2N87A

Solution structure of the ppiase domain of tbpar42
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
PTERHFYHVLVKHKDVRRPSSLAPRNKGEKITRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of the 42 kDa Parvulin of Trypanosoma brucei
doi rcsb
source organism Trypanosoma brucei brucei treu927
molecule tags Isomerase
molecule keywords Uncharacterized protein
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2n87A00
2Q5AA 3MDYB 3UQIA 3KAIA 1T11A 4J4NA 4U85A 4R0XA 4DRQA 2XP5A 2XP9A 1ZCNA 2XP4A 1ROUA 3PA7A 4TW8A 5HWCA 3H9RB 4ODNA 1FKIA 5HWBA 4C02B 2RSEA 2MLYA 3I6CA 4TW6A 1R9HA 1QZ2A 2OFNA 3WH0A 3ODKA 4LAWA 2XPAA 4NNRA 4DH0A 3FAPA 3TCZA 1N1AA 1NMVA 1HXVA 2RUDA 2ZR6A 2ZQVA 2XP7A 2MPHA 5B8IC 4QT3A 1FD9A 4IQCA 3JYJA 3KABA 3O5EA 4TW7A 2RUCA 2LGOA 1J4IA 2JZVA 2M2AA 1JNSA 2PPPA 1YW5A 5HUAA 1P5QA 3KCEA 2M1IA 2KFWA 2XP8A 1KT1A 2XP6A 3O5OA 3RFWA 4DZ2A 4N19A 4ODPA 2F21A 1FKBA 4TYOA 1Q1CA 5I98A 4LAVA 2F2DA 1KT0A 4G2PA 2DG9A 4DROA 5HW8A 3KAFA 4ITZA 2KI3A 4JFIA 4DRMA 5HTGA 1F8AB 4ODQA 2PV1A 2XP3A 3LUOA 2MLZA 2DG4A 4U86A 4W9PA 1Q6HA 5HKGA 2L2SA 3KZ7A 2MNTA 3O5QA 3PRDA 1TCOC 4MSPA 2D9FA 1Y0OA 1W26A 4W9QA 3O5RA 1FKTA 3KAHA 4U84A 2MLXA 2F4EA 3B7XA 1B6CA 4DT4A 1M5YA 4JFKA 1Q6IA 2KGJA 4TX0A 4BF8A 3RGCA 2ZR4A 4GGQA 3IKDA 4LAXA 1FKLA 2FKEA 1EQ3A 1QPLA 1J4HA 5HT1A 4ODLA 2DG3A 3O5GA 4TNSA 5J6EA 2Y78A 1D7HA 3O5DA 3IHZA 1D7JA 4ODRA 3O5LA 3O5MA 1FJDA 2N87A 1D6OA 1FKJA 3JYMA 2RQSA 1FKGA 2VN1A 2PBCA 3NTPA 4ODMA 5HW7A 2VCDA 2PV3A 3O5PA 2LPVA 3VAWA 4DRIA 3IK8A 4DRKA 4DRPA 5HW6A 3GPKA 3PRBA 1FKSA 1YATA 3UQBA 3KADA 3EY6A 1FKKA 1QPFA 4JYSA 4DRHA 4JFJA 1FAPA 1BKFA 1NMWA 1FKDA 1NSGA 5D75A 2ITKA 4GIVA 2ZQSA 3TC5A 3O5FA 5DIVA 3UI5A 2LJ4A 2KO7A 1EYMA 4QT2A 4DIPA 2KR7A 2FAPA 2XPBA 4MGVA 4ODOA 2ZR5A 4G50A 5DIUA 1Q6UA 3IKGA 1ZK6A 3OOBA 2PPNA 3UF8A 1FKRA 2AWGA 1PINA 1J6YA 1F40A 1BL4A 2RUQA 2PV2A 3O5KA 1L1PA 1A7XA 4IPXA 2UZ5A 2ZQUA 2K8IA 2RURA 4FN2A 3NRKA 5GPGA 5BXJA 3JXVA 3CGMA 4DRNA 1J4RA 5DITA 4ODKA 4DRJA 1JNTA 3UI4A 4O2TA 3UQAA 4J4OA 2ZQTA 4QIBA 1C9HA 1D7IA 4LAYA 4JFLA 3CGNA 4JFMA 2KE0A 1PBKA 3KAGA 1U79A 3O5IA 2MF9A 2M08A 4FAPA 4IQ2A 4W9OA 4DZ3A 1FKHA 1JVWA 1ROTA 3O5JA 3TDBA 2IF4A 3KACA 3UI6A 2LKNA 1FKFA 3NI6A 2PPOA
chains in the Genus database with same CATH superfamily
3KAIA 4J4NA 4R5EA 4U85A 1ZBWA 3PR9A 4TW8A 5HWCA 1ITXA 4ODNA 5HWBA 4C02B 1E44A 2OFNA 3WH0A 2DPEA 3ARPA 3FAPA 2RUDA 2ZR6A 1E6RA 4DWSB 4Z2IA 2PPPA 3PRAA 2XP8A 4N19A 1WB0A 3ARVA 5HTGA 2XP3A 3ARRA 1CTNA 3KZ7A 4MSPA 1Y0OA 2A3EA 3CH9A 2F4EA 1Q6IA 2KGJA 4BF8A 3RGCA 3RM8A 4URIA 4ODLA 2DG3A 3AS3A 3O5GA 3O5DA 2ETNA 3O5LA 4ODRA 2DT1A 1FJDA 3FY1A 3JYMA 3B8SA 4ODMA 2VCDA 1HJVA 2PV3A 1K9TA 2WK2A 4ZPTR 3BXWA 4P8UA 4DRIA 4DRPA 1FKSA 1FKKA 2AOSA 1FAPA 1BKFA 1NSGA 1LG2A 4GIVA 1EHNA 4DIPA 5DIVA 3UI5A 2KO7A 2LJ4A 4QT2A 3OOBA 1FKRA 1PINA 1F40A 1JCHB 2PV2A 3O5KA 4HARA 2A3AA 4IPXA 2RURA 3NRKA 1HJXA 2DSWA 3ARQA 4DRNA 4ODKA 3WKZA 1JNTA 2OLHA 1EDQA 3UQAA 1C9HA 4LAYA 3WL1A 1X6LA 2QF8A 1SR0A 2M08A 4W9OA 1KFWA 2PPOA 3UQIA 1T11A 1H0GA 2FDMA 2XP5A 3OA5A 3PA7A 1FKIA 1E15A 2RSEA 2MLYA 2WLZA 5HBFA 3AS0A 4NNRA 1ZBVA 1N1AA 3W4RA 2MPHA 4QZVB 1XHGA 3JYJA 3KABA 4TW7A 4ML4A 1J4IA 2LGOA 3WD4A 3ARYA 5HUAA 1P5QA 3WD1A 2M1IA 4LGXA 3G6MA 2XP6A 4ODPA 1FKBA 1H0IA 2F21A 1Q1CA 2F2DA 3RM4A 3B9EA 4MNKA 5HW8A 1W9PA 4MNMA 3CHEA 4HBEA 4DRMA 1F8AB 4ODQA 2PV1A 1E6ZA 4MNLA 1OGBA 1NWRA 2L2SA 2MNTA 3O5QA 1LL6A 1TCOC 3PRDA 4WIWA 4MPKA 3KAHA 1W1VA 1B6CA 4DT4A 1IX5A 1O6IA 3IKDA 2FKEA 4DWSA 4TNSA 2Y78A 1OGGA 1D7JA 1ZBKA 1D6OA 4Z2GA 3AS1A 1NWSA 1WAWA 2RQSA 2VN1A 2PBCA 2G41A 3O5PA 1GOIA 2LPVA 5HW6A 3IK8A 3GPKA 1YATA 1UR9A 4JFJA 3RM9A 5D75A 2B31A 2ITKA 4P8XA 1LJYA 3WD2A 4ODOA 4G50A 3UF8A 5DEZA 5GQBA 3WD0A 1NH6A 1A7XA 5GPGA 2YBTA 3JXVA 4WKFA 3AQUA 3WL0A 1HJWA 3ARWA 4QIBA 1LL7A 1E6PA 4JFLA 3WQVA 2KE0A 3ARUA 4NZCA 3GU0A 3O5IA 4FAPA 2MF9A 1LG1A 3O5JA 1ROTA 2O9OA 3KACA 1LL4A 2Q5AA 4Q7NA 3BMBA 2XP9A 1ZCNA 2XP4A 1NWUA 2DT0A 2WM0A 3H9RB 1FFQA 3I6CA 1QZ2A 4LAWA 2XPAA 3TCZA 4DWSC 1HKKA 1HXVA 1D2KA 2ZQVA 1FD9A 1W1PA 1UR8A 2RUCA 1VF8A 3ALFA 2M2AA 3CHCA 1KT1A 4DZ2A 2P4VA 2DG9A 4L3NA 4ITZA 1W9UA 3B9DA 4JFIA 4XAKA 2G8ZA 4U86A 4W9PA 1Q6HA 5HKGA 4W9QA 1FKTA 3ARSA 4U84A 2ESCA 4JFKA 2DSUA 2PI6A 4TX0A 2B5UB 1TFVA 2ZR4A 4LAXA 1FKLA 2PN0A 3FXYA 5J6EA 1D7HA 4IT4A 3G6LA 1HKJA 2A3CA 2N87A 1FKJA 4P8WA 1SYTA 1FKGA 5HW7A 2YBUA 3VAWA 3PRBA 3UQBA 2DT3A 3EIPA 3EY6A 4DWSD 1QPFA 4DRHA 2WLYA 3AS2A 3ARZA 4NSBA 3TC5A 4DROA 1EYMA 4ZS6A 2XPBA 2ZR5A 1Q6UA 3IKGA 1ZK6A 5DF0A 1ZBCA 2PPNA 1J6YA 4L72B 4WKAA 4MAVA 1L1PA 4MNJA 2UZ5A 2ZQUA 1HKMA 2K8IA 4WJXA 3ARTA 3CGMA 1J4RA 1D7IA 3CGNA 4JFMA 1PBKA 4KQZA 4IQ2A 3CHDA 4DZ3A 1FKHA 1JVWA 3TDBA 2IF4A 2LKNA 4Z2JA 1ZB5A 3MDYB 1ZU8A 4R0XA 4DRQA 1NWTA 4S3JA 1ROUA 1WNOA 5DO2A 4P8VA 1W1TA 5GPRA 2F23A 4TW6A 1R9HA 3ODKA 1X6NA 4DH0A 1NMVA 5JH8A 2XP7A 5B8IC 4KR0B 4IQCA 4QT3A 3O5EA 4MTVA 2JZVA 1JNSA 1YW5A 2EULA 3KCEA 2KFWA 1HKIA 3O5OA 3RFWA 4W5UA 4TYOA 3CHFA 5I98A 4LAVA 4Z2KA 1KT0A 4G2PA 3KAFA 2KI3A 1JNEA 1GUVA 1RD6A 2MLZA 2DG4A 2D9FA 1W26A 3O5RA 2MLXA 3B7XA 1M5YA 2DSZA 3WIJA 4GGQA 1E9LA 1EQ3A 1QPLA 1J4HA 5HT1A 3IHZA 3O5MA 4IT6A 3WQWA 3AROA 3GTYX 3ALGA 3NTPA 2O92A 2A3BA 2IUZA 1FFRA 4DRKA 3CZ8A 1LQ0A 3QOKA 1ZL1A 3KADA 4JYSA 1W9VA 1OWQA 1FKDA 1JNDA 1NMWA 1FKFA 4WKHA 4Z2LA 1EIBA 2ZQSA 3O5FA 4UDMA 4Z2HA 2KR7A 2FAPA 4MGVA 5DIUA 1XRVA 1E6NA 4S3KA 4ZPWR 2AWGA 3WD3A 3ARXA 1BL4A 2RUQA 4ZPVR 3RMEA 3B9AA 4FN2A 5BXJA 2DSVA 5DITA 4WK9A 4DRJA 4AY1A 3UI4A 4O2TA 4J4OA 2ZQTA 2DT2A 4HBOA 1GRJA 3KAGA 1U79A 1GPFA 3UI6A 4PTMA 4Q22A 1W1YA 3LUOA 3NI6A
chains in the Genus database with same CATH topology
3KAIA 4J4NA 4R5EA 4U85A 1ZBWA 3PR9A 4TW8A 5HWCA 1ITXA 4ODNA 5HWBA 4C02B 2OFNA 3WH0A 2DPEA 3ARPA 3FAPA 2RUDA 2ZR6A 1E6RA 4DWSB 4Z2IA 2PPPA 3PRAA 2XP8A 4N19A 1WB0A 3ARVA 5HTGA 2XP3A 3ARRA 1CTNA 3KZ7A 4MSPA 1Y0OA 2A3EA 3CH9A 2F4EA 1Q6IA 2KGJA 4BF8A 3RGCA 3RM8A 4URIA 4ODLA 2DG3A 3AS3A 3O5GA 3O5DA 4ODRA 3O5LA 1FJDA 2DT1A 3FY1A 3JYMA 3B8SA 4ODMA 2VCDA 1HJVA 2PV3A 1K9TA 2WK2A 4ZPTR 3BXWA 4P8UA 4DRIA 4DRPA 1FKSA 1FKKA 2AOSA 1FAPA 1BKFA 1NSGA 1LG2A 4GIVA 1EHNA 4DIPA 5DIVA 3UI5A 2KO7A 2LJ4A 4QT2A 3OOBA 1FKRA 1PINA 1F40A 2PV2A 3O5KA 4HARA 2A3AA 4IPXA 2RURA 3NRKA 1HJXA 2DSWA 3ARQA 4DRNA 4ODKA 3WKZA 1JNTA 2OLHA 1EDQA 3UQAA 1C9HA 4LAYA 3WL1A 1X6LA 2QF8A 1SR0A 2M08A 4W9OA 1KFWA 2PPOA 3UQIA 1T11A 1H0GA 2FDMA 2XP5A 3OA5A 3PA7A 1FKIA 1E15A 2RSEA 2MLYA 2WLZA 5HBFA 3AS0A 4NNRA 1ZBVA 1N1AA 3W4RA 2MPHA 4QZVB 1XHGA 3JYJA 3KABA 4TW7A 4ML4A 1J4IA 2LGOA 3WD4A 3ARYA 5HUAA 1P5QA 3WD1A 2M1IA 4LGXA 3G6MA 2XP6A 4ODPA 1FKBA 1H0IA 2F21A 1Q1CA 2F2DA 3RM4A 3B9EA 4MNKA 5HW8A 1W9PA 4MNMA 3CHEA 4HBEA 4DRMA 1F8AB 4ODQA 2PV1A 1E6ZA 4MNLA 1OGBA 1NWRA 2L2SA 2MNTA 3O5QA 1LL6A 1TCOC 3PRDA 4WIWA 4MPKA 3KAHA 1W1VA 1B6CA 4DT4A 1IX5A 1O6IA 3IKDA 2FKEA 4DWSA 4TNSA 2Y78A 1OGGA 1D7JA 1ZBKA 1D6OA 4Z2GA 3AS1A 1NWSA 1WAWA 2RQSA 2VN1A 2PBCA 2G41A 3O5PA 1GOIA 2LPVA 5HW6A 3IK8A 3GPKA 1YATA 1UR9A 4JFJA 3RM9A 5D75A 2B31A 2ITKA 4P8XA 1LJYA 3WD2A 4ODOA 4G50A 3UF8A 5DEZA 5GQBA 3WD0A 1NH6A 1A7XA 5GPGA 2YBTA 3JXVA 4WKFA 3AQUA 3WL0A 1HJWA 3ARWA 4QIBA 1LL7A 1E6PA 4JFLA 3WQVA 2KE0A 3ARUA 4NZCA 3O5IA 4FAPA 2MF9A 1LG1A 3O5JA 1ROTA 2O9OA 3KACA 1LL4A 2Q5AA 4Q7NA 2XP9A 1ZCNA 2XP4A 1NWUA 2DT0A 2WM0A 3H9RB 1FFQA 3I6CA 1QZ2A 4LAWA 2XPAA 3TCZA 4DWSC 1HKKA 1HXVA 1D2KA 2ZQVA 1FD9A 1W1PA 1UR8A 2RUCA 1VF8A 3ALFA 2M2AA 3CHCA 1KT1A 4DZ2A 2DG9A 4L3NA 4ITZA 1W9UA 3B9DA 4JFIA 4XAKA 2G8ZA 4U86A 4W9PA 1Q6HA 5HKGA 4W9QA 1FKTA 3ARSA 4U84A 2ESCA 4JFKA 2DSUA 2PI6A 4TX0A 1TFVA 2ZR4A 4LAXA 1FKLA 3FXYA 5J6EA 1D7HA 4IT4A 3G6LA 1HKJA 2A3CA 2N87A 1FKJA 4P8WA 1SYTA 1FKGA 5HW7A 2YBUA 3VAWA 3PRBA 3UQBA 2DT3A 3EY6A 4DWSD 1QPFA 4DRHA 2WLYA 3AS2A 3ARZA 4NSBA 3TC5A 4DROA 1EYMA 4ZS6A 2XPBA 2ZR5A 1Q6UA 3IKGA 1ZK6A 5DF0A 1ZBCA 2PPNA 1J6YA 4L72B 4WKAA 4MAVA 1L1PA 4MNJA 2UZ5A 2ZQUA 1HKMA 2K8IA 4WJXA 3ARTA 3CGMA 1J4RA 1D7IA 3CGNA 4JFMA 1PBKA 4KQZA 4IQ2A 3CHDA 4DZ3A 1FKHA 1JVWA 3TDBA 2IF4A 2LKNA 4Z2JA 1ZB5A 3MDYB 1ZU8A 4R0XA 4DRQA 1NWTA 4S3JA 1ROUA 1WNOA 5DO2A 4P8VA 1W1TA 5GPRA 4TW6A 1R9HA 3ODKA 1X6NA 4DH0A 1NMVA 5JH8A 2XP7A 5B8IC 4KR0B 4IQCA 4QT3A 3O5EA 4MTVA 2JZVA 1JNSA 1YW5A 3KCEA 2KFWA 1HKIA 3O5OA 3RFWA 4W5UA 4TYOA 3CHFA 5I98A 4LAVA 4Z2KA 1KT0A 4G2PA 3KAFA 2KI3A 1JNEA 1GUVA 1RD6A 2MLZA 2DG4A 2D9FA 1W26A 3O5RA 2MLXA 3B7XA 1M5YA 2DSZA 3WIJA 4GGQA 1E9LA 1EQ3A 1QPLA 1J4HA 5HT1A 3IHZA 3O5MA 4IT6A 3WQWA 3AROA 3ALGA 3NTPA 2O92A 2A3BA 2IUZA 1FFRA 4DRKA 3CZ8A 1LQ0A 3QOKA 1ZL1A 3KADA 4JYSA 1W9VA 1NMWA 1FKDA 1JNDA 1OWQA 1FKFA 4WKHA 4Z2LA 1EIBA 2ZQSA 3O5FA 4Z2HA 2KR7A 2FAPA 4MGVA 5DIUA 1XRVA 1E6NA 4S3KA 4ZPWR 2AWGA 3WD3A 3ARXA 1BL4A 2RUQA 4ZPVR 3RMEA 3B9AA 4FN2A 5BXJA 2DSVA 5DITA 4WK9A 4DRJA 4AY1A 3UI4A 4O2TA 4J4OA 2ZQTA 2DT2A 4HBOA 3KAGA 1U79A 1GPFA 3UI6A 4PTMA 4Q22A 1W1YA 3LUOA 3NI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5A A;  3MDY B;  3UQI A;  3KAI A;  1T11 A;  4J4N A;  4U85 A;  4R0X A;  4DRQ A;  2XP5 A;  2XP9 A;  1ZCN A;  2XP4 A;  1ROU A;  3PA7 A;  4TW8 A;  5HWC A;  3H9R B;  4ODN A;  1FKI A;  5HWB A;  4C02 B;  2RSE A;  2MLY A;  3I6C A;  4TW6 A;  1R9H A;  1QZ2 A;  2OFN A;  3WH0 A;  3ODK A;  4LAW A;  2XPA A;  4NNR A;  4DH0 A;  3FAP A;  3TCZ A;  1N1A A;  1NMV A;  1HXV A;  2RUD A;  2ZR6 A;  2ZQV A;  2XP7 A;  2MPH A;  5B8I C;  4QT3 A;  1FD9 A;  4IQC A;  3JYJ A;  3KAB A;  3O5E A;  4TW7 A;  2RUC A;  2LGO A;  1J4I A;  2JZV A;  2M2A A;  1JNS A;  2PPP A;  1YW5 A;  5HUA A;  1P5Q A;  3KCE A;  2M1I A;  2KFW A;  2XP8 A;  1KT1 A;  2XP6 A;  3O5O A;  3RFW A;  4DZ2 A;  4N19 A;  4ODP A;  2F21 A;  1FKB A;  4TYO A;  1Q1C A;  5I98 A;  4LAV A;  2F2D A;  1KT0 A;  4G2P A;  2DG9 A;  4DRO A;  5HW8 A;  3KAF A;  4ITZ A;  2KI3 A;  4JFI A;  4DRM A;  5HTG A;  1F8A B;  4ODQ A;  2PV1 A;  2XP3 A;  3LUO A;  2MLZ A;  2DG4 A;  4U86 A;  4W9P A;  1Q6H A;  5HKG A;  2L2S A;  3KZ7 A;  2MNT A;  3O5Q A;  3PRD A;  1TCO C;  4MSP A;  2D9F A;  1Y0O A;  1W26 A;  4W9Q A;  3O5R A;  1FKT A;  3KAH A;  4U84 A;  2MLX A;  2F4E A;  3B7X A;  1B6C A;  4DT4 A;  1M5Y A;  4JFK A;  1Q6I A;  2KGJ A;  4TX0 A;  4BF8 A;  3RGC A;  2ZR4 A;  4GGQ A;  3IKD A;  4LAX A;  1FKL A;  2FKE A;  1EQ3 A;  1QPL A;  1J4H A;  5HT1 A;  4ODL A;  2DG3 A;  3O5G A;  4TNS A;  5J6E A;  2Y78 A;  1D7H A;  3O5D A;  3IHZ A;  1D7J A;  4ODR A;  3O5L A;  3O5M A;  1FJD A;  2N87 A;  1D6O A;  1FKJ A;  3JYM A;  2RQS A;  1FKG A;  2VN1 A;  2PBC A;  3NTP A;  4ODM A;  5HW7 A;  2VCD A;  2PV3 A;  3O5P A;  2LPV A;  3VAW A;  4DRI A;  3IK8 A;  4DRK A;  4DRP A;  5HW6 A;  3GPK A;  3PRB A;  1FKS A;  1YAT A;  3UQB A;  3KAD A;  3EY6 A;  1FKK A;  1QPF A;  4JYS A;  4DRH A;  4JFJ A;  1FAP A;  1BKF A;  1NMW A;  1FKD A;  1NSG A;  5D75 A;  2ITK A;  4GIV A;  2ZQS A;  3TC5 A;  3O5F A;  5DIV A;  3UI5 A;  2LJ4 A;  2KO7 A;  1EYM A;  4QT2 A;  4DIP A;  2KR7 A;  2FAP A;  2XPB A;  4MGV A;  4ODO A;  2ZR5 A;  4G50 A;  5DIU A;  1Q6U A;  3IKG A;  1ZK6 A;  3OOB A;  2PPN A;  3UF8 A;  1FKR A;  2AWG A;  1PIN A;  1J6Y A;  1F40 A;  1BL4 A;  2RUQ A;  2PV2 A;  3O5K A;  1L1P A;  1A7X A;  4IPX A;  2UZ5 A;  2ZQU A;  2K8I A;  2RUR A;  4FN2 A;  3NRK A;  5GPG A;  5BXJ A;  3JXV A;  3CGM A;  4DRN A;  1J4R A;  5DIT A;  4ODK A;  4DRJ A;  1JNT A;  3UI4 A;  4O2T A;  3UQA A;  4J4O A;  2ZQT A;  4QIB A;  1C9H A;  1D7I A;  4LAY A;  4JFL A;  3CGN A;  4JFM A;  2KE0 A;  1PBK A;  3KAG A;  1U79 A;  3O5I A;  2MF9 A;  2M08 A;  4FAP A;  4IQ2 A;  4W9O A;  4DZ3 A;  1FKH A;  1JVW A;  1ROT A;  3O5J A;  3TDB A;  2IF4 A;  3KAC A;  3UI6 A;  2LKN A;  1FKF A;  3NI6 A;  2PPO A; 
#chains in the Genus database with same CATH topology
 3KAI A;  4J4N A;  4R5E A;  4U85 A;  1ZBW A;  3PR9 A;  4TW8 A;  5HWC A;  1ITX A;  4ODN A;  5HWB A;  4C02 B;  1E44 A;  2OFN A;  3WH0 A;  2DPE A;  3ARP A;  3FAP A;  2RUD A;  2ZR6 A;  1E6R A;  4DWS B;  4Z2I A;  2PPP A;  3PRA A;  2XP8 A;  4N19 A;  1WB0 A;  3ARV A;  5HTG A;  2XP3 A;  3ARR A;  1CTN A;  3KZ7 A;  4MSP A;  1Y0O A;  2A3E A;  3CH9 A;  2F4E A;  1Q6I A;  2KGJ A;  4BF8 A;  3RGC A;  3RM8 A;  4URI A;  4ODL A;  2DG3 A;  3AS3 A;  3O5G A;  3O5D A;  2ETN A;  3O5L A;  4ODR A;  2DT1 A;  1FJD A;  3FY1 A;  3JYM A;  3B8S A;  4ODM A;  2VCD A;  1HJV A;  2PV3 A;  1K9T A;  2WK2 A;  4ZPT R;  3BXW A;  4P8U A;  4DRI A;  4DRP A;  1FKS A;  1FKK A;  2AOS A;  1FAP A;  1BKF A;  1NSG A;  1LG2 A;  4GIV A;  1EHN A;  4DIP A;  5DIV A;  3UI5 A;  2KO7 A;  2LJ4 A;  4QT2 A;  3OOB A;  1FKR A;  1PIN A;  1F40 A;  1JCH B;  2PV2 A;  3O5K A;  4HAR A;  2A3A A;  4IPX A;  2RUR A;  3NRK A;  1HJX A;  2DSW A;  3ARQ A;  4DRN A;  4ODK A;  3WKZ A;  1JNT A;  2OLH A;  1EDQ A;  3UQA A;  1C9H A;  4LAY A;  3WL1 A;  1X6L A;  2QF8 A;  1SR0 A;  2M08 A;  4W9O A;  1KFW A;  2PPO A;  3UQI A;  1T11 A;  1H0G A;  2FDM A;  2XP5 A;  3OA5 A;  3PA7 A;  1FKI A;  1E15 A;  2RSE A;  2MLY A;  2WLZ A;  5HBF A;  3AS0 A;  4NNR A;  1ZBV A;  1N1A A;  3W4R A;  2MPH A;  4QZV B;  1XHG A;  3JYJ A;  3KAB A;  4TW7 A;  4ML4 A;  1J4I A;  2LGO A;  3WD4 A;  3ARY A;  5HUA A;  1P5Q A;  3WD1 A;  2M1I A;  4LGX A;  3G6M A;  2XP6 A;  4ODP A;  1FKB A;  1H0I A;  2F21 A;  1Q1C A;  2F2D A;  3RM4 A;  3B9E A;  4MNK A;  5HW8 A;  1W9P A;  4MNM A;  3CHE A;  4HBE A;  4DRM A;  1F8A B;  4ODQ A;  2PV1 A;  1E6Z A;  4MNL A;  1OGB A;  1NWR A;  2L2S A;  2MNT A;  3O5Q A;  1LL6 A;  1TCO C;  3PRD A;  4WIW A;  4MPK A;  3KAH A;  1W1V A;  1B6C A;  4DT4 A;  1IX5 A;  1O6I A;  3IKD A;  2FKE A;  4DWS A;  4TNS A;  2Y78 A;  1OGG A;  1D7J A;  1ZBK A;  1D6O A;  4Z2G A;  3AS1 A;  1NWS A;  1WAW A;  2RQS A;  2VN1 A;  2PBC A;  2G41 A;  3O5P A;  1GOI A;  2LPV A;  5HW6 A;  3IK8 A;  3GPK A;  1YAT A;  1UR9 A;  4JFJ A;  3RM9 A;  5D75 A;  2B31 A;  2ITK A;  4P8X A;  1LJY A;  3WD2 A;  4ODO A;  4G50 A;  3UF8 A;  5DEZ A;  5GQB A;  3WD0 A;  1NH6 A;  1A7X A;  5GPG A;  2YBT A;  3JXV A;  4WKF A;  3AQU A;  3WL0 A;  1HJW A;  3ARW A;  4QIB A;  1LL7 A;  1E6P A;  4JFL A;  3WQV A;  2KE0 A;  3ARU A;  4NZC A;  3GU0 A;  3O5I A;  4FAP A;  2MF9 A;  1LG1 A;  3O5J A;  1ROT A;  2O9O A;  3KAC A;  1LL4 A;  2Q5A A;  4Q7N A;  3BMB A;  2XP9 A;  1ZCN A;  2XP4 A;  1NWU A;  2DT0 A;  2WM0 A;  3H9R B;  1FFQ A;  3I6C A;  1QZ2 A;  4LAW A;  2XPA A;  3TCZ A;  4DWS C;  1HKK A;  1HXV A;  1D2K A;  2ZQV A;  1FD9 A;  1W1P A;  1UR8 A;  2RUC A;  1VF8 A;  3ALF A;  2M2A A;  3CHC A;  1KT1 A;  4DZ2 A;  2P4V A;  2DG9 A;  4L3N A;  4ITZ A;  1W9U A;  3B9D A;  4JFI A;  4XAK A;  2G8Z A;  4U86 A;  4W9P A;  1Q6H A;  5HKG A;  4W9Q A;  1FKT A;  3ARS A;  4U84 A;  2ESC A;  4JFK A;  2DSU A;  2PI6 A;  4TX0 A;  2B5U B;  1TFV A;  2ZR4 A;  4LAX A;  1FKL A;  2PN0 A;  3FXY A;  5J6E A;  1D7H A;  4IT4 A;  3G6L A;  1HKJ A;  2A3C A;  2N87 A;  1FKJ A;  4P8W A;  1SYT A;  1FKG A;  5HW7 A;  2YBU A;  3VAW A;  3PRB A;  3UQB A;  2DT3 A;  3EIP A;  3EY6 A;  4DWS D;  1QPF A;  4DRH A;  2WLY A;  3AS2 A;  3ARZ A;  4NSB A;  3TC5 A;  4DRO A;  1EYM A;  4ZS6 A;  2XPB A;  2ZR5 A;  1Q6U A;  3IKG A;  1ZK6 A;  5DF0 A;  1ZBC A;  2PPN A;  1J6Y A;  4L72 B;  4WKA A;  4MAV A;  1L1P A;  4MNJ A;  2UZ5 A;  2ZQU A;  1HKM A;  2K8I A;  4WJX A;  3ART A;  3CGM A;  1J4R A;  1D7I A;  3CGN A;  4JFM A;  1PBK A;  4KQZ A;  4IQ2 A;  3CHD A;  4DZ3 A;  1FKH A;  1JVW A;  3TDB A;  2IF4 A;  2LKN A;  4Z2J A;  1ZB5 A;  3MDY B;  1ZU8 A;  4R0X A;  4DRQ A;  1NWT A;  4S3J A;  1ROU A;  1WNO A;  5DO2 A;  4P8V A;  1W1T A;  5GPR A;  2F23 A;  4TW6 A;  1R9H A;  3ODK A;  1X6N A;  4DH0 A;  1NMV A;  5JH8 A;  2XP7 A;  5B8I C;  4KR0 B;  4IQC A;  4QT3 A;  3O5E A;  4MTV A;  2JZV A;  1JNS A;  1YW5 A;  2EUL A;  3KCE A;  2KFW A;  1HKI A;  3O5O A;  3RFW A;  4W5U A;  4TYO A;  3CHF A;  5I98 A;  4LAV A;  4Z2K A;  1KT0 A;  4G2P A;  3KAF A;  2KI3 A;  1JNE A;  1GUV A;  1RD6 A;  2MLZ A;  2DG4 A;  2D9F A;  1W26 A;  3O5R A;  2MLX A;  3B7X A;  1M5Y A;  2DSZ A;  3WIJ A;  4GGQ A;  1E9L A;  1EQ3 A;  1QPL A;  1J4H A;  5HT1 A;  3IHZ A;  3O5M A;  4IT6 A;  3WQW A;  3ARO A;  3GTY X;  3ALG A;  3NTP A;  2O92 A;  2A3B A;  2IUZ A;  1FFR A;  4DRK A;  3CZ8 A;  1LQ0 A;  3QOK A;  1ZL1 A;  3KAD A;  4JYS A;  1W9V A;  1OWQ A;  1FKD A;  1JND A;  1NMW A;  1FKF A;  4WKH A;  4Z2L A;  1EIB A;  2ZQS A;  3O5F A;  4UDM A;  4Z2H A;  2KR7 A;  2FAP A;  4MGV A;  5DIU A;  1XRV A;  1E6N A;  4S3K A;  4ZPW R;  2AWG A;  3WD3 A;  3ARX A;  1BL4 A;  2RUQ A;  4ZPV R;  3RME A;  3B9A A;  4FN2 A;  5BXJ A;  2DSV A;  5DIT A;  4WK9 A;  4DRJ A;  4AY1 A;  3UI4 A;  4O2T A;  4J4O A;  2ZQT A;  2DT2 A;  4HBO A;  1GRJ A;  3KAG A;  1U79 A;  1GPF A;  3UI6 A;  4PTM A;  4Q22 A;  1W1Y A;  3LUO A;  3NI6 A; 
#chains in the Genus database with same CATH homology
 3KAI A;  4J4N A;  4R5E A;  4U85 A;  1ZBW A;  3PR9 A;  4TW8 A;  5HWC A;  1ITX A;  4ODN A;  5HWB A;  4C02 B;  2OFN A;  3WH0 A;  2DPE A;  3ARP A;  3FAP A;  2RUD A;  2ZR6 A;  1E6R A;  4DWS B;  4Z2I A;  2PPP A;  3PRA A;  2XP8 A;  4N19 A;  1WB0 A;  3ARV A;  5HTG A;  2XP3 A;  3ARR A;  1CTN A;  3KZ7 A;  4MSP A;  1Y0O A;  2A3E A;  3CH9 A;  2F4E A;  1Q6I A;  2KGJ A;  4BF8 A;  3RGC A;  3RM8 A;  4URI A;  4ODL A;  2DG3 A;  3AS3 A;  3O5G A;  3O5D A;  4ODR A;  3O5L A;  1FJD A;  2DT1 A;  3FY1 A;  3JYM A;  3B8S A;  4ODM A;  2VCD A;  1HJV A;  2PV3 A;  1K9T A;  2WK2 A;  4ZPT R;  3BXW A;  4P8U A;  4DRI A;  4DRP A;  1FKS A;  1FKK A;  2AOS A;  1FAP A;  1BKF A;  1NSG A;  1LG2 A;  4GIV A;  1EHN A;  4DIP A;  5DIV A;  3UI5 A;  2KO7 A;  2LJ4 A;  4QT2 A;  3OOB A;  1FKR A;  1PIN A;  1F40 A;  2PV2 A;  3O5K A;  4HAR A;  2A3A A;  4IPX A;  2RUR A;  3NRK A;  1HJX A;  2DSW A;  3ARQ A;  4DRN A;  4ODK A;  3WKZ A;  1JNT A;  2OLH A;  1EDQ A;  3UQA A;  1C9H A;  4LAY A;  3WL1 A;  1X6L A;  2QF8 A;  1SR0 A;  2M08 A;  4W9O A;  1KFW A;  2PPO A;  3UQI A;  1T11 A;  1H0G A;  2FDM A;  2XP5 A;  3OA5 A;  3PA7 A;  1FKI A;  1E15 A;  2RSE A;  2MLY A;  2WLZ A;  5HBF A;  3AS0 A;  4NNR A;  1ZBV A;  1N1A A;  3W4R A;  2MPH A;  4QZV B;  1XHG A;  3JYJ A;  3KAB A;  4TW7 A;  4ML4 A;  1J4I A;  2LGO A;  3WD4 A;  3ARY A;  5HUA A;  1P5Q A;  3WD1 A;  2M1I A;  4LGX A;  3G6M A;  2XP6 A;  4ODP A;  1FKB A;  1H0I A;  2F21 A;  1Q1C A;  2F2D A;  3RM4 A;  3B9E A;  4MNK A;  5HW8 A;  1W9P A;  4MNM A;  3CHE A;  4HBE A;  4DRM A;  1F8A B;  4ODQ A;  2PV1 A;  1E6Z A;  4MNL A;  1OGB A;  1NWR A;  2L2S A;  2MNT A;  3O5Q A;  1LL6 A;  1TCO C;  3PRD A;  4WIW A;  4MPK A;  3KAH A;  1W1V A;  1B6C A;  4DT4 A;  1IX5 A;  1O6I A;  3IKD A;  2FKE A;  4DWS A;  4TNS A;  2Y78 A;  1OGG A;  1D7J A;  1ZBK A;  1D6O A;  4Z2G A;  3AS1 A;  1NWS A;  1WAW A;  2RQS A;  2VN1 A;  2PBC A;  2G41 A;  3O5P A;  1GOI A;  2LPV A;  5HW6 A;  3IK8 A;  3GPK A;  1YAT A;  1UR9 A;  4JFJ A;  3RM9 A;  5D75 A;  2B31 A;  2ITK A;  4P8X A;  1LJY A;  3WD2 A;  4ODO A;  4G50 A;  3UF8 A;  5DEZ A;  5GQB A;  3WD0 A;  1NH6 A;  1A7X A;  5GPG A;  2YBT A;  3JXV A;  4WKF A;  3AQU A;  3WL0 A;  1HJW A;  3ARW A;  4QIB A;  1LL7 A;  1E6P A;  4JFL A;  3WQV A;  2KE0 A;  3ARU A;  4NZC A;  3O5I A;  4FAP A;  2MF9 A;  1LG1 A;  3O5J A;  1ROT A;  2O9O A;  3KAC A;  1LL4 A;  2Q5A A;  4Q7N A;  2XP9 A;  1ZCN A;  2XP4 A;  1NWU A;  2DT0 A;  2WM0 A;  3H9R B;  1FFQ A;  3I6C A;  1QZ2 A;  4LAW A;  2XPA A;  3TCZ A;  4DWS C;  1HKK A;  1HXV A;  1D2K A;  2ZQV A;  1FD9 A;  1W1P A;  1UR8 A;  2RUC A;  1VF8 A;  3ALF A;  2M2A A;  3CHC A;  1KT1 A;  4DZ2 A;  2DG9 A;  4L3N A;  4ITZ A;  1W9U A;  3B9D A;  4JFI A;  4XAK A;  2G8Z A;  4U86 A;  4W9P A;  1Q6H A;  5HKG A;  4W9Q A;  1FKT A;  3ARS A;  4U84 A;  2ESC A;  4JFK A;  2DSU A;  2PI6 A;  4TX0 A;  1TFV A;  2ZR4 A;  4LAX A;  1FKL A;  3FXY A;  5J6E A;  1D7H A;  4IT4 A;  3G6L A;  1HKJ A;  2A3C A;  2N87 A;  1FKJ A;  4P8W A;  1SYT A;  1FKG A;  5HW7 A;  2YBU A;  3VAW A;  3PRB A;  3UQB A;  2DT3 A;  3EY6 A;  4DWS D;  1QPF A;  4DRH A;  2WLY A;  3AS2 A;  3ARZ A;  4NSB A;  3TC5 A;  4DRO A;  1EYM A;  4ZS6 A;  2XPB A;  2ZR5 A;  1Q6U A;  3IKG A;  1ZK6 A;  5DF0 A;  1ZBC A;  2PPN A;  1J6Y A;  4L72 B;  4WKA A;  4MAV A;  1L1P A;  4MNJ A;  2UZ5 A;  2ZQU A;  1HKM A;  2K8I A;  4WJX A;  3ART A;  3CGM A;  1J4R A;  1D7I A;  3CGN A;  4JFM A;  1PBK A;  4KQZ A;  4IQ2 A;  3CHD A;  4DZ3 A;  1FKH A;  1JVW A;  3TDB A;  2IF4 A;  2LKN A;  4Z2J A;  1ZB5 A;  3MDY B;  1ZU8 A;  4R0X A;  4DRQ A;  1NWT A;  4S3J A;  1ROU A;  1WNO A;  5DO2 A;  4P8V A;  1W1T A;  5GPR A;  4TW6 A;  1R9H A;  3ODK A;  1X6N A;  4DH0 A;  1NMV A;  5JH8 A;  2XP7 A;  5B8I C;  4KR0 B;  4IQC A;  4QT3 A;  3O5E A;  4MTV A;  2JZV A;  1JNS A;  1YW5 A;  3KCE A;  2KFW A;  1HKI A;  3O5O A;  3RFW A;  4W5U A;  4TYO A;  3CHF A;  5I98 A;  4LAV A;  4Z2K A;  1KT0 A;  4G2P A;  3KAF A;  2KI3 A;  1JNE A;  1GUV A;  1RD6 A;  2MLZ A;  2DG4 A;  2D9F A;  1W26 A;  3O5R A;  2MLX A;  3B7X A;  1M5Y A;  2DSZ A;  3WIJ A;  4GGQ A;  1E9L A;  1EQ3 A;  1QPL A;  1J4H A;  5HT1 A;  3IHZ A;  3O5M A;  4IT6 A;  3WQW A;  3ARO A;  3ALG A;  3NTP A;  2O92 A;  2A3B A;  2IUZ A;  1FFR A;  4DRK A;  3CZ8 A;  1LQ0 A;  3QOK A;  1ZL1 A;  3KAD A;  4JYS A;  1W9V A;  1NMW A;  1FKD A;  1JND A;  1OWQ A;  1FKF A;  4WKH A;  4Z2L A;  1EIB A;  2ZQS A;  3O5F A;  4Z2H A;  2KR7 A;  2FAP A;  4MGV A;  5DIU A;  1XRV A;  1E6N A;  4S3K A;  4ZPW R;  2AWG A;  3WD3 A;  3ARX A;  1BL4 A;  2RUQ A;  4ZPV R;  3RME A;  3B9A A;  4FN2 A;  5BXJ A;  2DSV A;  5DIT A;  4WK9 A;  4DRJ A;  4AY1 A;  3UI4 A;  4O2T A;  4J4O A;  2ZQT A;  2DT2 A;  4HBO A;  3KAG A;  1U79 A;  1GPF A;  3UI6 A;  4PTM A;  4Q22 A;  1W1Y A;  3LUO A;  3NI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...