2KGJA

Solution structure of parvulin domain of ppid from e.coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
TQPQRTRYSIIQTKTEDEAKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSGVIKSSVGFLIVRLDDIQAAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase D
publication title The prolyl isomerase domain of PpiD from Escherichia coli shows a parvulin fold but is devoid of catalytic activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 24
structure length 102
sequence length 102
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2kgjA00
1D7IA 2ZR6A 2XP3A 1FKHA 2LKNA 3UI5A 1FKKA 2KI3A 2M08A 3KACA 3UQBA 1D6OA 2Y78A 3CGNA 3KZ7A 1Q6HA 4IQ2A 2K8IA 4TW8A 4IPXA 3O5QA 3NI6A 4LAXA 2M2AA 1D7HA 4DRMA 4U85A 4LAWA 1FKSA 3IHZA 3UQIA 2IF4A 3KADA 3OOBA 2ZR5A 1A7XA 2PPNA 2RURA 5DIVA 5GPGA 5B8IC 3KAFA 4TW7A 5HW6A 3KCEA 3NTPA 4C02B 1BL4A 2Q5AA 2UZ5A 3WH0A 1T11A 3O5GA 3VAWA 5HW7A 5HWBA 4J4NA 2KFWA 2ZQSA 2RUDA 4ODQA 4ODNA 3TDBA 4DRKA 4JYSA 1FKTA 3JYJA 2DG9A 4DRNA 2ITKA 1FKDA 1QPFA 1R9HA 2XP7A 3B7XA 4ODLA 2ZQUA 2PV2A 2ZQVA 1QPLA 4MGVA 4R0XA 4DROA 3KABA 1NSGA 3O5LA 5HWCA 2KGJA 2M1IA 2PV3A 3O5EA 4FN2A 4ODKA 4JFLA 3O5JA 5D75A 2KR7A 3JXVA 2ZQTA 4TYOA 1M5YA 4W9OA 2LJ4A 3RFWA 2DG3A 1J6YA 2OFNA 5BXJA 2XP9A 1BKFA 1QZ2A 2KE0A 2MLZA 1N1AA 2XP4A 2KO7A 4GGQA 4ITZA 4JFKA 1Q1CA 2FAPA 1HXVA 4DRPA 1Q6UA 4DZ2A 4QT3A 3O5KA 1EQ3A 1NMWA 4GIVA 1J4HA 2ZR4A 1YW5A 1JNTA 3UF8A 4G50A 4IQCA 5J6EA 3ODKA 4TW6A 4U84A 1EYMA 2LPVA 1ROTA 1FAPA 4G2PA 3O5OA 5HT1A 5HTGA 3RGCA 2XP5A 3KAHA 4TNSA 3CGMA 4DH0A 5DIUA 3O5DA 3JYMA 1C9HA 3IK8A 3O5PA 4JFIA 4U86A 4QT2A 1W26A 3IKGA 4DRJA 3O5IA 3TCZA 4DZ3A 1D7JA 3H9RB 4W9QA 4LAVA 1JNSA 1TCOC 4NNRA 1ZCNA 3MDYB 3O5MA 2F21A 4ODOA 2VCDA 1FKRA 1F40A 5HW8A 2F4EA 4LAYA 2MLYA 1J4RA 2D9FA 4QIBA 2L2SA 2XPBA 3GPKA 3I6CA 4TX0A 4DRIA 2RSEA 3NRKA 2XP6A 4MSPA 3O5FA 5DITA 2N87A 3FAPA 1L1PA 3KAIA 4DIPA 1PBKA 4W9PA 2RUCA 3EY6A 2FKEA 2MPHA 4BF8A 3UQAA 3LUOA 2RQSA 4O2TA 5I98A 2LGOA 1B6CA 2PV1A 3PRBA 1Q6IA 1FKLA 1FJDA 3UI6A 1ZK6A 2JZVA 4JFJA 2VN1A 1Y0OA 2XPAA 1FKFA 1FKIA 2PBCA 4DRHA 1ROUA 3KAGA 1FKGA 1FKBA 1YATA 2MLXA 2XP8A 5HUAA 1FKJA 3O5RA 3TC5A 5HKGA 1F8AB 4DT4A 2PPOA 1U79A 1KT1A 4DRQA 3UI4A 1NMVA 1FD9A 2DG4A 1J4IA 1JVWA 2MF9A 1P5QA 3IKDA 4J4OA 4ODRA 2RUQA 2PPPA 1PINA 3PRDA 2F2DA 4JFMA 4FAPA 4ODMA 2MNTA 3PA7A 4N19A 2AWGA 1KT0A 4ODPA
chains in the Genus database with same CATH superfamily
1ZBCA 2ZR6A 1HKKA 3ARRA 3UQBA 1D6OA 4IQ2A 4IPXA 3AS0A 3WD0A 2WM0A 1ZBWA 1OGGA 5HW6A 3KAFA 3NTPA 1BL4A 3AS3A 2Q5AA 1LG1A 4J4NA 2KFWA 3BMBA 3CH9A 4ODNA 4DRKA 4PTMA 1WNOA 4UDMA 1GUVA 1JNEA 5HWCA 3EIPA 2M1IA 2PV3A 4JFLA 3RMEA 3RFWA 2ZQTA 4TYOA 2LJ4A 4JFMA 2MLZA 4JFKA 2FAPA 3ARYA 1EQ3A 4NSBA 1GRJA 1W1PA 1ROTA 3RM4A 3CGMA 3ARXA 5DIUA 3BXWA 3O5PA 4DRJA 2DT0A 3IKGA 3O5IA 1ZBVA 2WLYA 3H9RB 1OGBA 4NNRA 1ZCNA 3MDYB 3O5MA 1E44A 4S3JA 1ZB5A 1F40A 4KQZA 2D9FA 4WKAA 1W9UA 3WL1A 2B31A 5DITA 3FAPA 3KAIA 4W9PA 2MPHA 4BF8A 1NWSA 3PR9A 1EDQA 2LGOA 1B6CA 5HBFA 2DSVA 2O92A 3W4RA 4P8WA 4DWSC 2VN1A 1SYTA 2PBCA 1FKGA 1FKBA 3O5RA 3TC5A 3WKZA 4DRQA 1H0IA 1NMVA 1FD9A 2DG4A 1J4IA 1JVWA 2MF9A 1P5QA 3ARSA 3IKDA 4Z2LA 2RUQA 3PRDA 4ODMA 2MNTA 4WKHA 2XP3A 2DT3A 2LKNA 1FKKA 2M08A 4ZS6A 3KACA 4DWSA 1Q6HA 1JNDA 4Z2JA 4AY1A 4DRMA 2M2AA 1D7HA 3UQIA 2IF4A 4TW7A 3WH0A 3O5GA 3RM8A 2DSUA 2ZQSA 2A3BA 1NH6A 3JYJA 2DG9A 5GQBA 1EIBA 2F23A 1QPFA 1WB0A 2XP7A 3B7XA 4R0XA 2ZQUA 3O5LA 3O5EA 4ODKA 1W1YA 2KR7A 4W9OA 1VF8A 1NWUA 2DG3A 4WIWA 2XP9A 1BKFA 1N1AA 4GGQA 3ALFA 1Q1CA 4KR0B 4WKFA 1ZU8A 4WK9A 3AS2A 1E6RA 4GIVA 1J4HA 2ZR4A 1YW5A 3UF8A 5J6EA 4G50A 1O6IA 3CHFA 1EYMA 4TW6A 4G2PA 5HT1A 4Z2IA 3RGCA 3KAHA 2PI6A 3AS1A 3JYMA 1C9HA 3IK8A 3B9DA 1LQ0A 1OWQA 2FDMA 1D7JA 4W9QA 4Q7NA 2MLYA 2L2SA 2XPBA 3I6CA 1HJXA 2PN0A 3WQVA 4MSPA 4L72B 4MAVA 1L1PA 1PBKA 5GPRA 1FFQA 3UQAA 4P8UA 3WD1A 3PRAA 4R5EA 1FKLA 1ITXA 3UI6A 4ZPWR 4MPKA 1Y0OA 4HBEA 3B9EA 1E15A 4MNJA 1YATA 2XP8A 5HUAA 1CTNA 2QF8A 1F8AB 2A3EA 1D2KA 1KT1A 2WK2A 1JCHB 2YBUA 3GTYX 4FAPA 3ARTA 4LGXA 3JXVA 1KT0A 1D7IA 3ARQA 3UI5A 1GOIA 4MNLA 2KI3A 4IT6A 2YBTA 3KZ7A 2G41A 2K8IA 4TW8A 4L3NA 3CZ8A 3GU0A 3NI6A 3G6LA 4LAXA 4U85A 3WD2A 3IHZA 2DSWA 4DWSB 1XHGA 3KADA 2ZR5A 2RURA 2DT1A 2A3AA 3KCEA 4C02B 1LG2A 1T11A 5HWBA 1HJWA 1X6NA 3TDBA 1LJYA 1FKTA 5DO2A 4DRNA 2ITKA 1FKDA 4ODLA 4DROA 2ZQVA 3KABA 3O5JA 3QOKA 1ZBKA 1W1TA 3B8SA 1M5YA 1J6YA 2OFNA 2KE0A 2XP4A 4URIA 1H0GA 2IUZA 4QT3A 3O5KA 1JNTA 1HJVA 2LPVA 3ARUA 4MNMA 5HTGA 2XP5A 1TFVA 3ARPA 1GPFA 1W26A 1XRVA 3TCZA 4LAVA 1TCOC 3FY1A 2F21A 4ODOA 2VCDA 1FKRA 4W5UA 4LAYA 4Q22A 1J4RA 4QIBA 1HKMA 1RD6A 3GPKA 4Z2KA 4TX0A 1X6LA 1ZL1A 3NRKA 2OLHA 4HBOA 3OA5A 3EY6A 4ZPVR 3LUOA 4O2TA 3WQWA 2PV1A 3PRBA 1FJDA 2JZVA 4JFJA 1FKIA 1W9PA 3CHDA 4DRHA 1ROUA 3KAGA 2ESCA 1UR8A 1W1VA 1NWRA 5JH8A 1HKIA 4DT4A 5DF0A 1U79A 4ML4A 3UI4A 2DT2A 4J4OA 1E9LA 2PPPA 2B5UB 3G6MA 4N19A 4ODPA 1FKHA 3RM9A 2Y78A 3CGNA 3O5QA 1K9TA 1IX5A 4MTVA 1LL4A 4LAWA 1FKSA 3OOBA 1A7XA 2PPNA 3AQUA 5DIVA 5GPGA 5B8IC 4WJXA 1KFWA 5DEZA 3AROA 2UZ5A 3VAWA 5HW7A 2G8ZA 2O9OA 2RUDA 4MNKA 4ODQA 4JYSA 1FFRA 1R9HA 3CHCA 2PV2A 1W9VA 1QPLA 2WLZA 4MGVA 1NSGA 2KGJA 1HKJA 4FN2A 2P4VA 1SR0A 3WD4A 2DPEA 2DSZA 2EULA 2AOSA 3ALGA 5D75A 5BXJA 1QZ2A 4ITZA 2KO7A 1HXVA 4DRPA 1Q6UA 3CHEA 4DWSD 1NMWA 3WL0A 4IQCA 3ODKA 4Z2GA 4U84A 1FAPA 3O5OA 3FXYA 4TNSA 2A3CA 4DH0A 3O5DA 4JFIA 4U86A 3ARZA 4QT2A 3B9AA 4DZ3A 4HARA 1JNSA 3WD3A 1LL6A 5HW8A 2F4EA 4DRIA 2RSEA 1EHNA 2XP6A 3O5FA 4IT4A 1NWTA 2N87A 4P8XA 1E6ZA 1LL7A 2RUCA 2FKEA 4S3KA 2RQSA 5I98A 4NZCA 1Q6IA 4QZVB 4Z2HA 4ZPTR 3ARVA 1ZK6A 4P8VA 2XPAA 1E6NA 1FKFA 4XAKA 3WIJA 2ETNA 2MLXA 1FKJA 5HKGA 3ARWA 1UR9A 2PPOA 1E6PA 4DZ2A 4DIPA 4ODRA 1PINA 2F2DA 3PA7A 2AWGA 1WAWA
chains in the Genus database with same CATH topology
1ZBCA 2ZR6A 1HKKA 3ARRA 3UQBA 1D6OA 4IQ2A 4IPXA 3AS0A 3WD0A 2WM0A 1ZBWA 1OGGA 5HW6A 3KAFA 3NTPA 1BL4A 3AS3A 2Q5AA 1LG1A 4J4NA 2KFWA 3CH9A 4ODNA 4DRKA 4PTMA 1WNOA 1GUVA 1JNEA 5HWCA 2M1IA 2PV3A 4JFLA 3RMEA 3RFWA 2ZQTA 4TYOA 2LJ4A 4JFMA 2MLZA 4JFKA 2FAPA 3ARYA 1EQ3A 4NSBA 1W1PA 1ROTA 3RM4A 3CGMA 3ARXA 5DIUA 3BXWA 3O5PA 4DRJA 2DT0A 3IKGA 3O5IA 1ZBVA 2WLYA 3H9RB 1OGBA 4NNRA 1ZCNA 3MDYB 3O5MA 4S3JA 1ZB5A 1F40A 4KQZA 2D9FA 4WKAA 1W9UA 3WL1A 2B31A 5DITA 3FAPA 3KAIA 4W9PA 2MPHA 4BF8A 1NWSA 3PR9A 1EDQA 2LGOA 1B6CA 5HBFA 2DSVA 2O92A 3W4RA 4P8WA 4DWSC 2VN1A 1SYTA 2PBCA 1FKGA 1FKBA 3O5RA 3TC5A 3WKZA 4DRQA 1H0IA 1NMVA 1FD9A 2DG4A 1J4IA 1JVWA 2MF9A 1P5QA 3ARSA 3IKDA 4Z2LA 2RUQA 3PRDA 4ODMA 2MNTA 4WKHA 2XP3A 2DT3A 2LKNA 1FKKA 2M08A 4ZS6A 3KACA 4DWSA 1Q6HA 1JNDA 4Z2JA 4AY1A 4DRMA 2M2AA 1D7HA 3UQIA 2IF4A 4TW7A 3WH0A 3O5GA 3RM8A 2DSUA 2ZQSA 2A3BA 1NH6A 3JYJA 2DG9A 5GQBA 1EIBA 1QPFA 1WB0A 2XP7A 3B7XA 4R0XA 2ZQUA 3O5LA 3O5EA 4ODKA 1W1YA 2KR7A 4W9OA 1VF8A 1NWUA 2DG3A 4WIWA 2XP9A 1BKFA 1N1AA 4GGQA 3ALFA 1Q1CA 4KR0B 4WKFA 1ZU8A 4WK9A 3AS2A 1E6RA 4GIVA 1J4HA 2ZR4A 1YW5A 3UF8A 5J6EA 4G50A 1O6IA 3CHFA 1EYMA 4TW6A 4G2PA 5HT1A 4Z2IA 3RGCA 3KAHA 2PI6A 3AS1A 3JYMA 1C9HA 3IK8A 3B9DA 1LQ0A 1OWQA 2FDMA 1D7JA 4W9QA 4Q7NA 2MLYA 2L2SA 2XPBA 3I6CA 1HJXA 3WQVA 4MSPA 4L72B 4MAVA 1L1PA 1PBKA 5GPRA 1FFQA 3UQAA 4P8UA 3WD1A 3PRAA 4R5EA 1FKLA 1ITXA 3UI6A 4ZPWR 4MPKA 1Y0OA 4HBEA 3B9EA 1E15A 4MNJA 1YATA 2XP8A 5HUAA 1CTNA 2QF8A 1F8AB 2A3EA 1D2KA 1KT1A 2WK2A 2YBUA 4FAPA 3ARTA 4LGXA 3JXVA 1KT0A 1D7IA 3ARQA 3UI5A 1GOIA 4MNLA 2KI3A 4IT6A 2YBTA 3KZ7A 2G41A 2K8IA 4TW8A 4L3NA 3CZ8A 3NI6A 3G6LA 4LAXA 4U85A 3WD2A 3IHZA 2DSWA 4DWSB 1XHGA 3KADA 2ZR5A 2RURA 2DT1A 2A3AA 3KCEA 4C02B 1LG2A 1T11A 5HWBA 1HJWA 1X6NA 3TDBA 1LJYA 1FKTA 5DO2A 4DRNA 2ITKA 1FKDA 4ODLA 4DROA 2ZQVA 3KABA 3O5JA 3QOKA 1ZBKA 1W1TA 3B8SA 1M5YA 1J6YA 2OFNA 2KE0A 2XP4A 4URIA 1H0GA 2IUZA 4QT3A 3O5KA 1JNTA 1HJVA 2LPVA 3ARUA 4MNMA 5HTGA 2XP5A 1TFVA 3ARPA 1GPFA 1W26A 1XRVA 3TCZA 4LAVA 1TCOC 3FY1A 2F21A 4ODOA 2VCDA 1FKRA 4W5UA 4LAYA 4Q22A 1J4RA 4QIBA 1HKMA 1RD6A 3GPKA 4Z2KA 4TX0A 1X6LA 1ZL1A 3NRKA 2OLHA 4HBOA 3OA5A 3EY6A 4ZPVR 3LUOA 4O2TA 3WQWA 2PV1A 3PRBA 1FJDA 2JZVA 4JFJA 1FKIA 1W9PA 3CHDA 4DRHA 1ROUA 3KAGA 2ESCA 1UR8A 1W1VA 1NWRA 5JH8A 1HKIA 4DT4A 5DF0A 1U79A 4ML4A 3UI4A 2DT2A 4J4OA 1E9LA 2PPPA 3G6MA 4N19A 4ODPA 1FKHA 3RM9A 2Y78A 3CGNA 3O5QA 1K9TA 1IX5A 4MTVA 1LL4A 4LAWA 1FKSA 3OOBA 1A7XA 2PPNA 3AQUA 5DIVA 5GPGA 5B8IC 4WJXA 1KFWA 5DEZA 3AROA 2UZ5A 3VAWA 5HW7A 2G8ZA 2O9OA 2RUDA 4MNKA 4ODQA 4JYSA 1FFRA 1R9HA 3CHCA 2PV2A 1W9VA 1QPLA 2WLZA 4MGVA 1NSGA 2KGJA 1HKJA 4FN2A 1SR0A 3WD4A 2DPEA 2DSZA 5D75A 2AOSA 3ALGA 5BXJA 1QZ2A 4ITZA 2KO7A 1HXVA 4DRPA 1Q6UA 3CHEA 4DWSD 1NMWA 3WL0A 4IQCA 3ODKA 4Z2GA 4U84A 1FAPA 3O5OA 3FXYA 4TNSA 2A3CA 4DH0A 3O5DA 4JFIA 4U86A 3ARZA 4QT2A 3B9AA 4DZ3A 4HARA 1JNSA 3WD3A 1LL6A 5HW8A 2F4EA 4DRIA 2RSEA 1EHNA 2XP6A 3O5FA 4IT4A 1NWTA 2N87A 4P8XA 1E6ZA 1LL7A 2RUCA 2FKEA 4S3KA 2RQSA 5I98A 4NZCA 1Q6IA 4QZVB 4Z2HA 4ZPTR 3ARVA 1ZK6A 4P8VA 2XPAA 1E6NA 1FKFA 4XAKA 3WIJA 2MLXA 1FKJA 5HKGA 3ARWA 1UR9A 2PPOA 1E6PA 4DZ2A 4DIPA 4ODRA 1PINA 2F2DA 3PA7A 2AWGA 1WAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7I A;  2ZR6 A;  2XP3 A;  1FKH A;  2LKN A;  3UI5 A;  1FKK A;  2KI3 A;  2M08 A;  3KAC A;  3UQB A;  1D6O A;  2Y78 A;  3CGN A;  3KZ7 A;  1Q6H A;  4IQ2 A;  2K8I A;  4TW8 A;  4IPX A;  3O5Q A;  3NI6 A;  4LAX A;  2M2A A;  1D7H A;  4DRM A;  4U85 A;  4LAW A;  1FKS A;  3IHZ A;  3UQI A;  2IF4 A;  3KAD A;  3OOB A;  2ZR5 A;  1A7X A;  2PPN A;  2RUR A;  5DIV A;  5GPG A;  5B8I C;  3KAF A;  4TW7 A;  5HW6 A;  3KCE A;  3NTP A;  4C02 B;  1BL4 A;  2Q5A A;  2UZ5 A;  3WH0 A;  1T11 A;  3O5G A;  3VAW A;  5HW7 A;  5HWB A;  4J4N A;  2KFW A;  2ZQS A;  2RUD A;  4ODQ A;  4ODN A;  3TDB A;  4DRK A;  4JYS A;  1FKT A;  3JYJ A;  2DG9 A;  4DRN A;  2ITK A;  1FKD A;  1QPF A;  1R9H A;  2XP7 A;  3B7X A;  4ODL A;  2ZQU A;  2PV2 A;  2ZQV A;  1QPL A;  4MGV A;  4R0X A;  4DRO A;  3KAB A;  1NSG A;  3O5L A;  5HWC A;  2KGJ A;  2M1I A;  2PV3 A;  3O5E A;  4FN2 A;  4ODK A;  4JFL A;  3O5J A;  5D75 A;  2KR7 A;  3JXV A;  2ZQT A;  4TYO A;  1M5Y A;  4W9O A;  2LJ4 A;  3RFW A;  2DG3 A;  1J6Y A;  2OFN A;  5BXJ A;  2XP9 A;  1BKF A;  1QZ2 A;  2KE0 A;  2MLZ A;  1N1A A;  2XP4 A;  2KO7 A;  4GGQ A;  4ITZ A;  4JFK A;  1Q1C A;  2FAP A;  1HXV A;  4DRP A;  1Q6U A;  4DZ2 A;  4QT3 A;  3O5K A;  1EQ3 A;  1NMW A;  4GIV A;  1J4H A;  2ZR4 A;  1YW5 A;  1JNT A;  3UF8 A;  4G50 A;  4IQC A;  5J6E A;  3ODK A;  4TW6 A;  4U84 A;  1EYM A;  2LPV A;  1ROT A;  1FAP A;  4G2P A;  3O5O A;  5HT1 A;  5HTG A;  3RGC A;  2XP5 A;  3KAH A;  4TNS A;  3CGM A;  4DH0 A;  5DIU A;  3O5D A;  3JYM A;  1C9H A;  3IK8 A;  3O5P A;  4JFI A;  4U86 A;  4QT2 A;  1W26 A;  3IKG A;  4DRJ A;  3O5I A;  3TCZ A;  4DZ3 A;  1D7J A;  3H9R B;  4W9Q A;  4LAV A;  1JNS A;  1TCO C;  4NNR A;  1ZCN A;  3MDY B;  3O5M A;  2F21 A;  4ODO A;  2VCD A;  1FKR A;  1F40 A;  5HW8 A;  2F4E A;  4LAY A;  2MLY A;  1J4R A;  2D9F A;  4QIB A;  2L2S A;  2XPB A;  3GPK A;  3I6C A;  4TX0 A;  4DRI A;  2RSE A;  3NRK A;  2XP6 A;  4MSP A;  3O5F A;  5DIT A;  2N87 A;  3FAP A;  1L1P A;  3KAI A;  4DIP A;  1PBK A;  4W9P A;  2RUC A;  3EY6 A;  2FKE A;  2MPH A;  4BF8 A;  3UQA A;  3LUO A;  2RQS A;  4O2T A;  5I98 A;  2LGO A;  1B6C A;  2PV1 A;  3PRB A;  1Q6I A;  1FKL A;  1FJD A;  3UI6 A;  1ZK6 A;  2JZV A;  4JFJ A;  2VN1 A;  1Y0O A;  2XPA A;  1FKF A;  1FKI A;  2PBC A;  4DRH A;  1ROU A;  3KAG A;  1FKG A;  1FKB A;  1YAT A;  2MLX A;  2XP8 A;  5HUA A;  1FKJ A;  3O5R A;  3TC5 A;  5HKG A;  1F8A B;  4DT4 A;  2PPO A;  1U79 A;  1KT1 A;  4DRQ A;  3UI4 A;  1NMV A;  1FD9 A;  2DG4 A;  1J4I A;  1JVW A;  2MF9 A;  1P5Q A;  3IKD A;  4J4O A;  4ODR A;  2RUQ A;  2PPP A;  1PIN A;  3PRD A;  2F2D A;  4JFM A;  4FAP A;  4ODM A;  2MNT A;  3PA7 A;  4N19 A;  2AWG A;  1KT0 A;  4ODP A; 
#chains in the Genus database with same CATH topology
 1ZBC A;  2ZR6 A;  1HKK A;  3ARR A;  3UQB A;  1D6O A;  4IQ2 A;  4IPX A;  3AS0 A;  3WD0 A;  2WM0 A;  1ZBW A;  1OGG A;  5HW6 A;  3KAF A;  3NTP A;  1BL4 A;  3AS3 A;  2Q5A A;  1LG1 A;  4J4N A;  2KFW A;  3BMB A;  3CH9 A;  4ODN A;  4DRK A;  4PTM A;  1WNO A;  4UDM A;  1GUV A;  1JNE A;  5HWC A;  3EIP A;  2M1I A;  2PV3 A;  4JFL A;  3RME A;  3RFW A;  2ZQT A;  4TYO A;  2LJ4 A;  4JFM A;  2MLZ A;  4JFK A;  2FAP A;  3ARY A;  1EQ3 A;  4NSB A;  1GRJ A;  1W1P A;  1ROT A;  3RM4 A;  3CGM A;  3ARX A;  5DIU A;  3BXW A;  3O5P A;  4DRJ A;  2DT0 A;  3IKG A;  3O5I A;  1ZBV A;  2WLY A;  3H9R B;  1OGB A;  4NNR A;  1ZCN A;  3MDY B;  3O5M A;  1E44 A;  4S3J A;  1ZB5 A;  1F40 A;  4KQZ A;  2D9F A;  4WKA A;  1W9U A;  3WL1 A;  2B31 A;  5DIT A;  3FAP A;  3KAI A;  4W9P A;  2MPH A;  4BF8 A;  1NWS A;  3PR9 A;  1EDQ A;  2LGO A;  1B6C A;  5HBF A;  2DSV A;  2O92 A;  3W4R A;  4P8W A;  4DWS C;  2VN1 A;  1SYT A;  2PBC A;  1FKG A;  1FKB A;  3O5R A;  3TC5 A;  3WKZ A;  4DRQ A;  1H0I A;  1NMV A;  1FD9 A;  2DG4 A;  1J4I A;  1JVW A;  2MF9 A;  1P5Q A;  3ARS A;  3IKD A;  4Z2L A;  2RUQ A;  3PRD A;  4ODM A;  2MNT A;  4WKH A;  2XP3 A;  2DT3 A;  2LKN A;  1FKK A;  2M08 A;  4ZS6 A;  3KAC A;  4DWS A;  1Q6H A;  1JND A;  4Z2J A;  4AY1 A;  4DRM A;  2M2A A;  1D7H A;  3UQI A;  2IF4 A;  4TW7 A;  3WH0 A;  3O5G A;  3RM8 A;  2DSU A;  2ZQS A;  2A3B A;  1NH6 A;  3JYJ A;  2DG9 A;  5GQB A;  1EIB A;  2F23 A;  1QPF A;  1WB0 A;  2XP7 A;  3B7X A;  4R0X A;  2ZQU A;  3O5L A;  3O5E A;  4ODK A;  1W1Y A;  2KR7 A;  4W9O A;  1VF8 A;  1NWU A;  2DG3 A;  4WIW A;  2XP9 A;  1BKF A;  1N1A A;  4GGQ A;  3ALF A;  1Q1C A;  4KR0 B;  4WKF A;  1ZU8 A;  4WK9 A;  3AS2 A;  1E6R A;  4GIV A;  1J4H A;  2ZR4 A;  1YW5 A;  3UF8 A;  5J6E A;  4G50 A;  1O6I A;  3CHF A;  1EYM A;  4TW6 A;  4G2P A;  5HT1 A;  4Z2I A;  3RGC A;  3KAH A;  2PI6 A;  3AS1 A;  3JYM A;  1C9H A;  3IK8 A;  3B9D A;  1LQ0 A;  1OWQ A;  2FDM A;  1D7J A;  4W9Q A;  4Q7N A;  2MLY A;  2L2S A;  2XPB A;  3I6C A;  1HJX A;  2PN0 A;  3WQV A;  4MSP A;  4L72 B;  4MAV A;  1L1P A;  1PBK A;  5GPR A;  1FFQ A;  3UQA A;  4P8U A;  3WD1 A;  3PRA A;  4R5E A;  1FKL A;  1ITX A;  3UI6 A;  4ZPW R;  4MPK A;  1Y0O A;  4HBE A;  3B9E A;  1E15 A;  4MNJ A;  1YAT A;  2XP8 A;  5HUA A;  1CTN A;  2QF8 A;  1F8A B;  2A3E A;  1D2K A;  1KT1 A;  2WK2 A;  1JCH B;  2YBU A;  3GTY X;  4FAP A;  3ART A;  4LGX A;  3JXV A;  1KT0 A;  1D7I A;  3ARQ A;  3UI5 A;  1GOI A;  4MNL A;  2KI3 A;  4IT6 A;  2YBT A;  3KZ7 A;  2G41 A;  2K8I A;  4TW8 A;  4L3N A;  3CZ8 A;  3GU0 A;  3NI6 A;  3G6L A;  4LAX A;  4U85 A;  3WD2 A;  3IHZ A;  2DSW A;  4DWS B;  1XHG A;  3KAD A;  2ZR5 A;  2RUR A;  2DT1 A;  2A3A A;  3KCE A;  4C02 B;  1LG2 A;  1T11 A;  5HWB A;  1HJW A;  1X6N A;  3TDB A;  1LJY A;  1FKT A;  5DO2 A;  4DRN A;  2ITK A;  1FKD A;  4ODL A;  4DRO A;  2ZQV A;  3KAB A;  3O5J A;  3QOK A;  1ZBK A;  1W1T A;  3B8S A;  1M5Y A;  1J6Y A;  2OFN A;  2KE0 A;  2XP4 A;  4URI A;  1H0G A;  2IUZ A;  4QT3 A;  3O5K A;  1JNT A;  1HJV A;  2LPV A;  3ARU A;  4MNM A;  5HTG A;  2XP5 A;  1TFV A;  3ARP A;  1GPF A;  1W26 A;  1XRV A;  3TCZ A;  4LAV A;  1TCO C;  3FY1 A;  2F21 A;  4ODO A;  2VCD A;  1FKR A;  4W5U A;  4LAY A;  4Q22 A;  1J4R A;  4QIB A;  1HKM A;  1RD6 A;  3GPK A;  4Z2K A;  4TX0 A;  1X6L A;  1ZL1 A;  3NRK A;  2OLH A;  4HBO A;  3OA5 A;  3EY6 A;  4ZPV R;  3LUO A;  4O2T A;  3WQW A;  2PV1 A;  3PRB A;  1FJD A;  2JZV A;  4JFJ A;  1FKI A;  1W9P A;  3CHD A;  4DRH A;  1ROU A;  3KAG A;  2ESC A;  1UR8 A;  1W1V A;  1NWR A;  5JH8 A;  1HKI A;  4DT4 A;  5DF0 A;  1U79 A;  4ML4 A;  3UI4 A;  2DT2 A;  4J4O A;  1E9L A;  2PPP A;  2B5U B;  3G6M A;  4N19 A;  4ODP A;  1FKH A;  3RM9 A;  2Y78 A;  3CGN A;  3O5Q A;  1K9T A;  1IX5 A;  4MTV A;  1LL4 A;  4LAW A;  1FKS A;  3OOB A;  1A7X A;  2PPN A;  3AQU A;  5DIV A;  5GPG A;  5B8I C;  4WJX A;  1KFW A;  5DEZ A;  3ARO A;  2UZ5 A;  3VAW A;  5HW7 A;  2G8Z A;  2O9O A;  2RUD A;  4MNK A;  4ODQ A;  4JYS A;  1FFR A;  1R9H A;  3CHC A;  2PV2 A;  1W9V A;  1QPL A;  2WLZ A;  4MGV A;  1NSG A;  2KGJ A;  1HKJ A;  4FN2 A;  2P4V A;  1SR0 A;  3WD4 A;  2DPE A;  2DSZ A;  2EUL A;  2AOS A;  3ALG A;  5D75 A;  5BXJ A;  1QZ2 A;  4ITZ A;  2KO7 A;  1HXV A;  4DRP A;  1Q6U A;  3CHE A;  4DWS D;  1NMW A;  3WL0 A;  4IQC A;  3ODK A;  4Z2G A;  4U84 A;  1FAP A;  3O5O A;  3FXY A;  4TNS A;  2A3C A;  4DH0 A;  3O5D A;  4JFI A;  4U86 A;  3ARZ A;  4QT2 A;  3B9A A;  4DZ3 A;  4HAR A;  1JNS A;  3WD3 A;  1LL6 A;  5HW8 A;  2F4E A;  4DRI A;  2RSE A;  1EHN A;  2XP6 A;  3O5F A;  4IT4 A;  1NWT A;  2N87 A;  4P8X A;  1E6Z A;  1LL7 A;  2RUC A;  2FKE A;  4S3K A;  2RQS A;  5I98 A;  4NZC A;  1Q6I A;  4QZV B;  4Z2H A;  4ZPT R;  3ARV A;  1ZK6 A;  4P8V A;  2XPA A;  1E6N A;  1FKF A;  4XAK A;  3WIJ A;  2ETN A;  2MLX A;  1FKJ A;  5HKG A;  3ARW A;  1UR9 A;  2PPO A;  1E6P A;  4DZ2 A;  4DIP A;  4ODR A;  1PIN A;  2F2D A;  3PA7 A;  2AWG A;  1WAW A; 
#chains in the Genus database with same CATH homology
 1ZBC A;  2ZR6 A;  1HKK A;  3ARR A;  3UQB A;  1D6O A;  4IQ2 A;  4IPX A;  3AS0 A;  3WD0 A;  2WM0 A;  1ZBW A;  1OGG A;  5HW6 A;  3KAF A;  3NTP A;  1BL4 A;  3AS3 A;  2Q5A A;  1LG1 A;  4J4N A;  2KFW A;  3CH9 A;  4ODN A;  4DRK A;  4PTM A;  1WNO A;  1GUV A;  1JNE A;  5HWC A;  2M1I A;  2PV3 A;  4JFL A;  3RME A;  3RFW A;  2ZQT A;  4TYO A;  2LJ4 A;  4JFM A;  2MLZ A;  4JFK A;  2FAP A;  3ARY A;  1EQ3 A;  4NSB A;  1W1P A;  1ROT A;  3RM4 A;  3CGM A;  3ARX A;  5DIU A;  3BXW A;  3O5P A;  4DRJ A;  2DT0 A;  3IKG A;  3O5I A;  1ZBV A;  2WLY A;  3H9R B;  1OGB A;  4NNR A;  1ZCN A;  3MDY B;  3O5M A;  4S3J A;  1ZB5 A;  1F40 A;  4KQZ A;  2D9F A;  4WKA A;  1W9U A;  3WL1 A;  2B31 A;  5DIT A;  3FAP A;  3KAI A;  4W9P A;  2MPH A;  4BF8 A;  1NWS A;  3PR9 A;  1EDQ A;  2LGO A;  1B6C A;  5HBF A;  2DSV A;  2O92 A;  3W4R A;  4P8W A;  4DWS C;  2VN1 A;  1SYT A;  2PBC A;  1FKG A;  1FKB A;  3O5R A;  3TC5 A;  3WKZ A;  4DRQ A;  1H0I A;  1NMV A;  1FD9 A;  2DG4 A;  1J4I A;  1JVW A;  2MF9 A;  1P5Q A;  3ARS A;  3IKD A;  4Z2L A;  2RUQ A;  3PRD A;  4ODM A;  2MNT A;  4WKH A;  2XP3 A;  2DT3 A;  2LKN A;  1FKK A;  2M08 A;  4ZS6 A;  3KAC A;  4DWS A;  1Q6H A;  1JND A;  4Z2J A;  4AY1 A;  4DRM A;  2M2A A;  1D7H A;  3UQI A;  2IF4 A;  4TW7 A;  3WH0 A;  3O5G A;  3RM8 A;  2DSU A;  2ZQS A;  2A3B A;  1NH6 A;  3JYJ A;  2DG9 A;  5GQB A;  1EIB A;  1QPF A;  1WB0 A;  2XP7 A;  3B7X A;  4R0X A;  2ZQU A;  3O5L A;  3O5E A;  4ODK A;  1W1Y A;  2KR7 A;  4W9O A;  1VF8 A;  1NWU A;  2DG3 A;  4WIW A;  2XP9 A;  1BKF A;  1N1A A;  4GGQ A;  3ALF A;  1Q1C A;  4KR0 B;  4WKF A;  1ZU8 A;  4WK9 A;  3AS2 A;  1E6R A;  4GIV A;  1J4H A;  2ZR4 A;  1YW5 A;  3UF8 A;  5J6E A;  4G50 A;  1O6I A;  3CHF A;  1EYM A;  4TW6 A;  4G2P A;  5HT1 A;  4Z2I A;  3RGC A;  3KAH A;  2PI6 A;  3AS1 A;  3JYM A;  1C9H A;  3IK8 A;  3B9D A;  1LQ0 A;  1OWQ A;  2FDM A;  1D7J A;  4W9Q A;  4Q7N A;  2MLY A;  2L2S A;  2XPB A;  3I6C A;  1HJX A;  3WQV A;  4MSP A;  4L72 B;  4MAV A;  1L1P A;  1PBK A;  5GPR A;  1FFQ A;  3UQA A;  4P8U A;  3WD1 A;  3PRA A;  4R5E A;  1FKL A;  1ITX A;  3UI6 A;  4ZPW R;  4MPK A;  1Y0O A;  4HBE A;  3B9E A;  1E15 A;  4MNJ A;  1YAT A;  2XP8 A;  5HUA A;  1CTN A;  2QF8 A;  1F8A B;  2A3E A;  1D2K A;  1KT1 A;  2WK2 A;  2YBU A;  4FAP A;  3ART A;  4LGX A;  3JXV A;  1KT0 A;  1D7I A;  3ARQ A;  3UI5 A;  1GOI A;  4MNL A;  2KI3 A;  4IT6 A;  2YBT A;  3KZ7 A;  2G41 A;  2K8I A;  4TW8 A;  4L3N A;  3CZ8 A;  3NI6 A;  3G6L A;  4LAX A;  4U85 A;  3WD2 A;  3IHZ A;  2DSW A;  4DWS B;  1XHG A;  3KAD A;  2ZR5 A;  2RUR A;  2DT1 A;  2A3A A;  3KCE A;  4C02 B;  1LG2 A;  1T11 A;  5HWB A;  1HJW A;  1X6N A;  3TDB A;  1LJY A;  1FKT A;  5DO2 A;  4DRN A;  2ITK A;  1FKD A;  4ODL A;  4DRO A;  2ZQV A;  3KAB A;  3O5J A;  3QOK A;  1ZBK A;  1W1T A;  3B8S A;  1M5Y A;  1J6Y A;  2OFN A;  2KE0 A;  2XP4 A;  4URI A;  1H0G A;  2IUZ A;  4QT3 A;  3O5K A;  1JNT A;  1HJV A;  2LPV A;  3ARU A;  4MNM A;  5HTG A;  2XP5 A;  1TFV A;  3ARP A;  1GPF A;  1W26 A;  1XRV A;  3TCZ A;  4LAV A;  1TCO C;  3FY1 A;  2F21 A;  4ODO A;  2VCD A;  1FKR A;  4W5U A;  4LAY A;  4Q22 A;  1J4R A;  4QIB A;  1HKM A;  1RD6 A;  3GPK A;  4Z2K A;  4TX0 A;  1X6L A;  1ZL1 A;  3NRK A;  2OLH A;  4HBO A;  3OA5 A;  3EY6 A;  4ZPV R;  3LUO A;  4O2T A;  3WQW A;  2PV1 A;  3PRB A;  1FJD A;  2JZV A;  4JFJ A;  1FKI A;  1W9P A;  3CHD A;  4DRH A;  1ROU A;  3KAG A;  2ESC A;  1UR8 A;  1W1V A;  1NWR A;  5JH8 A;  1HKI A;  4DT4 A;  5DF0 A;  1U79 A;  4ML4 A;  3UI4 A;  2DT2 A;  4J4O A;  1E9L A;  2PPP A;  3G6M A;  4N19 A;  4ODP A;  1FKH A;  3RM9 A;  2Y78 A;  3CGN A;  3O5Q A;  1K9T A;  1IX5 A;  4MTV A;  1LL4 A;  4LAW A;  1FKS A;  3OOB A;  1A7X A;  2PPN A;  3AQU A;  5DIV A;  5GPG A;  5B8I C;  4WJX A;  1KFW A;  5DEZ A;  3ARO A;  2UZ5 A;  3VAW A;  5HW7 A;  2G8Z A;  2O9O A;  2RUD A;  4MNK A;  4ODQ A;  4JYS A;  1FFR A;  1R9H A;  3CHC A;  2PV2 A;  1W9V A;  1QPL A;  2WLZ A;  4MGV A;  1NSG A;  2KGJ A;  1HKJ A;  4FN2 A;  1SR0 A;  3WD4 A;  2DPE A;  2DSZ A;  5D75 A;  2AOS A;  3ALG A;  5BXJ A;  1QZ2 A;  4ITZ A;  2KO7 A;  1HXV A;  4DRP A;  1Q6U A;  3CHE A;  4DWS D;  1NMW A;  3WL0 A;  4IQC A;  3ODK A;  4Z2G A;  4U84 A;  1FAP A;  3O5O A;  3FXY A;  4TNS A;  2A3C A;  4DH0 A;  3O5D A;  4JFI A;  4U86 A;  3ARZ A;  4QT2 A;  3B9A A;  4DZ3 A;  4HAR A;  1JNS A;  3WD3 A;  1LL6 A;  5HW8 A;  2F4E A;  4DRI A;  2RSE A;  1EHN A;  2XP6 A;  3O5F A;  4IT4 A;  1NWT A;  2N87 A;  4P8X A;  1E6Z A;  1LL7 A;  2RUC A;  2FKE A;  4S3K A;  2RQS A;  5I98 A;  4NZC A;  1Q6I A;  4QZV B;  4Z2H A;  4ZPT R;  3ARV A;  1ZK6 A;  4P8V A;  2XPA A;  1E6N A;  1FKF A;  4XAK A;  3WIJ A;  2MLX A;  1FKJ A;  5HKG A;  3ARW A;  1UR9 A;  2PPO A;  1E6P A;  4DZ2 A;  4DIP A;  4ODR A;  1PIN A;  2F2D A;  3PA7 A;  2AWG A;  1WAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...