2YBTA

Crystal structure of human acidic chitinase in complex with bisdionin c
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
377
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ACIDIC MAMMALIAN CHITINASE
total genus 126
structure length 377
sequence length 377
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybtA01
2X0YA 4WSJA 1QOXA 1FFQA 4NSBA 3DYMA 3NSXA 4ZE4A 1H41A 1JZ6A 4J27A 1ZS2A 2WLYA 2WHKA 3WMSA 2DSWA 1R87A 3N17A 2YL6A 4W84A 4A3YA 1TA3A 2ZX6A 3N9KA 1EXPA 3VGHA 2G3JA 2YLLA 1MW1A 1V08A 1E6PA 3U5YA 5I23A 4HP5A 2CBJA 1ZBKA 5A3HA 4M56A 2PB1A 5A2CA 3WQWA 3PZUA 2XWEA 3AIQA 3AOFA 1O6IA 3N13A 4KGJA 3BCFA 1CLVA 1PIGA 2XGIA 1QNSA 3ZM8A 4UQAA 1E4LA 4JFTA 2WPGA 3OZPA 1DTUA 4TX6A 4PBGA 1VF8A 5A1AA 4S3JA 3ZMRA 2EQDA 1BF2A 2CKRA 2J25A 2YDRA 2WMFA 3ARYA 1KGUA 4HMCA 1JYXA 4RE2A 5I24A 1CGVA 4GO8A 2V5DA 2XSAA 1OD0A 3PTKA 2OWCA 4PUEA 1GNXA 4KRTA 2RGMA 2DH3A 3BMVA 4MNKA 1GPFA 3T0DA 3WDIA 1KR0A 1QVBA 4NRRA 1JD7A 4UQBA 1ISZA 3PZIA 5E0CA 2V3DA 3GXIA 1E0VA 4GZIA 1R8LA 1LWJA 4UNIA 4B15A 5A95A 3FXYA 4TOQA 5ABFB 5A6MA 1HJUA 4OZOA 1XCWA 4DUXA 2WBKA 2Z1SA 3MO4A 2VNCA 4F79A 1RH9A 4JKLA 4X9YA 4FLOA 4NF7A 4XB3A 3WQ4A 4WJXA 2J7EA 3PZMA 2FH8A 2VO5A 2WHJA 1AQHA 3SIMA 1E3XA 1QHPA 4FLQA 3TTOA 4JL1A 2W66A 1LQ0A 4ZXOA 1SYTA 4HZ6A 2ZUTA 3MS8A 2XVKA 2D1ZA 2DIEA 2JF7A 4IUGA 4AXNA 1W3HA 3SCPA 5FKYA 1L8NA 3NUKA 3BXWA 3AIBA 4B16A 4LQ1A 4AD0A 2WMKA 5CPTA 1CBGA 4JCMA 2G4FA 1IZKA 1V3JA 2TAAA 1JAKA 1JFHA 1C3FA 5A69A 2WVUA 1GQLA 1HJXA 1ISVA 1V6VA 3UERA 3EBVA 1QNPA 3SUVA 1C91A 1E0XA 4JAWA 1GUVA 2D22A 3POCA 2DT1A 2YBUA 4J3XA 3WUGA 4NI3A 3N1AA 3UR8A 3WL0A 4DWSD 1MFVA 4IPNB 3WF0A 2C0HA 1W9BM 2GK1B 5DO8A 1U2YA 2MANA 4JHOA 2FDMA 2VZTA 1WO2A 3L4YA 9CGTA 3RJYA 5I78A 5D8WA 3SUSA 3DECA 3MSGA 4XV0A 4H41A 3VGDA 4DUVA 1XH0A 1UKPA 2JIEA 4N0RA 4P8XA 3AIWA 2J7DA 3CUFA 5A6KA 2DSZA 2J7FA 4TTGA 3WH7A 4PYSA 5JUVA 5A8QA 4MAZA 3MKKA 4GQQA 3TP4A 3CIVA 1VFMA 3GNRA 5JIWA 2C7FA 2BFGA 3VD9A 2UY3A 5ECUA 4D6GA 5DMYA 3L4VA 3MUAA 5I2UA 1X6NA 2W63A 1HF6A 1Q6EA 1WZLA 4XZBA 1E0WA 2NT1A 1KBBA 3WD1A 4AZCA 1EIBA 3SUUA 1ZB5A 3VDCA 1EDTA 4F9DA 1UD3A 5IFTA 5E6ZA 4C7FA 3HJEA 1NP0A 3PN8A 4MB3A 3ZSTA 3WL1A 4TUFA 4ATLA 4C7GA 3L4XA 2VVNA 4YPJA 1LF1A 1V6UA 2E9LA 2E40A 4CD4A 3MMDA 1HKJA 4R5EA 4GZJA 2VTFA 4AWEA 2VZVA 3PTQA 3TTQA 1J0ZA 3N18A 4BA0A 2VQUA 2FGZA 2VR5A 1EA9C 3IJ7A 4HA1A 1KGWA 2CXGA 1VBRA 3CUHA 3VGGA 1KQYA 5BXTA 1OGSA 2WMJA 1BFNA 4GI6A 3M7SA 1C8XA 2W62A 1FP8A 4PTXA 3TONA 1PZ3A 1UR0A 1UR4A 1WDSA 1CPUA 3M46A 4AD2A 1E71M 4RE3A 1QW8A 1W1VA 3WH9A 4OOZA 5E9AA 1GORA 3KE0A 4CU8A 2WMGA 3GH5A 1V0NA 2VC9A 3EMZA 3BCDA 2VX6A 4XUYA 1VRXA 2F61A 2DIJA 1BTCA 4UQ9A 2X1IA 4W88A 2VOTA 4MAVA 1V0KA 2QV4A 3J7HA 3AICA 3CMGA 2CIPA 2VL4A 1V6YA 4UR9A 3OA5A 1EH9A 3VX1A 2WCAA 2J47A 2DPEA 5I3DA 3GNOA 4B3LA 3RO8A 1TVNA 2VCBA 1JI2A 4MNLA 4J7RA 4U5IA 1RD6A 1HXJA 3UETA 3ZQ9A 2CCRA 3VMNA 4MTVA 1L0PA 3ZT6A 5BCAA 2WC3A 3EDKA 1WDRA 1UR1A 1KWGA 3BGAA 4HZ7A 1E70M 4MB4A 1NWTA 5A8OA 3VINA 4B3KA 1DWIM 1WP6A 2BY3A 2WZHA 2AOSA 2RGLA 1W1YA 1QI0A 1UA3A 1FOBA 1JZ2A 1VFFA 1GHSA 1M04A 3AS0A 4UFMA 5IFPA 3OGSA 4UOQA 4LXFA 4WIWA 2G3NA 3HU7A 3PZQA 4EKJA 5KZ6A 5CLWA 1JYNA 3RDKA 4OBSA 3VIHA 7CGTA 3SUTA 1ODUA 2WMHA 5E0FA 1JDDA 4LGXA 1GJWA 1MXGA 4W8BA 1Z32X 4U33A 3VD3A 1OWQA 3W27A 4AIOA 1B30A 1JYWA 1UZ1A 4OIFA 5FIPA 3ZR6A 3WEMA 4U3CA 3KL3A 3GXMA 1BYAA 2GVYA 4E2OA 1UR9A 3NCOA 3SCRA 4CGTA 3AHXA 1UYQA 3RJXA 3SCOA 5A6SA 2GJXA 1JXJA 5E09A 1JXKA 4LYRA 1G0CA 1E6QM 1LG1A 1QHOA 4PTWA 1PZ2A 4UQEA 2JIWA 3VGFA 1WZMA 4J3UA 2EJ1A 3AIVA 1O7AA 4CN1A 2E9MA 3I3BA 4D6CA 1UD4A 2G8ZA 3OIHA 4CD7A 3CZKA 4F9JA 1XHGA 3WD0A 2BXZA 2NSXA 4M29A 1C7SA 5DT5A 7TAAA 1MW0A 2PWDA 3PHAA 1QHZA 1B0IA 4W7WA 4AMCA 2YL9A 5A6JA 4JKKA 4QLKA 2VZOA 4AY1A 4P7QA 1X6LA 5GQBA 1VJZA 3UEQA 2ZUUA 1E4MM 2E4TA 4QCEA 4UZSA 3IANA 1GOQA 2PBGA 4DWSB 4PCTA 2JE8A 3AS2A 3B9EA 4U5KA 3W24A 3TA9A 4D6FA 3L2LA 4MB5A 4PMYA 3QOMA 2VRKA 4TX8A 5EMYA 3K4AA 4WKFA 2XFRA 1DP0A 3OGVA 5CPSA 2YL8A 4H04A 3D3AA 1KFWA 2W5FA 2YJQA 3ZJKA 3N11A 4PTMA 3ALGA 4ZENA 1CXKA 1X1NA 3ARUA 5HBFA 4AISA 8A3HA 2ZWYA 5AC4A 3VIOA 3QOKA 3MV11 1HP5A 2QPSA 2Y8KA 3BH4A 3VIPA 1VEMA 4FLSA 1W3LA 4MNMA 2OSXA 4A3HA 1B3XA 2X8RA 4MADA 1CIUA 2WWCA 2J7BA 3FNDA 3PZ9A 4EE9A 1M01A 1UWTA 3WEOA 4NRSA 1JL8A 2OWXA 1OGGA 1W9PA 4L4OA 3ECQA 5EB8A 2A3AA 4HTYA 3EDJA 4E4PA 2ZUWA 4Z2IA 2NT0A 2E8ZA 3WNOA 4AZ6A 2W92A 1OIMA 1Q6GA 3VIGA 5I77A 1KXVA 4CVWA 3EMQA 3CZJA 3PZGA 4W85A 1D2KA 1V02A 1CXHA 4CD8A 1BYDA 3MSDA 4D1IA 3LPOA 3CUJA 1BSIA 2WSKA 3MMUA 4FMVA 4E8DA 5GNXA 3OG2A 1SFSA 3VOCA 3W26A 2JALA 1TE1A 5EFDA 1BLIA 2WVTA 5CLTA 4D1JA 1UOKA 4UZUA 4HPGA 1DHKA 3MU7A 2XPKA 1MW3A 1EDQA 2QMKA 2ZUMA 1CXLA 1S46A 1GOMA 4PMVA 4UFIA 3S2CA 3W6MA 1EQPA 4TVDA 1UA7A 4CCEA 3AFBA 3TTSA 2V3GA 3SCSA 3RM9A 1KCLA 4FK9A 2DH2A 4W7UA 1PJ9A 1UZ4A 2ZXBA 1GQKA 1G5AA 1HKIA 1HJVA 4DUWA 2F8QA 4AD3A 1HKKA 1GZJA 1B90A 3BC9A 1TFVA 4CN4A 2WXDM 2JEQA 5BROA 3AISA 1R7AA 4AZCB 1VBUA 5IHSA 5A6BD 3WF3A 4PMQA 2YBTA 2VX7A 5JBDA 2WYSA 2OLHA 3ALFA 3ARQA 1QW9A 2WHMA 5ABHA 3WIJA 1E72M 3DYOA 1UKQA 4U3AA 2XIIA 4HPHA 1LL6A 4PTVA 3GZAA 3E1F1 3GYCA 1G01A 4OBRA 1JDAA 4QFUA 3MUY1 1US2A 2VZUA 1CECA 2J75A 1NM9A 3II1A 3WDPP 2VURA 3O6AA 1AQMA 5BXPA 3ZT7A 3VIJA 2DSUA 4Z2KA 3KEHA 3F5LA 1DWHM 1XH1A 3OLGA 3AXHA 3OB8A 5DF0A 1C8YA 1NP2A 2W61A 5F7UA 1OM0A 4AD5A 3B9DA 3EYPA 2ZX8A 3WDQA 3WEZA 1HJWA 2CBIA 4GQRA 1H1NA 1PBGA 1CXFA 1G9HA 2CEQA 1C7TA 1BVNP 4BS0A 1V0LA 4UQDA 1XSKA 4YN5A 5CPQA 1WB0A 2X2YA 3IK2A 4F66A 1H2JA 3GDBA 1JI1A 1I1WA 3KL0A 2V5CA 1KQZA 1UWIA 2VRQA 3AHVA 4HA3A 2EPOA 5CJ5A 4KGLA 5HNNA 3CUGA 1V3LA 5AY7A 3TTYA 3MV01 1GCYA 3RCNA 1J0IA 1UQZA 5CG0A 4ZFMA 1D7FA 2YOCA 3EDDA 1ZBCA 3QR3A 4HOXA 1K9TA 1K6AA 3POHA 3CHCA 4HMEA 4UOZA 2WWDA 2CESA 3PZOA 1W3JA 1MXDA 4QCFA 4D6HA 2G3IA 2QHAA 3SCNA 2J78A 1J0YA 4Q22A 1EOKA 1E1EA 4P7LA 5I0DA 3BLKA 1KXQA 1MFUA 3VKKA 2ZE0A 3U7BA 1IT0A 3LPPA 4HU0A 4AZHA 1CTNA 2BY2A 3GH7A 4AEFA 2XYLA 1UG6A 3PZTA 1E6XM 3B9AA 5E70A 5JIPA 2O92A 2ZUNA 3AS1A 2BNJA 2IXUA 3VNYA 1TZ7A 2VUYA 1MWOA 2XTKA 1TUXA 3I3EA 4P7OA 3SCQA 4MB1A 3VIFA 3BSHA 3AIUA 2CKSA 2V38A 1XYZA 5ABGA 2XJ7A 3ARWA 3K46A 2W67A 3U7VA 2XVLA 1UKTA 1DWJM 3AQUA 3FAXA 2XIBA 1B3VA 4GZEA 1H0GA 3PZNA 3WUBA 3WD4A 1WDPA 4JFWA 1EHNA 3UCQA 5DFAA 1CDGA 1EQCA 1DWFM 2EPLX 2CERA 1OINA 1E6NA 2GK1A 3BLPX 3BAYA 1VFOA 1B31A 1UWSA 3WDRA 1PEZA 3WF4A 1CYGA 1EDGA 3CO4A 2J77A 1Q6CA 1DWAM 5BWFA 1B2YA 2QMJA 6A3HA 2VRJA 1CWYA 4LPCA 2X0HA 2VI0A 1NWRA 2DT0A 4GO9A 2JEPA 1G1YA 1R86A 2YA1A 3WBEA 3W37A 3AS3A 3A4WA 2XFYA 4ACZA 2Y24A 3AYRA 1W9UA 1VJSA 2X09A 1Q6FA 1TA3B 3T2OA 2EPKX 2D3NA 5KEZA 1BQCA 2PWHA 5TD4A 2A3EA 4CN6A 2VCAA 1XRVA 4MDPA 4GINA 4B9ZA 1XC6A 2G3MA 3CHEA 4ACZB 1VIWA 1JZ3A 4H8UA 4D6IA 3VTRA 4H8VA 1IV8A 4BQ3A 2ZICA 4JZ5A 4CVUA 2YLAA 3F5JA 3WQ8A 2EO7A 1QBAA 2E0PA 1E56A 1XV8A 1GOIA 4Y7EA 1NH6A 2NW0A 5DEZA 3CTTA 3K1DA 1FH9A 1VAHA 2DEPA 2WCSA 4V27A 1HVQA 3WY1A 2D24A 1J9YA 4J28A 4AIUA 3WNKA 2CETA 4BQ4A 5ABFA 3BAJA 5HPCA 4F8XA 5M03A 1HX0A 1UR8A 4AZGA 1TCMA 4P7NA 3MUIA 4EK7A 4IISA 3O2LA 3CZEA 4KRUA 1Y7VA 3CHFA 1P6WA 1IZJA 2O9TA 4AZ7A 2DQXA 1LG2A 5BRQA 1HN1A 4PMZA 2VX5A 4QP0A 5LA1A 1NOWA 3WF1A 1MYRA 2YA0A 5JH8A 4W86A 1HJSA 4AD1A 2X05A 3IJ8A 1ZBWA 2XM1A 3ARTA 2DSVA 1OD8A 2BHZA 3W53A 5A8NA 4M8UA 1HKMA 1SMDA 1MQQA 1NOUA 1GONA 2WMIA 2HISA 3T0AA 4M1RA 2D0HA 2D0FA 4ML4A 1KBKA 3WMCA 1J0HA 4EANA 1JG9A 1H49A 2AAAA 3OZOA 4PMRA 5A8MA 4M24A 3BAIA 2CYGA 1W2PA 3AHZA 2VVSA 2D3LA 3BAWA 1E73M 4W8AA 3W28A 4ACYA 1FH8A 1HJQA 2E8YA 2GSJA 2DDXA 3L4UA 5GPRA 4PMNA 4HZ8A 4QLLA 3WH8A 4J3TA 1BG4A 2WB5A 2VJXA 3SEPA 3WNLA 1PX8A 5M5DA 3T08A 3GH4A 2QPUA 1XSIA 1ZBVA 2Y2WA 2CNCA 3QHNA 2W91A 2ZUSA 2CITA 3MUZ1 2WANA 1HIZA 1ITXA 4GI9A 3ZJ7A 4JHZA 3IAQA 1UH4A 1ODZA 1E5JA 2GDVA 2O9PA 1JYVA 1UH3A 4LYQA 1W9XA 2CBVA 4CKQA 4CUCA 4MNJA 5ABEA 2J79A 1NQ6A 1MQPA 3CMJA 2VCCA 1RP8A 1FHLA 4RE4A 4FF5A 3VGEA 2GFTA 1BYBA 3OBAA 1JZ8A 3VO0A 2ESCA 1TG7A 3VDHA 4WLCA 2E3ZA 4DWSC 1FH7A 2O9OA 3WKZA 4E8CA 1UR2A 3GXFA 1MW2A 1NOFA 4PMUA 1J10A 1EO7A 1W9DM 4CCDA 1AQ0A 1H3GA 3SCVA 1OGBA 1JZ5A 4QAWA 2PI6A 3NDYA 4UTFA 1KWKA 3WUEA 1V6WA 1QNRA 3K8LA 3VDBA 4JCLA 3WUFA 3DHPA 3SCUA 3WMBA 1KXTA 2D2OA 1BGGA 1UKSA 3LPGA 1KGXA 3G6MA 2EPNA 3AI0A 4Q7NA 1RP9A 2GJPA 3N15A 2VMFA 2BS9A 4UFJA 3ZJ8A 1VB9A 4GKLA 1Q4NX 3F5KA 3OLEA 4PEEA 3EMCA 4U2YA 2WZIA 2V3EA 3CZGA 1QI3A 4H7VA 1CLXA 1FFRA 4KMQA 3U57A 2JFEX 4D72A 1J01A 5D9NA 5AYBA 3VM5A 1TVPA 2PWFA 1XYFA 4W7VA 1JF5A 5FOOA 1V3MA 3UESA 3SCTA 1PX3A 3VVGA 5D9OA 1EGZA 5GNYA 3FY1A 3NSNA 3ARPA 8CGTA 1ZL1A 1OB0A 4V2XA 3W6LA 4P8VA 3AHYA 2FH6A 1ISWA 3DYPA 5IDIA 3BSGA 4QDMA 1K9DA 1JIBA 3CLWA 1GHRA 3WDJA 2FHCA 4JIEA 5HDRA 3QHOA 1QNOA 1XD0A 4AIEA 3AJ7A 4URIA 2ZX9A 5FL1A 1QNQA 4OUEA 3L4WA 4PCSA 4XZWA 4DM2A 4WKAA 5M17A 2V3FA 4AD4A 1GQIA 5FD0A 1CGUA 2BHYA 3AIRA 2EBNA 2YKKA 1W1PA 4UCFA 4L4PA 1CNVA 3MMWA 4A4AA 2ZUVA 5BXRA 4J3WA 5I79A 4AZBA 2IUZA 1GOWA 3AZTA 5GNZA 1PPIA 3NYDA 5A2BA 3GBEA 1ZJBA 4PUDA 1VENA 3VD4A 1VEOA 1ZJAA 2CBUA 1GW1A 3OLIA 2VZSA 2BVDA 1JF6A 3DHUA 3W82A 2WW5A 1UD8A 1M03A 4GXPA 4MDOA 3ZJ6A 2FGLA 2OSWA 1JZ7A 2J62A 4AYSA 4UQCA 1K9FA 3GXDA 4HMDA 1W32A 4AW7A 4PMOA 3VGBA 2XVGA 3VUPA 2ZX5A 5C71A 4TVUA 2C8NA 3A6OA 3ZIZA 2A3HA 3T0BA 3VM7A 2BY1A 2FHBA 1WDQA 3W4RA 1R85A 3PBGA 5CSUA 4BZYA 2WM0A 3CZLA 1R7OA 5FCZA 3K8MA 1OT2A 4W89A 5CQ1A 2Y5EA 3FHQA 4TVCA 1UWUA 2PWEA 1OSEA 2PWGA 4HOZA 1J0KA 1W3KA 4H8HA 1TMQA 1US3A 3W25A 4DWSA 1NWSA 1WAWA 4PSPA 4CU7A 3UR7A 1ISXA 1CEOA 1CENA 2W4XA 4ZXLA 3F4VA 1FA2A 1WE5A 3THCA 2DT2A 2UWFA 4NZCA 7A3HA 2DSKA 3CHDA 5I5RA 4U31A 1H09A 4W87A 2D23A 3QHMA 3K8KA 1H11A 3WH6A 1RPKA 3O9NA 2XHYA 1E40A 4WSKA 2EPMX 5FL0A 5AC5A 3MANA 4IM4A 2WVVB 5A6BA 3BAXA 2OYLA 2A3CA 1NARA 1GJUA 5A6LA 3SURA 4AC1X 4CU6A 2BVTA 2EEXA 4ZEPA 3T2PA 4IPLA 1BHGA 1LLOA 3U5UA 3WSUA 5EBAA 4JFSA 5HOSA 1H0IA 4X0NA 4MJ2A 3IJ9A 1Q6DA 4DM1A 2J74A 5D9PA 2J7GA 1KR1A 4KWUA 3B8SA 1JZ4A 1A47A 1UD6A 3VD5A 3WDHA 3GM8A 4P7RA 1EO5A 5JBEA 5BXSA 4FLRA 1UWQA 2B31A 3CBWA 1CGXA 4YHEA 3T09A 1BVZA 3AIEA 5D8ZA 3WF2A 3G6LA 1UD2A 4JFVA 3CZ8A 1PIFA 2BXYA 1XSJA 1W1TA 1E6RA 2XG9A 2J7HA 4S3KA 2BVYA 2AMGA 1NWUA 1V3KA 4ATWA 2E9BA 1XD1A 1JNDA 3ZOAA 5HXMA 3ZO9A 2WC7A 4XX6A 3AZRA 3AHTA 5CZKA 3NIYA 3WFZA 2GUYA 1GVYA 3AMGA 1LJYA 4PMDA 4P8UA 1CZ1A 2BY0A 3WD3A 4K68A 4PN2A 1MQRA 1V03A 5EFFA 1CGTA 1OBAA 3VIMA 2YDQA 4W5ZA 1C90A 3RPMA 2G41A 5CGTA 3VU2A 3N04A 1JGIA 4JKMA 3SCWA 4Z2HA 2IXVA 1I1XA 4GIAA 5C8BB 4V28A 3L4TA 3BMWA 3UG4A 1UHVA 2WHLA 3VIIA 2VQTA 2F2HA 4M81A 5A2AA 3W29A 5BYWA 2PF0A 4Z2JA 1C92A 1W91A 3K4DA 3WD2A 1PAMA 4HU8A 5D9MA 2YL5A 3ARRA 5D4YA 1OCQA 4PSRA 1HL9A 4R27A 3BAKA 3L2MA 4GI8A 3D5HA 3LPFA 2ZXAA 1E9LA 1J18A 3GNPA 6TAAA 3RM4A 3CH9A 1BAGA 1A3HA 3W0KA 1B9ZA 3FHAA 2D0GA 1JD9A 5M3WA 3ZSSA 1XCXA 1E1FA 2XFFA 1LL7A 1GVIA 2VR4A 1UUQA 2WKGA 2YA2A 2Y4SA 2GJXB 4KH2A 1E4IA 4Z2LA 3FAWA 2UY5A 2QF8A 2PBOA 1XGZA 3L4ZA 5BRPA 3A47A 1J11A 1UQYA 3WNMA 2XSBA 1HL8A 4TXEA 3WNNA 5CSYA 2WCGA 1C8QA 2GDUA 3WFLA 4BQ2A 2WLZA 3AYSA 1QI2A 1E6SM 4GPNA 4OKDA 1WKYA 3RIKA 1JNEA 3M07A 3TOPA 3WQVA 2XVNA 4J3VA 1E43A 4P8WA 5LYRA 1EHAA 3UG3A 1PX4A 3WN6A 2HVMA 3THDA 4D6JA 1OIFA 1F4HA 1V3HA 1VEPA 4OJYA 3T2QA 1U30A 1YQ2A 1JAEA 3ARSA 1B3YA 1SR0A 4U2ZA 1F4AA 2O9RA 4D71A 4CCCA 6CGTA 1E4NA 1WPCA 3A3HA 2DGAA 2WAGA 2OSYA 2XVPA 4UFHA 5HPOA 2ZOXA 1D3CA 1B3WA 1WNOA 3RMEA 1ESWA 1ISYA 3PTMA 3UG5A 1MVYA 3WENA 1CGYA 1UH2A 2J4GA 3NDZA 1E3ZA 3ARXA 4WK9A 1HNYA 3IAPA 2CPUA 1U33A 1QI5A 5CGMA 4UFKA 3WQ5A 4D6EA 2A3BA 3VPLA 3VMPA 2WKLA 4AEEA 1DEDA 3AMLA 3W38A 2OYKA 1C93A 3S6TA 3VX0A 3VMOA 3PZVA 1OT1A 4M82A 1XH2A 3NJ3A 2UY2A 3ZT5A 2XM2A 1ECEA 4WF7A 1K9EA 2PC8A 4JL2A 5A6AA 1FHDA 1J12A 2CHNA 4W5UA 1UKOA 4WKHA 4CD5A 1V3IA 2QLYA 1H4PA 3CPUA 1WCGA 1SMAA 4CD6A 3VIKA 2XGBA 1VFUA 1V0MA 1I75A 2VX4A 5DT7A 2WNWA 1JFXA 1JDCA 4Z2GA 4BF7A 1M53A 5AYIA 4OOUA 1E5NA 1UD5A 5CXPA 1AVAA 3A4AA 4JFUA 3OLDA 4LX4A 5IXEA 2GJRA 1E15A 2JF6A 2WC4A 5E6YA 4RL3A 2YIHA 1BG9A 3AMKA 2ZXDA 3KZSA 1M7XA 1FP9A 2ZX7A 2VT0A 1W2VA 3AROA 2UY4A 1BYCA 1ZU8A 1V02E 2ZWZA 2WZEA 2WVSA 1KXHA 4ATDA 1N82A 5I6SA 3VILA 4HOWA 4N42A 3AMCA 3VNZA 4HA4A 1CGWA 3ARVA 1G94A 2DT3A 3GBDA 1QI4A 1ITCA 1V6XA 3VD7A 2ZXQA 1BPLB 2OWWA 3FN9A 2Z1KA 5C70A 1W9VA 1AMYA 3DC0A 3KWXA 2Y8VA 3ZR5A 3CUIA 1CXEA 3A4XA 3FW6A 2WBGA 3WH5A 4J3SA 5LA2A 4C7DA 4TTUA 3APGA 1EOMA 1BGAA 2EXOA 2J7CA 2ZIDA 3WQ6A 1HVXA 3KL5A 1E6ZA 3WELA 3JUGA 4AZ5A 4UOJA 2XUCA 2YDSA 2WK2A 3EDEA 4EAMA 3AXIA 3OGRA 4W8LA 1KCKA 4H2CA 3W81A 2XWDA 4W93A 1WZKA 2WMIB 3EDFA 2D20A 4PRWA 4M80A 2OYMA 3WNPA 1TR1A 3WBAA 4D6DA 2J8FA 3NSMA 2BHUA 3I3DA 1GQJA 3QGVA 1B1YA 1GOOA 4PMXA 1CXIA 3ARZA 3GTNA 3HN3A 3RILA 3M6DA 2Q8XA 3HMCA 4X0VA 5LA0A 1DWGM 1H5VA 4LYPA 1B3ZA 1QBBA 1LL4A 3LMYA 1WZAA 3AZSA 4B9YA 1UWRA 1E55A 5IHRA 4AZIA 4QLJA 1J0JA 4BQ5A 1KB3A 1LWHA 4BCEA 4YHGA 4MJ4A 2J8GA 2BV9A 2CHOA 5A94A 5JBFA 3SUWA 3AMDA 5A8PA 1HP4A 4UFLA 4ZE5A 2WVVA 3RM8A 1GOKA 1QPKA 2FHFA 1YHTA 3CGTA 3N12A 3VDAA 4MPKA 2WSPA 1HT6A 3AXXA
chains in the Genus database with same CATH superfamily
2PUZA 1QOXA 3NL6A 4NSBA 4H1ZA 3HM7A 3LNPA 2WHKA 1W5OA 4WR3A 3W71A 4GNVA 3O63A 3S2NA 4W84A 4A3YA 5GVJA 1TA3A 3IK4A 1W26A 3C0LA 1HW6A 1V08A 4QJ5B 4GE8A 4UNLA 1Q2RA 2CBJA 4I9MA 2Q09A 4U84A 3IV3A 3W1UA 3RU8X 2OGYA 3PZUA 1G67A 3AOFA 2P10A 1O6IA 4UMAA 1QNSA 2ZQTA 1AH0A 1BQGA 4JFTA 2WPGA 1MNSA 3UT0A 2DZTA 3H2FA 4BHYA 5A1AA 3XIMA 3ZMRA 4JTRA 1EEXA 1PZ0A 1BF2A 2E25A 2CKRA 3KAOA 2YDRA 2WMFA 3EEZA 1CGVA 2GVJA 3W1QA 2XSAA 3TAOA 2Z27A 3LBMA 4MGVA 2OWCA 3B0UX 3IRDA 2FIQA 4PUEA 1GNXA 1YLVA 3BURA 1V79A 2ZRYA 2DH3A 4MNKA 2HE8A 4C1NB 3W74A 1KR0A 1QVBA 3LGEA 3BSMA 4UQBA 3STEA 5E0CA 2DW7A 3S83A 4GZIA 1LRNA 3CM4A 4I9AA 4UNIA 1Y65A 3QM3A 5XIAA 4H9ZA 4TOQA 4H9TA 1P0BA 1I60A 5A6MA 4PEKA 1XCWA 2OEJA 3VOJA 2WBKA 2CLOA 3UJEA 2VWTA 2H6RA 2OO6A 3T1GA 3WQ4A 4WJXA 4DLMA 2J7EA 4DZIA 5G2IA 2VO5A 4PTDA 3EWYA 2DY3A 3ZR4A 1L9WA 1LUCB 1QHPA 2BODX 1EBHA 1LQ0A 2M1IA 3ATZA 4HZ6A 3P82A 1XCFA 1EC8A 1X6UA 1IWPA 2DV0A 4IPPA 4NILA 1W3HA 4PCNA 5FKYA 1ZAHA 3BXWA 3AIBA 3AYTA 2ITKA 1BRLA 3BANA 4B16A 3O7UA 4F0KA 2EHHA 3SGZA 5DIUA 2TAAA 1JAKA 1PSCA 3Q94A 1LOLA 1TMHA 4XVEA 1C91A 4XAKA 1QT1A 4F0LA 2IKGA 4L6HA 1ICSA 5CG7A 3I7QA 1I45A 3L21A 4QIUA 3L65A 2BG5A 4NI3A 3N1AA 4CNNA 1MFVA 3WF0A 2GK1B 3PPCA 1U2YA 2FDMA 3LUTA 1KFKA 5HW7A 2WNQA 4KWOA 1M9HA 1EQ3A 3SUSA 1NSJA 3DECA 4DUVA 1BKFA 2AL2B 1P1XA 1UKPA 2JIEA 4GC3A 5CH9A 3RGCA 3MKVA 3QMSA 4RE0A 4LUTA 1QXLA 3G1AA 4C6QA 3CUFA 4G8TA 1NTHA 4TTGA 3WH7A 5JUVA 1FAPA 2XN2A 4HD5A 4KEVA 4Q8MA 3N6QA 2MLYA 2OQHA 4D6GA 5DMYA 4FXFA 1N8WA 4C6KA 4XG1A 3M1ZA 1X6NA 2W63A 4KIEA 3SGGA 1Q6EA 1NQKA 3LCWA 3S5ZA 1WZLA 1XYMA 4MKSA 2NT1A 1KBBA 1JDFA 2ZVRA 4AZCA 1EIBA 1UZHA 4LUIA 4W4QA 1ZB5A 4OHQA 2PF8A 3N6JA 2HBXA 5DXYA 1R3VA 3HZ3A 3HJEA 3PN8A 5D2YA 2Y62A 1E9ZB 5KZMA 2PTDA 4HARA 1LF1A 1U1HA 3UWVA 1T11A 1GZGA 4FHAA 2WJZA 4GZJA 2VTFA 4AWEA 3TTQA 5T91A 2YCLB 3W83A 4US6A 2VR5A 2OX4A 1EA9C 4XBSA 4KPLA 4JPGA 3B04A 3VGGA 1KQYA 5BXTA 1XICA 2WMJA 1O5RA 1I2NA 2GQ9A 1QPLA 3STGA 3E38A 2Z1BA 1DIOA 1EX1A 2J9XA 1HGYA 1C8XA 1FP8A 3TONA 1DQUA 1G7VA 3MP5A 5A6TC 1Q66A 1WDSA 1RJRA 2C18A 2ZQ0A 3CLMA 3NZ1A 3UG8A 3NGFA 3LLFA 3TMLA 5LIYX 1H62A 1XRSA 2OELA 3GDRA 2XP6A 2PE4A 3EMZA 3KTCA 3QV8A 3R89A 4ZCWA 3V1HA 2F61A 4UQ9A 2FDSA 2X1IA 4L65A 1X39A 5HJYA 3FVDA 3CS2A 2VCDA 4I7VA 2DPEA 4GC4A 1K8ZA 4B3LA 2XIMA 1TVNA 4TO8A 4J7RA 1CW2A 3FIGA 1RD6A 3BICA 2PPNA 1GYLA 3VMNA 3LNMA 4BY3A 4XKYB 1EPVA 3KLKA 2WC3A 4B5UA 4HK6A 3EDKA 1RA0A 4WX2A 2FKPA 1S5MA 4ROQA 4MB4A 4B3KA 1WP6A 4RJEA 3TCZA 2RGLA 1W1YA 1QI0A 2PP1A 1FOBA 1JZ2A 3HGOA 1P7TA 4YVXA 5JMUA 4DIAA 4HNUA 4FNPA 4UOQA 3S1VA 2OB3A 4OTKA 1XQKA 2CLEA 2ICSA 2G3NA 2WQDA 4JQ2A 3HU7A 4EKJA 3RDKA 1YDYA 1BRLB 2QJNA 4TV5A 3GW0A 4HKPA 2WMHA 1GJWA 1MXGA 4ERIA 3S5OA 1F3XA 4S38A 3VZZA 1JYWA 1UZ1A 2V5BA 3W02A 4B5WA 3TFCA 4LV9A 2IPGA 3DG3A 4R0XA 3KL3A 4YTTA 2GVYA 1RSCA 3NCOA 1QATA 3AHXA 3A9IA 3RJXA 2DUAA 5A6SA 3BDKA 1L6YA 3TYZA 4S3FA 5DRCA 4PTWA 3SY5A 1TZ9A 4ZA0A 2JIWA 1OFBA 3VGFA 4J2MA 2EJ1A 3AIVA 1M7JA 1EFZA 4CN1A 4FZIA 2JK2A 2ZRWA 1UD4A 4TW6A 1WDWA 3WD0A 2NSXA 4M29A 2KZHA 5CZ0A 3BJFA 7TAAA 3CASA 3OZMA 3V5FA 6TIMA 1DIEA 1P0NA 4TNSA 1FHUA 4QROA 3HFTA 3TYUA 2QCCA 4AY1A 4AEOA 3CAWA 4QT3A 4HYWA 3KTSA 1E4MM 1DL3A 3MYOA 7ENLA 4UZSA 4JY8A 3IANA 3UR5A 4PCTA 3B06A 3W7QA 3IJQA 3AS2A 3B9EA 3DZ1A 1A3WA 3L2LA 3RMJA 4PMYA 3BMBA 3MI2A 4HB7A 4TX8A 3V18A 4GYPC 1HGWA 2XFRA 3DGRA 2FZDA 3CV2A 2FAPA 4NQ1A 4NZFA 4DB7A 3QQ1A 4N4PA 2W5FA 2YJQA 5HTGA 3ZJKA 1VBGA 3ALGA 3C6CA 3QFEA 4B92A 4ZENA 3KOYA 3LHUA 1CXKA 5G1TA 1X1NA 1O5XA 2Y5JA 1KLZA 2PU1A 2R91A 1Z69A 3GU2A 4JYEA 5HBFA 5EMLA 3VIOA 1HP5A 2QPSA 3CT7A 3KTXA 2C6QA 4FLSA 4MNMA 5BOOA 1B3XA 1ZSXA 5BU9A 3CXOA 1ZY9A 3LGDA 4LEQA 1UWTA 1XRTA 3EEGA 2P88A 3HQPA 4HGXA 3ECQA 4MSPA 4US5D 2A3AA 1J5SA 4E4PA 2ZUWA 3KW3A 2NT0A 3WNOA 4DY1A 2W92A 1ZQ5A 1X7FA 3LCHA 5I77A 1DPMA 1XL9A 4CVWA 4X61A 3CZJA 4EOUA 4W85A 1K02A 1X38A 1V02A 1KM3A 4K1WA 3MSDA 3LPOA 2F4EA 4RPQA 1BSIA 3E5PA 2Y7DA 3MMUA 4HA0A 1IIGA 1N2VA 4E8DA 2Y70A 3VOCA 3TKFA 4PBEA 3VAVA 4DBWA 1FKSA 3JS3A 4UZUA 3GVRA 3NAVA 3MU7A 2ZZ4A 3A3WA 1EDQA 3ISIX 3OW1A 2QMKA 4NJJA 2NV1A 1S46A 4EP8C 1R3YA 3KBWA 4UFIA 1EQPA 1DJGA 4Q7IA 4DJDD 4W7UA 1PJ9A 1W37A 4IT4A 2Y5SA 1UZ4A 1GQKA 3HPZA 2YPIA 2C1HA 3ZVHB 4NI8A 4AD3A 1EJUC 3IGXA 4IFRA 3UY7A 3RFWA 1JUEA 1TFVA 3W72A 2WXDM 5B80A 4AZCB 4XAGA 9XIMA 3IJDA 4UTIA 2OVLA 3BPWA 4PMQA 1QASA 2VWSA 4L80A 2QQ6A 3ARQA 3WIJA 1E72M 3T05A 1XBYA 3E5BA 3PB2A 4OBRA 5C2XA 3CEUA 3MUY1 4L72B 1E9IA 2J75A 3GAKA 3Q65A 3QLDA 3MP4A 5BXPA 2C79A 1NDWA 5AECA 3VCCA 4KWVA 3IIPA 3W1TA 1TV3A 3B8TA 1DWHM 2IW0A 3OLGA 2Z2BA 2INFA 4QSHA 4XBJA 1U5VA 1C8YA 2W61A 2FZMA 1OM0A 3WH0A 3LCXA 5BWAA 1QK0A 3W07A 3B9DA 4LF2A 4E3VA 4M7SA 3EYPA 4RDYA 3WEZA 1X1ZA 4GQRA 2VFFA 1H1NA 1TX0A 1CXFA 1UW9A 3WLPA 1XLBA 1V0LA 2ZR4A 1TIMA 4JYSA 4TX9A 3CV6A 2E7FA 2V5LA 2HBVA 3C3UA 3GIQA 2V5CA 1UWIA 1E51A 1TPH1 5AY7A 1RCOB 3TTYA 1A0EA 3MV01 1J6PA 1ZLPA 1OQFA 3F4DA 4U85A 1T41A 1UQZA 5CG0A 3U6WA 4ZFMA 1D7FA 3E0WA 5H1WA 5H8UA 3QR3A 4HOXA 3OVRA 1BF6A 1KM6A 4H2HA 4UOZA 3NQDA 4NZ4A 1EJXC 2Z1VA 4D6HA 4QBXA 1VFTA 2J78A 1EOKA 1B9BA 1F40A 3TE9A 4GY7A 1KXQA 1MFUA 3NPUA 3U7BA 2PLCA 3CUZA 3BQ5A 4AEFA 1KCXA 4M6VA 1E6XM 5E70A 1OCBA 2BNJA 4D9PA 3MCOA 1TZ7A 2AKZA 4MJZA 1ZZMA 3CWHA 3UU0A 3R94A 1K03A 4ZOBA 2PRHA 1RPXA 3IGSA 1TZZA 5F4SA 3K46A 4INFA 2IPFA 3DX5A 3O07A 5HR6A 3NI6A 4RLIA 3AQUA 3CJPA 3FAXA 1FWGC 2YCJA 3ZLHA 3PP7A 3WD4A 2MF9A 4M51A 4JFWA 3UCQA 4WY0F 2OOGA 1H5YA 1OYAA 2EPLX 1KRAC 2CERA 3EWBX 2QJMA 4JTQA 2GK1A 1F6PA 1B31A 3WF4A 3NPVA 1LBLA 1ZP3A 1Q6CA 1DWAM 1UR3M 2CLHA 3CYJA 4LPCA 5CC6A 1XS2A 3TQ0A 1PHWA 2JEPA 3WBEA 3AS3A 1PS9A 2XFYA 4DRQA 3O5RA 4MYAA 3W2JA 2BGNE 3GTXA 3AYRA 4ACZA 2X09A 1Q6FA 3VI2A 2P50A 3ZWSA 1DXEA 1XRVA 3KWSA 2RUCA 3QQWA 1JZ3A 4H8UA 2V9DA 3VTRA 3M0LA 1FKRA 4LU0A 4BQ3A 1BTMA 4HYRA 4JZ5A 2PCQA 3VYLA 3S1WA 3F5JA 4R88A 3ERPA 2EO7A 1GOIA 4PTNA 1NH6A 3SI9A 2E1WA 3CTTA 3PB0A 3DI0A 1CI1A 3RYSA 4O14A 5G1YA 2C71A 3W23A 3TLLA 4AIUA 3DERA 4HJFA 3I6TA 5ABFA 4F8XA 5M03A 4RCXA 3O5QA 4AZGA 3HF3A 3LM7A 4IISA 4O19A 3B97A 4KRUA 4I9TA 3FA4A 1Y7VA 3GHRA 1LRQA 1WYIA 4DZ5A 5BRQA 4PMZA 4O1CA 1XI3A 4QP0A 5LA1A 3WF1A 2ACQA 4X2PA 1D8WA 2YA0A 1SFJA 5HMSA 1ZBWA 3W53A 3W7LA 4KQNA 1NOUA 1GONA 2WMIA 4J2PA 1E1CB 2D0HA 3W1XA 4KEZA 5KINA 4IX0A 1KFJA 4EANA 3WLLA 1H49A 2AAAA 5FJIA 1I2QA 3IJ6A 4IG2A 2POZA 2VVSA 4MJMA 2PDMA 1DOSA 4W8AA 3IHZA 2NQHA 3MMTA 3IUIA 1R6WA 3GR4A 2E8YA 2DDXA 4O11A 2E77A 5LXEA 2YZRA 2RSEA 4HZ8A 2PGEA 3WH8A 2OLSA 4L9YA 5HUAA 4JDBA 1PX8A 4YTQA 5M5DA 1XXXA 4Q6JA 2R82A 3GH4A 2GWGA 1C9DA 1XSIA 4K6AA 1XLJA 2CNCA 3EGJA 2QPXA 2EKCA 4W9TA 1T99A 2NVCA 1OFEA 4KETA 4AHPA 3UR2A 3WFAA 1RALA 4DRHA 2O9PA 2IKIA 4AHQA 1JYVA 4CUCA 4DT4A 1W17A 2CBVA 4MNJA 5DCDA 4Q4SA 3CMJA 4NX5A 4IQ2A 1RP8A 4V1YA 1FHLA 4ZMGA 2RJHA 3TVAA 2GFTA 1ZCOA 4QG9A 2F2DA 3TUUA 2ESCA 1TG7A 3DU0A 3VDHA 4WLCA 3VDGA 2VEIA 4GUGA 1FH7A 3WKZA 4G7EA 4ML9A 4UIOA 1UR2A 1R5YA 1T40A 3NTYA 2PWVA 1ZK6A 5FACA 1W9DM 5D2WA 1AQ0A 1H3GA 4LUTB 1JZ5A 1TWZA 1TCOC 1HO1A 3N2MA 3N4FA 4CQAA 3VDBA 3FDGA 1VCFA 2HJPA 2VGGA 4GQBA 4L4LA 4EXBA 4AYGA 3CAKA 3P62A 3QC3A 3M0YA 1BGGA 3LTSA 4ILSA 5JH2A 1TPUA 2QIWA 2EPNA 4I6KA 3O5GA 4DBSA 3GC4A 3N15A 3DGBA 5DX7A 1DYSA 2BS9A 1UIOA 4GKLA 2G37A 1Q4NX 3F5KA 3A22A 4ZGYA 2X30A 2X40A 1VGAA 4PEEA 2V3EA 3CZGA 2WSYA 2GGHA 4H7VA 2QDDA 4KMQA 3U57A 2HV5A 2JFEX 1Q6UA 5AYBA 1TVPA 3TYEA 5CEWA 1XYFA 3CL8A 1JF5A 4H9UA 4PA8A 3IACA 5D9OA 6XIAA 3NQAA 1GVRA 1J4HA 4Z1DA 1RK5A 2Z2AA 1ISWA 3DYPA 4HSNA 3BSGA 1K9DA 2G95A 5D37A 1EYEA 1GHRA 1Z8AA 1VYSX 2BX7A 1XIMA 5HDRA 1KM5A 3BGJA 3TR9A 5JXQA 5I07A 1EKOA 4WKAA 3M0JA 1QPFA 1ZCCA 1GQIA 2J88A 3AIRA 2EBNA 5K7JA 3FK4A 5IOBA 1CNVA 3BW3A 3DHDA 5I79A 1XYLA 2IUZA 1O66A 3AZTA 5E0KA 1UBPC 3V0SA 4XZNX 4PUDA 4AY7A 1EWDA 1ZJAA 1FWDC 2CBUA 5AC7A 2I17A 5AC8A 1JF6A 3DHUA 4NNCA 2PDFA 1M03A 4WQ6A 2PDJA 4V1XA 2OSWA 4LS0A 1TJ2A 2C19A 1J4RA 1VCGA 1W32A 2R9RA 2FJKA 2XVGA 2ZX5A 4OV4A 4PUJA 3A6OA 5BW6A 3GD6A 2V5KA 4RW5A 1CCWB 1WDQA 3LCIA 4S2BA 4WDXA 1R7OA 2HK0A 4W89A 4NJHA 2OX1A 2XP5A 1YNQA 1OSEA 2WSQA 2F23A 4HOZA 4HHMA 1J0KA 4WXZA 1W3KA 4JN8A 3LSBA 3WBWA 1YNYA 3OYXA 1US3A 2Y7FA 4UCGA 3E96A 1NWSA 3BG9A 4PSPA 4NNRA 1ISXA 1B3OA 4Y9NA 1CEOA 1VIZA 3SY8A 4F40A 1ONRA 1CENA 4Q8NA 1IWAA 3THCA 4OT7A 2DT2A 3NL3A 3EWUA 1UB3A 3W7RA 1H09A 1D8CA 4EACA 1PV8A 1XIFA 2BGQA 1JQXA 1RPKA 3O9NA 2XHYA 3JYMA 2FVKA 4JN6A 1A3XA 3H7RA 4IM4A 4WDTA 5A6BA 3PUDA 3LEPA 1WUFA 3R0DA 4QG8A 3BAXA 5LKYA 2PDGA 2QCGA 3BLLA 1EUAA 2BVTA 3OVGA 1HTIA 2EEXA 4TR9A 4ZEPA 2NQZA 2QDEA 4B3ZA 3WSUA 1FJDA 3EOLA 3S1XA 3A21A 1H0IA 1ROUA 1DXIA 5HWNA 4ORMA 5D9PA 3WJSA 4N6EA 4KWUA 1A47A 3KBSA 1EO5A 4H6EA 4FLRA 1QWKA 1UWQA 2B31A 3CBWA 5CSSA 3M0VA 5FEXA 1F5ZA 3Q45A 2E6YA 3G6LA 3L5AA 2BXYA 1XSJA 1W1TA 2QCNA 4TW8A 4FN2A 5HJXA 3NQMA 2ONEA 4LAVA 2E09A 1OJXA 3B03A 1NWUA 4C5YA 2CZDA 3GDLA 3ZOAA 4XX6A 3WFZA 2G4JA 1Q1CA 1RHCA 4GQ0A 3L23A 1LJYA 3CK5A 3PA7A 2VD9A 3BV4A 4D2JA 2BY0A 3WD3A 1YW5A 5XINA 4ZO9A 4PN2A 2E5BA 1FD9A 3KBMA 1PKNA 3QYQA 3H2OA 2PEVA 3N04A 4JKMA 4PR4A 3OG3A 2CXEA 1YKWA 3B0XA 1YNPA 4GISA 1LCOA 3W29A 5BYWA 1C92A 5AHIA 1EEPA 4QISA 4B5NA 4GWEA 1J93A 4ZO7A 4HU8A 3AXMA 3O1NA 2Y0FA 4J35A 1KFEA 2V6AA 5HMDA 2Q8ZA 4O1AA 3TIMA 3WLJA 4GI8A 2ZXAA 3NO5A 4HHPA 1ELSA 6TAAA 3CH9A 2OODA 3VNKA 1S2WA 1A3HA 3W0KA 1TWWA 2PDPA 3FHAA 4MMWA 1PWLA 1F6YA 1WA3A 2YDAA 1LL7A 1GVIA 2VR4A 4JTHA 1NAL1 1UUQA 3ABOA 4K2SA 2YA2A 1V93A 2PTYA 3BUVA 3KP0A 4IQCA 2C1GA 2UY5A 5CC3A 3VC5A 1XGZA 3L4ZA 2R94A 4XD5A 1J11A 3FJLA 2VGFA 2DZPA 4M6PA 2A4AA 4ECLA 3BG5A 4O8RA 2OZ3A 3BLIA 1Z41A 4BQ2A 2E6DA 3AYSA 4GXWA 3AXKA 3RIKA 1JNEA 1H7WA 3TV8A 3WQVA 2XVNA 3KCLA 1RAKA 4R3UA 1EHAA 1FKDA 3NQ8A 1N8IA 1QPOA 1PX4A 2HVMA 4D6JA 1VEPA 1W5NA 2VYOA 3T2QA 1U30A 3ARSA 1B3YA 3GR8A 1SR0A 4U2ZA 4D71A 4NT0A 3T6CA 3T0TA 3IEBA 3GG8A 2DGAA 3EKGA 4QNWA 3L67A 4UFHA 2QUUA 2QIIA 3L2IA 2J24A 3UZ5A 2DJLA 2P8BA 2CU0A 4JTIA 3VZXA 2RURA 1KD0A 3P67A 1E3ZA 4G1KA 2QW5A 2PDYA 2BASA 1QI5A 1XLMA 2AMXA 3E0LA 2BOEX 4I6VA 1OFDA 7TIMA 4C6FA 3E2SA 4GGBA 4EIVA 1DEDA 4HNNA 3TXZA 4QS6A 4M82A 5FJUA 3ZT5A 1K8YA 2XM2A 1K9EA 3R10A 4JL2A 2V5JA 3HQNA 3RR1A 1J12A 3W7JA 4WKHA 4MF4A 3GFYA 2P4VA 1WCGA 4N19A 1S3HA 2VC6A 5REQB 3VIKA 3K2GA 2W6RA 2XGBA 3M4HA 3LX9A 2GQ3A 1ENUA 1I75A 2VX4A 3AUJA 1JFXA 1JDCA 4Z2GA 1PIIA 1JNSA 5CXPA 3PS7A 1FQ0A 5C7HA 3L5LA 3GO2A 4JFUA 3OLDA 3WQFA 2NVAA 4PL1A 2GGEA 3WJYA 4RL3A 4QJ4B 3KZSA 1JULA 2VT0A 2UY4A 4DYEA 1J2BA 1BYCA 1ZU8A 2NQJA 2ZZ3A 4JTEA 3RU6A 3IKDA 3N25A 4I5RA 4N42A 3VNZA 3O6YX 4IT1A 3S46A 4QT2A 4MY1A 3GBDA 3VD7A 1V6XA 1F7BA 2ZXQA 2DG4A 1BPLB 4JTCA 2Y63A 3EZ4A 5TIMA 1EC7A 2V82A 1AMYA 3DC0A 5C55A 4HNVA 3TC7A 5AVNA 2BXVA 3GKAA 1YADA 5FJTA 3WH5A 4J3SA 5FSEC 1OF8A 5LA2A 1IEWA 7PTDA 3UZWA 4QS5A 3UWUA 2J8TA 3UF9A 1EOMA 1J4EA 2J7CA 3E9AA 4XZHA 3VNLA 4IG2B 2YZ5A 3P5ZA 3KL5A 3G1XA 4DO7A 4AZ5A 2ATSA 4ZQRA 3S5NA 2AGKA 3P81A 3BWWA 6REQA 3EDFA 4KBXA 4M80A 2OYMA 1H60A 4XD4A 1M7PA 3WNPA 2GQAA 4F48A 3WBAA 4D6DA 2J8FA 4GA8A 1PVNA 3QGVA 4D8ZA 3ARZA 2RUSA 3UJFA 3GTNA 3RX4A 3M6DA 3E0IA 1OX6A 4LYPA 3M16A 1LL4A 3DI1A 5H2ZA 1UWRA 2QCEA 5HNTA 4KQZA 3HQ1A 4AZIA 3H24A 3N2TA 4QLJA 2NLYA 4BCEA 3TSDA 2PURA 3AWNA 1IEXA 2BV9A 5DN1A 3SUWA 4B5SA 4XZMX 2ZDRA 5A5WA 2Z26A 3C2OA 4MKVA 1S5WA 2D73A 2VFDA 3MTWA 3MZ2A 1DJNA 4GH1A 3CGTA 5HNRA 3VDAA 3QYSA 2WSPA 1HT6A 3T44A 4NAEA 2X0YA 5DQPA 3O5DA 2OG9A 4GVIA 5HWJA 4Q8WA 2PRMA 4GQGA 3NSXA 1H41A 1PB0A 4BF9A 4GLEA 1ZS2A 2WLYA 3WLKX 3EWCA 3WMSA 2DSWA 1LT7A 4H19A 3JXVA 1EJRC 3N9KA 1J79A 4YYFA 3VGHA 5CJNA 4O0ZA 2QUNA 1TV7A 2V30A 3U5YA 1Q6IA 4HP5A 5DMMA 2PB1A 5A2CA 4IIHA 4V33A 1YYAA 2XWEA 3NO1A 4E4UA 3V35A 4KGJA 1CLVA 2XGIA 5EBUA 1JPMA 5AYZA 5I09A 4XAPA 4NASA 1KFCA 3ONCA 4TX6A 1ZP4A 4M7TA 1VF8A 2Z7GA 5FAGA 4S3JA 1QPQA 3S5SA 3R0KA 1O1ZA 2EQDA 1EJVC 1QU4A 2J25A 3UW6A 3ARYA 1KGUA 3LCFA 4HMCA 1W3IA 1E1CA 4RE2A 4GO8A 3NA8A 2V5DA 3F03K 3QMTA 5I98A 3PTKA 5ECVA 2G0WA 3Q2DA 4E2BA 2A7RA 4KRTA 3RGTA 4HQVA 1QZ2A 2RGMA 2Q01A 4POCA 3T0DA 3IUHA 4GIEA 1X96A 2A21A 1JD7A 5AHMA 1ISZA 2Q5AA 2V3DA 1Q7MA 4NNAA 3KADA 4B15A 3G3MA 5HINA 1RV8A 1A0CA 2DZVA 4JX6A 4F79A 4MLJA 1RH9A 4NF7A 3UPMA 4XB3A 5KSWA 4YTSA 4JFMA 3TYCA 2FH8A 4QR6A 2WNZA 4US5A 1KKRA 3CIWA 1VD6A 4HIBA 4PODA 4LS1A 3A24A 1E3XA 1JPIA 4FLQA 7REQB 3G5EA 4JL1A 3WYZA 2C16A 3ZYZA 1BL4A 2OTDA 3OYZA 2XVKA 3GU0A 3MYPA 3L12A 3SCPA 1Y5WA 1TJ0A 1IEVA 3WK3A 5MHBA 3UPBA 5FF4A 2AL1A 4WDUA 1CBGA 4EXQA 1W5PA 2G4FA 1JFHA 3MBDA 4LVAA 5A69A 2FKEA 2WVUA 1H7XA 3VCRA 2FJUB 3UERA 4NJIA 1QNPA 4CEXC 5B7YA 2E6FA 4U28A 2PMQA 1MSSA 3T8LA 2D22A 2ZRZA 1I2PA 3CQJA 4FIRA 3VC6A 3A4JA 4H8NA 1LRTA 2ZBTA 4J3XA 4Q33A 3WUGA 4LBRA 4J4NA 5C7VA 3T81A 3WL0A 2DZXA 2MPHA 2I9UA 2P1FA 1YPIA 3G1FA 4FF7A 4GX8A 4Q4PA 2VZTA 2ZZ7A 1Y0OA 2HXUA 3WLSA 3RJYA 5D8WA 4K36A 5K9DA 3MSGA 4XV0A 3VE7A 4DWDA 4H41A 3PVFA 2V2HA 3L0NA 3CB3A 3VGDA 4FXRA 2HXTA 3E02A 4JFIA 1XH0A 2HVNA 4P8XA 1PYFA 2W3ZA 3LXBA 5A6KA 1EZWA 2D2GA 5CAHA 4PYSA 5A8QA 3KRUA 5I06A 2P5NA 1VFMA 2NLIA 4QNEA 2UY3A 3PBUA 4ZOEA 1FWWA 3L4VA 2VGBA 1KRBC 5I2UA 5DY3A 1A0DA 1NDYA 3QJAA 3KZPA 4BEUA 4XZBA 3JZUA 1C29A 3GS6A 3LQGA 3M5ZA 1XIEA 5IBXC 3EX4A 4DZHA 3NR0A 1AJ2A 1UD3A 4C7FA 4ZL1A 1NP0A 4PGLA 5EMMA 3WL1A 3N73A 4TUFA 2O56A 4ATLA 4DAIA 3GG7A 3INPA 2A6LA 5DBUA 4YPJA 1V6UA 2E9LA 5LNRA 2E40A 3E6EA 3ES7A 4GRSA 4JTKA 3HURA 4ICCX 4R5EA 2QGYA 3W84A 3PTQA 4Y6GA 3KXQA 4BA0A 2PDIA 3JU2A 4IMCA 4O1FA 3HGSA 3UJ2A 5BRBA 4RNJA 4Z1YA 3W7PA 4LB4A 2PODA 2DW6A 4GI6A 1EC9A 3LQLA 1Q7ZA 1RR2A 2OCZA 2W62A 4PTXA 1NF0A 3PK7A 1UR0A 4FR1A 1UR4A 3HO8A 1CPUA 4OE7A 1TPDA 3V1PA 3F2BA 1XKYA 3JW7A 3WH9A 1FWTA 1GORA 3R5EA 1F07A 2WNNA 1QTWA 1VYRA 3GH5A 3VOGA 3SSZA 5EGRA 2VX6A 3JZEA 4DRSA 2DIJA 3U2ZA 3LK6A 1KC7A 4JY9A 2QYGA 1YDOA 2HCVA 1KFLA 3KCOA 2RAGA 3GDKA 3N4AA 4MAVA 3J7HA 5I3DA 3GNOA 3AUOA 3UD6A 2J9ZA 1JCHB 3C61A 4MNLA 3QSRA 4DRPA 2CCRA 4MTVA 1BKHA 1XIDA 5D03A 1JPDX 1KNWA 1NDVA 5JU6A 3T7VA 4IIBA 3RCMA 3EOEA 1VRDA 1KWGA 3UBPC 1PDZA 3RO6A 3F4CA 4PBFA 1E70M 6ENLA 3LTYA 2OQYA 1AL8A 2K8IA 4DBUA 4OWGA 4C6NA 1DWIM 5FJRA 3D46A 2WZHA 3THQA 3MC5A 3MZNA 4GI4A 2WSRA 4CEUC 1VFFA 4HMNA 1GHSA 1M04A 3AS0A 5IFPA 1LT8A 3N2XA 3TJXA 3K13A 4WIWA 3PY2A 2ABAA 5CPLA 2RDTA 5CLWA 3PRAA 4OBSA 3VIHA 1TELA 1JR1A 1TQXA 1Z32X 4U33A 1OK4A 1L6FA 4LEFA 3EWZA 5FIPA 2NWRA 4WSHA 2GUUA 4ZQNA 4S3EA 3EWXA 3AC0A 1REQB 3GXMA 4G56A 4OFCA 4E2OA 4MUPA 4A05A 5K9CA 4XAYA 1L6SA 4X9SA 2NXGA 3WCZA 2GJXA 3W01A 3W2KA 5TBOA 4BI6A 1XM3A 4GK8A 3SZ8A 1QHOA 2O0TA 2CFFA 4JGDA 4UQEA 3M47A 3TNBA 1ZFJA 1WZMA 2OKTA 4B2DD 1O7AA 3DFYA 1I2RA 4A21A 3U2CA 2E9MA 1EUNA 4WEVX 4GJJA 2DUXA 1NY1A 2G8ZA 3OIHA 4E5TA 2WZTA 3U2OA 4XO7A 3CPRA 4B5TA 5DT5A 2PWDA 2QUTA 1B0IA 4W7WA 4KF1A 2OKOA 4GY1A 1O5KA 1WX0A 3KVKA 5L6UA 4JEQA 3NM3A 4KIRA 4F0MA 4JKKA 1P0KA 4QLKA 1J4IA 1MZRA 3W7OA 5GQBA 3UEQA 3WQDA 4NJKA 2BBFA 3IWPA 3PF3A 2PBGA 3D6NA 1GVSA 4GCAA 5I3FA 3NVTA 4AC7C 1XX1A 4QIBA 4U5KA 3W24A 4LAWA 3L68A 1M3UA 3RRAA 2YGYA 4WKFA 1ZUAX 1TV2A 4B4FA 4GYJA 4G1NA 4H04A 2DZWA 5G4WA 4O4VA 1BXNA 2C3ZA 3N11A 4ZB2A 1RA5A 3TQKA 2O4QA 4IPIA 3BTNA 3KS6A 5AYXA 3W7HA 1WBHA 3LYEA 4JIQA 2FYMA 1VR6A 3QOKA 1Z6KA 3PJTA 2Y8KA 1Z42A 2F38A 2OSXA 3ZLFA 4LAXA 4MADA 4Q4OA 1EJWC 1CIUA 3PZ9A 3LI0A 3WLOA 4HU3A 1UROA 1X7IA 3WEOA 4NRSA 1SW0A 2CWXA 3KRSA 1OGGA 1W9PA 1FCUA 4L4OA 2EG7A 5EB8A 3RFAA 3PAJA 4HTYA 3EDJA 4JHMA 1R3QA 1X8FA 3FYPA 2E8ZA 4AZ6A 1V51A 1OIMA 3S2JA 1XUUA 2QCLA 2YX0A 2QUMA 5CZJA 4E0CA 3PZGA 2RJGA 1W54A 1CXHA 2W0UA 4H6RA 1BYDA 1X1OA 2WSKA 1T6MA 4NZ3A 4FMVA 1YDVA 3HPSA 3OG2A 2A79A 3ME3A 3A13A 5EFDA 1BLIA 4DJDC 2ACRA 5PTDA 4NP7A 3I6RA 2QJGA 4AUBA 3SN4A 1DHKA 5FF2A 1MW3A 2GVEA 2H3BA 1CXLA 2YXXA 4IT6A 1CB7B 1RJQA 5LIXX 1GOMA 4PMVA 1N7KA 3AALA 4TVDA 1UA7A 3RM9A 1QO5A 3LV5A 1U79A 2ZXBA 3OHIA 1NMWA 2F8QA 1SSDA 4MLRA 7ODCA 2ZR5A 4DLFA 3GQYA 1B90A 3NL5A 2Q02A 3UZXA 4CN4A 5B8IC 4QG6A 5FEZA 3FCPA 5BROA 5I03A 3GC5A 3RPTA 1R7AA 5A6BD 4OBTA 2YBTA 1TB3A 4K8EA 2WHMA 1Q2SA 2A5HA 1UKQA 2NXHA 4OV9A 2XIIA 4HPHA 3E1F1 1KTBA 4R53A 2Z00A 1MUCA 1OADA 1US2A 4JS3A 2VZUA 1MEIA 1IXOA 5MF5A 1NM9A 1A5UA 4UWMA 3W87A 4AWUA 3WDPP 2VURA 1TYGA 3ZT7A 1UASA 3VIJA 3H53A 2DSUA 4I7WA 2ZVIA 3F5LA 4LSBA 1R9ZA 1XH1A 3AXHA 4RV8A 4AD5A 3KCJA 3CAVA 4UTMA 1OX5A 4GIYA 5HUPA 3GPKA 2ZX8A 3LRLA 3MDUA 1PBGA 2CEQA 1DE6A 3A9BA 5CPQA 5D2TA 2X2YA 1H2JA 4NXSA 4Q8QA 4FX6M 3KL0A 4IPJA 1KQZA 2X16A 4JYDA 3NPXA 1OFOA 3S9IA 3QGAC 1TJPA 4HHLA 1D7KA 4C60A 1S1RA 4KEMA 3P6LA 3M7WA 3B8UA 1A5BA 2TODA 4KCVA 3NXFA 4MGGA 2GWNA 2NUWA 4DRJA 3P8IA 3VNJA 4XO6A 4F2UA 1SZEA 1XIGA 4HMEA 4GCXA 2WWDA 3PZOA 4JICA 4QCFA 3XINA 3TMQA 4EPDC 2G3IA 2QHAA 3FSTA 1J0YA 1RXOB 1Q85A 4RV3A 4IICA 1I2OA 3BZJA 2ZE0A 4LAOA 4AZHA 3MW7A 3EA2A 4H6QA 3WK2A 5AN7A 2O92A 2ZUNA 3SY1A 2HSAA 1IE7C 4P7OA 4KT2A 2P0OA 3SCQA 3VIFA 4GBUA 3BSHA 3AIUA 3RLHA 4DJDA 1J6OA 2V67A 5ABGA 2ACSA 3VKBA 2NV9A 1H51A 4IXHA 4N9EA 4UTJA 1UIPA 1FKBA 2W67A 5C9RA 3MWAA 5K4XA 4PZVA 1UKTA 3O0KA 1DWJM 5D2VA 3RITA 2XIBA 4GZEA 3PZNA 2D2HA 3CAQA 1WDPA 4GX9A 3T9PA 1EHNA 4XAZA 3ITTA 3Q37A 3TA6A 1EQCA 3GK0A 2ZA2A 3M0KA 1OINA 2XPAA 1YE4A 1PEZA 1EDGA 3PWAA 4NXKA 1A4LA 1ZRQA 5E5CA 2QMJA 4IMDA 3UA3A 4DIPA 1CWYA 3QBUA 4DXKA 4YLWA 4S3CA 1C9HA 1G1YA 3QEZA 3WJWA 1A5LC 1Z9AA 4J4OA 4IIFA 5D05A 4NYUA 3UZJA 3WLRA 1W9UA 3W00A 1VJSA 1TA3B 3PUEA 2EPKX 1ROTA 5TD4A 2ZZ2A 4CN6A 3O5PA 1XC6A 1RBAA 4ZQOA 1YATA 4ACZB 3H2CA 5J8LA 3RUBL 4H8VA 5C9UA 3URQA 3GE7A 2VEFA 3ABXA 4EF9A 4HPXA 3ABQA 3W85A 1M5YA 1F61A 4I8DA 5C54A 1Q65A 5G4HC 1G4TA 1XV8A 4KWSA 1YDNA 3B0PA 4LT9A 1WKDA 4OECA 3S3GA 3WJZA 4X3ZA 3K1DA 2FZNA 2DEPA 2CLPA 4Q8UA 1HVQA 5E9XA 3RCYA 3WY1A 2D24A 3ZZ1A 5CPOA 2EPHA 4R33A 3WNKA 3TCSA 4BQ4A 4K39A 1Q8JA 3SJ3A 5HPCA 4HNOA 2Q8LA 1UR8A 3G77A 1TCMA 4RR4A 4EK7A 1K77A 1DQWA 2DU2A 3CZEA 4DN1A 1P6WA 1FXQA 2O9TA 1EJTC 1VJIA 4JX5A 3TXVA 1HN1A 1RK6A 1Q3NA 1QAPA 4EWJA 1MYRA 4IIEA 5JH8A 3O0FA 4H9XA 1ZJIA 3MHGA 1LQAA 2ASHA 3NURA 1U5JA 4NUWA 2BHZA 1TUFA 3R4IA 1HKMA 1SMDA 1QFEA 1SVDA 5HAOA 2HISA 4K8GA 4HJWA 1AD4A 1KBKA 4DNHA 3WMCA 1J0HA 2WOQA 1KBLA 1R2SA 3GW3A 2CYGA 2XP3A 1KBIA 1E73M 3O6CA 1SFTA 3KM8A 4ACYA 4IJBA 2Z24A 2GSJA 3LXCA 4ZPTR 1JCMP 1OABA 3PPHA 3KAFA 4J3TA 1BG4A 2WB5A 2VC5A 1DIKA 3R25A 4XZ9A 2YCLA 3UNTA 4G9PA 1G4EA 2X0SA 2YCIX 1ZAJA 5E1QA 4FSAA 4GABA 4UNKA 2QPUA 1SO6A 2CITA 3MUZ1 4EVZA 1AA1B 4IUOA 4IGMA 1TPB1 4BEQA 4S23A 5CKSA 3W1MA 4JHZA 3VNIA 3IAQA 2VEGA 3TC5A 1E5JA 3B40A 1T8XA 5JVLA 2QDHA 4LYQA 4WHBA 4CKQA 1YBQA 3TNOA 4IIDA 3MUCA 5ABEA 2J79A 3FDKA 2Z4GA 2VCCA 1TJ1A 1UC4A 3P2VA 1LORA 4HN4A 4R9OA 3KDOA 2YYTA 2PDQA 3ITLA 1JZ8A 1W1B1 3S9YA 2V8ZA 1RD5A 3FA5A 2E3ZA 5FEWA 3VOFA 2O9OA 4E8CA 1MW2A 2HQAA 4GJIA 4H00A 1EO7A 4WJEA 4CCDA 3SCVA 1OGBA 3W7IA 4QAWA 4E38A 4FNRA 4UTFA 4LC8A 1V6WA 3M5XA 4MFDA 4N2YA 4JCLA 4O15A 3WUFA 3W1LA 1XGDA 3T4WA 3PJXA 1V5XA 3SCUA 3KRZA 3PWIA 1KXTA 2D2OA 1UKSA 3LPGA 1EWEA 1KGXA 3M0MA 4Q7NA 3PUOA 3F7JA 3N4EA 3OIXA 5IBXA 2VMFA 3BCJA 2PDWA 3SQSA 3ZJ8A 1VB9A 3MJMA 4QDPA 3EMCA 4U2YA 3Q67A 2HS8A 3QKEA 5J5DA 3R13A 3HPFA 4C6DA 4W7VA 1PL9A 4LUYA 3EOUA 4S3DA 3UESA 3SCTA 3WQOA 2HVOA 1KLYA 2GSEA 3VVGA 1EGZA 3G3DA 3EB4A 4DF1A 4DQWA 2ZQVA 1UOZA 2QCDA 1BD0A 4FALA 4XZIA 5IDIA 5MKGA 1JIBA 3MI3A 4FA3A 2Y7EA 3PWGA 1TQJA 2E68A 3KOXA 4K38A 2R24A 1XD0A 3TZNA 2X2GA 4B91A 1W31A 1H61A 1OY0A 1VH7A 2UBPC 4YWIA 2VHLA 4XZWA 4DM2A 3LHVA 1HUVA 2DVXA 1CGUA 2FPVA 3CUXA 4FOUA 2BHYA 3FJNA 3NL2A 3URNA 4AWTA 1DJYA 2P76A 3LU2A 3KRBA 3MMWA 1P0EA 4K1GA 5BXRA 1ZGDA 1P48A 3O6DA 4ASTA 4LRSA 4IXXA 1JVWA 3HG5A 1ZJBA 1VEOA 2WO5A 3GFZA 1FKJA 3MA8A 3IIOA 1O94A 3OLIA 1FKHA 2VZSA 2WM1A 3CQ0A 1UD8A 5M1TA 4MDOA 3ZJ6A 2FGLA 4HCLA 3HMJG 3SN0A 2LGOA 1K9FA 4UTLA 3GXDA 4HMDA 3P93A 4AW7A 3BVJA 2HEJA 1JUBA 3VUPA 1W1IE 2C8NA 5H8PA 5TQLA 4UTTA 2P3EA 1TJRA 3UXLA 2A3HA 3T0BA 2XH0A 4PRTA 3G0XA 3W4RA 4BZYA 2WM0A 3CZLA 5FCZA 5EU9A 3IPWA 1OT2A 4LAZA 1OFAA 4NZ1A 2Y5EA 3FHQA 1UWUA 2PWEA 1OX4A 1ITQA 2OQLA 5LNVA 3NYZA 3STFA 1TMQA 3KACA 3UR7A 2W4XA 3F4VA 1WBJA 4L1XA 1ZCNA 4GHRA 3CHDA 5I5RA 1I9CB 4U31A 4PH6A 2EG8A 3R8GA 4PUUA 3WH6A 1VPYA 3CQHA 4WSKA 3B8IA 1HL2A 5FL0A 4C91A 2XH4A 2CLKA 3SN1A 2A3CA 1NARA 4O18A 3QKZA 3SURA 3TN6A 5D30A 4EWND 4WZHA 4XAFA 3T2PA 4IPLA 4WVXA 4IGSA 3SECA 1VFLA 5H6HA 1TVLA 2NV2A 4MJ2A 4WGHA 3RLUA 5FF3A 2PPGA 3D3FA 4DM1A 1KR1A 4WCJA 3B8SA 1JDEA 1UD6A 2PN0A 4P7RA 4JN7A 5JBEA 5BXSA 3CB8A 3PBWA 1LBMA 1G7UA 3SB0A 3REQB 4YHEA 3IRSA 1W3NA 4DJFD 1BVZA 3G8EA 3TQVA 3H8AA 5F4XA 1MDLA 5EMUA 4H9YA 2J7HA 3GTIA 3O5KA 3LXAA 3BJTA 3W1AA 2BVYA 3TWBA 1OFPA 4ATWA 2GLKA 3CIXA 3ZO9A 1BXCA 4JTUA 4XISA 4H9VA 2XP7A 4PMDA 4GD0A 5ENLA 4LH8A 3WLQA 4JBRA 4C6BA 3P74A 1MQRA 5EFFA 1OBAA 4O50A 2E5CA 4RZBA 4QGCA 2X1UA 1XC4A 1JCYA 3VU2A 2Z29A 4BR1A 1JGIA 2Y1HA 3QY6A 3SRKA 2QCHA 2ZRXA 2IXVA 1I1XA 2H90A 3NXLA 5C8BB 3UG4A 4QM1A 1TTJA 5A2AA 4Z2JA 3O5MA 3CEPA 1UJQA 4F0HA 2YCKX 1Z7AA 5D9MA 2YL5A 1JCTA 1R46A 3B8DA 1OCQA 4R27A 5LIUX 4DZ2A 3NFUA 4QX4A 1TE6A 4HBOA 2PRLA 2QKFA 3D5HA 3LPFA 4QITA 5SWUA 3PNUA 3U8GA 5A8GA 1AMKA 4Y9MA 1B9ZA 2WPBA 3EB2A 2BDQA 3P0WA 3ZSSA 1E1FA 1B54A 2XFFA 3U48A 1OFQA 1RY0A 2QVNA 4LAUA 3NQEA 2ZR6A 3CTLA 3CL6A 3UA4A 4D8LA 4KH2A 3V4BA 3P0XA 3H23A 2CLMA 2XSBA 2NUYA 5CC5A 4V15A 3WNNA 4RUBA 3QY8A 2RFGA 3W88A 3EWDA 4HTBA 5TAOA 2GVGA 4QQ3A 1QI2A 1E6SM 2NX9A 1WKYA 1FKWA 4NY2A 1GWJA 3TOPA 3S5YA 4J3VA 1E43A 2ZA3A 1OC5A 1UZDA 3SAZA 3WN6A 3THDA 3TW7A 3UPWA 1S2AA 1OIFA 1V3HA 4OJYA 4M5PA 4YWSA 1SO4A 1W1ZA 4RDVA 1ONWA 1F4AA 6CGTA 4L7ZA 1E4NA 3A3HA 2WAGA 2FMOA 1D3CA 4Y9PA 4EPEC 2ADAA 3EXTA 3PFRA 1ISYA 3UG5A 1MVYA 3IGUA 1J5TA 1CGYA 1UH2A 1WQ5A 1DTNA 3O5JA 4IL2A 2PLKA 3IAPA 1XYBA 5T9BG 5HKGA 1U33A 5CGMA 4F3HA 4ZB5A 5G4EA 3WQ5A 3T42A 3VPLA 1MUWA 3TZFA 2I5QA 4M6QA 1NF7A 3CYVA 3O16A 1C93A 2XP4A 1ONXA 3PZVA 4A22A 3MSYA 3NG3A 3EA1A 5ABTA 2UY2A 1H7NA 1ECEA 4DPQA 2YSWA 4WF7A 2PC8A 3ZS4A 5A6AA 2DG9A 1FCBA 4O4WA 1K3UA 1F2JA 2CHNA 4W5UA 1NVMA 1ICPA 1UKOA 4CD5A 1V3IA 3MVIA 1F3EA 1PYMA 3UGVA 1H4PA 4MUZA 1NFBA 1JPKA 4O52A 2X1TA 4CD6A 4UXDA 1V0MA 1RVKA 3SJNA 2ZFAA 1FKLA 1UD5A 2ZRUA 3URBA 3S4TA 4AQLA 3GHUA 1UP2A 1SO3A 5HJLA 3URAA 1E15A 5FJJA 2PV2A 5E6YA 4HCHA 3OHMB 1Z44A 3FA3A 3KBNA 1KXHA 2INZA 4XK2A 4N02A 3M9YA 1OCNA 1R3RA 2FZBA 1TREA 2QZRA 1XIBA 3AMCA 4HA4A 1TWSA 3H7VA 2XDFA 2QV5A 4L1GA 3SRDA 1F73A 2Z1KA 3U2EA 2XU2A 4Z0SA 2W9MA 1LQ2A 3FEMA 2Y8VA 3SFWA 1GOXA 3ZR5A 3TC6A 5J04A 3CUIA 1AW1A 3UNDA 2FVLA 3A4XA 3FW6A 4ITZA 2WBGA 1K4HA 3KVLA 3GU9A 3T55A 3STCA 1S5TA 3M5VA 1KTCA 2F7FA 2GYIA 2H8XA 3JUGA 5FESA 4UOJA 2YDSA 2WK2A 3P3BA 4EAMA 3AXIA 2PZ0A 4KFNA 4L9ZA 4W8LA 1KCKA 2OGJA 1OZQA 2XP9A 4W93A 2G96A 9XIAA 2WMIB 3FLUA 4LC6A 5CCZA 3DFOA 3DHFA 1IXNA 2CLFA 4UTWC 2ZQUA 3YPIA 4TMCA 2CWNA 2BHUA 2YXOA 4GUHA 4FB7A 3GUGA 1B1YA 4UMBA 3HN3A 3RILA 2IPJA 3HMCA 1TRDA 3ANYA 1B3ZA 4DO4A 3FGCA 4JTDA 4WOQA 2ACUA 4B9YA 4CNUA 5IDZA 3ZXWA 1VBJA 2ISWA 4JQ4A 3WK1A 1LWHA 2M2AA 1WDDA 1EZ2A 4PL2A 5I3IA 5CZTA 4JTGA 4YHGA 2J8GA 3TW9A 2CHOA 3M0HA 3AMDA 3R12A 4GVGA 3HGRA 1HP4A 3IGHX 4UFLA 4U10A 4ZE5A 2WVVA 2ALDA 3RM8A 3GXPA 4K7VA 3RAOA 1GOKA 1YHTA 3N12A 2ATMA 4YTRA 3UCDA 1LBFA 2MNTA 3AXXA 1DJXA 4YCOA 4A2RA 1T8QA 1FFQA 3PR9A 3DYMA 4GG9A 1R87A 3N17A 1UPMB 2YL6A 4ZQPA 3UI4A 5I3KA 2ZX6A 1EXPA 3B3DA 3CT2A 3ICJA 1OCJA 1MW1A 2D2JA 4EPBC 3G1VA 1V4YA 1E6PA 5I23A 5K9XA 2VDGA 5HANA 3G1YA 5A3HA 3L66A 4J3ZA 2F2KA 1PIGA 3ZM8A 2A85A 3C2FA 2KGJA 8XIAA 1ME7A 3KZ7A 1H7RA 1ME8A 4DI8A 3TQPA 4HHHA 3U4FA 3VXGA 5LGXA 1SR9A 1SZFA 3TFXA 2QEZA 1PZ1A 3BK0A 2GQ8A 1GPFA 2ODOA 1FTXA 4P5UA 4N7QA 4ODOA 4FXJA 1GEQA 4K7YA 4F2BA 2DIKA 3N29A 3WG6A 3GXIA 3MDWA 3QZEA 1XLCA 1R8LA 1LWJA 4O0KA 5ABFB 4C90A 4U4MA 3A5VA 4DUXA 2Z1SA 3MO4A 4JKLA 4FLOA 1SJBA 4KCUA 1GG1A 4IJRA 3PZMA 1HQTA 1UP3A 2WHJA 1AQHA 5J6EA 1WOAA 3OVQA 4DF0A 4ICMA 2YBVA 1ADSA 4ZO6A 3MDYB 2W66A 4IQJA 4ZXOA 1SYTA 4DJFA 2VFEA 3DESA 3TN3A 1EF2A 4IX2A 1SZGA 2A3LA 4C6MA 1DBTA 4FX8A 3KDNA 3PRDA 1R47A 2JF7A 4IUGA 3GNNA 5T8GA 1I0BA 2IQTA 4UTWA 5HQMA 4LQ1A 4LCSA 5CPTA 4JTFA 3FX4A 1XLIA 1ZTVA 1IZKA 3G0UA 1V3JA 1C3FA 4Y9AA 1V6VA 1ISVA 1ALDA 3EBVA 3SUVA 4Z1CA 1GUVA 1DXFA 4MSSA 1VPQA 2DZUA 1KT1A 3POCA 4YMZA 3W2LA 3H9RB 2Y8UA 2V2DA 3NQGA 1GTHA 5DO8A 2MANA 1WO2A 5AHLA 3WMLA 3T07A 1XR2A 2AKMA 3OJGA 4NVTA 8RUCA 4MFEA 2H3DA 4XIAA 2DJXA 3QC0A 3SBFA 1PDYA 3QTPA 1R38A 2TPSA 3LHTA 3AIWA 5C2GA 3LLDA 4HBKA 1W8GA 3S9ZA 1SM9A 1LROA 2X1RA 2PP0A 4IP7A 3D47A 2DSZA 3OVPA 4L56A 1EF3A 3MVTA 2FQIA 3DUGA 1F6KA 3TP4A 3QR1A 1CT5A 3DC8A 3OP2A 5JIWA 2C7FA 4N6FA 4GUFA 2VR2A 2IQ0A 3PPGA 1VYPX 1D9EA 4B4HA 4QHRA 2GGIA 3C3NA 2D9FA 1POKA 2HWGA 1HF6A 3DFTA 1E0WA 1JRBA 3WD1A 3SUUA 2X42A 3MWCA 1N8FA 2F21A 1VS1A 1EDTA 2VDIA 2BP1A 5E6ZA 3LA4A 5IFTA 3ZSTA 1JNTA 4C6JA 3HBLA 4C7GA 3HG4A 3L4XA 2VVNA 3KVJA 4CD4A 4ZO8A 1HKJA 3BJSA 1BWLA 3QY7A 4H6KA 4KS0A 4ZBCA 3EPOA 1J0ZA 1XIIA 2VQUA 3QPYA 4O1EA 2FGZA 4S2CA 3IJ7A 4HA1A 1S2TA 1KGWA 5AZ0A 3G0SA 3G1RA 2CXGA 1VBRA 1LOSA 3CUHA 4MIMA 4Q8VA 1RUSA 3M7SA 3I68A 4QE1A 1PZ3A 1B4KA 3TDFA 2E28A 3M46A 4AD2A 4JIHA 4O53A 1W1VA 3LMZA 3GIYA 3UXKA 2J6VA 3KE0A 4A3RA 1MEWA 4YL2A 2X1SA 5K2ZA 1V0NA 2VC9A 3BCDA 3EX1A 4XUYA 5REQA 1AW5A 1Q7QA 5EY5A 1L6WA 4QEEA 1Y0EA 3MB9A 4DJFC 4ROPA 1V0KA 3AICA 4YCPA 2CIPA 1V6YA 4UR9A 1XP3A 4A8IA 3H70A 4L61A 3VX1A 2J47A 3WK0A 5HMFA 3RO8A 2FTPA 1UMYA 3FJ4A 4O1DA 2VCBA 1JI2A 4C1NA 3R43A 3UI6A 2BVWA 3UETA 3AU2A 5AC6A 1XWYA 1L0PA 4S3GA 2AQOA 2BLEA 4UTTC 5D38A 4HT3A 4L3NA 4NZ5A 3B4YA 3HG2A 1A5NC 5A8OA 3PSVA 3VINA 2F6XA 3NQBA 2AOSA 1QOPA 3DN5A 3OU8A 3W6YA 2I56A 2XZ7A 1NELA 4QSFA 4UFMA 4C6PA 3OGSA 2R1PA 4LXFA 1S2VA 2EF9A 3W2UA 1QNVA 4CQBA 3AU6A 5HW8A 3VZYA 3SUTA 1ODUA 1SPQA 4JOMA 5E0FA 1JDDA 4LGXA 3QXBA 5B7ZA 1OC6A 4LAKA 1OWQA 2Y85A 2PDCA 3DKLA 3W27A 4AIOA 3QV6A 1F8AB 4DO5A 3P14A 4EXAA 2B7QA 4OIFA 4KFPA 3ZR6A 1GYNA 3WEMA 4U3CA 2V2CA 5FSDC 1I4NA 1KRMA 1UR9A 4MY9A 3SCRA 4CGTA 1AD1A 1UYQA 2QJIA 5DLCA 3SCOA 1VQTA 5E09A 4J5NA 1J96A 4LYRA 4AY8A 2RQSA 1G0CA 2NXIA 3C52A 1FVPA 3HFYA 1ICQA 9RUBA 1QWGA 4DZ3A 4IHCA 3LCLA 4IOTA 1DHPA 4J3UA 4X63A 1NFPA 2REQA 1G69A 1BVWA 4WD0A 4O54A 4RXGA 4D6CA 1MXSA 3B8WA 1SGJA 1G6CA 1D7JA 1C7SA 1QHZA 1NEYA 4PB3A 2B0MA 2OFNA 4AMCA 2CZFA 5A6JA 1Q8AA 4M0XA 4NZJA 4P7QA 2I1OA 1W5QA 3E0FA 2Y7GA 3GY1A 4EPKA 1W56A 2E4TA 4L64A 4PMJA 4DWSB 3R8RA 2JQXA 3TWAA 2VN1A 1DKWA 3PBVA 3LD5A 1FRBA 3GTYX 4F2TA 4CLMA 3TA9A 4M6UA 5F1VA 4D6FA 4MB5A 1FDJA 1VBHA 5EMYA 5FAJA 3K4AA 1L6GA 2KO7A 1GGOA 5CPSA 3D3AA 3EPMA 4XTIA 4PTMA 1E0TA 4S1FA 1RCXB 2EJAA 4XKMA 4WOZA 5AC4A 5DIVA 5F2GA 4I90A 5C6MA 3BH4A 3VIPA 1YPFA 4AF0A 1W3LA 4RX0A 3GB6A 3GNXA 1KBJA 2X8RA 2GL5A 2J7BA 2PDUA 3FNDA 2NZLA 2LKNA 1RQBA 3HB9A 4EE9A 5EYWA 3GG0A 1M01A 1H7PA 3F2DA 3VE9A 3PANA 3U4AA 4WY0A 2OT1A 3UYCA 3VKDA 1JL8A 4O12A 2OWXA 1RCQA 5I3JA 2I5IA 3LN3A 1GEHA 4B5VA 3W76A 4C1LA 4IF2A 3HTWA 3VIGA 4REQB 4W9QA 3LY0A 4JTJA 3EMQA 4ONVA 1MRAA 1L1PA 4CD8A 4AVOA 4D1IA 3CUJA 3S0CA 1PTAA 3V5OA 2WV8A 4F0RA 5GNXA 1SFSA 4XQ6A 1SFLA 3EOSA 2JALA 4QJ3B 3S2LA 2WVTA 4D1JA 2VEPA 2OXNA 4MZYA 4MZ1A 4HPJA 3KABA 1S3TC 3PAOA 4L4MA 5HT1A 3W7DA 1ADDA 1D3HA 3NQ7A 3S2CA 3W6MA 4UUIA 3AFBA 2PPPA 4ZB0A 1KCLA 1TV5A 2HDJA 3GVGA 4NNBA 2EKGA 1HKIA 3H26A 3TEVA 3GHSA 1HKKA 3NO3A 3UJRA 4N9DA 2CZ5A 3SW6A 3M0IA 3BC9A 1DE5A 1UWAA 3IIZA 3NQFA 3L9CA 4LUSB 5HMEA 3TH6A 4LB3A 3F4WA 5IHSA 3B9NA 4O8AA 1F3WA 2ZCGA 3BGGA 1VC4A 5JBDA 1IT8A 3BO9A 2WYSA 4RZ5A 3ALFA 3EOOA 2LJ4A 3NM1A 3TCEA 4LV4A 1XLEA 3LOTA 1XKJA 3LRKA 4C6IA 1WAUA 4U3AA 5U4NA 3ODKA 3APYA 2GPTA 4PTVA 3FFSA 3GLCA 3GYCA 4NJGA 2PLJA 4QFUA 1AW2A 4E3TA 1CECA 4IMAA 3II1A 1EIXA 3O6AA 3ITOA 1AQMA 3A23A 3WJXA 1MEHA 3M0XA 2WKJA 3U9IA 3OEXA 4AX7A 3OB8A 3KHJA 4LY4A 3ZFHA 1UC5A 2PZNA 3T40A 1I0DA 3EKZA 4JIPA 5DF0A 4DAFA 1XIJA 2FVMA 3FSUA 1GRJA 4DXVA 4BF8A 1X8CA 2XSXA 4PUMA 3WDQA 3O15A 1HJWA