2N87A

Solution structure of the ppiase domain of tbpar42
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
b'PTERHFYHVLVKHKDVRRPSSLAPRNKGEKITRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Structural Analysis of the 42 kDa Parvulin of Trypanosoma brucei
doi rcsb
source organism Trypanosoma brucei brucei treu927
molecule tags Isomerase
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2n87A00
2LPVA 4W9OA 3O5DA 2F21A 2PPOA 3TC5A 3UQIA 3EY6A 2MNTA 3UI4A 2AWGA 3PA7A 4ODRA 2Q5AA 3O5KA 4JFJA 2FKEA 4W9QA 2ITKA 2F4EA 2M2AA 1J4IA 2VCDA 2D9FA 4JFKA 1Q6IA 1D7IA 4ODKA 4DRKA 3UQBA 1FKSA 4U84A 5HUAA 4TX0A 3PRDA 3UI6A 3IK8A 3H9RB 3TCZA 1R9HA 2MLZA 1FKFA 1QPLA 1U79A 3KAFA 4DIPA 1J6YA 3JYMA 4ODPA 4QT2A 2KE0A 1ZK6A 3MDYB 4GIVA 5HW6A 3OOBA 2MPHA 3PRBA 4IQ2A 2DG3A 4LAWA 1F40A 1T11A 2KR7A 2LJ4A 1FKIA 3IKGA 2KI3A 2XP7A 2Y78A 3KCEA 4JFIA 2K8IA 2ZQSA 5BXJA 1FKTA 2XP3A 1J4RA 3FAPA 1L1PA 2M08A 2PBCA 3KAIA 2UZ5A 1JNSA 2DG4A 2JZVA 3RFWA 4DRQA 1FAPA 1JVWA 1TCOC 3ODKA 1FKKA 1FKGA 1FKLA 4FN2A 4DROA 3KAHA 4JYSA 4IQCA 5DITA 4C02B 1ZCNA 5HKGA 5J6EA 1QZ2A 1Q6UA 1W26A 2M1IA 1Y0OA 4DRNA 2RQSA 2XPBA 1NMWA 3O5JA 1B6CA 4QIBA 1NSGA 3KAGA 4U86A 1FKBA 1C9HA 2XP9A 2VN1A 4MGVA 1YATA 5DIUA 3JXVA 2PPPA 3WH0A 2L2SA 1FD9A 2XPAA 4DH0A 1EYMA 4O2TA 3UQAA 1FKHA 1FKDA 1M5YA 3O5FA 4G2PA 4ODMA 3LUOA 3O5IA 3TDBA 1N1AA 2IF4A 4LAVA 3O5PA 4J4NA 2RUQA 1A7XA 2ZR4A 3O5MA 3UF8A 4N19A 3KACA 2RURA 3O5GA 1D7JA 4DRIA 3NRKA 1FJDA 2ZQTA 3I6CA 5HWCA 1FKJA 1F8AB 2KFWA 5HW8A 1ROTA 2KGJA 5I98A 4DZ3A 2XP5A 3KABA 4TW7A 4IPXA 4DRJA 5GPGA 3VAWA 1QPFA 4W9PA 5D75A 1EQ3A 2PV3A 4LAYA 4TW6A 4G50A 3RGCA 3UI5A 5HW7A 4ITZA 1Q1CA 2LKNA 2PPNA 1Q6HA 4GGQA 4U85A 1BKFA 1PBKA 1JNTA 2LGOA 2ZQUA 2ZR6A 4JFLA 1HXVA 2MLXA 1NMVA 4ODOA 4LAXA 4DT4A 2XP4A 5HWBA 2ZQVA 2PV2A 2FAPA 2OFNA 4DZ2A 2RSEA 2DG9A 2RUDA 3IKDA 4ODLA 4R0XA 3O5EA 4DRMA 1FKRA 1BL4A 3GPKA 3O5OA 5HTGA 3O5QA 4ODNA 3IHZA 4DRHA 4FAPA 1PINA 5DIVA 3KADA 4J4OA 4NNRA 5HT1A 2ZR5A 1P5QA 1YW5A 2MF9A 3CGMA 4BF8A 3JYJA 5B8IC 2PV1A 3O5LA 4TYOA 1D7HA 3KZ7A 2N87A 3O5RA 1J4HA 2RUCA 4TW8A 2XP6A 3NI6A 4ODQA 2MLYA 3CGNA 1KT1A 2XP8A 4JFMA 4TNSA 3B7XA 3NTPA 1ROUA 4MSPA 2F2DA 1D6OA 2KO7A 1KT0A 4DRPA 4QT3A
chains in the Genus database with same CATH superfamily
1EDQA 2F21A 2DT1A 3B9DA 2Q5AA 3O5KA 2FKEA 2F4EA 4JFKA 1D7IA 4ODKA 1D2KA 4U84A 3WL0A 4TX0A 5HUAA 3RM4A 3OA5A 3TCZA 1U79A 1J6YA 3JYMA 1LJYA 3MDYB 3OOBA 2DG3A 1F40A 4DWSC 1LQ0A 1FKIA 1HKKA 2KI3A 2Y78A 3FY1A 3PR9A 4JFIA 1FKTA 1W1YA 3RFWA 4DRQA 1FAPA 1FKKA 1X6LA 1LL4A 3WQWA 5DO2A 1QZ2A 1W26A 4DRNA 1HJVA 1E15A 1ITXA 4NSBA 4U86A 2XP9A 2VN1A 1VF8A 2PPPA 4DH0A 2AOSA 3O5FA 4G2PA 4NZCA 4R5EA 4Z2KA 2RUQA 5JH8A 3KACA 3O5GA 3NRKA 1FKJA 2KFWA 2XP5A 4IPXA 5GPGA 2WK2A 4ZS6A 4TW6A 1E6RA 4ITZA 3WIJA 2A3CA 4WKAA 4GGQA 2O92A 2ZR6A 2P4VA 1NMVA 4DT4A 1TFVA 3CH9A 4DZ2A 2RUDA 4R0XA 3W4RA 3GPKA 4DRHA 4Q7NA 4PTMA 1P5QA 3CGMA 1HKIA 2PV1A 4TYOA 1D7HA 3KZ7A 4L72B 2N87A 2RUCA 4TW8A 2XP6A 3ALFA 3NI6A 2MLYA 1LG2A 2XP8A 4TNSA 3ARRA 1O6IA 3NTPA 4O2TA 1D6OA 4LAXA 1KT0A 4MNJA 1W9VA 5HW7A 2PPOA 2MNTA 4P8VA 3UI4A 4W9QA 3PA7A 4HARA 2ITKA 1J4IA 2VCDA 4ZPTR 3UQBA 1GRJA 1WAWA 2O9OA 3WD2A 2DSWA 4P8WA 3H9RB 1R9HA 2DT3A 1EIBA 2WLZA 3WKZA 2WLYA 1KFWA 4LAWA 3GTYX 2XP7A 5BXJA 3FAPA 2UZ5A 1E6ZA 3ARPA 1ZBVA 1TCOC 4FN2A 4DZ3A 3KAHA 4IQCA 5J6EA 1ZCNA 1XRVA 1Y0OA 2RQSA 4QIBA 1NMWA 1NSGA 4Z2GA 3G6LA 3KAGA 1C9HA 4MGVA 1YATA 3BXWA 5DIUA 2L2SA 2XPAA 4MTVA 4WK9A 1ZU8A 1E6NA 4DWSB 1FKHA 1M5YA 4ODMA 2ESCA 4IT6A 4LAVA 2IF4A 4Z2LA 3O5PA 3ALGA 1A7XA 4IT4A 3UF8A 2RURA 2G41A 1FJDA 5HWCA 5HBFA 5HW8A 4DRJA 1QPFA 5D75A 2PV3A 4G50A 1W9PA 1ZBKA 2OLHA 2LKNA 2PPNA 1Q6HA 4U85A 2LGOA 2ZQUA 5DF0A 2MLXA 4ODOA 4MAVA 5HWBA 3AS0A 2RSEA 3IKDA 4DRMA 1FKRA 1BL4A 3IHZA 4P8UA 2B5UB 4QZVB 2DT2A 1YW5A 1SR0A 3JYJA 5B8IC 3O5LA 5GQBA 1X6NA 3B9EA 3RMEA 3WD0A 4ODQA 3CGNA 4XAKA 2A3BA 4ZPVR 4W9OA 4S3JA 3O5DA 3UQIA 3EY6A 4ODRA 1ZB5A 2D9FA 2WM0A 4P8XA 1FKSA 1EHNA 3ARZA 3WD3A 4S3KA 3UI6A 1ZBWA 3IK8A 3BMBA 3GU0A 1HKJA 1W1VA 1FKFA 1QPLA 4DIPA 4QT2A 2KE0A 4GIVA 2DSVA 4HBEA 4KQZA 5HW6A 2MPHA 4IQ2A 4WJXA 1T11A 1ZBCA 2KR7A 2LJ4A 2FDMA 3KCEA 2ETNA 2K8IA 1OWQA 1LL7A 1JNDA 2PBCA 3G6MA 3AROA 3KAIA 2DG4A 1JVWA 3ODKA 3WL1A 1FKGA 4JYSA 1W1PA 4C02B 4ML4A 1B6CA 4MPKA 1W1TA 1FKBA 1FD9A 1EYMA 1FKDA 1XHGA 4WKFA 1RD6A 3TDBA 1N1AA 3B9AA 1UR8A 2ZR4A 3O5MA 3ARYA 1D7JA 1FFQA 4DRIA 2ZQTA 3I6CA 2A3EA 3ARVA 3ARUA 1F8AB 1E44A 5I98A 1ROTA 2KGJA 4WKHA 1WNOA 2EULA 1EQ3A 1Q1CA 4MNKA 1NWTA 1HXVA 2XP4A 2ZQVA 2FAPA 2OFNA 1HJWA 2DG9A 4ODLA 4Z2IA 1JCHB 3O5EA 1H0GA 3O5OA 3O5QA 4ODNA 1PINA 4AY1A 3KADA 2DPEA 4J4OA 5HT1A 2ZR5A 3ARXA 4URIA 4DWSD 3CHDA 1CTNA 1H0IA 1J4HA 2PN0A 1KT1A 4ZPWR 1HKMA 4MSPA 1ROUA 4DWSA 2DSZA 2KO7A 4KR0B 1NWUA 4QT3A 1NWRA 2LPVA 3TC5A 3RM8A 1W9UA 2AWGA 4JFJA 2M2AA 3CZ8A 1Q6IA 4DRKA 4MNLA 3CHFA 1LL6A 3PRDA 1K9TA 3RM9A 1JNEA 2DT0A 2MLZA 3KAFA 4ODPA 1WB0A 1ZK6A 3ARTA 2F23A 4WIWA 4Z2JA 3PRBA 2YBUA 2IUZA 3IKGA 2ZQSA 4Z2HA 2A3AA 3ARQA 2G8ZA 1J4RA 2XP3A 1L1PA 2M08A 1JNSA 1FFRA 2JZVA 1GPFA 1FKLA 4DROA 5DITA 5HKGA 3CHEA 1HJXA 1GOIA 2M1IA 1Q6UA 1OGGA 2B31A 3WD4A 2XPBA 3O5JA 3WD1A 3AQUA 3AS2A 1E6PA 3EIPA 3PRAA 1LG1A 5DEZA 3JXVA 3WH0A 5GPRA 1OGBA 3UQAA 1SYTA 3LUOA 3O5IA 3AS1A 2PI6A 4J4NA 4N19A 3B8SA 3CHCA 2QF8A 1UR9A 1E9LA 3KABA 4Q22A 4TW7A 4UDMA 3VAWA 1IX5A 4W9PA 4LAYA 3UI5A 3RGCA 1GUVA 2DSUA 4LGXA 3ARSA 3FXYA 4MNMA 1BKFA 1PBKA 1JNTA 4HBOA 4JFLA 2PV2A 1ZL1A 5HTGA 3WQVA 4FAPA 5DIVA 4NNRA 3QOKA 2MF9A 4BF8A 2YBTA 1NWSA 4W5UA 3O5RA 1NH6A 4JFMA 4L3NA 3B7XA 3ARWA 3AS3A 2F2DA 4DRPA
chains in the Genus database with same CATH topology
1EDQA 2F21A 2DT1A 3B9DA 2Q5AA 3O5KA 2FKEA 2F4EA 4JFKA 1D7IA 4ODKA 1D2KA 4U84A 3WL0A 4TX0A 5HUAA 3RM4A 3OA5A 3TCZA 1U79A 1J6YA 3JYMA 1LJYA 3MDYB 3OOBA 2DG3A 1F40A 4DWSC 1LQ0A 1FKIA 1HKKA 2KI3A 2Y78A 3FY1A 3PR9A 4JFIA 1FKTA 1W1YA 3RFWA 4DRQA 1FAPA 1FKKA 1X6LA 1LL4A 3WQWA 5DO2A 1QZ2A 1W26A 4DRNA 1HJVA 1E15A 1ITXA 4NSBA 4U86A 2XP9A 2VN1A 1VF8A 2PPPA 4DH0A 2AOSA 3O5FA 4G2PA 4NZCA 4R5EA 4Z2KA 2RUQA 5JH8A 3KACA 3O5GA 3NRKA 1FKJA 2KFWA 2XP5A 4IPXA 5GPGA 2WK2A 4ZS6A 4TW6A 1E6RA 4ITZA 3WIJA 2A3CA 4WKAA 4GGQA 2O92A 2ZR6A 1NMVA 4DT4A 1TFVA 3CH9A 4DZ2A 2RUDA 4R0XA 3W4RA 3GPKA 4DRHA 4Q7NA 4PTMA 1P5QA 3CGMA 1HKIA 2PV1A 4TYOA 1D7HA 3KZ7A 4L72B 2N87A 2RUCA 4TW8A 2XP6A 3ALFA 3NI6A 2MLYA 1LG2A 2XP8A 4TNSA 3ARRA 1O6IA 3NTPA 4O2TA 1D6OA 4LAXA 1KT0A 4MNJA 1W9VA 5HW7A 2PPOA 2MNTA 4P8VA 3UI4A 4W9QA 3PA7A 4HARA 2ITKA 1J4IA 2VCDA 4ZPTR 3UQBA 1WAWA 2O9OA 3WD2A 2DSWA 4P8WA 3H9RB 1R9HA 2DT3A 1EIBA 2WLZA 3WKZA 2WLYA 1KFWA 4LAWA 2XP7A 5BXJA 3FAPA 2UZ5A 1E6ZA 3ARPA 1ZBVA 1TCOC 4FN2A 4DZ3A 3KAHA 4IQCA 5J6EA 1ZCNA 1XRVA 1Y0OA 2RQSA 4QIBA 1NMWA 1NSGA 4Z2GA 3G6LA 3KAGA 1C9HA 4MGVA 1YATA 3BXWA 5DIUA 2L2SA 2XPAA 4MTVA 4WK9A 1ZU8A 1E6NA 4DWSB 1FKHA 1M5YA 4ODMA 2ESCA 4IT6A 4LAVA 2IF4A 4Z2LA 3O5PA 3ALGA 1A7XA 4IT4A 3UF8A 2RURA 2G41A 1FJDA 5HWCA 5HBFA 5HW8A 4DRJA 1QPFA 5D75A 2PV3A 4G50A 1W9PA 1ZBKA 2OLHA 2LKNA 2PPNA 1Q6HA 4U85A 2LGOA 2ZQUA 5DF0A 2MLXA 4ODOA 4MAVA 5HWBA 3AS0A 2RSEA 3IKDA 4DRMA 1FKRA 1BL4A 3IHZA 4P8UA 4QZVB 2DT2A 1YW5A 1SR0A 3JYJA 5B8IC 3O5LA 5GQBA 1X6NA 3B9EA 3RMEA 3WD0A 4ODQA 3CGNA 4XAKA 2A3BA 4ZPVR 4W9OA 4S3JA 3O5DA 3UQIA 3EY6A 4ODRA 1ZB5A 2D9FA 2WM0A 4P8XA 1FKSA 1EHNA 3ARZA 3WD3A 4S3KA 3UI6A 1ZBWA 3IK8A 1HKJA 1W1VA 1FKFA 1QPLA 4DIPA 4QT2A 2KE0A 4GIVA 2DSVA 4HBEA 4KQZA 5HW6A 2MPHA 4IQ2A 4WJXA 1T11A 1ZBCA 2KR7A 2LJ4A 2FDMA 3KCEA 2K8IA 1OWQA 1LL7A 1JNDA 2PBCA 3G6MA 3AROA 3KAIA 2DG4A 1JVWA 3ODKA 3WL1A 1FKGA 4JYSA 1W1PA 4C02B 4ML4A 1B6CA 4MPKA 1W1TA 1FKBA 1FD9A 1EYMA 1FKDA 1XHGA 4WKFA 1RD6A 3TDBA 1N1AA 3B9AA 1UR8A 2ZR4A 3O5MA 3ARYA 1D7JA 1FFQA 4DRIA 2ZQTA 3I6CA 2A3EA 3ARVA 3ARUA 1F8AB 5I98A 1ROTA 2KGJA 4WKHA 1WNOA 1EQ3A 1Q1CA 4MNKA 1NWTA 1HXVA 2XP4A 2ZQVA 2FAPA 2OFNA 1HJWA 2DG9A 4ODLA 4Z2IA 3O5EA 1H0GA 3O5OA 3O5QA 4ODNA 1PINA 4AY1A 3KADA 2DPEA 4J4OA 5HT1A 2ZR5A 3ARXA 4URIA 4DWSD 3CHDA 1CTNA 1H0IA 1J4HA 1KT1A 4ZPWR 1HKMA 4MSPA 1ROUA 4DWSA 2DSZA 2KO7A 4KR0B 1NWUA 4QT3A 1NWRA 2LPVA 3TC5A 3RM8A 1W9UA 2AWGA 4JFJA 2M2AA 3CZ8A 1Q6IA 4DRKA 4MNLA 3CHFA 1LL6A 3PRDA 1K9TA 3RM9A 1JNEA 2DT0A 2MLZA 3KAFA 4ODPA 1WB0A 1ZK6A 3ARTA 4WIWA 4Z2JA 3PRBA 2YBUA 2IUZA 3IKGA 2ZQSA 4Z2HA 2A3AA 3ARQA 2G8ZA 1J4RA 2XP3A 1L1PA 2M08A 1JNSA 1FFRA 2JZVA 1GPFA 1FKLA 4DROA 5DITA 5HKGA 3CHEA 1HJXA 1GOIA 2M1IA 1Q6UA 1OGGA 2B31A 3WD4A 2XPBA 3O5JA 3WD1A 3AQUA 3AS2A 1E6PA 3PRAA 1LG1A 5DEZA 3JXVA 3WH0A 5GPRA 1OGBA 3UQAA 1SYTA 3LUOA 3O5IA 3AS1A 2PI6A 4J4NA 4N19A 3B8SA 3CHCA 2QF8A 1UR9A 1E9LA 3KABA 4Q22A 4TW7A 3VAWA 1IX5A 4W9PA 4LAYA 3UI5A 3RGCA 1GUVA 2DSUA 4LGXA 3ARSA 3FXYA 4MNMA 1BKFA 1PBKA 1JNTA 4HBOA 4JFLA 2PV2A 1ZL1A 5HTGA 3WQVA 4FAPA 5DIVA 4NNRA 3QOKA 2MF9A 4BF8A 2YBTA 1NWSA 4W5UA 3O5RA 1NH6A 4JFMA 4L3NA 3B7XA 3ARWA 3AS3A 2F2DA 4DRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPV A;  4W9O A;  3O5D A;  2F21 A;  2PPO A;  3TC5 A;  3UQI A;  3EY6 A;  2MNT A;  3UI4 A;  2AWG A;  3PA7 A;  4ODR A;  2Q5A A;  3O5K A;  4JFJ A;  2FKE A;  4W9Q A;  2ITK A;  2F4E A;  2M2A A;  1J4I A;  2VCD A;  2D9F A;  4JFK A;  1Q6I A;  1D7I A;  4ODK A;  4DRK A;  3UQB A;  1FKS A;  4U84 A;  5HUA A;  4TX0 A;  3PRD A;  3UI6 A;  3IK8 A;  3H9R B;  3TCZ A;  1R9H A;  2MLZ A;  1FKF A;  1QPL A;  1U79 A;  3KAF A;  4DIP A;  1J6Y A;  3JYM A;  4ODP A;  4QT2 A;  2KE0 A;  1ZK6 A;  3MDY B;  4GIV A;  5HW6 A;  3OOB A;  2MPH A;  3PRB A;  4IQ2 A;  2DG3 A;  4LAW A;  1F40 A;  1T11 A;  2KR7 A;  2LJ4 A;  1FKI A;  3IKG A;  2KI3 A;  2XP7 A;  2Y78 A;  3KCE A;  4JFI A;  2K8I A;  2ZQS A;  5BXJ A;  1FKT A;  2XP3 A;  1J4R A;  3FAP A;  1L1P A;  2M08 A;  2PBC A;  3KAI A;  2UZ5 A;  1JNS A;  2DG4 A;  2JZV A;  3RFW A;  4DRQ A;  1FAP A;  1JVW A;  1TCO C;  3ODK A;  1FKK A;  1FKG A;  1FKL A;  4FN2 A;  4DRO A;  3KAH A;  4JYS A;  4IQC A;  5DIT A;  4C02 B;  1ZCN A;  5HKG A;  5J6E A;  1QZ2 A;  1Q6U A;  1W26 A;  2M1I A;  1Y0O A;  4DRN A;  2RQS A;  2XPB A;  1NMW A;  3O5J A;  1B6C A;  4QIB A;  1NSG A;  3KAG A;  4U86 A;  1FKB A;  1C9H A;  2XP9 A;  2VN1 A;  4MGV A;  1YAT A;  5DIU A;  3JXV A;  2PPP A;  3WH0 A;  2L2S A;  1FD9 A;  2XPA A;  4DH0 A;  1EYM A;  4O2T A;  3UQA A;  1FKH A;  1FKD A;  1M5Y A;  3O5F A;  4G2P A;  4ODM A;  3LUO A;  3O5I A;  3TDB A;  1N1A A;  2IF4 A;  4LAV A;  3O5P A;  4J4N A;  2RUQ A;  1A7X A;  2ZR4 A;  3O5M A;  3UF8 A;  4N19 A;  3KAC A;  2RUR A;  3O5G A;  1D7J A;  4DRI A;  3NRK A;  1FJD A;  2ZQT A;  3I6C A;  5HWC A;  1FKJ A;  1F8A B;  2KFW A;  5HW8 A;  1ROT A;  2KGJ A;  5I98 A;  4DZ3 A;  2XP5 A;  3KAB A;  4TW7 A;  4IPX A;  4DRJ A;  5GPG A;  3VAW A;  1QPF A;  4W9P A;  5D75 A;  1EQ3 A;  2PV3 A;  4LAY A;  4TW6 A;  4G50 A;  3RGC A;  3UI5 A;  5HW7 A;  4ITZ A;  1Q1C A;  2LKN A;  2PPN A;  1Q6H A;  4GGQ A;  4U85 A;  1BKF A;  1PBK A;  1JNT A;  2LGO A;  2ZQU A;  2ZR6 A;  4JFL A;  1HXV A;  2MLX A;  1NMV A;  4ODO A;  4LAX A;  4DT4 A;  2XP4 A;  5HWB A;  2ZQV A;  2PV2 A;  2FAP A;  2OFN A;  4DZ2 A;  2RSE A;  2DG9 A;  2RUD A;  3IKD A;  4ODL A;  4R0X A;  3O5E A;  4DRM A;  1FKR A;  1BL4 A;  3GPK A;  3O5O A;  5HTG A;  3O5Q A;  4ODN A;  3IHZ A;  4DRH A;  4FAP A;  1PIN A;  5DIV A;  3KAD A;  4J4O A;  4NNR A;  5HT1 A;  2ZR5 A;  1P5Q A;  1YW5 A;  2MF9 A;  3CGM A;  4BF8 A;  3JYJ A;  5B8I C;  2PV1 A;  3O5L A;  4TYO A;  1D7H A;  3KZ7 A;  2N87 A;  3O5R A;  1J4H A;  2RUC A;  4TW8 A;  2XP6 A;  3NI6 A;  4ODQ A;  2MLY A;  3CGN A;  1KT1 A;  2XP8 A;  4JFM A;  4TNS A;  3B7X A;  3NTP A;  1ROU A;  4MSP A;  2F2D A;  1D6O A;  2KO7 A;  1KT0 A;  4DRP A;  4QT3 A; 
#chains in the Genus database with same CATH topology
 1EDQ A;  2F21 A;  2DT1 A;  3B9D A;  2Q5A A;  3O5K A;  2FKE A;  2F4E A;  4JFK A;  1D7I A;  4ODK A;  1D2K A;  4U84 A;  3WL0 A;  4TX0 A;  5HUA A;  3RM4 A;  3OA5 A;  3TCZ A;  1U79 A;  1J6Y A;  3JYM A;  1LJY A;  3MDY B;  3OOB A;  2DG3 A;  1F40 A;  4DWS C;  1LQ0 A;  1FKI A;  1HKK A;  2KI3 A;  2Y78 A;  3FY1 A;  3PR9 A;  4JFI A;  1FKT A;  1W1Y A;  3RFW A;  4DRQ A;  1FAP A;  1FKK A;  1X6L A;  1LL4 A;  3WQW A;  5DO2 A;  1QZ2 A;  1W26 A;  4DRN A;  1HJV A;  1E15 A;  1ITX A;  4NSB A;  4U86 A;  2XP9 A;  2VN1 A;  1VF8 A;  2PPP A;  4DH0 A;  2AOS A;  3O5F A;  4G2P A;  4NZC A;  4R5E A;  4Z2K A;  2RUQ A;  5JH8 A;  3KAC A;  3O5G A;  3NRK A;  1FKJ A;  2KFW A;  2XP5 A;  4IPX A;  5GPG A;  2WK2 A;  4ZS6 A;  4TW6 A;  1E6R A;  4ITZ A;  3WIJ A;  2A3C A;  4WKA A;  4GGQ A;  2O92 A;  2ZR6 A;  2P4V A;  1NMV A;  4DT4 A;  1TFV A;  3CH9 A;  4DZ2 A;  2RUD A;  4R0X A;  3W4R A;  3GPK A;  4DRH A;  4Q7N A;  4PTM A;  1P5Q A;  3CGM A;  1HKI A;  2PV1 A;  4TYO A;  1D7H A;  3KZ7 A;  4L72 B;  2N87 A;  2RUC A;  4TW8 A;  2XP6 A;  3ALF A;  3NI6 A;  2MLY A;  1LG2 A;  2XP8 A;  4TNS A;  3ARR A;  1O6I A;  3NTP A;  4O2T A;  1D6O A;  4LAX A;  1KT0 A;  4MNJ A;  1W9V A;  5HW7 A;  2PPO A;  2MNT A;  4P8V A;  3UI4 A;  4W9Q A;  3PA7 A;  4HAR A;  2ITK A;  1J4I A;  2VCD A;  4ZPT R;  3UQB A;  1GRJ A;  1WAW A;  2O9O A;  3WD2 A;  2DSW A;  4P8W A;  3H9R B;  1R9H A;  2DT3 A;  1EIB A;  2WLZ A;  3WKZ A;  2WLY A;  1KFW A;  4LAW A;  3GTY X;  2XP7 A;  5BXJ A;  3FAP A;  2UZ5 A;  1E6Z A;  3ARP A;  1ZBV A;  1TCO C;  4FN2 A;  4DZ3 A;  3KAH A;  4IQC A;  5J6E A;  1ZCN A;  1XRV A;  1Y0O A;  2RQS A;  4QIB A;  1NMW A;  1NSG A;  4Z2G A;  3G6L A;  3KAG A;  1C9H A;  4MGV A;  1YAT A;  3BXW A;  5DIU A;  2L2S A;  2XPA A;  4MTV A;  4WK9 A;  1ZU8 A;  1E6N A;  4DWS B;  1FKH A;  1M5Y A;  4ODM A;  2ESC A;  4IT6 A;  4LAV A;  2IF4 A;  4Z2L A;  3O5P A;  3ALG A;  1A7X A;  4IT4 A;  3UF8 A;  2RUR A;  2G41 A;  1FJD A;  5HWC A;  5HBF A;  5HW8 A;  4DRJ A;  1QPF A;  5D75 A;  2PV3 A;  4G50 A;  1W9P A;  1ZBK A;  2OLH A;  2LKN A;  2PPN A;  1Q6H A;  4U85 A;  2LGO A;  2ZQU A;  5DF0 A;  2MLX A;  4ODO A;  4MAV A;  5HWB A;  3AS0 A;  2RSE A;  3IKD A;  4DRM A;  1FKR A;  1BL4 A;  3IHZ A;  4P8U A;  2B5U B;  4QZV B;  2DT2 A;  1YW5 A;  1SR0 A;  3JYJ A;  5B8I C;  3O5L A;  5GQB A;  1X6N A;  3B9E A;  3RME A;  3WD0 A;  4ODQ A;  3CGN A;  4XAK A;  2A3B A;  4ZPV R;  4W9O A;  4S3J A;  3O5D A;  3UQI A;  3EY6 A;  4ODR A;  1ZB5 A;  2D9F A;  2WM0 A;  4P8X A;  1FKS A;  1EHN A;  3ARZ A;  3WD3 A;  4S3K A;  3UI6 A;  1ZBW A;  3IK8 A;  3BMB A;  3GU0 A;  1HKJ A;  1W1V A;  1FKF A;  1QPL A;  4DIP A;  4QT2 A;  2KE0 A;  4GIV A;  2DSV A;  4HBE A;  4KQZ A;  5HW6 A;  2MPH A;  4IQ2 A;  4WJX A;  1T11 A;  1ZBC A;  2KR7 A;  2LJ4 A;  2FDM A;  3KCE A;  2ETN A;  2K8I A;  1OWQ A;  1LL7 A;  1JND A;  2PBC A;  3G6M A;  3ARO A;  3KAI A;  2DG4 A;  1JVW A;  3ODK A;  3WL1 A;  1FKG A;  4JYS A;  1W1P A;  4C02 B;  4ML4 A;  1B6C A;  4MPK A;  1W1T A;  1FKB A;  1FD9 A;  1EYM A;  1FKD A;  1XHG A;  4WKF A;  1RD6 A;  3TDB A;  1N1A A;  3B9A A;  1UR8 A;  2ZR4 A;  3O5M A;  3ARY A;  1D7J A;  1FFQ A;  4DRI A;  2ZQT A;  3I6C A;  2A3E A;  3ARV A;  3ARU A;  1F8A B;  1E44 A;  5I98 A;  1ROT A;  2KGJ A;  4WKH A;  1WNO A;  2EUL A;  1EQ3 A;  1Q1C A;  4MNK A;  1NWT A;  1HXV A;  2XP4 A;  2ZQV A;  2FAP A;  2OFN A;  1HJW A;  2DG9 A;  4ODL A;  4Z2I A;  1JCH B;  3O5E A;  1H0G A;  3O5O A;  3O5Q A;  4ODN A;  1PIN A;  4AY1 A;  3KAD A;  2DPE A;  4J4O A;  5HT1 A;  2ZR5 A;  3ARX A;  4URI A;  4DWS D;  3CHD A;  1CTN A;  1H0I A;  1J4H A;  2PN0 A;  1KT1 A;  4ZPW R;  1HKM A;  4MSP A;  1ROU A;  4DWS A;  2DSZ A;  2KO7 A;  4KR0 B;  1NWU A;  4QT3 A;  1NWR A;  2LPV A;  3TC5 A;  3RM8 A;  1W9U A;  2AWG A;  4JFJ A;  2M2A A;  3CZ8 A;  1Q6I A;  4DRK A;  4MNL A;  3CHF A;  1LL6 A;  3PRD A;  1K9T A;  3RM9 A;  1JNE A;  2DT0 A;  2MLZ A;  3KAF A;  4ODP A;  1WB0 A;  1ZK6 A;  3ART A;  2F23 A;  4WIW A;  4Z2J A;  3PRB A;  2YBU A;  2IUZ A;  3IKG A;  2ZQS A;  4Z2H A;  2A3A A;  3ARQ A;  2G8Z A;  1J4R A;  2XP3 A;  1L1P A;  2M08 A;  1JNS A;  1FFR A;  2JZV A;  1GPF A;  1FKL A;  4DRO A;  5DIT A;  5HKG A;  3CHE A;  1HJX A;  1GOI A;  2M1I A;  1Q6U A;  1OGG A;  2B31 A;  3WD4 A;  2XPB A;  3O5J A;  3WD1 A;  3AQU A;  3AS2 A;  1E6P A;  3EIP A;  3PRA A;  1LG1 A;  5DEZ A;  3JXV A;  3WH0 A;  5GPR A;  1OGB A;  3UQA A;  1SYT A;  3LUO A;  3O5I A;  3AS1 A;  2PI6 A;  4J4N A;  4N19 A;  3B8S A;  3CHC A;  2QF8 A;  1UR9 A;  1E9L A;  3KAB A;  4Q22 A;  4TW7 A;  4UDM A;  3VAW A;  1IX5 A;  4W9P A;  4LAY A;  3UI5 A;  3RGC A;  1GUV A;  2DSU A;  4LGX A;  3ARS A;  3FXY A;  4MNM A;  1BKF A;  1PBK A;  1JNT A;  4HBO A;  4JFL A;  2PV2 A;  1ZL1 A;  5HTG A;  3WQV A;  4FAP A;  5DIV A;  4NNR A;  3QOK A;  2MF9 A;  4BF8 A;  2YBT A;  1NWS A;  4W5U A;  3O5R A;  1NH6 A;  4JFM A;  4L3N A;  3B7X A;  3ARW A;  3AS3 A;  2F2D A;  4DRP A; 
#chains in the Genus database with same CATH homology
 1EDQ A;  2F21 A;  2DT1 A;  3B9D A;  2Q5A A;  3O5K A;  2FKE A;  2F4E A;  4JFK A;  1D7I A;  4ODK A;  1D2K A;  4U84 A;  3WL0 A;  4TX0 A;  5HUA A;  3RM4 A;  3OA5 A;  3TCZ A;  1U79 A;  1J6Y A;  3JYM A;  1LJY A;  3MDY B;  3OOB A;  2DG3 A;  1F40 A;  4DWS C;  1LQ0 A;  1FKI A;  1HKK A;  2KI3 A;  2Y78 A;  3FY1 A;  3PR9 A;  4JFI A;  1FKT A;  1W1Y A;  3RFW A;  4DRQ A;  1FAP A;  1FKK A;  1X6L A;  1LL4 A;  3WQW A;  5DO2 A;  1QZ2 A;  1W26 A;  4DRN A;  1HJV A;  1E15 A;  1ITX A;  4NSB A;  4U86 A;  2XP9 A;  2VN1 A;  1VF8 A;  2PPP A;  4DH0 A;  2AOS A;  3O5F A;  4G2P A;  4NZC A;  4R5E A;  4Z2K A;  2RUQ A;  5JH8 A;  3KAC A;  3O5G A;  3NRK A;  1FKJ A;  2KFW A;  2XP5 A;  4IPX A;  5GPG A;  2WK2 A;  4ZS6 A;  4TW6 A;  1E6R A;  4ITZ A;  3WIJ A;  2A3C A;  4WKA A;  4GGQ A;  2O92 A;  2ZR6 A;  1NMV A;  4DT4 A;  1TFV A;  3CH9 A;  4DZ2 A;  2RUD A;  4R0X A;  3W4R A;  3GPK A;  4DRH A;  4Q7N A;  4PTM A;  1P5Q A;  3CGM A;  1HKI A;  2PV1 A;  4TYO A;  1D7H A;  3KZ7 A;  4L72 B;  2N87 A;  2RUC A;  4TW8 A;  2XP6 A;  3ALF A;  3NI6 A;  2MLY A;  1LG2 A;  2XP8 A;  4TNS A;  3ARR A;  1O6I A;  3NTP A;  4O2T A;  1D6O A;  4LAX A;  1KT0 A;  4MNJ A;  1W9V A;  5HW7 A;  2PPO A;  2MNT A;  4P8V A;  3UI4 A;  4W9Q A;  3PA7 A;  4HAR A;  2ITK A;  1J4I A;  2VCD A;  4ZPT R;  3UQB A;  1WAW A;  2O9O A;  3WD2 A;  2DSW A;  4P8W A;  3H9R B;  1R9H A;  2DT3 A;  1EIB A;  2WLZ A;  3WKZ A;  2WLY A;  1KFW A;  4LAW A;  2XP7 A;  5BXJ A;  3FAP A;  2UZ5 A;  1E6Z A;  3ARP A;  1ZBV A;  1TCO C;  4FN2 A;  4DZ3 A;  3KAH A;  4IQC A;  5J6E A;  1ZCN A;  1XRV A;  1Y0O A;  2RQS A;  4QIB A;  1NMW A;  1NSG A;  4Z2G A;  3G6L A;  3KAG A;  1C9H A;  4MGV A;  1YAT A;  3BXW A;  5DIU A;  2L2S A;  2XPA A;  4MTV A;  4WK9 A;  1ZU8 A;  1E6N A;  4DWS B;  1FKH A;  1M5Y A;  4ODM A;  2ESC A;  4IT6 A;  4LAV A;  2IF4 A;  4Z2L A;  3O5P A;  3ALG A;  1A7X A;  4IT4 A;  3UF8 A;  2RUR A;  2G41 A;  1FJD A;  5HWC A;  5HBF A;  5HW8 A;  4DRJ A;  1QPF A;  5D75 A;  2PV3 A;  4G50 A;  1W9P A;  1ZBK A;  2OLH A;  2LKN A;  2PPN A;  1Q6H A;  4U85 A;  2LGO A;  2ZQU A;  5DF0 A;  2MLX A;  4ODO A;  4MAV A;  5HWB A;  3AS0 A;  2RSE A;  3IKD A;  4DRM A;  1FKR A;  1BL4 A;  3IHZ A;  4P8U A;  4QZV B;  2DT2 A;  1YW5 A;  1SR0 A;  3JYJ A;  5B8I C;  3O5L A;  5GQB A;  1X6N A;  3B9E A;  3RME A;  3WD0 A;  4ODQ A;  3CGN A;  4XAK A;  2A3B A;  4ZPV R;  4W9O A;  4S3J A;  3O5D A;  3UQI A;  3EY6 A;  4ODR A;  1ZB5 A;  2D9F A;  2WM0 A;  4P8X A;  1FKS A;  1EHN A;  3ARZ A;  3WD3 A;  4S3K A;  3UI6 A;  1ZBW A;  3IK8 A;  1HKJ A;  1W1V A;  1FKF A;  1QPL A;  4DIP A;  4QT2 A;  2KE0 A;  4GIV A;  2DSV A;  4HBE A;  4KQZ A;  5HW6 A;  2MPH A;  4IQ2 A;  4WJX A;  1T11 A;  1ZBC A;  2KR7 A;  2LJ4 A;  2FDM A;  3KCE A;  2K8I A;  1OWQ A;  1LL7 A;  1JND A;  2PBC A;  3G6M A;  3ARO A;  3KAI A;  2DG4 A;  1JVW A;  3ODK A;  3WL1 A;  1FKG A;  4JYS A;  1W1P A;  4C02 B;  4ML4 A;  1B6C A;  4MPK A;  1W1T A;  1FKB A;  1FD9 A;  1EYM A;  1FKD A;  1XHG A;  4WKF A;  1RD6 A;  3TDB A;  1N1A A;  3B9A A;  1UR8 A;  2ZR4 A;  3O5M A;  3ARY A;  1D7J A;  1FFQ A;  4DRI A;  2ZQT A;  3I6C A;  2A3E A;  3ARV A;  3ARU A;  1F8A B;  5I98 A;  1ROT A;  2KGJ A;  4WKH A;  1WNO A;  1EQ3 A;  1Q1C A;  4MNK A;  1NWT A;  1HXV A;  2XP4 A;  2ZQV A;  2FAP A;  2OFN A;  1HJW A;  2DG9 A;  4ODL A;  4Z2I A;  3O5E A;  1H0G A;  3O5O A;  3O5Q A;  4ODN A;  1PIN A;  4AY1 A;  3KAD A;  2DPE A;  4J4O A;  5HT1 A;  2ZR5 A;  3ARX A;  4URI A;  4DWS D;  3CHD A;  1CTN A;  1H0I A;  1J4H A;  1KT1 A;  4ZPW R;  1HKM A;  4MSP A;  1ROU A;  4DWS A;  2DSZ A;  2KO7 A;  4KR0 B;  1NWU A;  4QT3 A;  1NWR A;  2LPV A;  3TC5 A;  3RM8 A;  1W9U A;  2AWG A;  4JFJ A;  2M2A A;  3CZ8 A;  1Q6I A;  4DRK A;  4MNL A;  3CHF A;  1LL6 A;  3PRD A;  1K9T A;  3RM9 A;  1JNE A;  2DT0 A;  2MLZ A;  3KAF A;  4ODP A;  1WB0 A;  1ZK6 A;  3ART A;  4WIW A;  4Z2J A;  3PRB A;  2YBU A;  2IUZ A;  3IKG A;  2ZQS A;  4Z2H A;  2A3A A;  3ARQ A;  2G8Z A;  1J4R A;  2XP3 A;  1L1P A;  2M08 A;  1JNS A;  1FFR A;  2JZV A;  1GPF A;  1FKL A;  4DRO A;  5DIT A;  5HKG A;  3CHE A;  1HJX A;  1GOI A;  2M1I A;  1Q6U A;  1OGG A;  2B31 A;  3WD4 A;  2XPB A;  3O5J A;  3WD1 A;  3AQU A;  3AS2 A;  1E6P A;  3PRA A;  1LG1 A;  5DEZ A;  3JXV A;  3WH0 A;  5GPR A;  1OGB A;  3UQA A;  1SYT A;  3LUO A;  3O5I A;  3AS1 A;  2PI6 A;  4J4N A;  4N19 A;  3B8S A;  3CHC A;  2QF8 A;  1UR9 A;  1E9L A;  3KAB A;  4Q22 A;  4TW7 A;  3VAW A;  1IX5 A;  4W9P A;  4LAY A;  3UI5 A;  3RGC A;  1GUV A;  2DSU A;  4LGX A;  3ARS A;  3FXY A;  4MNM A;  1BKF A;  1PBK A;  1JNT A;  4HBO A;  4JFL A;  2PV2 A;  1ZL1 A;  5HTG A;  3WQV A;  4FAP A;  5DIV A;  4NNR A;  3QOK A;  2MF9 A;  4BF8 A;  2YBT A;  1NWS A;  4W5U A;  3O5R A;  1NH6 A;  4JFM A;  4L3N A;  3B7X A;  3ARW A;  3AS3 A;  2F2D A;  4DRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...