA 3LGGA 2VWTA 3M07A 1KRMA 1CDGA 1Y8BA 2PWVA 1CB2A 4IFKA 3TR2A 4OGZA 1H1NA 2HK0A 4WGXA 3GVGA 3IVUA 1DHPA 3KL0A 4IM4A 2RURA 1ZZMA 1UP3A 4Y9AA 3URQA 1MMFA 4OTKA 4GQRA 3A4XA 1PTDA 3ZLHA 1CECA 1T8XA 3B8IA 3WLHA 1XL9A 2PPNA 4FAPA 2R91A 4W8BA 1R47A 1K7FA 1ENUA 3ZJKA 4EAMA 4GA8A 1D7HA 3MUIA 3L4XA 3W2JA 2RGMA 3E5BA 1QK0A 2AQWA 1Q1CA 4R7WA 3N2XA 3S2MA 2RAGA 1TPH1 1TWIA 3QBUA 2OYMA 4JX4A 1H60A 2NVCA 3G0XA 3SIZA 3SUVA 4OJYA 3R0DA 4Q7BA 3AISA 5PTDA 2INZA 4IT1A 2E0PA 3EB3A 2J9XA 5BOEA 3MSRA 5HUAA 5G1YA 1BRLA 4Y9NA 3S1XA 1PB0A 3B9DA 1TJRA 4D2JA 2HVMA 3VGHA 5ABHA 4HTYA 3GXFA 3SIMA 1AW2A 3O15A 2A79A 1K8ZA 1OFRA 4LCQA 2GGIA 4FAMA 2EKCA 4HNVA 1K9TA 1J0IA 1BD0A 1XYMA 1EZ2A 1E9LA 2ZXAA 3VO0A 2KX9A 4F66A 3QFWA 1QNRA 5BXSA 4MB5A 3LYEA 3HTWA 3IGXA 1P1MA 2HISA 1H11A 3R25A 4UFIA 1ME9A 2GGJA 3CT2A 2Q09A 1EBGA 2Z2BA 3QSRA 3VGFA 1T0OA 3KAHA 4OZOA 1JCNA 3W29A 4IFRA 1OM0A 2PBCA 4Q22A 1FWRA 2FMOA 3VM5A 4RNFA 1E0WA 1REQA 3OHIA 1KCKA 3AUOA 3VUPA 4IP7A 4UTFA 4RE3A 3F1QA 3WF2A 3MKVA 1TA3B 3HG4A 3PFMA 3GHTA 4JTJA 4NZCA 1FKWA 5HWNA 1RR2A 5HMDA 4LX4A 3REQA 1EWDA 2YA2A 1S3TC 3DERA 1A0CA 3LDVA 1GKRA 1D3HA 1AA1B 2FVLA 2QAFA 2VXNA 4GYFA 2DSKA 4PUWA 4J35A 1RV8A 2XIJA 3UA3A 3PS7A 1G6CA 3VU2A 4AD1A 1R7OA 3NTYA 4JAWA 3RR1A 1QCWA 2ZX8A 4FR6A 3L65A 2YJQA 4W7VA 2BHUA 4DWDA 2XVPA 5LSMA 2QUTA 3FHAA 3GZ3A 3GLCA 4CN6A 3WLRA 3S2LA 2V3GA 4NX5A 2GZXA 2AMGA 2ZC1A 1KFCA 2BSLA 1U30A 4IQCA 3C3UA 1AMKA 3UNTA 1QHZA 2WKJA 3DHFA 1CXKA 1JQVA 4NNAA 1K6AA 2ZUWA 1ZNNA 2PV2A 3DESA 1SJBA 1XD0A 5D32A 4E4PA 2ACUA 2QJMA 3ONBA 3SRKA 3C86A 3WK3A 1TX0A 1YTKA 4I6KA 1LTDA 3B05A 3IV8A 4XAGA 1TKKA 1OG6A 2ABAA 1EFZA 3GTFA 4GNKB 4WOZA 1GZ1A 3H22A 3TYDA 3IACA 3G1FA 3FYOA 2LJ4A 1F05A 4KFPA 3IANA 1CCWB 4HYVA 3W72A 1ZP4A 3TMLA 2DP3A 3P80A 5B7YA 3TVAA 4NJGA 1HN1A 4NSBA 1R3QA 3HGOA 3LENA 1HUVA 1YBQA 1R0MA 1FKBA 3WD2A 1FCQA 3ABRA 1BWLA 1AUSL 2QW5A 1GONA 2ZZ3A 2DJLA 4KR0B 2BNJA 2OX4A 1HKMA 5FA5A 3LA4A 3RCNA 1KBLA 4ODQA 1VFOA 3E0VA 3WMCA 2IPWA 3WLIA 4RDVA 4ONVA 4K6AA 4XWUA 3VGEA 5IRPA 3SZ8A 3CUFA 3GIYA 3EPNA 4RW3A 3L4VA 2ZXQA 3ZR6A 3B06A 3KVLA 1PYFA 2X16A 1LQ0A 4XAZA 1GW1A 4GVHA 1PPIA 5T91A 2IPJA 4ZQOA 3PC0A 1OZQA 4TIMA 1WAWA 1FWBC 4L6DA 3HG5A 3BMVA 4L1XA 3UPMA 1GK8A 4NQ1A 1EC9A 1E6PA 2YDAA 1OD8A 4WDTA 3NO3A 2OLSA 4XIAA 4JTDA 1QNVA 3TYAA 4PN2A 4D8ZA 4XZIA 1SMDA 3NL2A 3RLHA 1AQFA 4NZ1A 1KGUA 1NVMA 2FKEA 3LU2A 2VEIA 1PKLA 2XVNA 1VFHA 1IWPA 2V3EA 4PMQA 1XDMA 5B8IC 2DPEA 3OQ8A 2ZQTA 4L3NA 3M6YA 3VDHA 4JDBA 5I3DA 4JL1A 3NZ1A 3UPWA 3E0IA 3CUIA 1JAEA 3DHDA 4S2BA 3WD0A 2JEPA 2MPHA 1AD4A 2KAUC 1TPC1 4PUUA 2HJPA 4BR1A 1Q6CA 1ZP3A 5HJLA 3PRBA 4A2RA 4AD4A 3ELFA 4X22A 3LUTA 1ISZA 3K1DA 3AIVA 1LG2A 3O0FA 3TCEA 3PBGA 1E56A 3IJ9A 1J79A 1VCGA 3HQ1A 1WOAA 4N2YA 1XIDA 4ZO7A 3BURA 4MKNA 4AWTA 4IHCA 1BKFA 2FYMA 1NM9A 1ODZA 3BXWA 2FPTA 4F3HA 5HNUA 4B2DA 3NUKA 3WUGA 4GNJA 4W4QA 4UTKA 3KP0A 5AHEA 3U4AA 3UCDA 1MNSA 1X6NA 4ODPA 4U85A 5BWAA 3O5GA 4Y8EA 2DJXA 4LU0A 1JUKA 2PD5A 4OBTA 2OSXA 1PX3A 2ZWZA 1DV7A 4GUIA 1A5AA 4I8YA 4PA8A 4R33A 5JH8A 4O1BA 4AYGA 4DM2A 3M16A 3UWQA 1MZRA 2B7PA 3H7VA 4H7CA 3IK2A 9CGTA 5K9DA 1S2TA 1V02E 3TC6A 1SFJA 1A50A 1FWAC 1B30A 4J2MA 1HXVA 1FHVA 3S6DA 3N73A 4RPQA 1UWQA 4XTIA 4XG1A 5D30A 3U57A 1XBXA 5A95A 4O8RA 3IJQA 3N17A 3OVQA 4JNMA 5IHRA 3GKAA 4DZ5A 1FWEC 1LRTA 2VFEA 3W6MA 1FVPA 2V3FA 3S1GA 3NM1A 3EY6A 3VIPA 3VGDA 5C2XA 4DJFA 4DZ2A 2B7QA 3UG3A 4D72A 4O12A 1ZL1A 2XWDA 3ISIX 3CGMA 2SFPA 4DRKA 3KTXA 3UZYA 1PTAA 2O9RA 2ZTKA 4O14A 5AC6A 3ARUA 1S46A 4BZYA 2KGJA 4XAPA 1VC4A 5C6MA 3UCQA 3TTEA 3TTQA 1W3JA 5LNRA 1KBKA 4GH3A 1B4EA 1L8PA 4IPNB 1HJWA 4XSLA 3VIMA 4YL2A 4HCDA 4E2OA 2A3CA 4LOCA 4AHQA 3DN5A 4YVPA 4IMFA 5GNZA 1JCHB 2I5GA 1KXVA 1YX1A 2EO7A 2DFAA 3CT7A 4DO4A 3NZGA 4C6KA 1RBLA 1LBMA 3AYRA 1HIZA 4D71A 3RYSA 1JF6A 1EIBA 2OLHA 3LCXA 2FQIA 1GPFA 4JIHA 5G1MA 4HCLA 1UQZA 2QUUA 3GDKA 3QR0A 4XKYB 3ITLA 1UA7A 1UP0A 2E9LA 1A5SA 3VOFA 1H1ZA 2XWEA 3HO8A 3LK6A 3EKLA 4NKCA 1KM1A 1Q3NA 3NA8A 3PZUA 4FMVA 3OGRA 3C61A 5B80A 1A4MA 4ES4A 1PZ1A 3H53A 4LB3A 3KRSA 2A3AA 4RZBA 5EMJA 2W0UA 3PBWA 3GS6A 3TOYA 2PURA 3LHYA 2ZZ1A 5J5DA 2FTWA 3QW3A 4NIRA 2QIWA 1YEYA 3EOLA 2AL2B 3QQ0A 2VDIA 1Q6LA 4GGBA 1MQPA 3UD6A 5I03A 3VOHA 1OY0A 4IGSA 4DBDA 1MXGA 1CYGA 3WK0A 1QNPA 4U5KA 3S0CA 3IUIA 1EF2A 4P8WA 5REQB 3ZOAA 1TCDA 1XG4A 3R8RA 1RPXA 2XFYA 2AL1A 3P8IA 4K3ZA 1O5KA 1FKGA 4LS1A 3URNA 3WMBA 2FGLA 3PWIA 3PBMA 4KRZA 4C1NA 3RIKA 4C6NA 1CLXA 1TTIA 1FD9A 3L2LA 4Z2IA 5JUVA 4CQ8A 3CIXA 5BWFA 4YMZA 1F3TA 1YPFA 4NVTA 1ZFJA 3ECQA 2OXNA 1DWFM 1PL9A 1O94A 1JDEA 1RSCA 4FX7A 5CGMA 5IFPA 4PL1A 3RXZA 1RA0A 2PZNA 2D2HA 1ML1A 4O50A 1HL2A 1AL8A 3N25A 3WDHA 4G7EB 3DXIA 4ORIA 3GNXA 4OU1A 4O13A 4TO8A 4GIVA 4N6FA 2OYLA 3PWAA 1DWGM 4ZS6A 3W23A 4B9YA 3N4AA 4EPBC 3WLQA 3COTA 4UOJA 3Q94A 1XLGA 3LHWA 3RAOA 3S5ZA 1G5AA 2I9UA 4PEEA 4RDZA 3K8KA 3MY9A 5IBXC 1PHQA 2NQZA 1TWSA 3LXAA 4CD7A 4M8UA 3E2SA 2GVJA 2BB0A 1G0CA 3MB9A 2E77A 4HOZA 3SJ3A 3CUZA 4FF5A 4C6QA 1AQ0A 5GJMA 3DFYA 1XLIA 4DM1A 1VZWA 3B8TA 4IIHA 2ADAA 1V8EA 3QYSA 1K9EA 1V51A 3FVMA 2JF7A 1ZBVA 3EA2A 4ZB0A 3P5ZA 4X60A 1V0KA 5K4ZA 3M0XA 4M7TA 1FKXA 4X9YA 1ZQ5A 3USZA 5KEZA 4A21A 3NG3A 1EB3A 1H51A 3I3BA 2NQHA 3RUBL 2R94A 5K3VA 4HYWA 2C16A 4MYXA 1TJPA 1TREA 2HV5A 2QCEA 2Y62A 2GK1A 3LM7A 1TE6A 4OBRA 4AHOA 2ZRXA 2V82A 2ON3A 1UD6A 3TR9A 1MVYA 5HKGA 2CWXA 3ZXWA 4ZODA 3TK7A 4J27A 3EZ4A 4P8VA 4LVFA 3C6CA 1TPB1 5AY7A 2CITA 1FRBA 2VP8A 1LG1A 5FACA 4KCWA 4TXEA 8XIAA 4FXSA 3HOJA 4XZNX 1YIXA 4HNUA 3VKAA 4JR5A 4GUFA 4J40A 3LHUA 4WVXA 9XIMA 1ELSA 3QPEA 1JDAA 3CTLA 4FEZA 3AIUA 3SADA 1OQFA 3C2VA 2YDRA 4TX6A 4M6QA 2PDUA 4GGHA 5CQ1A 3VNIA 1MO0A 3E0WA 1CGXA 2WXDM 1R9ZA 3AHTA 3W7EA 4BF5A 1DVJA 2DEPA 5TIMA 3QY6A 2NQLA 4Y8FA 1RJQA 3S4TA 3TWBA 2GOUA 1P6CA 2D73A 3VIJA 4BQ3A 2XSBA 3OLDA 4LRTA 3BOXA 2ZR5A 4GIYA 1N1AA 2VEGA 1MFUA 1PXGA 4H8UA 3ITVA 1P4CA 4JTAA 4MJMA 2H9AA 3W7JA 4GO9A 1LBFA 4GK8A 2B7OA 4QFUA 2RH9A 1PX8A 1DORA 3BAYA 3G1AA 4QQ3A 3H7UA 2PGEA 1BYDA 1AJ2A 3BMBA 3LLXA 4N4QA 3EGJA 2OVLA 1L6FA 1H4PA 4TU1A 4FZIA 1GGOA 2HS6A 3T0CA 1NJJA 3N04A 4GINA 1YRRA 3QF0A 5I77A 2E9MA 3W73A 4GIEA 3PZMA 4UTMA 4Y90A 2HVOA 5A2BA 5A1AA 1RALA 3CZ8A 2Y7FA 5EKYA 3PJWA 2ZZ6A 2WSQA 2JE8A 2E25A 3HPSA 3SO7A 1KC7A 1QI3A 3T2QA 2O9OA 5CPTA 3DH7A 2VDHA 1UB3A 4MPKA 4B5UA 1WZMA 3K30A 3OP2A 3T09A 1XYFA 5HQMA 3UR2A 2VGGA 2WANA 4G56A 1BWKA 1CPUA 4H8VA 2HVNA 4O1CA 1TV7A 3B4UA 4QJ5B 3C8NA 1E4LA 2Y5EA 3RPTA 3AXXA 3WF0A 4WSKA 1I2OA 4CVWA 4AZGA 1HO1A 3AOFA 3R5EA 1GQIA 3CHVA 2R6OA 2PDBA 4CQBA 5JU6A 3WQVA 5KZ6A 1O1ZA 1QPOA 1EQ3A 3PZQA 1IR1A 2VCAA 4AF0B 4FF7A 2ACSA 3FLUA 2R14A 4HU8A 1XIJA 2FIQA 1LROA 1V3IA 3CZEA 4JD4A 3L23A 1HG3A 1GVQA 1A5KC 4BFAA 5MF5A 2YFOA 3DBNA 4JQ4A 5G5IA 3NRKA 3VIKA 1MUCA 2VL4A 2DIJA 5M2FX 3TQVA 3GH4A 3VK5A 1TPUA 4TV5A 4UQEA 5DXXA 4QE5A 4P7OA 1XLEA 4K8EA 3W38A 3O7UA 4XAFA 2V81A 4PMNA 2ZVIA 1XIGA 1NIUA 1XISA 3SGGA 2YYUA 3DGBA 2DUXA 2I17A 3UXKA 4UR7A 1ZJAA 1M53A 4Z2JA 1YDOA 4HNNA 2GJNA 4B2DD 1V08A 3GHSA 3OOQA 3T2PA 5BU6A 3WEOA 1HKWA 4CEXC 4TUFA 3WLLA 1F8IA 3LQLA 3WQ4A 3BZGA 4GVFA 4R53A 4DUVA 3B8SA 3MMUA 1JQXA 3LPFA 2REQA 2INFA 2RJGA 3C4UA 4AZIA 3E9AA 2QIIA 2Z1XA 1FHUA 1DIEA 2CLEA 2YA0A 3A4JA 1ZCOA 2DQXA 3SN0A 2O9TA 4S3FA 2QR6A 1CBGA 1QHPA 5C7VA 1DJHA 4Y9MA 1Y7VA 2CLPA 1Z44A 4LUTA 1GOOA 1JZ5A 4CVUA 1SUXA 1HF6A 2B81A 3KUMA 4Z2LA 4X61A 1XYBA 2XN0A 3JU2A 4IFOA 3LGDA 1JF5A 2Y8UA 3UI4A 5G1TA 3KOXA 3ATZA 2ZA3A 2VGBA 1BXBA 3R79A 1IWAA 1PHWA 4IFKB 4LAMA 2F7FA 2AGKA 2Y70A 3UJSA 3ODKA 3QV6A 1PIIA 3EMQA 4UTWC 4YHEA 4AVNA 4IPJA 4DJFD 3ERPA 5FJOA 4RCXA 1U5HA 3P14A 4TVUA 5DITA 2Z28A 5DIUA 2AMXA 2Y24A 3LPPA 5AB3A 1VLWA 3DAQA 1M03A 1A5OC 4HU3A 3WLSA 4G2PA 1K6WA 5K4XA 5I3HA 3E38A 2VX5A 3K1GA 2ZXDA 5D38A 2W62A 3N19B 4G8TA 5CH9A 2OR2A 3W83A 1BAGA 3WNMA 3TSMA 2HBXA 3NPWA 3MI6A 3TEVA 4GACA 4UMCA 2Z1VA 4PTXA 2FJUB 4AD0A 3PBYA 5AOUA 1XIIA 1NWSA 3WH9A 1IXQA 3SQSA 4QEHA 4LAKA 3IS4A 1T41A 4XO6A 5D2TA 5DY3A 4DJED 2WHKA 4DRHA 4EIVA 1BRLB 4XD5A 1D7JA 2QXWA 2XP9A 5IDZA 4MVAA 4Q4OA 4ZTYA 4AWEA 3MJMA 1T11A 2ZVRA 3CAVA 4HMEA 2HPMA 1D3CA 3MMTA 5H6HA 1TWZA 2R8WA 4JHOA 5T26A 1JYXA 4H2HA 3U2EA 1KCXA 3VPLA 1W31A 4IMAA 4LF2A 2GJXA 1XGEA 3BLKA 3UI6A 4DX3A 1SVDA 4M82A 4V1YA 4BI7A 1JFHA 3WQ8A 3H54A 4AZ7A 1OSEA 4LCSA 1GYMA 2ZX6A 5AYZA 1GTHA 1GRJA 3RRXA 1UBPC 3P61A 5CAKA 3UW6A 1V3MA 4NX0A 3VIFA 1DWJM 1REQB 2EGZA 4AY7A 3ZVHA 4IMEA 5CPSA 1TV3A 1R9YA 3UR5A 4MTVA 3VM7A 4WJ8A 4Y6GA 3KTSA 3GO2A 4H6EA 3SB0A 4W7WA 5EFDA 4GIRA 1CZ1A 4ZSTA 5LIYX 1SSDA 3REQB 1DJNA 3QTGA 2DZAA 1QXLA 5FEZA 4HHPA 3PF3A 4IT6A 1WBJA 4DAIA 1BHGA 4O1AA 4DXKA 1UR9A 1VF8A 4O1DA 2QYGA 1LORA 2YLAA 4NRSA 3GBEA 3RCMA 2WM0A 3QEZA 3EIPA 3BZJA 2DT0A 4AEEA 1CNVA 1NFGA 6XIMA 3AXMA 1GKQA 3OG2A 2B7NA 2Y8VA 2VC5A 3RM4A 1R5YA 4UBPC 2X30A 1JRBA 1RCXB 1T40A 4AZBA 4BS0A 1S1RA 1XINA 2QCFA 3W1AA 4JEQA 3V5CA 3W07A 4A3HA 5HNNA 5I78A 4RZ5A 5FI8A 4HNTA 3B9NA 3S83A 4JYSA 1NFPA 2XZ7A 4I7WA 4KWSA 5EMMA 2ZYFA 3UP8A 1NELA 1NQ6A 1JGIA 4L6HA 4PCTA 1FWNA 2C0AA 2QPSA 4HHLA 1LLWA 5F4SA 4QDWA 1IXNA 3CMFA 1BFNA 2BY1A 4AY1A 2GLKA 3RU6A 4C6PA 2VFDA 1IT7A 4WR3A 4E6MA 4AXKA 4QXIA 4EPKA 1DQXA 4Z1DA 3LZ3A 4O52A 1TV4A 4HZMA 3NZQA 1JG9A 5CXPA 1Y5XA 4DRSA 5CSUA 5BU9A 1EPVA 1FWHC 4IGHA 1IE7C 4HKPA 3NDYA 3GIQA 1XQKA 4HPNA 4FOKA 4A3UA 4OE7A 3TW6A 2Z1WA 2XZ9A 3VXGA 4AG0A 1JI2A 3CO8A 4LJ3A 3N9KA 3R1ZA 4ADUA 4HCHA 3W81A 3V0SA 3IIXA 3SUSA 2Q02A 1C8XA 2XH0A 3CMGA 2G0WA 2BTMA 1RK5A 1GOMA 1Z7AA 1QBAA 5D04C 4KWWA 4IJRA 1VBJA 3ZSSA 4PB3A 2WKLA 4V15A 1YPXA 1KLYA 4JTSA 3SSZA 1A5UA 1BXNA 2P1FA 2Z0IA 5JXQA 1FHDA 4GVGA 4H6QA 2D24A 2XIMA 1MSSA 1SQ7A 5K9XA 4JL2A 3GWQA 3HPFA 2BVTA 2WSYA 3N6HA 1LWJA 2Z4GA 1W91A 3K8LA 2HE8A 2PE4A 5HUOA 7REQA 4MLJA 4LYKA 2OCZA 2RDTA 6A3HA 2Q01A 4GZJA 1TMQA 5H8MA 1V02A 2AKZA 2PDXA 3S8HA 2EJ1A 1R2RA 1L6WA 2DVXA 3SCOA 4HNOA 3SW6A 4NG3A 5HA7A 1H0IA 4BCEA 1OGGA 1W1TA 5HWBA 1X1ZA 4IIBA 2DG9A 1LJYA 2CLHA 4CU6A 1PIGA 4GG9A 3KVMA 3ARZA 3B8DA 3VZXA 5DIVA 3YPIA 5EGRA 5DELA 3LEPA 1A3WA 1ZTVA 2F2KA 2MANA 3S2JA 4GH1A 3M41A 4C1KA 3ARXA 1TUXA 1WBHA 1P6BA 3PY2A 2CHNA 2Q3RA 4Q8VA 3LHZA 5LGZA 3PA7A 3WLJA 2BASA 3URBA 3BQ5A 3KBJA 5F2MA 1HVXA 2FDMA 3TAOA 3ZVIA 5LIUX 4XD4A 4TW6A 1KNWA 4B5VA 5TAOA 4JFSA 3AS2A 2V2CA 5BXPA 2BODX 5ECVA 4U31A 3A9IA 1GQNA 5A8PA 2VR5A 3OHMB 1NTHA 3O0KA 5JBDA 3APYA 1NP0A 3PBUA 4IX0A 3GTYX 1XRTA 2CW6A 4O0ZA 1WNOA 3PB2A 3V16A 4DBUA 3OVRA 3KS6A 2JKPA 4D8AA 3DOPA 8XIMA 1CLKA 1XHGA 2C18A 2PDNA 3SUTA 4QM1A 3PANA 3BJFA 8A3HA 1CXIA 4PMYA 3GDLA 2ZZ7A 1BG4A 4CD8A 2HXTA 4YXGA 3MYOA 3WNNA 2H8XA 2HTMA 2ISSA 1IV8A 1N8WA 3GXMA 5U4NA 2ZZ2A 2I5QA 2P5NA 2V6AA 4DZHA 4S38A 2NQ5A 4WY0A 4QISA 1WB0A 4AD3A 1RUSA 3IWPA 4YVXA 4YWSA 1UWTA 3EWUA 4I5XA 1SMAA 4LTSA 2QJGA 3H24A 2DSUA 4G1NA 4AX7A 4QRNA 5GJPA 1UROA 4RXFA 2AGTA 2CFFA 4P7QA 2K8IA 5D2YA 1BTCA 4ZL1A 3GVRA 1UZ1A 1ZGDA 4US6A 5EMKA 2CLLA 4MJ2A 2O7QA 4JQAA 1SFTA 1XSIA 4LYQA 3TNOA 2RKXA 3KHJA 1TSIA 4H9ZA 4C7GA 3W22A 4R5EA 3ZLGA 2FTPA 1EP3A 1MDRA 3TIMA 5D9MA 1D7IA 1UC5A 1B3XA 4RV3A 3PTKA 3RGTA 3NPXA 4NNBA 1XW8A 3FKRA 3ZLFA 4O54A 4IMGA 4DXVA 3VD9A 1UH3A 3N9RA 4CN4A 3VAWA 1F4AA 5ABTA 2QCMA 1J9YA 4WD0A 3QKZA 3TC7A 2PWHA 4PFMA 3NQFA 4YTUA 4QBXA 2KFWA 5FJUA 1L1PA 5E0KA 2VCCA 1AK5A 1DPMA 5G4HC 3OGVA 4PUKA 3A5VA 5KZMA 3R94A 3KXQA 1S5NA 1OIMA 2G95A 1W3LA 3GVVA 3VOIA 3KFTA 4NNRA 2XG9A 2BMBA 1J93A 2UZ9A 3RILA 2G50A 3RX4A 3MO4A 3WF1A 3AIEA 2G3MA 5E5CA 3AALA 1I45A 1W1VA 2E4TA 4UUIA 3TOPA 2JGQA 1M1BA 4H41A 1W54A 2VD9A 2OO6A 2EG8A 3KBVA 4W84A 3WKZA 1IEWA 3I4KA 3LQGA 3SY5A 3WLTA 4URIA 1K8YA 5BXJA 2PWFA 1E3ZA 1ZCNA 1Q6HA 3JR2A 3GXDA 1E6SM 3OG3A 1FWSA 4JCMA 4GYPA 2WK2A 3HZ3A 1RPKA 3BLFA 2A4AA 2WHJA 1QHOA 5D33A 9XIAA 3SEPA 2F6UA 4DBSA 5HMFA 4QLKA 2G3FA 2V5JA 4AU0A 2AAMA 5BYWA 1YW1A 4LV4A 3FXYA 3BAWA 2DIEA 4J4NA 3BGAA 1A5LC 3HB9A 3M64A 1R2SA 3ALFA 5G4EA 2OZTA 1O7AA 4QLLA 4AEOA 2J7EA 4FXRA 5KTLA 1OC7A 3M4HA 1SZNA 1QWKA 3LTPA 3PHAA 4PUDA 1XRFA 3IJ8A 4PTVA 1PCKA 3WBYA 4MY9A 5A2AA 1X7FA 1DJWA 3DYMA 1XICA 2CEQA 1EQPA 1EQCA 1E43A 3EBVA 3L5MA 4K7VA 4IQEA 3PPGA 3C2FA 1TV5A 3R0KA 3SCUA 1US0A 4KS0A 3MA8A 4C1NB 2WW5A 4KEUA 3SGZA 4MNJA 1E0XA 4FIQA 1ZRQA 4UFHA 2F84A 1TIMA 3OA3A 1UR0A 1PKMA 3KCEA 3IVTA 3U7VA 5FF7A 1SZFA 2I9EA 4MSSA 3C2EA 3BG9A 3MP5A 1H3GA 5M1TA 3WFZA 2YX0A 2W66A 2ZDSA 4P8XA 2Z25A 1DOSA 2ZRWA 4MKVA 3URAA 3I10A 2PDYA 3QV7A 2HEJA 3H2FA 2YB1A 3KCJA 4XV0A 3GK0A 4UNIA 3MT1A 4MJ4A 3STEA 4J3XA 4XIMA 1S1PA 1UJQA 3GDMA 4NP7A 1JVNA 9RUBA 1V6TA 2PI6A 3AYVA 1C7SA 2ZUMA 2OMAA 1L6SA 1MXSA 3FW6A 2XP4A 1WCGA 1PWLA 2PWDA 3KOYA 4J4OA 3W87A 3QV9A 4PB5A 2XU2A 3N34A 2BY0A 5I24A 2A2IA 3PK7A 3A23A 4LYRA 4LS2A 2CKSA 2WCGA 5FAJA 1V7YA 4W88A 3BH4A 3AS3A 3E2VA 3CPGA 4V33A 4LAXA 1UKSA 2Q3OA 1NQKA 2V9DA 5HW8A 4KCUA 4YYFA 2HSAA 3VZZA 2O55A 2J6XA 4J7RA 5CSYA 2D0GA 5CC5A 1UR3M 2H3BA 5DMMA 4TVCA 1OVDA 1FH8A 5DCBA 3LCIA 3LCLA 1MRQA 3WBAA 1P48A 4ZENA 2TODA 1V77A 1EX1A 3GR7A 3VMPA 1QI5A 1XPGA 5CZKA 4REQA 5A8MA 3H9RB 1AODA 1JZ6A 4M5PA 1W9XA 5LA2A 4D6IA 1DWAM 3U3HA 2GK1B 1JULA 2A7PA 3D0CA 1EGVA 1U5VA 1S2UA 1MEIA 5EFFA 1PE1A 3U48A 2GDVA 5A69A 3CC1A 4AEFA 4RE2A 3PUGA 4PCNA 1H62A 1BYAA 1EJRC 3W37A 3S9IA 1CGWA 2XFWA 4L64A 2G4JA 2JFEX 3S9YA 3TTSA 2O56A 4QTGA 4IL2A 4L4LA 5FEXA 5CGQA 6CGTA 5JIPA 3MUCA 1QASA 1Z8AA 2NLYA 1V3LA 4GGQA 1PWMA 1DJQA 1D8CA 3FDKA 1EOKA 5LXEA 1TYGA 3BLOA 1CWYA 3TN6A 3UF8A 2WO5A 4Q6XA 3LN3A 1QUMA 2NX9A 4C7DA 2XTKA 2WJZA 3NXLA 4D6HA 1AW5A 2ZQ0A 2OFNA 2IF4A 1VFLA 2TRSA 3CZJA 3QY8A 4LV9A 1W5MA 1MUWA 5I23A 1I8JA 2H9AB 3VFLA 2RHGA 4O4VA 1TCOC 1XIMA 1FWDC 2INEA 2PTDA 1GOWA 5CZSA 1WZLA 2VYOA 3CAQA 3WBWA 4KWOA 3M7SA 1VEMA 1YXCA 5CJMA 3C0SA 3V3WA 4O18A 3VNKA 3Q58A 3W74A 1XC6A 4BWLA 3W1LA 1ZLPA 2EPKX 1Y0EA 3CQIA 3P93A 2BLEA 2GFTA 4GD0A 2EQDA 1AD1A 1N82A 1W3HA 3LMYA 3PZGA 3OPSA 2Z2AA 1SW0A 3SR7A 1UWUA 4PMDA 1OX4A 3KVKA 4TNSA 2IMRA 2XN1A 3BJSA 4YPJA 3T81A 1RJPA 3RM9A 2OWWA 3IKGA 6ALDA 2Q8LA 2PLJA 1FKDA 1I2RA 1Q66A 2POZA 4MUZA 4JNZA 1FDYA 1HL8A 3M0YA 2MLYA 3O5LA 3BWWA 2UY4A 5E6ZA 2CC0A 4LS0A 5D2XA 2P88A 4U4MA 5C9ZA 2PTZA 5I0DA 2Y7EA 1EZWA 3DC0A 5AC8A 3V5FA 5I06A 4A8RA 5A94A 1ZHAA 2BGNE 4LVDA 3KLLA 5A2CA 5C9WA 4RJEA 1EJ7L 1S5VA 2FVKA 1PSCA 1J18A 3OLIA 2L5HA 3U2ZA 4HZ8A 4ILSA 1W0MA 4U5IA 3UESA 1YTDA 2E5DA 4L9ZA 4Q7IA 1FKIA 3OZYA 2XIBA 1UZ4A 3EWZA 1JYVA 3QH2A 2J47A 2JKEA 1P7TA 1VIWA 5TD4A 3VAVA 2XPKA 4CUCA 1UWRA 2IKGA 3UQNA 1QPFA 4UTWA 4E0CA 3UJRA 3N14A 4W86A 1YYAA 4EWJA 2E5CA 1VPQA 3ARWA 3IKDA 1MW0A 1B5TA 3SURA 3CWOX 1V0LA 4WJXA 2ASHA 3QR1A 4HZ6A 1GZJA 1XV8A 4R27A 3C0JA 1ROUA 4ATWA 2VO5A 2WC3A 3NQAA 2Z26A 2LLEA 5F2LA 1KW1A 4XD6A 2P53A 3WMLA 2VQUA 5I00A 1W3NA 3G1RA 1GEQA 2IPGA 4DRMA 3VOGA 3UR7A 2FPVA 3S5SA 1JFXA 1F6PA 3G6MA 2AAAA 3PZ9A 4RKAA 3TYZA 3BLIA 1TPVA 4L6OA 3BLLA 3KL3A 4TX9A 4I9TA 1E4NA 2EG7A 4JHZA 3WUFA 5BOFA 4X2RA 1PDYA 4GNVA 1M7PA 5HWJA 1DXEA 4N0RA 4RX0A 4MWAD 2VD8A 1JL8A 2WJDA 4B92A 3T8QA 3FNDA 2ZFAA 3RMEA 3IRSA 3QRHA 2GWNA 4ATDA 2D22A 2ITKA 3BSMA 4WKFA 2REQB 5ABEA 4TTUA 1CB7B 1RP9A 5AZ0A 2E40A 1B9BA 3W7IA 1TCMA 3NSMA 4GBDA 4XB3A 4MB4A 2M2AA 1V0NA 1EC7A 3BV4A 2OB3A 3CAWA 4LUTB 2PCQA 4IPLA 5CJ5A 2XGBA 3BW3A 4WOQA 5A6MA 2DH3A 2OQYA 5KMYA 1M7XA 4H19A 4FLSA 4HZ7A 3AU6A 1KFKA 1DJXA 3VGGA 4EOUA 1LCOA 1J4EA 4JOMA 4D1IA 3VCCA 3ZJ8A 3KAGA 4EF8A 4XSMA 3CL6A 1UA3A 3N2TA 3FDGA 1OCQA 1JZ8A 1ADOA 3QOMA 3GXNA 3ZJ7A 4QCFA 1HJSA 4O0KA 2W9MA 3GU0A 1B3ZA 5J8LA 1Q8AA 4ZCWA 3H12A 3DFNA 5FSDC 3CZGA 3ABQA 3ARQA 2YL9A 3ARVA 1ECQA 3GM8A 1XH0A 3UWVA 3HA1A 1V4YA 3C3NA 3RFAA 2N87A 1B3YA 4A8IA 3WQOA 4DUOA 3V4BA 2QLYA 3P0XA 4DJFC 3EWWA 3GKFA 3PTMA 5REQA 5CAHA 1NMVA 5D2VA 3DFSA 1LLOA 4HGXA 2R1PA 3W76A 1H5YA 1TJ1A 2FAPA 1OADA 4AMCA 4L65A 3AMGA 2W4XA 5F7UA 4P2VA 3G1VA 2CWNA 1QO5A 1SYTA 2WHMA 3RO6A 3CLMA 7CGTA 3LHTA 1BGAA 4U2ZA 4XAKA 1KR0A 2XVKA 1W26A 4PTWA 1Z41A 2TYSA 4HPHA 1O6IA 1J12A 4LEQA 4XBKA 2DZSA 1C29A 2HCVA 2EBNA 2W6RA 3ANVA 1NEYA 5FJTA 4KFOA 4AWSA 1XJBA 3W6YA 1I2NA 4S23A 2AQOA 4CD5A 1VP5A 2GJXB 2FLIA 4ITZA 4CNNA 3OBEA 4LAOA 1TVLA 1UKPA 3W1NA 3OTRA 4DF1A 1ADDA 1JR1A 3G1DA 4IQLA 3MDYB 3O9NA 2QPXA 1I60A 3FJ6A 3HMJG 3TQPA 3UY7A 1CENA 1DJZA 1NF0A 2RDUA 1RQHA 1CXEA 3KDNA 3GRIA 3O6AA 3PJXA 1W8SA 1KTCA 3G8RA 1YQ2A 3EEZA 4YCOA 2PU1A 1R30A 2VKZG 1WOBA 4AZ6A 4FNRA 5CGTA 1POJA 4U2YA 3ZVHB 1N55A 1DHKA 2GYIA 1UHVA 3SAZA 1C8VA 5HR6A 1U33A 4FHAA 4L5ZA 4J28A 4OV4A 4E2DA 2VHLA 1TWDA 3UNDA 4DYJA 2DG3A 4F9JA 2WZTA 5E0FA 2G8ZA 1UD4A 1KFEA 3N9SA 4HA4A 2V5CA 1RA5A 3QN3A 1UQYA 4HVXA 2QULA 1EGZA 4GABA 3QTPA 4BEQA 5LIWX 2JF6A 4KESA 1PX4A 1MQRA 1QTWA 2FMNA 1PAMA 1EL3A 1RQEA 1G4SA 2J75A 3VKKA 3L67A 3H4GA 4IMDA 1NU5A 3JRKA 5DFAA 1PBGA 4PCPA 1JPKA 3N2MA 3EOSA 3LTYA 3P67A 3EDEA 3GU9A 4LXFA 3CIVA 1TPWA 2PP0A 3MU7A 1DWIM 1XR2A 5G4WA 2WQDA 5T9BG 4QR6A 1OGSA 4N9DA 2IKJA 5EY5A 3LPGA 3TP4A 3KVJA 3CXOA 2Q8ZA 4PRTA 1H5VA 3UJEA 4MFDA 1MEHA 4QS6A 4K2SA 2QJHA 2A21A 1H63A 5K9CA 4ACYA 3V7PA 2WVTA 4DI8A 4GI6A 4Q32A 4DZIA 2J7GA 3GW0A 1SJCA 3TJLA 5C54A 4L80A 3VIIA 3H2AA 4Y96A 2ZQVA 3U2CA 3TN4A 1UD8A 1D2KA 5AHMA 3KRZA 4GKTA 3WZ0E 1HL9A 2UV8G 5BCAA 1EF3A 3W7QA 1VAHA 3R8GA 4O8AA 5D8ZA 2Q5AA 3O06A 3VMNA 3THUA 5XIAA 1M41A 4ACZA 2DT1A 3T1GA 4D9PA 1E72M 3LPOA 2DVTA 3WL0A 5EU9A 3R8HA 2ISDA 3O5IA 3NO5A 1E51A 1SU5A 4K39A 4CEUC 3KRBA 4L4MA 1PO9A 4BA0A 2CHRA 1KD0A 3DGRA 1H61A 2EAWA 3WQCA 1GORA 1X6LA 4A2SA 1QI4A 4UFKA 3AQUA 3CGNA 3ZYZA 2QF7A 2PV3A 1YNYA 4C6IA 2D2JA 4QP0A 3L4ZA 2C79A 5AC5A 3B03A 4QE4A 2WSPA 3NSNA 1ZB5A 5HXMA 4QGCA 5F2GA 4GZ7A 1JCLA 1C7TA 3H4XA 2CZDA 2J7CA 1J0JA 4KGJA 5I07A 5I2UA 3OA5A 1WPCA 4LBRA 4LW7A 1F40A 4F0RA 1FP9A 3D6NA 4IG2A 1ZU8A 5F1UA 7REQB 3EAUA 3H2MA 1R3RA 5CLWA 1E6QM 1XXXA 4RE4A 3PJUA 2QV4A 3GTXA 4DY1A 4N9CA 1KRBC 2VDGA 3H6OA 3E3HA 4EANA 3GG7A 1MDLA 1P0NA 4PL2A 2PWUA 3BGJA 2H8ZA 3C8FA 1FP8A 2NT1A 3M5XA 5D75A 3EWCA 4M6VA 3L0KA 3PZIA 1KGWA 4W9TA 2OWCA 1R86A 4GI9A 3LOTA 4U3AA 4PB4A 4GZIA 2C8NA 4UFLA 1QNQA 3D3FA 3C2YA 3JW7A 2J62A 4K68A 1JNDA 4P7RA 3TQKA 1R3YA 5K2ZA 4KIEA 4JFLA 2VCDA 3NAVA 1IEQA 4GWEA 1L8NA 1OX6A 3BOLA 1H7NA 2GVYA 1UCWA 2YL6A 4PMOA 1LL6A 2HROA 1JVWA 2RQSA 4M80A 4S1FA 2YXOA 3FFSA 2Z1BA 4NJIA 1OK4A 2VN1A 1ZJIA 1A5NC 1J6PA 1W5NA 5DO8A 3POHA 3W85A 1FBAA 1SZEA 3W7RA 3MV01 4JKKA 3A5FA 3ICJA 4XVDA 1YDNA 2VI0A 4I3GA 3PRAA 1H09A 3KAFA 3F4CA 3TZNA 1P43A 4L1GA 4IOTA 1XGDA 1UD5A 4CD6A 4DBWA 4HMNA 1XYLA 2WC7A 3NURA 3PULA 4UDMA 1OFDA 1WXYA 3SDOA 2VC7A 4TW7A 2E6YA 3W1PA 1WDWA 3DUGA 3WY1A 1IIGA 4N7QA 4W5ZA 4WY0B 3UI5A 4V2XA 2WWCA 4QITA 1AJ0A 1UPMB 1B3WA 1W1YA 2JGYA 2NQ9A 3UZ5A 4H8NA 4S3AA 2ZR6A 4UCFA 3NGJA 3NGFA 4D6GA 2XP3A 2JIEA 3SN4A 4GFIA 1V0MA 3ANYA 3K13A 1ONEA 2PDQA 1Q5MA 4TOQA 2Y85A 4BY3A 5C9RA 3LBOA 4HJFA 2MNRA 3UETA 2V8ZA 4XUGA 3O5QA 4M7SA 4POCA 1M9HA 1TPDA 1TQXA 4NI3A 4HTBA 1BVWA 1GQJA 1XKYA 1ZENA 3W28A 4XD3A 3TFXA 4JKMA 4TVDA 1W9DM 3R12A 2WCAA 1IXPA 3IJIA 1A0EA 1VRXA 4BI5A 3TC3A 2J7DA 2O9PA 1K8CA 3KBSA 3S42A 4WHBA 2VM8A 2LPVA 1V3JA 1TJ2A 3N29A 5GNYA 3MYPA 3T07A 3AROA 2QMJA 4QNWA 2MF9A 1YDYA 5DCEA 1FKHA 4RDWA 1E6NA 2VJXA 4PSPA 2YKKA 1VGAA 5A6JA 4DYEA 4AFYA 3WL1A 3KP1A 3T2OA 3F4VA 2R1LA 1E1FA 4J4KA 1Q6EA 3RF9A 2OZ3A 3MCMA 3IIOA 3LLFA 2VUNA 4GCAA 2X41A 4KWUA 5C9XA 1Q2RA 5HULA 3CPRA 3OVGA 1UOKA 2PDCA 4ERIA 4XO7A 1H41A 2EJAA 1LF1A 4HPXA 1BXCA 5U7SA 4IL0A 1IEVA 1I2QA 5DF0A 4JTGA 3UG4A 4Z2GA 2ZC8A 1IR2A 1QVBA 3WLPA 1OWQA 2ABBA 2CHOA 5DN1A 4JQ1A 4UQDA 3MKKA 3P74A 1WDDA 2F23A 2G3JA 4W8LA 4J2PA 1H7WA 3TV8A 4XX6A 3W2UA 3G0SA 1EJWC 2QMKA 3P84A 4DQWA 1SJDA 4C5YA 2PUZA 3AIWA 5HPCA 3DZ1A 1AZ1A 2IKIA 3Q2DA 2RDWA 3AMKA 2OFJA 2G37A 4ZQPA 1SJAA 4ZR8A 3WUEA 2F9RA 3JYJA 1BGGA 3CM4A 4R7JA 3WQDA 4ODOA 2J24A 4CQAA 3QQ1A 5D2WA 4MSPA 4NZ3A 4UTIA 4DI9A 4AW7A 1ONRA 2WNNA 1GJWA 1UWIA 5KETA 2OLAA 3GR4A 3UFYA 2E68A 1KFJA 3M1ZA 3L4YA 3WD3A 1J6YA 1FX6A 1G4PA 1AG1O 4GY0A 2FFCA 2V68A 3A9BA 4NY2A 5XIMA 4GX8A 3WLOA 1M04A 4G1KA 4ZQNA 1E6RA 3SCPA 1BG9A 3W6LA 3GNRA 3ZT5A 2X7VA 2GWGA 3NVTA 5I7GA 4U10A 1K9DA 2QGHA 2XH2A 4E2VA 2WOQA 4RDYA 5LHEA 3W26A 1OYCA 3CEUA 4HQVA 3OB8A 1GVSA 5T9CE 2ZXBA 4IPIA 1DEDA 4ZFMA 1F3XA 1EXPA 3BAXA 5D9NA 3KWXA 4B5XA 4LB4A 4F79A 3WDPP 4I5RA 1J10A 4NHVA 3W0KA 4LC8A 3M9YA 4AB4A 5A8QA 3B3DA 4RLIA 4FX8A 3KWSA 5C2GA 1W17A 3MSGA 2A85A 1RY8A 1C91A 3VD3A 4RE0A 1BYCA 4GE8A 2Z6JA 1AJZA 1P5BA 4YNGA 4JY8A 1OF6A 3ZSTA 3V5OA 1CGUA 1EYWA 3GFZA 1UBSA 1V6XA 2ZQSA 3TSDA 3V0UA 1UR2A 1YMYA 2MNTA 4A6GA 1QOPA 4DBEA 1TTJA 3GR8A 1E55A 2OPJA 3GQYA 1F6KA 3RHGA 2CKRA 1RJRA 2PD9A 3OGSA 3AHZA 1PCWA 2QVHA 3A3HA 4QJ3B 3SJNA 1MWOA 2ZWYA 3BPWA 4M56A 4WXZA 1T8QA 3W2NA 1TX2A 1X6UA 1IEIA 2QUVA 3VD5A 3BVJA 4AIOA 1AVAA 2RJHA 3UGVA 4QT2A 4REQB 2OEMA 1XSKA 3WQGA 2BHYA 3WNKA 1I1WA 4IIGA 1A47A 1W2VA 5ABFA 3LS9A 3IGHX 3MTWA 3N6QA 4H01A 5BRPA 3PNZA 1CGYA 3W7PA 3GHUA 3WH6A 3U9IA 4F9DA 2PV1A 3CASA 1NFBA 3AIQA 1VPXA 2F6KA 2JBMA 3MP3A 2OKTA 2BHZA 3SQMA 3ES8A 5EPDA 1A80A 3H2OA 4JTLA 2R9RA 5BZAA 3BLEA 2B0MA 4PGLA 1SW7A 2FFIA 2VGFA 5I02A 3PPFA 2AOSA 2J27A 3G22A 3NJ3A 1WX0A 1XM3A 2CESA 4I5UA 1UMLA 3FX4A 4Y2WA 1VBUA 3DFOA 1OB0A 4AUBA 4Q4MA 1RK6A 3W00A 2CCRA 3WCZA 1J0KA 2PC8A 3EOEA 1XGZA 3KW3A 3VCNA 1VBHA 2B4GA 1W9UA 2WZEA 4ZQCA 3BCFA 3BG3A 3TKFA 4JS3A 1XLBA 2WHLA 3W70A 2L2SA 1VJZA 2PRLA 3QHMA 1C93A 1UW9A 2XSAA 4C6CA 1S2VA 4KRUA 3SCRA 1LDCA 4F2TA 5HWMA 2WVUA 3RJXA 1ITCA 5A6SA 4LANA 1PIFA 5TF0A 1DWHM 2HPIA 4XQ6A 4YIWA 2I56A 4DRNA 3GBDA 2HMCA 1OT2A 4C60A 2KE0A 1B9ZA 3BG5A 3W25A 4PMVA 1TTPA 5HWCA 4KEZA 4LRSA 3W3OA 4BF8A 3OYZA 1IWBA 3OOBA 1R3SA 1X38A 2ZADA 1ZAJA 3S3GA 1E44A 3P60A 3PPCA 2WQPA 4INFA 2CNCA 5LGXA 1QBBA 2HDJA 3GSMA 3TZFA 1JPIA 2IQ0A 3NQMA 2P4VA 3S1VA 3V18A 3FAWA 4WDUA 4DNHA 1OX4B 1GOQA 2JK2A 4Q8NA 3AICA 3LMZA 1E0TA 1GG0A 4QIUA 4IQJA 3CO4A 4UIOA 2X1TA 4ZQMA 4C5ZA 4MADA 2J8FA 4IF2A 4V27A 2CIPA 4RL3A 3CQ0A 4LAWA 3TUUA 3INPA 2P0OA 1G7VA 3D46A 3MDUA 4FK9A 3E0LA 3NCOA 3W7MA 3IGSA 3MPGA 2R1KA 1DL3A 4J3UA 2V2HA 3O8AA 1XFBA 3IJ7A 3IGUA 1JPHA 3CK5A 2V30A 2WZIA 2D2GA 4PMUA 1VR6A 5HPOA 1I9CB 1VFMA 3VI2A 3A4AA 1HGWA 2OZ0A 2FTYA 1J2BA 2ZOXA 3NQ8A 3DHPA 1XKJA 1MW1A 2EULA 3CV6A 3GYEA 3P2VA 3LY0A 2UWFA 1E71M 1HX0A 1XCWA 2XP5A 1P7TB 1AQMA 1W1B1 2CERA 1TMLA 4MAZA 1G94A 2IUZA 3S5OA 1QPKA 1UASA 2QCHA 4PMZA 1SFSA 2F8QA 1PJ9A 4NI8A 2WV8A 3TYCA 2M08A 4WEVX 1CXFA 2E3ZA 1GUVA 4D8LA 3GFYA 2RUDA 3W7CA 4H7ZA 4QG8A 5E6YA 3EWBX 1H2JA 3CU2A 2I14A 4D6CA 4N02A 1OHLA 1VD6A 5CPOA 3CB3A 3LSBA 3VNLA 3VDBA 4LFYA 3RCYA 4CU8A 1XP3A 2QF8A 4IJCA 3V36A 1KM0A 3UA4A 4GC3A 1DXFA 1YATA 1H1YA 3GIPA 5BRBA 3FN9A 1KFLA 2WBKA 1GTEA 3WQFA 2X0SA 4IGMA 3L9CA 3IAQA 1Q63A 2P50A 1H50A 2F6XA 4CD4A 3QR3A 4H9UA 2NW0A 5C0QA 4MWAE 2UY2A 2PDLA 3GDBA 1ECEA 2QJJA 1I0DA 1UC4A 3KL5A 1MYRA 3NEHA 4DUWA 3DG7A 2JZVA 4JDYA 3NQEA 2VCBA 2GQAA 1OK6A 2XIOA 1RLCL 1RBAA 4X9SA 3SCWA 4P61A 1YTEA 4DJEA 4ICNA 3I6CA 3VIHA 4S2CA 2E8ZA 1AMYA 1J4IA 3MANA 3KZPA 3CWNA 3BOFA 4O19A 1K9FA 4FOJA 4J1OA 2KI3A 4MNMA 1OG0A 1K