2YBTA

Crystal structure of human acidic chitinase in complex with bisdionin c
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
377
Chain Sequence
AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ACIDIC MAMMALIAN CHITINASE
total genus 126
structure length 377
sequence length 377
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybtA01
3VUPA 5A69A 4OBSA 2DSWA 2QHAA 2VQUA 1KGWA 4AZGA 4QFUA 1BYCA 1TE1A 4M56A 2WWDA 3N11A 5HNNA 4UFHA 2J47A 4XV0A 1WDQA 3AXIA 3RMEA 1PPIA 1XSJA 1I1XA 1W9UA 1AVAA 4AD2A 2W66A 3WH8A 3DYOA 3VIFA 4W8AA 3AMDA 2V3GA 2YL9A 1TMQA 2JFEX 1MW2A 3BAXA 2XG9A 1GPFA 1NARA 8CGTA 1IT0A 4H41A 1E15A 5TD4A 3WNKA 4PSPA 3WF1A 4P8WA 2Y8VA 1FP9A 2OWCA 2XM2A 4AMCA 3VD5A 2YA1A 3AHXA 4LYRA 2YA0A 2PWDA 1E3XA 1VF8A 3ARXA 2VMFA 1FH9A 3SIMA 3OLDA 5C71A 1WB0A 3WQVA 5EFFA 3VMNA 3WY1A 5M3WA 3CH9A 4L4OA 4P7RA 2VRKA 5CSUA 2VVNA 2QF8A 1QI0A 2YJQA 3VD9A 1EOKA 2JALA 5A8PA 1UOKA 3GXMA 5E6ZA 3AIBA 3ZSTA 3B9DA 1XD0A 1PIFA 1NWTA 1KQYA 4ZEPA 2GFTA 2JIWA 4F66A 3W82A 2IXVA 4JFTA 3CZJA 3RO8A 1P6WA 3WUFA 4P7OA 1XYZA 3VILA 2G41A 1H5VA 3WD4A 1WZMA 2BFGA 3WNOA 4S3KA 3GH4A 1B3WA 4MJ2A 5D9PA 1JYNA 2OSYA 4YN5A 2WSKA 1Q6EA 3T0DA 1ZBWA 1J0YA 2WANA 4TX6A 2G3IA 3K8LA 3CHFA 3T09A 3DC0A 2VCAA 4TTUA 3SCSA 1CENA 1BVNP 2O9PA 2D3NA 5CJ5A 4W84A 1EDTA 1BG4A 5A6AA 1PZ3A 3WQ6A 3VDHA 1OT2A 5GNZA 3AS0A 5A2CA 1V02E 1J0HA 2J7DA 1VRXA 4HZ7A 1GOMA 2D0FA 3G6MA 4AZCA 3N18A 4BA0A 4HA4A 1JZ6A 1HL8A 3W6MA 2VRJA 4FMVA 3K4AA 4E2OA 1E4NA 3AQUA 2WMIA 2D0GA 1GUVA 5A6SA 5JIPA 4DUXA 2B31A 4AISA 3D3AA 3MSGA 3ZQ9A 2D0HA 4EANA 4CKQA 2EPKX 4W93A 1UWIA 1E4LA 3GDBA 1PIGA 4MNLA 4P7LA 2F61A 1E71M 1PAMA 1KCKA 3EDDA 2DSZA 2GUYA 3WDQA 4X0NA 4LQ1A 1CGUA 1HL9A 2A3HA 3UESA 5CZKA 4TTGA 6TAAA 4PMUA 2XIBA 5D9OA 3RM4A 3ARPA 2EEXA 4HPHA 1GQLA 5I2UA 1BLIA 2CYGA 3CBWA 1DWJM 4E8DA 1WZKA 4W86A 3RJYA 1RPKA 1UH4A 4FLRA 2WK2A 3AI0A 4ZXOA 1GJUA 2QMJA 2VUYA 5E09A 1OGSA 3THDA 1MQRA 2HVMA 3ZJ6A 3KL0A 4PUDA 1U33A 3CZGA 1V08A 1W9XA 2PB1A 1HJSA 3AISA 1U30A 4Z2GA 1CGYA 2J7FA 3BAJA 2VR4A 3TOPA 3NDZA 3WMBA 5IHRA 1GQJA 1ZL1A 4PUEA 1J10A 2PWGA 1XH2A 1EXPA 5A94A 1WZAA 4P8VA 2J62A 1V3MA 4QLKA 1UKSA 3ZR5A 2DT1A 2CKSA 2ZXAA 4M1RA 1NP0A 2OSXA 1W9PA 1ISXA 3WMCA 2G4FA 4AZ5A 3FY1A 3WDRA 2PBGA 3N12A 3MKKA 4FF5A 1BAGA 1E0XA 1L0PA 3LPPA 3ZJ8A 1UA7A 1TVNA 4R27A 2OYKA 5CG0A 3FNDA 2GJXA 1UKOA 2YOCA 4AD0A 2NT0A 4AD4A 2JF6A 4M24A 2YKKA 3WEOA 4M82A 2J25A 3CUIA 1DWAM 1J0JA 3WIJA 2O9OA 5I5RA 2ZUWA 2YBTA 4WK9A 4WIWA 1QBBA 2ZXQA 4DUVA 4PYSA 1KBKA 1OINA 4UQAA 4U2YA 1E70M 2J8GA 1W1PA 2VCBA 1ZBVA 1FH7A 3MUAA 3D5HA 3M7SA 1PBGA 4MAVA 2WSPA 1CECA 5JBDA 3VNYA 1RD6A 1LLOA 1CXLA 4QDMA 4W8BA 2E8YA 4AIUA 1VB9A 4OBRA 1JZ4A 2GJPA 2WBGA 1QVBA 5EMYA 5EFDA 5C70A 3VIGA 1V3KA 4PSRA 4NZCA 2VCCA 4CCDA 1BYAA 5AY7A 3L4VA 1H1NA 3ZSSA 5A6KA 3W28A 3CUGA 2Y4SA 4LPCA 2E9LA 4CD6A 3OZOA 1H11A 3CMJA 1CTNA 4RL3A 3ZO9A 3IAQA 2W92A 1ESWA 2OYLA 1W32A 3CPUA 2CBVA 3B9EA 1VEOA 2WLZA 3I3BA 1NOWA 1EH9A 3PZGA 3CGTA 5BXTA 2CHOA 4AD3A 2VZVA 5BCAA 3ZIZA 5C8BB 3WQWA 1GVYA 2DDXA 4AW7A 1UZ1A 3IAPA 1J0IA 4UQDA 2WC7A 4JHZA 2DIJA 1GONA 4J3TA 2W62A 4ATDA 1K9TA 4FK9A 4H8HA 4H8UA 2XGIA 3E1F1 3HMCA 1HVXA 2AAAA 4HPGA 2ESCA 3AHTA 3KL5A 1V6YA 4PMZA 4UOQA 1LL6A 4V2XA 3SUVA 1WAWA 2BY0A 2DEPA 4ZENA 1UD8A 5A6BD 4NSBA 1E6RA 2W5FA 2NW0A 3VGHA 1BG9A 3CIVA 4B9ZA 3AJ7A 3AMCA 4PTXA 3MANA 1H4PA 3AMKA 3WDHA 2CKRA 4AD5A 2CESA 4J3SA 1UH2A 1BSIA 2DIEA 1E6PA 3CTTA 4GINA 2C7FA 4ATWA 1D3CA 1XCWA 2VOTA 2VZUA 3WF4A 2VRQA 3MMDA 4XZWA 3BC9A 4CN1A 2BHUA 1DWGM 1A3HA 2WHJA 4QLJA 4UQBA 1VIWA 1NM9A 1UD5A 1V6WA 1H0IA 1JGIA 1ZU8A 3AROA 1AQ0A 1BQCA 4ZFMA 2O9TA 3AZRA 1CGTA 2NSXA 1H49A 1ITCA 2D3LA 1DWFM 4U2ZA 3OIHA 2VZOA 1DP0A 1HXJA 1UD6A 1QOXA 3RIKA 3FXYA 1UR2A 1VFFA 1E6NA 3WD2A 3WNMA 3WH5A 2AMGA 1OT1A 3BAIA 3WF0A 4IUGA 5LYRA 3ZT7A 1X6NA 1YQ2A 2ZOXA 2XWEA 5D4YA 1KXVA 1H0GA 3S6TA 3W6LA 3L4UA 3VD4A 3T2PA 1QNQA 1HP4A 2WW5A 3VDBA 2WVSA 4JL2A 4KWUA 4P8XA 3QHMA 1HT6A 1ISVA 2V38A 4PCSA 4JFSA 3DHUA 2X2YA 4HP5A 4MNJA 3PTKA 4W7UA 3GNRA 4XZBA 1XRVA 3VIHA 1QNSA 3WL0A 1JDCA 3ZOAA 4D6IA 1MYRA 2V3DA 4J27A 1J18A 4X9YA 2C8NA 3WBAA 6A3HA 2YDQA 1CWYA 2GJXB 1W3KA 1E5JA 3L4WA 5AYBA 1JZ2A 8A3HA 1V0KA 4EAMA 3N17A 5IFTA 1EQPA 1FH8A 3SCWA 1KXTA 3CHDA 3VINA 3EDJA 3K8MA 1C90A 1EO7A 4P7QA 4D6HA 2UWFA 3AOFA 3VGBA 1NOFA 3HU7A 1GOWA 4UFJA 3MMUA 3KWXA 3RPMA 3W26A 3RJXA 1JFXA 5AC4A 2EQDA 5D9MA 3BAYA 4AXNA 2NT1A 6CGTA 1UHVA 4GQQA 2Y5EA 4JFWA 3WH6A 3AS1A 4KMQA 4PBGA 5A6MA 2YA2A 2WC3A 3GH7A 1H09A 4CN6A 2WXDM 5D8ZA 3VNZA 5ABHA 4PMDA 3MUY1 2IXUA 1E40A 3AHYA 4YHGA 2XPKA 1J0ZA 1W2PA 1JZ3A 4ACZB 3EDEA 3K8KA 3RM9A 4BQ4A 1CNVA 2ZWYA 1Q6FA 2XJ7A 5BRQA 2WM0A 2BXYA 4PCTA 4CD4A 1DEDA 3A4XA 3GXDA 1UD3A 4DM2A 3VGEA 3GXIA 4EE9A 1GW1A 3ARTA 3FW6A 3VGGA 2V3EA 5IHSA 1OGGA 4J3WA 4HOXA 1D2KA 3AICA 1EA9C 4H04A 3WH9A 3M46A 3SUSA 3ZT6A 1B90A 4D6EA 4KGLA 4AEFA 4H7VA 3OGVA 1H2JA 1VAHA 3AYRA 1BPLB 3CO4A 1B1YA 3HN3A 3VPLA 1ISYA 1YHTA 4JZ5A 1E4IA 1MWOA 5E9AA 1ZB5A 1XSIA 3WD1A 4JCMA 2CNCA 1HIZA 1UR1A 2WMJA 1JFHA 3SCVA 1BTCA 4F8XA 4B3LA 2FH8A 9CGTA 2BXZA 3VKKA 4DWSD 1ECEA 3PHAA 4CN4A 2PWFA 1G0CA 3VX0A 3MUZ1 1C8XA 4OIFA 3SUWA 3EYPA 3VD3A 3O6AA 1KFWA 2A3CA 4LX4A 1AQMA 3GZAA 2XTKA 2GJRA 3WEMA 1QI2A 5I77A 5ECUA 1PX3A 4OOUA 1D7FA 1W9DM 1M03A 1EDQA 3OLIA 1F4HA 3BSHA 3U5UA 2UY3A 3ZM8A 5HOSA 2GVYA 3FAXA 7CGTA 2VTFA 4KRTA 3B8SA 4MDOA 1OIFA 1E72M 1E6QM 3PZIA 3OB8A 4PTMA 1LG2A 1HJWA 3A3HA 1R85A 1QNPA 3NIYA 4TVUA 5GNXA 4CCEA 4DWSC 1E4MM 4GZJA 2BHYA 1OD8A 1V03A 3PZMA 3T2QA 1UKPA 2JF7A 4MPKA 5A6JA 2J8FA 4Q7NA 2ZX6A 1WPCA 4PMQA 5GQBA 5F7UA 3AZTA 2PC8A 3BSGA 3GH5A 4C7GA 3WN6A 2D2OA 4RE4A 4UOJA 1IV8A 2XVNA 1WDSA 1OSEA 5EBAA 4YPJA 1EQCA 1JF5A 1CGVA 4HMEA 4DWSB 4D6JA 2J4GA 3PZNA 4BS0A 2BS9A 4MNMA 5E0FA 2D1ZA 2FHBA 1JL8A 3PZQA 4TX8A 4W88A 4CU6A 1GVIA 4OUEA 4BQ2A 3ARZA 4CU8A 4GO8A 1JYVA 1QHZA 1C7SA 1KB3A 3CZ8A 1JIBA 1V6VA 1C93A 1UR9A 2BVYA 2OWXA 1HJUA 3JUGA 3UG4A 1EOMA 3ZJ7A 3ARUA 1GJWA 1V0MA 1E3ZA 1Y7VA 4MB3A 3WKZA 2DH3A 5ABEA 2Y2WA 2W61A 3WDIA 3VIMA 5ABGA 2J7EA 4X0VA 1HJQA 3ZMRA 5I79A 1W9BM 2WMHA 1O6IA 2W67A 2YL5A 1NWSA 3AIRA 3FN9A 4A4AA 3FHQA 5ABFA 2D20A 2WMFA 1JZ7A 1OCQA 1PX4A 5A3HA 1OBAA 4PRWA 2WCSA 1SMDA 1NQ6A 2J7BA 5CPTA 4GZIA 3QOKA 5FL1A 2F8QA 3VD7A 4PMNA 4JFVA 3ARRA 4JAWA 2J7CA 3MUIA 4URIA 1TG7A 2WVTA 2DQXA 2CBIA 4D6CA 3VGFA 1EIBA 3TTYA 2VZTA 1JI2A 1HVQA 4IPLA 1QW8A 1LWJA 2UY5A 3CHCA 1J9YA 2J77A 4WKHA 1WNOA 4OJYA 1CXHA 4AC1X 2XUCA 4KGJA 1V6UA 3OZPA 3BCDA 1OB0A 1IZJA 4D71A 1XSKA 3WQ4A 4HMCA 1UA3A 2Y8KA 4JKLA 5I78A 1UR0A 2YBUA 5CSYA 2RGMA 4AZIA 2WKLA 4QCEA 5FOOA 2JE8A 3WUEA 3N15A 3K46A 4CVUA 5JH8A 4OKDA 4UNIA 1EDGA 2WWCA 1KQZA 2WVUA 3AXXA 5BXRA 3VIJA 1E5NA 1QI3A 3WNNA 2ZIDA 3IJ8A 1ODUA 3MU7A 1MQQA 2W63A 1BVZA 2GK1A 1GHRA 4AZHA 3SCNA 4BCEA 1N82A 1UYQA 2EJ1A 2DH2A 2YL8A 2G3MA 3WL1A 1CGWA 4PEEA 4F9JA 4GI6A 1V0LA 3EDKA 2CXGA 4S3JA 4C7DA 4NRSA 1GQIA 3NYDA 3VMPA 4IISA 1E9LA 2EO7A 4ML4A 3NJ3A 2QMKA 2XFFA 3APGA 3EDFA 3N1AA 1B2YA 3BXWA 3AIEA 3WBEA 3AFBA 3GM8A 4GPNA 2XSBA 3W25A 1WP6A 3L2LA 1E6XM 2WCAA 2VX4A 2ZE0A 4AEEA 5CLWA 1IZKA 3LPGA 2CHNA 5FKYA 3I3DA 1C7TA 1C8YA 3QGVA 1ITXA 4A3HA 1LF1A 1C8QA 3PZTA 1E6ZA 3UG3A 3VIPA 3M07A 1FA2A 3CZLA 4Z2LA 1B9ZA 1AQHA 4PMOA 1XYFA 4NI3A 5EB8A 4OOZA 1V3HA 2VJXA 3CUHA 5DT7A 3IANA 4AZCB 1MFUA 4GIAA 4UFIA 3TTOA 1DTUA 1JXKA 1US2A 3SCRA 2UY2A 3S2CA 3SURA 3WF2A 3L4ZA 1JDDA 4D6FA 1NWRA 2BHZA 2E0PA 3VGDA 1US3A 1HNYA 2VL4A 3QHOA 5HDRA 3SCOA 1JD9A 1V3IA 1KR1A 2EPMX 1W1VA 1CBGA 4NF7A 4MTVA 5GPRA 5I6SA 4UFMA 5JUVA 1OD0A 4ATLA 4WSKA 1MXGA 3ARWA 2A3EA 3NSXA 2O9RA 3BH4A 3RCNA 3B9AA 1XHGA 1HKMA 1C92A 2WMGA 4PMXA 1LJYA 4LGXA 1VBRA 3IJ7A 4P8UA 1W3JA 1E0VA 2GSJA 5ABFB 1BYDA 4GI9A 4PN2A 1WDPA 2Z1SA 3WUGA 2XFYA 3SCTA 5JBEA 4CUCA 3AIQA 1MQPA 3W38A 3II1A 4LXFA 3W53A 4JCLA 3UG5A 1FOBA 3U57A 2WYSA 2OWWA 1OWQA 4Q22A 3VDAA 2VVSA 1CLXA 4TUFA 3O2LA 5LA1A 1G1YA 1KGXA 1V3LA 4D6DA 2WHLA 1EHAA 4WLCA 4TVCA 5BYWA 1BFNA 1QNRA 1JG9A 1R7OA 3OLGA 5A1AA 7TAAA 2DSKA 3N13A 1RP8A 3VU2A 3DHPA 1CEOA 4W8LA 1V02A 3NSNA 1FP8A 3K1DA 1LWHA 2BVTA 3PBGA 3NUKA 2UY4A 2Z1KA 2DT0A 1LG1A 4N0RA 4PMRA 4U33A 4DM1A 1NH6A 2VX5A 4BF7A 1OGBA 4HOWA 1E6SM 2VQTA 3NSMA 2ZUSA 4KRUA 3T2OA 2J79A 1BYBA 3ZJKA 4GQRA 2J78A 3WFLA 4W7WA 4U5KA 1HN1A 4AWEA 1E56A 5DO8A 1JZ5A 4QP0A 3TA9A 1TA3B 5A6LA 1X6LA 1Q4NX 1QPKA 1LL4A 2X09A 1HF6A 2GDUA 1SR0A 2DGAA 3MV11 1RH9A 2ZUVA 1ZS2A 3TTQA 2WKGA 4V28A 3AYSA 2ZXDA 3CLWA 3O9NA 1TZ7A 4UQ9A 1HKJA 1GCYA 4W89A 4CCCA 4HMDA 3W0KA 3SEPA 1UWQA 1MFVA 1EHNA 3SUTA 4AIEA 3VVGA 2XVPA 1TCMA 4HA1A 4IPNB 2J7GA 4CD5A 3PZOA 1CZ1A 3T08A 3EMQA 3VIKA 1JI1A 1UH3A 1WDRA 3J7HA 1FFRA 4GXPA 1K9FA 3CUJA 3HJEA 3ARQA 3OG2A 2J74A 3VX1A 2E4TA 4UR9A 1UD4A 1XV8A 1MXDA 1W1TA 2JEQA 3WD0A 1CDGA 1UKTA 4A3YA 5I24A 3FHAA 3THCA 2XYLA 1XGZA 2CITA 2PF0A 5CLTA 3UCQA 2XVLA 3KL3A 2A3AA 1I75A 1V0NA 4HOZA 4M81A 2XWDA 5BXPA 1OM0A 1SMAA 3W37A 1ISWA 7A3HA 2QPSA 1B30A 3POCA 2JIEA 5I3DA 2FDMA 1QI4A 4V27A 3VDCA 3AHVA 2V5CA 3L4XA 1DHKA 5E6YA 4B9YA 1E73M 1HKKA 3SUUA 2WHMA 3WELA 5A95A 3QHNA 4FLOA 2WZIA 1E1FA 3CMGA 5DMYA 2VI0A 2ZWZA 1BGAA 3OGRA 4XX6A 3SCQA 2DSUA 4ZE4A 1TFVA 1QI5A 3WENA 2W91A 2OLHA 2CEQA 4CD7A 1F4AA 1VFUA 3POHA 1NOUA 3UR8A 1I1WA 4C7FA 5CPQA 1VEPA 2GK1B 3AMLA 2YDRA 3LMYA 4N42A 2ZX5A 3ZR6A 3U7BA 2VC9A 1UWUA 2WHKA 3M6DA 4TOQA 1W3LA 4GKLA 3PZ9A 2J75A 1G01A 3A4AA 1M01A 3VTRA 1WCGA 3T0BA 5KZ6A 1NWUA 3WQ5A 4B3KA 5DFAA 2QLYA 2XFRA 5I23A 5M5DA 2VURA 2IUZA 1GQKA 1MW0A 3PN8A 3TTSA 3GBDA 1R7AA 4YHEA 3VO0A 1KWGA 1UWSA 2XVKA 1K9EA 4WF7A 4E4PA 2BNJA 5A8MA 5CQ1A 3WNLA 2WLYA 1W1YA 1GOQA 5IXEA 4OZOA 1WO2A 3CZEA 1V3JA 1GOIA 4QLLA 4AIOA 4IM4A 2WBKA 4GI8A 1C91A 1UG6A 2ZICA 3I3EA 1HJXA 4XB3A 2YL6A 1CYGA 2AOSA 5BROA 4PMYA 3UERA 4JFUA 1VENA 4QCFA 3WEZA 1JZ8A 4J3XA 1VBUA 4U3AA 5FL0A 2XSAA 2XVGA 4J7RA 5IDIA 1KXHA 4D1JA 2ZXBA 1W91A 3GYCA 1OIMA 3ALFA 4MB1A 4JL1A 2O92A 1JF6A 1VJSA 3ARSA 1JDAA 2PWEA 3QR3A 5JBFA 3KE0A 3RM8A 4ACZA 3BGAA 3LPFA 3N04A 2DPEA 5HBFA 1Q6DA 4H2CA 1QHPA 1JAKA 1GOOA 2HISA 1UR8A 2QV4A 2BY1A 4TXEA 4JKMA 1S46A 3BCFA 1FHLA 1EO5A 2GDVA 1R8LA 1SFSA 3U7VA 1ZJBA 4W85A 2OYMA 1QHOA 4CGTA 5DEZA 3GXFA 2V3FA 3WF3A 5A8OA 2E8ZA 5GNYA 3GTNA 2Y24A 3PZUA 2BY2A 2OSWA 1JNEA 1UR4A 2X05A 3WH7A 1WZLA 2G3NA 1KXQA 1B3XA 2WC4A 1JNDA 2YDSA 1U2YA 1VJZA 2D22A 4MNKA 4F79A 5FCZA 4J3VA 2CCRA 2EPOA 2ZUTA 1G9HA 3VM5A 4W87A 1KCLA 4BQ3A 4B16A 4HZ6A 1UUQA 4AZ7A 3AHZA 1CXKA 1GNXA 3DECA 5BWFA 2WB5A 4MB4A 1PJ9A 3UR7A 1BF2A 4MJ4A 1K6AA 1B31A 2ZX9A 2VX6A 1JD7A 4FLQA 1JYXA 2XHYA 4R5EA 4EK7A 3L4YA 3BLPX 2EBNA 3F5KA 3LPOA 3RDKA 3WDJA 4AYSA 1CLVA 1QW9A 3W24A 1TR1A 2FGZA 1Q6GA 2DT2A 1KBBA 4BZYA 2BV9A 1HKIA 1FHDA 1J0KA 1W3HA 3K4DA 3NCOA 1W9VA 1UD2A 1HJVA 3DYMA 3SCPA 3MSDA 4LYPA 2FGLA 4AY1A 3TP4A 2X0HA 1ISZA 4PTVA 2CBUA 4MAZA 3A47A 2C0HA 1PX8A 3F5LA 3CZKA 1LQ0A 2BY3A 1AMYA 3AIVA 4DUWA 4JKKA 2A3BA 2ZUMA 5A8QA 4ZE5A 3RILA 3AZSA 1ZBKA 1E43A 1M7XA 4U3CA 3DYPA 3WQ8A 1E55A 1E1EA 2YLLA 4UFKA 5A2AA 5A2BA 1H3GA 4H8VA 5M17A 4E8CA 4DWSA 3MS8A 4M80A 4Y7EA 3PTQA 2WPGA 4ACYA 4RE3A 5LA2A 3GNPA 2CPUA 5DT5A 4MADA 4J3UA 1UQYA 2FHFA 2E40A 4FLSA 5D9NA 2FHCA 3WMSA 3G6LA 5A8NA 3OGSA 1EGZA 4U31A 1HP5A 3W29A 1NP2A 4WSJA 1GOKA 1UWRA 3OA5A 4RE2A 2DSVA 5HPOA 2WMKA 5AC5A 1ZBCA 3AIWA 1LL7A 1JXJA 1UKQA 1CGXA 2QPUA 2X1IA 1DWHM 1JYWA 1FFQA 3CUFA 4JIEA 3OLEA 4CD8A 3WUBA 3IK2A 4W7VA 2VO5A 4WKAA 3BAKA 3A4WA 2ZUNA 1SYTA 2VNCA 4AZ6A 3W4RA 3CHEA 4UZSA 2TAAA 3GBEA 3L4TA 2PBOA 3PTMA 5DF0A 4K68A 4UTFA 1W2VA 3UETA 2WAGA 4BQ5A 4NRRA 4UZUA 3AS3A 3U5YA 1CXFA 3FAWA 5E0CA 5IFPA 2YLAA 1B3VA 3BMVA 1XC6A 4D72A 1KGUA 1M04A 4XUYA 4D6GA 1JAEA 3MO4A 3WFZA 2WZHA 3IJ9A 1VFOA 4TVDA 3T0AA 1GHSA 2VR5A 4J28A 5LA0A 2MANA 3ARVA 3MMWA 1J11A 1ODZA 1MVYA 1J12A 4WKFA 2VT0A 1G5AA 1VFMA 4UQEA 3BMWA 5A6BA 1QNOA 1R87A 1XD1A 1Q6CA 3QOMA 1CXEA 2V5DA 4GO9A 1TA3A 2X0YA 2G3JA 2D24A 4Z2HA 4AZBA 4UQCA 2EXOA 3W27A 2YIHA 1ZJAA 4HTYA 1CIUA 1XH0A 1UQZA 2XIIA 1MW3A 2CIPA 1HX0A 1RP9A 1QBAA 3PZVA 4M29A 4HU8A 2ZX8A 2ZUUA 5M03A 1X1NA 1B3YA 1MW1A 4PTWA 2PWHA 1CXIA 1GZJA 3ECQA 2FH6A 2E3ZA 1TUXA 1K9DA 2E9BA 3WSUA 3BAWA 4CU7A 2W4XA 1C3FA 3UEQA 1B3ZA 3EBVA 5BXSA 5CGMA 4WJXA 4PMVA 4MDPA 2XM1A 2DT3A 4Z2IA 2J7HA 3L2MA 2VX7A 4ZXLA 1KR0A 2VZSA 1B0IA 4QAWA 3VOCA 1CPUA 5KEZA 1V6XA 4HU0A 1M53A 1J01A 3AXHA 3ALGA 1XCXA 3VIIA 2WZEA 3WNPA 3WDPP 4CVWA 4P7NA 5FIPA 3KZSA 4MB5A 2CBJA 5CGTA 5E70A 1PEZA 3WD3A 4UFLA 3TONA 3KEHA 1KWKA 3GNOA 4U5IA 4KH2A 4W5ZA 1O7AA 3NDYA 3N9KA 2CETA 4L4PA 4HZ8A 5BRPA 3F4VA 4HA3A 1WE5A 2F2HA 2E9MA 3EMCA 1H41A 3W81A 5JIWA 1GORA 1R86A 2X8RA 5CXPA 1VEMA 3VM7A 2WMIB 2Q8XA 1BHGA 2JEPA 2EPLX 5HXMA 3AS2A 3AIUA 4EKJA 4B15A 4M8UA 2WVVA 3ARYA 4W5UA 5I0DA 3VMOA 3SCUA 3A6OA 1A47A 3OBAA 5AYIA 1DWIM 1PZ2A 4GZEA 1BGGA 4UOZA 2EPNA 5FD0A 2D23A 3AMGA 4D1IA 4AD1A 5HPCA 2XGBA 4UCFA 5D8WA 3VIOA 2BVDA 2WNWA 1E0WA 1L8NA 2PI6A 2CERA 1UWTA 3BLKA 2WCGA 3F5JA 3MV01 2G8ZA 4LYQA 2RGLA 4F9DA 1G94A 1WKYA 2ZX7A 1TVPA 4Z2JA 3EMZA 4JHOA 1Z32X 5CPSA 1UZ4A 1XH1A 3ZT5A 4Z2KA 2WVVB
chains in the Genus database with same CATH superfamily
1OF8A 2IKIA 1FWAC 3CXOA 2VQUA 1XIFA 4N4PA 4QFUA 1B3OA 2WWDA 3N11A 4DT4A 5HNNA 4UFHA 2J47A 3NM3A 2P50A 3DYOA 5FEZA 2XIQA 1TMQA 3QY7A 1W1A1 1KFKA 4JX4A 4D8AA 3QYSA 3BAXA 2XG9A 1GPFA 4H41A 3WLQA 5G1MA 1QPOA 4AF0A 2P8CA 1H50A 3SAZA 1W31A 3WLLA 5HINA 4QSFA 3WJXA 2OWCA 4GG9A 4AMCA 4L4MA 4KPLA 2OOFA 4FIQA 1VF8A 1ICSA 2PDPA 2RAGA 3SIMA 3KHDA 3U3HA 3GDKA 4KT2A 1EUNA 5CJNA 3UJSA 5H8UA 5M3WA 3U2EA 4L4OA 5CSUA 4IQEA 1YKWA 2E6AA 2YJQA 3QY8A 1UOKA 3N2CA 1XD0A 3ZSTA 3CT7A 2GFTA 5EPDA 3KRSA 3W82A 1XLJA 2WZMA 1A5KC 1TE6A 3UXKA 2G41A 2BGQA 3WD4A 2HVNA 3DHFA 3W1XA 2ZC8A 4S3KA 3GH4A 4KFNA 3IRDA 5K9DA 1B3WA 2XP7A 2X16A 2W3ZA 4MJ2A 4LBSA 4MG4A 3CLMA 2WSKA 2QKFA 2WANA 2QAPA 4NU7A 4TX6A 1S2WA 3FFSA 4KKXA 2G3IA 3T09A 4UR8A 3MVIA 1CENA 2O9PA 2D3NA 4ZFCA 4M0XA 1I6NA 1OCNA 3VDHA 2F4EA 1OT2A 3ME3A 1KT0A 3KRBA 3AS0A 2AMXA 5A2CA 2RFGA 3O6YX 2XN0A 1IHIA 4QG6A 1VRXA 2FZ8A 1WKFA 1XISA 3H12A 3N18A 1VPYA 1HL8A 2VRJA 4GIVA 4DZHA 1MUWA 4FMVA 4IMEA 2WMIA 2ODOA 1P6CA 2D0GA 5CG7A 4NAFB 5JIPA 2HBXA 2Y7EA 4GISA 2EPKX 4JDYA 1MDLA 3F03K 1FKJA 1JRCA 4DXKA 1E4LA 1PIGA 1A49A 2XFWA 2VEMA 4ODQA 1ONEA 4Q3MA 1H5YA 1HL9A 4AC7C 3F4WA 3NTYA 5MHBA 2NX1A 1TPFA 5C0QA 1ZAIA 3RM4A 1CI1A 4I9JA 4CNNA 2EEXA 4XAKA 3EPNA 5I2UA 1Q8JA 2CYGA 3H55A 3NI6A 2ETNA 1WZKA 1RPKA 4UMBA 2H3BA 3AI0A 3DDMA 2MLYA 1GJUA 2DQWA 4Q4QA 2QUMA 3SFKA 3ZJ6A 2PB1A 1FDJA 4Q4RA 2HTMA 3AISA 4Z2GA 4JQ1A 1CGYA 3BAJA 4ZQMA 3TOPA 2VM8A 3W84A 1N7KA 3WMBA 1GQJA 1PTGA 4JN6A 1QATA 1R46A 3WLMA 5BU6A 1EXPA 4KQNA 5C9WA 4A21A 3O0FA 2I57A 1V3MA 1S2CA 3FSTA 2DT1A 2ZXAA 2OSXA 1O5QA 1KTCA 4FO4A 1ISXA 4LVDA 1F3EA 3EPOA 4A3QA 1X1ZA 3N12A 1XM3A 2DZBA 1UA7A 2OYKA 3OQEA 2GJXA 1UKOA 2YYTA 2RDUA 2YOCA 1TCDA 4GUIA 4Y8FA 4DBEA 2IPWA 4N4QA 4TV6A 1VCFA 2YKKA 3WEOA 4M82A 5D2TA 1LTDA 2PDGA 1IGSA 2OCZA 5AHNA 3L0GA 1J0JA 3CV7A 2YBTA 4WK9A 4DUVA 1YXYA 3R43A 4NNAA 1W1PA 2PU1A 3NVDA 1LBFA 1LP6A 1V6TA 4JYSA 1WX0A 4HHLA 1PBGA 1ZRQA 4RZBA 1CECA 1MRQA 5JBDA 3SY5A 2PBCA 3RHGA 4QDMA 4JTFA 3A24A 3V3WA 1BKSA 4NL1A 4PFHA 1WXJA 4OBRA 4C91A 1ZFJA 6ALDA 1OFAA 3HGSA 3MSRA 4IPIA 4RE0A 3DENA 1BYAA 5AY7A 4DNHA 4C6MA 3QRHA 3BV7A 3GTXA 4LPCA 1KW1A 1EZWA 2W92A 4MPQA 1W3IA 3DEQA 4MYXA 3CPUA 4OFCA 2AL2B 2CBVA 1XKYA 3LM7A 2WLZA 4PL1A 1NOWA 1QOPA 3SADA 3VKBA 4R53A 1TJRA 3LTSA 1TQXA 1S3TC 2DVXA 5CGQA 4HKPA 2YYUA 3B4YA 5HWJA 3IAPA 1J0IA 4QDWA 1NEYA 3L23A 4QJ1A 4MWAB 2P4VA 3LBOA 2K8IA 1T6MA 3U8GA 4H8HA 3UI6A 3E1F1 4US5A 3M43A 4O13A 1HVXA 2ADAA 3E5PA 1LL6A 4PH6A 4IXXA 4ZENA 4UDMA 1ZCNA 1FWSA 4QJ3B 5SWUA 4BKNA 1E6RA 4OTKA 4G56A 4K7YA 4JNZA 1BG9A 3S46A 3G1RA 3LI1A 4Q8VA 1H1YA 2ZFAA 3ICJA 3AMCA 1KBIA 4HMNA 4FNQA 2ISDA 3WDHA 2CKRA 3A64A 4J3SA 1FHVA 1A5AA 1UOZA 1JCHB 2B4GA 1IT7A 1NJJA 3CEPA 1E6PA 1A0DA 4GI4A 3S1UA 4F0RA 3WLSA 4Z0SA 2QCFA 2C7FA 4ATWA 1XCWA 2JKAA 3W1MA 3FKRA 2PFHA 1FAPA 3WF4A 3MI6A 2VRQA 3MMDA 4XZWA 4CN1A 4WD0A 3NG3A 4R9XA 1A3HA 2WHJA 4QLJA 4IQ2A 1UD5A 1H0IA 1ZU8A 3AROA 4HCHA 4ZFMA 4IG2B 1LOLA 3AZRA 1CGTA 4FHAA 2E68A 4ODKA 1H49A 1ITCA 3U9IA 4XAFA 1DWFM 2RUDA 3OIHA 1ZTVA 2OFNA 4CQDA 3MP3A 3LOTA 3BARA 3WD2A 2Z1BA 4YU1A 2GGIA 4ADUA 2R6OA 4LEFA 2AMGA 4DVOA 5CC5A 4IUGA 2WQPA 5LYRA 3GDLA 3ZT7A 2GQ8A 1X6NA 3O16A 3WK2A 3W6LA 6XIAA 1KBJA 5D2VA 1QNQA 3DI0A 4EWND 2WVSA 4JL2A 4P8XA 4WXZA 3UF9A 3QHMA 1OYAA 3LV5A 3LZ3A 1DL3A 3GHRA 3DHUA 4KEMA 2X2YA 4DO6A 4DYEA 6TIMA 4HBEA 4HP5A 1UUMA 1EPVA 2FMNA 4G7EA 3T8LA 3R10A 2TODA 1MYRA 1J18A 4X9YA 5DMMA 2IPFA 3ZXWA 1QFEA 4YXGA 3AALA 2GVEA 1Z44A 2X7VA 2V2CA 1CWYA 1W3KA 3B8IA 3S83A 3L4WA 3URNA 1KA9F 1V0KA 4ZO8A 3N17A 1Q7MA 2DZPA 3LDVA 5IFTA 2CHRA 3LK6A 3VINA 5CBIA 3DFSA 3M7WA 1NOFA 2GUBA 4UFJA 4AXKA 3W26A 4GCXA 1OEPA 4AXNA 3E74A 3TJIA 2GUUA 2YX0A 2BODX 2POTA 2F6KA 3V18A 4EF9A 1TYGA 1C8VA 1UHVA 3VCRA 7TIMA 4GUJA 4JFWA 1W5OA 3RF9A 5A6MA 3EPMA 3FYYA 3UWWA 5PTDA 4GUHA 1Z9AA 4I7UA 5DQPA 3S9ZA 1LM1A 4QGCA 3MUY1 4IT4A 3AHYA 1J0ZA 1W2PA 1XQLA 1XIMA 5XIMA 1EP3A 1XBYA 4UNLA 3W07A 3BW2A 5K3VA 3UT0A 1ENUA 3HJZA 3L67A 3FAPA 2IKGA 2Z28A 3BCJA 1EEXA 1O66A 1DEDA 4DRSA 4UTIA 4C6EA 2C19A 4YTRA 4DH0A 3IHZA 1OYCA 4GD0A 3ARTA 3H2OA 5IHSA 1OGGA 4DF2A 4RPPA 4YTUA 1S2UA 1D2KA 2VD8A 3WH9A 2P76A 4M19A 1RY8A 4D6EA 2GWGA 4H7VA 1KFJA 3OGVA 2WKJA 3LSBA 3AYRA 1FKGA 3W7LA 3XIMA 3HN3A 1ME9A 1MWOA 3PNZA 1ZB5A 7PTDA 3VNDA 1XSIA 1Y65A 3BQ6A 4UTKA 4K6AA 3WD1A 3NL5A 4JCMA 2PDUA 1MEWA 1UR1A 2WMJA 4F8XA 2FH8A 2FTPA 3NZGA 2BXZA 4ZS6A 1ECEA 4CN4A 4NJJA 1PWLA 2MUCA 1C8XA 3LNMA 3MUZ1 2DW7A 4AX6A 4EVZA 3TMLA 3LV6A 3O6AA 2A3CA 3HPSA 4LX4A 3W7NA 3O5IA 4TV5A 2GJRA 3WEMA 1PUDA 5I77A 4OOUA 3GC2A 3ZS4A 1EDQA 2AQOA 5JVLA 2BOFX 3OLIA 4TR9A 5TQLA 2ZDRA 3Q67A 2GYIA 3BSHA 4MLRA 5A8GA 1SO5A 4QITA 5HOSA 2ZQSA 3FAXA 7CGTA 1WXZA 4MDOA 1OIFA 5K9CA 5I98A 3A3HA 3VKAA 4Q4OA 5GNXA 3H2FA 4DWSC 4GZJA 2BHYA 3QKZA 2PV3A 1UKPA 5FEXA 4H8NA 4LUTB 5LNVA 3A5FA 2C18A 1WPCA 4PMQA 5GQBA 3LHYA 3WN6A 2D2OA 3M0HA 2PU0A 3TW9A 3BVJA 1JF5A 3B9OA 2AL1A 5CZ0A 4Q4SA 3TSDA 4D6JA 3KAGA 4R9OA 1GG0A 1FWWA 4OWGA 2C79A 2FHBA 3QPEA 1JL8A 4LUJA 2UV8G 3PWGA 1U1UA 2ASHA 2IPGA 2YGYA 4OUEA 1GVQA 1XIDA 3LTPA 3UGVA 1TELA 2E77A 3G24A 3DFHA 3CZ8A 1JIBA 2ZZ7A 2PMQA 1C93A 1UR9A 2BVYA 3H2CA 2FYMA 3W7EA 2PCQA 3ZJ7A 5JXQA 1E3ZA 3BSMA 3GFZA 3N29A 1TWSA 2DH3A 3QZ6A 2IKHA 1LT8A 3E2QA 3GE7A 3NO1A 3WDIA 3ATZA 4PODA 4DBSA 5ABGA 2FFCA 4X0VA 3QQ1A 3F7JA 2XINA 4LNYA 3WJZA 1XWYA 2W0UA 3LTYA 4AWTA 4XZLX 2RDXA 2QJNA 3AIRA 5F1UA 3EA1A 1EP2A 1VCVA 2FTYA 3VABA 4GVHA 2WMFA 4XISA 3W7PA 2X7WA 3BG5A 3NQ8A 3T42A 3QN3A 5I06A 1PWMA 3P8JA 5BXJA 1K8ZA 3Q45A 3KAFA 4L6DA 1N55A 3SR7A 4EP8C 2FPTA 4JAWA 3UWYA 2PDHA 4URIA 2CBIA 2C6QA 1DXEA 4D6CA 1JI2A 4NNRA 3V7PA 2XN1A 2E1DA 1L6FA 4JTEA 5XINA 3N73A 3KUMA 2J77A 3SRFA 1WNOA 4L1XA 2ZZ4A 2OOGA 3BCDA 1OB0A 4YVXA 1XSKA 1Q6HA 2C91A 3EWXA 4HZMA 4IWWA 3PPCA 1UA3A 3HFYA 1EFZA 5I78A 3RNDA 1UR0A 4R33A 4B90A 3I4EA 2RGMA 5G1YA 1WUEA 4L6OA 1QXLA 4MMWA 3W2NA 5JH8A 3C56A 2VFIA 1J4IA 3QZEA 1YNPA 3RRXA 3WNNA 2VFEA 2ZIDA 2HSAA 7REQA 3FV9A 4OECA 5EY5A 4IUOA 1N8WA 4N9DA 4RW3A 1G7UA 2EJ1A 2G3MA 3ITTA 3MKVA 4LAUA 3PTDA 2PN0A 4WUIA 1YXCA 5D37A 1E51A 2WNQA 2EO7A 2EGZA 2QMKA 4QROA 3EDFA 3HQ1A 3QY6A 4W9TA 3WMLA 3BXWA 1T0OA 1QW7A 2X1RA 3KCLA 4UTTA 4JTSA 3GM8A 4LV4A 4MM1A 2XSBA 2HWGA 1TPC1 3W25A 4BWLC 4ONVA 3SDOA 2WCAA 2HROA 1DIOA 5CLWA 1HW6A 4X22A 2HXUA 1IZKA 2CHNA 5FKYA 3I3DA 5LHFA 4K1GA 3PZTA 4Y8EA 3UWUA 1E6ZA 4HJFA 3UG3A 2ZRZA 5RUBA 1Y0EA 1OZMA 2ITKA 3PFMA 3CUHA 3LLFA 4G7FA 1B54A 2LKNA 3TAKA 3KW3A 1A4LA 4ROQA 2VYOA 4ZB0A 1TJ0A 3SURA 1W0MA 3JU2A 4D6FA 3ONCA 3O5EA 4MWAA 4DXVA 3OBEA 1XYMA 3M5ZA 4TIMA 3PF3A 3AWNA 4MTVA 5I6SA 2YW4A 2Y7FA 1OK6A 1DE6A 3VNLA 1ZJIA 2O9RA 3ITYA 4IQDA 2WMGA 1LJYA 1EX1A 4JTLA 3C61A 1X8FA 1VBRA 3GIQA 4P8UA 3S9YA 4DELA 4P61A 4PN2A 1WDPA 3VCNA 3E0IA 2XFYA 3T0TA 1O95A 1NFGA 5CPOA 2GSHA 3W38A 3PJWA 2Y1HA 5CEWA 2OX4A 5DY3A 3T0CA 3QMRA 3MVTA 1FOBA 3FA5A 2C3ZA 3U57A 3S1GA 2GSEA 2XP4A 2VVSA 1EC7A 3O2LA 4G9PA 4ZB5A 3TU9A 1KGXA 1Q85A 3KOXA 1V3LA 3PRAA 1EHAA 4TVCA 1BFNA 1QNRA 2HCVA 5HMFA 2MPHA 1RP8A 5F2IA 4GNKB 4W8LA 1VBJA 1XIIA 4PA8A 1V02A 3KZ7A 5HK4A 3NSNA 1FP8A 1LWHA 2BVTA 3K1DA 3PBGA 2UY4A 4U33A 4DM1A 3KOFA 1FKLA 2VQTA 3DKJA 3WBXA 2B0MA 2J79A 4XZ9A 1IZCA 1KRBC 4LVFA 4I9MA 1TKKA 4ADSA 4WDWA 5LNRA 4EIVA 5DO2A 1TPVA 4U5KA 1HN1A 3U4AA 3B3DA 2H3DA 2GDUA 3S2NA 3S5ZA 1RH9A 4G1KA 5D2XA 4V28A 3R11A 2XPBA 4O52A 3VOJA 4B5SA 1R9XA 5H8PA 4QEHA 3GTIA 2XZ9A 3UQIA 3NQ2A 2Q3RA 1UWQA 1MFVA 3ODKA 3SUTA 1DOSA 3MDUA 1K4HA 3NVTA 1SFLA 2XVPA 2PE4A 2VDGA 2E67A 2CLMA 4AHOA 4ZQNA 3H53A 4O1DA 3EMQA 4IT1A 3CO8A 4EOUA 4E2DA 4K37A 3CUJA 1A0CA 3ARQA 3HJEA 3KBWA 1AODA 1KM6A 2E4TA 3B8VA 2BWGA 2ZTJA 3VAWA 4GIRA 3N34A 1UKTA 4HU3A 4DWDA 3EXRA 3W7KA 3THCA 2E7FA 1XGZA 3DU0A 4OV4A 3KL3A 3GG1A 3ZR4A 1V79A 3ITCA 4CNTA 1J79A 1TX2A 1OG6A 4FZIA 2QPSA 3TXZA 2ZQTA 3UQNA 3VDCA 3TFCA 3D47A 1DHKA 5E6YA 1BXBA 1PCWA 1GZGA 4H7CA 2G50A 1E73M 1HKKA 3G3DA 4LCQA 5A95A 1DKWA 4GFIA 1WV2A 4IPPA 3CMGA 3M1ZA 4NI8A 2R9RA 1BGAA 4XX6A 2DSUA 4W9OA 1FUYA 4QG8A 1QI5A 4BEUA 2NWRA 2OLHA 4ZOEA 1YDYA 1YBQA 2ISSA 1AFSA 4LBRA 4C1NB 3T78A 3UR8A 2PTYA 2NV9A 5CPQA 3AMLA 1YTKA 4DRPA 2QW5A 2VC9A 4AEOA 1E9IA 2WHKA 2YZ5A 4AYGA 1IF2A 4GVIA 2P3ZA 3UZWA 1NWUA 3H70A 1OY0A 3R58A 3EEGA 1FWHC 2IUZA 1GQKA 2A7RA 3B4UA 3W22A 2FFIA 4BY3A 2Z27A 4ZPTR 3JZUA 3I4KA 2FJKA 3VO0A 4AHPA 4AX7A 2XVKA 2OFJA 1TZ9A 1B4EA 2H9AB 3T81A 2WLYA 4GACA 1W1YA 4KCTA 2ALDA 1GOIA 2PDKA 2YR1A 1TPB1 4GI8A 2PV1A 2ZKMX 3PVFA 1ZJHA 2YL6A 3QKEA 1CYGA 5I00A 1H7RA 4Y2WA 4JQ2A 3CHVA 4JTAA 4LUTA 5LNWA 4ORIA 4JFUA 5DCEA 4C1LA 1TIWA 1TUFA 1UB3A 3V75A 4J7RA 1A53A 3PJTA 4D1JA 4IMAA 1OIMA 1ECQA 4DXXA 3ALFA 4MB1A 2IMRA 4JL1A 1V7YA 3HG4A 5CZJA 1UJQA 2OGJA 3W1AA 2ATMA 4Y9NA 3LPFA 2DPEA 2O4QA 1EJ7L 5E5CA 1FHLA 1OG0A 4LS0A 3P80A 1RALA 2GDVA 2B7OA 1K4GA 2VOMA 3VZZA 5G4EA 3IACA 4KETA 3U7VA 1JVNA 3URQA 1TPDA 4NILA 4W85A 4E8GA 2J9YA 3R0DA 1QHOA 5I02A 3GXFA 4E2BA 3W7MA 3CTLA 1VP5A 3ZWSA 3THQA 2Y24A 1MZHA 2BY2A 2NQ5A 5GPGA 2HMCA 3LBCA 3WO8A 3UPWA 1WZLA 3L12A 1KXQA 3DOPA 3V0UA 3E49A 5HTGA 1JNDA 2ZRYA 4GH3A 1V4YA 4TO8A 1VJZA 4DPQA 5C54A 4O1FA 1I45A 3FYOA 2C0AA 3LG3A 2PURA 1EGVA 4XD5A 2EPOA 4BK9A 4B16A 3G77A 1DXFA 3EOOA 3SGZA 3K13A 1GNXA 1X96A 3DECA 5BWFA 1LZOA 3BO9A 4MB4A 5AC7A 1PJ9A 1GVOA 2X40A 2REQA 1AA1B 3CV6A 3R8GA 3LA4A 1X98A 5IDZA 1GGOA 3AWOA 1P1MA 4FLQA 1JYXA 4R5EA 3BLPX 4UTWA 2H6RA 2LLEA 1TCOC 3WDJA 1JGMA 1I2OA 1R3VA 4QE1A 3HG3A 1IX5A 1SO4A 1SGJA 2BV9A 1W3HA 3K4DA 3UD6A 2ZZ3A 5FACA 3NCOA 4Q6XA 1W9VA 3GU9A 1HJVA 3SCPA 3MSDA 1LYXA 4LYPA 3CQJA 4EXQA 2KFWA 1ISZA 1GPWA 1D7HA 4REQA 2KGJA 1G6CA 4IGSA 3AIVA 2VDHA 3RR1A 5LHEA 4B4HA 2ZUMA 1EF3A 5A8QA 2NQJA 3E02A 1TREA 1UWAA 1ZBKA 1M7XA 3C2EA 2CZFA 4R7WA 3A21A 1E55A 4DO4A 4G8TA 3U0HA 1AUSL 3H2EA 4H8VA 5HA7A 1KCXA 4M80A 3PTQA 1BKHA 3WLPA 1RJRA 3LENA 2CZDA 4J3UA 4UTUA 2CC0A 2ISVA 3PC0A 4JTUA 3OGSA 6REQB 1W3TA 5H8MA 1G69A 1HP5A 4RE2A 5HPOA 2RUSA 1PB0A 3RR4A 4GYKA 3AIWA 2QPUA 4F2BA 1Q45A 2CLLA 3CUFA 4JIEA 4HSNA 3R13A 3TA6A 4W7VA 2VEFA 2ZUNA 1SYTA 3PRBA 2Q02A 3OP2A 3W4RA 3VNIA 1TR9A 2TAAA 3G5EA 4K68A 5CPMA 2WAGA 3R79A 1U5HA 1VD6A 3QV7A 4Q7BA 3FAWA 2OZ3A 3P5YA 4UTTC 1KGUA 1R2RA 2ZE3A 4S1FA 1YATA 3TE9A 4BWLA 1H7NA 1VFOA 1J6OA 2MANA 4GC3A 3BW4A 1KM2A 1Q2SA 2PDQA 2LGOA 4XAZA 4X3ZA 1S2AA 1J11A 1XLKA 4XD3A 1XCFA 4K7VA 2PDIA 3IJIA 1W37A 5K2ZA 1VFMA 4F40A 4UQEA 1QNVA 1QK2A 2EKGA 1R87A 3MHGA 4O50A 4AB4A 3UY8A 1ONXA 4GH1A 2X0YA 2AWGA 3NTPA 2G3JA 4Z2HA 3HPFA 3TOYA 4PL2A 1VKFA 1MI3A 2EXOA 3STEA 1JUKA 4A2RA 2CIPA 1Y5VA 4M29A 3UWEA 4S39A 2ZUUA 2Y63A 1RXOB 2PWHA 1CXIA 1GZJA 3ECQA 1R3WA 1TUXA 4A8RA 4H1ZA 2DUZA 4XKYB 2E6YA 2W4XA 5LSMA 1B3ZA 4N9BA 1YBQB 1Y5XA 1XGEA 4WJXA 3R2GA 4MDPA 4PMVA 4RV8A 2XM1A 2DT3A 1L6WA 2VX7A 4ZXLA 3PBUA 4PGLA 4QAWA 3VOCA 2Z1VA 4MKVA 3LCFA 4BF8A 1XCXA 5AB3A 3B0PA 5H1WA 3M64A 4CVWA 3EA3A 4HBOA 1ADDA 2OJPA 5CGTA 1PEZA 4N6FA 4NJIA 1XPGA 3GXNA 4HNCA 4IX0A 3IWPA 5BOEA 3GNOA 4KH2A 4LC6A 4PULA 3VFCA 4H9ZA 3TDBA 3ZLFA 4HZ8A 5FA5A 3S9IA 5BU9A 1YPIA 3SSZA 2HPMA 2FMOA 2RJGA 4F0SA 1M5YA 3VKCA 1H51A 1UR3M 3EX4A 2VEIA 5TNVA 2ZZ2A 1VEMA 5DITA 2WMIB 2BGSA 1BHGA 2Q8XA 2F23A 2CLIA 3E2SA 2EPLX 4JEJA 4NAFA 1MEIA 1NELA 4B15A 3AU6A 2WVVA 3HQNA 3H26A 5I0DA 2NUYA 2Z7KA 4Y90A 5AYIA 1TV2A 1XLEA 1FX6A 5HPCA 2P8BA 1E0TA 2PTDA 2V5KA 4CQAA 1E0WA 4ZVJA 3KLLA 4Z08A 3BLKA 2R1NA 3O5QA 4IF2A 3A9IA 1UMLA 2AQVA 3NNTA 5HUAA 1Z32X 4C6BA 1QPRA 4U85A 1EJWC 2V30A 4Z2KA 1QASA 3C2YA 1AG1O 2ZRVA 2DY3A 2WVVB 3SBFA 5HMDA 3VUPA 2V5JA 4NYYA 4OBSA 3IKGA 2QZRA 4JTIA 3P93A 1BYCA 1TE1A 4TMCA 3R94A 1KKOA 1W9UA 3WH8A 3MY9A 1P43A 2V3GA 3AMDA 4YWSA 1ITQA 1XLIA 4E6MA 2JFEX 1O5RA 5H2ZA 2NQ9A 3TWBA 1UIOA 1E15A 3NQAA 3WNKA 4P8WA 1OX5A 1FP9A 5EBUA 4H4IA 5CH9A 3AHXA 4LYRA 2YA0A 3NZQA 2PWDA 4GYJA 1E3XA 1UCWA 2ICSA 5C71A 1WB0A 4NNCA 4UB9A 1RY0A 3B40A 4GCAA 1C29A 5EFFA 4IP7A 3WY1A 3CH9A 1KM1A 4P7RA 1QI0A 5EGRA 3VD9A 5E6ZA 1K03A 3KVKA 1QOQA 1PIFA 2WSRA 2JIWA 4F66A 2IXVA 4JFTA 2XIOA 3CZJA 4U4MA 4ZL1A 1XYZA 3LXBA 4L7ZA 3VILA 3O5JA 1SJDA 2W79A 4PCPA 5EU9A 3RXZA 4YCPA 1DIKA 2GQ9A 1AL8A 3ZLGA 3E0WA 3RX4A 4MSSA 3KTXA 5CCZA 5D9PA 1L6YA 3TV8A 1JYNA 4ODNA 3LM3A 3A4JA 1O5KA 5F4SA 2RQSA 4I9AA 2YW3A 2OLAA 4ZQRA 3UVAA 3GG0A 3SQLA 2WNNA 5KTLA 3CHFA 3B8WA 1N2VA 4ROPA 3KFTA 4QEEA 1TRIA 1BVNP 4W84A 1BG4A 2IKJA 3MO7A 3V5FA 2FZ9A 1IXPA 3GG8A 4XTDA 3R25A 3R8HA 3W73A 1V02E 1E44A 4XZMX 3RUBL 3MWAA 3PBWA 1GOMA 4O4WA 3WZ0E 3OA3A 3G6MA 2O7QA 4A3UA 4BA0A 4LAVA 1OFPA 4MZ1A 3W6MA 4G2PA 2YCJA 3MI2A 3K4AA 4E2OA 3ANUA 2CFFA 3IJ6A 3B0VC 2B31A 4AISA 3D3AA 3TDFA 3MSGA 2D0HA 4CKQA 1UWIA 3VAVA 4BF5A 4PE8A 4ZBCA 3BZGA 1PAMA 1KCKA 3NOYA 5FJTA 4EPDC 4ECLA 3BTNA 3VA8A 5CZKA 4Q8OA 6TAAA 4I7WA 2PDLA 2XIBA 1CB2A 4MKSA 1XIGA 3ARPA 1IR2A 5BRBA 1R47A 4WZHA 4XO6A 4E8DA 1IQ8A 3RJYA 4AY8A 4Q4MA 3FGCB 3OW1A 5E09A 4ASTA 2VP8A 1OGSA 3THDA 1F3TA 3APYA 4HYWA 4UNKA 2HVMA 4PBFA 3KL0A 1U33A 3RCMA 1V08A 1FWFC 1HJSA 1NQKA 1U30A 4L3NA 2Z2BA 2VR4A 1DJXA 3QZAA 1TMLA 2V6AA 3NOEA 4DPPA 1KKRA 1J10A 2PWGA 2TRSA 5A94A 3BICA 1QCWA 2R1PA 3M0IA 4GA8A 3U2OA 4QLKA 1UKSA 2ZA1A 5M2FX 3W2KA 3EX1A 3WJSA 3FY1A 3WDRA 3TH6A 1ZUAX 3E3HA 2PBGA 4ICCX 4FF5A 3LPPA 3ZJ8A 4R27A 3W87A 2B7PA 1XFCA 4LS2A 4DB7A 2NT0A 2Y78A 4M24A 4YS1A 4BJHA 1QPFA 2F2KA 2WO5A 3WIJA 2O9OA 2OO6A 2ZUWA 4IFKA 2Q8ZA 3IIXA 5FAJA 2Z25A 1KBKA 4B3ZA 1OINA 4UQAA 3CASA 1E70M 4V1YA 3O7UA 1Z42A 2VCBA 4KW2A 2GGJA 1FH7A 1UMYA 3D5HA 3O5FA 4FAPA 3HG2A 2WSPA 2PDFA 1LLOA 1VFLA 1MDRA 3BLOA 2HXTA 4AIUA 2ZQUA 1JZ4A 2KAUC 2GJPA 2WBGA 5C70A 3TSMA 4CCDA 1EPXA 1AW1A 1I0DA 5A6KA 4FR1A 3CUGA 2Y4SA 3OIXA 1K77A 1IWPA 3QQWA 4REQB 3CMJA 4Q8UA 4FX8A 1ESWA 3P82A 5KZDA 3CMFA 1XIEA 2XSXA 4PCFA 3NPXA 4HNLA 3CL6A 3B9EA 4ZR8A 3I3BA 1EH9A 2CHOA 5L6UA 2OKOA 2VZVA 1IXNA 2EG7A 3WQWA 1GVYA 3SB0A 3OOQA 5HANA 2I16A 2EF9A 2WC7A 3URAA 2DIJA 1UP2A 1O12A 4ATDA 1K9TA 4FK9A 4NNBA 2O4MA 3KZPA 2XGIA 4PUJA 1M41A 4JFMA 1WDDA 5LNUA 2PDMA 3LN3A 2MLZA 1F3WA 3UXDA 1V6YA 1DXIA 1YTDA 5AHFA 3GVRA 1WAWA 3TIMA 1UD8A 3T7VA 4NSBA 3GK0A 3VOIA 1GEHA 2W5FA 2NW0A 3CIVA 4B9ZA 3C6CA 3O5OA 3C4UA 2ATSA 1H4PA 3P7YA 3AMKA 4DX3A 4AD5A 5G4WA 2HVOA 4O12A 1SQ7A 5ECVA 1UH2A 5REQA 4DJDA 1BSIA 2DIEA 5AHEA 4ODOA 4IFRA 2C15A 4EACA 3BGGA 4H83A 2VZUA 2ACUA 3TJXA 2FB2A 3BC9A 2BHUA 3TNOA 1DWGM 3HPZA 3SSJA 1OCBA 3NAVA 3MC5A 1VPXA 2F9RA 3FEQA 4RR4A 1BQCA 3R6IA 3VKDA 2PDXA 2ZTKA 1ZY9A 3FDGA 2NSXA 2D3LA 1DORA 3MA8A 4JDBA 1KM0A 1QOXA 3GU2A 2Y89A 4F3HA 1E6NA 3OO2A 1IEIA 4JYEA 5HMSA 3BAIA 4QJ5B 3GZ3A 1ALDA 4JNMA 3UA3A 3RLVA 1YQ2A 2PCEA 1ZZMA 4NUWA 4R3UA 3A5VA 4IIFA 3GC5A 4GX8A 3VD4A 4NG3A 4HNNA 1HP4A 3GNXA 3PSWA 5LIYX 4O14A 3NM1A 2IQDA 4JFSA 4O18A 1FKDA 5AVNA 2FPVA 1R2TA 4QXIA 2B81A 2WOQA 1JDCA 3ZOAA 4KEZA 4D6IA 4J27A 3SY1A 3STPA 2WJDA 1W1B1 2GJXB 1X38A 2RUCA 5AYBA 4EAMA 1XG3A 3NQ7A 3DUGA 5I09A 1EQPA 5F4WA 1KXTA 3CHDA 5IBXA 3EDJA 2XPAA 4D6HA 3ID7A 2UWFA 1GK8A 2QNEA 2VGFA 2BG5A 1VBGA 3M0XA 5I3KA 3JYMA 5AC4A 2EQDA 1BL4A 1S5TA 1XICA 1W8GA 3QPYA 3MPGA 3P8IA 4XAYA 4GYPA 2Y5EA 1HGYA 4MYAA 5DCBA 4KMQA 4PBGA 1F40A 1H09A 4CN6A 2OGYA 3TC7A 5D8ZA 1NDVA 4NZJA 2FLIA 5ABHA 4Z1YA 4PMDA 1NU5A 3UJRA 2IXUA 3SFWA 4WHBA 2XPKA 4FNRA 3GS6A 4YIWA 4XO7A 4ACZB 1R3RA 1MNSA 1CNVA 2XJ7A 2D73A 1RLCL 4AUBA 1Z3NA 1DTNA 4F48A 1EL3A 3GXDA 4ZQPA 1UD3A 3OZYA 1VYSX 5DBUA 1Q6UA 1GW1A 2YB1A 3VGGA 4ZQOA 4O28A 4FXSA 3E9AA 2GJNA 3GDRA 3DG7A 4J3WA 4HOXA 1T5AA 3SZ8A 1WBJA 4O8RA 3SUSA 4AEFA 4YWIA 2OT0A 1VAHA 2RURA 1JCNA 3VPLA 1ISYA 5T91A 3QR1A 1EKOA 1YHTA 4J40A 5E9AA 1FHUA 4RXGA 2A5HA 1HIZA 1BRLA 1XIHA 4RLIA 4B3LA 5LXXA 3UI5A 3VKKA 1LDCA 1LRNA 3B0UX 3SUWA 2PRHA 3GX9A 4QAIA 3BG9A 4DI8A 3DGRA 3LQGA 1SSGA 4L72B 2XTKA 1V8EA 1QI2A 3H6OA 1PX3A 4XZIA 3ES7A 1LQ2A 1LRTA 3A9BA 3H54A 4XKMA 1G67A 3BLLA 1E72M 1E6QM 1VHCA 3OB8A 1HJWA 3GXTA 1JUBA 4O1BA 3NIYA 3OHIA 3P60A 4M5PA 1XBXA 4TVUA 3KOZA 1I0BA 2B7QA 5FF4A 3PZMA 2DZUA 2JF7A 4H6KA 2Y8UA 9RUBA 1SUXA 2ZX6A 2ZZ1A 3AZTA 1YLVA 2PC8A 4H9MA 5FF0A 3RCYA 3W86A 4PTDA 4RE4A 2R82A 4XZHA 5EBAA 3W72A 2NQZA 4HMEA 4DWSB 3B8DA 2AKZA 4BS0A 4C90A 3W7GA 2D1ZA 3BJTA 1DIEA 2YB4A 4MUPA 3CC1A 1GVIA 4BQ2A 4ZSUA 1SZRA 4CU8A 2HS8A 1QHZA 1KB3A 4OHQA 2NQHA 3EKZA 2VGGA 1HJUA 4FR6A 1WBHA 1SJBA 4LAZA 1TWDA 4KR0B 4YMZA 1EC8A 3PM6A 3SJNA 4DJEC 2F84A 3VIMA 5HNRA 4A8LA 3S6DA 2PTZA 1J4RA 1HJQA 1BTMA 3TYEA 2YL5A 4NT0A 2YCIX 4OBTA 4DEFA 2OT1A 1SO6A 2P88A 3FN9A 4A4AA 1QPQA 1VBHA 2D20A 1JZ7A 4IJCA 5FEWA 2ZDSA 2BDQA 4PRWA 2WCSA 4TYOA 2A4AA 4CNOA 8RUCA 3FJNA 3GVVA 2VKZG 3PPHA 1DQUA 3GU0A 3NL3A 3ZYZA 1NDWA 4FB7A 1A3XA 5JMUA 3LS9A 3KS5A 3TTYA 3H22A 1HVQA 1QW8A 2IF4A 3V0TA 3R89A 5KETA 1PBKA 3MJYA 3E2RA 1CXHA 4AC1X 3BMXA 4LW7A 3OZPA 4ICMA 1GVFA 4A22A 3TX9A 1ADSA 1RPXA 1YW1A 4GE8A 2Y62A 4A35A 4NX0A 2XH4A 1FKSA 1O94A 2QIIA 4IX2A 2QEZA 3WK0A 4C6KA 1DE5A 1SZEA 1HL2A 1P48A 3UXIA 2WKLA 4QCEA 3VZXA 3DH7A 2JE8A 1O1ZA 1F07A 2JK2A 3RITA 2Q6ZA 3DG3A 4IIDA 1O1HA 4UNIA 2QAFA 3NURA 3O06A 3DGBA 4K8HA 3GDMA 1OFDA 3AXXA 5C9UA 5C7HA 1QI3A 3D0CA 2DG4A 1VPQA 3MJMA 4BEQA 3MU7A 1MQQA 3T6CA 1BVZA 3A23A 4IP5A 3W02A 1VS1A 2DVUA 3SCNA 3PP7A 1UYQA 4LY8A 4O10A 3LRKA 4PEEA 4AQLA 3RRAA 4F0HA 4ODPA 4GI6A 1V0LA 3GW3A 3QLDA 2YBVA 3VMPA 3K30A 1M68A 4I8DA 5MKGA 4ML4A 3NJ3A 3APGA 3N1AA 3VCCA 1J93A 1NF7A 2C71A 4DIAA 4O2TA 5I3IA 3L2IA 2AKMA 4CLMA 3AFBA 5DBTA 4GPNA 3LXAA 4BR1A 2V8ZA 4G50A 3L2LA 2ZE0A 5CZSA 3NEVA 2OB3A 3LPGA 4JFKA 3UFYA 4QJ4B 2CLEA 4O1AA 3A3XA 1C8YA 4O8AA 2WJFA 1UW9A 3W1UA 3VKJA 3E0LA 2PLKA 3G0UA 1FA2A 1B9ZA 3LXCA 5LIUX 3DFYA 4G7EB 4NI3A 3VNMA 4POCA 4DN1A 3PK7A 1DYSA 3HGJA 2VJXA 5DT7A 4NZ1A 4O16A 1L1PA 2Y85A 4AZCB 3GNNA 4HCLA 3RFAA 2NXIA 1DTUA 1K6WA 1US2A 3SCRA 2UY2A 1JDDA 3FOKA 2BHZA 2E0PA 4DBWA 4L1GA 2F6UA 2VL4A 2X1UA 3QHOA 2PPNA 1V3IA 1UZDA 1XLHA 2EPMX 2H90A 2PUZA 1JNSA 1DJYA 3UPMA 2A2IA 4KWWA 3SN0A 4A8NA 5LGZA 1MXGA 4IPXA 5BNKA 3CPRA 3B9AA 4MUZA 1GJPA 2RSEA 2X2GA 3WBWA 4IL2A 1TB3A 2DIKA 1NSGA 2R14A 4UMCA 4FEZA 4RNIA 3OZMA 1HO1A 4XD6A 3II1A 3MHUA 2YPIA 3W53A 4JCLA 1SO3A 2WYSA 2OWWA 1QR7A 1SM9A 3PNUA 4Q22A 4EPKA 3VDAA 4UC5A 3W00A 2ZZ6A 1G1YA 1OADA 2Y5JA 1EYEA 3GVQA 2UZ5A 1JG9A 3OLGA 1W5QA 4G2DA 3QGAC 5T8GA 7TAAA 1OC6A 3N13A 1K8CA 3R12A 2ZC1A 3G1HA 3M0KA 1E0UA 4IL0A 1FY6A 4MFEA 3NUKA 2HZGA 5AVHA 4W9QA 3R0KA 4KIEA 4PMRA 4BF7A 4D8LA 4HOWA 1XBZA 2PWUA 5F4XA 4E3VA 5DXYA 4MHBA 3ZJKA 2I56A 2WSQA 4AWEA 2ZBTA 3RG6A 4QP0A 5HWNA 1EJXC 1Q4NX 1QPKA 3T05A 1LL4A 1HF6A 1I2RA 1RQBA 1XG4A 2GVGA 4XK2A 2DGAA 3MV11 4TU1A 1RK5A 3QSTA 2XP9A 3TTQA 3F2BA 2Z4GA 2ISWA 1JVWA 3O9NA 1TZ7A 1F8IA 1GCYA 3KBMA 2NQLA 2XP6A 4ZOCA 1EHNA 1F2JA 1EZ2A 2EHHA 2EULA 5D2WA 1FKIA 3W23A 1AW2A 1PINA 1TCMA 4IPNB 4QHRA 3DFTA 3PZOA 3T07A 3T08A 1JI1A 4O17A 3J7HA 2VD9A 2QJJA 4OU1A 4R7JA 2Y7DA 1IXOA 4UR9A 1POJA 1XV8A 1IXQA 1UPPA 3TYAA 1RA0A 1W1TA 1W5PA 4A3YA 3HV9A 3FHAA 4GYPC 1S5NA 1PKYA 4P2VA 4AVOA 2PF0A 5CLTA 3EWBX 2J8TA 3UCQA 2A3AA 1I75A 3W83A 2PP1A 2XWDA 2J13A 1OM0A 1I2QA 4B5UA 1TTIA 1B30A 5BOOA 3CL7A 5I3DA 2FDMA 1FCUA 3L4XA 2E5BA 3OU8A 1F7BA 4B9YA 3Q4DA 5EYWA 3PPFA 2WHMA 1L6SA 3ABRA 2JGYA 1Q4WA 2XH2A 3BZJA 1SW7A 1ZK6A 4FLOA 4HIBA 1M65A 1G4TA 4DI9A 1E1FA 4I5UA 5DMYA 4ML9A 3N9SA 4LANA 2ZWZA 3OGRA 4ZE4A 2E5DA 3ERPA 2CEQA 4HNTA 3VOHA 1VFUA 1NOUA 3FJ4A 4JTTA 4KBXA 2G37A 1VEPA 3O6CA 1SJCA 3LMYA 3RYSA 1E1CB 1DIDA 3B9NA 3M6DA 3M5VA 2KR7A 2I17A 3PG8A 3W7QA 3PZ9A 1G01A 3VTRA 2DJXA 4X9SA 1NY1A 2NWSA 5JH1A 3T0BA 5DFAA 2QLYA 3KCJA 3M16A 2M08A 5M5DA 2VURA 4O0ZA 2P1FA 3IVSA 1LROA 1W54A 3TTSA 1JDEA 3HURA 4HCDA 1R7AA 1Q5MA 1F74A 5AHMA 4WF7A 4E4PA 3GPKA 3ITGA 2RJHA 5A8MA 3W1PA 3RX3A 1GOQA 5K4ZA 1WO2A 4QDPA 2I5IA 4GJIA 4QLLA 4HARA 1LLWA 4JIQA 2WBKA 5LIKX 3U48A 4DJFA 1A5UA 2OU4A 2ZICA 3DAQA 4DUOA 2OR2A 3LEPA 3CGMA 3G1AA 5CBBA 3BGJA 4HTBA 3UERA 4YLWA 1VENA 3MDWA 3WEZA 3FYPA 2XSAA 3N4AA 3GB6A 1XDLA 4JYFA 1H60A 3EB2A 2PRMA 1JF6A 3MDYB 1HZYA 1OJXA 5JBFA 5HUPA 5TIMA 3CQHA 4ZO7A 1KBLA 4QNEA 3OHMB 4L9XA 1UR8A 2QV4A 4HNVA 4JKMA 5I3JA 1S46A 3BCFA 1JCJA 1EO5A 1ZHAA 3THAA 4J35A 1F8AB 3HZ3A 3EOLA 3UYCA 1ZJBA 4IZGA 3KOYA 4BHYA 3OPSA 1JEZA 3TW7A 4XTIA 1PKNA 4ENLA 1WKEA 3TR9A 1PXGA 4GBUA 4ZZ9A 5HNUA 5A8OA 2E8ZA 5GNYA 3W2LA 3GTNA 3E2VA 3PZUA 4AWSA 4YNGA 1JNEA 3P67A 4MZ8A 4DAIA 4MVAA 3WH7A 4FOJA 1KFLA 3UG8A 2PWVA 3PRDA 4MY8A 3ORWA 3EIPA 1U2YA 2D22A 3IUDA 3TCZA 4MNKA 5HAOA 2W9MA 4F79A 1AJ0A 4J3VA 2QCLA 2ZUTA 3VM5A 5E9XA 4HZ6A 1Z8AA 1CXKA 3I6EA 2ZZ5A 2NXGA 3UZZA 1UP3A 3M0VA 4S3GA 1W5NA 1J2BA 3FS2A 1JD7A 5MKGB 3CAQA 3LGGA 2EBNA 1O4UA 4S23A 3QV8A 2HK0A 1FKTA 1TR1A 4I90A 1FHDA 4JHMA 4N02A 2F21A 1TO3A 2CZVA 1DJQA 1NSJA 4ES4A 1UD2A 3MB9A 2A0NA 3WBYA 2RDTA 1QPNA 2FGLA 4IH3A 2OKTA 4AY1A 3BL3A 4L9ZA 4YTQA 2CBUA 4MAZA 3IPWA 3PB0A 1PV8A 2WJEA 3F5LA 1LQ0A 1QDSA 3EAUA 4ZCWA 1S39A 4ZE5A 3EWWA 3WQ8A 1KFBA 3CB8A 4JD4A 1E1EA 1RAKA 3WLRA 4UFKA 5A2BA 2JGQA 3VI2A 5I3GA 3CYVA 4ACYA 2VC7A 2QCDB 2PDNA 2QYGA 2FHFA 2D2HA 2PTXA 2C13A 5D9NA 3G6LA 3IJDA 3UWQA 4U31A 4LAOA 3M47A 1F6KA 1GOKA 4S3BA 1KRCC 4E2VA 1XLLA 1BF6A 1TJPA 4RKAA 4AHQA 3DG6A 1NMVA 4C6JA 1JYWA 1FFQA 4ZOBA 3B04A 3LX9A 2VO5A 3OYXA 4WKAA 3GKAA 3A4WA 4LUSB 5I3FA 3VC5A 2Q09A 3CHEA 4UZSA 3L4TA 2BLEA 1TWIA 3PTMA 5DF0A 1YRRA 4UTFA 1A5SA 3LYEA 3A12A 3KLKA 4BQ5A 4F2TA 4JN8A 5BOFA 3CV2A 2I14A 3RU6A 3U5YA 1B3VA 4E5TA 1FWNA 3KWSA 1XUUA 3W7HA 4NQ1A 1M04A 4ZSTA 4B5VA 3MO4A 3V1HA 3WFZA 3LMZA 4XAGA 1VFTA 4C1NA 4TMBA 3CQKA 2JKPA 2HNHA 4ZMGA 4J28A 3P14A 3GR7A 1REQA 3GO2A 4ADTA 3MMWA 1FWCC 2ZA3A 3BWWA 3VZYA 3NXLA 4WKFA 3KABA 2L5HA 5F2LA 3BMWA 4ITZA 3QW4B 2VFGA 5L9FA 1QNOA 1Q6CA 1ME8A 1CXEA 4PR4A 4GYFA 3GWQA 3CQIA 1ZALA 1Q13A 1T41A 4AG0A 3UP8A 2R24A 2PGFA 2QCHA 4FNSA 4DRHA 3HM7A 4DLFA 5CKSA 1OQFA 3L68A 1ZJAA 4HTYA 1XH0A 2QGYA 3DC8A 4NASA 1DBTA 3TSBA 3I6CA 1RP9A 1XLBA 1QBAA 2WV8A 4RNJA 3PZVA 4Z0JA 1P0DA 4HU8A 3H2AA 5HR6A 2ZX8A 1AH3A 1FCVA 4ILSA 1X1NA 1MW1A 1VQTA 4XIMA 2E3ZA 3NZ1A 1K9DA 1RZMA 2E9BA 5E1QA 2IW0A 3BAWA 4CU7A 1C3FA 1YDOA 3TC3A 3WLIA 3DERA 3GTHA 5KMYA 5C2GA 2QDDA 4GY0A 4S3FA 1CPUA 4HU0A 3H9RB 1PL9A 2J9ZA 3AXHA 4FPSA 3VIIA 5M1TA 2QCGA 4UXDA 3KZSA 4MB5A 4LYKA 2ALRA 4AVFA 2DP3A 4W5ZA 2BP1A 1O7AA 3GQYA 3M5YA 3NDYA 3N9KA 2CETA 4V1XA 4XUGA 4X61A 5BRPA 3F4VA 2F2HA 3EMCA 5I07A 1XLGA 3W81A 2QDEA 1R86A 4KWVA 2CZ5A 2R91A 5CXPA 1EWDA 1QTWA 2Y88A 4EKJA 4NX5A 3W1NA 5B8IC 1OFQA 3ARYA 4W5UA 2QVNA 5JQ9A 1NDZA 4I3GA 2SFPA 1LBLA 3TXVA 5XIAA 2C1GA 4GZEA 1BGGA 3MW7A 2EPNA 3NO5A 4S2CA 5FD0A 1NF0A 4RDWA 1PDYA 4AD1A 4D1IA 4XVDA 3TLQA 3RO6A 2IS7A 5C6MA 5CPLA 2OODA 4TX0A 1ICQA 1WA3A 1UWTA 4MY1A 1KM5A 3F5JA 3MV01 2G8ZA 2EJAA 5G2IA 9XIMA 2RUQA 1EBGA 2ZX7A 3HO8A 1TVPA 3UNDA 1LBMA 3ABOA 5CPSA 1UZ4A 4RK8A 1XH1A 2ISFA 1ROUA 5FJPA 4LVGA 3E12A 4O4VA 1EJTC 3F4DA 1KRAC 4M56A 4FX6M 1OABA 3CIWA 4MSPA 1HKVA 1WDQA 3RMEA 1PPIA 1XSJA 1I1XA 1AVAA 3GY1A 3RAOA 4AD2A 2W66A 4PFMA 4IPJA 2YL9A 5CJMA 1EB3A 1MW2A 2XGZA 1WYIA 4YVPA 1NARA 2NVAA 8CGTA 1IT0A 1M5WA 3UA4A 4XBSA 5TD4A 3WF1A 3DXIA 2Y8VA 1P0BA 1RJQA 3GLCA 1XKJA 2XM2A 3N19B 2ON3A 1RBOB 2YA1A 2BXVA 1D8WA 2VMFA 1TTPA 2ZA2A 2DZSA 2H9AA 4N9EA 3CU2A 3DFQA 3NGFA 2W6RA 3W70A 1NVMA 3U2ZA 3DFNA 3VC6A 2VVNA 1GYNA 2HK1A 3B9DA 3PFRA 4ODRA 3ITLA 2XP5A 1NWTA 4ODMA 4ZEPA 1R5YA 2DV0A 2Q71A 3H7UA 3WUFA 2PPPA 3CAKA 1QMLA 1RVKA 2BFGA 3WNOA 3S5NA 3HIJA 1OZQA 4B91A 4EXAA 2PDYA 3NGJA 2DFAA 3EOSA 3RFWA 1MZRA 3G22A 1OFRA 2OSYA 4YN5A 4HHHA 3T0DA 1SSDA 2VELA 4JN7A 1ZBWA 1J0YA 2XDFA 1I4NA 1SFJA 1FWRA 3C3UA 3K8LA 3OODA 1NDYA 4RDVA 4HSOA 5DANA 3DC0A 2VCAA 4TTUA 4MKNA 3SCSA 5CJ5A 5A6AA 1PZ3A 2AL2A 4IIHA 3WQ6A 3E38A 4Z17A 1H7XA 4Y9MA 5EMJA 3LUOA 2PGRA 4GHRA 2R1LA 4DJFC 1J0HA 5HNTA 3KXQA 3LHUA 2J7DA 2D0FA 3KAHA 1WUFA 2QJMA 4AZCA 4LB3A 3D3FA 4HA4A 1JZ6A 2REQB 3T4CA 1R30A 5LXEA 4L56A 1E4NA 3QH2A 4HQVA 5A6SA 1GUVA 3ZVIA 4DUXA 3ZZ1A 2XZ7A 3EWCA 3H2MA 3ZQ9A 1K8XA 1PS9A 1DQWA 4LRSA 4HSHA 2X1TA 4W93A 1MNZA 2QDGA 3GDBA 4EWJA 1P0EA 4MNLA 4P7LA 1LWIA 1E71M 1V5XA 3EDDA 3A13A 2DSZA 1L6GA 4MLJA 2D69A 3UESA 3TJLA 2OEKA 1KV5A 4TTGA 5K7JA 4L6HA 4F0MA 3FSUA 1TJ2A 3KAIA 1XYLA 3BLFA 1G7VA 2E28A 4HPHA 1UBPC 1DWJM 1MUMA 2Z24A 2WK2A 4ZXOA 1JPHA 5AKQA 2VUYA 4U86A 1JNTA 3HMJG 4WJEA 1AQFA 1MQRA 4PUDA 3CZGA 4IMGA 2G3FA 1NIUA 4IIEA 3S8HA 3MMTA 3NDZA 5IHRA 3HFTA 4PUEA 1JPKA 1XR2A 1XH2A 1YTEA 1W5MA 2YXGA 4JPGA 4P8VA 4CQ9A 4R0XA 2CKSA 4M1RA 1NP0A 2GZXA 3F1QA 1W9PA 4F2UA 3UY7A 3BG3A 1LQAA 1FKFA 4LF1A 1PO9A 5J5RA 1SZFA 3FDKA 1E0XA 2ZRXA 1TSIA 5CG0A 1UP0A 1M1BA 3PJXA 4AD4A 3KBSA 1WAUA 2J25A 3M6YA 3QFWA 1FKBA 1DWAM 3P6LA 5I5RA 1I2PA 4WIWA 2JQXA 4YJ5A 3D6NA 1J5TA 2C1IA 1Q6QA 4YL2A 1QJWA 1XFBA 1SVDA 3RLGA 2VWSA 3OVRA 1ZBVA 4UWMA 3SM0A 3MUAA 3M7SA 3O05A 2QF7A 3C2FA 4LS1A 3VNYA 3IGUA 3GR8A 3NDOA 4A05A 4LOCA 4W8BA 1KTNA 1J4HA 5HQMA 1VB9A 4RXFA 1TTJA 3EX3A 4O0KA 1QVBA 4A8IA 5EMYA 2ACQA 3UZYA 5EFDA 4WGHA 1GRJA 3VIGA 1V3KA 3BJFA 4PSRA 2VCCA 3L4VA 8XIAA 1H1NA 2GWNA 2NV2A 1YXDA 3ZSSA 3INPA 2PC4A 2E9LA 5AFDA 4CD6A 5BWAA 1OVDA 4RNHA 1YDNA 2OTDA 4RL3A 2WM1A 3C0JA 4H00A 3IAQA 4GX9A 4IGHA 4PCNA 5GVJA 1VEOA 3PZGA 1A5OC 3I7RA 5BXTA 4AD3A 4H01A 2VUNA 4KF1A 3JW7A 5BCAA 3NL2A 5C8BB 3OVPA 2DDXA 1JJKA 1CW2A 3CJPA 3GVWA 4DJFD 3V16A 1VC4A 2FTWA 2DG9A 4UQDA 3WLOA 5FF2A 5REQB 4J3TA 2N87A 1A50A 2PD9A 1UJPA 4FP1A 3F2DA 3HMCA 4XAPA 5FJRA 3AHTA 4PMZA 3L65A 1RUSA 2Y61A 3KM8A 4UOQA 1R6WA 4S3DA 4V2XA 1J8VA 2BY0A 3IK4A 4M6VA 3SUVA 1JPMA 2MNTA 5A6BD 4KEUA 1FWTA 2QIWA 2ZCGA 3VGHA 3WJYA 3AJ7A 4PTXA 3MANA 4E4FA 1JCLA 4NY2A 4M6UA 4I9TA 2CESA 3GIYA 1X39A 3TR2A 2NX9A 2VEKA 3MI3A 5J6EA 2YXOA 1X97A 3EOEA 3QC0A 1D3CA 4YVVA 2VCDA 3WQOA 1A5BA 1X1OA 4B92A 1S38A 1VIWA 4IIGA 1V6WA 4NKCA 1JGIA 1VJIA 3TJ4A 3ISIX 1EYWA 1WOBA 1P4CA 4IGNA 4N19A 2HS6A 4U2ZA 1WQ5A 3B0YA 1DP0A 3NPUA 1HXJA 2BVWA 1UD6A 1Q8AA 3FXYA 4DRQA 1VFFA 3H4WA 2Q3OA 2KO7A 3WNMA 4PUUA 3STGA 1FTXA 4HYRA 1V51A 5BW6A 3JRKA 5DLCA 3U6WA 2ZOXA 4FALA 5D4YA 4LRTA 5G1TA 1JCXA 4LEQA 1Z6KA 1U79A 4Y9PA 5C9RA 3BV4A 3R4IA 1XC4A 4UIOA 3NO3A 5AZ0A 4ZPWR 4O1CA 3PSVA 3FJLA 1YPXA 1ISVA 1FDYA 2V38A 4PCSA 3MBFA 4LF2A 3PA7A 2QUVA 1H7OA 2Q8LA 4MNJA 3PTKA 4W7UA 4XZBA 2A7PA 1XRVA 5FI8A 3WL0A 1OX4A 4LNCA 2PZ0A 5C7VA 2PDJA 5HUOA 4QG9A 4HU4A 3WBAA 6A3HA 1JPDX 2D2GA 2J6XA 1JZ2A 8A3HA 1WKDA 1ZENA 3GAYA 1FH8A 2PZNA 5GJPA 3K8MA 3L7RA 1C90A 1EO7A 3AOFA 2Z6JA 3H7VA 4WY0F 5DY2A 1GOWA 3IUHA 3OOBA 3KWXA 3MMUA 3IV8A 2BSLA 4Z1DA 5D9MA 3BAYA 5HWMA 3N25A 2NT1A 4DY1A 3N3TA 3LCGA 3O5LA 3C0LA 3RGCA 5TBOA 4GQQA 3TN5A 3C2RA 3WH6A 1XPYA 2YA2A 2DW6A 3GH7A 1LT7A 1J6YA 4Z1BA 3VNZA 1Q6LA 1Z7AA 4JQAA 1FRBA 4YHGA 5U7SA 4B2DD 4X63A 3UZ5A 3W6YA 1D6OA 3C3NA 1JZ3A 1QK0A 2Y5SA 3K8KA 5BZAA 1KT1A 3RM9A 4BQ4A 4JFLA 2ZWYA 2A79A 2WM0A 3B7XA 2VFFA 2BXYA 1A5LC 4X60A 4PCTA 4OQVA 1XDJA 3V1PA 3A4XA 3EXTA 3NQGA 3VGEA 3AC0A 4EE9A 4DROA 1NTHA 1IEQA 3FW6A 2X41A 4WVXA 1OC7A 2XP8A 2V3EA 1PKLA 2XH0A 1CT5A 3PUEA 4UCGA 1SFTA 5A5WA 4MWAC 1RLDA 1VFHA 3AICA 1EA9C 4H04A 3M46A 3KVLA 1SW0A 3LCIA 1UUOA 3PANA 2X42A 3JS3A 4LH8A 6XIMA 1Z69A 1H2JA 3WQEA 4PUKA 1GG1A 4DYJA 1B1YA 4M6QA 4C6OA 5D32A 4UTMA 2OXNA 4HHMA 1RQHA 5CC6A 4GKTA 1BTCA 2MNRA 1UZHA 1KV8A 4LCSA 3IVUA 3KBNA 3VFLA 2PWFA 1G0CA 1K70A 2EAWA 3EYPA 1POKA 2J9XA 3FA3A 2PLCA 3UWZA 4LCRA 1VRDA 4NJHA 3W01A 3P81A 2NVDA 4FSAA 4UTLA 5DN1A 1D7FA 2OQLA 1M03A 1A5NC 4HNUA 2E1WA 1UBSA 3VYLA 3QW3A 5AZ1A 3LRLA 5U4NA 2UY3A 4FXRA 4US5D 4HT3A 2VTFA 4FX7A 3B8SA 9XIAA 4B4FA 3MYPA 4PTMA 1LG2A 3L0KA 1P1XA 2DZTA 2YCLB 3W9ZA 4CCEA 1E4MM 3IVTA 1OD8A 2GDQA 1V03A 3NEHA 3ZLHA 2E5CA 1FJDA 1GTHA 2ZR6A 4MPKA 5A6JA 1EJVC 4MZYA 2J8FA 1IT8A 4Q8TA 3P74A 4YTSA 3BSGA 3GH5A 4C7GA 4XVEA 2ZR5A 4CNUA 1IV8A 5KZMA 2M2AA 2XVNA 5AC8A 4AH7A 5HQLA 4IG2A 4QIUA 4ZQCA 2J4GA 3GXPA 2I1OA 3EWUA 3NYZA 3KBVA 3TTEA 4HK7A 2BS9A 5E0FA 1BXNA 2A6NA 4GNVA 1ADOA 1US0A 1VYPX 4LAKA 4GO8A 3A3WA 1C7SA 3NWRA 5FJIA 2QCEA 1V6VA 1XQKA 2OWXA 2OELA 1FWDC 3JUGA 1S1RA 3UG4A