1FJDA

Human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 104
sequence length 104
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fjdA00
1A7XA 4JFIA 1ROTA 4IQ2A 1Y0OA 1BL4A 2D9FA 3KAFA 3JYJA 3OOBA 3UQBA 1YW5A 4J4NA 2DG3A 1QPFA 2JZVA 4IQCA 4IPXA 2RSEA 1FKTA 4NNRA 4FN2A 4DRNA 4DRJA 3O5MA 4G2PA 4ODRA 2K8IA 2Q5AA 3H9RB 4BF8A 2M2AA 1KT1A 2ZQSA 3O5JA 5B8IC 4TW6A 2ITKA 2LKNA 5J6EA 4ITZA 1BKFA 3O5PA 3LUOA 5HW7A 1PINA 1C9HA 1QZ2A 4N19A 4QIBA 3WH0A 3UQIA 2RURA 3IK8A 5HT1A 3B7XA 3UI4A 4DZ3A 2RUCA 2DG9A 2RQSA 4ODPA 4TW8A 1FKRA 2FAPA 2RUQA 2ZR6A 1J6YA 4JFLA 2PV1A 3I6CA 1KT0A 4C02B 1J4RA 5HUAA 2ZQTA 4JFJA 1U79A 1PBKA 1B6CA 3KABA 1Q6HA 4TX0A 5DIVA 2KI3A 2UZ5A 1ZK6A 2XPAA 3KAHA 4ODQA 1FKJA 4TW7A 4TYOA 1QPLA 2N87A 3RGCA 1FKFA 2F2DA 1JVWA 3VAWA 1FKHA 4DZ2A 2XP8A 4QT2A 4ODLA 4DRHA 2RUDA 1JNSA 2MLYA 3KAIA 2XP9A 3O5LA 4ODOA 5I98A 3O5FA 2OFNA 1J4IA 2M1IA 4GIVA 4LAVA 3RFWA 5D75A 1ZCNA 1FD9A 2DG4A 2ZQVA 3KACA 3TCZA 2VCDA 4DRQA 4FAPA 2XP7A 3KZ7A 2XPBA 3O5EA 1J4HA 2F21A 3O5OA 2MF9A 3PRBA 3UI6A 5HW6A 1Q6IA 3MDYB 4ODKA 1FKKA 4DIPA 3TC5A 2KGJA 2LGOA 2L2SA 3PRDA 4JFMA 1NSGA 1JNTA 3CGNA 4MSPA 2KE0A 1EYMA 4MGVA 1NMVA 4DRMA 3JXVA 5DITA 4G50A 5HKGA 1FKBA 2ZR5A 4DH0A 4JYSA 3O5QA 4DRIA 2ZQUA 1F40A 3IKDA 1D7IA 1FAPA 4LAWA 2KFWA 3JYMA 1F8AB 3PA7A 3KCEA 2LJ4A 1NMWA 3O5KA 4R0XA 1D6OA 4W9OA 3UF8A 1FKLA 4ODNA 1R9HA 1EQ3A 4O2TA 3NTPA 3CGMA 2XP6A 1FKSA 3O5DA 2F4EA 3O5RA 1HXVA 2IF4A 1FKDA 3NI6A 4U85A 2AWGA 5DIUA 3FAPA 2MLXA 4JFKA 3KADA 3GPKA 1N1AA 5HWCA 1YATA 1TCOC 4U84A 1W26A 1FKIA 1FJDA 4DRPA 1D7HA 2XP3A 1P5QA 4ODMA 4TNSA 2M08A 1Q1CA 2KO7A 4W9PA 3O5GA 2PPOA 2MPHA 3ODKA 4LAYA 3UQAA 2PPNA 3TDBA 5HW8A 2MNTA 2PV2A 4U86A 2LPVA 2VN1A 4DT4A 3O5IA 2XP4A 5BXJA 5GPGA 2XP5A 3KAGA 4GGQA 1Q6UA 3UI5A 3NRKA 4QT3A 1L1PA 1T11A 1ROUA 5HWBA 4J4OA 4LAXA 3IHZA 2KR7A 3IKGA 1M5YA 2FKEA 2PPPA 2MLZA 2ZR4A 4W9QA 4DRKA 2PBCA 3EY6A 5HTGA 1FKGA 2Y78A 1D7JA 4DROA 2PV3A
chains in the Genus database with same CATH superfamily
1A7XA 1ROTA 4P8WA 1BL4A 2D9FA 3KAFA 4DWSC 3B9EA 2RSEA 2B5UB 3WD2A 2YBTA 4DRJA 1W9VA 1LL4A 3CH9A 4G2PA 5B8IC 4ITZA 5HW7A 2ESCA 3IK8A 5DF0A 2RUCA 4TW8A 1E15A 1WB0A 2EULA 2FAPA 2RUQA 2ZR6A 5JH8A 1J6YA 4UDMA 4JFLA 2PV1A 3CHFA 4JFJA 1PBKA 1U79A 1B6CA 4DWSD 5DIVA 2PN0A 4TX0A 2XPAA 4TYOA 2WLYA 3KAHA 4P8VA 1QPLA 2WK2A 3RGCA 2A3EA 1FKFA 4W5UA 3WD1A 2XP8A 4DRHA 4ZS6A 2MLYA 1CTNA 1H0GA 2M1IA 4LAVA 2WLZA 4DRQA 2VCDA 3RMEA 2DPEA 1J4HA 2F21A 3PRBA 2MF9A 1HJXA 4DWSB 4DIPA 3TC5A 4JFMA 3GTYX 1UR9A 4L3NA 4MGVA 1NMVA 3JXVA 5DITA 1HKIA 1D7IA 4LAWA 2KFWA 2ETNA 3JYMA 5GQBA 1HJVA 4ZPWR 4MTVA 1EQ3A 4PTMA 3B8SA 3CGMA 1FKSA 1HXVA 2IF4A 1TFVA 1EHNA 1X6LA 3GPKA 1YATA 4U84A 1W26A 1FKIA 1GPFA 1D7HA 1P5QA 3TDBA 5HW8A 2VN1A 3O5IA 3WL0A 4WJXA 1E6RA 4ZPTR 1O6IA 2KR7A 3IKGA 2PPPA 2ZR4A 4QZVB 1LQ0A 4DROA 1EIBA 4JFIA 2WM0A 3ARTA 3OOBA 3UQBA 1XRVA 1QPFA 4IQCA 3G6MA 3AS3A 1NWSA 4ODRA 2K8IA 5HBFA 1EDQA 1WNOA 2M2AA 2LKNA 5J6EA 1PINA 1C9HA 3WH0A 2RURA 2G8ZA 5HT1A 3ARYA 2DG9A 1LG2A 3I6CA 1KT0A 4C02B 5HUAA 4TW7A 3WIJA 2A3CA 3PR9A 3B9AA 4DZ2A 1LL6A 4KQZA 3AS1A 4ODLA 2XP9A 5I98A 2OFNA 3RFWA 2PI6A 2DG4A 2ZQVA 3AQUA 3TCZA 2XP7A 2XPBA 5HW6A 2O9OA 1Q6IA 3ALGA 2LGOA 3FXYA 3PRDA 3CGNA 1EYMA 3ARQA 4DRMA 4G50A 3EIPA 4DH0A 4JYSA 4LGXA 3IKDA 1OGGA 2FDMA 1D6OA 1FKLA 3WD3A 1K9TA 4O2TA 1E6ZA 3GU0A 3NTPA 4AY1A 3BMBA 2XP6A 4P8XA 1NWTA 4JFKA 1NH6A 1N1AA 1NWUA 3WQVA 1FJDA 4ODMA 3AS2A 4W9PA 4U86A 1RD6A 4DT4A 5BXJA 3WKZA 4GGQA 3WQWA 4MNLA 3UI5A 4QT3A 1VF8A 2QF8A 2FKEA 1JNDA 4DRKA 4W9QA 3EY6A 2PV3A 5HTGA 1GOIA 4IQ2A 1Y0OA 1ZBWA 2DT3A 4J4NA 3ARVA 2DSWA 4IPXA 4NNRA 1E6NA 4FN2A 1IX5A 4DRNA 3O5MA 4BF8A 1KT1A 4TW6A 3O5PA 3ARZA 3LUOA 1HKKA 1QZ2A 3ARPA 3UI4A 3B7XA 4DWSA 1FKRA 1SR0A 1J4RA 4URIA 2ZQTA 3KABA 2KI3A 1ZL1A 4ODQA 2N87A 2AOSA 3CHDA 2F2DA 1JVWA 4S3KA 1OWQA 1H0IA 3ARUA 4WK9A 4Z2GA 1JNSA 3O5LA 3KAIA 1ZBKA 4Z2JA 4ODOA 3O5FA 4ZPVR 4Z2IA 4GIVA 1GRJA 5D75A 2A3BA 3O5EA 3O5OA 5DO2A 3UI6A 3CHCA 4ODKA 1FKKA 3W4RA 2KGJA 4MAVA 4Z2KA 2L2SA 2YBUA 4Z2HA 1NSGA 4MSPA 2A3AA 2KE0A 2OLHA 3WD0A 1E6PA 1F40A 4MNJA 4WIWA 1D2KA 1FAPA 3PA7A 3O5KA 4W9OA 4NZCA 3UF8A 1LL7A 3FY1A 3ARRA 1LJYA 1UR8A 3O5DA 3CHEA 4L72B 1FKDA 3NI6A 4U85A 2AWGA 5DIUA 3FAPA 4WKAA 4WKFA 3KADA 1NWRA 1W1VA 3AROA 1TCOC 1SYTA 1W1YA 4DRPA 1W1PA 2XP3A 4TNSA 1W9PA 1Q1CA 2KO7A 3O5GA 2PPOA 4LAYA 4KR0B 1ZBVA 2O92A 3WL1A 2PV2A 4HBOA 1E9LA 5GPGA 2XP5A 2DT1A 1Q6UA 4HARA 3NRKA 1L1PA 1T11A 3IHZA 1W9UA 2DSVA 4Q22A 1E44A 4MNMA 3KZ7A 1WAWA 3QOKA 1FFQA 3JYJA 2G41A 1YW5A 4MNKA 2DG3A 2JZVA 3ARSA 1FKTA 1OGBA 2Q5AA 3H9RB 2ZQSA 3ALFA 3O5JA 2ITKA 5DEZA 1BKFA 2B31A 4N19A 4QIBA 3UQIA 3RM8A 4DZ3A 4ODPA 2RQSA 3WD4A 4ML4A 2DT0A 1Q6HA 1ZBCA 2UZ5A 1ZK6A 1X6NA 1FKJA 3VAWA 1FKHA 4QT2A 3G6LA 2RUDA 4Z2LA 1ITXA 1J4IA 1ZCNA 1FD9A 3KACA 4FAPA 4P8UA 4HBEA 3MDYB 4Q7NA 4NSBA 1ZB5A 1JNTA 5HKGA 1FKBA 2ZR5A 3ARWA 4DRIA 3O5QA 1ZU8A 2ZQUA 3RM4A 1F8AB 1FFRA 2IUZA 3KCEA 2LJ4A 1NMWA 4R0XA 4ODNA 1R9HA 1XHGA 1HKJA 2P4VA 1HJWA 1W1TA 2F4EA 1JNEA 3O5RA 3AS0A 2F23A 4IT6A 3OA5A 1HKMA 2MLXA 3B9DA 2DSZA 3ARXA 1JCHB 5HWCA 4S3JA 4MPKA 5GPRA 1LG1A 2M08A 4XAKA 3ODKA 2DSUA 2MPHA 3UQAA 2PPNA 4R5EA 2MNTA 2LPVA 4WKHA 2XP4A 3KAGA 4IT4A 1ROUA 5HWBA 4J4OA 4LAXA 1GUVA 2DT2A 3RM9A 1M5YA 2MLZA 3BXWA 2PBCA 1KFWA 1FKGA 2Y78A 1D7JA 3CZ8A 3PRAA
chains in the Genus database with same CATH topology
1A7XA 1ROTA 4P8WA 1BL4A 2D9FA 3KAFA 4DWSC 3B9EA 2RSEA 3WD2A 2YBTA 4DRJA 1W9VA 1LL4A 3CH9A 4G2PA 5B8IC 4ITZA 5HW7A 2ESCA 3IK8A 5DF0A 2RUCA 4TW8A 1E15A 1WB0A 2FAPA 2RUQA 2ZR6A 5JH8A 1J6YA 4JFLA 2PV1A 3CHFA 4JFJA 1PBKA 1U79A 1B6CA 4DWSD 5DIVA 4TX0A 2XPAA 4TYOA 2WLYA 3KAHA 4P8VA 1QPLA 2WK2A 3RGCA 2A3EA 1FKFA 4W5UA 3WD1A 2XP8A 4DRHA 4ZS6A 2MLYA 1CTNA 1H0GA 2M1IA 4LAVA 2WLZA 4DRQA 2VCDA 3RMEA 2DPEA 1J4HA 2F21A 3PRBA 2MF9A 1HJXA 4DWSB 4DIPA 3TC5A 4JFMA 1UR9A 4L3NA 4MGVA 1NMVA 3JXVA 5DITA 1HKIA 1D7IA 4LAWA 2KFWA 3JYMA 5GQBA 1HJVA 4ZPWR 4MTVA 1EQ3A 4PTMA 3B8SA 3CGMA 1FKSA 1HXVA 2IF4A 1TFVA 1EHNA 1X6LA 3GPKA 1YATA 4U84A 1W26A 1FKIA 1GPFA 1D7HA 1P5QA 3TDBA 5HW8A 2VN1A 3O5IA 3WL0A 4WJXA 1E6RA 4ZPTR 1O6IA 2KR7A 3IKGA 2PPPA 2ZR4A 4QZVB 1LQ0A 4DROA 1EIBA 4JFIA 2WM0A 3ARTA 3OOBA 3UQBA 1XRVA 1QPFA 4IQCA 3G6MA 3AS3A 1NWSA 4ODRA 2K8IA 5HBFA 1EDQA 1WNOA 2M2AA 2LKNA 5J6EA 1PINA 1C9HA 3WH0A 2RURA 2G8ZA 5HT1A 3ARYA 2DG9A 1LG2A 3I6CA 1KT0A 4C02B 5HUAA 4TW7A 3WIJA 2A3CA 3PR9A 3B9AA 4DZ2A 1LL6A 4KQZA 3AS1A 4ODLA 2XP9A 5I98A 2OFNA 3RFWA 2PI6A 2DG4A 2ZQVA 3AQUA 3TCZA 2XP7A 2XPBA 5HW6A 2O9OA 1Q6IA 3ALGA 2LGOA 3FXYA 3PRDA 3CGNA 1EYMA 3ARQA 4DRMA 4G50A 4DH0A 4JYSA 4LGXA 3IKDA 1OGGA 2FDMA 1D6OA 1FKLA 3WD3A 1K9TA 4O2TA 1E6ZA 3NTPA 4AY1A 2XP6A 4P8XA 1NWTA 4JFKA 1NH6A 1N1AA 1NWUA 3WQVA 1FJDA 4ODMA 3AS2A 4W9PA 4U86A 1RD6A 4DT4A 5BXJA 3WKZA 4GGQA 3WQWA 4MNLA 3UI5A 4QT3A 1VF8A 2QF8A 2FKEA 1JNDA 4DRKA 4W9QA 3EY6A 2PV3A 5HTGA 1GOIA 4IQ2A 1Y0OA 1ZBWA 2DT3A 4J4NA 3ARVA 2DSWA 4IPXA 4NNRA 1E6NA 4FN2A 1IX5A 4DRNA 3O5MA 4BF8A 1KT1A 4TW6A 3O5PA 3ARZA 3LUOA 1HKKA 1QZ2A 3ARPA 3UI4A 3B7XA 4DWSA 1FKRA 1SR0A 1J4RA 4URIA 2ZQTA 3KABA 2KI3A 1ZL1A 4ODQA 2N87A 2AOSA 3CHDA 2F2DA 1JVWA 4S3KA 1OWQA 1H0IA 3ARUA 4WK9A 4Z2GA 1JNSA 3O5LA 3KAIA 1ZBKA 4Z2JA 4ODOA 3O5FA 4ZPVR 4Z2IA 4GIVA 5D75A 2A3BA 3O5EA 3O5OA 5DO2A 3UI6A 3CHCA 4ODKA 1FKKA 3W4RA 2KGJA 4MAVA 4Z2KA 2L2SA 2YBUA 4Z2HA 1NSGA 4MSPA 2A3AA 2KE0A 2OLHA 3WD0A 1E6PA 1F40A 4MNJA 4WIWA 1D2KA 1FAPA 3PA7A 3O5KA 4W9OA 4NZCA 3UF8A 1LL7A 3FY1A 3ARRA 1LJYA 1UR8A 3O5DA 3CHEA 4L72B 1FKDA 3NI6A 4U85A 2AWGA 5DIUA 3FAPA 4WKAA 4WKFA 3KADA 1NWRA 1W1VA 3AROA 1TCOC 1SYTA 1W1YA 4DRPA 1W1PA 2XP3A 4TNSA 1W9PA 1Q1CA 2KO7A 3O5GA 2PPOA 4LAYA 4KR0B 1ZBVA 2O92A 3WL1A 2PV2A 4HBOA 1E9LA 5GPGA 2XP5A 2DT1A 1Q6UA 4HARA 3NRKA 1L1PA 1T11A 3IHZA 1W9UA 2DSVA 4Q22A 4MNMA 3KZ7A 1WAWA 3QOKA 1FFQA 3JYJA 2G41A 1YW5A 4MNKA 2DG3A 2JZVA 3ARSA 1FKTA 1OGBA 2Q5AA 3H9RB 2ZQSA 3ALFA 3O5JA 2ITKA 5DEZA 1BKFA 2B31A 4N19A 4QIBA 3UQIA 3RM8A 4DZ3A 4ODPA 2RQSA 3WD4A 4ML4A 2DT0A 1Q6HA 1ZBCA 2UZ5A 1ZK6A 1X6NA 1FKJA 3VAWA 1FKHA 4QT2A 3G6LA 2RUDA 4Z2LA 1ITXA 1J4IA 1ZCNA 1FD9A 3KACA 4FAPA 4P8UA 4HBEA 3MDYB 4Q7NA 4NSBA 1ZB5A 1JNTA 5HKGA 1FKBA 2ZR5A 3ARWA 4DRIA 3O5QA 1ZU8A 2ZQUA 3RM4A 1F8AB 1FFRA 2IUZA 3KCEA 2LJ4A 1NMWA 4R0XA 4ODNA 1R9HA 1XHGA 1HKJA 1HJWA 1W1TA 2F4EA 1JNEA 3O5RA 3AS0A 4IT6A 3OA5A 1HKMA 2MLXA 3B9DA 2DSZA 3ARXA 5HWCA 4S3JA 4MPKA 5GPRA 1LG1A 2M08A 4XAKA 3ODKA 2DSUA 2MPHA 3UQAA 2PPNA 4R5EA 2MNTA 2LPVA 4WKHA 2XP4A 3KAGA 4IT4A 1ROUA 5HWBA 4J4OA 4LAXA 1GUVA 2DT2A 3RM9A 1M5YA 2MLZA 3BXWA 2PBCA 1KFWA 1FKGA 2Y78A 1D7JA 3CZ8A 3PRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  4JFI A;  1ROT A;  4IQ2 A;  1Y0O A;  1BL4 A;  2D9F A;  3KAF A;  3JYJ A;  3OOB A;  3UQB A;  1YW5 A;  4J4N A;  2DG3 A;  1QPF A;  2JZV A;  4IQC A;  4IPX A;  2RSE A;  1FKT A;  4NNR A;  4FN2 A;  4DRN A;  4DRJ A;  3O5M A;  4G2P A;  4ODR A;  2K8I A;  2Q5A A;  3H9R B;  4BF8 A;  2M2A A;  1KT1 A;  2ZQS A;  3O5J A;  5B8I C;  4TW6 A;  2ITK A;  2LKN A;  5J6E A;  4ITZ A;  1BKF A;  3O5P A;  3LUO A;  5HW7 A;  1PIN A;  1C9H A;  1QZ2 A;  4N19 A;  4QIB A;  3WH0 A;  3UQI A;  2RUR A;  3IK8 A;  5HT1 A;  3B7X A;  3UI4 A;  4DZ3 A;  2RUC A;  2DG9 A;  2RQS A;  4ODP A;  4TW8 A;  1FKR A;  2FAP A;  2RUQ A;  2ZR6 A;  1J6Y A;  4JFL A;  2PV1 A;  3I6C A;  1KT0 A;  4C02 B;  1J4R A;  5HUA A;  2ZQT A;  4JFJ A;  1U79 A;  1PBK A;  1B6C A;  3KAB A;  1Q6H A;  4TX0 A;  5DIV A;  2KI3 A;  2UZ5 A;  1ZK6 A;  2XPA A;  3KAH A;  4ODQ A;  1FKJ A;  4TW7 A;  4TYO A;  1QPL A;  2N87 A;  3RGC A;  1FKF A;  2F2D A;  1JVW A;  3VAW A;  1FKH A;  4DZ2 A;  2XP8 A;  4QT2 A;  4ODL A;  4DRH A;  2RUD A;  1JNS A;  2MLY A;  3KAI A;  2XP9 A;  3O5L A;  4ODO A;  5I98 A;  3O5F A;  2OFN A;  1J4I A;  2M1I A;  4GIV A;  4LAV A;  3RFW A;  5D75 A;  1ZCN A;  1FD9 A;  2DG4 A;  2ZQV A;  3KAC A;  3TCZ A;  2VCD A;  4DRQ A;  4FAP A;  2XP7 A;  3KZ7 A;  2XPB A;  3O5E A;  1J4H A;  2F21 A;  3O5O A;  2MF9 A;  3PRB A;  3UI6 A;  5HW6 A;  1Q6I A;  3MDY B;  4ODK A;  1FKK A;  4DIP A;  3TC5 A;  2KGJ A;  2LGO A;  2L2S A;  3PRD A;  4JFM A;  1NSG A;  1JNT A;  3CGN A;  4MSP A;  2KE0 A;  1EYM A;  4MGV A;  1NMV A;  4DRM A;  3JXV A;  5DIT A;  4G50 A;  5HKG A;  1FKB A;  2ZR5 A;  4DH0 A;  4JYS A;  3O5Q A;  4DRI A;  2ZQU A;  1F40 A;  3IKD A;  1D7I A;  1FAP A;  4LAW A;  2KFW A;  3JYM A;  1F8A B;  3PA7 A;  3KCE A;  2LJ4 A;  1NMW A;  3O5K A;  4R0X A;  1D6O A;  4W9O A;  3UF8 A;  1FKL A;  4ODN A;  1R9H A;  1EQ3 A;  4O2T A;  3NTP A;  3CGM A;  2XP6 A;  1FKS A;  3O5D A;  2F4E A;  3O5R A;  1HXV A;  2IF4 A;  1FKD A;  3NI6 A;  4U85 A;  2AWG A;  5DIU A;  3FAP A;  2MLX A;  4JFK A;  3KAD A;  3GPK A;  1N1A A;  5HWC A;  1YAT A;  1TCO C;  4U84 A;  1W26 A;  1FKI A;  1FJD A;  4DRP A;  1D7H A;  2XP3 A;  1P5Q A;  4ODM A;  4TNS A;  2M08 A;  1Q1C A;  2KO7 A;  4W9P A;  3O5G A;  2PPO A;  2MPH A;  3ODK A;  4LAY A;  3UQA A;  2PPN A;  3TDB A;  5HW8 A;  2MNT A;  2PV2 A;  4U86 A;  2LPV A;  2VN1 A;  4DT4 A;  3O5I A;  2XP4 A;  5BXJ A;  5GPG A;  2XP5 A;  3KAG A;  4GGQ A;  1Q6U A;  3UI5 A;  3NRK A;  4QT3 A;  1L1P A;  1T11 A;  1ROU A;  5HWB A;  4J4O A;  4LAX A;  3IHZ A;  2KR7 A;  3IKG A;  1M5Y A;  2FKE A;  2PPP A;  2MLZ A;  2ZR4 A;  4W9Q A;  4DRK A;  2PBC A;  3EY6 A;  5HTG A;  1FKG A;  2Y78 A;  1D7J A;  4DRO A;  2PV3 A; 
#chains in the Genus database with same CATH topology
 1A7X A;  1ROT A;  4P8W A;  1BL4 A;  2D9F A;  3KAF A;  4DWS C;  3B9E A;  2RSE A;  2B5U B;  3WD2 A;  2YBT A;  4DRJ A;  1W9V A;  1LL4 A;  3CH9 A;  4G2P A;  5B8I C;  4ITZ A;  5HW7 A;  2ESC A;  3IK8 A;  5DF0 A;  2RUC A;  4TW8 A;  1E15 A;  1WB0 A;  2EUL A;  2FAP A;  2RUQ A;  2ZR6 A;  5JH8 A;  1J6Y A;  4UDM A;  4JFL A;  2PV1 A;  3CHF A;  4JFJ A;  1PBK A;  1U79 A;  1B6C A;  4DWS D;  5DIV A;  2PN0 A;  4TX0 A;  2XPA A;  4TYO A;  2WLY A;  3KAH A;  4P8V A;  1QPL A;  2WK2 A;  3RGC A;  2A3E A;  1FKF A;  4W5U A;  3WD1 A;  2XP8 A;  4DRH A;  4ZS6 A;  2MLY A;  1CTN A;  1H0G A;  2M1I A;  4LAV A;  2WLZ A;  4DRQ A;  2VCD A;  3RME A;  2DPE A;  1J4H A;  2F21 A;  3PRB A;  2MF9 A;  1HJX A;  4DWS B;  4DIP A;  3TC5 A;  4JFM A;  3GTY X;  1UR9 A;  4L3N A;  4MGV A;  1NMV A;  3JXV A;  5DIT A;  1HKI A;  1D7I A;  4LAW A;  2KFW A;  2ETN A;  3JYM A;  5GQB A;  1HJV A;  4ZPW R;  4MTV A;  1EQ3 A;  4PTM A;  3B8S A;  3CGM A;  1FKS A;  1HXV A;  2IF4 A;  1TFV A;  1EHN A;  1X6L A;  3GPK A;  1YAT A;  4U84 A;  1W26 A;  1FKI A;  1GPF A;  1D7H A;  1P5Q A;  3TDB A;  5HW8 A;  2VN1 A;  3O5I A;  3WL0 A;  4WJX A;  1E6R A;  4ZPT R;  1O6I A;  2KR7 A;  3IKG A;  2PPP A;  2ZR4 A;  4QZV B;  1LQ0 A;  4DRO A;  1EIB A;  4JFI A;  2WM0 A;  3ART A;  3OOB A;  3UQB A;  1XRV A;  1QPF A;  4IQC A;  3G6M A;  3AS3 A;  1NWS A;  4ODR A;  2K8I A;  5HBF A;  1EDQ A;  1WNO A;  2M2A A;  2LKN A;  5J6E A;  1PIN A;  1C9H A;  3WH0 A;  2RUR A;  2G8Z A;  5HT1 A;  3ARY A;  2DG9 A;  1LG2 A;  3I6C A;  1KT0 A;  4C02 B;  5HUA A;  4TW7 A;  3WIJ A;  2A3C A;  3PR9 A;  3B9A A;  4DZ2 A;  1LL6 A;  4KQZ A;  3AS1 A;  4ODL A;  2XP9 A;  5I98 A;  2OFN A;  3RFW A;  2PI6 A;  2DG4 A;  2ZQV A;  3AQU A;  3TCZ A;  2XP7 A;  2XPB A;  5HW6 A;  2O9O A;  1Q6I A;  3ALG A;  2LGO A;  3FXY A;  3PRD A;  3CGN A;  1EYM A;  3ARQ A;  4DRM A;  4G50 A;  3EIP A;  4DH0 A;  4JYS A;  4LGX A;  3IKD A;  1OGG A;  2FDM A;  1D6O A;  1FKL A;  3WD3 A;  1K9T A;  4O2T A;  1E6Z A;  3GU0 A;  3NTP A;  4AY1 A;  3BMB A;  2XP6 A;  4P8X A;  1NWT A;  4JFK A;  1NH6 A;  1N1A A;  1NWU A;  3WQV A;  1FJD A;  4ODM A;  3AS2 A;  4W9P A;  4U86 A;  1RD6 A;  4DT4 A;  5BXJ A;  3WKZ A;  4GGQ A;  3WQW A;  4MNL A;  3UI5 A;  4QT3 A;  1VF8 A;  2QF8 A;  2FKE A;  1JND A;  4DRK A;  4W9Q A;  3EY6 A;  2PV3 A;  5HTG A;  1GOI A;  4IQ2 A;  1Y0O A;  1ZBW A;  2DT3 A;  4J4N A;  3ARV A;  2DSW A;  4IPX A;  4NNR A;  1E6N A;  4FN2 A;  1IX5 A;  4DRN A;  3O5M A;  4BF8 A;  1KT1 A;  4TW6 A;  3O5P A;  3ARZ A;  3LUO A;  1HKK A;  1QZ2 A;  3ARP A;  3UI4 A;  3B7X A;  4DWS A;  1FKR A;  1SR0 A;  1J4R A;  4URI A;  2ZQT A;  3KAB A;  2KI3 A;  1ZL1 A;  4ODQ A;  2N87 A;  2AOS A;  3CHD A;  2F2D A;  1JVW A;  4S3K A;  1OWQ A;  1H0I A;  3ARU A;  4WK9 A;  4Z2G A;  1JNS A;  3O5L A;  3KAI A;  1ZBK A;  4Z2J A;  4ODO A;  3O5F A;  4ZPV R;  4Z2I A;  4GIV A;  1GRJ A;  5D75 A;  2A3B A;  3O5E A;  3O5O A;  5DO2 A;  3UI6 A;  3CHC A;  4ODK A;  1FKK A;  3W4R A;  2KGJ A;  4MAV A;  4Z2K A;  2L2S A;  2YBU A;  4Z2H A;  1NSG A;  4MSP A;  2A3A A;  2KE0 A;  2OLH A;  3WD0 A;  1E6P A;  1F40 A;  4MNJ A;  4WIW A;  1D2K A;  1FAP A;  3PA7 A;  3O5K A;  4W9O A;  4NZC A;  3UF8 A;  1LL7 A;  3FY1 A;  3ARR A;  1LJY A;  1UR8 A;  3O5D A;  3CHE A;  4L72 B;  1FKD A;  3NI6 A;  4U85 A;  2AWG A;  5DIU A;  3FAP A;  4WKA A;  4WKF A;  3KAD A;  1NWR A;  1W1V A;  3ARO A;  1TCO C;  1SYT A;  1W1Y A;  4DRP A;  1W1P A;  2XP3 A;  4TNS A;  1W9P A;  1Q1C A;  2KO7 A;  3O5G A;  2PPO A;  4LAY A;  4KR0 B;  1ZBV A;  2O92 A;  3WL1 A;  2PV2 A;  4HBO A;  1E9L A;  5GPG A;  2XP5 A;  2DT1 A;  1Q6U A;  4HAR A;  3NRK A;  1L1P A;  1T11 A;  3IHZ A;  1W9U A;  2DSV A;  4Q22 A;  1E44 A;  4MNM A;  3KZ7 A;  1WAW A;  3QOK A;  1FFQ A;  3JYJ A;  2G41 A;  1YW5 A;  4MNK A;  2DG3 A;  2JZV A;  3ARS A;  1FKT A;  1OGB A;  2Q5A A;  3H9R B;  2ZQS A;  3ALF A;  3O5J A;  2ITK A;  5DEZ A;  1BKF A;  2B31 A;  4N19 A;  4QIB A;  3UQI A;  3RM8 A;  4DZ3 A;  4ODP A;  2RQS A;  3WD4 A;  4ML4 A;  2DT0 A;  1Q6H A;  1ZBC A;  2UZ5 A;  1ZK6 A;  1X6N A;  1FKJ A;  3VAW A;  1FKH A;  4QT2 A;  3G6L A;  2RUD A;  4Z2L A;  1ITX A;  1J4I A;  1ZCN A;  1FD9 A;  3KAC A;  4FAP A;  4P8U A;  4HBE A;  3MDY B;  4Q7N A;  4NSB A;  1ZB5 A;  1JNT A;  5HKG A;  1FKB A;  2ZR5 A;  3ARW A;  4DRI A;  3O5Q A;  1ZU8 A;  2ZQU A;  3RM4 A;  1F8A B;  1FFR A;  2IUZ A;  3KCE A;  2LJ4 A;  1NMW A;  4R0X A;  4ODN A;  1R9H A;  1XHG A;  1HKJ A;  2P4V A;  1HJW A;  1W1T A;  2F4E A;  1JNE A;  3O5R A;  3AS0 A;  2F23 A;  4IT6 A;  3OA5 A;  1HKM A;  2MLX A;  3B9D A;  2DSZ A;  3ARX A;  1JCH B;  5HWC A;  4S3J A;  4MPK A;  5GPR A;  1LG1 A;  2M08 A;  4XAK A;  3ODK A;  2DSU A;  2MPH A;  3UQA A;  2PPN A;  4R5E A;  2MNT A;  2LPV A;  4WKH A;  2XP4 A;  3KAG A;  4IT4 A;  1ROU A;  5HWB A;  4J4O A;  4LAX A;  1GUV A;  2DT2 A;  3RM9 A;  1M5Y A;  2MLZ A;  3BXW A;  2PBC A;  1KFW A;  1FKG A;  2Y78 A;  1D7J A;  3CZ8 A;  3PRA A; 
#chains in the Genus database with same CATH homology
 1A7X A;  1ROT A;  4P8W A;  1BL4 A;  2D9F A;  3KAF A;  4DWS C;  3B9E A;  2RSE A;  3WD2 A;  2YBT A;  4DRJ A;  1W9V A;  1LL4 A;  3CH9 A;  4G2P A;  5B8I C;  4ITZ A;  5HW7 A;  2ESC A;  3IK8 A;  5DF0 A;  2RUC A;  4TW8 A;  1E15 A;  1WB0 A;  2FAP A;  2RUQ A;  2ZR6 A;  5JH8 A;  1J6Y A;  4JFL A;  2PV1 A;  3CHF A;  4JFJ A;  1PBK A;  1U79 A;  1B6C A;  4DWS D;  5DIV A;  4TX0 A;  2XPA A;  4TYO A;  2WLY A;  3KAH A;  4P8V A;  1QPL A;  2WK2 A;  3RGC A;  2A3E A;  1FKF A;  4W5U A;  3WD1 A;  2XP8 A;  4DRH A;  4ZS6 A;  2MLY A;  1CTN A;  1H0G A;  2M1I A;  4LAV A;  2WLZ A;  4DRQ A;  2VCD A;  3RME A;  2DPE A;  1J4H A;  2F21 A;  3PRB A;  2MF9 A;  1HJX A;  4DWS B;  4DIP A;  3TC5 A;  4JFM A;  1UR9 A;  4L3N A;  4MGV A;  1NMV A;  3JXV A;  5DIT A;  1HKI A;  1D7I A;  4LAW A;  2KFW A;  3JYM A;  5GQB A;  1HJV A;  4ZPW R;  4MTV A;  1EQ3 A;  4PTM A;  3B8S A;  3CGM A;  1FKS A;  1HXV A;  2IF4 A;  1TFV A;  1EHN A;  1X6L A;  3GPK A;  1YAT A;  4U84 A;  1W26 A;  1FKI A;  1GPF A;  1D7H A;  1P5Q A;  3TDB A;  5HW8 A;  2VN1 A;  3O5I A;  3WL0 A;  4WJX A;  1E6R A;  4ZPT R;  1O6I A;  2KR7 A;  3IKG A;  2PPP A;  2ZR4 A;  4QZV B;  1LQ0 A;  4DRO A;  1EIB A;  4JFI A;  2WM0 A;  3ART A;  3OOB A;  3UQB A;  1XRV A;  1QPF A;  4IQC A;  3G6M A;  3AS3 A;  1NWS A;  4ODR A;  2K8I A;  5HBF A;  1EDQ A;  1WNO A;  2M2A A;  2LKN A;  5J6E A;  1PIN A;  1C9H A;  3WH0 A;  2RUR A;  2G8Z A;  5HT1 A;  3ARY A;  2DG9 A;  1LG2 A;  3I6C A;  1KT0 A;  4C02 B;  5HUA A;  4TW7 A;  3WIJ A;  2A3C A;  3PR9 A;  3B9A A;  4DZ2 A;  1LL6 A;  4KQZ A;  3AS1 A;  4ODL A;  2XP9 A;  5I98 A;  2OFN A;  3RFW A;  2PI6 A;  2DG4 A;  2ZQV A;  3AQU A;  3TCZ A;  2XP7 A;  2XPB A;  5HW6 A;  2O9O A;  1Q6I A;  3ALG A;  2LGO A;  3FXY A;  3PRD A;  3CGN A;  1EYM A;  3ARQ A;  4DRM A;  4G50 A;  4DH0 A;  4JYS A;  4LGX A;  3IKD A;  1OGG A;  2FDM A;  1D6O A;  1FKL A;  3WD3 A;  1K9T A;  4O2T A;  1E6Z A;  3NTP A;  4AY1 A;  2XP6 A;  4P8X A;  1NWT A;  4JFK A;  1NH6 A;  1N1A A;  1NWU A;  3WQV A;  1FJD A;  4ODM A;  3AS2 A;  4W9P A;  4U86 A;  1RD6 A;  4DT4 A;  5BXJ A;  3WKZ A;  4GGQ A;  3WQW A;  4MNL A;  3UI5 A;  4QT3 A;  1VF8 A;  2QF8 A;  2FKE A;  1JND A;  4DRK A;  4W9Q A;  3EY6 A;  2PV3 A;  5HTG A;  1GOI A;  4IQ2 A;  1Y0O A;  1ZBW A;  2DT3 A;  4J4N A;  3ARV A;  2DSW A;  4IPX A;  4NNR A;  1E6N A;  4FN2 A;  1IX5 A;  4DRN A;  3O5M A;  4BF8 A;  1KT1 A;  4TW6 A;  3O5P A;  3ARZ A;  3LUO A;  1HKK A;  1QZ2 A;  3ARP A;  3UI4 A;  3B7X A;  4DWS A;  1FKR A;  1SR0 A;  1J4R A;  4URI A;  2ZQT A;  3KAB A;  2KI3 A;  1ZL1 A;  4ODQ A;  2N87 A;  2AOS A;  3CHD A;  2F2D A;  1JVW A;  4S3K A;  1OWQ A;  1H0I A;  3ARU A;  4WK9 A;  4Z2G A;  1JNS A;  3O5L A;  3KAI A;  1ZBK A;  4Z2J A;  4ODO A;  3O5F A;  4ZPV R;  4Z2I A;  4GIV A;  5D75 A;  2A3B A;  3O5E A;  3O5O A;  5DO2 A;  3UI6 A;  3CHC A;  4ODK A;  1FKK A;  3W4R A;  2KGJ A;  4MAV A;  4Z2K A;  2L2S A;  2YBU A;  4Z2H A;  1NSG A;  4MSP A;  2A3A A;  2KE0 A;  2OLH A;  3WD0 A;  1E6P A;  1F40 A;  4MNJ A;  4WIW A;  1D2K A;  1FAP A;  3PA7 A;  3O5K A;  4W9O A;  4NZC A;  3UF8 A;  1LL7 A;  3FY1 A;  3ARR A;  1LJY A;  1UR8 A;  3O5D A;  3CHE A;  4L72 B;  1FKD A;  3NI6 A;  4U85 A;  2AWG A;  5DIU A;  3FAP A;  4WKA A;  4WKF A;  3KAD A;  1NWR A;  1W1V A;  3ARO A;  1TCO C;  1SYT A;  1W1Y A;  4DRP A;  1W1P A;  2XP3 A;  4TNS A;  1W9P A;  1Q1C A;  2KO7 A;  3O5G A;  2PPO A;  4LAY A;  4KR0 B;  1ZBV A;  2O92 A;  3WL1 A;  2PV2 A;  4HBO A;  1E9L A;  5GPG A;  2XP5 A;  2DT1 A;  1Q6U A;  4HAR A;  3NRK A;  1L1P A;  1T11 A;  3IHZ A;  1W9U A;  2DSV A;  4Q22 A;  4MNM A;  3KZ7 A;  1WAW A;  3QOK A;  1FFQ A;  3JYJ A;  2G41 A;  1YW5 A;  4MNK A;  2DG3 A;  2JZV A;  3ARS A;  1FKT A;  1OGB A;  2Q5A A;  3H9R B;  2ZQS A;  3ALF A;  3O5J A;  2ITK A;  5DEZ A;  1BKF A;  2B31 A;  4N19 A;  4QIB A;  3UQI A;  3RM8 A;  4DZ3 A;  4ODP A;  2RQS A;  3WD4 A;  4ML4 A;  2DT0 A;  1Q6H A;  1ZBC A;  2UZ5 A;  1ZK6 A;  1X6N A;  1FKJ A;  3VAW A;  1FKH A;  4QT2 A;  3G6L A;  2RUD A;  4Z2L A;  1ITX A;  1J4I A;  1ZCN A;  1FD9 A;  3KAC A;  4FAP A;  4P8U A;  4HBE A;  3MDY B;  4Q7N A;  4NSB A;  1ZB5 A;  1JNT A;  5HKG A;  1FKB A;  2ZR5 A;  3ARW A;  4DRI A;  3O5Q A;  1ZU8 A;  2ZQU A;  3RM4 A;  1F8A B;  1FFR A;  2IUZ A;  3KCE A;  2LJ4 A;  1NMW A;  4R0X A;  4ODN A;  1R9H A;  1XHG A;  1HKJ A;  1HJW A;  1W1T A;  2F4E A;  1JNE A;  3O5R A;  3AS0 A;  4IT6 A;  3OA5 A;  1HKM A;  2MLX A;  3B9D A;  2DSZ A;  3ARX A;  5HWC A;  4S3J A;  4MPK A;  5GPR A;  1LG1 A;  2M08 A;  4XAK A;  3ODK A;  2DSU A;  2MPH A;  3UQA A;  2PPN A;  4R5E A;  2MNT A;  2LPV A;  4WKH A;  2XP4 A;  3KAG A;  4IT4 A;  1ROU A;  5HWB A;  4J4O A;  4LAX A;  1GUV A;  2DT2 A;  3RM9 A;  1M5Y A;  2MLZ A;  3BXW A;  2PBC A;  1KFW A;  1FKG A;  2Y78 A;  1D7J A;  3CZ8 A;  3PRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...