2RSEA

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rseA00
4ODLA 3O5LA 4TW7A 2K8IA 5HW8A 2DG9A 3CGNA 4DIPA 3RFWA 1M5YA 2PV3A 2XP7A 3JYMA 3NRKA 3O5QA 3IKDA 5HT1A 2M2AA 3O5PA 1EQ3A 3H9RB 1A7XA 1D6OA 1D7HA 1FD9A 4IPXA 4NNRA 4U86A 4DZ3A 5HWBA 1FKFA 3KAIA 2F4EA 4DRHA 2F2DA 2MF9A 2KR7A 1FKBA 2RQSA 1N1AA 2UZ5A 3O5GA 2RURA 2ZQTA 4G50A 1NMVA 1J4IA 5HW7A 2RUCA 2RUQA 3O5RA 2N87A 2XPBA 2VN1A 2ZR5A 4IQ2A 2MLZA 3TCZA 1NMWA 4ODPA 3O5DA 4ODKA 3KACA 1FKKA 4QT2A 4ODOA 5DITA 2L2SA 3KAFA 3UI4A 1FKRA 2XPAA 3TDBA 3UF8A 3EY6A 2MLYA 3IHZA 4DT4A 2MPHA 2PPOA 2M1IA 3CGMA 4J4NA 2ZQUA 1QZ2A 1BKFA 2PPNA 2XP5A 1YW5A 1C9HA 3KAHA 3PRBA 4QT3A 4W9QA 5HWCA 3KCEA 1PINA 4U84A 1R9HA 4DRMA 2JZVA 1P5QA 4TW8A 4TNSA 3MDYB 2KO7A 3O5EA 3KAGA 2Q5AA 4U85A 4DRIA 1BL4A 4FAPA 2ITKA 2XP8A 5D75A 1JNTA 1D7IA 4JFJA 3OOBA 2PBCA 1FKTA 4JYSA 3I6CA 1FKJA 2PV1A 4IQCA 5HKGA 3O5JA 3FAPA 1ZK6A 1KT1A 2PV2A 2LPVA 3KADA 3WH0A 4DROA 1FKSA 3UQAA 3UQBA 3KZ7A 4GGQA 2MNTA 5DIUA 1QPLA 4R0XA 4ODNA 4MGVA 4TYOA 4TX0A 1J6YA 3TC5A 2M08A 2DG3A 1Q1CA 2LGOA 1TCOC 2ZR4A 4FN2A 1FKDA 1FKGA 4JFIA 3UI5A 2FAPA 3NI6A 4DRPA 5BXJA 5HW6A 4W9OA 4DRJA 5J6EA 2D9FA 4DRNA 1D7JA 1FKHA 2AWGA 3O5KA 1QPFA 4G2PA 4JFMA 2FKEA 2KGJA 4J4OA 1JVWA 1YATA 3IK8A 4JFKA 1ROTA 1NSGA 1W26A 1Q6HA 1Y0OA 2F21A 3PA7A 1L1PA 5DIVA 1JNSA 4BF8A 1PBKA 1T11A 2RUDA 5I98A 1FAPA 3GPKA 1HXVA 4DH0A 2KFWA 2IF4A 1KT0A 2LKNA 3UI6A 2DG4A 2ZQSA 2XP6A 4N19A 2XP3A 3O5FA 1ROUA 3JYJA 3IKGA 2LJ4A 2VCDA 1J4HA 3ODKA 4O2TA 2KE0A 1J4RA 4JFLA 4ODRA 1U79A 1ZCNA 3KABA 4LAYA 4ODMA 3LUOA 2ZR6A 2Y78A 4TW6A 4MSPA 5GPGA 3VAWA 1FKIA 2RSEA 2ZQVA 5HUAA 1FJDA 2KI3A 5B8IC 2PPPA 3O5OA 2MLXA 1F8AB 4QIBA 1Q6UA 3NTPA 3B7XA 4W9PA 3O5MA 3PRDA 4GIVA 1FKLA 4C02B 4LAVA 4ODQA 2XP9A 3UQIA 4LAWA 2XP4A 3O5IA 4LAXA 3JXVA 5HTGA 1B6CA 4DRQA 1EYMA 4ITZA 3RGCA 1F40A 2OFNA 4DZ2A 1Q6IA 4DRKA
chains in the Genus database with same CATH superfamily
4Q7NA 3JYMA 3O5QA 5HT1A 3BXWA 3CHDA 3RM8A 4IPXA 1FKFA 2F4EA 4DRHA 2F2DA 1W1VA 2ZQTA 4PTMA 2WLZA 3ARWA 3ARPA 2ZR5A 3TCZA 1NMWA 4ODPA 3KACA 4MNJA 1JNDA 1EHNA 4Z2GA 3ALFA 2DSWA 2O9OA 3IHZA 2MPHA 2PPOA 2ZQUA 4W9QA 3AS1A 1YW5A 1C9HA 4QT3A 5HWCA 1GRJA 4DRMA 1NWRA 1OWQA 2JZVA 4Z2IA 1P5QA 2ETNA 3KAGA 1E6ZA 2ITKA 2XP8A 1D7IA 3OOBA 2PBCA 1FKTA 1FKJA 2PV1A 4HBOA 3FAPA 1ZK6A 3KADA 2PV2A 5DF0A 4DROA 1HJVA 1LG1A 2G41A 4GGQA 4NSBA 3WD3A 4R0XA 3ARTA 1UR8A 4ZPWR 1TFVA 1VF8A 3EIPA 4URIA 2D9FA 1OGBA 5DEZA 4JFKA 1NSGA 3AS2A 1L1PA 5DIVA 3CHCA 3WD0A 2DT3A 4IT6A 3PR9A 3G6MA 3GTYX 3UI6A 2DG4A 4N19A 3IKGA 3ODKA 4ODMA 4Q22A 1JNEA 1LL7A 1FKIA 2AOSA 2RSEA 2ZQVA 1FJDA 3ARYA 5B8IC 1WNOA 4LAVA 1LL4A 4MAVA 3JXVA 3RM9A 3RMEA 5JH8A 2OFNA 4WIWA 3WL0A 4L3NA 2DG9A 1ITXA 3CGNA 2DT1A 3ARXA 3GU0A 2PV3A 2XP7A 3IKDA 4NNRA 1A7XA 1D6OA 5HWBA 4DWSC 4HBEA 2KR7A 2RQSA 1N1AA 4G50A 4MNMA 1E9LA 3O5RA 2N87A 4MNKA 2PI6A 4IQ2A 4ODKA 3WQVA 3FXYA 2B31A 2L2SA 3KAFA 5DITA 3CHFA 3TDBA 2WLYA 1W9UA 2DT2A 1CTNA 3PRBA 1HKKA 1HKMA 1PINA 1EIBA 4U84A 2YBTA 2DSVA 1H0IA 2KO7A 3ARRA 2Q5AA 2WK2A 1BL4A 5D75A 1NWTA 3I6CA 4IQCA 4ML4A 4XAKA 4AY1A 2IUZA 1KT1A 4WK9A 2LPVA 4UDMA 1FKSA 1HKIA 1O6IA 1OGGA 2WM0A 3ARSA 3KZ7A 1ZBVA 1NWSA 3WIJA 1E6NA 4FN2A 3ARVA 4MNLA 1FKDA 2FAPA 2PN0A 4Z2JA 4DWSD 4W9OA 5J6EA 1HJXA 2ESCA 1JVWA 4L72B 1W26A 1Q6HA 3PA7A 4S3JA 1W1YA 1JNSA 1SR0A 1T11A 2RUDA 1FAPA 3GPKA 1KT0A 2B5UB 2XP3A 1GOIA 2LJ4A 2VCDA 1J4HA 3RM4A 2KE0A 4ODRA 1U79A 1ZCNA 4LAYA 4TW6A 4MSPA 1GUVA 3AS3A 2P4VA 3NTPA 4W9PA 4HARA 3PRDA 1FKLA 4ODQA 3G6LA 3UQIA 2YBUA 5HTGA 1NH6A 4WKHA 5HBFA 1Q6IA 4ODLA 1E6RA 1UR9A 3O5LA 2K8IA 5HW8A 1ZBCA 3O5PA 3H9RB 4DZ3A 1FD9A 5GQBA 3KAIA 2MF9A 1FKBA 1W1PA 3QOKA 3O5GA 2UZ5A 1NMVA 1LQ0A 1J4IA 4MTVA 2RUQA 4ZS6A 2XPBA 2MLZA 1K9TA 3WD1A 1FFQA 3O5DA 1FKKA 4IT4A 4W5UA 4QT2A 3ALGA 4ODOA 2FDMA 2XPAA 3EY6A 2MLYA 2M1IA 1E15A 3CGMA 1NWUA 4J4NA 1QZ2A 2PPNA 3KAHA 2XP5A 4TNSA 3W4RA 3AQUA 4QZVB 1E6PA 3O5EA 1SYTA 4U85A 4FAPA 2EULA 3AROA 3O5JA 3WH0A 1ZB5A 2DPEA 4KR0B 5DIUA 1IX5A 1QPLA 4TYOA 3ARQA 1J6YA 2LGOA 4Z2LA 3AS0A 1TCOC 2ZR4A 4P8XA 1FKGA 4JFIA 3NI6A 3B9DA 4DRPA 4DRJA 4G2PA 3O5KA 4JFMA 1ZBWA 4J4OA 1YATA 1Y0OA 2F21A 4BF8A 1PBKA 5I98A 4DH0A 1LJYA 4P8WA 2LKNA 3ARUA 1ZU8A 2ZQSA 2XP6A 3O5FA 3JYJA 3WD4A 1HJWA 1J4RA 3LUOA 1X6NA 5HUAA 2KI3A 2PPPA 1FFRA 1Q6UA 3B7XA 4C02B 4LAWA 4ZPTR 4LAXA 1B6CA 1D2KA 3WKZA 1EYMA 4ITZA 1F40A 4DZ2A 1WAWA 4DRKA 4TW7A 2A3EA 4DIPA 3RFWA 1M5YA 3NRKA 2DSUA 2M2AA 1LG2A 1EQ3A 4U86A 1D7HA 3B9EA 3CH9A 2DSZA 3WL1A 2A3AA 2RURA 3B8SA 3OA5A 5HW7A 2RUCA 2A3CA 2VN1A 4P8UA 1WB0A 3UI4A 1FKRA 3UF8A 4R5EA 1W1TA 4DT4A 1W9PA 4ZPVR 3ARZA 1BKFA 1W9VA 3PRAA 2F23A 4MPKA 3KCEA 1R9HA 4P8VA 4TW8A 1HKJA 1GPFA 3MDYB 5GPRA 4DRIA 3WD2A 4DWSB 1JNTA 4JFJA 4WJXA 2OLHA 4JYSA 1EDQA 5HKGA 3UQAA 3CHEA 1LL6A 4WKFA 3UQBA 2MNTA 3WQWA 1KFWA 4MGVA 1ZL1A 3FY1A 4TX0A 3TC5A 2M08A 2DG3A 1Q1CA 3B9AA 3UI5A 1E44A 5BXJA 5HW6A 4DRNA 1D7JA 1FKHA 2AWGA 1QPFA 3BMBA 2FKEA 2KGJA 4Z2KA 3IK8A 4Z2HA 4S3KA 1ROTA 1X6LA 1ZBKA 1HXVA 4WKAA 1XHGA 1XRVA 2KFWA 2IF4A 1RD6A 2QF8A 2O92A 1JCHB 1ROUA 4ODNA 1H0GA 4O2TA 4JFLA 5GPGA 3KABA 2ZR6A 2Y78A 4LGXA 4NZCA 3VAWA 3CZ8A 3O5OA 4QIBA 2MLXA 1F8AB 4DWSA 3O5MA 4GIVA 4KQZA 2XP9A 5DO2A 2XP4A 2G8ZA 3O5IA 2A3BA 4DRQA 3RGCA 2DT0A
chains in the Genus database with same CATH topology
4Q7NA 3JYMA 3O5QA 5HT1A 3BXWA 3CHDA 3RM8A 4IPXA 1FKFA 2F4EA 4DRHA 2F2DA 1W1VA 2ZQTA 4PTMA 2WLZA 3ARWA 3ARPA 2ZR5A 3TCZA 1NMWA 4ODPA 3KACA 4MNJA 1JNDA 1EHNA 4Z2GA 3ALFA 2DSWA 2O9OA 3IHZA 2MPHA 2PPOA 2ZQUA 4W9QA 3AS1A 1YW5A 1C9HA 4QT3A 5HWCA 4DRMA 1NWRA 1OWQA 2JZVA 4Z2IA 1P5QA 3KAGA 1E6ZA 2ITKA 2XP8A 1D7IA 3OOBA 2PBCA 1FKTA 1FKJA 2PV1A 4HBOA 3FAPA 1ZK6A 3KADA 2PV2A 5DF0A 4DROA 1HJVA 1LG1A 2G41A 4GGQA 4NSBA 3WD3A 4R0XA 3ARTA 1UR8A 4ZPWR 1TFVA 1VF8A 4URIA 2D9FA 1OGBA 5DEZA 4JFKA 1NSGA 3AS2A 1L1PA 5DIVA 3CHCA 3WD0A 2DT3A 4IT6A 3PR9A 3G6MA 3UI6A 2DG4A 4N19A 3IKGA 3ODKA 4ODMA 4Q22A 1JNEA 1LL7A 1FKIA 2AOSA 2RSEA 2ZQVA 1FJDA 3ARYA 5B8IC 1WNOA 4LAVA 1LL4A 4MAVA 3JXVA 3RM9A 3RMEA 5JH8A 2OFNA 4WIWA 3WL0A 4L3NA 2DG9A 1ITXA 3CGNA 2DT1A 3ARXA 2PV3A 2XP7A 3IKDA 4NNRA 1A7XA 1D6OA 5HWBA 4DWSC 4HBEA 2KR7A 2RQSA 1N1AA 4G50A 4MNMA 1E9LA 3O5RA 2N87A 4MNKA 2PI6A 4IQ2A 4ODKA 3WQVA 3FXYA 2B31A 2L2SA 3KAFA 5DITA 3CHFA 3TDBA 2WLYA 1W9UA 2DT2A 1CTNA 3PRBA 1HKKA 1HKMA 1PINA 1EIBA 4U84A 2YBTA 2DSVA 1H0IA 2KO7A 3ARRA 2Q5AA 2WK2A 1BL4A 5D75A 1NWTA 3I6CA 4IQCA 4ML4A 4XAKA 4AY1A 2IUZA 1KT1A 4WK9A 2LPVA 1FKSA 1HKIA 1O6IA 1OGGA 2WM0A 3ARSA 3KZ7A 1ZBVA 1NWSA 3WIJA 1E6NA 4FN2A 3ARVA 4MNLA 1FKDA 2FAPA 4Z2JA 4DWSD 4W9OA 5J6EA 1HJXA 2ESCA 1JVWA 4L72B 1W26A 1Q6HA 3PA7A 4S3JA 1W1YA 1JNSA 1SR0A 1T11A 2RUDA 1FAPA 3GPKA 1KT0A 2XP3A 1GOIA 2LJ4A 2VCDA 1J4HA 3RM4A 2KE0A 4ODRA 1U79A 1ZCNA 4LAYA 4TW6A 4MSPA 1GUVA 3AS3A 3NTPA 4W9PA 4HARA 3PRDA 1FKLA 4ODQA 3G6LA 3UQIA 2YBUA 5HTGA 1NH6A 4WKHA 5HBFA 1Q6IA 4ODLA 1E6RA 1UR9A 3O5LA 2K8IA 5HW8A 1ZBCA 3O5PA 3H9RB 4DZ3A 1FD9A 5GQBA 3KAIA 2MF9A 1FKBA 1W1PA 3QOKA 3O5GA 2UZ5A 1NMVA 1LQ0A 1J4IA 4MTVA 2RUQA 4ZS6A 2XPBA 2MLZA 1K9TA 3WD1A 1FFQA 3O5DA 1FKKA 4IT4A 4W5UA 4QT2A 3ALGA 4ODOA 2FDMA 2XPAA 3EY6A 2MLYA 2M1IA 1E15A 3CGMA 1NWUA 4J4NA 1QZ2A 2PPNA 3KAHA 2XP5A 4TNSA 3W4RA 3AQUA 4QZVB 1E6PA 3O5EA 1SYTA 4U85A 4FAPA 3AROA 3O5JA 3WH0A 1ZB5A 2DPEA 4KR0B 5DIUA 1IX5A 1QPLA 4TYOA 3ARQA 1J6YA 2LGOA 4Z2LA 3AS0A 1TCOC 2ZR4A 4P8XA 1FKGA 4JFIA 3NI6A 3B9DA 4DRPA 4DRJA 4G2PA 3O5KA 4JFMA 1ZBWA 4J4OA 1YATA 1Y0OA 2F21A 4BF8A 1PBKA 5I98A 4DH0A 1LJYA 4P8WA 2LKNA 3ARUA 1ZU8A 2ZQSA 2XP6A 3O5FA 3JYJA 3WD4A 1HJWA 1J4RA 3LUOA 1X6NA 5HUAA 2KI3A 2PPPA 1FFRA 1Q6UA 3B7XA 4C02B 4LAWA 4ZPTR 4LAXA 1B6CA 1D2KA 3WKZA 1EYMA 4ITZA 1F40A 4DZ2A 1WAWA 4DRKA 4TW7A 2A3EA 4DIPA 3RFWA 1M5YA 3NRKA 2DSUA 2M2AA 1LG2A 1EQ3A 4U86A 1D7HA 3B9EA 3CH9A 2DSZA 3WL1A 2A3AA 2RURA 3B8SA 3OA5A 5HW7A 2RUCA 2A3CA 2VN1A 4P8UA 1WB0A 3UI4A 1FKRA 3UF8A 4R5EA 1W1TA 4DT4A 1W9PA 4ZPVR 3ARZA 1BKFA 1W9VA 3PRAA 4MPKA 3KCEA 1R9HA 4P8VA 4TW8A 1HKJA 1GPFA 3MDYB 5GPRA 4DRIA 3WD2A 4DWSB 1JNTA 4JFJA 4WJXA 2OLHA 4JYSA 1EDQA 5HKGA 3UQAA 3CHEA 1LL6A 4WKFA 3UQBA 2MNTA 3WQWA 1KFWA 4MGVA 1ZL1A 3FY1A 4TX0A 3TC5A 2M08A 2DG3A 1Q1CA 3B9AA 3UI5A 5BXJA 5HW6A 4DRNA 1D7JA 1FKHA 2AWGA 1QPFA 2FKEA 2KGJA 4Z2KA 3IK8A 4Z2HA 4S3KA 1ROTA 1X6LA 1ZBKA 1HXVA 4WKAA 1XHGA 1XRVA 2KFWA 2IF4A 1RD6A 2QF8A 2O92A 1ROUA 4ODNA 1H0GA 4O2TA 4JFLA 5GPGA 3KABA 2ZR6A 2Y78A 4LGXA 4NZCA 3VAWA 3CZ8A 3O5OA 4QIBA 2MLXA 1F8AB 4DWSA 3O5MA 4GIVA 4KQZA 2XP9A 5DO2A 2XP4A 2G8ZA 3O5IA 2A3BA 4DRQA 3RGCA 2DT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODL A;  3O5L A;  4TW7 A;  2K8I A;  5HW8 A;  2DG9 A;  3CGN A;  4DIP A;  3RFW A;  1M5Y A;  2PV3 A;  2XP7 A;  3JYM A;  3NRK A;  3O5Q A;  3IKD A;  5HT1 A;  2M2A A;  3O5P A;  1EQ3 A;  3H9R B;  1A7X A;  1D6O A;  1D7H A;  1FD9 A;  4IPX A;  4NNR A;  4U86 A;  4DZ3 A;  5HWB A;  1FKF A;  3KAI A;  2F4E A;  4DRH A;  2F2D A;  2MF9 A;  2KR7 A;  1FKB A;  2RQS A;  1N1A A;  2UZ5 A;  3O5G A;  2RUR A;  2ZQT A;  4G50 A;  1NMV A;  1J4I A;  5HW7 A;  2RUC A;  2RUQ A;  3O5R A;  2N87 A;  2XPB A;  2VN1 A;  2ZR5 A;  4IQ2 A;  2MLZ A;  3TCZ A;  1NMW A;  4ODP A;  3O5D A;  4ODK A;  3KAC A;  1FKK A;  4QT2 A;  4ODO A;  5DIT A;  2L2S A;  3KAF A;  3UI4 A;  1FKR A;  2XPA A;  3TDB A;  3UF8 A;  3EY6 A;  2MLY A;  3IHZ A;  4DT4 A;  2MPH A;  2PPO A;  2M1I A;  3CGM A;  4J4N A;  2ZQU A;  1QZ2 A;  1BKF A;  2PPN A;  2XP5 A;  1YW5 A;  1C9H A;  3KAH A;  3PRB A;  4QT3 A;  4W9Q A;  5HWC A;  3KCE A;  1PIN A;  4U84 A;  1R9H A;  4DRM A;  2JZV A;  1P5Q A;  4TW8 A;  4TNS A;  3MDY B;  2KO7 A;  3O5E A;  3KAG A;  2Q5A A;  4U85 A;  4DRI A;  1BL4 A;  4FAP A;  2ITK A;  2XP8 A;  5D75 A;  1JNT A;  1D7I A;  4JFJ A;  3OOB A;  2PBC A;  1FKT A;  4JYS A;  3I6C A;  1FKJ A;  2PV1 A;  4IQC A;  5HKG A;  3O5J A;  3FAP A;  1ZK6 A;  1KT1 A;  2PV2 A;  2LPV A;  3KAD A;  3WH0 A;  4DRO A;  1FKS A;  3UQA A;  3UQB A;  3KZ7 A;  4GGQ A;  2MNT A;  5DIU A;  1QPL A;  4R0X A;  4ODN A;  4MGV A;  4TYO A;  4TX0 A;  1J6Y A;  3TC5 A;  2M08 A;  2DG3 A;  1Q1C A;  2LGO A;  1TCO C;  2ZR4 A;  4FN2 A;  1FKD A;  1FKG A;  4JFI A;  3UI5 A;  2FAP A;  3NI6 A;  4DRP A;  5BXJ A;  5HW6 A;  4W9O A;  4DRJ A;  5J6E A;  2D9F A;  4DRN A;  1D7J A;  1FKH A;  2AWG A;  3O5K A;  1QPF A;  4G2P A;  4JFM A;  2FKE A;  2KGJ A;  4J4O A;  1JVW A;  1YAT A;  3IK8 A;  4JFK A;  1ROT A;  1NSG A;  1W26 A;  1Q6H A;  1Y0O A;  2F21 A;  3PA7 A;  1L1P A;  5DIV A;  1JNS A;  4BF8 A;  1PBK A;  1T11 A;  2RUD A;  5I98 A;  1FAP A;  3GPK A;  1HXV A;  4DH0 A;  2KFW A;  2IF4 A;  1KT0 A;  2LKN A;  3UI6 A;  2DG4 A;  2ZQS A;  2XP6 A;  4N19 A;  2XP3 A;  3O5F A;  1ROU A;  3JYJ A;  3IKG A;  2LJ4 A;  2VCD A;  1J4H A;  3ODK A;  4O2T A;  2KE0 A;  1J4R A;  4JFL A;  4ODR A;  1U79 A;  1ZCN A;  3KAB A;  4LAY A;  4ODM A;  3LUO A;  2ZR6 A;  2Y78 A;  4TW6 A;  4MSP A;  5GPG A;  3VAW A;  1FKI A;  2RSE A;  2ZQV A;  5HUA A;  1FJD A;  2KI3 A;  5B8I C;  2PPP A;  3O5O A;  2MLX A;  1F8A B;  4QIB A;  1Q6U A;  3NTP A;  3B7X A;  4W9P A;  3O5M A;  3PRD A;  4GIV A;  1FKL A;  4C02 B;  4LAV A;  4ODQ A;  2XP9 A;  3UQI A;  4LAW A;  2XP4 A;  3O5I A;  4LAX A;  3JXV A;  5HTG A;  1B6C A;  4DRQ A;  1EYM A;  4ITZ A;  3RGC A;  1F40 A;  2OFN A;  4DZ2 A;  1Q6I A;  4DRK A; 
#chains in the Genus database with same CATH topology
 4Q7N A;  3JYM A;  3O5Q A;  5HT1 A;  3BXW A;  3CHD A;  3RM8 A;  4IPX A;  1FKF A;  2F4E A;  4DRH A;  2F2D A;  1W1V A;  2ZQT A;  4PTM A;  2WLZ A;  3ARW A;  3ARP A;  2ZR5 A;  3TCZ A;  1NMW A;  4ODP A;  3KAC A;  4MNJ A;  1JND A;  1EHN A;  4Z2G A;  3ALF A;  2DSW A;  2O9O A;  3IHZ A;  2MPH A;  2PPO A;  2ZQU A;  4W9Q A;  3AS1 A;  1YW5 A;  1C9H A;  4QT3 A;  5HWC A;  1GRJ A;  4DRM A;  1NWR A;  1OWQ A;  2JZV A;  4Z2I A;  1P5Q A;  2ETN A;  3KAG A;  1E6Z A;  2ITK A;  2XP8 A;  1D7I A;  3OOB A;  2PBC A;  1FKT A;  1FKJ A;  2PV1 A;  4HBO A;  3FAP A;  1ZK6 A;  3KAD A;  2PV2 A;  5DF0 A;  4DRO A;  1HJV A;  1LG1 A;  2G41 A;  4GGQ A;  4NSB A;  3WD3 A;  4R0X A;  3ART A;  1UR8 A;  4ZPW R;  1TFV A;  1VF8 A;  3EIP A;  4URI A;  2D9F A;  1OGB A;  5DEZ A;  4JFK A;  1NSG A;  3AS2 A;  1L1P A;  5DIV A;  3CHC A;  3WD0 A;  2DT3 A;  4IT6 A;  3PR9 A;  3G6M A;  3GTY X;  3UI6 A;  2DG4 A;  4N19 A;  3IKG A;  3ODK A;  4ODM A;  4Q22 A;  1JNE A;  1LL7 A;  1FKI A;  2AOS A;  2RSE A;  2ZQV A;  1FJD A;  3ARY A;  5B8I C;  1WNO A;  4LAV A;  1LL4 A;  4MAV A;  3JXV A;  3RM9 A;  3RME A;  5JH8 A;  2OFN A;  4WIW A;  3WL0 A;  4L3N A;  2DG9 A;  1ITX A;  3CGN A;  2DT1 A;  3ARX A;  3GU0 A;  2PV3 A;  2XP7 A;  3IKD A;  4NNR A;  1A7X A;  1D6O A;  5HWB A;  4DWS C;  4HBE A;  2KR7 A;  2RQS A;  1N1A A;  4G50 A;  4MNM A;  1E9L A;  3O5R A;  2N87 A;  4MNK A;  2PI6 A;  4IQ2 A;  4ODK A;  3WQV A;  3FXY A;  2B31 A;  2L2S A;  3KAF A;  5DIT A;  3CHF A;  3TDB A;  2WLY A;  1W9U A;  2DT2 A;  1CTN A;  3PRB A;  1HKK A;  1HKM A;  1PIN A;  1EIB A;  4U84 A;  2YBT A;  2DSV A;  1H0I A;  2KO7 A;  3ARR A;  2Q5A A;  2WK2 A;  1BL4 A;  5D75 A;  1NWT A;  3I6C A;  4IQC A;  4ML4 A;  4XAK A;  4AY1 A;  2IUZ A;  1KT1 A;  4WK9 A;  2LPV A;  4UDM A;  1FKS A;  1HKI A;  1O6I A;  1OGG A;  2WM0 A;  3ARS A;  3KZ7 A;  1ZBV A;  1NWS A;  3WIJ A;  1E6N A;  4FN2 A;  3ARV A;  4MNL A;  1FKD A;  2FAP A;  2PN0 A;  4Z2J A;  4DWS D;  4W9O A;  5J6E A;  1HJX A;  2ESC A;  1JVW A;  4L72 B;  1W26 A;  1Q6H A;  3PA7 A;  4S3J A;  1W1Y A;  1JNS A;  1SR0 A;  1T11 A;  2RUD A;  1FAP A;  3GPK A;  1KT0 A;  2B5U B;  2XP3 A;  1GOI A;  2LJ4 A;  2VCD A;  1J4H A;  3RM4 A;  2KE0 A;  4ODR A;  1U79 A;  1ZCN A;  4LAY A;  4TW6 A;  4MSP A;  1GUV A;  3AS3 A;  2P4V A;  3NTP A;  4W9P A;  4HAR A;  3PRD A;  1FKL A;  4ODQ A;  3G6L A;  3UQI A;  2YBU A;  5HTG A;  1NH6 A;  4WKH A;  5HBF A;  1Q6I A;  4ODL A;  1E6R A;  1UR9 A;  3O5L A;  2K8I A;  5HW8 A;  1ZBC A;  3O5P A;  3H9R B;  4DZ3 A;  1FD9 A;  5GQB A;  3KAI A;  2MF9 A;  1FKB A;  1W1P A;  3QOK A;  3O5G A;  2UZ5 A;  1NMV A;  1LQ0 A;  1J4I A;  4MTV A;  2RUQ A;  4ZS6 A;  2XPB A;  2MLZ A;  1K9T A;  3WD1 A;  1FFQ A;  3O5D A;  1FKK A;  4IT4 A;  4W5U A;  4QT2 A;  3ALG A;  4ODO A;  2FDM A;  2XPA A;  3EY6 A;  2MLY A;  2M1I A;  1E15 A;  3CGM A;  1NWU A;  4J4N A;  1QZ2 A;  2PPN A;  3KAH A;  2XP5 A;  4TNS A;  3W4R A;  3AQU A;  4QZV B;  1E6P A;  3O5E A;  1SYT A;  4U85 A;  4FAP A;  2EUL A;  3ARO A;  3O5J A;  3WH0 A;  1ZB5 A;  2DPE A;  4KR0 B;  5DIU A;  1IX5 A;  1QPL A;  4TYO A;  3ARQ A;  1J6Y A;  2LGO A;  4Z2L A;  3AS0 A;  1TCO C;  2ZR4 A;  4P8X A;  1FKG A;  4JFI A;  3NI6 A;  3B9D A;  4DRP A;  4DRJ A;  4G2P A;  3O5K A;  4JFM A;  1ZBW A;  4J4O A;  1YAT A;  1Y0O A;  2F21 A;  4BF8 A;  1PBK A;  5I98 A;  4DH0 A;  1LJY A;  4P8W A;  2LKN A;  3ARU A;  1ZU8 A;  2ZQS A;  2XP6 A;  3O5F A;  3JYJ A;  3WD4 A;  1HJW A;  1J4R A;  3LUO A;  1X6N A;  5HUA A;  2KI3 A;  2PPP A;  1FFR A;  1Q6U A;  3B7X A;  4C02 B;  4LAW A;  4ZPT R;  4LAX A;  1B6C A;  1D2K A;  3WKZ A;  1EYM A;  4ITZ A;  1F40 A;  4DZ2 A;  1WAW A;  4DRK A;  4TW7 A;  2A3E A;  4DIP A;  3RFW A;  1M5Y A;  3NRK A;  2DSU A;  2M2A A;  1LG2 A;  1EQ3 A;  4U86 A;  1D7H A;  3B9E A;  3CH9 A;  2DSZ A;  3WL1 A;  2A3A A;  2RUR A;  3B8S A;  3OA5 A;  5HW7 A;  2RUC A;  2A3C A;  2VN1 A;  4P8U A;  1WB0 A;  3UI4 A;  1FKR A;  3UF8 A;  4R5E A;  1W1T A;  4DT4 A;  1W9P A;  4ZPV R;  3ARZ A;  1BKF A;  1W9V A;  3PRA A;  2F23 A;  4MPK A;  3KCE A;  1R9H A;  4P8V A;  4TW8 A;  1HKJ A;  1GPF A;  3MDY B;  5GPR A;  4DRI A;  3WD2 A;  4DWS B;  1JNT A;  4JFJ A;  4WJX A;  2OLH A;  4JYS A;  1EDQ A;  5HKG A;  3UQA A;  3CHE A;  1LL6 A;  4WKF A;  3UQB A;  2MNT A;  3WQW A;  1KFW A;  4MGV A;  1ZL1 A;  3FY1 A;  4TX0 A;  3TC5 A;  2M08 A;  2DG3 A;  1Q1C A;  3B9A A;  3UI5 A;  1E44 A;  5BXJ A;  5HW6 A;  4DRN A;  1D7J A;  1FKH A;  2AWG A;  1QPF A;  3BMB A;  2FKE A;  2KGJ A;  4Z2K A;  3IK8 A;  4Z2H A;  4S3K A;  1ROT A;  1X6L A;  1ZBK A;  1HXV A;  4WKA A;  1XHG A;  1XRV A;  2KFW A;  2IF4 A;  1RD6 A;  2QF8 A;  2O92 A;  1JCH B;  1ROU A;  4ODN A;  1H0G A;  4O2T A;  4JFL A;  5GPG A;  3KAB A;  2ZR6 A;  2Y78 A;  4LGX A;  4NZC A;  3VAW A;  3CZ8 A;  3O5O A;  4QIB A;  2MLX A;  1F8A B;  4DWS A;  3O5M A;  4GIV A;  4KQZ A;  2XP9 A;  5DO2 A;  2XP4 A;  2G8Z A;  3O5I A;  2A3B A;  4DRQ A;  3RGC A;  2DT0 A; 
#chains in the Genus database with same CATH homology
 4Q7N A;  3JYM A;  3O5Q A;  5HT1 A;  3BXW A;  3CHD A;  3RM8 A;  4IPX A;  1FKF A;  2F4E A;  4DRH A;  2F2D A;  1W1V A;  2ZQT A;  4PTM A;  2WLZ A;  3ARW A;  3ARP A;  2ZR5 A;  3TCZ A;  1NMW A;  4ODP A;  3KAC A;  4MNJ A;  1JND A;  1EHN A;  4Z2G A;  3ALF A;  2DSW A;  2O9O A;  3IHZ A;  2MPH A;  2PPO A;  2ZQU A;  4W9Q A;  3AS1 A;  1YW5 A;  1C9H A;  4QT3 A;  5HWC A;  4DRM A;  1NWR A;  1OWQ A;  2JZV A;  4Z2I A;  1P5Q A;  3KAG A;  1E6Z A;  2ITK A;  2XP8 A;  1D7I A;  3OOB A;  2PBC A;  1FKT A;  1FKJ A;  2PV1 A;  4HBO A;  3FAP A;  1ZK6 A;  3KAD A;  2PV2 A;  5DF0 A;  4DRO A;  1HJV A;  1LG1 A;  2G41 A;  4GGQ A;  4NSB A;  3WD3 A;  4R0X A;  3ART A;  1UR8 A;  4ZPW R;  1TFV A;  1VF8 A;  4URI A;  2D9F A;  1OGB A;  5DEZ A;  4JFK A;  1NSG A;  3AS2 A;  1L1P A;  5DIV A;  3CHC A;  3WD0 A;  2DT3 A;  4IT6 A;  3PR9 A;  3G6M A;  3UI6 A;  2DG4 A;  4N19 A;  3IKG A;  3ODK A;  4ODM A;  4Q22 A;  1JNE A;  1LL7 A;  1FKI A;  2AOS A;  2RSE A;  2ZQV A;  1FJD A;  3ARY A;  5B8I C;  1WNO A;  4LAV A;  1LL4 A;  4MAV A;  3JXV A;  3RM9 A;  3RME A;  5JH8 A;  2OFN A;  4WIW A;  3WL0 A;  4L3N A;  2DG9 A;  1ITX A;  3CGN A;  2DT1 A;  3ARX A;  2PV3 A;  2XP7 A;  3IKD A;  4NNR A;  1A7X A;  1D6O A;  5HWB A;  4DWS C;  4HBE A;  2KR7 A;  2RQS A;  1N1A A;  4G50 A;  4MNM A;  1E9L A;  3O5R A;  2N87 A;  4MNK A;  2PI6 A;  4IQ2 A;  4ODK A;  3WQV A;  3FXY A;  2B31 A;  2L2S A;  3KAF A;  5DIT A;  3CHF A;  3TDB A;  2WLY A;  1W9U A;  2DT2 A;  1CTN A;  3PRB A;  1HKK A;  1HKM A;  1PIN A;  1EIB A;  4U84 A;  2YBT A;  2DSV A;  1H0I A;  2KO7 A;  3ARR A;  2Q5A A;  2WK2 A;  1BL4 A;  5D75 A;  1NWT A;  3I6C A;  4IQC A;  4ML4 A;  4XAK A;  4AY1 A;  2IUZ A;  1KT1 A;  4WK9 A;  2LPV A;  1FKS A;  1HKI A;  1O6I A;  1OGG A;  2WM0 A;  3ARS A;  3KZ7 A;  1ZBV A;  1NWS A;  3WIJ A;  1E6N A;  4FN2 A;  3ARV A;  4MNL A;  1FKD A;  2FAP A;  4Z2J A;  4DWS D;  4W9O A;  5J6E A;  1HJX A;  2ESC A;  1JVW A;  4L72 B;  1W26 A;  1Q6H A;  3PA7 A;  4S3J A;  1W1Y A;  1JNS A;  1SR0 A;  1T11 A;  2RUD A;  1FAP A;  3GPK A;  1KT0 A;  2XP3 A;  1GOI A;  2LJ4 A;  2VCD A;  1J4H A;  3RM4 A;  2KE0 A;  4ODR A;  1U79 A;  1ZCN A;  4LAY A;  4TW6 A;  4MSP A;  1GUV A;  3AS3 A;  3NTP A;  4W9P A;  4HAR A;  3PRD A;  1FKL A;  4ODQ A;  3G6L A;  3UQI A;  2YBU A;  5HTG A;  1NH6 A;  4WKH A;  5HBF A;  1Q6I A;  4ODL A;  1E6R A;  1UR9 A;  3O5L A;  2K8I A;  5HW8 A;  1ZBC A;  3O5P A;  3H9R B;  4DZ3 A;  1FD9 A;  5GQB A;  3KAI A;  2MF9 A;  1FKB A;  1W1P A;  3QOK A;  3O5G A;  2UZ5 A;  1NMV A;  1LQ0 A;  1J4I A;  4MTV A;  2RUQ A;  4ZS6 A;  2XPB A;  2MLZ A;  1K9T A;  3WD1 A;  1FFQ A;  3O5D A;  1FKK A;  4IT4 A;  4W5U A;  4QT2 A;  3ALG A;  4ODO A;  2FDM A;  2XPA A;  3EY6 A;  2MLY A;  2M1I A;  1E15 A;  3CGM A;  1NWU A;  4J4N A;  1QZ2 A;  2PPN A;  3KAH A;  2XP5 A;  4TNS A;  3W4R A;  3AQU A;  4QZV B;  1E6P A;  3O5E A;  1SYT A;  4U85 A;  4FAP A;  3ARO A;  3O5J A;  3WH0 A;  1ZB5 A;  2DPE A;  4KR0 B;  5DIU A;  1IX5 A;  1QPL A;  4TYO A;  3ARQ A;  1J6Y A;  2LGO A;  4Z2L A;  3AS0 A;  1TCO C;  2ZR4 A;  4P8X A;  1FKG A;  4JFI A;  3NI6 A;  3B9D A;  4DRP A;  4DRJ A;  4G2P A;  3O5K A;  4JFM A;  1ZBW A;  4J4O A;  1YAT A;  1Y0O A;  2F21 A;  4BF8 A;  1PBK A;  5I98 A;  4DH0 A;  1LJY A;  4P8W A;  2LKN A;  3ARU A;  1ZU8 A;  2ZQS A;  2XP6 A;  3O5F A;  3JYJ A;  3WD4 A;  1HJW A;  1J4R A;  3LUO A;  1X6N A;  5HUA A;  2KI3 A;  2PPP A;  1FFR A;  1Q6U A;  3B7X A;  4C02 B;  4LAW A;  4ZPT R;  4LAX A;  1B6C A;  1D2K A;  3WKZ A;  1EYM A;  4ITZ A;  1F40 A;  4DZ2 A;  1WAW A;  4DRK A;  4TW7 A;  2A3E A;  4DIP A;  3RFW A;  1M5Y A;  3NRK A;  2DSU A;  2M2A A;  1LG2 A;  1EQ3 A;  4U86 A;  1D7H A;  3B9E A;  3CH9 A;  2DSZ A;  3WL1 A;  2A3A A;  2RUR A;  3B8S A;  3OA5 A;  5HW7 A;  2RUC A;  2A3C A;  2VN1 A;  4P8U A;  1WB0 A;  3UI4 A;  1FKR A;  3UF8 A;  4R5E A;  1W1T A;  4DT4 A;  1W9P A;  4ZPV R;  3ARZ A;  1BKF A;  1W9V A;  3PRA A;  4MPK A;  3KCE A;  1R9H A;  4P8V A;  4TW8 A;  1HKJ A;  1GPF A;  3MDY B;  5GPR A;  4DRI A;  3WD2 A;  4DWS B;  1JNT A;  4JFJ A;  4WJX A;  2OLH A;  4JYS A;  1EDQ A;  5HKG A;  3UQA A;  3CHE A;  1LL6 A;  4WKF A;  3UQB A;  2MNT A;  3WQW A;  1KFW A;  4MGV A;  1ZL1 A;  3FY1 A;  4TX0 A;  3TC5 A;  2M08 A;  2DG3 A;  1Q1C A;  3B9A A;  3UI5 A;  5BXJ A;  5HW6 A;  4DRN A;  1D7J A;  1FKH A;  2AWG A;  1QPF A;  2FKE A;  2KGJ A;  4Z2K A;  3IK8 A;  4Z2H A;  4S3K A;  1ROT A;  1X6L A;  1ZBK A;  1HXV A;  4WKA A;  1XHG A;  1XRV A;  2KFW A;  2IF4 A;  1RD6 A;  2QF8 A;  2O92 A;  1ROU A;  4ODN A;  1H0G A;  4O2T A;  4JFL A;  5GPG A;  3KAB A;  2ZR6 A;  2Y78 A;  4LGX A;  4NZC A;  3VAW A;  3CZ8 A;  3O5O A;  4QIB A;  2MLX A;  1F8A B;  4DWS A;  3O5M A;  4GIV A;  4KQZ A;  2XP9 A;  5DO2 A;  2XP4 A;  2G8Z A;  3O5I A;  2A3B A;  4DRQ A;  3RGC A;  2DT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...