1FJDA

Human parvulin-like peptidyl prolyl cis/trans isomerase, hpar14
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GSGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL PROLYL CIS/TRANS ISOMERASE (PPIASE)
publication title Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 12
structure length 104
sequence length 104
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2000-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fjdA00
1JNTA 2VCDA 1FKRA 1HXVA 1FKGA 4DRHA 4TW7A 3I6CA 1FKDA 3O5PA 4W9OA 5BXJA 2XP8A 3O5JA 3O5FA 2JZVA 3B7XA 3UF8A 4TX0A 1NSGA 1Q6UA 1FKJA 3UI4A 1EQ3A 1BL4A 5HUAA 2N87A 2PV2A 3PA7A 2ZQSA 1N1AA 1FAPA 1FKTA 4DRMA 1J4RA 1ROUA 4IQ2A 2PV1A 1QZ2A 4JFKA 2XP5A 3O5MA 1Q1CA 1D7HA 2XP7A 3GPKA 4DIPA 2ITKA 4TNSA 1M5YA 2FKEA 5HT1A 4J4OA 2RUDA 2PPOA 3KADA 4TYOA 2DG4A 2F21A 1Y0OA 2M2AA 1JNSA 3O5OA 1F8AB 4ODNA 2ZR6A 2LJ4A 3KAFA 4QT2A 4W9QA 3UI5A 2RSEA 2PPPA 2XPBA 1KT0A 2DG9A 4R0XA 3O5IA 4LAWA 1B6CA 2XP3A 3KZ7A 4MSPA 1W26A 3VAWA 3UQIA 1ZK6A 1TCOC 2XP6A 4GIVA 4QT3A 2LPVA 5B8IC 5J6EA 4DRQA 1J4HA 2RUQA 2PBCA 4MGVA 5GPGA 3TCZA 2F2DA 3WH0A 4DH0A 5HWCA 4ODKA 1Q6HA 3RFWA 3CGNA 1QPLA 4ITZA 1T11A 2ZQUA 4JFMA 2ZR4A 4ODPA 3EY6A 3O5EA 4DRKA 1L1PA 2KE0A 3H9RB 4GGQA 1A7XA 4NNRA 4QIBA 1R9HA 1C9HA 2PPNA 4ODLA 3RGCA 3KAIA 3O5LA 4ODMA 1J4IA 4LAVA 3TC5A 4BF8A 1BKFA 2Y78A 5HW8A 1YW5A 1NMVA 3IKGA 3TDBA 2D9FA 2L2SA 4TW6A 1PBKA 2LGOA 2M1IA 2VN1A 4IQCA 3NTPA 5DIVA 3UQAA 1FKLA 2AWGA 2DG3A 2KGJA 2LKNA 3LUOA 3KAGA 3PRBA 4DZ2A 2F4EA 2K8IA 3IKDA 4IPXA 4O2TA 4U84A 1ROTA 2MLXA 5DITA 4DRIA 1Q6IA 1EYMA 1ZCNA 2KR7A 2MLZA 2XP9A 1FKSA 2IF4A 3IHZA 3MDYB 3O5QA 4G2PA 4LAYA 4DT4A 2KFWA 4U86A 4C02B 1QPFA 2PV3A 1FJDA 4ODQA 1P5QA 4ODRA 4DZ3A 4DRPA 1D7IA 1KT1A 4N19A 3IK8A 5HKGA 1PINA 3NRKA 4ODOA 2XP4A 3KACA 2OFNA 3JXVA 5DIUA 3UQBA 2M08A 1D7JA 5HWBA 4DRNA 1J6YA 3JYJA 2Q5AA 4G50A 1F40A 3FAPA 5HTGA 1YATA 2KI3A 4JYSA 2RQSA 2XPAA 3JYMA 2ZQTA 3O5KA 4J4NA 2MNTA 3PRDA 2ZQVA 3KAHA 4JFJA 1FKKA 5D75A 1JVWA 1U79A 4DROA 3ODKA 1FKBA 2MLYA 4U85A 3NI6A 2MF9A 2UZ5A 5HW6A 4DRJA 3KABA 3O5RA 3CGMA 4FAPA 1FKHA 4TW8A 1D6OA 1FKIA 1FKFA 3O5DA 2RUCA 3UI6A 1NMWA 2KO7A 3KCEA 3O5GA 1FD9A 4W9PA 5HW7A 4LAXA 2RURA 5I98A 2MPHA 2ZR5A 4JFIA 4FN2A 4JFLA 3OOBA 2FAPA
chains in the Genus database with same CATH superfamily
2VCDA 3CHEA 3G6MA 1KFWA 3O5PA 3UI4A 3G6LA 1ZU8A 3WKZA 1FAPA 4DRMA 2YBTA 1QZ2A 1LL6A 4HBOA 2ITKA 4TNSA 1M5YA 4IT6A 4QZVB 2F21A 3B9EA 2IUZA 3O5OA 2PI6A 3KAFA 3RMEA 1O6IA 3QOKA 1E6ZA 2DT2A 3BMBA 1ZL1A 4GIVA 1ZBWA 1IX5A 4DRHA 4JFMA 1LL4A 2ZQUA 4S3KA 2ZR4A 3O5EA 4GGQA 3AS3A 1W9VA 1LJYA 3ARYA 5HW8A 1YW5A 1NMVA 2D9FA 4IQCA 5JH8A 2WLYA 5DO2A 2AWGA 2LKNA 1OGGA 3W4RA 1EYMA 2B5UB 4G2PA 4DT4A 1WNOA 5HBFA 4C02B 2PV3A 1FJDA 1P5QA 2DSZA 5GQBA 2F23A 3NRKA 3KACA 3JXVA 3AROA 3UQBA 2DPEA 4P8XA 1D7JA 4L72B 3ARXA 4KQZA 3WL1A 1F40A 1YATA 2RQSA 2XPAA 4J4NA 2ZQTA 3ODKA 2WLZA 4DWSC 1ZB5A 1FKHA 4TW8A 3O5DA 2DSUA 2RUCA 4ML4A 1NMWA 4PTMA 4LAXA 4URIA 2MPHA 1JNEA 2A3EA 4IT4A 4Q7NA 1JNTA 3I6CA 1FKDA 2PN0A 2JZVA 2WM0A 3ARZA 1HKMA 2P4VA 3ALFA 3B7XA 4MPKA 1BL4A 1GUVA 3WD2A 3PA7A 2ZQSA 1N1AA 1FKTA 4Q22A 3WD3A 1GPFA 1SR0A 1HKJA 2A3BA 1GRJA 1Q1CA 1LQ0A 1SYTA 4W5UA 1W1TA 3RM4A 3WD1A 3AQUA 4Z2IA 4J4OA 3KADA 1UR8A 3WQVA 4P8VA 2DG4A 1JNSA 2ZR6A 2LJ4A 4W9QA 4HBEA 2XPBA 1KT0A 1H0IA 4LAWA 1EIBA 1B6CA 1W26A 1E6RA 3VAWA 2DT1A 3PRAA 1TCOC 2XP6A 4Z2KA 1TFVA 1J4HA 4MGVA 3WH0A 3RFWA 4ODPA 4DRKA 2O92A 3KAIA 3O5LA 4ODMA 1J4IA 3TC5A 1BKFA 3IKGA 3TDBA 2L2SA 1PBKA 3NTPA 1FKLA 2DG3A 2F4EA 2G8ZA 2ESCA 3IKDA 5DITA 2MLXA 4WKHA 4DRIA 2MLZA 3IHZA 2XP9A 2IF4A 3EIPA 3ARUA 4ODQA 4ODRA 1D7IA 1E6NA 3IK8A 1HKIA 4KR0B 1OWQA 2DSVA 2M08A 2DT3A 4DRNA 3JYJA 3O5KA 2MNTA 3ARPA 2ZQVA 3KAHA 1FKKA 3PR9A 5D75A 1U79A 1RD6A 2MF9A 2UZ5A 1D2KA 4DRJA 3CGMA 4FAPA 1E6PA 4ZPWR 2EULA 1K9TA 2DT0A 3UI6A 3O5GA 3KCEA 1FD9A 5HW7A 1NWSA 4WIWA 4DWSB 2FAPA 2OLHA 2A3AA 1E44A 4WKFA 1FKGA 2QF8A 4W9OA 5BXJA 3O5JA 3O5FA 3RM9A 1EQ3A 3UF8A 4TX0A 1Q6UA 1FKJA 3ARSA 5HUAA 1J4RA 4IQ2A 2PV1A 1HJXA 4MNJA 1JCHB 1W9PA 2XP7A 3GPKA 2FKEA 2RUDA 4TYOA 2M2AA 1F8AB 1LG2A 4QT2A 3FXYA 1XRVA 3UI5A 2RSEA 2PPPA 2DG9A 3O5IA 2XP3A 3KZ7A 4MSPA 3UQIA 3ARQA 1W9UA 1UR9A 5DF0A 4QT3A 5J6EA 4DRQA 1E9LA 5GPGA 3TCZA 2F2DA 3B9DA 4DH0A 3CGNA 1QPLA 4ITZA 1T11A 3WQWA 1W1PA 1A7XA 1R9HA 3RGCA 3ALGA 4LAVA 3AS1A 4BF8A 4TW6A 2LGOA 1W1VA 2M1IA 2VN1A 2YBUA 5DIVA 3LUOA 2K8IA 4IPXA 4O2TA 3ARVA 1NWUA 5GPRA 1X6NA 1ZCNA 3O5QA 4U84A 1FKSA 3MDYB 4MNKA 1ITXA 2KFWA 4U86A 1VF8A 4HARA 1PINA 4S3JA 4ODOA 2OFNA 4MTVA 4ZPVR 5HWBA 1GOIA 1J6YA 4G50A 4JYSA 3JYMA 3PRDA 4JFJA 1FKBA 4Z2LA 3NI6A 1HJVA 5HW6A 3O5RA 1NH6A 1D6OA 4XAKA 1FKFA 3CH9A 1ZBVA 3CHDA 3B9AA 1LG1A 1WAWA 2RURA 1EDQA 5I98A 3AS0A 4JFIA 4DZ2A 3OOBA 4LGXA 1NWRA 1FKRA 1HXVA 4TW7A 2ETNA 4Z2JA 2XP8A 4DZ3A 3AS2A 1NSGA 4MAVA 2A3CA 2DSWA 2N87A 2PV2A 1ROUA 4JFKA 1EHNA 2XP5A 3ARRA 3O5MA 1D7HA 1CTNA 3BXWA 4WK9A 4DIPA 5HT1A 2PPOA 1XHGA 1LL7A 1Y0OA 1X6LA 4WKAA 4ODNA 4P8WA 3GU0A 4UDMA 1W1YA 3WD0A 3OA5A 4R0XA 3CZ8A 4NSBA 4DWSD 4DWSA 1WB0A 1ZK6A 3ARWA 3WD4A 2LPVA 5B8IC 2RUQA 2PBCA 2WK2A 5HWCA 4ODKA 1Q6HA 4ZPTR 2B31A 3FY1A 1L1PA 3EY6A 4NZCA 2KE0A 3H9RB 4Z2GA 4NNRA 4QIBA 1C9HA 2PPNA 4ODLA 4AY1A 2Y78A 1HJWA 5DEZA 1ZBCA 3UQAA 2KGJA 3PRBA 3KAGA 1OGBA 4R5EA 4MNLA 1ROTA 3GTYX 1Q6IA 4Z2HA 2KR7A 4LAYA 1ZBKA 1QPFA 1E15A 1NWTA 4P8UA 4DRPA 1KT1A 3ARTA 4N19A 5HKGA 1FFRA 2XP4A 1JNDA 5DIUA 2G41A 2Q5AA 3FAPA 5HTGA 2KI3A 3CHCA 4ZS6A 2O9OA 3RM8A 1JVWA 4DROA 4L3NA 1H0GA 2MLYA 4U85A 3KABA 4WJXA 3WL0A 2AOSA 3WIJA 1FKIA 4MNMA 2FDMA 1HKKA 3CHFA 2KO7A 1FFQA 4W9PA 2ZR5A 4FN2A 4JFLA 3B8SA
chains in the Genus database with same CATH topology
2VCDA 3CHEA 3G6MA 1KFWA 3O5PA 3UI4A 3G6LA 1ZU8A 3WKZA 1FAPA 4DRMA 2YBTA 1QZ2A 1LL6A 4HBOA 2ITKA 4TNSA 1M5YA 4IT6A 4QZVB 2F21A 3B9EA 2IUZA 3O5OA 2PI6A 3KAFA 3RMEA 1O6IA 3QOKA 1E6ZA 2DT2A 1ZL1A 4GIVA 1ZBWA 1IX5A 4DRHA 4JFMA 1LL4A 2ZQUA 4S3KA 2ZR4A 3O5EA 4GGQA 3AS3A 1W9VA 1LJYA 3ARYA 5HW8A 1YW5A 1NMVA 2D9FA 4IQCA 5JH8A 2WLYA 5DO2A 2AWGA 2LKNA 1OGGA 3W4RA 1EYMA 4G2PA 4DT4A 1WNOA 5HBFA 4C02B 2PV3A 1FJDA 1P5QA 2DSZA 5GQBA 3NRKA 3KACA 3JXVA 3AROA 3UQBA 2DPEA 4P8XA 1D7JA 4L72B 3ARXA 4KQZA 3WL1A 1F40A 1YATA 2RQSA 2XPAA 4J4NA 2ZQTA 3ODKA 2WLZA 4DWSC 1ZB5A 1FKHA 4TW8A 3O5DA 2DSUA 2RUCA 4ML4A 1NMWA 4PTMA 4LAXA 4URIA 2MPHA 1JNEA 2A3EA 4IT4A 4Q7NA 1JNTA 3I6CA 1FKDA 2JZVA 2WM0A 3ARZA 1HKMA 3ALFA 3B7XA 4MPKA 1BL4A 1GUVA 3WD2A 3PA7A 2ZQSA 1N1AA 1FKTA 4Q22A 3WD3A 1GPFA 1SR0A 1HKJA 2A3BA 1Q1CA 1LQ0A 1SYTA 4W5UA 1W1TA 3RM4A 3WD1A 3AQUA 4Z2IA 4J4OA 3KADA 1UR8A 3WQVA 4P8VA 2DG4A 1JNSA 2ZR6A 2LJ4A 4W9QA 4HBEA 2XPBA 1KT0A 1H0IA 4LAWA 1EIBA 1B6CA 1W26A 1E6RA 3VAWA 2DT1A 3PRAA 1TCOC 2XP6A 4Z2KA 1TFVA 1J4HA 4MGVA 3WH0A 3RFWA 4ODPA 4DRKA 2O92A 3KAIA 3O5LA 4ODMA 1J4IA 3TC5A 1BKFA 3IKGA 3TDBA 2L2SA 1PBKA 3NTPA 1FKLA 2DG3A 2F4EA 2G8ZA 2ESCA 3IKDA 5DITA 2MLXA 4WKHA 4DRIA 2MLZA 3IHZA 2XP9A 2IF4A 3ARUA 4ODQA 4ODRA 1D7IA 1E6NA 3IK8A 1HKIA 4KR0B 1OWQA 2DSVA 2M08A 2DT3A 4DRNA 3JYJA 3O5KA 2MNTA 3ARPA 2ZQVA 3KAHA 1FKKA 3PR9A 5D75A 1U79A 1RD6A 2MF9A 2UZ5A 1D2KA 4DRJA 3CGMA 4FAPA 1E6PA 4ZPWR 1K9TA 2DT0A 3UI6A 3O5GA 3KCEA 1FD9A 5HW7A 1NWSA 4WIWA 4DWSB 2FAPA 2OLHA 2A3AA 4WKFA 1FKGA 2QF8A 4W9OA 5BXJA 3O5JA 3O5FA 3RM9A 1EQ3A 3UF8A 4TX0A 1Q6UA 1FKJA 3ARSA 5HUAA 1J4RA 4IQ2A 2PV1A 1HJXA 4MNJA 2XP7A 1W9PA 3GPKA 2FKEA 2RUDA 4TYOA 2M2AA 1F8AB 1LG2A 4QT2A 3FXYA 1XRVA 3UI5A 2RSEA 2PPPA 2DG9A 3O5IA 2XP3A 3KZ7A 4MSPA 3UQIA 3ARQA 1W9UA 1UR9A 5DF0A 4QT3A 5J6EA 4DRQA 1E9LA 5GPGA 3TCZA 2F2DA 3B9DA 4DH0A 3CGNA 1QPLA 4ITZA 1T11A 3WQWA 1W1PA 1A7XA 1R9HA 3RGCA 3ALGA 4LAVA 3AS1A 4BF8A 4TW6A 2LGOA 1W1VA 2M1IA 2VN1A 2YBUA 5DIVA 3LUOA 2K8IA 4IPXA 4O2TA 3ARVA 1NWUA 5GPRA 1X6NA 1ZCNA 3O5QA 4U84A 1FKSA 3MDYB 4MNKA 1ITXA 2KFWA 4U86A 1VF8A 4HARA 1PINA 4S3JA 4ODOA 2OFNA 4MTVA 4ZPVR 5HWBA 1GOIA 1J6YA 4G50A 4JYSA 3JYMA 3PRDA 4JFJA 1FKBA 4Z2LA 3NI6A 1HJVA 5HW6A 3O5RA 1NH6A 1D6OA 4XAKA 1FKFA 3CH9A 1ZBVA 3CHDA 3B9AA 1LG1A 1WAWA 2RURA 1EDQA 5I98A 3AS0A 4JFIA 4DZ2A 3OOBA 4LGXA 1NWRA 1FKRA 1HXVA 4TW7A 4Z2JA 2XP8A 4DZ3A 3AS2A 1NSGA 4MAVA 2A3CA 2DSWA 2N87A 2PV2A 1ROUA 4JFKA 1EHNA 2XP5A 3ARRA 3O5MA 1D7HA 1CTNA 3BXWA 4WK9A 4DIPA 5HT1A 2PPOA 1XHGA 1LL7A 1Y0OA 1X6LA 4WKAA 4ODNA 4P8WA 1W1YA 3WD0A 3OA5A 4R0XA 3CZ8A 4NSBA 4DWSD 4DWSA 1WB0A 1ZK6A 3ARWA 3WD4A 2LPVA 5B8IC 2RUQA 2PBCA 2WK2A 5HWCA 4ODKA 1Q6HA 4ZPTR 2B31A 3FY1A 1L1PA 3EY6A 4NZCA 2KE0A 3H9RB 4Z2GA 4NNRA 4QIBA 1C9HA 2PPNA 4ODLA 4AY1A 2Y78A 1HJWA 5DEZA 1ZBCA 3UQAA 2KGJA 3PRBA 3KAGA 1OGBA 4R5EA 4MNLA 1ROTA 1Q6IA 4Z2HA 2KR7A 4LAYA 1ZBKA 1QPFA 1E15A 1NWTA 4P8UA 4DRPA 1KT1A 3ARTA 4N19A 5HKGA 1FFRA 2XP4A 1JNDA 5DIUA 2G41A 2Q5AA 3FAPA 5HTGA 2KI3A 3CHCA 4ZS6A 2O9OA 3RM8A 1JVWA 4DROA 4L3NA 1H0GA 2MLYA 4U85A 3KABA 4WJXA 3WL0A 2AOSA 3WIJA 1FKIA 4MNMA 2FDMA 1HKKA 3CHFA 2KO7A 1FFQA 4W9PA 2ZR5A 4FN2A 4JFLA 3B8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNT A;  2VCD A;  1FKR A;  1HXV A;  1FKG A;  4DRH A;  4TW7 A;  3I6C A;  1FKD A;  3O5P A;  4W9O A;  5BXJ A;  2XP8 A;  3O5J A;  3O5F A;  2JZV A;  3B7X A;  3UF8 A;  4TX0 A;  1NSG A;  1Q6U A;  1FKJ A;  3UI4 A;  1EQ3 A;  1BL4 A;  5HUA A;  2N87 A;  2PV2 A;  3PA7 A;  2ZQS A;  1N1A A;  1FAP A;  1FKT A;  4DRM A;  1J4R A;  1ROU A;  4IQ2 A;  2PV1 A;  1QZ2 A;  4JFK A;  2XP5 A;  3O5M A;  1Q1C A;  1D7H A;  2XP7 A;  3GPK A;  4DIP A;  2ITK A;  4TNS A;  1M5Y A;  2FKE A;  5HT1 A;  4J4O A;  2RUD A;  2PPO A;  3KAD A;  4TYO A;  2DG4 A;  2F21 A;  1Y0O A;  2M2A A;  1JNS A;  3O5O A;  1F8A B;  4ODN A;  2ZR6 A;  2LJ4 A;  3KAF A;  4QT2 A;  4W9Q A;  3UI5 A;  2RSE A;  2PPP A;  2XPB A;  1KT0 A;  2DG9 A;  4R0X A;  3O5I A;  4LAW A;  1B6C A;  2XP3 A;  3KZ7 A;  4MSP A;  1W26 A;  3VAW A;  3UQI A;  1ZK6 A;  1TCO C;  2XP6 A;  4GIV A;  4QT3 A;  2LPV A;  5B8I C;  5J6E A;  4DRQ A;  1J4H A;  2RUQ A;  2PBC A;  4MGV A;  5GPG A;  3TCZ A;  2F2D A;  3WH0 A;  4DH0 A;  5HWC A;  4ODK A;  1Q6H A;  3RFW A;  3CGN A;  1QPL A;  4ITZ A;  1T11 A;  2ZQU A;  4JFM A;  2ZR4 A;  4ODP A;  3EY6 A;  3O5E A;  4DRK A;  1L1P A;  2KE0 A;  3H9R B;  4GGQ A;  1A7X A;  4NNR A;  4QIB A;  1R9H A;  1C9H A;  2PPN A;  4ODL A;  3RGC A;  3KAI A;  3O5L A;  4ODM A;  1J4I A;  4LAV A;  3TC5 A;  4BF8 A;  1BKF A;  2Y78 A;  5HW8 A;  1YW5 A;  1NMV A;  3IKG A;  3TDB A;  2D9F A;  2L2S A;  4TW6 A;  1PBK A;  2LGO A;  2M1I A;  2VN1 A;  4IQC A;  3NTP A;  5DIV A;  3UQA A;  1FKL A;  2AWG A;  2DG3 A;  2KGJ A;  2LKN A;  3LUO A;  3KAG A;  3PRB A;  4DZ2 A;  2F4E A;  2K8I A;  3IKD A;  4IPX A;  4O2T A;  4U84 A;  1ROT A;  2MLX A;  5DIT A;  4DRI A;  1Q6I A;  1EYM A;  1ZCN A;  2KR7 A;  2MLZ A;  2XP9 A;  1FKS A;  2IF4 A;  3IHZ A;  3MDY B;  3O5Q A;  4G2P A;  4LAY A;  4DT4 A;  2KFW A;  4U86 A;  4C02 B;  1QPF A;  2PV3 A;  1FJD A;  4ODQ A;  1P5Q A;  4ODR A;  4DZ3 A;  4DRP A;  1D7I A;  1KT1 A;  4N19 A;  3IK8 A;  5HKG A;  1PIN A;  3NRK A;  4ODO A;  2XP4 A;  3KAC A;  2OFN A;  3JXV A;  5DIU A;  3UQB A;  2M08 A;  1D7J A;  5HWB A;  4DRN A;  1J6Y A;  3JYJ A;  2Q5A A;  4G50 A;  1F40 A;  3FAP A;  5HTG A;  1YAT A;  2KI3 A;  4JYS A;  2RQS A;  2XPA A;  3JYM A;  2ZQT A;  3O5K A;  4J4N A;  2MNT A;  3PRD A;  2ZQV A;  3KAH A;  4JFJ A;  1FKK A;  5D75 A;  1JVW A;  1U79 A;  4DRO A;  3ODK A;  1FKB A;  2MLY A;  4U85 A;  3NI6 A;  2MF9 A;  2UZ5 A;  5HW6 A;  4DRJ A;  3KAB A;  3O5R A;  3CGM A;  4FAP A;  1FKH A;  4TW8 A;  1D6O A;  1FKI A;  1FKF A;  3O5D A;  2RUC A;  3UI6 A;  1NMW A;  2KO7 A;  3KCE A;  3O5G A;  1FD9 A;  4W9P A;  5HW7 A;  4LAX A;  2RUR A;  5I98 A;  2MPH A;  2ZR5 A;  4JFI A;  4FN2 A;  4JFL A;  3OOB A;  2FAP A; 
#chains in the Genus database with same CATH topology
 2VCD A;  3CHE A;  3G6M A;  1KFW A;  3O5P A;  3UI4 A;  3G6L A;  1ZU8 A;  3WKZ A;  1FAP A;  4DRM A;  2YBT A;  1QZ2 A;  1LL6 A;  4HBO A;  2ITK A;  4TNS A;  1M5Y A;  4IT6 A;  4QZV B;  2F21 A;  3B9E A;  2IUZ A;  3O5O A;  2PI6 A;  3KAF A;  3RME A;  1O6I A;  3QOK A;  1E6Z A;  2DT2 A;  3BMB A;  1ZL1 A;  4GIV A;  1ZBW A;  1IX5 A;  4DRH A;  4JFM A;  1LL4 A;  2ZQU A;  4S3K A;  2ZR4 A;  3O5E A;  4GGQ A;  3AS3 A;  1W9V A;  1LJY A;  3ARY A;  5HW8 A;  1YW5 A;  1NMV A;  2D9F A;  4IQC A;  5JH8 A;  2WLY A;  5DO2 A;  2AWG A;  2LKN A;  1OGG A;  3W4R A;  1EYM A;  2B5U B;  4G2P A;  4DT4 A;  1WNO A;  5HBF A;  4C02 B;  2PV3 A;  1FJD A;  1P5Q A;  2DSZ A;  5GQB A;  2F23 A;  3NRK A;  3KAC A;  3JXV A;  3ARO A;  3UQB A;  2DPE A;  4P8X A;  1D7J A;  4L72 B;  3ARX A;  4KQZ A;  3WL1 A;  1F40 A;  1YAT A;  2RQS A;  2XPA A;  4J4N A;  2ZQT A;  3ODK A;  2WLZ A;  4DWS C;  1ZB5 A;  1FKH A;  4TW8 A;  3O5D A;  2DSU A;  2RUC A;  4ML4 A;  1NMW A;  4PTM A;  4LAX A;  4URI A;  2MPH A;  1JNE A;  2A3E A;  4IT4 A;  4Q7N A;  1JNT A;  3I6C A;  1FKD A;  2PN0 A;  2JZV A;  2WM0 A;  3ARZ A;  1HKM A;  2P4V A;  3ALF A;  3B7X A;  4MPK A;  1BL4 A;  1GUV A;  3WD2 A;  3PA7 A;  2ZQS A;  1N1A A;  1FKT A;  4Q22 A;  3WD3 A;  1GPF A;  1SR0 A;  1HKJ A;  2A3B A;  1GRJ A;  1Q1C A;  1LQ0 A;  1SYT A;  4W5U A;  1W1T A;  3RM4 A;  3WD1 A;  3AQU A;  4Z2I A;  4J4O A;  3KAD A;  1UR8 A;  3WQV A;  4P8V A;  2DG4 A;  1JNS A;  2ZR6 A;  2LJ4 A;  4W9Q A;  4HBE A;  2XPB A;  1KT0 A;  1H0I A;  4LAW A;  1EIB A;  1B6C A;  1W26 A;  1E6R A;  3VAW A;  2DT1 A;  3PRA A;  1TCO C;  2XP6 A;  4Z2K A;  1TFV A;  1J4H A;  4MGV A;  3WH0 A;  3RFW A;  4ODP A;  4DRK A;  2O92 A;  3KAI A;  3O5L A;  4ODM A;  1J4I A;  3TC5 A;  1BKF A;  3IKG A;  3TDB A;  2L2S A;  1PBK A;  3NTP A;  1FKL A;  2DG3 A;  2F4E A;  2G8Z A;  2ESC A;  3IKD A;  5DIT A;  2MLX A;  4WKH A;  4DRI A;  2MLZ A;  3IHZ A;  2XP9 A;  2IF4 A;  3EIP A;  3ARU A;  4ODQ A;  4ODR A;  1D7I A;  1E6N A;  3IK8 A;  1HKI A;  4KR0 B;  1OWQ A;  2DSV A;  2M08 A;  2DT3 A;  4DRN A;  3JYJ A;  3O5K A;  2MNT A;  3ARP A;  2ZQV A;  3KAH A;  1FKK A;  3PR9 A;  5D75 A;  1U79 A;  1RD6 A;  2MF9 A;  2UZ5 A;  1D2K A;  4DRJ A;  3CGM A;  4FAP A;  1E6P A;  4ZPW R;  2EUL A;  1K9T A;  2DT0 A;  3UI6 A;  3O5G A;  3KCE A;  1FD9 A;  5HW7 A;  1NWS A;  4WIW A;  4DWS B;  2FAP A;  2OLH A;  2A3A A;  1E44 A;  4WKF A;  1FKG A;  2QF8 A;  4W9O A;  5BXJ A;  3O5J A;  3O5F A;  3RM9 A;  1EQ3 A;  3UF8 A;  4TX0 A;  1Q6U A;  1FKJ A;  3ARS A;  5HUA A;  1J4R A;  4IQ2 A;  2PV1 A;  1HJX A;  4MNJ A;  1JCH B;  1W9P A;  2XP7 A;  3GPK A;  2FKE A;  2RUD A;  4TYO A;  2M2A A;  1F8A B;  1LG2 A;  4QT2 A;  3FXY A;  1XRV A;  3UI5 A;  2RSE A;  2PPP A;  2DG9 A;  3O5I A;  2XP3 A;  3KZ7 A;  4MSP A;  3UQI A;  3ARQ A;  1W9U A;  1UR9 A;  5DF0 A;  4QT3 A;  5J6E A;  4DRQ A;  1E9L A;  5GPG A;  3TCZ A;  2F2D A;  3B9D A;  4DH0 A;  3CGN A;  1QPL A;  4ITZ A;  1T11 A;  3WQW A;  1W1P A;  1A7X A;  1R9H A;  3RGC A;  3ALG A;  4LAV A;  3AS1 A;  4BF8 A;  4TW6 A;  2LGO A;  1W1V A;  2M1I A;  2VN1 A;  2YBU A;  5DIV A;  3LUO A;  2K8I A;  4IPX A;  4O2T A;  3ARV A;  1NWU A;  5GPR A;  1X6N A;  1ZCN A;  3O5Q A;  4U84 A;  1FKS A;  3MDY B;  4MNK A;  1ITX A;  2KFW A;  4U86 A;  1VF8 A;  4HAR A;  1PIN A;  4S3J A;  4ODO A;  2OFN A;  4MTV A;  4ZPV R;  5HWB A;  1GOI A;  1J6Y A;  4G50 A;  4JYS A;  3JYM A;  3PRD A;  4JFJ A;  1FKB A;  4Z2L A;  3NI6 A;  1HJV A;  5HW6 A;  3O5R A;  1NH6 A;  1D6O A;  4XAK A;  1FKF A;  3CH9 A;  1ZBV A;  3CHD A;  3B9A A;  1LG1 A;  1WAW A;  2RUR A;  1EDQ A;  5I98 A;  3AS0 A;  4JFI A;  4DZ2 A;  3OOB A;  4LGX A;  1NWR A;  1FKR A;  1HXV A;  4TW7 A;  2ETN A;  4Z2J A;  2XP8 A;  4DZ3 A;  3AS2 A;  1NSG A;  4MAV A;  2A3C A;  2DSW A;  2N87 A;  2PV2 A;  1ROU A;  4JFK A;  1EHN A;  2XP5 A;  3ARR A;  3O5M A;  1D7H A;  1CTN A;  3BXW A;  4WK9 A;  4DIP A;  5HT1 A;  2PPO A;  1XHG A;  1LL7 A;  1Y0O A;  1X6L A;  4WKA A;  4ODN A;  4P8W A;  3GU0 A;  4UDM A;  1W1Y A;  3WD0 A;  3OA5 A;  4R0X A;  3CZ8 A;  4NSB A;  4DWS D;  4DWS A;  1WB0 A;  1ZK6 A;  3ARW A;  3WD4 A;  2LPV A;  5B8I C;  2RUQ A;  2PBC A;  2WK2 A;  5HWC A;  4ODK A;  1Q6H A;  4ZPT R;  2B31 A;  3FY1 A;  1L1P A;  3EY6 A;  4NZC A;  2KE0 A;  3H9R B;  4Z2G A;  4NNR A;  4QIB A;  1C9H A;  2PPN A;  4ODL A;  4AY1 A;  2Y78 A;  1HJW A;  5DEZ A;  1ZBC A;  3UQA A;  2KGJ A;  3PRB A;  3KAG A;  1OGB A;  4R5E A;  4MNL A;  1ROT A;  3GTY X;  1Q6I A;  4Z2H A;  2KR7 A;  4LAY A;  1ZBK A;  1QPF A;  1E15 A;  1NWT A;  4P8U A;  4DRP A;  1KT1 A;  3ART A;  4N19 A;  5HKG A;  1FFR A;  2XP4 A;  1JND A;  5DIU A;  2G41 A;  2Q5A A;  3FAP A;  5HTG A;  2KI3 A;  3CHC A;  4ZS6 A;  2O9O A;  3RM8 A;  1JVW A;  4DRO A;  4L3N A;  1H0G A;  2MLY A;  4U85 A;  3KAB A;  4WJX A;  3WL0 A;  2AOS A;  3WIJ A;  1FKI A;  4MNM A;  2FDM A;  1HKK A;  3CHF A;  2KO7 A;  1FFQ A;  4W9P A;  2ZR5 A;  4FN2 A;  4JFL A;  3B8S A; 
#chains in the Genus database with same CATH homology
 2VCD A;  3CHE A;  3G6M A;  1KFW A;  3O5P A;  3UI4 A;  3G6L A;  1ZU8 A;  3WKZ A;  1FAP A;  4DRM A;  2YBT A;  1QZ2 A;  1LL6 A;  4HBO A;  2ITK A;  4TNS A;  1M5Y A;  4IT6 A;  4QZV B;  2F21 A;  3B9E A;  2IUZ A;  3O5O A;  2PI6 A;  3KAF A;  3RME A;  1O6I A;  3QOK A;  1E6Z A;  2DT2 A;  1ZL1 A;  4GIV A;  1ZBW A;  1IX5 A;  4DRH A;  4JFM A;  1LL4 A;  2ZQU A;  4S3K A;  2ZR4 A;  3O5E A;  4GGQ A;  3AS3 A;  1W9V A;  1LJY A;  3ARY A;  5HW8 A;  1YW5 A;  1NMV A;  2D9F A;  4IQC A;  5JH8 A;  2WLY A;  5DO2 A;  2AWG A;  2LKN A;  1OGG A;  3W4R A;  1EYM A;  4G2P A;  4DT4 A;  1WNO A;  5HBF A;  4C02 B;  2PV3 A;  1FJD A;  1P5Q A;  2DSZ A;  5GQB A;  3NRK A;  3KAC A;  3JXV A;  3ARO A;  3UQB A;  2DPE A;  4P8X A;  1D7J A;  4L72 B;  3ARX A;  4KQZ A;  3WL1 A;  1F40 A;  1YAT A;  2RQS A;  2XPA A;  4J4N A;  2ZQT A;  3ODK A;  2WLZ A;  4DWS C;  1ZB5 A;  1FKH A;  4TW8 A;  3O5D A;  2DSU A;  2RUC A;  4ML4 A;  1NMW A;  4PTM A;  4LAX A;  4URI A;  2MPH A;  1JNE A;  2A3E A;  4IT4 A;  4Q7N A;  1JNT A;  3I6C A;  1FKD A;  2JZV A;  2WM0 A;  3ARZ A;  1HKM A;  3ALF A;  3B7X A;  4MPK A;  1BL4 A;  1GUV A;  3WD2 A;  3PA7 A;  2ZQS A;  1N1A A;  1FKT A;  4Q22 A;  3WD3 A;  1GPF A;  1SR0 A;  1HKJ A;  2A3B A;  1Q1C A;  1LQ0 A;  1SYT A;  4W5U A;  1W1T A;  3RM4 A;  3WD1 A;  3AQU A;  4Z2I A;  4J4O A;  3KAD A;  1UR8 A;  3WQV A;  4P8V A;  2DG4 A;  1JNS A;  2ZR6 A;  2LJ4 A;  4W9Q A;  4HBE A;  2XPB A;  1KT0 A;  1H0I A;  4LAW A;  1EIB A;  1B6C A;  1W26 A;  1E6R A;  3VAW A;  2DT1 A;  3PRA A;  1TCO C;  2XP6 A;  4Z2K A;  1TFV A;  1J4H A;  4MGV A;  3WH0 A;  3RFW A;  4ODP A;  4DRK A;  2O92 A;  3KAI A;  3O5L A;  4ODM A;  1J4I A;  3TC5 A;  1BKF A;  3IKG A;  3TDB A;  2L2S A;  1PBK A;  3NTP A;  1FKL A;  2DG3 A;  2F4E A;  2G8Z A;  2ESC A;  3IKD A;  5DIT A;  2MLX A;  4WKH A;  4DRI A;  2MLZ A;  3IHZ A;  2XP9 A;  2IF4 A;  3ARU A;  4ODQ A;  4ODR A;  1D7I A;  1E6N A;  3IK8 A;  1HKI A;  4KR0 B;  1OWQ A;  2DSV A;  2M08 A;  2DT3 A;  4DRN A;  3JYJ A;  3O5K A;  2MNT A;  3ARP A;  2ZQV A;  3KAH A;  1FKK A;  3PR9 A;  5D75 A;  1U79 A;  1RD6 A;  2MF9 A;  2UZ5 A;  1D2K A;  4DRJ A;  3CGM A;  4FAP A;  1E6P A;  4ZPW R;  1K9T A;  2DT0 A;  3UI6 A;  3O5G A;  3KCE A;  1FD9 A;  5HW7 A;  1NWS A;  4WIW A;  4DWS B;  2FAP A;  2OLH A;  2A3A A;  4WKF A;  1FKG A;  2QF8 A;  4W9O A;  5BXJ A;  3O5J A;  3O5F A;  3RM9 A;  1EQ3 A;  3UF8 A;  4TX0 A;  1Q6U A;  1FKJ A;  3ARS A;  5HUA A;  1J4R A;  4IQ2 A;  2PV1 A;  1HJX A;  4MNJ A;  2XP7 A;  1W9P A;  3GPK A;  2FKE A;  2RUD A;  4TYO A;  2M2A A;  1F8A B;  1LG2 A;  4QT2 A;  3FXY A;  1XRV A;  3UI5 A;  2RSE A;  2PPP A;  2DG9 A;  3O5I A;  2XP3 A;  3KZ7 A;  4MSP A;  3UQI A;  3ARQ A;  1W9U A;  1UR9 A;  5DF0 A;  4QT3 A;  5J6E A;  4DRQ A;  1E9L A;  5GPG A;  3TCZ A;  2F2D A;  3B9D A;  4DH0 A;  3CGN A;  1QPL A;  4ITZ A;  1T11 A;  3WQW A;  1W1P A;  1A7X A;  1R9H A;  3RGC A;  3ALG A;  4LAV A;  3AS1 A;  4BF8 A;  4TW6 A;  2LGO A;  1W1V A;  2M1I A;  2VN1 A;  2YBU A;  5DIV A;  3LUO A;  2K8I A;  4IPX A;  4O2T A;  3ARV A;  1NWU A;  5GPR A;  1X6N A;  1ZCN A;  3O5Q A;  4U84 A;  1FKS A;  3MDY B;  4MNK A;  1ITX A;  2KFW A;  4U86 A;  1VF8 A;  4HAR A;  1PIN A;  4S3J A;  4ODO A;  2OFN A;  4MTV A;  4ZPV R;  5HWB A;  1GOI A;  1J6Y A;  4G50 A;  4JYS A;  3JYM A;  3PRD A;  4JFJ A;  1FKB A;  4Z2L A;  3NI6 A;  1HJV A;  5HW6 A;  3O5R A;  1NH6 A;  1D6O A;  4XAK A;  1FKF A;  3CH9 A;  1ZBV A;  3CHD A;  3B9A A;  1LG1 A;  1WAW A;  2RUR A;  1EDQ A;  5I98 A;  3AS0 A;  4JFI A;  4DZ2 A;  3OOB A;  4LGX A;  1NWR A;  1FKR A;  1HXV A;  4TW7 A;  4Z2J A;  2XP8 A;  4DZ3 A;  3AS2 A;  1NSG A;  4MAV A;  2A3C A;  2DSW A;  2N87 A;  2PV2 A;  1ROU A;  4JFK A;  1EHN A;  2XP5 A;  3ARR A;  3O5M A;  1D7H A;  1CTN A;  3BXW A;  4WK9 A;  4DIP A;  5HT1 A;  2PPO A;  1XHG A;  1LL7 A;  1Y0O A;  1X6L A;  4WKA A;  4ODN A;  4P8W A;  1W1Y A;  3WD0 A;  3OA5 A;  4R0X A;  3CZ8 A;  4NSB A;  4DWS D;  4DWS A;  1WB0 A;  1ZK6 A;  3ARW A;  3WD4 A;  2LPV A;  5B8I C;  2RUQ A;  2PBC A;  2WK2 A;  5HWC A;  4ODK A;  1Q6H A;  4ZPT R;  2B31 A;  3FY1 A;  1L1P A;  3EY6 A;  4NZC A;  2KE0 A;  3H9R B;  4Z2G A;  4NNR A;  4QIB A;  1C9H A;  2PPN A;  4ODL A;  4AY1 A;  2Y78 A;  1HJW A;  5DEZ A;  1ZBC A;  3UQA A;  2KGJ A;  3PRB A;  3KAG A;  1OGB A;  4R5E A;  4MNL A;  1ROT A;  1Q6I A;  4Z2H A;  2KR7 A;  4LAY A;  1ZBK A;  1QPF A;  1E15 A;  1NWT A;  4P8U A;  4DRP A;  1KT1 A;  3ART A;  4N19 A;  5HKG A;  1FFR A;  2XP4 A;  1JND A;  5DIU A;  2G41 A;  2Q5A A;  3FAP A;  5HTG A;  2KI3 A;  3CHC A;  4ZS6 A;  2O9O A;  3RM8 A;  1JVW A;  4DRO A;  4L3N A;  1H0G A;  2MLY A;  4U85 A;  3KAB A;  4WJX A;  3WL0 A;  2AOS A;  3WIJ A;  1FKI A;  4MNM A;  2FDM A;  1HKK A;  3CHF A;  2KO7 A;  1FFQ A;  4W9P A;  2ZR5 A;  4FN2 A;  4JFL A;  3B8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...