1FJDA

Human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 12
structure length 104
sequence length 104
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fjdA00
5B8IC 2KR7A 4DT4A 4MSPA 1TCOC 2RURA 4J4NA 3O5EA 2XP5A 5HTGA 1QPLA 4QT3A 4TX0A 1R9HA 1U79A 5HW7A 3O5FA 1D6OA 2VN1A 4DROA 2MLXA 2UZ5A 2F21A 3WH0A 2PV2A 2ZR6A 2PPPA 2ZR4A 3RGCA 1FJDA 4TW6A 4DIPA 4IPXA 2ZQSA 4U84A 4DRJA 1FKGA 3O5MA 1FKDA 3O5GA 4TW7A 1Q6UA 4W9PA 1P5QA 1Q1CA 1J4IA 4U86A 3TC5A 3TCZA 2AWGA 3KAGA 1D7HA 1L1PA 1FKRA 2N87A 1W26A 2RUCA 4TNSA 1KT1A 1JNTA 2IF4A 3O5JA 1FKFA 3KAIA 4LAYA 1BL4A 3JYJA 1D7JA 3GPKA 3IKDA 2OFNA 3I6CA 1M5YA 3VAWA 4JFJA 2VCDA 1JNSA 2RUDA 3NI6A 3O5OA 4DZ3A 1ROUA 3OOBA 1F40A 1JVWA 4MGVA 2ITKA 2Y78A 2XP3A 5HWCA 4W9OA 1PINA 4ITZA 1YW5A 3UQBA 4NNRA 1D7IA 2DG3A 2MNTA 4TW8A 4N19A 5GPGA 1ZCNA 4ODPA 3H9RB 3NRKA 2PBCA 1FKLA 1NSGA 2F2DA 4ODKA 5D75A 4DRIA 4ODLA 3UQAA 1KT0A 1N1AA 4JYSA 3O5DA 2ZQVA 4G50A 5HW8A 4DRQA 5HWBA 2PPNA 4ODNA 3EY6A 3IKGA 4DRMA 3O5PA 4FAPA 3KABA 4C02B 4BF8A 3O5QA 1Y0OA 1F8AB 3IHZA 1FKTA 1B6CA 2KO7A 3ODKA 5DIUA 1EYMA 2KGJA 1J4HA 1FD9A 2Q5AA 3O5KA 3PRBA 1FKJA 4GIVA 4IQCA 4ODMA 5J6EA 1QZ2A 1YATA 2KE0A 2ZQUA 2KFWA 3O5IA 1Q6HA 3NTPA 4JFIA 2XP7A 5BXJA 2MLYA 2RQSA 4DH0A 3B7XA 4FN2A 2PV3A 3KZ7A 2M2AA 5DIVA 4DRPA 2DG9A 2XPAA 3CGMA 4JFKA 3UF8A 4DRHA 4ODOA 5HW6A 4ODRA 1C9HA 3LUOA 2XP6A 5HUAA 2L2SA 3IK8A 3KAHA 3MDYB 2M08A 4QT2A 1Q6IA 3UI4A 4DRNA 1EQ3A 3CGNA 3KCEA 2FKEA 4JFMA 2D9FA 1HXVA 2ZR5A 2MF9A 1J6YA 3JXVA 2XP9A 1FKSA 4DZ2A 5HT1A 2DG4A 2XPBA 3TDBA 1FAPA 4U85A 2XP8A 2M1IA 3KAFA 1QPFA 2LPVA 1PBKA 2XP4A 3O5LA 4J4OA 4LAWA 5I98A 2LKNA 2PPOA 4DRKA 1ZK6A 5HKGA 2ZQTA 2RUQA 3PRDA 4W9QA 1NMVA 3O5RA 2JZVA 2F4EA 1T11A 2PV1A 1A7XA 4ODQA 1FKHA 4TYOA 1ROTA 2K8IA 2LGOA 2LJ4A 2KI3A 4R0XA 4LAVA 1FKBA 3UI5A 2MLZA 3FAPA 2MPHA 4GGQA 3UI6A 4QIBA 4LAXA 1J4RA 4G2PA 2RSEA 1FKKA 2FAPA 1BKFA 1FKIA 1NMWA 3JYMA 3KACA 3PA7A 4JFLA 3KADA 4IQ2A 5DITA 3RFWA 3UQIA 4O2TA
chains in the Genus database with same CATH superfamily
1HJXA 4J4NA 3WD0A 1ZBKA 1R9HA 1E6PA 2MLXA 2UZ5A 2F21A 1W1VA 3B9AA 3WL0A 1FJDA 1UR8A 1NWUA 4DRJA 4ZPVR 1OWQA 1LL7A 2O92A 1E6NA 3WD3A 4W9PA 1P5QA 1Q1CA 4U86A 3CHEA 3TC5A 3TCZA 2WLYA 2N87A 2A3EA 2F23A 1SYTA 1ZBCA 3O5JA 4Z2LA 3OA5A 4DWSD 1HJWA 2OFNA 1M5YA 2PN0A 3PR9A 2VCDA 1JNSA 1GOIA 3NI6A 3O5OA 1F40A 1ROUA 1JVWA 4MGVA 2Y78A 5HWCA 3UQBA 4N19A 4NZCA 5JH8A 1W1YA 3NRKA 2PBCA 1FKLA 4ODKA 4DRIA 1LL4A 1N1AA 3O5DA 4P8VA 4G50A 4DRQA 2PPNA 3O5PA 3KABA 3O5QA 1RD6A 4W5UA 3IHZA 1B6CA 2KO7A 1HKKA 3GTYX 5DIUA 1FD9A 1FKJA 4IQCA 5J6EA 1VF8A 2KE0A 3O5IA 1W9VA 1Q6HA 4ML4A 5HBFA 1HKJA 5BXJA 3AROA 2MLYA 4IT6A 1E9LA 4DH0A 4FN2A 2PV3A 3B9DA 2DG9A 3UF8A 1NWTA 3QOKA 2XP6A 1EHNA 3EIPA 3IK8A 1NWRA 4L3NA 1Q6IA 1EQ3A 4DRNA 2DSWA 1J6YA 5DEZA 1FKSA 4DZ2A 3WKZA 2WM0A 2EULA 1FAPA 4Z2JA 1D2KA 4Z2KA 2LPVA 1X6LA 2XP4A 4J4OA 3WQVA 2P4VA 2LKNA 2PPOA 4DRKA 1ZL1A 2JZVA 2F4EA 1T11A 4R0XA 1FKBA 3UI5A 2DT0A 2B31A 2QF8A 4QIBA 1LJYA 2DSZA 2RSEA 1TFVA 3WD2A 3JYMA 3KACA 1GUVA 4O2TA 2O9OA 5B8IC 2RURA 2XP5A 1QPLA 4QT3A 4TX0A 4UDMA 1UR9A 4KR0B 1E6RA 3RGCA 4TW6A 4IPXA 4MPKA 4TW7A 3WQWA 4ZS6A 1L1PA 2RUCA 1W9PA 4URIA 1LQ0A 1JNTA 2IF4A 4NSBA 1WB0A 1IX5A 3VAWA 4HBEA 3RM9A 4JFJA 2RUDA 3AS3A 4W9OA 1PINA 2A3AA 1YW5A 4ZPTR 4NNRA 1D7IA 4ODPA 4S3JA 3B9EA 1FFRA 2F2DA 3UQAA 1KT0A 1ITXA 4JYSA 4ODNA 3FY1A 4FAPA 4Z2GA 2KGJA 3PRBA 4ODMA 4GIVA 1QZ2A 2XP7A 3B7XA 4JFKA 3CGMA 4ODOA 3CZ8A 2DSVA 5HW6A 3BMBA 1E6ZA 3MDYB 4WKHA 3UI4A 1W1PA 4JFMA 4P8WA 1HXVA 2XP9A 2DG4A 4MAVA 3TDBA 1QPFA 4Z2IA 3CHDA 1PBKA 4LAWA 4QZVB 1LL6A 5HKGA 2ZQTA 3PRDA 4W9QA 4KQZA 3ARVA 2DT3A 1A7XA 1ROTA 1HJVA 4LAVA 4L72B 4GGQA 1FKKA 2FAPA 2WLZA 1BKFA 1FKIA 2FDMA 5DITA 3ARUA 3KADA 1WNOA 3ARWA 3G6LA 3RM8A 4DT4A 4MSPA 1TCOC 2DT2A 4AY1A 4PTMA 1K9TA 2ESCA 1U79A 5HW7A 2DSUA 1D6OA 1WAWA 1XRVA 3B8SA 3AS0A 1LG1A 2PV2A 2PPPA 1SR0A 1JCHB 1LG2A 3O5MA 1FKDA 3O5GA 4MNMA 1Q6UA 3ALGA 1J4IA 3KAGA 4WKFA 2DT1A 1W26A 3AQUA 2PI6A 2WK2A 1E15A 3FXYA 1BL4A 3JYJA 1D7JA 3GPKA 3I6CA 3RM4A 1O6IA 5GPRA 3OOBA 2XP3A 4WKAA 2DG3A 2MNTA 4TW8A 5GPGA 1ZCNA 3H9RB 2OLHA 1W1TA 2G8ZA 4ODLA 4WK9A 2DPEA 5HW8A 3G6MA 4MTVA 4DRMA 1H0IA 3RMEA 1W9UA 1EIBA 1EYMA 2Q5AA 1J4HA 3CH9A 3O5KA 2YBTA 1HKMA 3NTPA 4JFIA 2RQSA 1XHGA 3ARZA 3KZ7A 4DRPA 2A3BA 1H0GA 2XPAA 3W4RA 4DRHA 2B5UB 5DF0A 1C9HA 5HUAA 1GRJA 2L2SA 4DWSB 4XAKA 4ZPWR 3CGNA 4R5EA 4IT4A 2D9FA 2ZR5A 1JNEA 1GPFA 3ARQA 2XPBA 4U85A 5I98A 3O5LA 4P8XA 1NMVA 2PV1A 4ODQA 1E44A 4P8UA 2LGOA 2K8IA 3CHFA 1HKIA 3ALFA 2MLZA 2G41A 3FAPA 3UI6A 2YBUA 4G2PA 3PA7A 4JFLA 3UQIA 1FFQA 2KR7A 3O5EA 5HTGA 3O5FA 2VN1A 4DROA 3WD4A 3WH0A 2ZR6A 2ZR4A 3AS1A 4DIPA 2ZQSA 4U84A 1FKGA 3ARTA 4MNJA 2AWGA 1D7HA 3ARRA 4TNSA 1KT1A 1FKFA 3CHCA 3KAIA 4LAYA 3IKDA 3BXWA 4DZ3A 4DWSC 2ITKA 4ITZA 3WL1A 3ARYA 1NSGA 1OGGA 5D75A 1JNDA 3GU0A 2ZQVA 4LGXA 5HWBA 4MNLA 3EY6A 1CTNA 3IKGA 4C02B 4BF8A 1Y0OA 1F8AB 1FKTA 3ARPA 3ODKA 5DO2A 1YATA 2ZQUA 2KFWA 1NH6A 4DWSA 1ZBVA 5DIVA 2M2AA 1ZU8A 2A3CA 4ODRA 4WJXA 3LUOA 1ZB5A 4HARA 4HBOA 1ZBWA 3KAHA 2M08A 4QT2A 4S3KA 3KCEA 2FKEA 2MF9A 3JXVA 5HT1A 3WD1A 3AS2A 2XP8A 4Q22A 2ETNA 2M1IA 3KAFA 4Z2HA 1NWSA 1OGBA 1EDQA 1ZK6A 2RUQA 4MNKA 3O5RA 3WIJA 1FKHA 4TYOA 1X6NA 2IUZA 2LJ4A 2KI3A 3ARXA 4Q7NA 3PRAA 1KFWA 3ARSA 2MPHA 5GQBA 4LAXA 1J4RA 1NMWA 4WIWA 4IQ2A 2AOSA 3RFWA 1FKRA
chains in the Genus database with same CATH topology
1HJXA 4J4NA 3WD0A 1ZBKA 1R9HA 1E6PA 2MLXA 2UZ5A 2F21A 1W1VA 3B9AA 3WL0A 1FJDA 1UR8A 1NWUA 4DRJA 4ZPVR 1OWQA 1LL7A 2O92A 1E6NA 3WD3A 4W9PA 1P5QA 1Q1CA 4U86A 3CHEA 3TC5A 3TCZA 2WLYA 2N87A 2A3EA 1SYTA 1ZBCA 3O5JA 4Z2LA 3OA5A 4DWSD 1HJWA 2OFNA 1M5YA 3PR9A 2VCDA 1JNSA 1GOIA 3NI6A 3O5OA 1F40A 1ROUA 1JVWA 4MGVA 2Y78A 5HWCA 3UQBA 4N19A 4NZCA 5JH8A 1W1YA 3NRKA 2PBCA 1FKLA 4ODKA 4DRIA 1LL4A 1N1AA 3O5DA 4P8VA 4G50A 4DRQA 2PPNA 3O5PA 3KABA 3O5QA 1RD6A 4W5UA 3IHZA 1B6CA 2KO7A 1HKKA 5DIUA 1FD9A 1FKJA 4IQCA 5J6EA 1VF8A 2KE0A 3O5IA 1W9VA 1Q6HA 4ML4A 5HBFA 1HKJA 5BXJA 3AROA 2MLYA 4IT6A 1E9LA 4DH0A 4FN2A 2PV3A 3B9DA 2DG9A 3UF8A 1NWTA 3QOKA 2XP6A 1EHNA 3IK8A 1NWRA 4L3NA 1Q6IA 1EQ3A 4DRNA 2DSWA 1J6YA 5DEZA 1FKSA 4DZ2A 3WKZA 2WM0A 1FAPA 4Z2JA 1D2KA 4Z2KA 2LPVA 1X6LA 2XP4A 4J4OA 3WQVA 2LKNA 2PPOA 4DRKA 1ZL1A 2JZVA 2F4EA 1T11A 4R0XA 1FKBA 3UI5A 2DT0A 2B31A 2QF8A 4QIBA 1LJYA 2DSZA 2RSEA 1TFVA 3WD2A 3JYMA 3KACA 1GUVA 4O2TA 2O9OA 5B8IC 2RURA 2XP5A 1QPLA 4QT3A 4TX0A 1UR9A 4KR0B 1E6RA 3RGCA 4TW6A 4IPXA 4MPKA 4TW7A 3WQWA 4ZS6A 1L1PA 2RUCA 1W9PA 4URIA 1LQ0A 1JNTA 2IF4A 4NSBA 1WB0A 1IX5A 3VAWA 4HBEA 3RM9A 4JFJA 2RUDA 3AS3A 4W9OA 1PINA 2A3AA 1YW5A 4ZPTR 4NNRA 1D7IA 4ODPA 4S3JA 3B9EA 1FFRA 2F2DA 3UQAA 1KT0A 1ITXA 4JYSA 4ODNA 3FY1A 4FAPA 4Z2GA 2KGJA 3PRBA 4ODMA 4GIVA 1QZ2A 2XP7A 3B7XA 4JFKA 3CGMA 4ODOA 3CZ8A 2DSVA 5HW6A 1E6ZA 3MDYB 4WKHA 3UI4A 1W1PA 4JFMA 4P8WA 1HXVA 2XP9A 2DG4A 4MAVA 3TDBA 1QPFA 4Z2IA 3CHDA 1PBKA 4LAWA 4QZVB 1LL6A 5HKGA 2ZQTA 3PRDA 4W9QA 4KQZA 3ARVA 2DT3A 1A7XA 1ROTA 1HJVA 4LAVA 4L72B 4GGQA 1FKKA 2FAPA 2WLZA 1BKFA 1FKIA 2FDMA 5DITA 3ARUA 3KADA 1WNOA 3ARWA 3G6LA 3RM8A 4DT4A 4MSPA 1TCOC 2DT2A 4AY1A 4PTMA 1K9TA 2ESCA 1U79A 5HW7A 2DSUA 1D6OA 1WAWA 1XRVA 3B8SA 3AS0A 1LG1A 2PV2A 2PPPA 1SR0A 1LG2A 3O5MA 1FKDA 3O5GA 4MNMA 1Q6UA 3ALGA 1J4IA 3KAGA 4WKFA 2DT1A 1W26A 3AQUA 2PI6A 2WK2A 1E15A 3FXYA 1BL4A 3JYJA 1D7JA 3GPKA 3I6CA 3RM4A 1O6IA 5GPRA 3OOBA 2XP3A 4WKAA 2DG3A 2MNTA 4TW8A 5GPGA 1ZCNA 3H9RB 2OLHA 1W1TA 2G8ZA 4ODLA 4WK9A 2DPEA 5HW8A 3G6MA 4MTVA 4DRMA 1H0IA 3RMEA 1W9UA 1EIBA 1EYMA 2Q5AA 1J4HA 3CH9A 3O5KA 2YBTA 1HKMA 3NTPA 4JFIA 2RQSA 1XHGA 3ARZA 3KZ7A 4DRPA 2A3BA 1H0GA 2XPAA 3W4RA 4DRHA 5DF0A 1C9HA 5HUAA 2L2SA 4DWSB 4XAKA 4ZPWR 3CGNA 4R5EA 4IT4A 2D9FA 2ZR5A 1JNEA 1GPFA 3ARQA 2XPBA 4U85A 5I98A 3O5LA 4P8XA 1NMVA 2PV1A 4ODQA 4P8UA 2LGOA 2K8IA 3CHFA 1HKIA 3ALFA 2MLZA 2G41A 3FAPA 3UI6A 2YBUA 4G2PA 3PA7A 4JFLA 3UQIA 1FFQA 2KR7A 3O5EA 5HTGA 3O5FA 2VN1A 4DROA 3WD4A 3WH0A 2ZR6A 2ZR4A 3AS1A 4DIPA 2ZQSA 4U84A 1FKGA 3ARTA 4MNJA 2AWGA 1D7HA 3ARRA 4TNSA 1KT1A 1FKFA 3CHCA 3KAIA 4LAYA 3IKDA 3BXWA 4DZ3A 4DWSC 2ITKA 4ITZA 3WL1A 3ARYA 1NSGA 1OGGA 5D75A 1JNDA 2ZQVA 4LGXA 5HWBA 4MNLA 3EY6A 1CTNA 3IKGA 4C02B 4BF8A 1Y0OA 1F8AB 1FKTA 3ARPA 3ODKA 5DO2A 1YATA 2ZQUA 2KFWA 1NH6A 4DWSA 1ZBVA 5DIVA 2M2AA 1ZU8A 2A3CA 4ODRA 4WJXA 3LUOA 1ZB5A 4HARA 4HBOA 1ZBWA 3KAHA 2M08A 4QT2A 4S3KA 3KCEA 2FKEA 2MF9A 3JXVA 5HT1A 3WD1A 3AS2A 2XP8A 4Q22A 2M1IA 3KAFA 4Z2HA 1NWSA 1OGBA 1EDQA 1ZK6A 2RUQA 4MNKA 3O5RA 3WIJA 1FKHA 4TYOA 1X6NA 2IUZA 2LJ4A 2KI3A 3ARXA 4Q7NA 3PRAA 1KFWA 3ARSA 2MPHA 5GQBA 4LAXA 1J4RA 1NMWA 4WIWA 4IQ2A 2AOSA 3RFWA 1FKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B8I C;  2KR7 A;  4DT4 A;  4MSP A;  1TCO C;  2RUR A;  4J4N A;  3O5E A;  2XP5 A;  5HTG A;  1QPL A;  4QT3 A;  4TX0 A;  1R9H A;  1U79 A;  5HW7 A;  3O5F A;  1D6O A;  2VN1 A;  4DRO A;  2MLX A;  2UZ5 A;  2F21 A;  3WH0 A;  2PV2 A;  2ZR6 A;  2PPP A;  2ZR4 A;  3RGC A;  1FJD A;  4TW6 A;  4DIP A;  4IPX A;  2ZQS A;  4U84 A;  4DRJ A;  1FKG A;  3O5M A;  1FKD A;  3O5G A;  4TW7 A;  1Q6U A;  4W9P A;  1P5Q A;  1Q1C A;  1J4I A;  4U86 A;  3TC5 A;  3TCZ A;  2AWG A;  3KAG A;  1D7H A;  1L1P A;  1FKR A;  2N87 A;  1W26 A;  2RUC A;  4TNS A;  1KT1 A;  1JNT A;  2IF4 A;  3O5J A;  1FKF A;  3KAI A;  4LAY A;  1BL4 A;  3JYJ A;  1D7J A;  3GPK A;  3IKD A;  2OFN A;  3I6C A;  1M5Y A;  3VAW A;  4JFJ A;  2VCD A;  1JNS A;  2RUD A;  3NI6 A;  3O5O A;  4DZ3 A;  1ROU A;  3OOB A;  1F40 A;  1JVW A;  4MGV A;  2ITK A;  2Y78 A;  2XP3 A;  5HWC A;  4W9O A;  1PIN A;  4ITZ A;  1YW5 A;  3UQB A;  4NNR A;  1D7I A;  2DG3 A;  2MNT A;  4TW8 A;  4N19 A;  5GPG A;  1ZCN A;  4ODP A;  3H9R B;  3NRK A;  2PBC A;  1FKL A;  1NSG A;  2F2D A;  4ODK A;  5D75 A;  4DRI A;  4ODL A;  3UQA A;  1KT0 A;  1N1A A;  4JYS A;  3O5D A;  2ZQV A;  4G50 A;  5HW8 A;  4DRQ A;  5HWB A;  2PPN A;  4ODN A;  3EY6 A;  3IKG A;  4DRM A;  3O5P A;  4FAP A;  3KAB A;  4C02 B;  4BF8 A;  3O5Q A;  1Y0O A;  1F8A B;  3IHZ A;  1FKT A;  1B6C A;  2KO7 A;  3ODK A;  5DIU A;  1EYM A;  2KGJ A;  1J4H A;  1FD9 A;  2Q5A A;  3O5K A;  3PRB A;  1FKJ A;  4GIV A;  4IQC A;  4ODM A;  5J6E A;  1QZ2 A;  1YAT A;  2KE0 A;  2ZQU A;  2KFW A;  3O5I A;  1Q6H A;  3NTP A;  4JFI A;  2XP7 A;  5BXJ A;  2MLY A;  2RQS A;  4DH0 A;  3B7X A;  4FN2 A;  2PV3 A;  3KZ7 A;  2M2A A;  5DIV A;  4DRP A;  2DG9 A;  2XPA A;  3CGM A;  4JFK A;  3UF8 A;  4DRH A;  4ODO A;  5HW6 A;  4ODR A;  1C9H A;  3LUO A;  2XP6 A;  5HUA A;  2L2S A;  3IK8 A;  3KAH A;  3MDY B;  2M08 A;  4QT2 A;  1Q6I A;  3UI4 A;  4DRN A;  1EQ3 A;  3CGN A;  3KCE A;  2FKE A;  4JFM A;  2D9F A;  1HXV A;  2ZR5 A;  2MF9 A;  1J6Y A;  3JXV A;  2XP9 A;  1FKS A;  4DZ2 A;  5HT1 A;  2DG4 A;  2XPB A;  3TDB A;  1FAP A;  4U85 A;  2XP8 A;  2M1I A;  3KAF A;  1QPF A;  2LPV A;  1PBK A;  2XP4 A;  3O5L A;  4J4O A;  4LAW A;  5I98 A;  2LKN A;  2PPO A;  4DRK A;  1ZK6 A;  5HKG A;  2ZQT A;  2RUQ A;  3PRD A;  4W9Q A;  1NMV A;  3O5R A;  2JZV A;  2F4E A;  1T11 A;  2PV1 A;  1A7X A;  4ODQ A;  1FKH A;  4TYO A;  1ROT A;  2K8I A;  2LGO A;  2LJ4 A;  2KI3 A;  4R0X A;  4LAV A;  1FKB A;  3UI5 A;  2MLZ A;  3FAP A;  2MPH A;  4GGQ A;  3UI6 A;  4QIB A;  4LAX A;  1J4R A;  4G2P A;  2RSE A;  1FKK A;  2FAP A;  1BKF A;  1FKI A;  1NMW A;  3JYM A;  3KAC A;  3PA7 A;  4JFL A;  3KAD A;  4IQ2 A;  5DIT A;  3RFW A;  3UQI A;  4O2T A; 
#chains in the Genus database with same CATH topology
 1HJX A;  4J4N A;  3WD0 A;  1ZBK A;  1R9H A;  1E6P A;  2MLX A;  2UZ5 A;  2F21 A;  1W1V A;  3B9A A;  3WL0 A;  1FJD A;  1UR8 A;  1NWU A;  4DRJ A;  4ZPV R;  1OWQ A;  1LL7 A;  2O92 A;  1E6N A;  3WD3 A;  4W9P A;  1P5Q A;  1Q1C A;  4U86 A;  3CHE A;  3TC5 A;  3TCZ A;  2WLY A;  2N87 A;  2A3E A;  2F23 A;  1SYT A;  1ZBC A;  3O5J A;  4Z2L A;  3OA5 A;  4DWS D;  1HJW A;  2OFN A;  1M5Y A;  2PN0 A;  3PR9 A;  2VCD A;  1JNS A;  1GOI A;  3NI6 A;  3O5O A;  1F40 A;  1ROU A;  1JVW A;  4MGV A;  2Y78 A;  5HWC A;  3UQB A;  4N19 A;  4NZC A;  5JH8 A;  1W1Y A;  3NRK A;  2PBC A;  1FKL A;  4ODK A;  4DRI A;  1LL4 A;  1N1A A;  3O5D A;  4P8V A;  4G50 A;  4DRQ A;  2PPN A;  3O5P A;  3KAB A;  3O5Q A;  1RD6 A;  4W5U A;  3IHZ A;  1B6C A;  2KO7 A;  1HKK A;  3GTY X;  5DIU A;  1FD9 A;  1FKJ A;  4IQC A;  5J6E A;  1VF8 A;  2KE0 A;  3O5I A;  1W9V A;  1Q6H A;  4ML4 A;  5HBF A;  1HKJ A;  5BXJ A;  3ARO A;  2MLY A;  4IT6 A;  1E9L A;  4DH0 A;  4FN2 A;  2PV3 A;  3B9D A;  2DG9 A;  3UF8 A;  1NWT A;  3QOK A;  2XP6 A;  1EHN A;  3EIP A;  3IK8 A;  1NWR A;  4L3N A;  1Q6I A;  1EQ3 A;  4DRN A;  2DSW A;  1J6Y A;  5DEZ A;  1FKS A;  4DZ2 A;  3WKZ A;  2WM0 A;  2EUL A;  1FAP A;  4Z2J A;  1D2K A;  4Z2K A;  2LPV A;  1X6L A;  2XP4 A;  4J4O A;  3WQV A;  2P4V A;  2LKN A;  2PPO A;  4DRK A;  1ZL1 A;  2JZV A;  2F4E A;  1T11 A;  4R0X A;  1FKB A;  3UI5 A;  2DT0 A;  2B31 A;  2QF8 A;  4QIB A;  1LJY A;  2DSZ A;  2RSE A;  1TFV A;  3WD2 A;  3JYM A;  3KAC A;  1GUV A;  4O2T A;  2O9O A;  5B8I C;  2RUR A;  2XP5 A;  1QPL A;  4QT3 A;  4TX0 A;  4UDM A;  1UR9 A;  4KR0 B;  1E6R A;  3RGC A;  4TW6 A;  4IPX A;  4MPK A;  4TW7 A;  3WQW A;  4ZS6 A;  1L1P A;  2RUC A;  1W9P A;  4URI A;  1LQ0 A;  1JNT A;  2IF4 A;  4NSB A;  1WB0 A;  1IX5 A;  3VAW A;  4HBE A;  3RM9 A;  4JFJ A;  2RUD A;  3AS3 A;  4W9O A;  1PIN A;  2A3A A;  1YW5 A;  4ZPT R;  4NNR A;  1D7I A;  4ODP A;  4S3J A;  3B9E A;  1FFR A;  2F2D A;  3UQA A;  1KT0 A;  1ITX A;  4JYS A;  4ODN A;  3FY1 A;  4FAP A;  4Z2G A;  2KGJ A;  3PRB A;  4ODM A;  4GIV A;  1QZ2 A;  2XP7 A;  3B7X A;  4JFK A;  3CGM A;  4ODO A;  3CZ8 A;  2DSV A;  5HW6 A;  3BMB A;  1E6Z A;  3MDY B;  4WKH A;  3UI4 A;  1W1P A;  4JFM A;  4P8W A;  1HXV A;  2XP9 A;  2DG4 A;  4MAV A;  3TDB A;  1QPF A;  4Z2I A;  3CHD A;  1PBK A;  4LAW A;  4QZV B;  1LL6 A;  5HKG A;  2ZQT A;  3PRD A;  4W9Q A;  4KQZ A;  3ARV A;  2DT3 A;  1A7X A;  1ROT A;  1HJV A;  4LAV A;  4L72 B;  4GGQ A;  1FKK A;  2FAP A;  2WLZ A;  1BKF A;  1FKI A;  2FDM A;  5DIT A;  3ARU A;  3KAD A;  1WNO A;  3ARW A;  3G6L A;  3RM8 A;  4DT4 A;  4MSP A;  1TCO C;  2DT2 A;  4AY1 A;  4PTM A;  1K9T A;  2ESC A;  1U79 A;  5HW7 A;  2DSU A;  1D6O A;  1WAW A;  1XRV A;  3B8S A;  3AS0 A;  1LG1 A;  2PV2 A;  2PPP A;  1SR0 A;  1JCH B;  1LG2 A;  3O5M A;  1FKD A;  3O5G A;  4MNM A;  1Q6U A;  3ALG A;  1J4I A;  3KAG A;  4WKF A;  2DT1 A;  1W26 A;  3AQU A;  2PI6 A;  2WK2 A;  1E15 A;  3FXY A;  1BL4 A;  3JYJ A;  1D7J A;  3GPK A;  3I6C A;  3RM4 A;  1O6I A;  5GPR A;  3OOB A;  2XP3 A;  4WKA A;  2DG3 A;  2MNT A;  4TW8 A;  5GPG A;  1ZCN A;  3H9R B;  2OLH A;  1W1T A;  2G8Z A;  4ODL A;  4WK9 A;  2DPE A;  5HW8 A;  3G6M A;  4MTV A;  4DRM A;  1H0I A;  3RME A;  1W9U A;  1EIB A;  1EYM A;  2Q5A A;  1J4H A;  3CH9 A;  3O5K A;  2YBT A;  1HKM A;  3NTP A;  4JFI A;  2RQS A;  1XHG A;  3ARZ A;  3KZ7 A;  4DRP A;  2A3B A;  1H0G A;  2XPA A;  3W4R A;  4DRH A;  2B5U B;  5DF0 A;  1C9H A;  5HUA A;  1GRJ A;  2L2S A;  4DWS B;  4XAK A;  4ZPW R;  3CGN A;  4R5E A;  4IT4 A;  2D9F A;  2ZR5 A;  1JNE A;  1GPF A;  3ARQ A;  2XPB A;  4U85 A;  5I98 A;  3O5L A;  4P8X A;  1NMV A;  2PV1 A;  4ODQ A;  1E44 A;  4P8U A;  2LGO A;  2K8I A;  3CHF A;  1HKI A;  3ALF A;  2MLZ A;  2G41 A;  3FAP A;  3UI6 A;  2YBU A;  4G2P A;  3PA7 A;  4JFL A;  3UQI A;  1FFQ A;  2KR7 A;  3O5E A;  5HTG A;  3O5F A;  2VN1 A;  4DRO A;  3WD4 A;  3WH0 A;  2ZR6 A;  2ZR4 A;  3AS1 A;  4DIP A;  2ZQS A;  4U84 A;  1FKG A;  3ART A;  4MNJ A;  2AWG A;  1D7H A;  3ARR A;  4TNS A;  1KT1 A;  1FKF A;  3CHC A;  3KAI A;  4LAY A;  3IKD A;  3BXW A;  4DZ3 A;  4DWS C;  2ITK A;  4ITZ A;  3WL1 A;  3ARY A;  1NSG A;  1OGG A;  5D75 A;  1JND A;  3GU0 A;  2ZQV A;  4LGX A;  5HWB A;  4MNL A;  3EY6 A;  1CTN A;  3IKG A;  4C02 B;  4BF8 A;  1Y0O A;  1F8A B;  1FKT A;  3ARP A;  3ODK A;  5DO2 A;  1YAT A;  2ZQU A;  2KFW A;  1NH6 A;  4DWS A;  1ZBV A;  5DIV A;  2M2A A;  1ZU8 A;  2A3C A;  4ODR A;  4WJX A;  3LUO A;  1ZB5 A;  4HAR A;  4HBO A;  1ZBW A;  3KAH A;  2M08 A;  4QT2 A;  4S3K A;  3KCE A;  2FKE A;  2MF9 A;  3JXV A;  5HT1 A;  3WD1 A;  3AS2 A;  2XP8 A;  4Q22 A;  2ETN A;  2M1I A;  3KAF A;  4Z2H A;  1NWS A;  1OGB A;  1EDQ A;  1ZK6 A;  2RUQ A;  4MNK A;  3O5R A;  3WIJ A;  1FKH A;  4TYO A;  1X6N A;  2IUZ A;  2LJ4 A;  2KI3 A;  3ARX A;  4Q7N A;  3PRA A;  1KFW A;  3ARS A;  2MPH A;  5GQB A;  4LAX A;  1J4R A;  1NMW A;  4WIW A;  4IQ2 A;  2AOS A;  3RFW A;  1FKR A; 
#chains in the Genus database with same CATH homology
 1HJX A;  4J4N A;  3WD0 A;  1ZBK A;  1R9H A;  1E6P A;  2MLX A;  2UZ5 A;  2F21 A;  1W1V A;  3B9A A;  3WL0 A;  1FJD A;  1UR8 A;  1NWU A;  4DRJ A;  4ZPV R;  1OWQ A;  1LL7 A;  2O92 A;  1E6N A;  3WD3 A;  4W9P A;  1P5Q A;  1Q1C A;  4U86 A;  3CHE A;  3TC5 A;  3TCZ A;  2WLY A;  2N87 A;  2A3E A;  1SYT A;  1ZBC A;  3O5J A;  4Z2L A;  3OA5 A;  4DWS D;  1HJW A;  2OFN A;  1M5Y A;  3PR9 A;  2VCD A;  1JNS A;  1GOI A;  3NI6 A;  3O5O A;  1F40 A;  1ROU A;  1JVW A;  4MGV A;  2Y78 A;  5HWC A;  3UQB A;  4N19 A;  4NZC A;  5JH8 A;  1W1Y A;  3NRK A;  2PBC A;  1FKL A;  4ODK A;  4DRI A;  1LL4 A;  1N1A A;  3O5D A;  4P8V A;  4G50 A;  4DRQ A;  2PPN A;  3O5P A;  3KAB A;  3O5Q A;  1RD6 A;  4W5U A;  3IHZ A;  1B6C A;  2KO7 A;  1HKK A;  5DIU A;  1FD9 A;  1FKJ A;  4IQC A;  5J6E A;  1VF8 A;  2KE0 A;  3O5I A;  1W9V A;  1Q6H A;  4ML4 A;  5HBF A;  1HKJ A;  5BXJ A;  3ARO A;  2MLY A;  4IT6 A;  1E9L A;  4DH0 A;  4FN2 A;  2PV3 A;  3B9D A;  2DG9 A;  3UF8 A;  1NWT A;  3QOK A;  2XP6 A;  1EHN A;  3IK8 A;  1NWR A;  4L3N A;  1Q6I A;  1EQ3 A;  4DRN A;  2DSW A;  1J6Y A;  5DEZ A;  1FKS A;  4DZ2 A;  3WKZ A;  2WM0 A;  1FAP A;  4Z2J A;  1D2K A;  4Z2K A;  2LPV A;  1X6L A;  2XP4 A;  4J4O A;  3WQV A;  2LKN A;  2PPO A;  4DRK A;  1ZL1 A;  2JZV A;  2F4E A;  1T11 A;  4R0X A;  1FKB A;  3UI5 A;  2DT0 A;  2B31 A;  2QF8 A;  4QIB A;  1LJY A;  2DSZ A;  2RSE A;  1TFV A;  3WD2 A;  3JYM A;  3KAC A;  1GUV A;  4O2T A;  2O9O A;  5B8I C;  2RUR A;  2XP5 A;  1QPL A;  4QT3 A;  4TX0 A;  1UR9 A;  4KR0 B;  1E6R A;  3RGC A;  4TW6 A;  4IPX A;  4MPK A;  4TW7 A;  3WQW A;  4ZS6 A;  1L1P A;  2RUC A;  1W9P A;  4URI A;  1LQ0 A;  1JNT A;  2IF4 A;  4NSB A;  1WB0 A;  1IX5 A;  3VAW A;  4HBE A;  3RM9 A;  4JFJ A;  2RUD A;  3AS3 A;  4W9O A;  1PIN A;  2A3A A;  1YW5 A;  4ZPT R;  4NNR A;  1D7I A;  4ODP A;  4S3J A;  3B9E A;  1FFR A;  2F2D A;  3UQA A;  1KT0 A;  1ITX A;  4JYS A;  4ODN A;  3FY1 A;  4FAP A;  4Z2G A;  2KGJ A;  3PRB A;  4ODM A;  4GIV A;  1QZ2 A;  2XP7 A;  3B7X A;  4JFK A;  3CGM A;  4ODO A;  3CZ8 A;  2DSV A;  5HW6 A;  1E6Z A;  3MDY B;  4WKH A;  3UI4 A;  1W1P A;  4JFM A;  4P8W A;  1HXV A;  2XP9 A;  2DG4 A;  4MAV A;  3TDB A;  1QPF A;  4Z2I A;  3CHD A;  1PBK A;  4LAW A;  4QZV B;  1LL6 A;  5HKG A;  2ZQT A;  3PRD A;  4W9Q A;  4KQZ A;  3ARV A;  2DT3 A;  1A7X A;  1ROT A;  1HJV A;  4LAV A;  4L72 B;  4GGQ A;  1FKK A;  2FAP A;  2WLZ A;  1BKF A;  1FKI A;  2FDM A;  5DIT A;  3ARU A;  3KAD A;  1WNO A;  3ARW A;  3G6L A;  3RM8 A;  4DT4 A;  4MSP A;  1TCO C;  2DT2 A;  4AY1 A;  4PTM A;  1K9T A;  2ESC A;  1U79 A;  5HW7 A;  2DSU A;  1D6O A;  1WAW A;  1XRV A;  3B8S A;  3AS0 A;  1LG1 A;  2PV2 A;  2PPP A;  1SR0 A;  1LG2 A;  3O5M A;  1FKD A;  3O5G A;  4MNM A;  1Q6U A;  3ALG A;  1J4I A;  3KAG A;  4WKF A;  2DT1 A;  1W26 A;  3AQU A;  2PI6 A;  2WK2 A;  1E15 A;  3FXY A;  1BL4 A;  3JYJ A;  1D7J A;  3GPK A;  3I6C A;  3RM4 A;  1O6I A;  5GPR A;  3OOB A;  2XP3 A;  4WKA A;  2DG3 A;  2MNT A;  4TW8 A;  5GPG A;  1ZCN A;  3H9R B;  2OLH A;  1W1T A;  2G8Z A;  4ODL A;  4WK9 A;  2DPE A;  5HW8 A;  3G6M A;  4MTV A;  4DRM A;  1H0I A;  3RME A;  1W9U A;  1EIB A;  1EYM A;  2Q5A A;  1J4H A;  3CH9 A;  3O5K A;  2YBT A;  1HKM A;  3NTP A;  4JFI A;  2RQS A;  1XHG A;  3ARZ A;  3KZ7 A;  4DRP A;  2A3B A;  1H0G A;  2XPA A;  3W4R A;  4DRH A;  5DF0 A;  1C9H A;  5HUA A;  2L2S A;  4DWS B;  4XAK A;  4ZPW R;  3CGN A;  4R5E A;  4IT4 A;  2D9F A;  2ZR5 A;  1JNE A;  1GPF A;  3ARQ A;  2XPB A;  4U85 A;  5I98 A;  3O5L A;  4P8X A;  1NMV A;  2PV1 A;  4ODQ A;  4P8U A;  2LGO A;  2K8I A;  3CHF A;  1HKI A;  3ALF A;  2MLZ A;  2G41 A;  3FAP A;  3UI6 A;  2YBU A;  4G2P A;  3PA7 A;  4JFL A;  3UQI A;  1FFQ A;  2KR7 A;  3O5E A;  5HTG A;  3O5F A;  2VN1 A;  4DRO A;  3WD4 A;  3WH0 A;  2ZR6 A;  2ZR4 A;  3AS1 A;  4DIP A;  2ZQS A;  4U84 A;  1FKG A;  3ART A;  4MNJ A;  2AWG A;  1D7H A;  3ARR A;  4TNS A;  1KT1 A;  1FKF A;  3CHC A;  3KAI A;  4LAY A;  3IKD A;  3BXW A;  4DZ3 A;  4DWS C;  2ITK A;  4ITZ A;  3WL1 A;  3ARY A;  1NSG A;  1OGG A;  5D75 A;  1JND A;  2ZQV A;  4LGX A;  5HWB A;  4MNL A;  3EY6 A;  1CTN A;  3IKG A;  4C02 B;  4BF8 A;  1Y0O A;  1F8A B;  1FKT A;  3ARP A;  3ODK A;  5DO2 A;  1YAT A;  2ZQU A;  2KFW A;  1NH6 A;  4DWS A;  1ZBV A;  5DIV A;  2M2A A;  1ZU8 A;  2A3C A;  4ODR A;  4WJX A;  3LUO A;  1ZB5 A;  4HAR A;  4HBO A;  1ZBW A;  3KAH A;  2M08 A;  4QT2 A;  4S3K A;  3KCE A;  2FKE A;  2MF9 A;  3JXV A;  5HT1 A;  3WD1 A;  3AS2 A;  2XP8 A;  4Q22 A;  2M1I A;  3KAF A;  4Z2H A;  1NWS A;  1OGB A;  1EDQ A;  1ZK6 A;  2RUQ A;  4MNK A;  3O5R A;  3WIJ A;  1FKH A;  4TYO A;  1X6N A;  2IUZ A;  2LJ4 A;  2KI3 A;  3ARX A;  4Q7N A;  3PRA A;  1KFW A;  3ARS A;  2MPH A;  5GQB A;  4LAX A;  1J4R A;  1NMW A;  4WIW A;  4IQ2 A;  2AOS A;  3RFW A;  1FKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...