2YBTA

Crystal structure of human acidic chitinase in complex with bisdionin c
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
377
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ACIDIC MAMMALIAN CHITINASE
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 377
sequence length 377
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybtA01
4DM1A 4CU6A 3L4TA 3AQUA 1OIMA 1V3MA 1PIFA 1VFOA 3RCNA 4HA1A 1PPIA 2WMFA 1DTUA 2WW5A 2QF8A 1IV8A 3PHAA 1OM0A 1JZ2A 2BHUA 1E0WA 4PBGA 1EQCA 2XVKA 4CN1A 2CKSA 3D3AA 4JKKA 3CZEA 4DUXA 1QI3A 3WFLA 2J4GA 2QLYA 1LLOA 1CLXA 3FAWA 1GOMA 2OSXA 2FH6A 4JFSA 1E1EA 5GPRA 3T0AA 3M6DA 1H1NA 4PMXA 3JUGA 3VDHA 4B9ZA 3GDBA 5JUVA 2WXDM 1US2A 3FHQA 1DWGM 1PX3A 3WL0A 4MDOA 3TONA 2FGZA 4L4PA 4U31A 5BRQA 5I0DA 3W0KA 1TA3A 1VB9A 3FAXA 3WNMA 1XCXA 4IUGA 3VIKA 1ZS2A 4U3AA 1E5NA 4Z2HA 3EMQA 1DWIM 1V6YA 2CITA 2CBIA 1QBAA 3AMLA 3NSXA 3GXMA 1GPFA 3WUFA 4MB4A 1B31A 4AY1A 2BS9A 1OD8A 1TUXA 5IHSA 5AY7A 1WE5A 4AZBA 4BZYA 4CUCA 1NOUA 3HJEA 3IAQA 2D3NA 4AD0A 1W9XA 2WHLA 1YQ2A 5D9NA 2CIPA 3RPMA 4PMVA 4OBSA 2OLHA 1QNOA 1FOBA 2PWHA 3HMCA 1M03A 2E3ZA 3QHNA 4QLJA 3POHA 2B31A 2ZE0A 4KRTA 1HKMA 4LPCA 8A3HA 3SUUA 1UKOA 3A4XA 3CIVA 1TCMA 3VINA 1QNQA 5AYIA 3VGHA 1C93A 3AS1A 1OT1A 1V0LA 2V3FA 2OYMA 3ZJ8A 3G6LA 2FGLA 4U5IA 2G3MA 1BF2A 3LPGA 3K4DA 1EDTA 1GCYA 2J7EA 4H2CA 3WDRA 4HMEA 5C70A 3GZAA 3VPLA 3VNYA 2ZUVA 2DT3A 1MXDA 2JEPA 2Y2WA 4CVWA 5CJ5A 4HMCA 4WJXA 1GOQA 1M53A 1UWSA 1H49A 1V02E 2C0HA 3D5HA 3WF2A 2ZXDA 3QOMA 5A8MA 5I2UA 4QDMA 2VVSA 2CESA 2G41A 3ZSTA 3WDQA 1KXTA 4C7FA 3ARSA 5BRPA 4GXPA 5BXTA 1A3HA 3W6MA 1AQHA 1W3KA 2VX4A 3AHTA 5FD0A 3L2LA 3AI0A 5CSUA 1WZKA 1NWTA 2JIEA 2XYLA 1CGYA 4W88A 1JIBA 3WUGA 3ARVA 1VENA 1CYGA 4GZJA 4D6FA 1R87A 2W63A 4AZ5A 2WB5A 1JL8A 1W9UA 2F61A 1WO2A 3VIGA 3GH7A 3BAXA 4W7UA 3A4AA 1B3ZA 1BVNP 2YA0A 3FN9A 4XB3A 3NDYA 5JBFA 1OGBA 1GHSA 3BAKA 3F4VA 3POCA 2VNCA 2XSAA 4IM4A 3CHCA 2OWXA 1IT0A 3OB8A 2ESCA 1OBAA 1UD8A 4IISA 1E4NA 4FLSA 2W92A 1NQ6A 3TTQA 1L8NA 2BXYA 1UR8A 4WKHA 2J7CA 2J47A 1C7SA 4LXFA 4C7DA 3VD9A 2CBJA 3OGRA 3VVGA 4MJ2A 1J12A 1AVAA 1R7OA 3WKZA 3N18A 1BYBA 1UD4A 3AIWA 3O9NA 1QHPA 2UY4A 3A3HA 3ZR5A 3F5JA 3QGVA 4UFJA 4AEFA 4WIWA 3PZMA 3ZIZA 3U5YA 1KR1A 1PX8A 2XSBA 1JI1A 2O9TA 2YJQA 3B9AA 1Q6CA 1V0KA 3CHDA 3WMCA 1BGAA 2BFGA 1UA3A 2ZX7A 1LF1A 2E40A 4E2OA 2XIBA 1BAGA 2ZX6A 1ZU8A 1DHKA 2WVVA 3VOCA 2CNCA 5DEZA 3ALFA 1E6XM 4W7VA 1HJQA 2DSKA 1JD7A 1W1TA 2NSXA 4D1JA 3W6LA 3AXIA 3CGTA 4Z2LA 3MKKA 4M56A 4Z2GA 1C7TA 1GOOA 4TVDA 3ZSSA 4RL3A 5DFAA 1TMQA 3GXIA 1PJ9A 3W29A 5D9MA 3WEOA 4R5EA 4EK7A 3SUVA 1E4MM 1HP4A 4PTVA 3ECQA 5DF0A 2J7GA 4P7QA 3L2MA 1MW3A 1NP2A 2PWGA 2VR5A 4ZXOA 4WK9A 3BSHA 4HPHA 2WMIB 1CDGA 1GVIA 4JIEA 1B2YA 3VGBA 3ZOAA 1DWAM 3OLDA 3MV11 3SEPA 1UA7A 4QFUA 4QLKA 1ISVA 4LYRA 2GJXB 3MUIA 4RE2A 4D6EA 2WSPA 1VEPA 1W3HA 4TVCA 4W93A 2ZXAA 5A8QA 1TR1A 1CGVA 1CGWA 4DWSA 2J8GA 4HTYA 1R7AA 4AZIA 4HMDA 4P8VA 3PZOA 1LWJA 5AC5A 2C8NA 1B90A 2OWWA 3UR7A 4AD1A 2O92A 4F9DA 1E1FA 3VM5A 3RIKA 2RGMA 4QCEA 1BHGA 3N13A 2DSWA 4ACYA 3CUFA 4GI8A 1W91A 4E8DA 3WY1A 1E70M 3S6TA 2DT2A 4YPJA 2O9RA 1CENA 1GQIA 2W62A 5ABFB 2W91A 4J3SA 1NM9A 4CCDA 5A69A 1C8YA 4UFKA 3OG2A 3TTOA 4AC1X 3GH5A 1EA9C 3VU2A 1ZL1A 3WMBA 4TTGA 2J62A 4Q7NA 2CEQA 2WMGA 2E9LA 1GVYA 1FFRA 2BNJA 1JXKA 4UR9A 4TTUA 4TX6A 1OB0A 3WQ5A 1ZJAA 3B9EA 4JFUA 3O2LA 3G6MA 1VFUA 2J7HA 5CPSA 1E4IA 2Y5EA 5GQBA 4NF7A 1YHTA 3VD7A 2DPEA 1EDGA 1VAHA 4UOJA 4LX4A 5BYWA 3BXWA 4L4OA 4AZHA 5CGTA 4CVUA 2E8ZA 2YKKA 3WUBA 1XC6A 2GK1B 4MB5A 2EPOA 1W2PA 2WHJA 1Q6GA 2PWDA 1CGUA 1HKJA 3AIQA 1VJSA 2IXUA 4V27A 3UETA 3MUAA 3QHOA 2BY0A 3AISA 2J79A 3SCUA 5M5DA 4Y7EA 1I1XA 1D7FA 2DIEA 1HL8A 2X8RA 4GIAA 2BY3A 3GM8A 1J0HA 3O6AA 2ZUWA 4P7OA 3AMDA 2J74A 1NOWA 2XGBA 4K68A 1BVZA 2D22A 2F8QA 2VL4A 1O7AA 1PZ2A 4C7GA 1LL4A 3CH9A 1OCQA 4ZXLA 4CD8A 3KE0A 5TD4A 3VIPA 2J78A 2JF6A 1SMDA 2VX7A 1SR0A 4FLOA 2OSYA 1TE1A 4D6IA 4PMDA 1JZ8A 1E43A 2CBUA 3ARXA 2PBGA 3B8SA 5FL1A 5FIPA 4U3CA 2DGAA 4JFWA 5EBAA 1JZ7A 2YLLA 3VM7A 1FH8A 4YHEA 2Y8VA 3U7VA 5M03A 1TG7A 2W4XA 4GQRA 4LYQA 1QOXA 1V0NA 2Y8KA 5I78A 3A4WA 7TAAA 5I3DA 4UZSA 4MPKA 2E0PA 5EB8A 3EDKA 5CG0A 3IK2A 1JNEA 2W66A 4JZ5A 3VGDA 5AYBA 3RO8A 4N0RA 5KZ6A 2EEXA 3K8LA 2D0HA 3UG4A 2QHAA 1XD1A 3AMGA 5BROA 1C90A 1JAKA 1QI4A 5I5RA 4UFIA 4BQ3A 1OGGA 1XGZA 1VFFA 2VTFA 3ZT5A 3AS3A 1JAEA 3MS8A 3MSDA 4UZUA 1V3KA 4J3TA 2YBTA 5A8OA 1Y7VA 4J27A 1M01A 4DM2A 3FNDA 1ZBKA 3PTQA 3WEZA 2DSUA 3OA5A 2QPUA 4FF5A 4M80A 1E71M 2A3HA 4ZFMA 2ZX9A 3LPOA 1H3GA 2GSJA 4CCEA 1W1YA 5C71A 5DMYA 2ZWZA 2WWDA 1BSIA 3SCNA 1V3JA 3AROA 4MTVA 4MNKA 3VGEA 3M46A 5EMYA 3WDJA 1JYXA 3WD3A 4PTWA 1KCLA 1H0IA 4AZGA 4MDPA 3BAJA 4PMYA 1R85A 3WNLA 3BSGA 2ZICA 4M8UA 1FP9A 3KWXA 4P8WA 2ZUTA 4ATLA 4UFMA 3DC0A 2YL9A 3IJ8A 1JZ3A 3DHPA 1V6UA 1DWJM 1G9HA 2X1IA 3EDFA 3AZRA 1ITCA 3GYCA 4TVUA 1E3ZA 3TTSA 3ZQ9A 3THDA 4P8UA 3UG3A 4B3LA 2O9OA 1EOMA 1BGGA 1OGSA 1WDSA 3T0BA 5LA0A 1BG4A 3BMWA 3EMCA 1UR9A 3ALGA 2DIJA 2VURA 1QW9A 2WCSA 2YL5A 2J8FA 1CGTA 5DO8A 1X1NA 1GOWA 1ZBCA 2ZUNA 1P6WA 3BMVA 3J7HA 5ABEA 4UFLA 1J10A 1J0ZA 5HBFA 4X9YA 3T0DA 1RP8A 5D9PA 3UESA 1GORA 1IZJA 3VD3A 3WH5A 1CWYA 4W8LA 1E4LA 5CLWA 4J7RA 4LQ1A 4M29A 3VILA 5A6AA 3N12A 4QP0A 2PBOA 1B3YA 1ZB5A 3WMSA 2VO5A 2XGIA 1GQKA 2EXOA 2JEQA 4A3HA 3BCDA 2AMGA 2X2YA 4AIUA 3F5LA 2DSZA 3ZT6A 4TOQA 3AHXA 4UQCA 4AEEA 2FH8A 4UOZA 1L0PA 2JE8A 2WVTA 4UCFA 1UWIA 1SFSA 1MW1A 3WD0A 1GW1A 1N82A 5IXEA 3WL1A 1CBGA 5A8NA 5E09A 3PZNA 2BY2A 3GH4A 1UKQA 2VVNA 4D6GA 3MANA 5D4YA 4XZBA 3L4UA 4OZOA 4MNJA 3UR8A 4GQQA 5IHRA 3AOFA 4H04A 3PZ9A 5CXPA 5I6SA 3N04A 1UD2A 2WLYA 2ZXQA 1DWFM 3WEMA 3WQWA 5IFPA 4W7WA 4BCEA 3VIFA 1UR1A 3I3EA 3N1AA 2NT1A 3RJYA 2DSVA 4KGLA 3WBEA 5A95A 1NWSA 3CZLA 3CTTA 1HP5A 1UUQA 5E6ZA 3CZ8A 1HJUA 1M7XA 3B9DA 3VIMA 3WH6A 1UOKA 3WH9A 4OUEA 3WD2A 3FXYA 1KGWA 4AISA 4RE3A 2YA1A 3T2OA 1W9BM 2X0HA 2XM2A 2WKGA 4F8XA 3WNPA 3CZJA 1DP0A 2VUYA 2V5DA 1E55A 2XJ7A 4A3YA 1EGZA 5GNYA 2OYLA 4JFVA 2XWDA 2QMKA 4X0NA 1KXHA 2X05A 2WMIA 3VUPA 4W8AA 1BG9A 3AS2A 2ZOXA 3OZPA 3EYPA 3N9KA 4PSPA 3W81A 1XH0A 3ARYA 2YDRA 2GJXA 5IDIA 4PUDA 1X6LA 3W4RA 5D8WA 3GXFA 3F5KA 4GI9A 3AIBA 3CUJA 3UERA 3SUTA 3NSNA 3ARUA 1KGUA 4AYSA 4HOWA 3OBAA 1MFVA 9CGTA 1KBBA 2XPKA 4OIFA 4MAZA 3BGAA 2VQUA 1FFQA 2BY1A 3OLGA 2CYGA 5M3WA 4Z2KA 3K4AA 3PBGA 4PMQA 4D71A 3GNRA 4H8VA 7CGTA 1V03A 1HF6A 1LJYA 3W24A 1WAWA 4GO9A 3CUIA 4AXNA 5ABFA 5HXMA 2Y4SA 2D24A 4ACZA 5LA2A 3W82A 4HP5A 1UWUA 3SCTA 4WSJA 4HPGA 4CCCA 2VRQA 3KL3A 1UZ4A 4YHGA 1UR0A 5A8PA 4UQEA 5A3HA 5BXSA 4MNMA 1JXJA 4CD5A 4UQAA 3FW6A 1KR0A 4BQ5A 4JCMA 4XV0A 3SUWA 1KQYA 3S2CA 1GOKA 5A6BA 1WDRA 3WF4A 3AIEA 4JL1A 4WLCA 2WLZA 1V6WA 2VZSA 4W87A 1HL9A 1LG1A 4TUFA 4D6JA 2OWCA 5EFFA 1JYNA 1VEMA 1WKYA 4OOZA 5M17A 3AIUA 1H5VA 4AD5A 4ZE4A 4UQ9A 4KRUA 2UY3A 5CSYA 3U5UA 1FA2A 5CPTA 3MV01 3PZTA 1FP8A 4DWSC 3AMCA 1OIFA 3NSMA 2YL8A 2VZTA 1CGXA 3PTMA 1TZ7A 2MANA 1RH9A 1PZ3A 2GDUA 2ZUSA 3BAWA 3WENA 4PEEA 1H4PA 3VTRA 2GFTA 3VMOA 4H8HA 3AHZA 4URIA 1B0IA 3KL5A 3OLIA 1KWGA 2XTKA 1GONA 5HDRA 2E9MA 3GTNA 3SCWA 4W8BA 1CIUA 3K8KA 4UTFA 1OSEA 1UD3A 1GZJA 3WDPP 4ATWA 3I3DA 5HPOA 5JBDA 1PX4A 1W1PA 3GBDA 1GJWA 3PZGA 1CXLA 1UR4A 4MB3A 3E1F1 2DT0A 1B30A 1JGIA 2BVYA 2TAAA 3I3BA 1GQLA 4B16A 4M82A 1FH9A 2D20A 3PZVA 1V6XA 1NP0A 2WCGA 3RILA 4H41A 3THCA 4JKLA 1UWQA 4D1IA 1JZ6A 1JF6A 1EH9A 3VDAA 3ZMRA 5I23A 2WMKA 1J0JA 1XYFA 2WANA 2PC8A 1K9FA 3L4WA 4OOUA 1KB3A 1US3A 1ZJBA 1GUVA 2X0YA 4F9JA 1NWRA 4PN2A 2EBNA 4BQ2A 3SURA 2WSKA 2VOTA 4WF7A 3CMJA 3VDBA 3MSGA 3T2QA 2NW0A 1JD9A 1VF8A 1B3WA 4RE4A 3WH8A 2W61A 1UH3A 2A3EA 3ARQA 1HN1A 1CNVA 3U57A 2VX5A 4XUYA 2GJRA 1QI5A 1XH2A 1JZ4A 1UD5A 3APGA 1E73M 2WHKA 1DWHM 2CETA 5LYRA 1J11A 2YBUA 1H11A 3ZM8A 2W5FA 1BPLB 2PWEA 3AIRA 5BXPA 2VMFA 4J28A 3VIOA 2VCBA 1UH4A 5D8ZA 1ISYA 4PUEA 4JFTA 4UOQA 2Q8XA 4DUWA 4ATDA 2CERA 3MMUA 3TP4A 3VDCA 3SCQA 5A2CA 2JFEX 4GI6A 4P7RA 4CU7A 5CPQA 5F7UA 1E6ZA 4M24A 1JF5A 1E72M 3VGFA 1KQZA 3MUZ1 5DT5A 1WDQA 3WNNA 3PZUA 2QPSA 1CXKA 2FHBA 3GXDA 3MMDA 5BWFA 3BCFA 2WAGA 4HOXA 3VD5A 1CZ1A 3ZT7A 2VZUA 1WCGA 2C7FA 3AMKA 1NWUA 1QHZA 1ISWA 1KGXA 4EAMA 3A6OA 3EDEA 4HU0A 1E9LA 3VIHA 1UKTA 3MMWA 3K8MA 2PWFA 1ZBWA 4W84A 5I77A 1MWOA 1KXQA 4EANA 3DYMA 2NT0A 4B15A 2VT0A 4CD4A 4DWSD 1H41A 1LL6A 1Q6FA 2J7FA 2VI0A 3WIJA 3WQ4A 2CPUA 2JF7A 1U33A 3AHVA 1G01A 3TOPA 3BAYA 3RM9A 3BLKA 1V3IA 3VD4A 2QV4A 2D2OA 1KBKA 3CUGA 1BFNA 4FK9A 1XSIA 3ARPA 2VJXA 2G3IA 1H2JA 3II1A 2YDQA 5E9AA 1QNRA 3VMPA 3WDIA 1OINA 1V3LA 3DECA 4HA4A 2EO7A 1C3FA 3PN8A 5A6LA 3VKKA 2BVDA 4CU8A 1VBRA 3AIVA 5A1AA 2WC7A 1MXGA 3SCVA 3WQVA 3CPUA 4PMNA 4V28A 2BHYA 3QHMA 1Z32X 4PMOA 1B9ZA 4AIEA 2FHCA 2WM0A 2WBKA 3T2PA 1W9VA 1XHGA 1UKSA 2IXVA 4PSRA 1EHAA 2D3LA 3FY1A 2WVSA 5A6MA 4PMZA 3GNOA 1UQYA 1MW2A 1PAMA 3IANA 3AFBA 1HKKA 5IFTA 3QR3A 2ZXBA 1IZKA 4PTMA 2XG9A 1CXHA 1EO7A 3NDZA 5GNXA 4AZCB 2Y24A 1E0XA 5ABGA 4J3WA 3SCPA 2BV9A 3K1DA 3RJXA 1I75A 4NRSA 4W85A 4U33A 1HKIA 1C91A 2V3EA 5A6SA 2VRJA 1O6IA 5E70A 1CXFA 1SMAA 4CN6A 1M04A 3WD4A 1JI2A 1C8QA 5A6KA 3CLWA 3WN6A 2A3AA 2ZIDA 5D9OA 2CHOA 2A3BA 1JDDA 2XVNA 4B9YA 1W9PA 3T08A 2A3CA 1JDCA 1GHRA 4QLLA 4WSKA 1G0CA 3VX0A 2OSWA 2YIHA 3VO0A 3WNKA 4AIOA 4GO8A 5CQ1A 2JALA 2XVGA 3KL0A 2GUYA 1BLIA 1HXJA 4J3UA 5JH8A 4GINA 4AD2A 4A4AA 1WZMA 4NSBA 5JIWA 4H8UA 4FLRA 4JHZA 1R8LA 3VIIA 1W3LA 4W5UA 2OYKA 1UWTA 1Q4NX 1NH6A 3N11A 1FH7A 1HJVA 1WNOA 2YLAA 4KWUA 1B1YA 2WZIA 4AW7A 1W9DM 2V3DA 4AWEA 3ZJKA 4UQBA 2VCAA 1X6NA 4AD4A 3ARZA 3RMEA 2UY2A 4PTXA 1C92A 1E40A 4JKMA 1JG9A 5ABHA 1RPKA 2CKRA 2QMJA 3AXXA 5HNNA 2VR4A 4E8CA 1EOKA 1G94A 1HVQA 1MQPA 3NIYA 3L4ZA 4OKDA 3ZR6A 1I1WA 2DEPA 4EE9A 4PMUA 5BXRA 2VZVA 2EPLX 1OWQA 1K6AA 3M7SA 3W28A 4D72A 1U30A 1ESWA 4P7NA 5LA1A 4XX6A 4M1RA 4PCSA 1V6VA 1MVYA 4BQ4A 4OJYA 1RP9A 4PMRA 4CN4A 5A6JA 2UY5A 1LL7A 4HZ6A 4W86A 5E0CA 5HOSA 1D2KA 3NCOA 1G5AA 4KGJA 6A3HA 4S3JA 1CLVA 2VC9A 4AD3A 4D6DA 4PRWA 1CEOA 2F2HA 3QOKA 2WWCA 3HN3A 4NZCA 5DT7A 3MU7A 5GNZA 1V0MA 1V08A 3CHFA 1PIGA 3OGVA 4GZEA 2EPKX 4X0VA 3NJ3A 3L4YA 1K9TA 3T09A 1A47A 1E6SM 3DYPA 1UD6A 1F4AA 1ECEA 4TXEA 1CXIA 3W38A 2GJPA 2XVLA 3AJ7A 2BHZA 4MB1A 1TA3B 2XUCA 1EDQA 1E5JA 2ZUUA 4OBRA 3KZSA 4QAWA 4V2XA 1UYQA 2DH2A 3WF0A 2WK2A 3CMGA 1AQMA 1B3XA 2Z1KA 1XSKA 3WSUA 4P8XA 4WKAA 1C8XA 2WPGA 5CGMA 1R86A 1QPKA 1UHVA 4PCTA 4UNIA 4UQDA 1V3HA 3K46A 1W32A 1HJWA 3PTKA 1ODZA 1E6RA 1JYVA 1KFWA 4CGTA 5I24A 2GDVA 1WDPA 3CUHA 2UWFA 1LWHA 1WP6A 2G3NA 1MFUA 4E4PA 1B3VA 3ARWA 1ODUA 1UKPA 3WQ8A 3DHUA 2J7DA 2V5CA 4HZ7A 3WQ6A 3MUY1 4H7VA 2CBVA 3W27A 1VRXA 4N42A 2BVTA 4MJ4A 3SIMA 3ARRA 2D23A 3CO4A 4ZE5A 1F4HA 5AC4A 4F79A 1QI0A 1KWKA 1OD0A 4CKQA 4Z2JA 1XH1A 1HVXA 3MO4A 3W37A 2YOCA 1E15A 2JIWA 3LMYA 1JZ5A 3AXHA 3AHYA 2WMHA 3SCRA 1VEOA 2GK1A 4PYSA 4GPNA 1XYZA 2ZX8A 3UEQA 1J01A 4GZIA 2J77A 3BLPX 3NUKA 3WNOA 2VQTA 3LPPA 2E4TA 4R27A 3AYSA 3OGSA 2YDSA 1TVNA 1J0IA 4FMVA 4IPLA 2VX6A 3PZQA 2CHNA 3SCOA 4AZ7A 2J75A 1NARA 3SUSA 5JIPA 1XRVA 3W26A 4TX8A 3OIHA 2XFRA 1AQ0A 1FHDA 3ZJ6A 4XZWA 3VMNA 1E6PA 4HA3A 4CD7A 4LGXA 1E3XA 3WFZA 3L4XA 2DH3A 4LYPA 4GKLA 2PI6A 2O9PA 3BC9A 3OZOA 2WCAA 1LG2A 4AZ6A 1K9DA 1MYRA 2VRKA 2E8YA 1DEDA 1SYTA 2WBGA 2XFYA 4BF7A 4MAVA 1QI2A 5FL0A 2RGLA 3W53A 1WPCA 3VGGA 3FHAA 1QBBA 4ML4A 1XV8A 3W25A 2WC3A 1QNPA 4B3KA 4BS0A 1UH2A 3NYDA 3M07A 3DYOA 4Z2IA 1W1VA 1XSJA 3L4VA 6CGTA 4ZENA 1CXEA 3VNZA 1VIWA 1WZLA 5ECUA 3BAIA 2WYSA 1E0VA 1UWRA 1WB0A 5FOOA 2AAAA 4KMQA 5KEZA 1GQJA 3SCSA 2YA2A 1QW8A 3WF1A 3VX1A 1KXVA 1U2YA 4BA0A 2XFFA 2V3GA 5A2BA 3AICA 1H09A 1PEZA 1TVPA 5CZKA 3WBAA 2EPMX 2VZOA 2XM1A 1JFHA 1ITXA 2XHYA 2FDMA 1GNXA 4ACZB 4FLQA 1LQ0A 1OT2A 1EO5A 2WNWA 2WZEA 3IAPA 4P7LA 5EFDA 4MNLA 2G8ZA 4NRRA 3CZGA 3RDKA 2XIIA 1CPUA 5E0FA 2WZHA 3WH7A 1FHLA 3AYRA 3GNPA 1J18A 2EJ1A 1HJSA 7A3HA 1XD0A 4HZ8A 1BYDA 4ZEPA 5FCZA 2CCRA 4JCLA 1E6QM 1HX0A 3CZKA 2W67A 1EXPA 2G4FA 3PZIA 5I79A 5E6YA 4JAWA 5A2AA 3ARTA 1S46A 3AS0A 4IPNB 3LPFA 1JDAA 1RD6A 1KCKA 1HT6A 1VFMA 4WKFA 6TAAA 2WVVB 2EQDA 4W5ZA 2WKLA 2VCCA 2DQXA 2D1ZA 3RM4A 1J0KA 2WMJA 2DDXA 1G1YA 1ISZA 1HNYA 5A6BD 2GVYA 1V02A 5BCAA 2XWEA 1EHNA 3ZJ7A 1HIZA 3WD1A 5FKYA 3VIJA 3AZTA 2PB1A 1J0YA 2FHFA 2XVPA 4YN5A 1W2VA 4UFHA 3U7BA 4D6CA 3UG5A 2WC4A 1QVBA 1BYCA 1CECA 1UQZA 1BTCA 4QCFA 8CGTA 1UR2A 4CD6A 2V38A 3N17A 4W89A 3ZO9A 5HPCA 4AZCA 2YL6A 1J9YA 1MQRA 1Q6DA 4AMCA 1JYWA 4U5KA 1GJUA 1EQPA 3CBWA 4EKJA 5A94A 2ZX5A 4KH2A 5JBEA 2DT1A 1JFXA 1VJZA 3HU7A 2EPNA 3BH4A 4DWSB 1VBUA 3IJ9A 3IJ7A 4J3XA 2WVUA 2J25A 4DUVA 1BYAA 3WUEA 1E6NA 1E56A 1W3JA 1GOIA 4Q22A 2PF0A 2HISA 2Z1SA 4HOZA 2IUZA 1HJXA 2D0GA 1TFVA 1EIBA 3WELA 1CTNA 4MADA 1K9EA 4D6HA 3A47A 2X09A 2HVMA 3EDDA 4JHOA 1BQCA 1AMYA 1QNSA 3EMZA 3AZSA 3N15A 2D0FA 3WDHA 1ZBVA 1UG6A 5CLTA 4M81A 2WHMA 3OLEA 3TA9A 1WZAA 2BXZA 4S3KA 2ZUMA 4U2ZA 1H0GA 1PBGA 5C8BB 1Q6EA 1NOFA 2CXGA 3TTYA 2ZWYA 3KEHA 3UCQA 1UZ1A 1QHOA 2J7BA 3EBVA 1XCWA 4F66A 4NI3A 2G3JA 3EDJA 3CHEA 2E9BA 4U2YA 3RM8A 4JL2A 1MW0A 3GBEA 1JNDA 4J3VA 2AOSA 3WF3A 1ISXA 1MQQA 4HU8A 1D3CA
chains in the Genus database with same CATH superfamily
5I02A 3GHTA 1V3MA 3L5MA 3IEBA 4DJFD 2VGBA 1MDRA 3THUA 2WW5A 2QF8A 2H8ZA 3WLQA 3WQDA 2BHUA 2QXWA 5AVNA 3N9RA 2NX9A 2CKSA 3CZEA 3N2XA 4Y9OA 3F4NA 4WVXA 1UZDA 2P76A 2DIKA 1F76A 1LLOA 3FVDA 4JFSA 3A5VA 4HK6A 3GHUA 4LT9A 2PC4A 4QQ3A 4PMXA 1VFSA 4H9TA 4KWOA 4WEVX 4XZNX 3I68A 3E96A 1F6YA 4L4PA 4B5UA 4U31A 4N7QA 5BRQA 1O5RA 3SGZA 3UXLA 4DPQA 1Q65A 4IUGA 2NX3A 1Z44A 3QJAA 5F2LA 4WDTA 1QZ2A 2XP3A 1AA1B 2W6RA 1RPXA 1DWIM 1TMLA 1TPC1 2H9AA 3NQAA 4F2TA 4PE8A 3GU0A 3GXMA 2DUAA 2BS9A 2PRLA 1WE5A 1JPDX 4BZYA 4G6CA 3LEPA 2XH7A 1W9XA 3RPMA 4DI8A 1TJRA 3W6YA 4A2SA 4G1NA 2NQHA 1FOBA 3M0IA 2ZTJA 3QHNA 4QLJA 3POHA 3NFUA 1HKMA 3A4XA 3CEUA 2Z26A 3M16A 1F8IA 4NZ4A 1GVRA 5AYIA 2ITKA 3VGHA 3AS1A 2NV2A 3W7EA 1V0LA 4CNOA 1XUZA 3ZJ8A 2FGLA 4LC8A 3WBXA 2G5WA 1EIXA 2I7GA 3W74A 1EDTA 1OADA 3DAQA 1GCYA 4GI4A 4ZO9A 2J7EA 1AJ2A 1WKDA 3KS5A 3GZAA 3VPLA 3QV7A 3ZVHB 3NQ2A 3VNYA 2ZUVA 2DZBA 2DT3A 3CT7A 3PBUA 2WNQA 1RCOB 1Q13A 3S6DA 1GOQA 3LRLA 1V02E 2EF9A 5I2UA 3WDQA 1KXTA 1OCBA 4UMCA 2CWXA 3U8GA 5BXTA 4WY0A 1DIEA 2PPNA 2QEZA 1AQHA 1W3KA 4ILSA 3TWAA 5FD0A 5FJOA 4DYJA 1F6PA 3VYLA 1GOXA 1A5CA 3L9CA 1NWTA 2NV9A 3UWZA 2JIEA 1CGYA 4XAPA 4X22A 4YYCA 3WUGA 3ARVA 3A22A 1LRNA 3IJDA 4A3UA 3R58A 3WG6A 1VZWA 1CYGA 3E0FA 2NUWA 4ENLA 1R87A 3LLFA 2Z2BA 3BJFA 3VIGA 1A4LA 3R13A 3A4AA 1B3ZA 2ZRZA 1K3UA 2XZ7A 3FN9A 3VK5A 3W7LA 4XB3A 3NDYA 1OGBA 1GHSA 4Y8EA 3BAKA 3F4VA 1V5XA 1VFHA 2VNCA 3O07A 3IIXA 1US0A 5HATA 3TJLA 4I9JA 4U85A 4DF1A 2W92A 3BLIA 2PTDA 3KCOA 1L8NA 4D2JA 4I8DA 2DZSA 1JPKA 2FFIA 2PTYA 3HQ1A 3ABQA 1C7SA 1B5TA 2QDHA 4XAYA 4JS3A 1AVAA 2DZTA 3N18A 1BYBA 1UD4A 4MWAB 2UY4A 3VNKA 5HNRA 4QG8A 2FQIA 3F5JA 3C8FA 5BRBA 1G67A 1SO5A 2ZZ6A 4PFHA 4KT2A 3WLKX 4NAFA 2XSBA 3BZJA 3NAVA 3P67A 1V0KA 4E3TA 2E6FA 8TIMA 5I09A 3W72A 2ZX7A 1O5XA 2PRHA 1AL7A 2V9DA 3TKFA 3FA4A 3SRKA 3N14A 1FKLA 3SQSA 4E2OA 5KZEA 2ACQA 4JTTA 4UTTA 1XFBA 3TSDA 1E6XM 5AHNA 1W1TA 1JPMA 3W6LA 1VLWA 1KTBA 4Z2LA 2V30A 4OBTA 4QISA 1GOOA 3ZSSA 3HA1A 4RL3A 1TMQA 3GXIA 1NIUA 3WEOA 4R5EA 3PJWA 4DBSA 1LZOA 1XYBA 2ZRUA 1AQFA 4KR0B 1M5WA 1W5MA 3L2MA 1R47A 2VR5A 5TNVA 1RALA 3K4WA 3KCLA 4HPHA 2WMIB 1CDGA 2RDWA 2HV5A 5CCZA 2XDFA 4JIEA 4PZVA 4DHGA 4ZODA 4C5YA 2F2KA 4R9XA 4KFNA 1RSCA 4AVOA 1UA7A 4QLKA 1Q4WA 2VOMA 1OF6A 1W3HA 4RK8A 1WV2A 3M0KA 3NVTA 1FWFC 1QOPA 1I9CB 4XZ9A 3H55A 2OWWA 3UR7A 4IX2A 1AG1O 4HNLA 2RGMA 2QCEA 4KWSA 2DSWA 1ZJIA 1B4EA 3DU0A 4GD0A 1ZCNA 2E68A 4ACYA 4E8DA 1W91A 1VPQA 3RYSA 1E70M 3VNJA 1OF8A 2Z1XA 3M0VA 3UZJA 2DT2A 4NASA 2Q02A 2V5BA 2MUCA 1A5BA 3TNBA 4CCDA 3M0MA 3TTOA 3BLOA 4DRIA 1XG3A 3GWQA 3LG3A 2ALDA 4JD4A 3VNMA 3CWHA 1REQB 5FJRA 2CEQA 3I6CA 4GCAA 3TH6A 4TTUA 1IR2A 1OB0A 5FF3A 4JFUA 2PDCA 2F7FA 5CPSA 4DLMA 3VD7A 4UOJA 2EPHA 3BXWA 3GS6A 4QEHA 1Q66A 2QUMA 2E8ZA 1R3RA 2D73A 4MB5A 1ONWA 2EPOA 2IKJA 2WHJA 2ZA3A 1CGUA 3BOXA 1VJSA 3EOSA 2A1YA 3GTIA 3MUAA 3EEZA 3I6TA 3S3GA 1A5AA 1OZQA 2VD8A 3SCUA 1MEIA 2P0OA 2YFOA 3FOKA 1HL8A 3GU1A 4GIAA 4WZHA 4P7OA 3GVWA 3AMDA 3TN4A 2J74A 3T78A 4O0KA 1ONRA 3GD6A 2D22A 2ZRYA 2F8QA 3MDYB 1O7AA 1J4RA 2PDXA 1TTPA 2QIIA 4ZXLA 4CD8A 5CC6A 5MF5A 3VIPA 2X16A 2C79A 2OSYA 1F8AB 1ZFJA 5FL1A 5EBAA 1EYMA 1JDFA 3VM7A 4YHEA 1N8IA 3NURA 4RV3A 4LYQA 1V0NA 3KACA 1XINA 2Y8KA 2HNEA 4ZQPA 2VCDA 4MPKA 4IQJA 3BURA 2E0PA 4EVZA 4G7EA 4S38A 5CG0A 2PSNA 3N19B 1XDJA 4DQWA 4JZ5A 1FRBA 4N0RA 4HN4A 5KZ6A 4O1AA 3K8LA 1BKSA 3LSBA 1TV3A 4GWEA 3T6CA 3F2CA 4QRNA 3EGJA 1XD1A 4O16A 2HPMA 5BROA 4N9EA 5BMXA 3EWDA 3WJSA 3QSTA 4BQ3A 1OGGA 2HCVA 2QGYA 4EOUA 1SO3A 2OEMA 2Y5SA 3QC3A 3MSDA 4UZUA 3LGDA 4J3TA 1Y7VA 4RNHA 4QDWA 1ZBKA 2FVKA 3P74A 3KBMA 5HR7A 5KETA 3LXBA 1ZAJA 2QPUA 2QIWA 3LTYA 4O1FA 1E71M 4ZFMA 3LPOA 2GSJA 1W1YA 2YCIX 2YDAA 5DMYA 3KCJA 3SCNA 5REQB 3O5DA 3R0DA 5FF0A 5LNWA 3VGEA 3WDJA 4Z17A 4EACA 3DI1A 3WD3A 5EL1A 1KCLA 3HIJA 1TPDA 3N6HA 3E3HA 4GMEA 1FCVA 4F40A 5XIAA 3WNLA 4KERA 2ZICA 4M8UA 1FP9A 2Q01A 5HMDA 3V3WA 2DZXA 3IJQA 1PZ1A 5LNSA 4DAFA 4LVBA 4GBUA 4DZAA 1EP1A 2I14A 1FKKA 3Q2DA 2YL9A 5HWBA 1W3TA 1H7NA 4Z0JA 1OC5A 1XIJA 4ORMA 1POKA 4YU1A 5C2GA 1E3ZA 4PL1A 4B3LA 1EOMA 2QPXA 1OGSA 4GISA 9XIMA 3STCA 4LALA 4R7JA 4XUGA 3BMWA 4PUJA 1UR9A 3UJRA 2VURA 1K4GA 3DOPA 4HYVA 4DRJA 5HW7A 4ZMGA 3T4CA 4B92A 3J7HA 1YBQA 3SSZA 3W84A 3WJZA 4UFLA 1UROA 2HXUA 1FXQA 5HBFA 1KCXA 1NAL1 1RP8A 3UESA 1GORA 3ZYZA 3GNDA 1ZZMA 1CWYA 4GVGA 2H3DA 3L68A 1JCYA 2PGWA 1E4LA 1V6TA 5CLWA 3GVGA 1XYCA 2JGQA 3GRIA 1P4CA 3VILA 3S1VA 1WX0A 2LPVA 1ZB5A 3RFAA 2Y0FA 2QF7A 1B3OA 2C16A 3DN5A 5T8GA 2ZZ5A 3DG3A 4FXSA 2FH8A 4UOZA 1L0PA 1UWIA 1RZMA 1GYMA 3E74A 1MUMA 2VEMA 3TTEA 3GW3A 1N82A 3T07A 3PZNA 2QCCA 3B0YA 3GH4A 3CB8A 1D9EA 2VVNA 3DGBA 1Z9AA 4R85A 1P43A 4XZBA 3L4UA 4OZOA 5IOBA 3UQAA 3TIMA 1S5WA 3JVAA 4GQQA 3AOFA 3PZ9A 1DWFM 1DVJA 5I06A 4HSNA 2ZCGA 1W5PA 1LBFA 3N1AA 2B5UB 3NQCA 4LAYA 3ITCA 4KGLA 1IEWA 1B57A 1TV5A 4LVFA 1W56A 3U3HA 3FKRA 5E6ZA 5DELA 3OODA 1UOKA 3WH9A 3FXYA 1N55A 2AL1A 4AISA 3RO6A 2CC0A 4C6KA 1JCJA 3RPDA 1LLZA 3V0SA 2XM2A 2WKGA 3GIYA 1LT8A 3CZJA 3M0JA 3PBWA 4BKNA 1E55A 3QV9A 3VFLA 4A3YA 1EGZA 2B7QA 2YBVA 2HDJA 4JFVA 4E38A 1KXHA 3IRDA 3U6WA 3N9KA 3LHUA 3W81A 3KVKA 1ME7A 1ZQ5A 3QY8A 3VE9A 4Q8VA 5MKGA 1XH0A 2YSWA 1SSDA 3TJ4A 1FKGA 5JVLA 3A24A 2PCEA 2GJXA 1U79A 4PUDA 3F5KA 5AHLA 4GI9A 5FEWA 3DC8A 2PDWA 3REQA 3S5SA 1F74A 1KGUA 3UWVA 4LAOA 3JZEA 4HOWA 3QPZA 4OIFA 4Q4OA 1FFQA 3DFQA 1PTAA 2Y6ZA 3GNRA 3CUZA 3KZPA 3W7RA 4H8VA 4PCFA 3NQEA 1V03A 5I00A 4TW7A 4LW7A 1QXLA 3D3FA 1WAWA 1S2WA 5ABFA 3V5FA 3XISA 4BF9A 1RVKA 3PY2A 5LA2A 3W82A 5HKGA 4MSSA 4P2VA 3SCTA 2X1TA 4HPGA 2ZVRA 4NJJA 3B8TA 5A8PA 2FLIA 5FEPA 3T8LA 4DNMA 5I03A 2VELA 1GOKA 1KW1A 4KKXA 3WF4A 3AIEA 5H8UA 4H83A 4LAWA 1LORA 2VZSA 1PL9A 4D6JA 2OWCA 5EFFA 1GYLA 4ES4A 1SQ7A 2R1KA 4L1XA 4OOZA 4GH1A 4L1GA 4MWAD 3TX9A 1SFJA 4KRUA 3VFCA 1U1UA 5BNKA 5CSYA 3H26A 3HPAA 4DAIA 1IEVA 4A2RA 1P1MA 4Y9MA 2VZTA 3IWPA 1DXFA 3IACA 1Y8BA 1NDVA 3T81A 3B9NA 3S83A 1PTDA 3VTRA 2UBPC 1JPHA 1OYBA 3KADA 1FCUA 2XU2A 2Z2AA 5HDRA 2HQAA 3PUGA 3SCWA 1UPPA 2ACUA 1JEZA 4QEEA 1CIUA 3K8KA 4C6BA 1OSEA 1M7OA 1PX4A 1RBAA 3GBDA 3R8RA 1ZGDA 4JTCA 4X2RA 5DBUA 4MB3A 5E0KA 2OR2A 5D2TA 3UCDA 4GYFA 4B16A 3I10A 1FH9A 6XIMA 2X30A 1NP0A 5CPMA 4JKLA 5E5CA 2R24A 3P93A 2OODA 4D1IA 1JF6A 1F8MA 4UNKA 5EA9A 3GR8A 1OQFA 1DBTA 1DJQA 2OZ8A 3IKDA 1ZJBA 1G4TA 2Z24A 3G0SA 4WF7A 2C0AA 1VF8A 4CQ8A 3H6OA 4I3GA 3WH8A 4IMFA 1A5NC 1YW1A 1UH3A 3QY6A 3P62A 3ZLFA 1HN1A 1CNVA 2E77A 2GJRA 3APGA 1E73M 3QYSA 5A5WA 3RX2A 1Q3NA 2G95A 1YW5A 4A6GA 4LEQA 1H11A 1H7OA 3LCXA 2W5FA 1ADDA 3OVPA 3V1HA 1PIIA 4MZ8A 4IT1A 1I4NA 2VMFA 1V4YA 1ZK6A 1UH4A 1XKYA 4Q3MA 5D8ZA 4LB3A 3PTDA 4Z1YA 4DYKA 4JFTA 1T99A 2CERA 1DHPA 1VFTA 2EGZA 1P7TB 3GU9A 4HPNA 4JEQA 1T8QA 4B3ZA 2R94A 4CU7A 3SRFA 4WUIA 2F84A 3M41A 4ERAA 1HL2A 1YNYA 3MT1A 1Z41A 3WNNA 4L56A 3U4FA 1JCXA 3BCFA 2WAGA 4HOXA 1YMYA 3VD5A 3SADA 2UZ5A 3Q94A 3AMKA 1E0TA 4ROPA 3L0KA 2IPJA 4OU1A 2AL2B 1E9LA 3IHZA 1K70A 2PLMA 3UR5A 5I77A 2V68A 3C52A 1X8FA 4PB5A 4EANA 2VT0A 4DRKA 1KCZA 2A5HA 2GVEA 1EL3A 2TSYA 4C90A 3V7PA 1S3TC 1SW3A 2L5HA 2JF7A 2Q6ZA 3HPSA 3TOPA 3RM9A 3A12A 4E3VA 3KABA 4XTDA 3SFWA 3QY7A 2JKEA 4QT3A 5CGQA 3DHDA 1KBKA 3T8QA 1XSIA 1NMVA 5HMFA 1RCXB 5E9AA 1Q2RA 2DJLA 3DECA 4HA4A 4AFYA 1C3FA 4IFOA 3VKKA 3DENA 3AIVA 2Z2UA 5A1AA 3LB0A 3N9SA 4NP7A 3ZVHA 1FCBA 4DO7A 3TYCA 4PMNA 3QHMA 1BWVA 3ENLA 4JFJA 1B9ZA 5GJNA 2WM0A 2WBKA 1XHGA 4EAYA 1DL3A 3QBUA 4YVVA 3GNOA 2AGKA 4GJIA 1UQYA 3N6QA 3IANA 2YW3A 3AXMA 3B0UX 4S3BA 3GHSA 2GJNA 5IFTA 3AXKA 2ZQTA 4AIBA 2XG9A 2Q8ZA 1EO7A 3AO0A 1TX0A 4AZCB 4R3UA 2Y24A 3GUGA 3SCPA 1H63A 1XCFA 4DXVA 3RJXA 5LIKX 1I75A 2O4MA 4PRRA 3EPOA 4WCJA 1SMAA 3MI2A 1M04A 4CN6A 1KFLA 2EULA 1SZGA 1VYSX 3UZ5A 4DT4A 1D8WA 3CLWA 5A8GA 1VBJA 1VBHA 2ZIDA 3DBNA 3U9IA 1HZYA 1DPMA 5D9OA 4EF8A 1XLMA 2A3BA 4BF8A 1JDDA 2BBFA 2CZ5A 3UJEA 1TPEA 1X38A 3T08A 2A3CA 3O6YX 2DY3A 4WSKA 4O53A 3VX0A 2OSWA 4QJ5B 4MFEA 4GYPA 5LIUX 1TZZA 2WOQA 2XVGA 5CSRA 1PKNA 3B03A 5BOEA 4KS0A 4J3UA 4GINA 4AD2A 4NSBA 4Q4MA 5HAOA 3WFAA 4FLRA 5G1TA 4JHZA 3QXBA 2EKCA 5CAKA 3N2OA 3MZ2A 2VXNA 3M0LA 1JGMA 1NH6A 1FH7A 4AVNA 1HJVA 2YLAA 3NZGA 3CB3A 2WZIA 1GVEA 3QC0A 4PRTA 2VFIA 2UY2A 3UD6A 4LB4A 1RHCA 2P1FA 4NXKA 1RPKA 1QPQA 3EX2A 4H2HA 2EAWA 2VR4A 2QCLA 1EOKA 3STPA 3GDRA 4EF9A 1Q6RA 4OKDA 3LMZA 3TXZA 5TAOA 2VZVA 2EPLX 3EA1A 2VEFA 3M7SA 4L4MA 3QW3A 3O3RA 5LIWX 2CZEA 1ESWA 4JR5A 4WSHA 4XX6A 3IKGA 3R12A 4M1RA 4PCSA 1V6VA 3HPZA 1RP9A 1ME9A 3R0UA 4FO4A 1D2KA 2ZDRA 4NNBA 5DMMA 2P4VA 4JYEA 4QE5A 4S3JA 3VNLA 1L2QA 4HBEA 3P0WA 4R7WA 1DYSA 4JXCA 4PRWA 1CEOA 2PP3A 2QCFA 1VS1A 2PDPA 3W2MA 2LLEA 4NZCA 5DT7A 4I9MA 1EJUC 2XIQA 3MU7A 1V0MA 1WXZA 4NJIA 3O16A 3EB4A 3H12A 3IVSA 1BVWA 3T09A 1A47A 4C1NB 1E6SM 4IPPA 4QG9A 2XVLA 2BHZA 1TA3B 1E5JA 1Z3NA 4DRHA 1UYQA 3QMRA 2RURA 5IBXC 4GABA 4C6NA 4S23A 3IV8A 1XSKA 2R1NA 1VC4A 1C8XA 4ZPVR 3W7MA 1XLFA 4IIGA 2ZZ1A 4JQ1A 4UDMA 1HJWA 4WX2A 3NL5A 4I7UA 1KFWA 1XGDA 4RDVA 2QJNA 2GDVA 3BV4A 1R3QA 4GIRA 1MFUA 1FWWA 2ADAA 1ODUA 1F3XA 1UKPA 2PP1A 4HT3A 4HCLA 1CX9A 3DHUA 3RLGA 4F3HA 2V5CA 4GFIA 1REQA 4HZ7A 3W7CA 3MUY1 3DGRA 4H7VA 4UTMA 3OG3A 2CBVA 4MJ4A 3E2SA 4DJDD 3CO4A 2ZC8A 2XN0A 3TC5A 5HINA 1YEYA 5AC4A 1W6TA 1KWKA 5CAHA 3MO4A 5CJMA 3R25A 3W75A 2ZA1A 3SCRA 4PYSA 1XYZA 1OC7A 1H60A 2VQTA 2OLSA 2VDHA 3GLCA 1RXOB 1XX1A 4MYXA 1AL8A 1UP0A 4B91A 3HB9A 1DJIA 2VX6A 3D0CA 1L6YA 3SCOA 4AZ7A 1R38A 4K1GA 4UUIA 2PZ0A 4FP1A 3UWWA 3UPWA 3MCOA 3SUSA 3CJPA 1XRVA 3PWIA 3WZ0E 2Z7KA 5F4SA 2GUUA 3VMNA 5HQLA 4HU4A 4CD7A 4R53A 3WFZA 3L4XA 4LYPA 4PUMA 1ZENA 1Z7AA 4AZ6A 1MYRA 2E8YA 2V67A 1SYTA 1BRLA 2VN1A 3R79A 2GWNA 3TNOA 2XFYA 4JX6A 1W5QA 4IL0A 5FL0A 2ZZ2A 1QBBA 1GWJA 5G4EA 2WC3A 1KRAC 3W1QA 4ZOCA 1FWRA 3NYDA 1ONXA 3W00A 4LVDA 3P8IA 3H24A 2F6KA 4MZYA 2VYOA 1WZLA 3FDKA 3V4BA 1WB0A 2AAAA 5KEZA 3JR2A 3SCSA 1QW8A 3LQGA 2OZTA 4WGXA 3W01A 3LOTA 3NVDA 1TPWA 1KXVA 3PK7A 1TELA 1DQWA 5CZKA 2EPMX 4O0QA 4O50A 2VZOA 3MHGA 4ACZB 2ZFAA 2A3LA 1UMYA 1OT2A 3IAPA 4M6VA 4MY1A 4MNLA 4NRRA 3CZGA 3UA3A 3W1NA 4EP8C 3R11A 1CPUA 4V1XA 5E0FA 3O5JA 3GNPA 4IQEA 1EFZA 1J18A 2EJ1A 3HG5A 5REQA 1FTXA 3H7RA 4I7WA 1BYDA 2CCRA 4U86A 4JCLA 4AWTA 1E6QM 3PZIA 5I79A 2PU1A 1XLKA 4R7OA 4AX7A 1BWLA 1VFMA 5D04C 2ANUA 6TAAA 2WVVB 4TO8A 1EPVA 4D8AA 2J66A 3SDOA 4Q7BA 4Q4KA 1EHNA 3S2JA 4BWLA 3ELFA 4UNLA 3BQ6A 1XIMA 3WD1A 5CG7A 2XVPA 4J9JA 2VWSA 1W2VA 3RITA 1OFOA 3BG3A 4PBEA 2DG3A 2C1HA 1Y65A 3LY0A 4IFRA 4XD3A 1BYCA 4HNUA 1CECA 4Q8TA 5HPCA 3PRDA 3R94A 2YL6A 3FA5A 4NAEA 1Q6DA 1MQRA 4NHVA 5B7ZA 3CBWA 4KEUA 4PFMA 4WJ8A 1DIDA 1JFXA 2C18A 3P3BA 4DWSB 3QSRA 3IJ7A 2WVUA 4BI6A 4DUVA 1SJCA 1TUFA 3BG5A 3WUEA 1E56A 1O5KA 1YTEA 4Y9AA 4Q4SA 1J2BA 4HOZA 4J2PA 4NY2A 1EP3A 7REQB 1J2WA 4Q4RA 1XC4A 4C1LA 4D6HA 3W7JA 3LSCA 1LWIA 1AMYA 4GVIA 1QNSA 2RHGA 2D0FA 3WDHA 1K77A 2ISFA 2AMXA 1JRBA 4QR6A 2H8XA 2IPGA 2F4EA 2PURA 2Y1HA 4A22A 2INZA 3EXSA 4U2ZA 3W70A 1PBGA 1VPXA 3DFYA 1J5SA 1X7FA 1KKOA 3PC0A 1EA0A 4QSHA 2PA6A 4XSLA 3EWXA 3KEHA 1DXEA 2IQTA 2PV2A 1FUYA 1TB3A 4FAPA 4OFCA 3R7MA 3I4KA 3GVQA 1TMHA 2HTMA 4DI9A 4YXGA 4XBJA 4YYFA 3MYPA 3H70A 3MP4A 4H6RA 1W1IE 2PS2A 3USBA 1PIFA 3HG2A 3A4JA 5HQMA 3RCNA 1F9CA 2J8TA 1DTUA 2I17A 1HG3A 1IV8A 3PNZA 1OM0A 5B7YA 3LN3A 1S2VA 3A9BA 4PBGA 1TCOC 4GQBA 1E0UA 3CAWA 4DUXA 3DG6A 1QI3A 1QPLA 3NEHA 2QLYA 1PYMA 4A05A 4QG6A 1WYIA 2FH6A 1OYAA 4ZQRA 1Q6HA 3M6DA 1H1NA 5TBOA 2AKZA 3VDHA 4QM1A 1DXIA 5J5RA 2CFFA 3T9PA 1VLIA 1P6CA 4EIVA 1RCQA 5AOUA 3AALA 3FHQA 1PX3A 4MDOA 1V79A 4GYKA 5LKYA 3LTSA 1SZRA 3AC0A 1QFEA 5G4WA 3W0KA 1YDOA 1XXXA 3KAIA 1OK4A 3FAXA 3WNMA 3VIKA 1ZS2A 4U3AA 1E5NA 4Z2HA 2E5BA 2OMAA 4AHQA 2VR2A 3O5GA 5EMUA 2JZVA 1LOLA 4N6EA 3WH0A 3KVLA 4D8ZA 1TWWA 1YYAA 2CITA 2CBIA 3L7RA 4ITZA 3AMLA 3NSXA 1E1CA 4H19A 3KBSA 2NWRA 3T4WA 2ZQ0A 2QJMA 2TYSA 3PR2A 3NNTA 2VGIA 4CUCA 2J24A 3BCJA 1H1ZA 1YRRA 4R9OA 1DE6A 4PMVA 4IPXA 1ELSA 4RNIA 2PWHA 1M03A 1MNSA 3M0YA 2OOFA 2DZVA 1XM3A 5PTDA 4P61A 1DQUA 3P14A 2B31A 2HMCA 3MCMA 4PH6A 1M68A 1YE4A 3G0UA 2HZGA 1C93A 5FSDC 2VENA 2Y7DA 2OEJA 1WUEA 1QT1A 4U5IA 4PB4A 3STFA 2XP6A 2FFCA 3EKGA 5HWCA 2OGJA 3UWUA 4HMEA 1IF2A 1T96A 1F05A 1SSGA 4IGMA 4YTTA 1GVQA 2JEPA 2Y2WA 5DN1A 2X41A 4CVWA 3HZ3A 1Q8JA 1M53A 3WF2A 2ZXDA 3QOMA 3CK5A 1XI3A 2G50A 5A8MA 1TJ1A 1LUCB 1YDNA 2OX1A 2CESA 1EJ7L 3ZXWA 4C7FA 5J04A 3WLOA 3ARSA 3LQLA 3KVJA 4LV9A 3AHTA 3L2LA 1UASA 2P3ZA 4AB4A 1WZKA 1RY0A 3XIMA 4HZMA 4Y9NA 2XYLA 4W88A 1JIBA 3IVUA 1N2VA 2E1WA 2GGGA 1F61A 3UWEA 4U10A 4D6FA 3LTPA 5JH2A 2W63A 1G4PA 2NXIA 4EXAA 1JL8A 1WO2A 3BAXA 3V1PA 1RBLA 2C14A 2YA0A 1W5OA 3LHVA 4IZGA 1KLYA 4DB7A 1I0BA 5JBFA 4NIRA 2WZMA 3POCA 9RUBA 1K8ZA 1I8JA 1K6WA 3VKBA 1UBPC 3BARA 3KAOA 1E4NA 3BOLA 1NQ6A 4IGNA 3TTQA 3JRKA 2ATSA 2J7CA 3SO7A 4YTRA 4C7DA 5AC6A 1H50A 3OGRA 3VVGA 3QEZA 1R5YA 4MJ2A 2Z4GA 4RCXA 3B4UA 3O9NA 3V5CA 1BXCA 3ZR5A 4RLIA 4C6LA 3QGVA 3FJLA 3H4WA 3MO7A 4AEFA 3ZIZA 5G4HC 4NZ1A 1PX8A 4W9OA 3MWCA 3FJNA 4DJEC 1BGAA 2GQ3A 3W1TA 2MF9A 1UA3A 3DFTA 1FCQA 2BSLA 3VABA 4F0KA 2NWSA 3THAA 3DBPA 1VPYA 3WK1A 1ROTA 1T5AA 5DXXA 2ZX6A 1BAGA 5ENLA 1ZU8A 1R6WA 1TWIA 1DHKA 2HS6A 3BWWA 3VOCA 5DEZA 4IGSA 2E28A 1NEYA 1YATA 4L7ZA 3TOYA 1UC4A 4GBDA 4M56A 4Z2GA 2KZHA 3EA2A 1S38A 2B0MA 5DFAA 4JNZA 4XBKA 3HGSA 3V75A 5G2WA 1VD6A 1B4KA 2XIMA 1E4MM 3E0IA 1HP4A 3UGVA 4KF1A 4PTVA 3DESA 5LGZA 3SN1A 3ECQA 4GFSA 2E5CA 1NP2A 2PWGA 3VNDA 3RCMA 4GX8A 1VJIA 4WK9A 2WNZA 1B2YA 4UTIA 3ZOAA 3N2MA 3MV11 2CLLA 4QFUA 5AHIA 1O4UA 1T7LA 4RE2A 3BVJA 4GRSA 4YWIA 5AYZA 1RD5A 5D75A 3PZOA 3ME3A 4AD1A 4IIDA 4F9DA 3VM5A 4MGGA 2OKOA 1OABA 3RLHA 3C2FA 2CLOA 1FWAC 4GI8A 3CC1A 3TQ0A 3FEQA 3V5OA 1ZP4A 4PUNA 3S6TA 1DKWA 2X42A 3LZ5A 5HQEA 2J13A 1L8PA 2O9RA 1X8CA 1CENA 2W62A 4OVXA 1GJPA 3RFWA 3S5OA 1A53A 4K8GA 3O5EA 1E9IA 3QH2A 4O17A 3OU8A 4LVAA 4Q8QA 1YXDA 3VU2A 1ZL1A 5HTGA 3TC7A 3E0LA 3DFHA 1BSLA 3BK0A 3A23A 3V18A 3UNTA 3CIWA 1Q1CA 4QS5A 1VFUA 5GJPA 3IARA 4IXHA 4A3QA 1R2SA 2FTYA 4NF7A 4O19A 1VAHA 1EDGA 3UZZA 4L4OA 3MMTA 3B0PA 4IP5A 4CVUA 1V7AA 3TFXA 4S2BA 1UBSA 3WUBA 3ZZ1A 1XC6A 2GK1B 1W2PA 2I1OA 1Q6GA 1NSGA 3NZ1A 1F73A 1HKJA 4V27A 1WKFA 2PBCA 2PDJA 1NDYA 1KT0A 5M5DA 5EYWA 2DIEA 1UIOA 3CHVA 2BY3A 3GM8A 1GKQA 4K36A 3O6AA 1VR6A 2ZUWA 1L2UA 3NO1A 4AX6A 1NOWA 3H2EA 4QNEA 3TW9A 2OX4A 3N29A 1BVZA 2RQSA 3B7XA 2Y89A 3O6DA 1LL4A 1OCQA 2INEA 5TD4A 4JFLA 2JF6A 1M7PA 4OV4A 4F0RA 1SMDA 2VX7A 4RXFA 3FA3A 1TE1A 3ONBA 4PMDA 5FA5A 1EPXA 2CBUA 1KM6A 3B8SA 5FIPA 2AQVA 3MBFA 2DGAA 1L6WA 2YLLA 1FH8A 1TREA 3SW6A 4R0XA 2W4XA 4CQ9A 7TAAA 5LSMA 1EX5A 3GX9A 5I3DA 3H54A 4JDYA 4TW8A 2FZMA 2DUZA 3IK2A 4MY9A 2FJUB 5U7SA 3LHZA 3E12A 3KWSA 4V15A 5AYBA 5LHEA 4NU7A 3W07A 4DIPA 4Q32A 2D0HA 1EUNA 4NX0A 1TWDA 2YYTA 3AMGA 2PTZA 4DBDA 1A49A 4UFIA 3JS3A 2VDIA 3RLUA 1OX6A 2VTFA 4HNVA 3IJLA 5KINA 3IIPA 2ISVA 1JAEA 1V3KA 2YBTA 3HJZA 2I16A 1N7KA 3PTQA 4JY9A 2DSUA 2J9XA 3M5YA 1ZNNA 4M80A 5D33A 2A3HA 4H4IA 2ZX9A 1R3YA 4CCEA 3EPMA 4JTGA 2WWDA 1BSIA 3HM7A 2BMBA 2NVAA 3AROA 4K1WA 3IPWA 2C13A 5EMYA 3OEXA 1JYXA 5HUOA 4PTWA 1LBMA 4AZGA 4MDPA 2Y78A 1R85A 4ZB0A 3UVAA 1JCTA 3BSGA 3E0WA 1D3HA 1JVWA 3O5RA 1KD0A 4UFMA 3PG8A 3DC0A 1A3XA 1D7JA 3DHPA 4DBWA 3NXFA 1V6UA 3EDFA 1ITCA 1RK6A 4TVUA 4EWJA 1FDJA 3TTSA 4XO7A 3THDA 3NDOA 1TPFA 3T0BA 1BG4A 1WXYA 2B4GA 3QQWA 4G8TA 3EMCA 5K9DA 2ZR5A 1LRQA 2J8FA 6REQB 1G4EA 4C1NA 1X1NA 3N25A 4R33A 3BV7A 3BG9A 3BW4A 4KWVA 3B0VC 3PS7A 3KTXA 2GQAA 1W54A 1J10A 2PWVA 3NQBA 3T0DA 5D9PA 3NEVA 1KFJA 2GOUA 3ZFHA 3HFYA 3GC5A 1M6JA 1L6GA 1DOSA 4ODRA 3NM3A 5AC7A 5HJLA 3LV6A 3PPGA 1O66A 2ZZ3A 5HUPA 5A6AA 3N12A 3NQGA 4QP0A 3F03K 4K6AA 1YXYA 1KV5A 1IHIA 1G69A 4PR4A 2JEQA 5DX7A 4A3HA 4DNHA 3HTWA 2V5JA 1CLKA 2XPBA 3F5LA 2DSZA 1P0NA 4ERIA 4UCFA 1SFSA 1MW1A 5HJYA 1EJRC 4GQ0A 1EGMA 3JXVA 4ODOA 3VKJA 2E7FA 2VGGA 4MNJA 4XZMX 1XBZA 5IHRA 4H04A 4JTEA 3LNPA 4KETA 1IWAA 1YPIA 3CU2A 5I6SA 2WLYA 3KOFA 3WEMA 3WQWA 2P0IA 4BCEA 4RUBA 5FJPA 2PEVA 3I3EA 4DBUA 3W9ZA 3MJYA 5FEZA 1X6UA 4BEQA 3BSMA 3BLEA 3RJYA 1NWSA 2C3ZA 2P5NA 3QV8A 1UUQA 3G1FA 4F0SA 1HJUA 3EPNA 3B9DA 4Q8PA 3W1RA 4TR9A 1KGWA 3EKZA 2WJEA 3UI6A 3FEMA 1W9BM 3K13A 2DVTA 3NYZA 4F8XA 5D02A 4UXDA 1DP0A 3G1AA 4O2TA 3W2NA 2V5DA 4B2DA 4INFA 1AK5A 2E6AA 1GK8A 3UG8A 3B0XA 5FSEC 2FTWA 1NDZA 4QZVB 2XWDA 3VUPA 3QN3A 5GPGA 1BG9A 4S3EA 4W8AA 2ZOXA 5BWAA 3M6YA 4EPDC 1MZRA 1U5HA 3ARYA 3NQVA 3H21A 3NOEA 1YLVA 1FJDA 4AY8A 3GXFA 4JTUA 3RG6A 5C2CA 4GIYA 4JTJA 2ZYFA 3ARUA 4XZIA 4UBPC 3A21A 4AG0A 1SUXA 3OBAA 1MFVA 1KBBA 3M64A 2VM8A 2VQUA 2BY1A 3KAGA 3FJ4A 2CYGA 3KOZA 1A50A 2QGHA 4PMQA 3VOFA 3C0QA 1QATA 1HF6A 4CCZA 1LRTA 3W24A 2E6DA 2Y4SA 3LDVA 4O13A 4ACZA 3Q37A 4HSOA 4HP5A 2E25A 4O10A 4WSJA 4CCCA 4GUGA 1UZ4A 4ZTYA 4YHGA 4OGZA 2BOEX 1FX6A 4H7CA 4KCVA 4UQEA 5BXSA 4CNUA 4MNMA 1JXJA 3PJUA 3FW6A 1KR0A 4BQ5A 4S2CA 4XV0A 1KQYA 2BXVA 5BOFA 4GLEA 5DY2A 5A6BA 2YCJA 1UUOA 5DCBA 4XD6A 4P5UA 5DQPA 4PUWA 3PUOA 3DX5A 5DRIA 4TUFA 4PEKA 2POZA 4AHPA 5AECA 1IT7A 1JYNA 1W31A 3KW3A 3O5QA 1VEMA 3SY1A 1WKYA 1IXQA 3LD5A 1LROA 5M17A 3G0XA 2O7QA 4RNJA 4RZ5A 5KZDA 1ZTVA 3TVAA 4AD5A 1EC7A 3PULA 3SSJA 4I6VA 4GHRA 4JICA 1FA2A 4QT2A 3MV01 1QO2A 4XZHA 1TJPA 2G96A 1FP8A 3BDKA 5D09A 1KA9F 3V35A 3NSMA 4LYKA 3PTMA 1TZ7A 1SW7A 1GPWA 4UMBA 4GH3A 2MANA 2GDUA 4PEEA 2CW6A 2GFTA 1W1B1 3FAPA 4C65A 1EZ2A 2PD5A 3SJ3A 4URIA 3TZFA 2QULA 3KL5A 3OLIA 4L80A 4V1YA 1J96A 4JNMA 1GONA 2E9MA 1XW8A 3UJSA 3KRZA 3MJMA 2IKGA 4MUPA 4PCPA 4HKPA 1GZJA 4JTFA 4LS1A 4ATWA 5FAJA 1LTDA 1KFKA 2CZDA 3I3DA 3P6LA 3W7KA 3PZGA 1UR4A 1JGIA 3AWNA 2ZRWA 4IH3A 3PPFA 2TAAA 2NUXA 1GQLA 3Q45A 3PRBA 1TWSA 1XLJA 5EBUA 2VHLA 3GFXA 4ZOEA 3A3WA 3RILA 4N19A 5HW6A 3V0TA 1LM1A 1EYEA 1JZ6A 6XIAA 3VDAA 1DIOA 3PWGA 1Q6UA 1RJQA 3Q65A 4OOUA 1KB3A 1QU4A 1A7XA 4F9JA 1RQHA 2ONEA 3GKFA 4QNWA 2VOTA 1O1HA 3W2JA 2N87A 4RE4A 3MKCA 4XAZA 2A3EA 3ARQA 2YXOA 5HWJA 3UWYA 4A8LA 4YTQA 5T91A 4C6FA 3VOGA 1XH2A 1JZ4A 1UD5A 3R0KA 4JN6A 3BJSA 1DWHM 1ICSA 2CETA 1DQXA 3OYXA 3W7GA 4PBFA 4C6QA 2VEPA 2NUYA 3SJNA 5LGXA 3G1SA 2PWEA 3AIRA 5BXPA 4L4LA 2NQJA 4J28A 5H8MA 3VIOA 2VCBA 4L9XA 5D2XA 4FNPA 4J4KA 2Q8XA 1SFTA 3DHFA 3MMUA 3ABXA 3VDCA 2NQ9A 2GQ8A 4QAIA 4GI6A 4P7RA 1XISA 5CPQA 4NNCA 5F7UA 1E6ZA 1JCHB 1E72M 2OO6A 3CAQA 5LNUA 2MPHA 4HHPA 5DO2A 4L9YA 3W7NA 1THFD 3PZUA 4KBXA 3GTFA 1JCLA 3NA8A 2I57A 3RK8A 4CNPA 2W0UA 4JTIA 4FR1A 3T44A 1F7BA 1F07A 3MPGA 3MQTA 1CZ1A 2VZUA 4J40A 1WCGA 2ASHA 4W9PA 1NWUA 2R14A 3W71A 7TIMA 1EBHA 1SO6A 2OFNA 4HU0A 4NNRA 4LS2A 3C3NA 4Y6GA 2E09A 1HGYA 4WDUA 4L1WA 3K8MA 2PWFA 3VC5A 2VUNA 4RZ6A 1ENUA 3OW1A 4IG2B 3SGUA 1KXQA 1F6KA 2NT0A 3DFOA 2YB1A 2I5QA 1P0EA 3K2GA 4WRHA 2DJXA 3WQ4A 5I3HA 2CPUA 1FWTA 4LCQA 3AHVA 1XFCA 2JBMA 2R91A 3BAYA 2XIOA 1H5YA 4IL2A 4HIBA 2PPOA 2QAPA 1V3IA 3VD4A 2V8ZA 3CUGA 4FNTA 2G3FA 3MY9A 4FK9A 3FJ6A 3KBJA 3DDMA 3FYPA 5D2WA 3VMPA 1OINA 2WJFA 5HULA 1EB3A 5SWUA 4O1BA 5HUAA 3PG9A 1ZSXA 1ML1A 1MXGA 3CLMA 3O5LA 2P8CA 3CPUA 4V28A 1OX4B 2BHYA 3P5ZA 3S42A 3Q58A 2BOFX 5HR6A 4CLMA 4ZB2A 3NWRA 1NFPA 3MDUA 3T2PA 1W9VA 1JDEA 1XLBA 3F7JA 3WLPA 4C6PA 1EBGA 1EHAA 4I9TA 2WVSA 3M1ZA 4MLRA 4PMZA 1EJTC 4L6DA 2ISSA 3GFZA 5C5YA 4PA8A 1HKKA 3QR3A 5CPNA 3GG8A 3W73A 3O1NA 4W4QA 3RR1A 2ZXBA 1IZKA 3CIXA 1XLIA 2KFWA 3K1DA 4B5SA 4G1KA 4HU3A 4NRSA 5AHEA 4Z0SA 1HKIA 4F48A 2NVCA 1POJA 3G8EA 2GGHA 2VRJA 5C0QA 5E70A 1CXFA 3R8HA 4GYPC 3FV9A 4FS9A 5BMWA 3P60A 3VZXA 5AN7A 4GACA 3YPIA 2A3AA 1ZHAA 4OE7A 2CHOA 2XVNA 4B9YA 5E9XA 1W9PA 1JDCA 1G0CA 3UY7A 3NI6A 2YIHA 3WNKA 4AY7A 1OJXA 3N34A 4MWAC 5EKYA 5CQ1A 3WJWA 2JALA 1CB7B 1P48A 1Z89A 3AJXA 3V36A 5JMUA 4LAKA 4A4AA 4DPPA 4H8UA 1OCJA 3VIIA 3KBVA 1FWCC 1W3LA 2OYKA 1UWTA 1B9BA 4WOQA 3JYJA 1EJXC 4IXXA 3M5ZA 4ZOAA 4AW7A 2V3DA 3O7UA 4AWEA 3ZJKA 1JUEA 2VCAA 1R3SA 3ARZA 4L72B 3RMEA 3H2FA 1B54A 1C92A 1XYLA 1RJRA 1BL4A 1JG9A 3TE9A 2CKRA 4KFPA 7ODCA 2QMJA 4ZGYA 4JN8A 3PUDA 3CV6A 4GJJA 1MQPA 3EX3A 2TODA 2QCDA 4JIQA 2DEPA 3FFSA 3MSYA 4HARA 1K6AA 3C2OA 3A9IA 3QZAA 4BR1A 3N3TA 1U30A 4FR6A 1YIXA 5IRPA 4U4MA 1FKJA 1W0MA 3SN4A 1Z48A 2HVOA 1MVYA 1W37A 4OJYA 2UY5A 2REQA 4HZ6A 5E0CA 3VDGA 3ZWSA 1NELA 2KI3A 5HOSA 3NCOA 6A3HA 2IQDA 1CLVA 2VC9A 1EGVA 4XBSA 1KRMA 3NZQA 2PDUA 4NYYA 4IIHA 4LC6A 3QOKA 3K5XA 4CNNA 2BTMA 3UFYA 1V08A 3BO9A 3E0VA 3TW6A 1PIGA 3R1ZA 1EC9A 4YJ5A 4EPBC 5HK4A 2D2GA 4LF1A 3ABOA 3L4YA 1DJYA 4JTAA 1K9TA 3KXQA 3QGKC 4TXEA 1ONEA 3TK7A 3W38A 3AJ7A 3LCHA 4MB1A 1XIGA 2XUCA 1EDQA 1O60A 4QAWA 3WK3A 2DH2A 3WF0A 2WK2A 4UR7A 1AQMA 1B3XA 1YX1A 3KLKA 1KM2A 2ZC1A 1R86A 1QPKA 2NXGA 1UHVA 4H01A 2OQLA 4HHLA 2D2JA 1GG0A 1AMKA 1QWGA 1V3HA 1W32A 2CLFA 3VXGA 3B9OA 1IEIA 1M1BA 2QVNA 1ODZA 1EQ3A 3BGJA 3EXTA 2QW5A 3PR9A 1C9HA 5CC5A 3QV6A 3S1UA 4E4PA 1FKDA 1B3VA 3TYAA 4O4VA 2GJLA 2B7PA 3WMLA 2HBVA 2J7DA 4H00A 3TN6A 3BGGA 5AYYA 2JGYA 2BVTA 5IM51 3SIMA 3ARRA 2D23A 4ZBCA 3TW7A 4ZE5A 3FIGA 2P53A 4PTDA 1IT8A 1OD0A 3QRHA 1XH1A 3R2GA 1HVXA 2F6XA 2BVWA 2JK2A 3W7PA 2JIWA 2TRSA 2GK1A 3RLVA 4PB3A 2ZX8A 5HW8A 3UEQA 1J01A 4GZIA 2J77A 3NUKA 3WNOA 1J6OA 3QPEA 3OO2A 2QDEA 3C4UA 2FPVA 2YDSA 3S9YA 1J0IA 4FMVA 1XLCA 4LH8A 5A6TC 2C19A 1B6CA 3LXCA 3RHGA 4FF7A 4FNUA 4DJEA 2HE8A 5JIPA 1BKFA 1DJNA 4QDPA 4TU1A 3W26A 3OIHA 4WY0B 4JPGA 1FHDA 1E6PA 4IQ2A 4LGXA 4I8YA 4PCNA 2PI6A 2O9PA 2X0SA 3KHJA 3OZOA 3CAKA 5EMMA 4MOZA 4Y90A 1DEDA 1M9HA 4IX0A 1TO3A 4X2PA 4DF2A 3RRXA 4BF7A 3W53A 1WPCA 1XWYA 3FHAA 1EEXA 4B2DD 5CKSA 1UH2A 3KLLA 3DYOA 4Z2IA 2FB2A 3LRMA 3M4HA 4Z1CA 6CGTA 2Q09A 4ICCX 3MBDA 4PULA 3TQVA 1VIWA 4O1DA 4GC3A 5ECUA 3BAIA 3B06A 1E0VA 5FOOA 3QYQA 2KR7A 1SVDA 4CQDA 2YA2A 4JX4A 1U1JA 5AVHA 4HBKA 1U2YA 2PN0A 5D37A 1LOQA 5HMEA 2PDBA 3AICA 1H09A 4J35A 3NM1A 1TVPA 3NRKA 5AYXA 2YW4A 4ZQCA 3OHMB 2XM1A 1JFHA 1TCDA 2MLYA 5H2ZA 1GNXA 2WQPA 4FLQA 4HNOA 1I2RA 3HV9A 5C9UA 3C6CA 4HK5A 3TQPA 4P7LA 1W26A 5EFDA 2RH9A 2G8ZA 1T40A 1VCGA 3HPFA 3RDKA 1J6YA 5CC7A 3GZ3A 1HGWA 4LY4A 4QE4A 3WH7A 2WZHA 3ANUA 4LUTB 3XINA 1FHLA 3AYRA 4NAFB 4IMGA 4LV4A 4HZ8A 2ON3A 1LP6A 5C9WA 4BWLC 4JFKA 3CZKA 4D9PA 5HNTA 3OZYA 4IIBA 1HO1A 1I2QA 4JAWA 4LNYA 3ARTA 3AS0A 1JDAA 1VYRA 2JKPA 3CQIA 5D2YA 4YTSA 1HT6A 3NOYA 1TPUA 1L9WA 1O12A 2WMJA 2VFFA 2EG8A 1ISZA 1HNYA 3LS9A 4RPPA 4K7YA 5A6BD 3ABZA 3ITYA 3M47A 2QUNA 4F2UA 1PYFA 4CEXC 3KDNA 3AZTA 1U83A 2PB1A 1OYCA 2ABAA 1ADSA 3NGFA 4YN5A 1M5YA 4UFHA 4PUUA 4QBXA 1FKIA 2WC4A 1HUVA 3G24A 3VCRA 3RX3A 4JIPA 5LNRA 3C3UA 1BTCA 2V6AA 4QCFA 4HN8A 3TLQA 3N17A 1P0DA 5T9BG 3ZO9A 4XKMA 3O05A 4YCOA 3GR7A 6REQA 4J2MA 3O0FA 4U5KA 1GJUA 2WZTA 1EQPA 4EKJA 5I98A 1S5VA 3PBVA 3WBWA 2X7VA 2ZX5A 4X3ZA 3WLJA 5JBEA 3EWCA 2X1SA 2DT1A 1VJZA 2Q71A 2EPNA 3PM6A 3ABRA 3U48A 1VBUA 3IJ9A 2ZZ4A 3IIOA 3S1GA 1QMLA 4TMCA 1BYAA 4J4OA 1E6NA 3AYTA 4GJ1A 1EC8A 1W3JA 4Q22A 3B04A 1PVNA 2HISA 4JNYA 2OQHA 2IUZA 1J4IA 1TFVA 4I9AA 3WELA 3JZUA 3KZ7A 2H90A 4MADA 3GU2A 4B5NA 4FNRA 3M43A 4JHOA 1XDMA 1R9XA 1QPFA 1VH7A 3EMZA 3AZSA 2Y7GA 1XDLA 3DG7A 4Q6XA 5CLTA 1NF7A 2WHMA 3C2EA 1MRAA 3OLEA 3M0XA 1Y5WA 1KFBA 4S3KA 4YIWA 1TE6A 1UOZA 5C8BB 3HGJA 1S2TA 4F0LA 2CXGA 3DZ1A 4G56A 2Z0IA 2ZWYA 1QHOA 2PGEA 1EWDA 3MI3A 3B3DA 1TZ9A 1JVNA 1TTQA 3EBVA 3P80A 3GFYA 1V8EA 2DZAA 3EDJA 1DJWA 2WM1A 1WBJA 2E9BA 3W2LA 4JL2A 4I5XA 1JNDA 3QVQA 3H2AA 4J3VA 2J9ZA 3WF3A 1DE5A 3PAJA 2GGEA 3O8AA 2I5IA 2Z1VA 4CU6A 3L4TA 3AQUA 1OIMA 3RGTA 2EG7A 3UYIA 4XQ6A 4IMEA 1PWMA 1YKWA 2BGNE 4JGDA 2FAPA 4HCDA 3LENA 3TZNA 1UP3A 1TV2A 3DFPA 3JW7A 2ZR4A 4DRSA 4XZLX 5TF0A 1EQCA 4CN1A 3T0TA 4FXJA 4JKKA 3QR0A 3SIZA 3WFLA 2I5GA 3ITGA 2J4GA 2WV8A 1IIHA 3TMQA 3BLDA 3E5BA 1CLXA 3FAWA 1GOMA 1IE7C 2OSXA 1K7FA 3HOJA 4L65A 1E1EA 3T0AA 3VAWA 3BMXA 3ORWA 4B9ZA 4IJCA 3GDBA 1US2A 3FYYA 3WL0A 4DJDC 5U4NA 5C7VA 2FGZA 4B5TA 3GY1A 3SI9A 2WQDA 1VB9A 1XCXA 4M7TA 5BU6A 4ODNA 1ALDA 3EMQA 4QJ1A 1V6YA 4HPJA 3R89A 4PC8A 3EKLA 2BX7A 5H1WA 3WX7A 3G1DA 1TUXA 1NOUA 1IEQA 4PODA 3UJ2A 2C15A 3IAQA 4AD0A 2WHLA 3HGOA 4O8RA 4LUSA 2ALRA 4WOZA 2CIPA 2Z7GA 2OLHA 1V7YA 3TXVA 4S39A 1QNOA 4UTUA 2JKAA 2O0TA 4AF0A 2RUCA 3KHDA 2QUUA 2R6OA 8XIAA 1Y0EA 4KRTA 5D2VA 3NQ8A 1UKOA 3CIVA 4ROQA 1TCMA 1U22A 3VINA 4FXRA 1NFBA 4ALDA 1QNQA 4TQTA 1VHCA 1G7VA 1CT5A 1VQTA 2V3FA 3B97A 4JN7A 3G6LA 4IJRA 4RR4A 2NQ5A 1SU5A 2G3MA 4H9MA 4REQA 2XP4A 4US6A 5LNVA 3CPRA 3K4DA 1TTIA 3O5IA 3IS4A 4F0HA 2PWUA 3RU6A 3WDRA 5C70A 2OO0A 4ZPTR 1OCNA 3HQPA 4R34A 4C02B 4QX4A 3CUXA 1K02A 1MXDA 3GHRA 1S2UA 1F2JA 2WSRA 5CJ5A 3DH7A 2ABBA 1UWSA 9XIAA 4DF0A 2C0HA 2BOGX 3UVIA 3L2IA 4QDMA 3AUOA 2G41A 3ZSTA 3EOOA 4N4PA 1N8WA 1NMWA 1WA3A 1A3HA 3W6MA 1TJ0A 4C6CA 3NL6A 4DZIA 1R3WA 2ETNA 3IV3A 4KEMA 2F21A 2HPIA 4JTHA 3P0XA 1VENA 3TYDA 2GWGA 4GZJA 4AZ5A 3VKDA 1N1AA 2F61A 3H2MA 4Y2WA 4S1FA 3BE7A 2F38A 3ZVIA 1OG0A 4EPEC 3W86A 4GGHA 5F2IA 4EXBA 3UJFA 1XYMA 2XSAA 3WBYA 3S1WA 1TWZA 2XH2A 3CHCA 5T9CE 3WCZA 2OWXA 3UXKA 4KCTA 1S5NA 2O7SA 1OBAA 1UD8A 2YFNA 4IISA 2J6VA 4OWGA 4GG9A 1O1ZA 4HNNA 1UR8A 4QXIA 5J6EA 3I7SA 2WJZA 1R0MA 3VD9A 3L0GA 2EHHA 5EPDA 3WKZA 2IF4A 1QW7A 3AIWA 1A5UA 2J6XA 4H3DA 3A3XA 4UFJA 4LFYA 4WIWA 3PZMA 3VOIA 1CI1A 2NSOA 1KR1A 1GVOA 1JI1A 1BD0A 1Q6CA 3LGEA 3CHDA 4V33A 1YPFA 3EOLA 2QS8A 2IKHA 3GVRA 1UP2A 3A5FA 4RXGA 3IUHA 1WOBA 5IDZA 4LANA 3URAA 3LBCA 3FGCA 2Y7FA 4OQVA 2DSKA 1JD7A 1Q5MA 3C2YA 4D1JA 1QPOA 4LY8A 1GTEA 3MKKA 4M6PA 1C7TA 1D8CA 4TVDA 1QTWA 1PJ9A 3W29A 5D9MA 4EK7A 4IUOA 3SUVA 2ZVIA 4L61A 2PLJA 5DF0A 2J7GA 1MW3A 4ZXOA 3TJXA 3BSHA 3BL3A 1FBAA 3NTYA 4JX5A 4C5ZA 4AHOA 1JCNA 1FWHC 1MEHA 5JU6A 4IICA 1VHNA 1DWAM 5MKGB 2QJGA 3SEPA 2Z25A 4LYRA 1UCWA 2GJXB 3MUIA 3UQBA 5BU9A 4D6EA 1OFRA 3TR9A 3HMJG 1KT1A 2ZXAA 5I7GA 1TR1A 3MC5A 1CGWA 2J8GA 3VC6A 1R7AA 4AZIA 4HMDA 3WLIA 1OZMA 4P8VA 1LWJA 5AC5A 3R10A 1Q2SA 3ABSA 1B90A 1ZJHA 3OIXA 2O92A 2FZ8A 2YB4A 2PDYA 4Y8FA 3RIKA 3W85A 3ERPA 3N13A 2FYMA 3IGHX 4MJZA 2R1MA 3C8NA 3CUFA 4IG2A 4LWWA 3S6OA 3WY1A 4GXWA 4B90A 3S2LA 4ML9A 3RMJA 1GRJA 3W1XA 5ABFB 3G3MA 4I5UA 4B5VA 2GYIA 3FXGA 5A69A 4UFKA 3OG2A 4HB7A 1JQXA 3GH5A 1KNWA 1EA9C 4MM1A 3UP8A 3WMBA 3W7DA 4TTGA 4LRTA 4C60A 2J62A 3C0SA 5C9ZA 4Q7NA 1EJVC 3HQOA 4UTJA 4XG1A 2E9LA 3ONCA 1GVYA 5D38A 4UR9A 4TX6A 5DMNA 4ODKA 3GXNA 4LNCA 2J7HA 2FZNA 2Y5EA 2QKFA 1R2RA 1YHTA 3TYBA 5G1MA 5BYWA 4LX4A 3FKKA 4FSAA 5DANA 4OTKA 2YKKA 2WO5A 1YE6A 3CGMA 1EF3A 2ZRXA 3GW0A 5CZSA 1E44A 3KBNA 3AIQA 2PF8A 2HEJA 4K2SA 3ANVA 4XIAA 3EIPA 3QHOA 2BY0A 3AISA 3UXIA 2PV3A 3W1AA 2J79A 4J1OA 3M5VA 4Y7EA 1I1XA 3MA8A 1PHWA 2C1GA 4JYSA 2X8RA 1J0HA 5C55A 2QCGA 2IQ0A 1TJ2A 4NQ1A 1PXGA 3RNDA 1MSSA 2QCNA 3GDKA 3PPHA 3PSWA 4H1ZA 3P82A 4K68A 3KAHA 3WLTA 4YCPA 1PZ2A 2Y88A 4C7GA 3GSMA 1GEQA 4FOJA 3KE0A 1Z42A 1QOQA 2QJIA 4FLOA 2PBGA 4FIRA 4U3CA 3GNNA 1V51A 1JZ7A 1OC6A 5HWMA 1H51A 3L66A 5F4XA 2XIJA 4GQRA 1QOXA 3A4WA 7XIMA 4LRSA 1O95A 1SW0A 4UZSA 3H4XA 3QKZA 2XN2A 3ID7A 3GTXA 4QHRA 3F2DA 4NKCA 1H1YA 4O11A 2W66A 4K39A 3NO3A 2Y5JA 3S8HA 1RA5A 2A2IA 1IR1A 2H6RA 2AKMA 2QHAA 4GE8A 1OVDA 2MLXA 1JAKA 1XIIA 4HGXA 3R8GA 2KO7A 3SM0A 1XGZA 1VFFA 3ZT5A 4KRZA 3WLNA 3M0ZA 1M01A 4Z08A 4MJMA 4DM2A 3WYZA 1SZNA 3KCEA 3OA5A 5LIXX 1Q7QA 3QFWA 1A3WA 2ZWZA 3NQFA 1LT7A 3F1QA 3M46A 4A8IA 3L0NA 3LA4A 4PMJA 3BAJA 1ICPA 2VKZG 3BOFA 1KM5A 4QQUA 1UC5A 5KZMA 2WSQA 5EMJA 2XGZA 2ZUTA 2PPPA 4OT7A 1PTGA 1J93A 4F0MA 2NLYA 3IJ8A 1OK6A 2OELA 5BZAA 4QJ4B 3S5NA 1DWJM 2X1IA 3AAMA 3AZRA 3GYCA 4ODMA 3E5PA 4B4FA 5CH9A 1QASA 1BGGA 3HO8A 1A80A 4XISA 4DY1A 4GY0A 4Q8NA 3CMFA 4JQ4A 2DIJA 4RDZA 3TCZA 2WCSA 4H9ZA 4GGQA 4O52A 1CGTA 5FF7A 5DO8A 4GVFA 3SB0A 3PPCA 1GOWA 4QS6A 3BMVA 1FAPA 3O5MA 2HRWA 2C6QA 3B8IA 1WUFA 3N2TA 5C9XA 1IZJA 2XP9A 3VD3A 3WH5A 1Q6QA 2VC7A 3PWAA 1YXCA 4W8LA 2HBXA 2PBOA 2RFGA 5F1VA 5FAGA 2VO5A 3GR4A 2XGIA 3KOXA 3CM4A 1PDYA 1PINA 1T8XA 3BCDA 2AMGA 4G2PA 3ZT6A 4TOQA 4UQCA 4AEEA 3AUJA 4KPLA 4RX0A 1XLHA 2X40A 3UBPC 2JE8A 1KBIA 2YCLB 3WD0A 1GW1A 1KM1A 3LCIA 2MNRA 3C61A 1KFCA 1KBJA 3Q4DA 4MWAA 5E09A 3UU0A 1K8XA 2BY2A 4D6GA