2YBTA

Crystal structure of human acidic chitinase in complex with bisdionin c
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
377
structure length
377
Chain Sequence
b'AYQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC MAMMALIAN CHITINASE
publication title Analyzing airway inflammation with chemical biology: dissection of acidic mammalian chitinase function with a selective drug-like inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 126
structure length 377
sequence length 377
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ybtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ybtA01
1PX3A 2CHNA 4ZFMA 1UWRA 1E4IA 2YJQA 1DWAM 1OCQA 2DT1A 2G3IA 4MNJA 2WVSA 2DH3A 3AIUA 4CCEA 3N11A 3A4XA 2C8NA 5A8PA 1CXFA 2WVVA 4W5ZA 4V28A 1PJ9A 1H2JA 5IHSA 1E3XA 1ODZA 4QLJA 1HL9A 4PMXA 1FP9A 4MAVA 3LPPA 5C70A 3AIRA 2WMHA 3WELA 2W61A 3GXMA 2QPSA 1BGGA 2YKKA 2WZEA 4ZEPA 1FA2A 1EH9A 4CUCA 3CZGA 1EOMA 1QNSA 3WDJA 1B2YA 2FHCA 3F5KA 1BYAA 2OWWA 4JIEA 3AFBA 4PSPA 3AS3A 3TTYA 3VIOA 4BA0A 5A6MA 2XM1A 4KRUA 1EGZA 3WH9A 4W8BA 3M6DA 1VFUA 4BS0A 1C91A 2IXVA 3GZAA 1VJZA 1QW9A 3M07A 2VZUA 5EB8A 1C7TA 3A6OA 3CZEA 3NSNA 4PN2A 1MFVA 3L4UA 1GOIA 3WQ5A 1GPFA 1JXKA 3NIYA 1K9TA 1X6NA 4D6DA 3WKZA 3OG2A 2XG9A 3NYDA 4TTUA 3WNKA 2BXZA 4PCTA 1UKPA 2VRJA 5A2AA 1QHZA 1NWUA 3WD4A 2AOSA 5FL1A 4UFHA 3THCA 3BMVA 3DC0A 1UKQA 1CZ1A 4P8XA 4BZYA 3ARXA 2YLAA 1H0IA 4TX8A 1FHDA 4FLOA 3RJXA 3U5UA 5A6JA 1KFWA 5JH8A 4YPJA 1J0HA 2DIEA 1GQJA 3AMCA 1ZBKA 1MXDA 2E40A 2EXOA 3N17A 1JGIA 3KWXA 2VUYA 1VRXA 3WDRA 4QP0A 4OOUA 1BF2A 1F4AA 1KXQA 4EANA 1JF5A 2XYLA 1KGXA 4EK7A 4DM2A 2VO5A 3VILA 3U57A 4UFMA 3K8MA 4UFJA 1KXVA 4TUFA 3GXFA 4TXEA 4Z2GA 5ABHA 1E4LA 2DSVA 3CUGA 1UD4A 1W1TA 1W9PA 4P7QA 4B15A 3CHDA 3UEQA 3J7HA 4L4PA 4MDPA 3VD9A 2J4GA 2BHUA 4UFKA 4HTYA 2JIWA 3HJEA 2WVUA 3BAXA 1UZ4A 7A3HA 1G01A 4AY1A 2UY2A 4MAZA 4PMQA 5HDRA 3OGVA 4PYSA 4W84A 3MMUA 3MANA 4BF7A 2W91A 3W53A 1KBKA 4ZXOA 4AZGA 5A8MA 2BVYA 2WWCA 1K6AA 4J3VA 4CN6A 4CCCA 2PB1A 1OIMA 1WKYA 2JEPA 4CD5A 3ZOAA 1QI2A 1UA3A 3F4VA 3WQVA 2ZUMA 1O7AA 4PMRA 2W67A 1MQPA 1CTNA 4IUGA 3MUAA 1CNVA 3GM8A 1W9BM 5A6KA 3FW6A 2ZUNA 4CN1A 2ZUTA 3BXWA 4CGTA 3POHA 1RP9A 4RL3A 2GDUA 4CD6A 1HP4A 3KZSA 3L4VA 2E8ZA 3WH5A 2PWGA 2WSPA 1AMYA 1JZ3A 3AI0A 3AXIA 3GNPA 4F79A 3ZSTA 2GK1B 1IZKA 1PZ3A 1W91A 3IAQA 1R7OA 2Z1KA 2VJXA 1Q6FA 3BLKA 4ZE5A 1H0GA 3VNYA 4AZ5A 1KBBA 1CENA 2WZHA 3WH6A 3ZSSA 4JFWA 3VGDA 1G1YA 1MW3A 4LYQA 3WH7A 4DUVA 1U30A 1ZJAA 1EHAA 3AHXA 4AIUA 4R27A 3WFLA 2W62A 4PSRA 3VMNA 4ACZA 1E1EA 3UR7A 2C0HA 3ECQA 3WDHA 3WNMA 3VX1A 1VF8A 3AZSA 1W9VA 3IJ7A 2WMJA 3SUWA 1JXJA 1NH6A 3W6MA 1IZJA 4JKMA 4DM1A 2CITA 4WIWA 1W2VA 1UR8A 1NQ6A 2VTFA 2XVGA 1UKOA 2UY4A 4ATWA 2E0PA 1OWQA 1KCLA 2XTKA 4BQ2A 3VMPA 4H04A 1K9DA 1KGUA 4WKFA 1P6WA 1QNQA 2D22A 2A3BA 1GORA 4P7OA 3WL1A 1GUVA 4W89A 2QLYA 5IDIA 4PRWA 4MB1A 1GVIA 2ZX9A 4TVCA 2W4XA 4AISA 3IJ8A 1LLOA 1V6VA 2PF0A 1MYRA 2A3AA 2CBUA 2WC4A 1EO7A 5GNYA 1UD3A 1Z32X 1E9LA 1O6IA 2XM2A 3VIGA 1GQLA 4GQRA 5BCAA 1W1PA 1LF1A 3TOPA 1US3A 1JIBA 1LWJA 1J0YA 3TP4A 3CMGA 4HOWA 4HU0A 4MADA 5GNXA 2O9TA 1UH2A 4JCMA 3MKKA 2EQDA 1BYDA 5E6ZA 1ZS2A 3FN9A 3N9KA 2YBUA 2O9PA 3ARUA 4XV0A 1E4MM 3W25A 2WANA 4D6FA 2VT0A 4TVDA 4CVUA 3WMSA 5D9OA 4D6GA 2EO7A 7TAAA 1BFNA 3OBAA 1LL7A 3PTMA 4PCSA 2E9BA 3AYSA 1VFMA 1HKKA 2WKLA 3NDYA 2O9RA 5JBEA 2UY3A 3W28A 4PTMA 3CBWA 3PHAA 4BQ4A 2XFYA 2PWDA 1DP0A 1V02A 1ZBWA 3WMBA 2CESA 3MO4A 4FMVA 5C71A 4H8VA 1U33A 1C8YA 5A8NA 3ZM8A 2PWEA 2J47A 4JFTA 1D2KA 4U2YA 3CUFA 3T09A 2V38A 3EDKA 2W92A 4MJ4A 1M04A 2GK1A 4HZ6A 5A1AA 2A3CA 1QW8A 1VEPA 3VIKA 3WQWA 1B3VA 1CPUA 2VURA 3F5LA 3BLPX 1E4NA 3AJ7A 2WLYA 3MUZ1 5AYIA 5DT5A 4W8LA 6A3HA 5D8WA 3LPFA 1WNOA 2X8RA 1Q6CA 1GW1A 1CXLA 1GOMA 1ZL1A 4AYSA 3NSXA 3W6LA 3M7SA 5I23A 2CXGA 4U2ZA 1FH7A 1PX8A 5D9NA 1H11A 4AMCA 4E2OA 3CHCA 2D3NA 4XB3A 3WBAA 3AXXA 4PMUA 2GFTA 1TA3B 1E56A 2JEQA 4M29A 4LGXA 1RPKA 4GO9A 1Q4NX 2GSJA 3DYPA 1CXHA 1H49A 4D1IA 2W66A 1UHVA 2X0HA 2XHYA 4PMNA 3WDQA 5CLWA 2GJXA 1EDGA 1QBBA 1XD1A 2J75A 2VR4A 1CXKA 1PBGA 3RILA 1HIZA 4U3AA 1YQ2A 4WKHA 4JKLA 5A8QA 1A47A 4PMDA 3SCOA 5CXPA 4R5EA 5HPCA 4M24A 2BHZA 1BVZA 1UZ1A 3VIJA 4PMZA 4ACYA 3WEOA 4AZIA 3AROA 2WMIA 1W1VA 1GCYA 1XV8A 4UFLA 1UR2A 1WZAA 1V3HA 2QV4A 3GXDA 1V0LA 5A69A 3W26A 5BWFA 5DF0A 3ZR6A 1JL8A 2BHYA 3G6LA 3GH7A 1NP0A 2D1ZA 2YBTA 1W3JA 3RPMA 1CYGA 2VCAA 4UNIA 4AC1X 1E5NA 3OLEA 3B8SA 5FOOA 5I6SA 1HJQA 3QOKA 3WD2A 1V3MA 6TAAA 3WUGA 4U5KA 3VIFA 2IXUA 3DYOA 4OKDA 3WNOA 4Z2HA 1BYCA 2FHFA 3NDZA 4PUEA 3VGGA 2EPKX 1SMAA 4CU8A 5D9MA 2FHBA 3S2CA 1TE1A 3SCQA 4LPCA 2J8FA 4JKKA 2OYLA 3W37A 1V0KA 1R85A 2VX7A 2V3DA 4AD4A 4QLKA 2FGLA 2CNCA 1NOWA 2X2YA 3K46A 3CH9A 1CXIA 4PMVA 1JZ2A 3O9NA 1J0IA 4WF7A 1TVPA 1C7SA 4V2XA 3SCRA 1UR4A 2WSKA 2OYMA 2ZWZA 2EPNA 4AXNA 3RCNA 3ARQA 1QI3A 4CD7A 3MU7A 1HP5A 1IT0A 3VTRA 3WDIA 4CKQA 1OT2A 3RM4A 1V0MA 3SCNA 5BXSA 1NWSA 1B3WA 3ZJKA 4AZCA 3ZJ8A 3MV01 4HMEA 5A8OA 2YL6A 1B1YA 3FY1A 4IPLA 5JIPA 1LWHA 2G8ZA 1G94A 3AISA 1JYNA 3ARSA 3OGSA 2VX6A 4W7VA 1LG2A 3DHUA 4AZ7A 3PTKA 3THDA 1WCGA 2WHKA 4HMDA 4JL2A 5HNNA 1HKMA 5EFDA 5I78A 1V08A 3CTTA 3VD4A 1KQZA 2VVNA 5JBDA 4NI3A 2E8YA 4QLLA 4UOZA 4C7DA 2V5CA 2PBOA 5M5DA 5ECUA 4A3HA 3GBDA 3VGBA 3T08A 4UQAA 1KR0A 1W1YA 2CERA 1UQZA 1V03A 1ZJBA 3VD7A 3FNDA 4PMOA 5CZKA 1D7FA 1GOKA 2VCCA 5CGTA 5E6YA 4Z2LA 1V3LA 4GZIA 1J01A 2ZUUA 5BXTA 2VRKA 1NM9A 4OBSA 4H41A 3VM5A 4U3CA 2XWEA 2BV9A 3OA5A 1G9HA 1E43A 1GZJA 4TX6A 4V27A 2VVSA 3AIWA 2DPEA 3T0DA 5GNZA 1MFUA 1QNPA 2JF6A 5A2BA 1B90A 2ZWYA 4W7WA 1MVYA 2WBKA 5CQ1A 1TUXA 2JF7A 3UG3A 3W0KA 1NP2A 3ARPA 1E55A 3AICA 3HU7A 3FAXA 4K68A 3AHTA 2CETA 3VDBA 3EDFA 4UR9A 2J7EA 1PIGA 4QCFA 3CUHA 2XGBA 1J9YA 1J0ZA 1LG1A 4F9JA 5CSYA 1BSIA 4ATLA 4UTFA 4E8DA 5CJ5A 3PZQA 1L0PA 2O9OA 5E70A 2X1IA 5CPTA 1OD8A 1HKJA 3ARTA 1AQMA 3WNNA 2J7BA 4PTWA 2RGLA 3VGFA 2BXYA 3BAYA 4AD2A 3VD3A 1TMQA 2CCRA 3SCSA 1GOWA 3PZMA 4Q7NA 2BY2A 1GONA 1A3HA 1H5VA 3UESA 2XJ7A 3K4AA 4M1RA 5ABFB 1J12A 3NUKA 3AHVA 1QNRA 4P8UA 2WK2A 1UH4A 1Y7VA 5HXMA 1DEDA 4BQ3A 3K4DA 3JUGA 4M82A 1XCWA 3BSHA 4WSJA 4W93A 2GVYA 5HOSA 2WHLA 2WNWA 1E15A 2WMKA 3QOMA 1GVYA 3SCPA 4CU7A 1SR0A 1M7XA 2GJPA 1JYVA 2WKGA 2G3MA 3PN8A 5BYWA 2WCSA 2BY1A 2CBVA 7CGTA 1C93A 3ARWA 5AC4A 1VAHA 1AQHA 3VX0A 2VQUA 1K9EA 4E8CA 3DHPA 1WDRA 2WPGA 5LA2A 2EBNA 3E1F1 3EDJA 3ZJ6A 4CD8A 3WL0A 3GYCA 3ARRA 3FXYA 3D5HA 2DSKA 2BY3A 4GI8A 5TD4A 3L4TA 5AYBA 2AAAA 4LX4A 1TR1A 4AD1A 1BVNP 3G6MA 4EKJA 3QHMA 5LA0A 3TTQA 3ZT5A 3NCOA 4XUYA 4IPNB 3VPLA 4IM4A 2XFRA 1UWTA 3W27A 3N1AA 3FHQA 1BPLB 4PBGA 5FIPA 2DGAA 1HT6A 4CN4A 4N0RA 3ZR5A 1GQKA 2CPUA 5CLTA 3WSUA 3GXIA 2XVNA 2Y8KA 3KEHA 3WD0A 1ISVA 1HVXA 3RJYA 4UOJA 4CU6A 5AY7A 1Q6DA 4OIFA 4FLSA 3RIKA 1PAMA 1W9UA 1HJWA 2ZOXA 2YLLA 3EMCA 1R87A 2IUZA 3DECA 1B9ZA 2JE8A 2ZICA 1FHLA 1PZ2A 1C8QA 4MNKA 4E4PA 3N12A 1JYWA 2VQTA 3UG4A 4F66A 3OZOA 1HL8A 2DSZA 2QPUA 4D6CA 5GQBA 2ZX6A 4D71A 3IANA 4NF7A 3CUJA 2ZUWA 3W24A 3A4WA 4RE2A 1EA9C 3GNOA 2WXDM 5CG0A 1JD7A 1C3FA 1CBGA 2ZX8A 1J0KA 1WB0A 4Z2KA 3WF3A 3L2LA 4Y7EA 4JZ5A 1CLVA 2WC3A 4PUDA 8A3HA 1DTUA 3DYMA 5BRPA 2HVMA 2G3NA 2YDQA 2DSUA 3HMCA 5DT7A 4PEEA 3PZOA 2V3FA 2F8QA 3WNPA 3NSMA 3QR3A 5CGMA 2VOTA 1UD5A 1OGSA 1GJUA 1UKSA 4CCDA 3EMQA 1FOBA 3VDHA 2J77A 4W8AA 2E4TA 2BFGA 4GZJA 5AC5A 1L8NA 2AMGA 1V0NA 2J7FA 1GJWA 2VX4A 1H41A 5M17A 1BTCA 4WKAA 1G0CA 4KH2A 2J25A 5F7UA 2ZX5A 3UG5A 1XH1A 1D3CA 2E9LA 4ZE4A 2GJRA 3PZGA 1OSEA 1UYQA 3VKKA 2X0YA 3AOFA 4HPGA 1XYFA 1E6QM 1UOKA 4KGJA 4MNLA 3MSGA 2VL4A 1E3ZA 4S3KA 1WZKA 4J3XA 4D6IA 2J78A 3PZTA 1C92A 1XH2A 2WVTA 4M8UA 1EQPA 1W9DM 3I3DA 3VD5A 5I5RA 4DUXA 2FH8A 2WZIA 1VEMA 2F2HA 5ABEA 2UY5A 1CGXA 1E72M 1H1NA 5EMYA 2Z1SA 1WDSA 4J28A 1QNOA 2VNCA 1XSJA 1OM0A 4WK9A 4P7LA 3AS1A 2WB5A 3WN6A 1CWYA 1H4PA 4Q22A 2J7HA 3I3EA 3PZIA 1V6XA 3AMGA 1UWUA 1TCMA 1XC6A 3LMYA 4MB3A 1W3LA 3W4RA 1HJSA 3A4AA 3EDDA 1XSIA 4HZ8A 1SMDA 2XVPA 3WFZA 1ITCA 2F61A 4XX6A 2QHAA 1KB3A 1I1WA 5D8ZA 4J3UA 1QI5A 5DO8A 1QHPA 5LYRA 1F4HA 4HOZA 1E40A 2VZOA 1DWHM 1ISZA 4LQ1A 1QOXA 2E9MA 3IK2A 1KR1A 3W82A 2Y5EA 4KGLA 1QI0A 3U7BA 1H09A 1ZB5A 1DWJM 2QF8A 4QCEA 1W32A 3BCDA 1VEOA 3WQ8A 3UR8A 3AS0A 1VJSA 4AD5A 1UR9A 3EYPA 1ITXA 4UQ9A 2D2OA 3T0BA 3VO0A 1BG4A 2Y24A 2OSWA 1E5JA 1XHGA 1BAGA 3WD1A 4J7RA 1DHKA 2XUCA 1PEZA 3L4YA 1PX4A 1XYZA 4J3SA 1R86A 5JIWA 1JNEA 1CGYA 2VC9A 3UETA 2DEPA 1HF6A 5M3WA 1J11A 4W85A 3S6TA 5C8BB 5CPQA 3AIVA 3PTQA 9CGTA 3CUIA 5FCZA 4A4AA 1R7AA 2OSYA 4EE9A 3VIMA 5D9PA 3BSGA 4H8HA 1DWIM 1V3KA 3WF0A 2E3ZA 2QMJA 4GKLA 5GPRA 4AIOA 5DEZA 1ISXA 1OT1A 4NSBA 3AIQA 4HP5A 4UZSA 4GQQA 3WH8A 1HVQA 1UA7A 3L4WA 4KMQA 5IFPA 3GBEA 1GHSA 1JF6A 1WO2A 3CHEA 3F5JA 4M56A 2EJ1A 4W87A 5I24A 5A6AA 1JFHA 4DWSB 3CMJA 2XSAA 4JHOA 3WD3A 4W5UA 5A94A 1JD9A 1JDCA 5LA1A 1CLXA 3WEMA 4JFUA 2XVLA 4PTXA 2BS9A 4J27A 3HN3A 3UERA 1FFRA 4MB4A 3T2QA 2WM0A 2ZXDA 3KL0A 3TTSA 4UQCA 3BAKA 3OLIA 4EAMA 4GXPA 2OWXA 1CIUA 1GHRA 1HKIA 1VIWA 2D23A 1CGTA 4JCLA 1V3JA 1TVNA 2J8GA 1ECEA 1UR1A 3BGAA 2XFFA 2J7CA 3WF1A 1JZ4A 3A3HA 4WJXA 3EDEA 3AHZA 6CGTA 3AS2A 3SCWA 4J3WA 1J0JA 2CKRA 5JBFA 2Q8XA 3N18A 3AXHA 2J74A 3VGEA 1MXGA 4F8XA 2J62A 1EHNA 4W86A 4D6JA 1M53A 3VVGA 2XSBA 3VGHA 1WE5A 1MW2A 3O2LA 1HJXA 3WDPP 2D3LA 4M81A 4KWUA 1JDDA 1VFOA 4OBRA 5BXRA 2DQXA 2YL9A 2CBJA 1PIFA 1RH9A 2VR5A 1EDTA 2G3JA 2YA2A 1VENA 4AD0A 1E6RA 1KWKA 1S46A 3PZ9A 3SCUA 1TA3A 3AIEA 3L2MA 1GOOA 2BNJA 2A3HA 3PBGA 1DWFM 2XGIA 1EXPA 1OIFA 3SUUA 3QHNA 1UH3A 4B9ZA 1C90A 3BAWA 1HNYA 4MTVA 2WW5A 1SFSA 2OSXA 4RE3A 2YIHA 3FAWA 1EIBA 1H3GA 2DSWA 1XD0A 1R8LA 1OGBA 2CBIA 3ARZA 2X09A 3OLGA 3TTOA 3W29A 2D0GA 3MS8A 2DT0A 1MW1A 2A3EA 1VBRA 5I2UA 2CYGA 2VRQA 4Z2IA 2TAAA 1EQCA 4UQBA 4JFVA 1UG6A 2J7GA 3D3AA 3BAIA 3VM7A 1XCXA 3ARYA 3BH4A 1E6NA 4PTVA 1J18A 4OOZA 1E73M 2WHJA 2ZUVA 1C8XA 4IISA 4C7GA 3B9EA 2WBGA 4FLQA 4URIA 1B30A 4TTGA 2MANA 1EDQA 1V02E 3ZIZA 2PBGA 3ARVA 1QI4A 2HISA 1ODUA 1LQ0A 1UKTA 4NRSA 3T2PA 1JAKA 4AZBA 2CIPA 1MW0A 1NOUA 2ZXBA 4ACZB 1N82A 4QFUA 4J3TA 4QAWA 3TA9A 4A3YA 1X6LA 2NSXA 4DWSA 3OZPA 2YL8A 3MV11 2BVDA 3WEZA 1FFQA 1W3KA 4B3LA 3WMCA 5BXPA 3GH5A 1QPKA 2ZX7A 3CZ8A 4GZEA 2DIJA 2YOCA 1TG7A 2B31A 4HA3A 1E1FA 1FH8A 3SUVA 2X05A 1E0WA 3II1A 1KXTA 1VFFA 1Q6GA 3T2OA 3FHAA 8CGTA 4H2CA 1XH0A 5JUVA 1K9FA 1UD8A 2DH2A 4B3KA 4P7NA 4FLRA 5E0CA 3SURA 4LYPA 1JAEA 4AWEA 2PWFA 3AHYA 3VMOA 3T0AA 1BHGA 1W3HA 4P7RA 1QHOA 3AMDA 2JIEA 4DUWA 2V3GA 2D20A 3IAPA 5I3DA 2J7DA 2ZUSA 4UFIA 2FDMA 1KWGA 3CO4A 1B0IA 2WHMA 4CD4A 1WDPA 1AQ0A 5I0DA 2PI6A 3TONA 5IXEA 1B3YA 2GUYA 1XRVA 3KE0A 4F9DA 1ESWA 2CHOA 1JDAA 4UQEA 3WUFA 1ZU8A 2PC8A 3RM8A 4GPNA 1MWOA 4YHGA 1U2YA 1X1NA 1SYTA 2C7FA 2NT1A 1YHTA 1GQIA 2ZXQA 4U5IA 1QBAA 3GNRA 3ALGA 3GH4A 2FGZA 4H8UA 4AIEA 3RM9A 1XGZA 3ZT7A 4ZENA 2D24A 4KRTA 4TVUA 3VIHA 4MJ2A 2D0FA 3AYRA 2OLHA 2Y4SA 5KZ6A 2JALA 1B31A 3WBEA 4X9YA 4UCFA 2PWHA 1CGVA 1UWIA 3KL3A 3L4XA 1JZ6A 3OLDA 2O92A 2WCAA 1CGUA 1E70M 1VBUA 2ZE0A 5M03A 3K8LA 2Y8VA 1NWTA 5A6BA 3WY1A 2UWFA 3B9AA 1BQCA 2DT3A 5ABGA 4BQ5A 1WPCA 3MUY1 1JI1A 2W63A 5IHRA 5A6SA 5FD0A 3OGRA 3MUIA 1FH9A 3EBVA 3KL5A 4D6HA 4YHEA 4JAWA 3WF4A 2G41A 3BCFA 2YDRA 2BY0A 1M03A 3QHOA 1E6ZA 4UQDA 4JHZA 1RP8A 3SIMA 1DWGM 1VB9A 3RDKA 3WENA 1BYBA 1GOQA 2XVKA 1ISWA 1JZ7A 2NT0A 4ATDA 5A95A 4LXFA 3SCTA 3VINA 2YA0A 3MMWA 2OWCA 1HJVA 1JI2A 3VDCA 1JG9A 2VZTA 3RO8A 1BG9A 5DFAA 3W38A 1QVBA 5I79A 1UUQA 1TFVA 2GJXB 4ZXLA 5EFFA 1UD6A 4AW7A 1ZBCA 4NZCA 1HX0A 2XWDA 1ZBVA 2Y2WA 4HMCA 3WNLA 1CEOA 4AD3A 5HBFA 2W5FA 3SUSA 3SCVA 4LYRA 5ABFA 1XSKA 3SUTA 3SEPA 1UWQA 1B3ZA 1E0VA 3K1DA 2WMIB 1UD2A 1CDGA 4U31A 2JFEX 1WZMA 1Q6EA 3UCQA 1KGWA 4CVWA 4DWSD 1WZLA 3APGA 4W88A 1I1XA 1FP8A 1CGWA 2XIIA 1CXEA 4D72A 1OB0A 1JZ5A 3CZKA 1I75A 2EPLX 4H7VA 1LL4A 3GDBA 4FF5A 3OB8A 2WC7A 3BAJA 1TZ7A 4AZHA 1PPIA 4AEEA 5E0FA 2WMGA 3U5YA 1NARA 1WAWA 3WF2A 1E6XM 2ZXAA 3AIBA 4HA1A 1M01A 2CKSA 3VDAA 4MDOA 2YA1A 1UQYA 4UZUA 2J79A 5KEZA 4L4OA 3VNZA 3LPOA 3EMZA 3VOCA 4OZOA 1JFXA 4ML4A 3AZRA 1MQQA 5A3HA 1IV8A 2VZVA 3NJ3A 4WLCA 4S3JA 3A47A 3W81A 2DT2A 2VZSA 4X0VA 4XZBA 3I3BA 1GNXA 2YDSA 3CPUA 1JZ8A 1G5AA 2WAGA 3OIHA 3VIIA 4MB5A 5FKYA 3MSDA 1HJUA 2YL5A 2VCBA 2ESCA 4MNMA 2VI0A 3O6AA 1V6YA 5D4YA 2VX5A 5EBAA 1US2A 4B16A 1V6UA 4GIAA 4D1JA 4AZCB 2V5DA 3VIPA 4M80A 3ZJ7A 2WVVB 1E6PA 1CECA 1KXHA 5E9AA 1NOFA 4AZ6A 3AZTA 2NW0A 1J10A 3M46A 4GI6A 3CIVA 2XPKA 1ISYA 2WLZA 2G4FA 1UR0A 2FH6A 3QGVA 3ALFA 1BLIA 1OBAA 3AQUA 2EPOA 4GINA 1E6SM 3K8KA 3VU2A 4P8WA 4DWSC 3CZLA 2EEXA 4HOXA 2WCGA 5BROA 4GI9A 5BRQA 3U7VA 2EPMX 4U33A 3WQ4A 4OUEA 4TOQA 3MMDA 2VMFA 4PMYA 5A6BD 3L4ZA 2V3EA 1V6WA 3GTNA 4QDMA 1OINA 3AMLA 3BC9A 1LL6A 4RE4A 3B9DA 2OYKA 1OGGA 4YN5A 4C7FA 5HPOA 3N04A 1NWRA 3IJ9A 3ZMRA 2GDVA 3VUPA 1JYXA 4FK9A 4BCEA 4XZWA 1EO5A 3N13A 5CSUA 3AMKA 2RGMA 5A2CA 2WMFA 4W7UA 1RD6A 3BMWA 3ZO9A 3CHFA 5CPSA 3WUBA 3CGTA 3PZVA 4N42A 5IFTA 1LJYA 3POCA 4P8VA 1KQYA 1AVAA 5A6LA 2XIBA 4UOQA 3PZUA 2QMKA 3ZT6A 1B3XA 3CLWA 1UWSA 1W9XA 2ZIDA 3WUEA 1HXJA 2BVTA 4HU8A 1V3IA 3N15A 5FL0A 4HZ7A 2WYSA 3CZJA 5DMYA 4X0NA 1BGAA 4Z2JA 1OD0A 3WQ6A 4HPHA 1W2PA 4JL1A 4D6EA 2CEQA 4MPKA 4GO8A 4JFSA 3RMEA 2D0HA 1JNDA 1E0XA 3PZNA 4HA4A 1HN1A 1E71M 1EOKA 5I77A 2WWDA 3WIJA 1KCKA 4B9YA 1MQRA 3LPGA 1WDQA 3ZQ9A 4AEFA 4WSKA 1WP6A 4NRRA 4OJYA 2DDXA 5E09A
chains in the Genus database with same CATH superfamily
3GD6A 3HZ3A 1VP5A 4ZFMA 1UWRA 4DLMA 3W74A 2P8CA 3ATZA 1DWAM 4F2TA 2WVSA 2DH3A 3AIUA 4PUUA 1LOLA 4QIBA 2WVVA 2OU4A 1EX1A 4ZGYA 5IHSA 2KGJA 1E3XA 2P76A 4QLJA 2BSLA 3ME3A 3UJFA 5G2HA 2RUDA 1NY1A 3LQLA 4MAVA 2HWGA 3LPPA 1PCWA 5C70A 1VIZA 3WQOA 4A6GA 3AIRA 4LAWA 3UJSA 3E2SA 3WELA 2W61A 1REQA 1Q66A 5C7VA 4QE5A 2VEPA 4NY2A 2NVDA 2E09A 1EOMA 3A3WA 1VHNA 4JIEA 1TPWA 3AFBA 3TNBA 4BA0A 4LAUA 2XM1A 4QE1A 4S3FA 1EGZA 1T8XA 4NU7A 3U2CA 2Y7DA 1M65A 1VFUA 1C91A 2VZUA 2PGWA 3HPXA 2G96A 3A6OA 4JTFA 1ZCNA 1KFLA 3L4UA 1GOIA 1NIUA 3SI9A 3RPTA 1K9TA 4D6DA 3TCZA 1XIBA 2XG9A 4TTUA 2PDYA 2BXZA 4PCTA 1UKPA 2VRJA 1NWUA 4ZB5A 3U4FA 2OEMA 4UFHA 3RG6A 4HJWA 3VI2A 3ARXA 1XIGA 2VCDA 1FHDA 4POCA 4O10A 2M1IA 1O5XA 3W87A 5A6JA 1A7XA 1GK8A 5AZ0A 3AMCA 4C65A 4HCDA 4X2RA 3CC1A 1KV8A 3GG7A 1S39A 1LLZA 2VUYA 1SSDA 4IT6A 1VH7A 2XP9A 1W8GA 1IIGA 4H3DA 1UP3A 1KXQA 4G50A 1JF5A 1P7TA 2XYLA 2DZPA 4RJEA 3GY1A 5CZSA 4DM2A 4Q32A 4X2PA 5HUAA 3APYA 3VUSA 4Q8OA 1XG4A 2X30A 3C52A 1M41A 3TZNA 2ISWA 3W6YA 1R3WA 3SFWA 2DSVA 3N2XA 4CNTA 2I14A 3MSYA 4B15A 4IOTA 1C9WA 3U3HA 3CHDA 4NG3A 2OZTA 4RR4A 3NTYA 3VD9A 2GUUA 5DITA 4UFKA 4YVVA 3LSCA 4AVFA 1IR2A 2WVUA 1VFTA 7A3HA 1UZ4A 5K7JA 4AY1A 3BOFA 3QXBA 1XP3A 3A64A 5HDRA 2VOMA 3L23A 3OGVA 4C90A 3NEVA 4W84A 3MMUA 3B8UA 4IT1A 4HIBA 4BF7A 1YDNA 3W53A 1KBKA 4ZXOA 4HT3A 3LLXA 4AZGA 4HYRA 2G3FA 3ITLA 4XAYA 2CLOA 3DFNA 2D9FA 2C18A 2PB1A 1OIMA 3ZOAA 4L65A 1THFD 1UA3A 3EKZA 1W56A 2ZUMA 4FZIA 4LY8A 3LGDA 3IV8A 1NEYA 1CTNA 1ICPA 3MUAA 4Q8WA 1Q6QA 5A6KA 4QJ4B 1QK2A 2ZUNA 7ODCA 4RL3A 4G2DA 4CD6A 3O1NA 3CMFA 1RCXB 3L4VA 4O4WA 3G22A 3CUZA 1JZ3A 4ENLA 2RH9A 2YB4A 4F79A 3ZSTA 2OT1A 2TRSA 3M4HA 2RDUA 3EOOA 3DDMA 4AF0A 2ZZ1A 3DX5A 1J6OA 3LDVA 3WK3A 1PZ3A 3M0HA 1R9ZA 2Y85A 4AZ5A 1XLLA 3ZSSA 4JFWA 1MW3A 2Z27A 5H8MA 4Y9AA 4NIRA 3VFLA 4PGLA 4C6CA 1JQVA 1UZHA 3WFLA 4BF8A 1FD9A 4GNVA 1S5NA 4Q4RA 1E1EA 5HJLA 4Y9OA 2QJNA 1VF8A 3AZSA 2HRWA 4ES4A 2WMJA 1IZJA 3GG0A 2XVGA 1UKOA 1X96A 3TAOA 4UR8A 2CLEA 1IWPA 2LPVA 4QG8A 4E8GA 2D73A 2ISDA 3VMPA 5E0KA 3S5SA 1K9DA 2PWUA 1KGUA 2E25A 2QUTA 2OKTA 4JY9A 3KOYA 2HTMA 4XAFA 3W71A 4AISA 1MYRA 5MKGB 3EA2A 4GMEA 1Q6RA 1Q6OA 2V9DA 1O6IA 3URAA 2Q8ZA 2OELA 3HIJA 1W1PA 1SJCA 3LOTA 5G5IA 4IQEA 3TOPA 4O1CA 1M3UA 1JIBA 1LWJA 4Q4KA 2VWTA 3SECA 4HOWA 1H62A 4Y6GA 4FR1A 4MADA 5GNXA 3R13A 1L8PA 3PWIA 4JCMA 4ZR8A 3TE9A 2CZ5A 2EQDA 2VC7A 3FGCB 5E6ZA 3ANYA 3LZ3A 4XV0A 3W25A 2NX3A 4TVDA 3IJQA 4DZ2A 2ZFAA 1HXVA 1XM3A 1UASA 1Q2SA 1VCVA 3CT7A 4S2CA 1F2JA 4KEZA 1RPXA 4I8YA 3BLFA 5FF0A 4IWWA 1YADA 1LL7A 2X16A 1P6CA 3GR7A 1LYXA 1DJHA 1TCDA 3Q67A 3E96A 2PRHA 3C56A 2XU2A 4PTMA 4O52A 1DP0A 3KCOA 2TMDA 5C71A 1U33A 1OZMA 4DWDA 2YX0A 2WQPA 4M51A 4JEQA 1RA0A 4MJ4A 4HZ6A 5HWMA 1RJQA 3UYCA 3R0UA 4KETA 3VIKA 3TSBA 5M1TA 4JFMA 2WLYA 3P93A 7ENLA 3MUZ1 5AYIA 3W7DA 3LPFA 4MG4A 3DHFA 4AYSA 3H2OA 5REQB 2WZMA 3EEZA 3CEPA 3EA1A 4HD5A 7PTDA 5HUPA 4PL2A 4ZCWA 1GTEA 3O5PA 4AMCA 1NAL1 4E2OA 3CHCA 2JQXA 1A0CA 2D3NA 5H6HA 3WBAA 2GFTA 4FS9A 1J6PA 2W79A 3OU8A 3QF0A 1RPKA 4D8AA 2VENA 1Q4NX 3DYPA 4D1IA 2W66A 1J96A 2B7NA 2X0HA 1TRDA 4UMBA 1EDGA 1QBBA 1XD1A 2VR4A 2KE0A 3RILA 1HIZA 1AJ2A 4U3AA 1YQ2A 4JKLA 1M68A 4DRMA 1DKWA 5CXPA 1RZMA 5HA7A 3IJ6A 4ZQCA 4HNUA 5DMLA 3QPEA 3B7XA 1XV8A 4UFLA 2IKJA 3PS7A 1UR2A 1WZAA 1V3HA 5A69A 3W26A 3ITVA 5DF0A 3N3TA 3KBSA 3VKAA 3GH7A 1NP0A 2D1ZA 4IIDA 1R9YA 1K4HA 2VUNA 1CYGA 2VCAA 3G1SA 3S3GA 4AC1X 1E5NA 5FOOA 4HYVA 4AIBA 4LUYA 4G7FA 5I6SA 3QOKA 3UYIA 3GYEA 1IEWA 2IXUA 1W17A 2GQ8A 1EIXA 3M0JA 4Z2HA 3KUMA 2NUWA 3THUA 4CU8A 3Q37A 3SFKA 3SCQA 3L5MA 2J8FA 3C3NA 1IX5A 4QLKA 1NOWA 3PG9A 3IK4A 4LTSA 3CH9A 1CXIA 2E28A 3UI5A 1WKEA 4FNUA 4JXCA 3NPUA 3W1NA 2OLSA 3PB2A 1ONXA 3SCRA 4K1GA 1UR4A 3P81A 3RN6A 1OZQA 4R0XA 4DZ3A 2GQ3A 2Y70A 1HP5A 3IGSA 3M0YA 5D38A 4CKQA 4H7ZA 1NWSA 2LGOA 4KEVA 1B3WA 3TQ0A 3ZJ8A 5AYYA 3MV01 5HMFA 2YL6A 1AL7A 4QT3A 1B1YA 4IPLA 2X2GA 3A23A 3KABA 3SSZA 5JIPA 1TELA 4UTLA 2DW6A 1KC7A 3ARSA 3OGSA 2GOKA 3S2JA 1H7NA 2AMXA 3THDA 3LGEA 1HKMA 2B81A 5EFDA 1V08A 3VD4A 3PM6A 4Q8VA 3A4JA 3NPXA 2R24A 3BG5A 3HPAA 4G1NA 3NQ7A 5D2VA 3W2KA 4N19A 5M5DA 1F6PA 4QJ1A 4A3HA 3HBLA 4HN4A 2Z2UA 4ROPA 4NNAA 4PE8A 3W1QA 1BVWA 4PBEA 1V03A 5T9CE 1ZJBA 4H9MA 3FNDA 3EAUA 1H7OA 5KTLA 5E6YA 1FKTA 5JQ9A 3PRAA 4GZIA 2P10A 2QJJA 2ZUUA 4FPSA 1W37A 1NM9A 3NQCA 4ZODA 4H41A 3VM5A 3RRXA 2B5UB 4U3CA 5I3FA 1G9HA 3MB9A 4V27A 3AU2A 5AC7A 3W02A 3HPSA 3W7KA 1QO2A 2VEFA 5A2BA 2PDWA 5CQ1A 3I6CA 3UG3A 3QGKC 4IPIA 1NP2A 6ALDA 3ERPA 1IEVA 1B6CA 3HU7A 3I7QA 2PF8A 3NQVA 4X22A 3RR4A 1PKMA 1PIGA 1LZOA 2RUQA 1W6TA 2VDGA 1XLJA 2E6AA 3CUHA 1J9YA 2VDIA 1J0ZA 2REQA 4F9JA 3NQGA 1WV2A 3OEXA 4A8LA 3WJYA 1O68A 4GFIA 3QYSA 2EG8A 5D37A 2X1IA 3IIPA 1HKJA 2EG6A 3RXZA 3NL5A 4KF1A 4JOMA 2RGLA 3M0LA 2PU1A 2CCRA 3SCSA 4QS5A 1XBZA 3ONBA 1GOWA 1YX1A 5K2ZA 4K1WA 3RU6A 1X6UA 1GONA 3RPDA 4LAVA 3UESA 2XJ7A 5ABFB 4M1RA 1J12A 2HROA 3NUKA 3H7VA 1Y7VA 4JIQA 4IJBA 4BQ3A 3JUGA 4I5RA 3JR2A 5K4ZA 3FV9A 4IJCA 2WNWA 4E38A 1E15A 3CAWA 3OOQA 1O5QA 3QOMA 4UTMA 4H01A 3SCPA 1B57A 1PL9A 4CU7A 1M7XA 2GJPA 2HK0A 3PN8A 4WXYA 3UJRA 2BY1A 3KS6A 4G56A 5AC4A 1AQHA 3VX0A 1H61A 1GZ1A 1K4GA 1WDRA 3PR2A 1SVDA 3TC3A 3GYCA 4ZQNA 4I7WA 3GXTA 4W9PA 4WDXA 2C15A 5H8PA 3D5HA 2DSKA 1SSGA 4JTSA 3M7WA 4E2BA 1Z48A 1XQLA 4LX4A 4HHLA 3G1AA 1G4PA 4AD1A 2MLZA 3PJXA 1QDSA 3QHMA 2HJPA 3TTQA 4XUYA 3VZXA 3VPLA 1DJWA 1ZAJA 3SGGA 2XSXA 3IJIA 2ZVIA 4GGBA 2AGKA 3WLRA 1SO6A 3NPVA 3FHQA 5FIPA 2DGAA 3GTIA 3QV6A 1HT6A 4CN4A 3ZR5A 1W5OA 3UXKA 1XWYA 4QG9A 3IUHA 3WQFA 3P60A 1MUMA 4OIFA 2OX4A 2R9RA 3LG3A 3RIKA 5LNSA 2UBPC 1W9UA 3MI3A 2PGEA 3WLNA 2YLLA 4JQ3A 2ISSA 1R87A 2IUZA 3U4AA 2JE8A 1IXQA 4W9TA 1Q63A 2V30A 2V68A 5TQLA 1H63A 5LIKX 4MNKA 4F66A 3OZOA 2DSZA 5AVHA 1C9HA 3OZYA 4D6CA 2EJAA 3VKBA 2YYTA 4D71A 3IANA 3UWYA 1I0BA 2DZVA 1PUDA 2WQDA 2ODOA 4GYPC 4IQ2A 4YIWA 1JNTA 1J0KA 3WF3A 3L2LA 4JZ5A 8A3HA 4PUDA 3URQA 4AH7A 1AG1O 1SJAA 1WYIA 5G1TA 2WSQA 2G3NA 1L1PA 2YDQA 1NVMA 3H6OA 3O07A 3S1XA 3PZOA 2V67A 3UF9A 3QR3A 3FVMA 1P0NA 2HZGA 3T05A 4CCDA 5I3JA 4NJGA 3H54A 2E4TA 4JTRA 5CJMA 1L8NA 2AMGA 1BTCA 1Z3NA 3N2TA 2INZA 2J25A 3SR7A 5F7UA 2ZX5A 1DPMA 5D33A 1UYQA 1S38A 3IPWA 2X0YA 2M2AA 1NTHA 1EWEA 5HULA 1R46A 1SO4A 3P84A 4QIUA 1XLAA 3MSGA 4H1ZA 1LOQA 3IIVA 1P0DA 4JTDA 1WZKA 4ZPVR 3TEVA 1ZENA 1ME9A 2HS6A 3BO9A 2J78A 4JTIA 4J3XA 3PZTA 4KFOA 4DRPA 1C92A 3JVAA 3I3DA 1PDYA 2V2HA 3PJWA 2FH8A 3W7MA 3L65A 1SUXA 1OFEA 1SJBA 1E72M 4DROA 1KLYA 1EJWC 1H1NA 4Y9PA 1S2AA 5K3VA 1WDSA 1QO5A 3RX3A 4RX0A 5DRIA 1XSJA 1LLWA 4JTHA 4WK9A 3W1TA 5HK4A 4ALDA 3F2CA 3AS1A 1GEHA 5LGXA 1H4PA 4F0LA 3E2VA 3MC5A 3GIQA 2UZ9A 1UWUA 6ENLA 4LBUA 3A4AA 5HKGA 4GQBA 3MJMA 4AU0A 3HOJA 1K70A 4HZ8A 5GVJA 2XVPA 3URNA 1TWWA 1YDVA 3SJNA 1KB3A 5F4SA 4DBEA 3LM3A 1U83A 1JEZA 3DIPA 4HOZA 1E40A 4J40A 3UQNA 3DCPA 4ERIA 1ISZA 3W7IA 3LHTA 4LQ1A 1QOXA 1YPFA 3CK5A 2IMRA 2IKGA 3T4WA 3HQNA 2BZNA 3W82A 4KGLA 2PMQA 3U7BA 5G1MA 2Z24A 4BHYA 4UR7A 3WQ8A 3UR8A 4ML9A 3W7JA 3KBMA 4L6OA 1ITXA 1OQFA 3H4GA 4O54A 2D2OA 3W1LA 2Y24A 4J9JA 4NXSA 4L9YA 1DHKA 2NV1A 4IMAA 2CLKA 3PUDA 3UETA 2V8ZA 3SY8A 5M3WA 3DFYA 3S6TA 3ABOA 1PHWA 3RUBL 3G1DA 4DN1A 2OSYA 2TYSA 3VIMA 1UB3A 1ME7A 4H8HA 4Y9MA 1M1BA 3FOKA 3L9CA 2VGIA 4R9XA 5CH9A 4TQTA 4PH6A 3KWSA 2E3ZA 3W7LA 2ZA2A 1OK6A 5GPRA 4B5TA 1LBMA 2VKZG 4FOJA 4UZSA 1PKNA 3V75A 4GQQA 5I3HA 1AJZA 3L4WA 5IFPA 3QH2A 4E3VA 3GBEA 1JF6A 1XJBA 5D2XA 2CLFA 3I4KA 1JFHA 5A6AA 1FKKA 3NL2A 2XSAA 2PV3A 1XDJA 2ISVA 2ZYFA 5A94A 5LA1A 3B0VC 1CLXA 3GAYA 3WEMA 3H55A 1DXEA 3VKDA 4MB4A 1CLKA 4UTWC 4NX0A 3CT2A 3LHUA 1GHRA 2OQLA 3GX9A 4ODQA 2D23A 2ZC8A 1UR1A 2HBVA 6CGTA 1SGJA 3W2JA 3V4BA 4G8TA 1J0JA 2CKRA 3EPOA 3WZ0E 3AXHA 1V4YA 1VS1A 2J74A 1SZNA 3OVPA 3SGUA 1I2PA 4XTIA 3TYDA 4QEHA 5K9DA 1A4MA 1YW5A 3VGHA 2JKPA 3O2LA 2DVTA 4GC3A 3NQ2A 4C5YA 2V5JA 4WUIA 3WQEA 2QGYA 3U9IA 1VFOA 1K7EA 1TYGA 1LBLA 1P4CA 1ZNNA 1EDTA 2PDJA 2G3JA 5HW8A 2YDAA 5I3GA 3VDGA 1PIIA 1E6RA 5DBTA 3B0UX 1VFHA 1IXNA 2OEJA 2R14A 2ZZ4A 3L2MA 2BNJA 1GWJA 3SUUA 1OX6A 3QHNA 1NU5A 4AAJA 4NASA 5IM51 4ICCX 1FKSA 2YIHA 1FDJA 3MYOA 1H3GA 1XD0A 4DIPA 2CBIA 3ARZA 3RK8A 2ZR5A 2X09A 3MWAA 3OLGA 2FZ9A 3W29A 3MS8A 3W7EA 5HNUA 2PDBA 3QSTA 1VBRA 2I1OA 3L68A 3FJLA 3KACA 4FX7A 5BMXA 1D9EA 1OC6A 3GK0A 1UG6A 2PDCA 3BAIA 3UNTA 5L9FA 4OOZA 1E73M 2WHJA 2BOGX 4FLQA 3INPA 4N9EA 2MANA 4WGXA 2ACRA 3OBKA 3ZIZA 4MWAE 1YPXA 2HISA 3FYYA 3GVRA 1TTQA 4GUHA 3UGRA 1QR7A 4S3AA 3NI6A 1UWAA 4ACZB 3TVAA 4HYWA 1XISA 1V6TA 4A3YA 3BWWA 4I7UA 4NZ1A 3NZPA 4NILA 3PA7A 1BWKA 3AWOA 4OGZA 2BXVA 3MV11 4TMBA 4I9TA 4B3LA 3WMCA 3TFCA 3TN4A 3TC7A 1QPKA 3OZMA 4ZB0A 4GZEA 2DIJA 3L67A 1U79A 4NXKA 5CAKA 4NYYA 2YCIX 1I2RA 4S39A 3O5DA 4JTKA 3S2MA 2XH7A 1KFJA 1KXTA 4KQNA 4BI6A 3F4WA 4EP8C 1VFFA 1Q6GA 1XLKA 4M1BA 3T2OA 3GW0A 3O15A 3LRLA 1XH0A 3LBMA 1QAPA 4B4HA 1ZJIA 5KZEA 4LYPA 1JAEA 5KETA 4AWEA 2KI3A 1FHVA 1W3HA 3NR0A 2Q5AA 3VC6A 2D20A 4N02A 1EGVA 5BMWA 1B4EA 4UFIA 2PP3A 4LVGA 1B0IA 1ZAHA 1QJWA 1AQ0A 1PINA 4RE0A 5F2MA 1I2OA 3VNJA 3PUEA 2PC8A 1EC7A 3RM8A 4OWGA 1MWOA 4YHGA 1SJDA 3WG6A 1X1NA 1SYTA 2C7FA 1YHTA 3B8TA 1MZRA 3ABSA 5B7ZA 1ZPTA 4FNSA 3E6EA 1QBAA 4JEJA 3ALGA 4L4MA 2FGZA 4H8UA 2PC4A 2CU0A 1RBAA 3M0ZA 5HWCA 2QDHA 2V5LA 5E9XA 2PD5A 4EX4A 2TSYA 4MM1A 4UCFA 5JH1A 1CGVA 3IIXA 1RQBA 1UWIA 3TCSA 2WCAA 3V0SA 6XIMA 3M9YA 2Y62A 5M03A 5CZTA 1NWTA 3P8IA 3DG6A 3CL6A 3FDKA 1RLCL 1O94A 2AL1A 2Y5SA 2FKPA 2W63A 3KCLA 4ZMGA 1O5RA 5A6SA 5A6TC 2V5KA 3OGRA 1EQ3A 4G7EB 3EBVA 2IS7A 3E49A 2G41A 4QJ5B 1W31A 3WENA 1GOQA 1ISWA 1JZ7A 3G1VA 4R85A 2NT0A 4ATDA 5A95A 3SCTA 4GABA 3VINA 2OWCA 3JYJA 1JI2A 3W7OA 2AL2A 2VZTA 1EZWA 1QVBA 1UUQA 1TFVA 3KOZA 1K3UA 2PSNA 4KWSA 3LI1A 4NZCA 4IX0A 3P0XA 4HMCA 5HBFA 3SUSA 3SCVA 1A3XA 4XQ6A 2EHHA 3K2GA 3ZWSA 1UWQA 1B3ZA 4PA8A 3K1DA 5FSEC 3HQ1A 2WMIB 1CDGA 4IHCA 2PPGA 1TPVA 3WX7A 4DQWA 3P3BA 1NDYA 3NXFA 3APGA 5LNVA 1CGWA 3LTPA 4JTTA 4MKNA 1JQXA 2EPLX 4XSMA 1LL4A 3UWZA 4FF5A 3R4IA 1BXNA 3AIBA 1RVKA 2CKSA 3NGJA 3VDAA 5CG7A 1Z69A 4QITA 1XW8A 2YA1A 4S3EA 1V8EA 2OG9A 4J1OA 3VNZA 4XK2A 3IKDA 3EMZA 3VOCA 2P5NA 3AXKA 3AZRA 2ITKA 1QPNA 4K6AA 4S3JA 3A47A 4EPDC 4WQ6A 3T0TA 1F05A 1Y5XA 3IVUA 3ZVIA 3VNDA 5I03A 3HV8A 4XZBA 2DUZA 1G67A 4DRKA 3I3BA 2XIQA 3GVQA 4S38A 4UTJA 4FX6M 1G5AA 3FSUA 1BKHA 2Y8UA 3MSDA 3P7YA 3UCDA 1EEXA 2VYOA 4QEEA 3TW7A 2OO6A 4UB9A 4NQ1A 3S5NA 1A5NC 1EJSC 1E6PA 1KXHA 5E9AA 4QHRA 2WJFA 2PV1A 4AZ6A 4E0CA 2OMAA 3AZTA 3W1AA 2G97A 4AX7A 2UV8G 3QBUA 2QJMA 1UR0A 3QGVA 2IKIA 3ALFA 2HNEA 2EPOA 4GINA 3MDWA 4QXIA 3P80A 3QMRA 3K30A 4P8WA 3DXIA 3CZLA 2EEXA 2HXTA 4GZ7A 3L5LA 3SO7A 1LDCA 4U33A 3VC5A 3VNKA 3HGRA 2G0WA 2YBVA 4JIHA 2DVXA 1V79A 2VMFA 4PMYA 5EMMA 2SFPA 4GRSA 2ZQUA 3GTNA 2HPIA 3BZGA 3CQIA 3VYLA 4RE4A 4PCPA 2FFCA 3QTPA 3HJZA 3HURA 5IBXC 2C3ZA 2ZRYA 4BJHA 3Q2DA 4YN5A 4C7FA 1U5HA 3W1PA 3QM3A 3N04A 1NWRA 3IJ9A 1PYMA 2VP8A 1JYXA 3ABRA 4XZWA 4GYKA 1NSJA 3WJXA 4JX5A 4JICA 2AQOA 4H9XA 5CSUA 3WBYA 1FQ0A 5A5WA 1VZWA 3O5QA 5A2CA 2WMFA 3FFSA 2NX9A 2RKXA 4AVOA 5HAOA 3W9ZA 4DO6A 4N42A 1F8IA 5IFTA 4RXGA 4P8VA 4F48A 3UVAA 1HTIA 3W7PA 1K77A 5K9CA 2H8XA 4GQ0A 1UC4A 4HK6A 5A6LA 1EL3A 4GI4A 1B3XA 3HG3A 1XIDA 1DYSA 1FWHC 2RFGA 4UWMA 4ZO8A 3SIZA 4HU8A 1V3IA 3ITCA 4BFAA 1DIOA 1XYBA 5DMYA 1BGAA 3HG4A 3LTSA 5LIUX 4Z2JA 1OD0A 4LCRA 2EF9A 3EOEA 1HKVA 4KFPA 3RCYA 2C1IA 4HPHA 1PCKA 1UBSA 2CEQA 4RLIA 3RX2A 2PDFA 3SRHA 3RMEA 2FZBA 1JNDA 3TU9A 3PZNA 1EOKA 2IQDA 1DQXA 3ZQ9A 4O11A 3W7GA 4NRRA 3S9ZA 3I6RA 3ANVA 3S2LA 2DDXA 1JGMA 3IHZA 1PX3A 5AC8A 3DZ1A 2VM8A 1E4IA 3NQFA 1AFSA 2OPJA 2G3IA 3GXNA 4XAZA 3JS3A 3A4XA 5A8PA 1H2JA 4Q3MA 1SFLA 5LKYA 2C13A 3N6QA 2VWSA 3O0FA 2FPVA 2PP1A 4PMXA 3UI4A 1XUZA 1XBVA 2P4VA 8XIMA 1FWAC 1FY6A 1DJZA 4LUSB 4KKXA 1OEPA 3KVKA 3W83A 2PU0A 4UIOA 2WMHA 3TXZA 3MDUA 4KERA 2Z29A 3LRKA 5IOBA 2X7VA 3R43A 4J35A 2YKKA 3CASA 4ZEPA 3VOIA 1EH9A 4CUCA 4MHBA 3THAA 5AC6A 1QNSA 3HPZA 4YWIA 1B2YA 3F5KA 2DP3A 1OYCA 2POZA 3BMXA 3SRKA 4LSBA 3VIOA 1PB0A 3PNUA 4GA8A 4W8BA 3VE9A 2Y89A 3M6DA 2HDJA 2NLYA 5DCEA 4BEUA 4AHQA 3GZAA 1VJZA 4QR6A 3M07A 4E3TA 3FAPA 1ZCOA 4HBOA 1KTNA 3T0CA 3G0UA 3OTRA 4DELA 2H3BA 2ZQ0A 2FYMA 3CXOA 4NNCA 3NIYA 3GC2A 3B97A 4OV4A 4MFEA 4TU1A 3FA5A 3OG2A 3DERA 4I9MA 2QZRA 4NZ3A 4Z08A 3IIOA 3WD4A 1GYNA 4UTTC 1RHCA 1UKQA 5DXYA 4P8XA 4BZYA 3T40A 1BWVA 4FNPA 2YLAA 1AW5A 4FLOA 2I17A 3T42A 1KFWA 2F38A 3BUVA 4IL0A 2ONEA 1GQJA 3GDRA 2E1WA 1G4SA 3N17A 1JGIA 5C55A 3LX9A 4QROA 5CGQA 2ZKMX 4LY4A 1KBLA 1VRXA 1SFJA 3WDRA 4QP0A 1BF2A 1NDZA 4MUPA 1KGXA 3QKZA 2VO5A 3W1RA 3U57A 3NQ6A 4KR0B 1S1RA 3W7RA 3NQMA 1QRQA 3A13A 3D46A 4TIMA 5D09A 1S5MA 2NSOA 4WCJA 4K7YA 3HQOA 4TXEA 4A29A 3CHVA 1E4LA 5CKSA 3CNYA 3OOBA 3LCIA 3KRBA 1UD4A 4PUJA 1W1TA 2I16A 3RNDA 1D7JA 4RUBA 1QW7A 4DRSA 4L4PA 4MDPA 2Y63A 4LC8A 5KSWA 4ZZ9A 3IUIA 4LAOA 1W3TA 3G5EA 4B5VA 4KS0A 2JIWA 3HJEA 3NM3A 1OY0A 4IXHA 3E2RA 4MKVA 1G01A 4LEQA 5CPLA 4MAZA 4PMQA 4PYSA 3LS9A 4PUNA 3MANA 4IXXA 3UQBA 3R8GA 4PODA 3WCZA 3MPGA 2WWCA 1OFAA 3MVTA 1WKYA 2JEPA 2ZR4A 4CD5A 1IYXA 2C91A 2GDQA 3F4VA 3WQVA 2GWGA 4C1NB 4TW6A 2B0MA 3DEQA 1SW3A 3GM8A 1W9BM 4UMAA 3VOGA 2JKAA 1U1UA 3TN5A 3EEGA 2GVGA 3BXWA 4XBJA 1X1OA 3JYMA 2GDUA 4ASTA 3EY6A 2AQWA 2P88A 4RW3A 3O5KA 2OXNA 4PCNA 3BK0A 2WSPA 1B4KA 4TV6A 2ZE3A 3AXIA 3GNPA 3V5CA 1FBAA 4MZ1A 1IZKA 4GLEA 3IAQA 1YATA 1R7OA 3BLKA 4ZE5A 1H0GA 4NAEA 3KS5A 4WOZA 4DX3A 2X0SA 3WH6A 1ROUA 3F4DA 5CZJA 3STCA 2N87A 3VGDA 1G1YA 3PWGA 1V7YA 3T44A 1U30A 3VXGA 3AHXA 4QGCA 4R27A 2BBFA 5I7GA 1NF0A 3VMNA 3OYZA 1EWDA 4GKTA 1ZZMA 3WNMA 3NXLA 4DJEC 1BRLA 3H7UA 2V81A 1JXJA 4DM1A 4GNJA 5F2GA 1NQ6A 1H51A 3IVTA 3EX2A 4ATWA 1OWQA 1HL2A 3SJ3A 4XWUA 3STEA 4N4QA 3FS2A 5T8GA 2OO0A 1D3GA 4WKFA 1JCNA 1P6WA 1QNQA 2A3BA 4FOUA 5U7SA 3EWXA 4IPPA 3O05A 4W89A 4XAGA 1RVGA 5IDIA 4PRWA 3S83A 3TLQA 3SRFA 3CV7A 3ELFA 4A3RA 5C9RA 1MDRA 3IJ8A 1LLOA 4MKSA 1YPIA 2CBUA 1EO7A 2BX7A 1UD3A 1Z32X 4PRRA 2H8ZA 2XM2A 1GQLA 4NJIA 1LF1A 4GVIA 3V1PA 5HT1A 1OF8A 3NEHA 3UT0A 2QEZA 2BDQA 3O5RA 1UH2A 1K02A 2I57A 1YBQB 3EWWA 4IGSA 2PTYA 3CAKA 2O9PA 3ARUA 4JN7A 4D6FA 3LA4A 4CVUA 5HMDA 1SW0A 1GKQA 3PR9A 4BF5A 2BG5A 3KTSA 4D6GA 1MNSA 1KFKA 2GQ9A 4X60A 3CAQA 4JNMA 4EOUA 1BFNA 1XIFA 1M5YA 2O7QA 1X39A 3PTMA 4IMGA 3AYSA 4B5SA 2WKLA 2O9RA 2Y7GA 5JBEA 3B0PA 3CBWA 2PWDA 1V02A 2CESA 2WM1A 3MO4A 3C2RA 5D32A 4H8VA 3NG3A 3ZM8A 5FF7A 3S2NA 4RK8A 3CUFA 3VOJA 1EB3A 3IJLA 1XLGA 4C6DA 1B54A 1QU4A 2FGBA 2VR2A 4IG2A 3EDKA 5H8UA 1ME8A 1T7LA 1M04A 5A1AA 1E1CB 1QW8A 1VEPA 1H7XA 5DLCA 3LCWA 5I3IA 3WQWA 1B3VA 1CPUA 2G4JA 3W70A 2X8RA 1GW1A 1CXLA 5C2CA 1ZL1A 5EMKA 3MTWA 4TYOA 3W6LA 1RUSA 1EXBA 5HWJA 3M7SA 2A6LA 3SW6A 4EAYA 2CXGA 4MY1A 4U2ZA 5I23A 5AKQA 4KPLA 5D9NA 4MUZA 2BVWA 1FCVA 3DOPA 4AWTA 4Z17A 2FPYA 4XAPA 4XB3A 3AXMA 4PMUA 2QJHA 1TA3B 4L64A 4M29A 2VFHA 2QIIA 4GH1A 2CLPA 5AN7A 1QTWA 2XP6A 1ZP4A 5B7YA 3TR9A 3GIPA 4AY7A 5TIMA 3UZWA 4RPQA 4LYKA 1CXKA 4XO7A 4WKHA 3W2LA 1F3TA 6REQB 3SCOA 3GDLA 3B3DA 4FXJA 5EMJA 2QGHA 3LXBA 2CZVA 4ACYA 2V82A 3UP8A 3WJSA 3TKFA 1A5AA 2QV4A 1V0LA 3PANA 1TE6A 2QAFA 3LERA 3ZR6A 3DGBA 1JL8A 3FJ4A 3G6LA 2TPSA 2KAUC 5BZAA 4U86A 2W27A 4N4PA 2QUNA 3RPMA 4UNIA 3KRSA 3TN3A 5CC3A 1YMYA 3A21A 4EXQA 5G1YA 1H7WA 3OLEA 3GB6A 1SZRA 2GSHA 4N2YA 1HJQA 3TJLA 2XP8A 1V3MA 4OU1A 3WUGA 3VIFA 2QT3A 1RBOB 3EWCA 3H70A 3N29A 1YBQA 3DYOA 4JDYA 5DCDA 4ODNA 1DJGA 3NDZA 3DFHA 4GVGA 3S2CA 3QQ0A 1TE1A 1HUVA 4KT2A 3M0XA 4Q8PA 1ICSA 1R85A 2VX7A 3TOYA 1UP0A 2V3DA 4JYFA 4AD4A 2X2YA 1OFOA 2PCQA 4PMVA 3NNTA 3O9NA 4G2PA 4NX5A 2PDGA 2L2SA 3DBNA 5BOOA 2WSKA 1JVWA 2EPNA 3RCNA 1W54A 4HQVA 4GBUA 3WDIA 3RM4A 4LWWA 5BXSA 3C61A 3S5YA 4RZ5A 2A0NA 4AZCA 2E6DA 3R0DA 5D2YA 3S9YA 2Z1WA 1OCJA 5A8OA 3AWNA 5DQPA 4H6RA 3FY1A 3GSMA 1XBYA 1LWHA 1G94A 3LCGA 2PZNA 4N9CA 4HK7A 2O4QA 2VX6A 5FJOA 1FDYA 4V15A 1W5PA 2J9ZA 1GZGA 2WHKA 2OVLA 4LCSA 4JL2A 1PV8A 2ZZ2A 3MP3A 5BU6A 2H9AA 4DBWA 4ODMA 3GFXA 4F2UA 3LNMA 4M7TA 2ZZ7A 2PWVA 2GLKA 4L80A 2GOUA 8RUCA 4FEZA 1D8CA 4IMFA 2QXWA 4C6KA 3GIYA 1WKDA 4IL2A 2CERA 3MJYA 1EUNA 4PMOA 4C91A 3C86A 1D7FA 2HVOA 3OVRA 4DZHA 1D6OA 1V3LA 4L5ZA 2PDIA 4PUMA 3W76A 5E1QA 6REQA 3EGJA 4WJEA 3BDKA 1UCWA 2VFGA 2XWEA 2BV9A 2NVAA 3PBYA 2BB0A 1QUMA 5FJJA 1GZJA 4ADTA 4TX6A 2VVSA 1F07A 1DL3A 3R5EA 1MI3A 3FIGA 3R6IA 1KT0A 1XPGA 3AIWA 2DPEA 2FB3A 1GTHA 5GNZA 1KM1A 2JF6A 1B90A 2K8IA 4W7WA 2WBKA 1TUXA 3S9IA 3I7SA 2DZSA 2CETA 3VDBA 4QCFA 3UW6A 3TMLA 1Q6IA 3T8LA 3WLJA 1QFEA 4ATLA 1F40A 4UTFA 2FFIA 3PZQA 1L0PA 2O9OA 4E4FA 1TV5A 3TR2A 3WNNA 4PTWA 2BXYA 2RDXA 4JGDA 2DUAA 3GS6A 4Q4PA 5KITA 3PZMA 4Q7NA 1Y0OA 3GDTA 3EOSA 4EXAA 3K4AA 4MSPA 3O3RA 1PXGA 1L9WA 3H2FA 1DEDA 3V35A 3K4DA 3QW4B 3TH6A 4TNSA 1XCWA 3BSHA 1GKRA 2F6XA 3B4UA 5BW6A 4W93A 4HK5A 2WHLA 2XN1A 2ATSA 5AYXA 1SR0A 1M7OA 5EKYA 2WKGA 3GHRA 2ZTKA 3NPWA 2R8WA 5CSSA 7CGTA 4F2BA 3IIZA 3PJTA 3W1XA 2OEKA 4ODRA 2VQUA 4RPPA 4XZ9A 4KBXA 2G5WA 2Q02A 1PS9A 4AQLA 3UXLA 2JGYA 1LCOA 1L2UA 2BY3A 3CPGA 3HG5A 3L4TA 2F21A 2INEA 5AYBA 3TQKA 4HN8A 2MNRA 5AB3A 3UVIA 3G6MA 2AWGA 1AW1A 1ADSA 3CIWA 1IGSA 1Q2RA 1FX6A 3E74A 1RCQA 1VR6A 3ZT5A 3NCOA 2HS8A 2NXGA 3RF9A 1FKWA 1YTDA 2Y7EA 4KCTA 5B80A 1BL4A 3N1AA 2A79A 1KFCA 1GQKA 2CPUA 1QT1A 5CLTA 3EXTA 3NO1A 5CAHA 4UTUA 3KEHA 1IE7C 1ECQA 3L21A 1OJXA 1ISVA 1O5KA 4HNNA 2PRLA 4FN2A 4Q6XA 4GK8A 4V1YA 1Q6DA 3ZWTA 1HJWA 3KAOA 5ECVA 4AFYA 3DH7A 3AU6A 1UPMB 3EMCA 2ZZ3A 3CU2A 4LEFA 3NO5A 2X41A 3GUWA 3PBMA 2ZICA 1FHLA 1PZ2A 1JYWA 3N12A 1Z7AA 1FKBA 3UG4A 3WBWA 4FI4A 4YTUA 1TRIA 3Q4DA 4RNJA 4LH8A 4JTLA 5ABTA 3ID7A 3W24A 3A4WA 4RE2A 4O4VA 1EA9C 1UBPC 3RITA 1OF6A 1LBFA 1TPFA 4MOZA 1X7IA 3OPSA 3IACA 3Q45A 3KRUA 4JTAA 1WB0A 3OVGA 4O13A 4Y7EA 3BQ5A 4JN6A 5DN1A 4JX4A 3W1MA 3USZA 5KMYA 2HVMA 1VPYA 2RJGA 1LRQA 3BW4A 4MY8A 5DT7A 1F3XA 4PULA 2F84A 3WNPA 1FDZA 3QFEA 3NSMA 2VOTA 3VK5A 1OGSA 1UKSA 3TYUA 4GNKB 4HNOA 2J77A 1MRAA 3TAKA 4P2VA 5M17A 2VX4A 1GJWA 3QV9A 4J5NA 3MZNA 3KDNA 2J6XA 4XVEA 2DZXA 3M0VA 3UG5A 1XH1A 1A5KC 4ZE4A 3PF3A 2XIJA 1TUFA 3M5XA 4GY1A 1AD4A 1Z9AA 1EBGA 1SZFA 1XYFA 1E6QM 1UOKA 4JTEA 1HW6A 1GG0A 1I4NA 1AD1A 1AUSL 3TXVA 3C5QA 4LNCA 4S3KA 4RNFA 5D30A 1Q13A 4QTGA 5EMUA 4WY0A 4HMNA 4LBSA 4D6IA 1QPLA 3O63A 3I68A 1XH2A 3V16A 1W3NA 3D47A 1BF6A 3DFSA 4DUXA 1FKXA 1LUCA 2UY5A 5EMYA 3M6YA 3RAOA 2Z1SA 4YYFA 2RDWA 2YCLA 2VNCA 3BLDA 4MWAA 1OM0A 4IIHA 3UBPC 3CAVA 2F2KA 4ZBCA 3FKKA 2GQAA 4I3GA 4K2SA 1CWYA 3FLUA 4B2DA 4JQ4A 4C6EA 2J7HA 1PWMA 1V6XA 3AMGA 2NQLA 4M6UA 4ITZA 1XC6A 2VEIA 4NZ4A 1EJ7L 3CGMA 1OX4B 4C6PA 4E6MA 4U10A 2CLMA 2R1KA 1I1WA 5DCBA 3TW9A 3TK7A 5HJYA 5IRPA 1AJ0A 1L6SA 3IJDA 2V63A 1DWHM 1TV3A 1YEYA 4GIYA 1K7XA 3W01A 2WSYA 1YKWA 4K7VA 3OBEA 8TIMA 1QI0A 4UBPC 1H09A 4R7JA 1ZB5A 1REQB 1DWJM 3MWCA 2QF8A 1AL8A 4QCEA 4XBKA 3W73A 1QWGA 1VEOA 1JUEA 3TCEA 1VJSA 2QDGA 1XRSA 4JQ2A 1UR9A 3EYPA 3WQGA 3DAQA 3LENA 3T0BA 3EX6A 2CLIA 5CSRA 1E5JA 1BAGA 4J7RA 3R10A 1E0UA 3ONCA 4YXGA 1PX4A 1UW9A 2OGYA 2X1SA 5JIWA 1JNEA 2VC9A 3FVDA 2DEPA 1HF6A 1GRJA 1KNWA 2DFAA 3C4UA 5CPQA 4WDUA 1AMKA 2I5IA 3AIVA 9CGTA 4GY0A 1A49A 4A2SA 3CUIA 5AFDA 4OECA 5FCZA 1F61A 2PDKA 3N6HA 2PGFA 5HUOA 1Y5WA 1OC5A 3HTWA 3KVJA 2PRMA 4DO5A 3FYOA 3DI1A 1LQAA 1EC8A 1RQHA 1ISXA 2WPBA 4NSBA 4MY9A 4CNPA 2OFNA 2MUCA 2PN0A 1QNVA 4DH0A 1HVQA 2QCFA 7XIMA 2PP0A 1KTCA 4KCVA 3F5JA 2EJ1A 1R9HA 3GKFA 1NFPA 1XX1A 4I5XA 2A85A 2R1PA 4DXKA 4DWSB 1KRMA 2OQYA 3CYVA 4JHOA 1PBKA 4OFCA 3P61A 2ISFA 2QCNA 2OODA 1R30A 1JD9A 1FWDC 4S2BA 2XVLA 5G2WA 3TUUA 4PTXA 1IR1A 2BS9A 1Q3NA 4C02B 3HN3A 1RA5A 1Q85A 2NV2A 3H26A 3T2QA 2WM0A 1P7TB 3KL0A 5CPMA 4TMCA 1S2VA 3MW7A 3M43A 4EAMA 4QDPA 4GXPA 2OWXA 1HKIA 3MVIA 2HK1A 4PFHA 3UU0A 1TVNA 1ECEA 4DJFA 2XFFA 2J7CA 3A3HA 3QKEA 3DG3A 2B4GA 1LORA 3BARA 3QZ6A 4L1GA 3NYZA 1VYPX 1MXGA 3BSMA 1OX4A 2J62A 3VVGA 1AQFA 2ALRA 3FK4A 1SQ7A 1ITUA 2A4AA 4ZPWR 4H9TA 4A3QA 1HJXA 3WDPP 4LUTA 4G5DA 4MWAD 1SPQA 2YL9A 2CBJA 3BJFA 1EPXA 3PBUA 3G1RA 4B2DD 2YA2A 1VENA 2FQIA 1JPKA 1RALA 3CQKA 3E0LA 4AD0A 1F6KA 1JNSA 1KWKA 3PZ9A 1DV7A 3SCUA 2MPHA 1JCHB 4AC7C 1GOOA 2A3HA 3TTEA 3PBGA 5CBJA 2XGIA 1EXPA 4L1WA 1UH3A 3VOFA 4LFYA 1FWIC 1HNYA 4F0SA 3P8JA 2OSXA 3TSMA 2DZBA 3FAWA 1W0MA 3MMTA 3CYJA 5DELA 2VFIA 4F0RA 3NRKA 1WOAA 5I2UA 5I06A 1EP3A 2I9EA 5XINA 2ZQVA 3G8EA 3I6EA 5E93A 2D2JA 4UQBA 4JFVA 3MKCA 3TC6A 2J7GA 3D3AA 4AF0B 2PV2A 4PTVA 1KTBA 3BVJA 3UG8A 3UWWA 4C7GA 3N2OA 3DKJA 1B30A 2PDXA 4FHAA 1EDQA 2EAWA 4WZHA 1VPQA 1IF2A 1J5SA 1QI4A 1UKTA 4RNHA 3HGSA 1SU5A 2BTMA 1N82A 1KT1A 1Y65A 4J3TA 4QAWA 3TA9A 4UTHA 1XIIA 4DUOA 4DWSA 4GVHA 5ENLA 3WEZA 1FFQA 1W3KA 2GVJA 1W5MA 3GH5A 4KCWA 4LT9A 3TMQA 1AH4A 2ZX7A 4GUFA 4QT2A 3IGUA 5CZ0A 1ITQA 4NVTA 2DIKA 4HA3A 3GU2A 2XFWA 3P2VA 2X05A 1E0WA 2NXHA 3II1A 3GG1A 3NURA 1DE6A 4AX6A 8CGTA 2RJHA 2B7OA 1T11A 2IPWA 4S3GA 2DH2A 3B40A 4P7NA 3QW3A 4FLRA 3WLSA 1AK5A 4MVAA 1KM4A 1UROA 3ITXA 3KZ7A 1XLDA 4Z1YA 2R91A 1BHGA 3RHGA 3AMDA 4DUWA 2DZWA 1E0TA 2ZUSA 5EYWA 3MHFA 2FDMA 3VZYA 4AUBA 3CO4A 3L0KA 1KWGA 2MLXA 1VBHA 2WHMA 4DJDA 4O16A 4CD4A 3ZFHA 1WDPA 4DJFD 4IIFA 4R88A 1B3YA 3WQCA 1JCJA 4PFMA 5BU9A 2DQWA 3WUFA 3BURA 1ONEA 4JTQA 1U2YA 3S5ZA 1GQIA 1S2UA 3PPCA 1OYAA 3IVSA 4U5IA 3HA1A 3LK6A 4M6QA 1OG6A 2F23A 5G4EA 2QCMA 2Z2AA 3PUOA 4TVUA 3R8RA 4MJ2A 3AYRA 2OLHA 2OOGA 4O53A 4XZIA 2KZHA 3WBEA 4PB5A 3IK8A 1KM5A 3UPBA 3L4XA 4I9AA 1JZ6A 3OLDA 1OFRA 3QMSA 1E70M 3QPYA 1VBUA 1VCGA 4W9OA 4MJMA 5F1VA 3SAZA 5I02A 3S46A 4K36A 4R9OA 5A6BA 4ZTYA 4JTGA 2UWFA 1ELSA 3B9AA 2P3EA 2DT3A 4BQ5A 1Y5VA 4DI8A 3MY9A 4J4NA 1JI1A 4S3BA 3KP0A 1P5BA 2XZ7A 4Q4SA 3KL5A 3RMJA 4D6HA 1CX9A 4YHEA 4JAWA 3WF4A 3MI6A 3SIMA 5K4XA 3BLOA 1VB9A 5LHFA 1JDEA 2XVKA 3UZ5A 4H8NA 1A53A 3I10A 2FKEA 2XH2A 4AWUA 2FMNA 2YCKX 3MMWA 3V0UA 3ZLGA 1F3WA 1BG9A 3W38A 5I79A 1TWSA 2FTPA 1UD6A 4GCAA 3G77A 3H12A 4L9XA 1ZBCA 3U2ZA 2XGZA 1J6YA 3VNIA 4X3ZA 1CEOA 4AD3A 1OHLA 2W5FA 2IQTA 3SUTA 3SEPA 3W86A 5C2GA 1DOSA 1F73A 1MUCA 1IZCA 2G50A 1E0VA 1A0EA 1LTDA 1MEHA 3B03A 1LROA 3N25A 2QDEA 2Q3RA 2QIWA 5FEXA 2JFEX 4DAFA 3F2BA 4ZSUA 1WZMA 1Q6EA 2QQ6A 1KGWA 1XRFA 4CVWA 4DWSD 4DZ5A 4ZS6A 3C0SA 3KZPA 4ZO7A 5EU9A 1DTNA 5LGZA 1JCMP 4AEEA 2UZ5A 3GVVA 3UY8A 2FVMA 3U5YA 1WAWA 5JU6A 4O2TA 1RSCA 2HEJA 1UQYA 4QRNA 4WGHA 2B7QA 4QNWA 1TIWA 1WXJA 4L4OA 2M08A 1T8QA 4GXMA 5T91A 4OZOA 1JFXA 5A3HA 3O0KA 3HM7A 4WLCA 2Z28A 3W00A 3MA8A 1FWFC 3PNZA 4MF4A 3NA8A 1TPEA 1N8WA 1GNXA 1NMWA 2YDSA 4DJDD 4DPQA 2BODX 4QSHA 4MB5A 1HQTA 4I9JA 2YFOA 1VYRA 2PLJA 2VI0A 2WV8A 5DY3A 2XN2A 3ABZA 1US2A 3CJPA 4B16A 1V6UA 4CLMA 2CZEA 2V5DA 3VIPA 3KAHA 1IHIA 1TV4A 3M46A 2XIOA 4GI6A 4S23A 2FVLA 2DUXA 3CIVA 4CQCA 1C9DA 2FH6A 3C0JA 3LGGA 2PBCA 3ORWA 3SQLA 3VU2A 4NT0A 3GVWA 3KBNA 2FTYA 4IFOA 3L66A 4J4KA 1A5SA 2WCGA 4ICNA 3KADA 4FXFA 4NJKA 5FJPA 5BRQA 2EPMX 3LCFA 4AVNA 3NQBA 5A6BD 4RDYA 1V6WA 4EIVA 1S3HA 4C6FA 4QDMA 1OINA 5F2IA 3AMLA 4CQ9A 3BC9A 2Z25A 4H9ZA 4DF2A 1HKWA 2C19A 4FX8A 4ZA0A 1J4IA 5HPOA 1E9IA 3ZMRA 2GDVA 3S0CA 4JIPA 4FK9A 2NX1A 2ZDSA 2ZZ6A 4X61A 3PSVA 3PFRA 2C0AA 1TO3A 4W7UA 4HBEA 1TPUA 4M0XA 3CPRA 2E77A 1LJYA 1JRCA 3POCA 4PUWA 4XKYB 3UWVA 4UXDA 1I6NA 2OZ0A 2BOEX 4UOQA 3PZUA 2QMKA 1FKHA 2YYUA 5GPGA 2X1RA 2ZIDA 3WUEA 1HXJA 4JR5A 2ZBTA 3N15A 5FL0A 1EGMA 1XIEA 4HZ7A 2REQB 2WYSA 3N9SA 2XIMA 1I60A 1KV5A 5HMEA 1TPB1 4MZYA 3K13A 1J2WA 1ZAIA 4D6EA 4Z0SA 2Y88A 4GO8A 2O55A 4YNGA 1NMVA 6XIAA 1D3HA 3C2FA 2ZTJA 2EKGA 1DJNA 3F2DA 4BWLC 3RFWA 3NFUA 1XYAA 3GQYA 4QSFA 4GQGA 2CHNA 3XIMA 3PY2A 4ODOA 3B8IA 1FCQA 2YJQA 2XP4A 2DT1A 4MNJA 2ASHA 3C8FA 4CCEA 3N11A 3F1QA 2C8NA 2C6QA 1E9YB 5EY5A 1T5AA 4XD4A 4W9QA 4IP5A 1ODZA 1XYCA 4TO8A 4M6VA 1KKOA 3M41A 2Z1VA 1Z41A 4C6QA 3O5JA 4OVXA 1SM9A 2BP1A 4RCXA 4KWVA 4N6FA 2Z6JA 5DRCA 1KW1A 2H90A 1FA2A 4JDBA 3M64A 1FCUA 3BGGA 2OWWA 3EOLA 3TTYA 3PVFA 2OB3A 3C2OA 5A6MA 1TJ1A 4LRTA 3PPHA 3WH9A 4HPNA 5T9BG 1QW9A 5EB8A 3V0TA 3T81A 4FXSA 4D9PA 1IGWA 4NZJA 4PN2A 3M44A 1CB2A 3R79A 3BLIA 2QULA 5LIYX 3LHVA 2GUBA 1GPFA 2EG7A 2GJLA 2XP7A 3EX4A 3WLTA 3NYDA 4Q8MA 5XIAA 1P0BA 1DVJA 4H00A 1WAUA 5A2AA 5FL1A 2ACUA 4KWWA 1F3EA 3DC0A 1CZ1A 5AHMA 4XKYA 3OODA 3MCMA 3IARA 3LI0A 1XDLA 2IPFA 3CS2A 4IPJA 3U5UA 4GE8A 5JH8A 4YPJA 1J0HA 2DIEA 2OZ3A 1ZBKA 4TV5A 3B8VA 4I6KA 4FALA 2EXOA 3OIXA 2HV5A 2GGGA 1F9CA 3CO8A 4DF1A 1F4AA 3MYPA 4EANA 3RX4A 1YNYA 4EK7A 1I9CB 5D2TA 5A8GA 2NQHA 2Y1HA 5JXQA 1IXPA 4H9YA 1FWCC 4IGHA 1XG3A 4IMCA 3S1WA 3H7RA 3LY0A 3R94A 3GU1A 4UFJA 4DNHA 3DGRA 5PTDA 3LCXA 4BI5A 4TUFA 3W22A 2QUUA 3GXFA 4Y96A 2PTZA 4Z2GA 3E3HA 3CUGA 1W9PA 4P7QA 1T41A 1FWGC 3J7HA 1KO0A 3CB3A 1ZQ5A 3UCCA 2J4GA 2BHUA 4HTYA 2DG9A 4LAKA 1PSCA 3QC3A 5HW6A 2FMOA 1I8JA 4TX9A 3BAXA 1DHPA 1GQNA 4Q8QA 3K5XA 3LNPA 4M7SA 4I8DA 2W91A 3ZYZA 4O1EA 1CCWB 1W1ZA 2E68A 1Z6KA 3A3XA 2DV0A 4CCCA 3FEMA 1XFBA 3K1GA 1ZY9A 4RZ4A 1QI2A 2NZLA 4Y90A 1O7AA 3CUXA 1BWLA 3WJZA 1KM3A 4ERGA 1MQPA 3RCMA 3RU8X 5AVNA 3KXQA 3PK7A 2CLHA 3FW6A 4Z1BA 3KDOA 4QQ3A 4CN1A 3FA4A 2PPPA 3POHA 5TAOA 3TWBA 1NDVA 2P1FA 3KZSA 2E8ZA 3WH5A 4HNLA 1LOSA 4ZQMA 1AMYA 4GVFA 4HKPA 3AI0A 3BJSA 3O6CA 1EF3A 4L4LA 4R33A 5HINA 1GVEA 4F3HA 5KINA 4RDZA 4BF9A 5HNTA 1TQXA 1JCTA 4QG6A 3G1FA 3MKVA 2WNQA 2C71A 3H4XA 4WEVX 5F1UA 4Z1DA 4F4RA 4LYQA 3T78A 1EEPA 1GEQA 2GGHA 4RKAA 4LUIA 2QUMA 1ZJAA 1EHAA 1RLDA 1PO9A 1GKPA 3U8GA 3D0CA 3PRDA 3LYEA 4PSRA 5F4WA 1TQJA 3BL3A 2VD8A 1XKYA 3ECQA 5I98A 3KAGA 3IJ7A 3SUWA 3I6TA 3UNDA 1NH6A 4GOAA 2INFA 2ZADA 2J9XA 3MBFA 3XINA 2KR7A 3FKRA 1W2VA 4PL1A 4ZFCA 4C6BA 2UY4A 3TA6A 2WJEA 2E0PA 2HMCA 1X98A 3AJXA 1FUYA 6PTDA 5AHFA 1RXOB 4Y9NA 3CWNA 4IGNA 4P7OA 3A12A 3CQJA 1GVIA 1KA9F 3UZYA 4C1KA 4TVCA 4B5UA 3URBA 1V6VA 2PF0A 4E4UA 4MIMA 3C2YA 3S1UA 2PA6A 2H6RA 3VIGA 3FDGA 4GQRA 1KKRA 1US3A 4ZQPA 5FACA 3TP4A 3CMGA 3QRHA 3PG8A 3JXVA 3MUXA 1KCXA 1X7FA 4FA3A 3W84A 3N9KA 2YBUA 1XIHA 2IQ0A 1XPYA 1E4MM 2F6UA 4J3ZA 2FZMA 2VT0A 5RUBA 3WMSA 1KRAC 2Y78A 2EO7A 1TMHA 4AMAA 1S5TA 2VELA 3OBAA 4QBXA 5BOFA 1JPMA 2J88A 4L6DA 3MI2A 4PCSA 1JPIA 5BXJA 3LHZA 1VFMA 1EYEA 3QZAA 1O12A 4LOCA 1E9ZB 4ODPA 3NVDA 2UY3A 3W28A 4PC8A 2XFYA 2F4EA 1F8AB 1ZBWA 3WMBA 1P5QA 4FMVA 2XZ9A 4EPKA 2R1MA 1GG1A 1C8YA 1Z44A 4JFTA 4DAIA 5DMMA 4GX8A 3VAWA 3LMZA 2V38A 4ZB2A 4J2PA 3PBWA 3TDFA 3BW2A 4I7VA 1QATA 1BQGA 2VURA 1M6JA 3AJ7A 3C3UA 3LUTA 3HPFA 1J93A 2CXEA 5DT5A 4W8LA 5D8WA 4IP4A 2PDMA 3LCLA 2BGQA 3KFTA 3NSXA 1A80A 1F6YA 3VA8A 5HJXA 1XLEA 1FH7A 1PX8A 1H11A 1XICA 1FKJA 3JZEA 3R12A 1TPDA 4TW8A 3LB0A 4HCHA 4LGXA 5CBBA 4EWND 3W1UA 3SY5A 2GSJA 1H49A 3ITTA 1UHVA 4PMNA 2CZDA 2GJXA 2J75A 1VLIA 1PBGA 2Z4GA 4E2DA 1A47A 5AZ1A 2WZTA 1JDFA 4R5EA 4ODLA 2BHZA 2QUVA 1GT8A 4LF1A 1CB7B 2D2HA 1TPC1 3VIJA 3UZJA 3WEOA 3AROA 1R2SA 1LRTA 3NQEA 1GCYA 4YMZA 7REQA 4EPBC 4KWOA 3WO8A 5J04A 3GDKA 2DG4A 2BHYA 2YCEA 1EP1A 2VFFA 1MZHA 1W3JA 2P0OA 3ES8A 2EULA 3B8SA 1MUWA 6TAAA 3OQ8A 1EJRC 1W5NA 3T1GA 3WNOA 1KM6A 2FHFA 1TMLA 4PUEA 5CC7A 2EPKX 2FHBA 3TYBA 1EP2A 1TV2A 4LPCA 4JKKA 3VCCA 1MMFA 2PUZA 4Q4OA 2FGLA 2CNCA 4GYPA 2F9RA 1IEQA 4FOKA 1JZ2A 4JYSA 1TVPA 4IIBA 4FSAA 1C7SA 2QCCA 4GYFA 4V2XA 2ZWZA 5D2WA 4AG0A 3ARQA 1QI3A 4CD7A 2YFNA 1IT0A 3VTRA 3AUOA 4FNRA 5KZMA 1OT2A 1V0MA 3SCNA 3UA4A 2W9MA 1T99A 4JS3A 3W7QA 4B5XA 1ALDA 4HMEA 1DBTA 4YYCA 3UWEA 2QCDA 2G8ZA 2J24A 1WX0A 3UJEA 2E5DA 3A5VA 3AISA 5HNRA 1JJKA 3KRZA 3WLPA 1LG2A 1XLMA 3R2GA 1XFCA 2Q8LA 1KRCC 4AZ7A 1J8VA 4HMDA 3T07A 4JTCA 5I78A 3G1XA 1KQZA 4IFKB 2VVNA 1AODA 3VFCA 2E8YA 4UOZA 4C7DA 2V5CA 2PBOA 3O5LA 2ZRWA 5ECUA 3GBDA 1M7JA 2E5CA 4EF9A 4Z42C 3VGBA 3T08A 3NAVA 4UQAA 4C6LA 2PPOA 3TSDA 1KR0A 1UIOA 1DJYA 1VQTA 3C6CA 3ENLA 5CZKA 1GOKA 3PUGA 2VCCA 5CGTA 2A7PA 4Z2LA 1K8YA 3RLUA 1T6MA 5D02A 1HGYA 4XBSA 1J01A 3WLIA 3UGVA 4IH3A 3B06A 5HTGA 4OBSA 4LANA 2PEVA 3QY6A 4H83A 2Q3OA 1E43A 1RQEA 3PPFA 5CPNA 3DFTA 4ILSA 4K3ZA 4OV9A 4RDWA 3EA3A 4UCGA 4B92A 3F4CA 1QNPA 3N73A 3QV8A 1MVYA 5AYZA 1XGDA 4O1AA 4NNBA 3W0KA 3ARPA