2KGJA

Solution structure of parvulin domain of ppid from e.coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
TQPQRTRYSIIQTKTEDEAKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSGVIKSSVGFLIVRLDDIQAAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase D
publication title The prolyl isomerase domain of PpiD from Escherichia coli shows a parvulin fold but is devoid of catalytic activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 102
sequence length 102
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2kgjA00
3TCZA 3O5GA 3KAGA 2PV1A 4ITZA 4W9QA 1JNTA 3O5DA 1HXVA 4DRHA 2N87A 2XP6A 3UI4A 2KE0A 3UI5A 1NMWA 4DH0A 5HUAA 1C9HA 4DRMA 1ZCNA 4ODOA 3NTPA 1J4RA 1FKIA 1M5YA 1BL4A 1KT1A 4IQCA 2FKEA 1FKGA 2PPNA 4DZ3A 4DZ2A 5I98A 5DIVA 1D7HA 4JYSA 4ODPA 2RUDA 3O5MA 2XP9A 4O2TA 3CGNA 1D6OA 2M2AA 2XP7A 3MDYB 1FJDA 2OFNA 4G50A 2Q5AA 4LAXA 5HTGA 1T11A 1J4HA 2F21A 1FKTA 1FKHA 1BKFA 3KABA 3KAHA 4LAYA 4TW7A 4JFIA 5D75A 3KAIA 4DRJA 4DROA 1J4IA 5J6EA 2LPVA 1W26A 1Y0OA 2XPBA 5HWCA 4JFKA 4DRQA 2KI3A 1FKDA 2KR7A 2M1IA 1ZK6A 5HKGA 3TDBA 1NSGA 3IHZA 1Q6UA 3O5RA 4ODKA 2UZ5A 2ZR6A 4LAWA 2JZVA 4DRIA 1PINA 3RGCA 3O5FA 1JNSA 3GPKA 4JFJA 1JVWA 1FKRA 2MLZA 1KT0A 4FN2A 5HW7A 5HT1A 4R0XA 2ITKA 5B8IC 4BF8A 2RUCA 1U79A 4DRPA 2ZQUA 3O5JA 1QPLA 4GIVA 4J4OA 3IK8A 3KAFA 4TYOA 3KACA 4U84A 5GPGA 5BXJA 1EQ3A 1YATA 3O5EA 1P5QA 2ZQSA 2LGOA 4QT3A 1QPFA 3O5IA 1D7JA 3IKGA 2MF9A 3JXVA 4ODQA 4TW8A 1FKFA 2XP3A 3ODKA 3CGMA 3UI6A 4J4NA 4U85A 4FAPA 2ZR4A 3I6CA 2M08A 4G2PA 4N19A 4TW6A 4DRKA 2DG4A 1TCOC 3JYMA 2PBCA 2LKNA 2PV3A 1FKBA 2VN1A 4ODRA 4TNSA 3O5PA 1FD9A 3UF8A 3B7XA 4JFLA 2Y78A 3WH0A 1B6CA 2XP5A 4QT2A 2L2SA 4NNRA 2RUQA 2D9FA 2LJ4A 1Q1CA 1YW5A 2MLYA 2XP4A 2DG3A 2KFWA 3IKDA 3JYJA 3O5QA 4DT4A 4U86A 2RSEA 4W9OA 3UQAA 2KGJA 2ZQVA 3TC5A 4DIPA 5HWBA 4W9PA 2IF4A 4DRNA 4ODMA 1Q6IA 3VAWA 1ROTA 2K8IA 3EY6A 3KCEA 1L1PA 3PRBA 4ODLA 1FKSA 1NMVA 3H9RB 2ZR5A 1QZ2A 4MGVA 3OOBA 4TX0A 2XPAA 4QIBA 3RFWA 2F2DA 2DG9A 2VCDA 1FKLA 4ODNA 1R9HA 2PPOA 3LUOA 4IQ2A 1D7IA 1J6YA 2PV2A 3FAPA 2KO7A 1A7XA 2MNTA 2MLXA 3NI6A 1FKKA 2ZQTA 5DITA 5HW6A 1EYMA 3UQIA 2FAPA 4GGQA 3PA7A 4IPXA 1Q6HA 1ROUA 2PPPA 5HW8A 5DIUA 4LAVA 2RURA 3O5LA 3KADA 2AWGA 2F4EA 1FKJA 1F8AB 1N1AA 2XP8A 4C02B 3NRKA 1FAPA 4MSPA 3KZ7A 4JFMA 3O5OA 3UQBA 2MPHA 1F40A 3PRDA 3O5KA 2RQSA 1PBKA
chains in the Genus database with same CATH superfamily
3KAGA 2PV1A 1SR0A 5HUAA 1HJVA 1W9VA 4MNLA 1ZCNA 4ODOA 1J4RA 1FKIA 1KT1A 1FKGA 3FXYA 5I98A 4JYSA 4ODPA 2XP7A 4G50A 1FKTA 2DSUA 1LG1A 1FKHA 2OLHA 5J6EA 4DROA 4DWSD 3QOKA 4ZS6A 4ODKA 2ZR6A 4DRIA 3RGCA 2PI6A 1FKRA 4LGXA 1XHGA 1EIBA 5HT1A 1GOIA 4R0XA 3WQVA 2ITKA 5B8IC 1WNOA 1W1VA 4DRPA 4J4OA 3O5JA 3RMEA 5BXJA 1E9LA 3KAFA 5GPGA 1P5QA 1QPFA 1D7JA 3JXVA 1HJXA 3PR9A 1W1PA 4Z2LA 3I6CA 2DG4A 1JNEA 3ARZA 2PV3A 1LJYA 4W5UA 3O5PA 4P8XA 3UF8A 4JFLA 2Y78A 1B6CA 1E15A 4QT2A 4NNRA 2RUQA 1YW5A 2MLYA 2XP4A 2DG3A 2KFWA 1WB0A 3G6LA 4U86A 1E6ZA 4MAVA 4W9PA 2IF4A 1OGGA 1NMVA 1ZU8A 1KFWA 2QF8A 2ETNA 4MGVA 3OOBA 3WD3A 1HKMA 4ZPVR 2DT1A 2XPAA 1R9HA 3RM8A 2B5UB 1HKIA 1A7XA 1FKKA 2FDMA 1NH6A 3O5LA 2YBUA 1HKJA 4JFMA 3ARVA 1K9TA 3O5OA 1LG2A 1ITXA 4ITZA 2EULA 3O5DA 2O9OA 1NMWA 1TFVA 4DRMA 1GPFA 2FKEA 4DZ3A 5DIVA 1D7HA 3WD0A 3O5MA 1LL6A 4O2TA 1D6OA 1JNDA 3MDYB 4LAXA 1T11A 1JCHB 4P8UA 4LAYA 4P8VA 4JFIA 5D75A 3KAIA 1W26A 4JFKA 4DRQA 3ARYA 1FKDA 2KR7A 2M1IA 1NSGA 4LAWA 1ZBWA 1PINA 1JNSA 3O5FA 1VF8A 4JFJA 1OGBA 1KT0A 2WLYA 3CZ8A 1W9PA 3GU0A 4HARA 4BF8A 4ZPTR 1W9UA 3CHCA 2ZQUA 3IK8A 3WD1A 3O5EA 3AS0A 2ZQSA 2LGOA 3WQWA 3IKGA 4ODQA 4TW8A 3CGMA 3UI6A 4WIWA 4J4NA 2ZR4A 2M08A 3WL0A 4MPKA 1TCOC 2PBCA 1X6NA 2VN1A 1FD9A 5DO2A 4WKAA 2XP5A 5DF0A 2PN0A 1Q1CA 3O5QA 4DT4A 1GUVA 2RSEA 1H0GA 3UQAA 2ZQVA 2DSZA 4DRNA 4P8WA 5JH8A 2K8IA 3EY6A 4ODLA 2B31A 3H9RB 4IT6A 1QZ2A 3WIJA 3RFWA 2DG9A 1FKLA 2PPOA 1NWRA 3LUOA 4IT4A 1WAWA 4URIA 4L3NA 2KO7A 3NI6A 5HWBA 5HW6A 2ZQTA 3OA5A 2FAPA 3GTYX 4GGQA 3AROA 1ROUA 5HW8A 5GPRA 3B9EA 1X6LA 5DIUA 2DT0A 2RURA 1SYTA 4C02B 2YBTA 1FAPA 4MSPA 4Z2JA 4Z2GA 1F40A 3O5KA 3O5GA 4WJXA 3RM9A 1NWUA 1JNTA 4Z2HA 2N87A 3ARPA 3UI4A 2KE0A 3UI5A 3B9DA 5HBFA 1C9HA 3ARQA 3NTPA 4IQCA 2PPNA 4DZ2A 2RUDA 2XP9A 2OFNA 5HTGA 3PRAA 1J4HA 3KAHA 4TW7A 4ML4A 1J4IA 1Y0OA 5HWCA 2KI3A 1E6PA 1E6NA 3ARRA 1ZK6A 3TDBA 4L72B 2DT2A 2UZ5A 3CH9A 1HKKA 3GPKA 4Q7NA 3B8SA 1OWQA 4FN2A 2RUCA 1UR9A 4TYOA 1QPLA 1LL7A 4QT3A 3O5IA 4S3KA 2MF9A 2XP3A 1LL4A 4G2PA 4KR0B 4MNMA 2DSVA 2LKNA 1CTNA 4R5EA 1FKBA 3BXWA 4TNSA 4DWSA 3B7XA 3WH0A 1IX5A 2A3AA 2D9FA 2LJ4A 2WK2A 4WKHA 2KGJA 4Z2IA 2A3EA 3WD2A 4ODMA 1Q6IA 3KCEA 1L1PA 2ZR5A 4TX0A 4AY1A 4S3JA 4Q22A 2VCDA 4ODNA 2DPEA 1ZL1A 3AS3A 2G41A 2PV2A 4MNJA 2MLXA 5DITA 1H0IA 3UQIA 3AS2A 4IPXA 3WKZA 3RM4A 4WKFA 2PPPA 4LAVA 2AOSA 2AWGA 1FKJA 1F8AB 2XP8A 3ARUA 1FFQA 2A3CA 3NRKA 4PTMA 2WM0A 3UQBA 3ARWA 3PRDA 3TCZA 1W1YA 4W9QA 3WD4A 1HXVA 4DRHA 2XP6A 3CHFA 3B9AA 4DH0A 3WL1A 2P4VA 1HJWA 1M5YA 4WK9A 1BL4A 3ARXA 3ALFA 1EDQA 2F23A 1GRJA 2M2AA 3CGNA 1FJDA 2Q5AA 2F21A 5GQBA 1BKFA 3KABA 4HBEA 4DRJA 1NWSA 2LPVA 2XPBA 3ALGA 4UDMA 1UR8A 4MTVA 5HKGA 3IHZA 1Q6UA 3O5RA 2JZVA 1JVWA 2ESCA 3ARSA 2MLZA 2WLZA 5HW7A 1LQ0A 2DT3A 2DSWA 1U79A 4GIVA 1EQ3A 3KACA 4U84A 1YATA 3FY1A 3AS1A 1EHNA 2IUZA 4DWSC 1ZBKA 1J6YA 1FKFA 1ZBVA 3ODKA 5DEZA 3BMBA 1E44A 4U85A 3ARTA 1ZBCA 4N19A 4TW6A 4FAPA 4DRKA 1D2KA 3JYMA 2A3BA 3CHDA 4ODRA 4MNKA 2O92A 4HBOA 2L2SA 1O6IA 4Z2KA 3IKDA 3JYJA 4QZVB 4W9OA 4KQZA 3TC5A 1RD6A 4DIPA 3VAWA 1ROTA 1NWTA 4NZCA 3W4RA 3PRBA 3EIPA 1FKSA 4QIBA 2F2DA 4IQ2A 1D7IA 1XRVA 2G8ZA 4ZPWR 3FAPA 2MNTA 1E6RA 1EYMA 3PA7A 1Q6HA 4NSBA 4XAKA 1ZB5A 3G6MA 1FFRA 3KADA 2F4EA 1N1AA 4DWSB 3CHEA 3KZ7A 1W1TA 2MPHA 3AQUA 2RQSA 1PBKA
chains in the Genus database with same CATH topology
3KAGA 2PV1A 1SR0A 5HUAA 1HJVA 1W9VA 4MNLA 1ZCNA 4ODOA 1J4RA 1FKIA 1KT1A 1FKGA 3FXYA 5I98A 4JYSA 4ODPA 2XP7A 4G50A 1FKTA 2DSUA 1LG1A 1FKHA 2OLHA 5J6EA 4DROA 4DWSD 3QOKA 4ZS6A 4ODKA 2ZR6A 4DRIA 3RGCA 2PI6A 1FKRA 4LGXA 1XHGA 1EIBA 5HT1A 1GOIA 4R0XA 3WQVA 2ITKA 5B8IC 1WNOA 1W1VA 4DRPA 4J4OA 3O5JA 3RMEA 5BXJA 1E9LA 3KAFA 5GPGA 1P5QA 1QPFA 1D7JA 3JXVA 1HJXA 3PR9A 1W1PA 4Z2LA 3I6CA 2DG4A 1JNEA 3ARZA 2PV3A 1LJYA 4W5UA 3O5PA 4P8XA 3UF8A 4JFLA 2Y78A 1B6CA 1E15A 4QT2A 4NNRA 2RUQA 1YW5A 2MLYA 2XP4A 2DG3A 2KFWA 1WB0A 3G6LA 4U86A 1E6ZA 4MAVA 4W9PA 2IF4A 1OGGA 1NMVA 1ZU8A 1KFWA 2QF8A 4MGVA 3OOBA 3WD3A 1HKMA 4ZPVR 2DT1A 2XPAA 1R9HA 3RM8A 1HKIA 1A7XA 1FKKA 2FDMA 1NH6A 3O5LA 2YBUA 1HKJA 4JFMA 3ARVA 1K9TA 3O5OA 1LG2A 1ITXA 4ITZA 3O5DA 2O9OA 1NMWA 1TFVA 4DRMA 1GPFA 2FKEA 4DZ3A 5DIVA 1D7HA 3WD0A 3O5MA 1LL6A 4O2TA 1D6OA 1JNDA 3MDYB 4LAXA 1T11A 4P8UA 4LAYA 4P8VA 4JFIA 5D75A 3KAIA 1W26A 4JFKA 4DRQA 3ARYA 1FKDA 2KR7A 2M1IA 1NSGA 4LAWA 1ZBWA 1PINA 1JNSA 3O5FA 1VF8A 4JFJA 1OGBA 1KT0A 2WLYA 3CZ8A 1W9PA 4HARA 4BF8A 4ZPTR 1W9UA 3CHCA 2ZQUA 3IK8A 3WD1A 3O5EA 3AS0A 2ZQSA 2LGOA 3WQWA 3IKGA 4ODQA 4TW8A 3CGMA 3UI6A 4WIWA 4J4NA 2ZR4A 2M08A 3WL0A 4MPKA 1TCOC 2PBCA 1X6NA 2VN1A 1FD9A 5DO2A 4WKAA 2XP5A 5DF0A 1Q1CA 3O5QA 4DT4A 1GUVA 2RSEA 1H0GA 3UQAA 2ZQVA 2DSZA 4DRNA 4P8WA 5JH8A 2K8IA 3EY6A 4ODLA 2B31A 3H9RB 4IT6A 1QZ2A 3WIJA 3RFWA 2DG9A 1FKLA 2PPOA 1NWRA 3LUOA 4IT4A 1WAWA 4URIA 4L3NA 2KO7A 3NI6A 5HWBA 5HW6A 2ZQTA 3OA5A 2FAPA 4GGQA 3AROA 1ROUA 5HW8A 5GPRA 3B9EA 1X6LA 5DIUA 2DT0A 2RURA 1SYTA 4C02B 2YBTA 1FAPA 4MSPA 4Z2JA 4Z2GA 1F40A 3O5KA 3O5GA 4WJXA 3RM9A 1NWUA 1JNTA 4Z2HA 2N87A 3ARPA 3UI4A 2KE0A 3UI5A 3B9DA 5HBFA 1C9HA 3ARQA 3NTPA 4IQCA 2PPNA 4DZ2A 2RUDA 2XP9A 2OFNA 5HTGA 3PRAA 1J4HA 3KAHA 4TW7A 4ML4A 1J4IA 1Y0OA 5HWCA 2KI3A 1E6PA 1E6NA 3ARRA 1ZK6A 3TDBA 4L72B 2DT2A 2UZ5A 3CH9A 1HKKA 3GPKA 4Q7NA 3B8SA 1OWQA 4FN2A 2RUCA 1UR9A 4TYOA 1QPLA 1LL7A 4QT3A 3O5IA 4S3KA 2MF9A 2XP3A 1LL4A 4G2PA 4KR0B 4MNMA 2DSVA 2LKNA 1CTNA 4R5EA 1FKBA 3BXWA 4TNSA 4DWSA 3B7XA 3WH0A 1IX5A 2A3AA 2D9FA 2LJ4A 2WK2A 4WKHA 2KGJA 4Z2IA 2A3EA 3WD2A 4ODMA 1Q6IA 3KCEA 1L1PA 2ZR5A 4TX0A 4AY1A 4S3JA 4Q22A 2VCDA 4ODNA 2DPEA 1ZL1A 3AS3A 2G41A 2PV2A 4MNJA 2MLXA 5DITA 1H0IA 3UQIA 3AS2A 4IPXA 3WKZA 3RM4A 4WKFA 2PPPA 4LAVA 2AOSA 2AWGA 1FKJA 1F8AB 2XP8A 3ARUA 1FFQA 2A3CA 3NRKA 4PTMA 2WM0A 3UQBA 3ARWA 3PRDA 3TCZA 1W1YA 4W9QA 3WD4A 1HXVA 4DRHA 2XP6A 3CHFA 3B9AA 4DH0A 3WL1A 1HJWA 1M5YA 4WK9A 1BL4A 3ARXA 3ALFA 1EDQA 3CGNA 2M2AA 1FJDA 2Q5AA 2F21A 5GQBA 1BKFA 3KABA 4HBEA 4DRJA 1NWSA 2LPVA 2XPBA 3ALGA 1UR8A 4MTVA 5HKGA 3IHZA 1Q6UA 3O5RA 2JZVA 1JVWA 2ESCA 3ARSA 2MLZA 2WLZA 5HW7A 1LQ0A 2DT3A 2DSWA 1U79A 4GIVA 1EQ3A 3KACA 4U84A 1YATA 3FY1A 3AS1A 1EHNA 2IUZA 4DWSC 1ZBKA 1J6YA 1FKFA 1ZBVA 3ODKA 5DEZA 4U85A 3ARTA 1ZBCA 4N19A 4TW6A 4FAPA 4DRKA 1D2KA 3JYMA 2A3BA 3CHDA 4ODRA 4MNKA 2O92A 4HBOA 2L2SA 1O6IA 4Z2KA 3IKDA 3JYJA 4QZVB 4W9OA 4KQZA 3TC5A 1RD6A 4DIPA 3VAWA 1ROTA 1NWTA 4NZCA 3W4RA 3PRBA 1FKSA 4QIBA 2F2DA 4IQ2A 1D7IA 1XRVA 2G8ZA 4ZPWR 3FAPA 2MNTA 1E6RA 1EYMA 3PA7A 1Q6HA 4NSBA 4XAKA 1ZB5A 3G6MA 1FFRA 3KADA 2F4EA 1N1AA 4DWSB 3CHEA 3KZ7A 1W1TA 2MPHA 3AQUA 2RQSA 1PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCZ A;  3O5G A;  3KAG A;  2PV1 A;  4ITZ A;  4W9Q A;  1JNT A;  3O5D A;  1HXV A;  4DRH A;  2N87 A;  2XP6 A;  3UI4 A;  2KE0 A;  3UI5 A;  1NMW A;  4DH0 A;  5HUA A;  1C9H A;  4DRM A;  1ZCN A;  4ODO A;  3NTP A;  1J4R A;  1FKI A;  1M5Y A;  1BL4 A;  1KT1 A;  4IQC A;  2FKE A;  1FKG A;  2PPN A;  4DZ3 A;  4DZ2 A;  5I98 A;  5DIV A;  1D7H A;  4JYS A;  4ODP A;  2RUD A;  3O5M A;  2XP9 A;  4O2T A;  3CGN A;  1D6O A;  2M2A A;  2XP7 A;  3MDY B;  1FJD A;  2OFN A;  4G50 A;  2Q5A A;  4LAX A;  5HTG A;  1T11 A;  1J4H A;  2F21 A;  1FKT A;  1FKH A;  1BKF A;  3KAB A;  3KAH A;  4LAY A;  4TW7 A;  4JFI A;  5D75 A;  3KAI A;  4DRJ A;  4DRO A;  1J4I A;  5J6E A;  2LPV A;  1W26 A;  1Y0O A;  2XPB A;  5HWC A;  4JFK A;  4DRQ A;  2KI3 A;  1FKD A;  2KR7 A;  2M1I A;  1ZK6 A;  5HKG A;  3TDB A;  1NSG A;  3IHZ A;  1Q6U A;  3O5R A;  4ODK A;  2UZ5 A;  2ZR6 A;  4LAW A;  2JZV A;  4DRI A;  1PIN A;  3RGC A;  3O5F A;  1JNS A;  3GPK A;  4JFJ A;  1JVW A;  1FKR A;  2MLZ A;  1KT0 A;  4FN2 A;  5HW7 A;  5HT1 A;  4R0X A;  2ITK A;  5B8I C;  4BF8 A;  2RUC A;  1U79 A;  4DRP A;  2ZQU A;  3O5J A;  1QPL A;  4GIV A;  4J4O A;  3IK8 A;  3KAF A;  4TYO A;  3KAC A;  4U84 A;  5GPG A;  5BXJ A;  1EQ3 A;  1YAT A;  3O5E A;  1P5Q A;  2ZQS A;  2LGO A;  4QT3 A;  1QPF A;  3O5I A;  1D7J A;  3IKG A;  2MF9 A;  3JXV A;  4ODQ A;  4TW8 A;  1FKF A;  2XP3 A;  3ODK A;  3CGM A;  3UI6 A;  4J4N A;  4U85 A;  4FAP A;  2ZR4 A;  3I6C A;  2M08 A;  4G2P A;  4N19 A;  4TW6 A;  4DRK A;  2DG4 A;  1TCO C;  3JYM A;  2PBC A;  2LKN A;  2PV3 A;  1FKB A;  2VN1 A;  4ODR A;  4TNS A;  3O5P A;  1FD9 A;  3UF8 A;  3B7X A;  4JFL A;  2Y78 A;  3WH0 A;  1B6C A;  2XP5 A;  4QT2 A;  2L2S A;  4NNR A;  2RUQ A;  2D9F A;  2LJ4 A;  1Q1C A;  1YW5 A;  2MLY A;  2XP4 A;  2DG3 A;  2KFW A;  3IKD A;  3JYJ A;  3O5Q A;  4DT4 A;  4U86 A;  2RSE A;  4W9O A;  3UQA A;  2KGJ A;  2ZQV A;  3TC5 A;  4DIP A;  5HWB A;  4W9P A;  2IF4 A;  4DRN A;  4ODM A;  1Q6I A;  3VAW A;  1ROT A;  2K8I A;  3EY6 A;  3KCE A;  1L1P A;  3PRB A;  4ODL A;  1FKS A;  1NMV A;  3H9R B;  2ZR5 A;  1QZ2 A;  4MGV A;  3OOB A;  4TX0 A;  2XPA A;  4QIB A;  3RFW A;  2F2D A;  2DG9 A;  2VCD A;  1FKL A;  4ODN A;  1R9H A;  2PPO A;  3LUO A;  4IQ2 A;  1D7I A;  1J6Y A;  2PV2 A;  3FAP A;  2KO7 A;  1A7X A;  2MNT A;  2MLX A;  3NI6 A;  1FKK A;  2ZQT A;  5DIT A;  5HW6 A;  1EYM A;  3UQI A;  2FAP A;  4GGQ A;  3PA7 A;  4IPX A;  1Q6H A;  1ROU A;  2PPP A;  5HW8 A;  5DIU A;  4LAV A;  2RUR A;  3O5L A;  3KAD A;  2AWG A;  2F4E A;  1FKJ A;  1F8A B;  1N1A A;  2XP8 A;  4C02 B;  3NRK A;  1FAP A;  4MSP A;  3KZ7 A;  4JFM A;  3O5O A;  3UQB A;  2MPH A;  1F40 A;  3PRD A;  3O5K A;  2RQS A;  1PBK A; 
#chains in the Genus database with same CATH topology
 3KAG A;  2PV1 A;  1SR0 A;  5HUA A;  1HJV A;  1W9V A;  4MNL A;  1ZCN A;  4ODO A;  1J4R A;  1FKI A;  1KT1 A;  1FKG A;  3FXY A;  5I98 A;  4JYS A;  4ODP A;  2XP7 A;  4G50 A;  1FKT A;  2DSU A;  1LG1 A;  1FKH A;  2OLH A;  5J6E A;  4DRO A;  4DWS D;  3QOK A;  4ZS6 A;  4ODK A;  2ZR6 A;  4DRI A;  3RGC A;  2PI6 A;  1FKR A;  4LGX A;  1XHG A;  1EIB A;  5HT1 A;  1GOI A;  4R0X A;  3WQV A;  2ITK A;  5B8I C;  1WNO A;  1W1V A;  4DRP A;  4J4O A;  3O5J A;  3RME A;  5BXJ A;  1E9L A;  3KAF A;  5GPG A;  1P5Q A;  1QPF A;  1D7J A;  3JXV A;  1HJX A;  3PR9 A;  1W1P A;  4Z2L A;  3I6C A;  2DG4 A;  1JNE A;  3ARZ A;  2PV3 A;  1LJY A;  4W5U A;  3O5P A;  4P8X A;  3UF8 A;  4JFL A;  2Y78 A;  1B6C A;  1E15 A;  4QT2 A;  4NNR A;  2RUQ A;  1YW5 A;  2MLY A;  2XP4 A;  2DG3 A;  2KFW A;  1WB0 A;  3G6L A;  4U86 A;  1E6Z A;  4MAV A;  4W9P A;  2IF4 A;  1OGG A;  1NMV A;  1ZU8 A;  1KFW A;  2QF8 A;  2ETN A;  4MGV A;  3OOB A;  3WD3 A;  1HKM A;  4ZPV R;  2DT1 A;  2XPA A;  1R9H A;  3RM8 A;  2B5U B;  1HKI A;  1A7X A;  1FKK A;  2FDM A;  1NH6 A;  3O5L A;  2YBU A;  1HKJ A;  4JFM A;  3ARV A;  1K9T A;  3O5O A;  1LG2 A;  1ITX A;  4ITZ A;  2EUL A;  3O5D A;  2O9O A;  1NMW A;  1TFV A;  4DRM A;  1GPF A;  2FKE A;  4DZ3 A;  5DIV A;  1D7H A;  3WD0 A;  3O5M A;  1LL6 A;  4O2T A;  1D6O A;  1JND A;  3MDY B;  4LAX A;  1T11 A;  1JCH B;  4P8U A;  4LAY A;  4P8V A;  4JFI A;  5D75 A;  3KAI A;  1W26 A;  4JFK A;  4DRQ A;  3ARY A;  1FKD A;  2KR7 A;  2M1I A;  1NSG A;  4LAW A;  1ZBW A;  1PIN A;  1JNS A;  3O5F A;  1VF8 A;  4JFJ A;  1OGB A;  1KT0 A;  2WLY A;  3CZ8 A;  1W9P A;  3GU0 A;  4HAR A;  4BF8 A;  4ZPT R;  1W9U A;  3CHC A;  2ZQU A;  3IK8 A;  3WD1 A;  3O5E A;  3AS0 A;  2ZQS A;  2LGO A;  3WQW A;  3IKG A;  4ODQ A;  4TW8 A;  3CGM A;  3UI6 A;  4WIW A;  4J4N A;  2ZR4 A;  2M08 A;  3WL0 A;  4MPK A;  1TCO C;  2PBC A;  1X6N A;  2VN1 A;  1FD9 A;  5DO2 A;  4WKA A;  2XP5 A;  5DF0 A;  2PN0 A;  1Q1C A;  3O5Q A;  4DT4 A;  1GUV A;  2RSE A;  1H0G A;  3UQA A;  2ZQV A;  2DSZ A;  4DRN A;  4P8W A;  5JH8 A;  2K8I A;  3EY6 A;  4ODL A;  2B31 A;  3H9R B;  4IT6 A;  1QZ2 A;  3WIJ A;  3RFW A;  2DG9 A;  1FKL A;  2PPO A;  1NWR A;  3LUO A;  4IT4 A;  1WAW A;  4URI A;  4L3N A;  2KO7 A;  3NI6 A;  5HWB A;  5HW6 A;  2ZQT A;  3OA5 A;  2FAP A;  3GTY X;  4GGQ A;  3ARO A;  1ROU A;  5HW8 A;  5GPR A;  3B9E A;  1X6L A;  5DIU A;  2DT0 A;  2RUR A;  1SYT A;  4C02 B;  2YBT A;  1FAP A;  4MSP A;  4Z2J A;  4Z2G A;  1F40 A;  3O5K A;  3O5G A;  4WJX A;  3RM9 A;  1NWU A;  1JNT A;  4Z2H A;  2N87 A;  3ARP A;  3UI4 A;  2KE0 A;  3UI5 A;  3B9D A;  5HBF A;  1C9H A;  3ARQ A;  3NTP A;  4IQC A;  2PPN A;  4DZ2 A;  2RUD A;  2XP9 A;  2OFN A;  5HTG A;  3PRA A;  1J4H A;  3KAH A;  4TW7 A;  4ML4 A;  1J4I A;  1Y0O A;  5HWC A;  2KI3 A;  1E6P A;  1E6N A;  3ARR A;  1ZK6 A;  3TDB A;  4L72 B;  2DT2 A;  2UZ5 A;  3CH9 A;  1HKK A;  3GPK A;  4Q7N A;  3B8S A;  1OWQ A;  4FN2 A;  2RUC A;  1UR9 A;  4TYO A;  1QPL A;  1LL7 A;  4QT3 A;  3O5I A;  4S3K A;  2MF9 A;  2XP3 A;  1LL4 A;  4G2P A;  4KR0 B;  4MNM A;  2DSV A;  2LKN A;  1CTN A;  4R5E A;  1FKB A;  3BXW A;  4TNS A;  4DWS A;  3B7X A;  3WH0 A;  1IX5 A;  2A3A A;  2D9F A;  2LJ4 A;  2WK2 A;  4WKH A;  2KGJ A;  4Z2I A;  2A3E A;  3WD2 A;  4ODM A;  1Q6I A;  3KCE A;  1L1P A;  2ZR5 A;  4TX0 A;  4AY1 A;  4S3J A;  4Q22 A;  2VCD A;  4ODN A;  2DPE A;  1ZL1 A;  3AS3 A;  2G41 A;  2PV2 A;  4MNJ A;  2MLX A;  5DIT A;  1H0I A;  3UQI A;  3AS2 A;  4IPX A;  3WKZ A;  3RM4 A;  4WKF A;  2PPP A;  4LAV A;  2AOS A;  2AWG A;  1FKJ A;  1F8A B;  2XP8 A;  3ARU A;  1FFQ A;  2A3C A;  3NRK A;  4PTM A;  2WM0 A;  3UQB A;  3ARW A;  3PRD A;  3TCZ A;  1W1Y A;  4W9Q A;  3WD4 A;  1HXV A;  4DRH A;  2XP6 A;  3CHF A;  3B9A A;  4DH0 A;  3WL1 A;  2P4V A;  1HJW A;  1M5Y A;  4WK9 A;  1BL4 A;  3ARX A;  3ALF A;  1EDQ A;  2F23 A;  1GRJ A;  2M2A A;  3CGN A;  1FJD A;  2Q5A A;  2F21 A;  5GQB A;  1BKF A;  3KAB A;  4HBE A;  4DRJ A;  1NWS A;  2LPV A;  2XPB A;  3ALG A;  4UDM A;  1UR8 A;  4MTV A;  5HKG A;  3IHZ A;  1Q6U A;  3O5R A;  2JZV A;  1JVW A;  2ESC A;  3ARS A;  2MLZ A;  2WLZ A;  5HW7 A;  1LQ0 A;  2DT3 A;  2DSW A;  1U79 A;  4GIV A;  1EQ3 A;  3KAC A;  4U84 A;  1YAT A;  3FY1 A;  3AS1 A;  1EHN A;  2IUZ A;  4DWS C;  1ZBK A;  1J6Y A;  1FKF A;  1ZBV A;  3ODK A;  5DEZ A;  3BMB A;  1E44 A;  4U85 A;  3ART A;  1ZBC A;  4N19 A;  4TW6 A;  4FAP A;  4DRK A;  1D2K A;  3JYM A;  2A3B A;  3CHD A;  4ODR A;  4MNK A;  2O92 A;  4HBO A;  2L2S A;  1O6I A;  4Z2K A;  3IKD A;  3JYJ A;  4QZV B;  4W9O A;  4KQZ A;  3TC5 A;  1RD6 A;  4DIP A;  3VAW A;  1ROT A;  1NWT A;  4NZC A;  3W4R A;  3PRB A;  3EIP A;  1FKS A;  4QIB A;  2F2D A;  4IQ2 A;  1D7I A;  1XRV A;  2G8Z A;  4ZPW R;  3FAP A;  2MNT A;  1E6R A;  1EYM A;  3PA7 A;  1Q6H A;  4NSB A;  4XAK A;  1ZB5 A;  3G6M A;  1FFR A;  3KAD A;  2F4E A;  1N1A A;  4DWS B;  3CHE A;  3KZ7 A;  1W1T A;  2MPH A;  3AQU A;  2RQS A;  1PBK A; 
#chains in the Genus database with same CATH homology
 3KAG A;  2PV1 A;  1SR0 A;  5HUA A;  1HJV A;  1W9V A;  4MNL A;  1ZCN A;  4ODO A;  1J4R A;  1FKI A;  1KT1 A;  1FKG A;  3FXY A;  5I98 A;  4JYS A;  4ODP A;  2XP7 A;  4G50 A;  1FKT A;  2DSU A;  1LG1 A;  1FKH A;  2OLH A;  5J6E A;  4DRO A;  4DWS D;  3QOK A;  4ZS6 A;  4ODK A;  2ZR6 A;  4DRI A;  3RGC A;  2PI6 A;  1FKR A;  4LGX A;  1XHG A;  1EIB A;  5HT1 A;  1GOI A;  4R0X A;  3WQV A;  2ITK A;  5B8I C;  1WNO A;  1W1V A;  4DRP A;  4J4O A;  3O5J A;  3RME A;  5BXJ A;  1E9L A;  3KAF A;  5GPG A;  1P5Q A;  1QPF A;  1D7J A;  3JXV A;  1HJX A;  3PR9 A;  1W1P A;  4Z2L A;  3I6C A;  2DG4 A;  1JNE A;  3ARZ A;  2PV3 A;  1LJY A;  4W5U A;  3O5P A;  4P8X A;  3UF8 A;  4JFL A;  2Y78 A;  1B6C A;  1E15 A;  4QT2 A;  4NNR A;  2RUQ A;  1YW5 A;  2MLY A;  2XP4 A;  2DG3 A;  2KFW A;  1WB0 A;  3G6L A;  4U86 A;  1E6Z A;  4MAV A;  4W9P A;  2IF4 A;  1OGG A;  1NMV A;  1ZU8 A;  1KFW A;  2QF8 A;  4MGV A;  3OOB A;  3WD3 A;  1HKM A;  4ZPV R;  2DT1 A;  2XPA A;  1R9H A;  3RM8 A;  1HKI A;  1A7X A;  1FKK A;  2FDM A;  1NH6 A;  3O5L A;  2YBU A;  1HKJ A;  4JFM A;  3ARV A;  1K9T A;  3O5O A;  1LG2 A;  1ITX A;  4ITZ A;  3O5D A;  2O9O A;  1NMW A;  1TFV A;  4DRM A;  1GPF A;  2FKE A;  4DZ3 A;  5DIV A;  1D7H A;  3WD0 A;  3O5M A;  1LL6 A;  4O2T A;  1D6O A;  1JND A;  3MDY B;  4LAX A;  1T11 A;  4P8U A;  4LAY A;  4P8V A;  4JFI A;  5D75 A;  3KAI A;  1W26 A;  4JFK A;  4DRQ A;  3ARY A;  1FKD A;  2KR7 A;  2M1I A;  1NSG A;  4LAW A;  1ZBW A;  1PIN A;  1JNS A;  3O5F A;  1VF8 A;  4JFJ A;  1OGB A;  1KT0 A;  2WLY A;  3CZ8 A;  1W9P A;  4HAR A;  4BF8 A;  4ZPT R;  1W9U A;  3CHC A;  2ZQU A;  3IK8 A;  3WD1 A;  3O5E A;  3AS0 A;  2ZQS A;  2LGO A;  3WQW A;  3IKG A;  4ODQ A;  4TW8 A;  3CGM A;  3UI6 A;  4WIW A;  4J4N A;  2ZR4 A;  2M08 A;  3WL0 A;  4MPK A;  1TCO C;  2PBC A;  1X6N A;  2VN1 A;  1FD9 A;  5DO2 A;  4WKA A;  2XP5 A;  5DF0 A;  1Q1C A;  3O5Q A;  4DT4 A;  1GUV A;  2RSE A;  1H0G A;  3UQA A;  2ZQV A;  2DSZ A;  4DRN A;  4P8W A;  5JH8 A;  2K8I A;  3EY6 A;  4ODL A;  2B31 A;  3H9R B;  4IT6 A;  1QZ2 A;  3WIJ A;  3RFW A;  2DG9 A;  1FKL A;  2PPO A;  1NWR A;  3LUO A;  4IT4 A;  1WAW A;  4URI A;  4L3N A;  2KO7 A;  3NI6 A;  5HWB A;  5HW6 A;  2ZQT A;  3OA5 A;  2FAP A;  4GGQ A;  3ARO A;  1ROU A;  5HW8 A;  5GPR A;  3B9E A;  1X6L A;  5DIU A;  2DT0 A;  2RUR A;  1SYT A;  4C02 B;  2YBT A;  1FAP A;  4MSP A;  4Z2J A;  4Z2G A;  1F40 A;  3O5K A;  3O5G A;  4WJX A;  3RM9 A;  1NWU A;  1JNT A;  4Z2H A;  2N87 A;  3ARP A;  3UI4 A;  2KE0 A;  3UI5 A;  3B9D A;  5HBF A;  1C9H A;  3ARQ A;  3NTP A;  4IQC A;  2PPN A;  4DZ2 A;  2RUD A;  2XP9 A;  2OFN A;  5HTG A;  3PRA A;  1J4H A;  3KAH A;  4TW7 A;  4ML4 A;  1J4I A;  1Y0O A;  5HWC A;  2KI3 A;  1E6P A;  1E6N A;  3ARR A;  1ZK6 A;  3TDB A;  4L72 B;  2DT2 A;  2UZ5 A;  3CH9 A;  1HKK A;  3GPK A;  4Q7N A;  3B8S A;  1OWQ A;  4FN2 A;  2RUC A;  1UR9 A;  4TYO A;  1QPL A;  1LL7 A;  4QT3 A;  3O5I A;  4S3K A;  2MF9 A;  2XP3 A;  1LL4 A;  4G2P A;  4KR0 B;  4MNM A;  2DSV A;  2LKN A;  1CTN A;  4R5E A;  1FKB A;  3BXW A;  4TNS A;  4DWS A;  3B7X A;  3WH0 A;  1IX5 A;  2A3A A;  2D9F A;  2LJ4 A;  2WK2 A;  4WKH A;  2KGJ A;  4Z2I A;  2A3E A;  3WD2 A;  4ODM A;  1Q6I A;  3KCE A;  1L1P A;  2ZR5 A;  4TX0 A;  4AY1 A;  4S3J A;  4Q22 A;  2VCD A;  4ODN A;  2DPE A;  1ZL1 A;  3AS3 A;  2G41 A;  2PV2 A;  4MNJ A;  2MLX A;  5DIT A;  1H0I A;  3UQI A;  3AS2 A;  4IPX A;  3WKZ A;  3RM4 A;  4WKF A;  2PPP A;  4LAV A;  2AOS A;  2AWG A;  1FKJ A;  1F8A B;  2XP8 A;  3ARU A;  1FFQ A;  2A3C A;  3NRK A;  4PTM A;  2WM0 A;  3UQB A;  3ARW A;  3PRD A;  3TCZ A;  1W1Y A;  4W9Q A;  3WD4 A;  1HXV A;  4DRH A;  2XP6 A;  3CHF A;  3B9A A;  4DH0 A;  3WL1 A;  1HJW A;  1M5Y A;  4WK9 A;  1BL4 A;  3ARX A;  3ALF A;  1EDQ A;  3CGN A;  2M2A A;  1FJD A;  2Q5A A;  2F21 A;  5GQB A;  1BKF A;  3KAB A;  4HBE A;  4DRJ A;  1NWS A;  2LPV A;  2XPB A;  3ALG A;  1UR8 A;  4MTV A;  5HKG A;  3IHZ A;  1Q6U A;  3O5R A;  2JZV A;  1JVW A;  2ESC A;  3ARS A;  2MLZ A;  2WLZ A;  5HW7 A;  1LQ0 A;  2DT3 A;  2DSW A;  1U79 A;  4GIV A;  1EQ3 A;  3KAC A;  4U84 A;  1YAT A;  3FY1 A;  3AS1 A;  1EHN A;  2IUZ A;  4DWS C;  1ZBK A;  1J6Y A;  1FKF A;  1ZBV A;  3ODK A;  5DEZ A;  4U85 A;  3ART A;  1ZBC A;  4N19 A;  4TW6 A;  4FAP A;  4DRK A;  1D2K A;  3JYM A;  2A3B A;  3CHD A;  4ODR A;  4MNK A;  2O92 A;  4HBO A;  2L2S A;  1O6I A;  4Z2K A;  3IKD A;  3JYJ A;  4QZV B;  4W9O A;  4KQZ A;  3TC5 A;  1RD6 A;  4DIP A;  3VAW A;  1ROT A;  1NWT A;  4NZC A;  3W4R A;  3PRB A;  1FKS A;  4QIB A;  2F2D A;  4IQ2 A;  1D7I A;  1XRV A;  2G8Z A;  4ZPW R;  3FAP A;  2MNT A;  1E6R A;  1EYM A;  3PA7 A;  1Q6H A;  4NSB A;  4XAK A;  1ZB5 A;  3G6M A;  1FFR A;  3KAD A;  2F4E A;  1N1A A;  4DWS B;  3CHE A;  3KZ7 A;  1W1T A;  2MPH A;  3AQU A;  2RQS A;  1PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...