1FJDA

Human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL PROLYL CIS/TRANS ISOMERASE (PPIASE)
total genus 12
structure length 104
sequence length 104
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fjdA00
3O5EA 1D7HA 3O5PA 2KR7A 4ODNA 4R0XA 2OFNA 2ITKA 2XP7A 1NMWA 3LUOA 2LKNA 3RFWA 4W9OA 3O5OA 2LPVA 2ZR5A 2PV3A 1Q6UA 3JYJA 4ODRA 4TW7A 1TCOC 1FAPA 4IQCA 4DRQA 2RUDA 4ODQA 1ZCNA 3UF8A 5HUAA 3UI4A 1D7JA 2RSEA 5D75A 2LJ4A 1D6OA 1FKTA 2KE0A 4BF8A 3KAIA 4QT3A 4ODMA 2XPAA 5DIVA 4ODOA 4DT4A 5J6EA 4LAWA 1HXVA 1QPLA 2XP8A 3TC5A 2KFWA 4FN2A 1FKLA 3O5LA 3UI6A 2KGJA 1P5QA 2PPPA 3UQIA 2RQSA 3O5DA 4DZ2A 1FKJA 2LGOA 2Y78A 1YATA 2XP3A 4TYOA 2XP4A 4DRJA 3KAFA 3O5FA 1BL4A 3IK8A 4DRIA 2F4EA 1FKSA 3KACA 3UQBA 1KT1A 2FKEA 1FKBA 2KI3A 2MLYA 2RUQA 4J4OA 4C02B 5B8IC 5BXJA 2MLZA 1FKKA 2XP5A 2D9FA 2UZ5A 4LAXA 3O5MA 4G50A 1N1AA 3CGMA 4DRMA 4DRPA 1YW5A 2DG4A 4GIVA 1FD9A 3O5IA 1FKDA 1JNTA 2XPBA 4JFMA 2MLXA 2RUCA 3CGNA 3OOBA 1A7XA 5HW8A 1J4IA 4JFLA 1J4HA 1QZ2A 2L2SA 1Q6HA 3KADA 4ITZA 4QIBA 3WH0A 4DIPA 4DROA 2XP9A 1J4RA 5GPGA 3O5KA 3IKDA 4NNRA 3I6CA 4DRHA 3UQAA 4ODLA 2PV1A 2M1IA 1JVWA 1ZK6A 4TW8A 1ROUA 5HWCA 2F21A 1FKRA 3JXVA 3KCEA 4U84A 3O5GA 4O2TA 4FAPA 1M5YA 1BKFA 2MF9A 4TW6A 5DITA 4J4NA 3B7XA 1Q6IA 2M08A 4JFKA 2Q5AA 4ODPA 3TDBA 1Y0OA 2PBCA 5HW6A 4IPXA 4GGQA 2ZQUA 4MSPA 2KO7A 2ZQTA 1NMVA 3H9RB 1C9HA 1NSGA 1FKIA 1KT0A 3KAHA 2JZVA 3MDYB 3NI6A 3O5QA 3PA7A 3PRDA 4ODKA 2M2AA 5HKGA 4N19A 1D7IA 1EQ3A 4JFJA 2MPHA 5HT1A 3EY6A 3PRBA 2DG3A 4W9QA 1L1PA 4U85A 2F2DA 2ZQSA 4IQ2A 4W9PA 2XP6A 1J6YA 2ZQVA 4DH0A 4MGVA 1FJDA 4JFIA 2MNTA 3TCZA 1T11A 4TX0A 2ZR6A 1R9HA 3IHZA 1F8AB 5HW7A 5HWBA 5I98A 1FKFA 1U79A 3IKGA 4LAYA 3UI5A 1FKGA 1QPFA 2K8IA 3KZ7A 3KABA 1F40A 1B6CA 2AWGA 3GPKA 2IF4A 3RGCA 1JNSA 4QT2A 2FAPA 2RURA 3O5JA 4LAVA 3O5RA 4DRNA 1PINA 1ROTA 4DZ3A 5HTGA 2DG9A 2PPNA 2VN1A 3JYMA 2PV2A 3VAWA 1FKHA 2VCDA 3NRKA 4JYSA 4U86A 2N87A 3ODKA 2PPOA 2ZR4A 3FAPA 4G2PA 3NTPA 1Q1CA 4DRKA 1EYMA 3KAGA 5DIUA 1PBKA 1W26A 4TNSA
chains in the Genus database with same CATH superfamily
1D7HA 2KR7A 4R0XA 1NWSA 3ARQA 3B9EA 2LPVA 4ODRA 4NZCA 3ARRA 2YBUA 4IQCA 3AS2A 5HUAA 1ZCNA 3UF8A 3AS1A 4ZPTR 1OWQA 4HBEA 1E6PA 4QT3A 2PI6A 2KGJA 3UQIA 4Z2IA 2LGOA 1LG1A 3WKZA 2F4EA 1H0IA 4C02B 2RUQA 5B8IC 5BXJA 4J4OA 4PTMA 3O5MA 1NWRA 4G50A 4Q22A 2A3AA 3CGMA 4GIVA 1FKDA 2WM0A 4DWSB 2MLXA 3BXWA 4URIA 1NWUA 1Q6HA 2DT0A 2XP9A 1J4RA 3ARTA 1UR9A 1ZB5A 2F21A 3JXVA 4O2TA 4ZPVR 4Z2HA 2MF9A 1OGGA 3TDBA 2M08A 2Q5AA 3WD1A 1C9HA 1NSGA 1KT0A 1LJYA 4ODKA 1EQ3A 3EY6A 3FY1A 4W9QA 1ZBKA 4R5EA 3WD4A 3ALGA 2F2DA 2ZQSA 4IQ2A 3WL1A 4XAKA 1J6YA 2ZQVA 1GOIA 4DH0A 1VF8A 2MNTA 4TX0A 4ZS6A 1LG2A 2K8IA 1JCHB 1RD6A 2DT2A 1F40A 1K9TA 1IX5A 3RMEA 3O5JA 3O5RA 4DWSA 4DZ3A 1W1PA 2DG9A 3RM9A 3ARWA 2VN1A 3VAWA 2PV2A 1XRVA 3NRKA 2VCDA 2FDMA 4JYSA 4L3NA 3ODKA 2B31A 1H0GA 3KAGA 5DIUA 4TNSA 1W1TA 1CTNA 3LUOA 2LKNA 4W9OA 2DSUA 2PV3A 3JYJA 4HARA 1E44A 4TW7A 4MAVA 2RSEA 1FKTA 2QF8A 1FFRA 4MPKA 4ODMA 2XPAA 5DIVA 4DT4A 1NH6A 1UR8A 1HXVA 2AOSA 1W1VA 2DSZA 2KFWA 4FN2A 3AROA 1FKLA 1X6NA 3O5LA 1ZU8A 1P5QA 2Y78A 2XP3A 4TYOA 4DRJA 3O5FA 1EHNA 5GPRA 2FKEA 5I98A 2MLYA 2MLZA 4Q7NA 4NSBA 2DG4A 2G8ZA 1FD9A 3O5IA 1JNTA 2RUCA 1HKMA 3RM8A 1HJVA 1J4IA 4JFLA 4ITZA 4QIBA 3KADA 3WH0A 4DIPA 5GPGA 3O5KA 3IKDA 1SYTA 3I6CA 4DRHA 4ODLA 2PV1A 1TFVA 4TW8A 1ROUA 4MNLA 4S3KA 4U84A 4IT6A 1BKFA 4TW6A 1Q6IA 2PBCA 4MNMA 4IPXA 4W5UA 4MSPA 2KO7A 3H9RB 3W4RA 2WK2A 3ARVA 3O5QA 5HKGA 2P4VA 1D7IA 2MPHA 5HT1A 3PRBA 4W9PA 3WD3A 2OLHA 1FJDA 1T11A 3IHZA 1R9HA 5HW7A 3ARSA 1U79A 3IKGA 4LAYA 2DT3A 1ZBVA 4DWSC 3UI5A 3KZ7A 2AWGA 3GPKA 2FAPA 2RURA 1ROTA 1ZL1A 4WK9A 1Q1CA 1W26A 4P8WA 3O5EA 5DEZA 3O5PA 2ITKA 2XP7A 1NMWA 5GQBA 3RFWA 3O5OA 3CHCA 2YBTA 4ZPWR 1TCOC 1FAPA 1JNEA 1W1YA 2DPEA 4LGXA 1GRJA 4ODQA 4DRQA 4S3JA 5JH8A 5D75A 1HKIA 3WD0A 2LJ4A 2KE0A 2F23A 3KAIA 3RM4A 3BMBA 1W9UA 3PR9A 3TC5A 1GUVA 3UI6A 2PPPA 3ARPA 1YATA 3ARUA 3WD2A 1WNOA 3IK8A 4DRIA 3KACA 3UQBA 1KT1A 2KI3A 2IUZA 2UZ5A 4LAXA 3CHFA 1N1AA 2PN0A 1YW5A 4ML4A 1E6RA 5DF0A 4JFMA 1W9VA 1E9LA 4DWSD 3OOBA 1A7XA 5HW8A 1J4HA 1QZ2A 2L2SA 4DROA 4NNRA 1SR0A 5HWCA 4P8UA 4MTVA 3KCEA 3O5GA 5HBFA 1M5YA 3ARYA 5DITA 4WKAA 4ODPA 3B7XA 4GGQA 2ZQTA 4HBOA 2JZVA 3PRDA 4AY1A 2DSWA 4JFJA 3CHDA 1D2KA 2A3BA 3ALFA 2XP6A 4WJXA 3AS0A 4L72B 4JFIA 2WLYA 3OA5A 5DO2A 3TCZA 1E6NA 3GU0A 1F8AB 1LL7A 1NWTA 3GTYX 1HJXA 1FKFA 2EULA 2ESCA 1FKGA 3QOKA 1B6CA 1JNSA 1ZBWA 4LAVA 4DRNA 5HTGA 1PINA 3WIJA 2PPNA 3AQUA 2ZR4A 1E6ZA 3FAPA 1HKKA 4DRKA 1PBKA 1KFWA 1WAWA 3CZ8A 4ODNA 2OFNA 4KQZA 2ZR5A 1Q6UA 4WKFA 1W9PA 2RUDA 3UI4A 1D7JA 1D6OA 2A3EA 4BF8A 4ODOA 5J6EA 4LAWA 1QPLA 2O9OA 2XP8A 4Z2JA 3B9DA 1LQ0A 2RQSA 3O5DA 1ITXA 4DZ2A 1FKJA 4Z2GA 2XP4A 3KAFA 1BL4A 1HJWA 1FKSA 1FKBA 2XP5A 1FKKA 2D9FA 1GPFA 4P8VA 4DRMA 1O6IA 4DRPA 1OGBA 1E15A 1LL6A 1EIBA 2XPBA 4QZVB 1JNDA 2ETNA 3CGNA 2B5UB 3WL0A 2DT1A 3CHEA 4P8XA 3UQAA 3PRAA 2M1IA 3ARXA 1JVWA 4MNJA 1ZK6A 1FKRA 3G6MA 2O92A 4Z2LA 3B8SA 1LL4A 4Z2KA 3WQVA 4FAPA 1HKJA 4J4NA 4JFKA 4WIWA 5HW6A 1Y0OA 3WQWA 2ZQUA 3FXYA 4WKHA 4MNKA 1NMVA 1FKIA 3KAHA 3MDYB 3NI6A 3PA7A 2M2AA 4N19A 1EDQA 3B9AA 3ARZA 2DG3A 1L1PA 2G41A 4U85A 3EIPA 4UDMA 4KR0B 4MGVA 5HWBA 2ZR6A 1X6LA 3CH9A 3AS3A 1QPFA 2WLZA 3KABA 2DSVA 2A3CA 1ZBCA 1WB0A 2IF4A 3RGCA 4QT2A 4IT4A 3JYMA 1FKHA 3G6LA 1XHGA 4U86A 2N87A 2PPOA 4G2PA 3NTPA 1EYMA 1FFQA
chains in the Genus database with same CATH topology
1D7HA 2KR7A 4R0XA 1NWSA 3ARQA 3B9EA 2LPVA 4ODRA 4NZCA 3ARRA 2YBUA 4IQCA 3AS2A 5HUAA 1ZCNA 3UF8A 3AS1A 4ZPTR 1OWQA 4HBEA 1E6PA 4QT3A 2PI6A 2KGJA 3UQIA 4Z2IA 2LGOA 1LG1A 3WKZA 2F4EA 1H0IA 4C02B 2RUQA 5B8IC 5BXJA 4J4OA 4PTMA 3O5MA 1NWRA 4G50A 4Q22A 2A3AA 3CGMA 4GIVA 1FKDA 2WM0A 4DWSB 2MLXA 3BXWA 4URIA 1NWUA 1Q6HA 2DT0A 2XP9A 1J4RA 3ARTA 1UR9A 1ZB5A 2F21A 3JXVA 4O2TA 4ZPVR 4Z2HA 2MF9A 1OGGA 3TDBA 2M08A 2Q5AA 3WD1A 1C9HA 1NSGA 1KT0A 1LJYA 4ODKA 1EQ3A 3EY6A 3FY1A 4W9QA 1ZBKA 4R5EA 3WD4A 3ALGA 2F2DA 2ZQSA 4IQ2A 3WL1A 4XAKA 1J6YA 2ZQVA 1GOIA 4DH0A 1VF8A 2MNTA 4TX0A 4ZS6A 1LG2A 2K8IA 1RD6A 2DT2A 1F40A 1K9TA 1IX5A 3RMEA 3O5JA 3O5RA 4DWSA 4DZ3A 1W1PA 2DG9A 3RM9A 3ARWA 2VN1A 3VAWA 2PV2A 1XRVA 3NRKA 2VCDA 2FDMA 4JYSA 4L3NA 3ODKA 2B31A 1H0GA 3KAGA 5DIUA 4TNSA 1W1TA 1CTNA 3LUOA 2LKNA 4W9OA 2DSUA 2PV3A 3JYJA 4HARA 4TW7A 4MAVA 2RSEA 1FKTA 2QF8A 1FFRA 4MPKA 4ODMA 2XPAA 5DIVA 4DT4A 1NH6A 1UR8A 1HXVA 2AOSA 1W1VA 2DSZA 2KFWA 4FN2A 3AROA 1FKLA 1X6NA 3O5LA 1ZU8A 1P5QA 2Y78A 2XP3A 4TYOA 4DRJA 3O5FA 1EHNA 5GPRA 2FKEA 5I98A 2MLYA 2MLZA 4Q7NA 4NSBA 2DG4A 2G8ZA 1FD9A 3O5IA 1JNTA 2RUCA 1HKMA 3RM8A 1HJVA 1J4IA 4JFLA 4ITZA 4QIBA 3KADA 3WH0A 4DIPA 5GPGA 3O5KA 3IKDA 1SYTA 3I6CA 4DRHA 4ODLA 2PV1A 1TFVA 4TW8A 1ROUA 4MNLA 4S3KA 4U84A 4IT6A 1BKFA 4TW6A 1Q6IA 2PBCA 4MNMA 4IPXA 4W5UA 4MSPA 2KO7A 3H9RB 3W4RA 2WK2A 3ARVA 3O5QA 5HKGA 1D7IA 2MPHA 5HT1A 3PRBA 4W9PA 3WD3A 2OLHA 1FJDA 1T11A 3IHZA 1R9HA 5HW7A 3ARSA 1U79A 3IKGA 4LAYA 2DT3A 1ZBVA 4DWSC 3UI5A 3KZ7A 2AWGA 3GPKA 2FAPA 2RURA 1ROTA 1ZL1A 4WK9A 1Q1CA 1W26A 4P8WA 3O5EA 5DEZA 3O5PA 2ITKA 2XP7A 1NMWA 5GQBA 3RFWA 3O5OA 3CHCA 2YBTA 4ZPWR 1TCOC 1FAPA 1JNEA 1W1YA 2DPEA 4LGXA 4ODQA 4DRQA 4S3JA 5JH8A 5D75A 1HKIA 3WD0A 2LJ4A 2KE0A 3KAIA 3RM4A 1W9UA 3PR9A 3TC5A 1GUVA 3UI6A 2PPPA 3ARPA 1YATA 3ARUA 3WD2A 1WNOA 3IK8A 4DRIA 3KACA 3UQBA 1KT1A 2KI3A 2IUZA 2UZ5A 4LAXA 3CHFA 1N1AA 1YW5A 4ML4A 1E6RA 5DF0A 4JFMA 1W9VA 1E9LA 4DWSD 3OOBA 1A7XA 5HW8A 1J4HA 1QZ2A 2L2SA 4DROA 4NNRA 1SR0A 5HWCA 4P8UA 4MTVA 3KCEA 3O5GA 5HBFA 1M5YA 3ARYA 5DITA 4WKAA 4ODPA 3B7XA 4GGQA 2ZQTA 4HBOA 2JZVA 3PRDA 4AY1A 2DSWA 4JFJA 3CHDA 1D2KA 2A3BA 3ALFA 2XP6A 4WJXA 3AS0A 4L72B 4JFIA 2WLYA 3OA5A 5DO2A 3TCZA 1E6NA 1F8AB 1LL7A 1NWTA 1HJXA 1FKFA 2ESCA 1FKGA 3QOKA 1B6CA 1JNSA 1ZBWA 4LAVA 4DRNA 5HTGA 1PINA 3WIJA 2PPNA 3AQUA 2ZR4A 1E6ZA 3FAPA 1HKKA 4DRKA 1PBKA 1KFWA 1WAWA 3CZ8A 4ODNA 2OFNA 4KQZA 2ZR5A 1Q6UA 4WKFA 1W9PA 2RUDA 3UI4A 1D7JA 1D6OA 2A3EA 4BF8A 4ODOA 5J6EA 4LAWA 1QPLA 2O9OA 2XP8A 4Z2JA 3B9DA 1LQ0A 2RQSA 3O5DA 1ITXA 4DZ2A 1FKJA 4Z2GA 2XP4A 3KAFA 1BL4A 1HJWA 1FKSA 1FKBA 2XP5A 1FKKA 2D9FA 1GPFA 4P8VA 4DRMA 1O6IA 4DRPA 1OGBA 1E15A 1LL6A 1EIBA 2XPBA 4QZVB 1JNDA 3CGNA 3WL0A 2DT1A 3CHEA 4P8XA 3UQAA 3PRAA 2M1IA 3ARXA 1JVWA 4MNJA 1ZK6A 1FKRA 3G6MA 2O92A 4Z2LA 3B8SA 1LL4A 4Z2KA 3WQVA 4FAPA 1HKJA 4J4NA 4JFKA 4WIWA 5HW6A 1Y0OA 3WQWA 2ZQUA 3FXYA 4WKHA 4MNKA 1NMVA 1FKIA 3KAHA 3MDYB 3NI6A 3PA7A 2M2AA 4N19A 1EDQA 3B9AA 3ARZA 2DG3A 1L1PA 2G41A 4U85A 4KR0B 4MGVA 5HWBA 2ZR6A 1X6LA 3CH9A 3AS3A 1QPFA 2WLZA 3KABA 2DSVA 2A3CA 1ZBCA 1WB0A 2IF4A 3RGCA 4QT2A 4IT4A 3JYMA 1FKHA 3G6LA 1XHGA 4U86A 2N87A 2PPOA 4G2PA 3NTPA 1EYMA 1FFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5E A;  1D7H A;  3O5P A;  2KR7 A;  4ODN A;  4R0X A;  2OFN A;  2ITK A;  2XP7 A;  1NMW A;  3LUO A;  2LKN A;  3RFW A;  4W9O A;  3O5O A;  2LPV A;  2ZR5 A;  2PV3 A;  1Q6U A;  3JYJ A;  4ODR A;  4TW7 A;  1TCO C;  1FAP A;  4IQC A;  4DRQ A;  2RUD A;  4ODQ A;  1ZCN A;  3UF8 A;  5HUA A;  3UI4 A;  1D7J A;  2RSE A;  5D75 A;  2LJ4 A;  1D6O A;  1FKT A;  2KE0 A;  4BF8 A;  3KAI A;  4QT3 A;  4ODM A;  2XPA A;  5DIV A;  4ODO A;  4DT4 A;  5J6E A;  4LAW A;  1HXV A;  1QPL A;  2XP8 A;  3TC5 A;  2KFW A;  4FN2 A;  1FKL A;  3O5L A;  3UI6 A;  2KGJ A;  1P5Q A;  2PPP A;  3UQI A;  2RQS A;  3O5D A;  4DZ2 A;  1FKJ A;  2LGO A;  2Y78 A;  1YAT A;  2XP3 A;  4TYO A;  2XP4 A;  4DRJ A;  3KAF A;  3O5F A;  1BL4 A;  3IK8 A;  4DRI A;  2F4E A;  1FKS A;  3KAC A;  3UQB A;  1KT1 A;  2FKE A;  1FKB A;  2KI3 A;  2MLY A;  2RUQ A;  4J4O A;  4C02 B;  5B8I C;  5BXJ A;  2MLZ A;  1FKK A;  2XP5 A;  2D9F A;  2UZ5 A;  4LAX A;  3O5M A;  4G50 A;  1N1A A;  3CGM A;  4DRM A;  4DRP A;  1YW5 A;  2DG4 A;  4GIV A;  1FD9 A;  3O5I A;  1FKD A;  1JNT A;  2XPB A;  4JFM A;  2MLX A;  2RUC A;  3CGN A;  3OOB A;  1A7X A;  5HW8 A;  1J4I A;  4JFL A;  1J4H A;  1QZ2 A;  2L2S A;  1Q6H A;  3KAD A;  4ITZ A;  4QIB A;  3WH0 A;  4DIP A;  4DRO A;  2XP9 A;  1J4R A;  5GPG A;  3O5K A;  3IKD A;  4NNR A;  3I6C A;  4DRH A;  3UQA A;  4ODL A;  2PV1 A;  2M1I A;  1JVW A;  1ZK6 A;  4TW8 A;  1ROU A;  5HWC A;  2F21 A;  1FKR A;  3JXV A;  3KCE A;  4U84 A;  3O5G A;  4O2T A;  4FAP A;  1M5Y A;  1BKF A;  2MF9 A;  4TW6 A;  5DIT A;  4J4N A;  3B7X A;  1Q6I A;  2M08 A;  4JFK A;  2Q5A A;  4ODP A;  3TDB A;  1Y0O A;  2PBC A;  5HW6 A;  4IPX A;  4GGQ A;  2ZQU A;  4MSP A;  2KO7 A;  2ZQT A;  1NMV A;  3H9R B;  1C9H A;  1NSG A;  1FKI A;  1KT0 A;  3KAH A;  2JZV A;  3MDY B;  3NI6 A;  3O5Q A;  3PA7 A;  3PRD A;  4ODK A;  2M2A A;  5HKG A;  4N19 A;  1D7I A;  1EQ3 A;  4JFJ A;  2MPH A;  5HT1 A;  3EY6 A;  3PRB A;  2DG3 A;  4W9Q A;  1L1P A;  4U85 A;  2F2D A;  2ZQS A;  4IQ2 A;  4W9P A;  2XP6 A;  1J6Y A;  2ZQV A;  4DH0 A;  4MGV A;  1FJD A;  4JFI A;  2MNT A;  3TCZ A;  1T11 A;  4TX0 A;  2ZR6 A;  1R9H A;  3IHZ A;  1F8A B;  5HW7 A;  5HWB A;  5I98 A;  1FKF A;  1U79 A;  3IKG A;  4LAY A;  3UI5 A;  1FKG A;  1QPF A;  2K8I A;  3KZ7 A;  3KAB A;  1F40 A;  1B6C A;  2AWG A;  3GPK A;  2IF4 A;  3RGC A;  1JNS A;  4QT2 A;  2FAP A;  2RUR A;  3O5J A;  4LAV A;  3O5R A;  4DRN A;  1PIN A;  1ROT A;  4DZ3 A;  5HTG A;  2DG9 A;  2PPN A;  2VN1 A;  3JYM A;  2PV2 A;  3VAW A;  1FKH A;  2VCD A;  3NRK A;  4JYS A;  4U86 A;  2N87 A;  3ODK A;  2PPO A;  2ZR4 A;  3FAP A;  4G2P A;  3NTP A;  1Q1C A;  4DRK A;  1EYM A;  3KAG A;  5DIU A;  1PBK A;  1W26 A;  4TNS A; 
#chains in the Genus database with same CATH topology
 1D7H A;  2KR7 A;  4R0X A;  1NWS A;  3ARQ A;  3B9E A;  2LPV A;  4ODR A;  4NZC A;  3ARR A;  2YBU A;  4IQC A;  3AS2 A;  5HUA A;  1ZCN A;  3UF8 A;  3AS1 A;  4ZPT R;  1OWQ A;  4HBE A;  1E6P A;  4QT3 A;  2PI6 A;  2KGJ A;  3UQI A;  4Z2I A;  2LGO A;  1LG1 A;  3WKZ A;  2F4E A;  1H0I A;  4C02 B;  2RUQ A;  5B8I C;  5BXJ A;  4J4O A;  4PTM A;  3O5M A;  1NWR A;  4G50 A;  4Q22 A;  2A3A A;  3CGM A;  4GIV A;  1FKD A;  2WM0 A;  4DWS B;  2MLX A;  3BXW A;  4URI A;  1NWU A;  1Q6H A;  2DT0 A;  2XP9 A;  1J4R A;  3ART A;  1UR9 A;  1ZB5 A;  2F21 A;  3JXV A;  4O2T A;  4ZPV R;  4Z2H A;  2MF9 A;  1OGG A;  3TDB A;  2M08 A;  2Q5A A;  3WD1 A;  1C9H A;  1NSG A;  1KT0 A;  1LJY A;  4ODK A;  1EQ3 A;  3EY6 A;  3FY1 A;  4W9Q A;  1ZBK A;  4R5E A;  3WD4 A;  3ALG A;  2F2D A;  2ZQS A;  4IQ2 A;  3WL1 A;  4XAK A;  1J6Y A;  2ZQV A;  1GOI A;  4DH0 A;  1VF8 A;  2MNT A;  4TX0 A;  4ZS6 A;  1LG2 A;  2K8I A;  1JCH B;  1RD6 A;  2DT2 A;  1F40 A;  1K9T A;  1IX5 A;  3RME A;  3O5J A;  3O5R A;  4DWS A;  4DZ3 A;  1W1P A;  2DG9 A;  3RM9 A;  3ARW A;  2VN1 A;  3VAW A;  2PV2 A;  1XRV A;  3NRK A;  2VCD A;  2FDM A;  4JYS A;  4L3N A;  3ODK A;  2B31 A;  1H0G A;  3KAG A;  5DIU A;  4TNS A;  1W1T A;  1CTN A;  3LUO A;  2LKN A;  4W9O A;  2DSU A;  2PV3 A;  3JYJ A;  4HAR A;  1E44 A;  4TW7 A;  4MAV A;  2RSE A;  1FKT A;  2QF8 A;  1FFR A;  4MPK A;  4ODM A;  2XPA A;  5DIV A;  4DT4 A;  1NH6 A;  1UR8 A;  1HXV A;  2AOS A;  1W1V A;  2DSZ A;  2KFW A;  4FN2 A;  3ARO A;  1FKL A;  1X6N A;  3O5L A;  1ZU8 A;  1P5Q A;  2Y78 A;  2XP3 A;  4TYO A;  4DRJ A;  3O5F A;  1EHN A;  5GPR A;  2FKE A;  5I98 A;  2MLY A;  2MLZ A;  4Q7N A;  4NSB A;  2DG4 A;  2G8Z A;  1FD9 A;  3O5I A;  1JNT A;  2RUC A;  1HKM A;  3RM8 A;  1HJV A;  1J4I A;  4JFL A;  4ITZ A;  4QIB A;  3KAD A;  3WH0 A;  4DIP A;  5GPG A;  3O5K A;  3IKD A;  1SYT A;  3I6C A;  4DRH A;  4ODL A;  2PV1 A;  1TFV A;  4TW8 A;  1ROU A;  4MNL A;  4S3K A;  4U84 A;  4IT6 A;  1BKF A;  4TW6 A;  1Q6I A;  2PBC A;  4MNM A;  4IPX A;  4W5U A;  4MSP A;  2KO7 A;  3H9R B;  3W4R A;  2WK2 A;  3ARV A;  3O5Q A;  5HKG A;  2P4V A;  1D7I A;  2MPH A;  5HT1 A;  3PRB A;  4W9P A;  3WD3 A;  2OLH A;  1FJD A;  1T11 A;  3IHZ A;  1R9H A;  5HW7 A;  3ARS A;  1U79 A;  3IKG A;  4LAY A;  2DT3 A;  1ZBV A;  4DWS C;  3UI5 A;  3KZ7 A;  2AWG A;  3GPK A;  2FAP A;  2RUR A;  1ROT A;  1ZL1 A;  4WK9 A;  1Q1C A;  1W26 A;  4P8W A;  3O5E A;  5DEZ A;  3O5P A;  2ITK A;  2XP7 A;  1NMW A;  5GQB A;  3RFW A;  3O5O A;  3CHC A;  2YBT A;  4ZPW R;  1TCO C;  1FAP A;  1JNE A;  1W1Y A;  2DPE A;  4LGX A;  1GRJ A;  4ODQ A;  4DRQ A;  4S3J A;  5JH8 A;  5D75 A;  1HKI A;  3WD0 A;  2LJ4 A;  2KE0 A;  2F23 A;  3KAI A;  3RM4 A;  3BMB A;  1W9U A;  3PR9 A;  3TC5 A;  1GUV A;  3UI6 A;  2PPP A;  3ARP A;  1YAT A;  3ARU A;  3WD2 A;  1WNO A;  3IK8 A;  4DRI A;  3KAC A;  3UQB A;  1KT1 A;  2KI3 A;  2IUZ A;  2UZ5 A;  4LAX A;  3CHF A;  1N1A A;  2PN0 A;  1YW5 A;  4ML4 A;  1E6R A;  5DF0 A;  4JFM A;  1W9V A;  1E9L A;  4DWS D;  3OOB A;  1A7X A;  5HW8 A;  1J4H A;  1QZ2 A;  2L2S A;  4DRO A;  4NNR A;  1SR0 A;  5HWC A;  4P8U A;  4MTV A;  3KCE A;  3O5G A;  5HBF A;  1M5Y A;  3ARY A;  5DIT A;  4WKA A;  4ODP A;  3B7X A;  4GGQ A;  2ZQT A;  4HBO A;  2JZV A;  3PRD A;  4AY1 A;  2DSW A;  4JFJ A;  3CHD A;  1D2K A;  2A3B A;  3ALF A;  2XP6 A;  4WJX A;  3AS0 A;  4L72 B;  4JFI A;  2WLY A;  3OA5 A;  5DO2 A;  3TCZ A;  1E6N A;  3GU0 A;  1F8A B;  1LL7 A;  1NWT A;  3GTY X;  1HJX A;  1FKF A;  2EUL A;  2ESC A;  1FKG A;  3QOK A;  1B6C A;  1JNS A;  1ZBW A;  4LAV A;  4DRN A;  5HTG A;  1PIN A;  3WIJ A;  2PPN A;  3AQU A;  2ZR4 A;  1E6Z A;  3FAP A;  1HKK A;  4DRK A;  1PBK A;  1KFW A;  1WAW A;  3CZ8 A;  4ODN A;  2OFN A;  4KQZ A;  2ZR5 A;  1Q6U A;  4WKF A;  1W9P A;  2RUD A;  3UI4 A;  1D7J A;  1D6O A;  2A3E A;  4BF8 A;  4ODO A;  5J6E A;  4LAW A;  1QPL A;  2O9O A;  2XP8 A;  4Z2J A;  3B9D A;  1LQ0 A;  2RQS A;  3O5D A;  1ITX A;  4DZ2 A;  1FKJ A;  4Z2G A;  2XP4 A;  3KAF A;  1BL4 A;  1HJW A;  1FKS A;  1FKB A;  2XP5 A;  1FKK A;  2D9F A;  1GPF A;  4P8V A;  4DRM A;  1O6I A;  4DRP A;  1OGB A;  1E15 A;  1LL6 A;  1EIB A;  2XPB A;  4QZV B;  1JND A;  2ETN A;  3CGN A;  2B5U B;  3WL0 A;  2DT1 A;  3CHE A;  4P8X A;  3UQA A;  3PRA A;  2M1I A;  3ARX A;  1JVW A;  4MNJ A;  1ZK6 A;  1FKR A;  3G6M A;  2O92 A;  4Z2L A;  3B8S A;  1LL4 A;  4Z2K A;  3WQV A;  4FAP A;  1HKJ A;  4J4N A;  4JFK A;  4WIW A;  5HW6 A;  1Y0O A;  3WQW A;  2ZQU A;  3FXY A;  4WKH A;  4MNK A;  1NMV A;  1FKI A;  3KAH A;  3MDY B;  3NI6 A;  3PA7 A;  2M2A A;  4N19 A;  1EDQ A;  3B9A A;  3ARZ A;  2DG3 A;  1L1P A;  2G41 A;  4U85 A;  3EIP A;  4UDM A;  4KR0 B;  4MGV A;  5HWB A;  2ZR6 A;  1X6L A;  3CH9 A;  3AS3 A;  1QPF A;  2WLZ A;  3KAB A;  2DSV A;  2A3C A;  1ZBC A;  1WB0 A;  2IF4 A;  3RGC A;  4QT2 A;  4IT4 A;  3JYM A;  1FKH A;  3G6L A;  1XHG A;  4U86 A;  2N87 A;  2PPO A;  4G2P A;  3NTP A;  1EYM A;  1FFQ A; 
#chains in the Genus database with same CATH homology
 1D7H A;  2KR7 A;  4R0X A;  1NWS A;  3ARQ A;  3B9E A;  2LPV A;  4ODR A;  4NZC A;  3ARR A;  2YBU A;  4IQC A;  3AS2 A;  5HUA A;  1ZCN A;  3UF8 A;  3AS1 A;  4ZPT R;  1OWQ A;  4HBE A;  1E6P A;  4QT3 A;  2PI6 A;  2KGJ A;  3UQI A;  4Z2I A;  2LGO A;  1LG1 A;  3WKZ A;  2F4E A;  1H0I A;  4C02 B;  2RUQ A;  5B8I C;  5BXJ A;  4J4O A;  4PTM A;  3O5M A;  1NWR A;  4G50 A;  4Q22 A;  2A3A A;  3CGM A;  4GIV A;  1FKD A;  2WM0 A;  4DWS B;  2MLX A;  3BXW A;  4URI A;  1NWU A;  1Q6H A;  2DT0 A;  2XP9 A;  1J4R A;  3ART A;  1UR9 A;  1ZB5 A;  2F21 A;  3JXV A;  4O2T A;  4ZPV R;  4Z2H A;  2MF9 A;  1OGG A;  3TDB A;  2M08 A;  2Q5A A;  3WD1 A;  1C9H A;  1NSG A;  1KT0 A;  1LJY A;  4ODK A;  1EQ3 A;  3EY6 A;  3FY1 A;  4W9Q A;  1ZBK A;  4R5E A;  3WD4 A;  3ALG A;  2F2D A;  2ZQS A;  4IQ2 A;  3WL1 A;  4XAK A;  1J6Y A;  2ZQV A;  1GOI A;  4DH0 A;  1VF8 A;  2MNT A;  4TX0 A;  4ZS6 A;  1LG2 A;  2K8I A;  1RD6 A;  2DT2 A;  1F40 A;  1K9T A;  1IX5 A;  3RME A;  3O5J A;  3O5R A;  4DWS A;  4DZ3 A;  1W1P A;  2DG9 A;  3RM9 A;  3ARW A;  2VN1 A;  3VAW A;  2PV2 A;  1XRV A;  3NRK A;  2VCD A;  2FDM A;  4JYS A;  4L3N A;  3ODK A;  2B31 A;  1H0G A;  3KAG A;  5DIU A;  4TNS A;  1W1T A;  1CTN A;  3LUO A;  2LKN A;  4W9O A;  2DSU A;  2PV3 A;  3JYJ A;  4HAR A;  4TW7 A;  4MAV A;  2RSE A;  1FKT A;  2QF8 A;  1FFR A;  4MPK A;  4ODM A;  2XPA A;  5DIV A;  4DT4 A;  1NH6 A;  1UR8 A;  1HXV A;  2AOS A;  1W1V A;  2DSZ A;  2KFW A;  4FN2 A;  3ARO A;  1FKL A;  1X6N A;  3O5L A;  1ZU8 A;  1P5Q A;  2Y78 A;  2XP3 A;  4TYO A;  4DRJ A;  3O5F A;  1EHN A;  5GPR A;  2FKE A;  5I98 A;  2MLY A;  2MLZ A;  4Q7N A;  4NSB A;  2DG4 A;  2G8Z A;  1FD9 A;  3O5I A;  1JNT A;  2RUC A;  1HKM A;  3RM8 A;  1HJV A;  1J4I A;  4JFL A;  4ITZ A;  4QIB A;  3KAD A;  3WH0 A;  4DIP A;  5GPG A;  3O5K A;  3IKD A;  1SYT A;  3I6C A;  4DRH A;  4ODL A;  2PV1 A;  1TFV A;  4TW8 A;  1ROU A;  4MNL A;  4S3K A;  4U84 A;  4IT6 A;  1BKF A;  4TW6 A;  1Q6I A;  2PBC A;  4MNM A;  4IPX A;  4W5U A;  4MSP A;  2KO7 A;  3H9R B;  3W4R A;  2WK2 A;  3ARV A;  3O5Q A;  5HKG A;  1D7I A;  2MPH A;  5HT1 A;  3PRB A;  4W9P A;  3WD3 A;  2OLH A;  1FJD A;  1T11 A;  3IHZ A;  1R9H A;  5HW7 A;  3ARS A;  1U79 A;  3IKG A;  4LAY A;  2DT3 A;  1ZBV A;  4DWS C;  3UI5 A;  3KZ7 A;  2AWG A;  3GPK A;  2FAP A;  2RUR A;  1ROT A;  1ZL1 A;  4WK9 A;  1Q1C A;  1W26 A;  4P8W A;  3O5E A;  5DEZ A;  3O5P A;  2ITK A;  2XP7 A;  1NMW A;  5GQB A;  3RFW A;  3O5O A;  3CHC A;  2YBT A;  4ZPW R;  1TCO C;  1FAP A;  1JNE A;  1W1Y A;  2DPE A;  4LGX A;  4ODQ A;  4DRQ A;  4S3J A;  5JH8 A;  5D75 A;  1HKI A;  3WD0 A;  2LJ4 A;  2KE0 A;  3KAI A;  3RM4 A;  1W9U A;  3PR9 A;  3TC5 A;  1GUV A;  3UI6 A;  2PPP A;  3ARP A;  1YAT A;  3ARU A;  3WD2 A;  1WNO A;  3IK8 A;  4DRI A;  3KAC A;  3UQB A;  1KT1 A;  2KI3 A;  2IUZ A;  2UZ5 A;  4LAX A;  3CHF A;  1N1A A;  1YW5 A;  4ML4 A;  1E6R A;  5DF0 A;  4JFM A;  1W9V A;  1E9L A;  4DWS D;  3OOB A;  1A7X A;  5HW8 A;  1J4H A;  1QZ2 A;  2L2S A;  4DRO A;  4NNR A;  1SR0 A;  5HWC A;  4P8U A;  4MTV A;  3KCE A;  3O5G A;  5HBF A;  1M5Y A;  3ARY A;  5DIT A;  4WKA A;  4ODP A;  3B7X A;  4GGQ A;  2ZQT A;  4HBO A;  2JZV A;  3PRD A;  4AY1 A;  2DSW A;  4JFJ A;  3CHD A;  1D2K A;  2A3B A;  3ALF A;  2XP6 A;  4WJX A;  3AS0 A;  4L72 B;  4JFI A;  2WLY A;  3OA5 A;  5DO2 A;  3TCZ A;  1E6N A;  1F8A B;  1LL7 A;  1NWT A;  1HJX A;  1FKF A;  2ESC A;  1FKG A;  3QOK A;  1B6C A;  1JNS A;  1ZBW A;  4LAV A;  4DRN A;  5HTG A;  1PIN A;  3WIJ A;  2PPN A;  3AQU A;  2ZR4 A;  1E6Z A;  3FAP A;  1HKK A;  4DRK A;  1PBK A;  1KFW A;  1WAW A;  3CZ8 A;  4ODN A;  2OFN A;  4KQZ A;  2ZR5 A;  1Q6U A;  4WKF A;  1W9P A;  2RUD A;  3UI4 A;  1D7J A;  1D6O A;  2A3E A;  4BF8 A;  4ODO A;  5J6E A;  4LAW A;  1QPL A;  2O9O A;  2XP8 A;  4Z2J A;  3B9D A;  1LQ0 A;  2RQS A;  3O5D A;  1ITX A;  4DZ2 A;  1FKJ A;  4Z2G A;  2XP4 A;  3KAF A;  1BL4 A;  1HJW A;  1FKS A;  1FKB A;  2XP5 A;  1FKK A;  2D9F A;  1GPF A;  4P8V A;  4DRM A;  1O6I A;  4DRP A;  1OGB A;  1E15 A;  1LL6 A;  1EIB A;  2XPB A;  4QZV B;  1JND A;  3CGN A;  3WL0 A;  2DT1 A;  3CHE A;  4P8X A;  3UQA A;  3PRA A;  2M1I A;  3ARX A;  1JVW A;  4MNJ A;  1ZK6 A;  1FKR A;  3G6M A;  2O92 A;  4Z2L A;  3B8S A;  1LL4 A;  4Z2K A;  3WQV A;  4FAP A;  1HKJ A;  4J4N A;  4JFK A;  4WIW A;  5HW6 A;  1Y0O A;  3WQW A;  2ZQU A;  3FXY A;  4WKH A;  4MNK A;  1NMV A;  1FKI A;  3KAH A;  3MDY B;  3NI6 A;  3PA7 A;  2M2A A;  4N19 A;  1EDQ A;  3B9A A;  3ARZ A;  2DG3 A;  1L1P A;  2G41 A;  4U85 A;  4KR0 B;  4MGV A;  5HWB A;  2ZR6 A;  1X6L A;  3CH9 A;  3AS3 A;  1QPF A;  2WLZ A;  3KAB A;  2DSV A;  2A3C A;  1ZBC A;  1WB0 A;  2IF4 A;  3RGC A;  4QT2 A;  4IT4 A;  3JYM A;  1FKH A;  3G6L A;  1XHG A;  4U86 A;  2N87 A;  2PPO A;  4G2P A;  3NTP A;  1EYM A;  1FFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...