2RSEA

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rseA00
4O2TA 2XPBA 4DZ2A 1QPLA 3IK8A 2ZR4A 3PRBA 4DRQA 1J4HA 1FKGA 2RSEA 2XP3A 4ODRA 4LAWA 4BF8A 2UZ5A 1ZK6A 3UI4A 3I6CA 2MF9A 1KT0A 2KFWA 2XP8A 3MDYB 4MGVA 2OFNA 3NI6A 3KADA 3PA7A 3UQBA 2MPHA 2ZQSA 1KT1A 4TX0A 1FKJA 1D7HA 3KAFA 2PV2A 1FAPA 2RUCA 3O5RA 2N87A 4IQ2A 1FKRA 3TC5A 2KR7A 1D7IA 1EQ3A 2MLZA 3CGMA 4W9OA 1FKSA 3O5MA 5HTGA 1N1AA 3IKGA 2DG4A 3B7XA 3O5EA 2PBCA 1PINA 5DIUA 2Y78A 4GGQA 5DITA 1J6YA 4TYOA 2FKEA 4DRKA 2RUQA 1FD9A 2VN1A 4J4NA 1P5QA 1NMVA 3LUOA 4TNSA 2KGJA 3H9RB 4LAVA 3NTPA 2LJ4A 3CGNA 2ZQVA 4JFJA 4MSPA 3GPKA 1D7JA 2RQSA 1FKFA 3UQAA 1U79A 5HW8A 3O5LA 1W26A 3PRDA 1TCOC 3IKDA 2IF4A 2AWGA 4DT4A 4JYSA 5HWBA 3O5OA 1R9HA 1QZ2A 2XP5A 4ODKA 2DG3A 2PPNA 3JYJA 3O5KA 2XP4A 3JYMA 2PPPA 1A7XA 2JZVA 3FAPA 1NSGA 2RURA 4TW7A 1BL4A 4IQCA 3O5PA 3UI6A 4DRNA 4U84A 3O5QA 5HKGA 1Q6UA 1T11A 4DRPA 1L1PA 1FJDA 2RUDA 2L2SA 3ODKA 4QIBA 3KACA 4FN2A 4GIVA 4U85A 5GPGA 3TCZA 5HW6A 5HW7A 1ZCNA 2LGOA 2LPVA 3KAIA 1BKFA 1FKDA 2ITKA 4JFIA 2LKNA 2XP6A 4G50A 3NRKA 2ZR6A 4FAPA 3KAHA 3KZ7A 1YW5A 2KO7A 3RGCA 2XP7A 2XP9A 5HWCA 2D9FA 4JFLA 2MLXA 5I98A 4ODLA 5D75A 1FKHA 1EYMA 2VCDA 1JVWA 5J6EA 1NMWA 1PBKA 2PPOA 2ZR5A 2DG9A 3OOBA 5DIVA 1Y0OA 3VAWA 3UQIA 4DIPA 1J4RA 3EY6A 4DRMA 4DRHA 2PV3A 1F40A 2F2DA 1C9HA 1FKTA 2M08A 4LAYA 5HUAA 4W9QA 2PV1A 2ZQUA 4DROA 3O5GA 3KAGA 5HT1A 1YATA 4R0XA 3UF8A 4DRIA 4DZ3A 3KCEA 1Q6HA 4NNRA 3RFWA 4TW8A 2MNTA 1Q1CA 5B8IC 4DRJA 4C02B 4DH0A 1M5YA 1JNTA 1QPFA 2FAPA 4ODMA 5BXJA 1D6OA 4JFKA 1J4IA 3WH0A 4TW6A 2M1IA 1FKKA 4J4OA 4U86A 1JNSA 2XPAA 1B6CA 2M2AA 1FKIA 2F4EA 2Q5AA 3IHZA 3O5DA 3TDBA 2MLYA 4G2PA 3JXVA 4QT2A 4JFMA 4LAXA 1FKLA 3O5JA 3UI5A 1Q6IA 4ODNA 4N19A 4ODPA 1FKBA 1ROTA 4IPXA 4QT3A 1ROUA 2KE0A 4W9PA 3KABA 2K8IA 2KI3A 4ITZA 4ODOA 1F8AB 2ZQTA 1HXVA 3O5FA 4ODQA 2F21A 3O5IA
chains in the Genus database with same CATH superfamily
3WQVA 4DRQA 1J4HA 3ALGA 3UI4A 3WD2A 3I6CA 2KFWA 4MGVA 3MDYB 3KADA 4TX0A 1W1TA 4IQ2A 3O5RA 1W1PA 4P8VA 1VF8A 5HTGA 2ETNA 4DWSD 1WB0A 5DITA 2FKEA 1P5QA 4TNSA 4LAVA 2LJ4A 1D7JA 1EHNA 3B9EA 4HARA 1HJXA 4DT4A 5HWBA 2AWGA 3CZ8A 1NWRA 3O5KA 3WD1A 2RURA 1HKKA 1BL4A 4KR0B 4U84A 1Q6UA 2RUDA 3FXYA 4QIBA 5GPGA 3RM9A 5HUAA 1HJWA 2LPVA 4MNKA 1LL4A 1FKDA 1ITXA 3B9DA 2ITKA 3AS3A 4P8WA 4W5UA 2ZR6A 3RGCA 3W4RA 1JCHB 5HWCA 5HBFA 4ODLA 5D75A 1LG2A 2PPOA 2DG9A 4DIPA 1J4RA 2DT0A 4DRHA 2M08A 1FKTA 4ZPVR 4MNJA 2ZQUA 4DRIA 1YATA 2OLHA 4DZ3A 1NWUA 4NNRA 2A3AA 1QPFA 1JNTA 2FAPA 1J4IA 3ARWA 3WD0A 4J4OA 1W9UA 5DF0A 2XPAA 4MAVA 4MNLA 2Q5AA 3IHZA 4DWSB 4LAXA 1LG1A 4S3JA 2KE0A 3KABA 4HBEA 4ITZA 2A3CA 1LL7A 3IK8A 3PRBA 1FKGA 2A3EA 4LAWA 1EDQA 1E44A 1KT0A 2XP8A 4MTVA 3PA7A 3UQBA 2ZQSA 1KT1A 1E6PA 3ALFA 1FAPA 1FKRA 3CHFA 1D7IA 2MLZA 4W9OA 1FKSA 3IKGA 3O5EA 2PBCA 2Y78A 4GGQA 2EULA 3RM8A 1FD9A 1NH6A 4LGXA 3PR9A 1NMVA 3WL0A 1WNOA 1UR9A 3GPKA 4MNMA 3BMBA 1E6NA 1FKFA 1NWTA 1HKMA 4MPKA 2WLYA 2DSZA 3AQUA 3AROA 4AY1A 3O5LA 1W26A 1R9HA 1QZ2A 2XP5A 4ODKA 2A3BA 2PPNA 2XP4A 2PPPA 3FAPA 1NSGA 2O9OA 1RD6A 4IQCA 4IT6A 1L1PA 1T11A 4ZPTR 4U85A 3KACA 4FN2A 3ARTA 4DWSC 3PRAA 1BKFA 3ARZA 3NRKA 3KAHA 2XP7A 2XP9A 2WLZA 2D9FA 4JFLA 2DSVA 1W9PA 1FKHA 2O92A 5J6EA 1D2KA 2ZR5A 3UQAA 3RM4A 1Y0OA 5GPRA 3WD4A 1C9HA 4Z2JA 3O5GA 1GOIA 4IT4A 1UR8A 2YBTA 3KCEA 4Q7NA 1ZU8A 4Z2IA 4WKHA 1W1VA 3OA5A 2B5UB 3WQWA 4DH0A 1M5YA 1X6NA 5BXJA 1D6OA 4JFKA 1FFQA 2M1IA 1FKKA 3WIJA 1E6RA 1ZBVA 2ESCA 3O5DA 2DSUA 4JFMA 3O5JA 1HJVA 2DSWA 4ODNA 4WIWA 5JH8A 2IUZA 2G8ZA 3ARPA 4W9PA 3ARQA 4L72B 2K8IA 4ODOA 2ZQTA 1JNDA 1HXVA 3G6LA 4ODQA 2F21A 5DIVA 3ARXA 4O2TA 4DZ2A 3ARUA 2ZR4A 2RSEA 2XP3A 2UZ5A 4Z2KA 2MF9A 3EIPA 1ZB5A 3NI6A 1O6IA 1D7HA 2PV2A 3G6MA 2N87A 4WKAA 2KR7A 3CHDA 3CGMA 1X6LA 3GU0A 3O5MA 3QOKA 3B7XA 1PINA 1J6YA 4TYOA 1OGBA 3LUOA 1KFWA 4JFJA 4MSPA 3CGNA 2ZQVA 4NSBA 1GPFA 5DEZA 1XRVA 4NZCA 4JYSA 3O5OA 3GTYX 3B8SA 3JYJA 3ARRA 4TW7A 5HKGA 1JNSA 3WKZA 3O5PA 3UI6A 3WD3A 1ZBCA 1FJDA 2L2SA 3ODKA 1ZCNA 1K9TA 2DT1A 2XP6A 4G50A 4FAPA 1YW5A 4P8UA 4ZPWR 3BXWA 3ARYA 2MLXA 4P8XA 5I98A 1EYMA 2VCDA 1JVWA 3VAWA 3OOBA 2DT2A 4DRMA 3UQIA 3EY6A 1F40A 2PV3A 2F2DA 1OGGA 4LAYA 3KAGA 5HT1A 3UF8A 1TFVA 1Q6HA 3RFWA 3AS2A 1OWQA 2MNTA 1XHGA 1Q1CA 1JNEA 1NWSA 3WH0A 4TW6A 3AS0A 1HKJA 2F23A 1FKIA 1E6ZA 2F4EA 5DO2A 4QT2A 1FKLA 4N19A 4KQZA 1E15A 4ODPA 1FKBA 4QT3A 3WL1A 1ROUA 2KI3A 4DWSA 3O5FA 2XPBA 1SR0A 2DT3A 1QPLA 1LJYA 1W9VA 1EIBA 1H0IA 3CHEA 4ODRA 4R5EA 4BF8A 1ZK6A 2PN0A 2OFNA 2WM0A 4WKFA 2MPHA 4WK9A 1FKJA 2DPEA 3KAFA 2RUCA 3TC5A 1EQ3A 2AOSA 4L3NA 1N1AA 2DG4A 5DIUA 4DRKA 2RUQA 2VN1A 4J4NA 2QF8A 1GRJA 2KGJA 1ZBKA 3H9RB 3NTPA 1CTNA 2RQSA 1IX5A 2FDMA 1U79A 5HW8A 1HKIA 3PRDA 1TCOC 3IKDA 1LQ0A 2IF4A 2DG3A 2G41A 3JYMA 1A7XA 2JZVA 2PI6A 4DRNA 4UDMA 3O5QA 3ARVA 4DRPA 3B9AA 4GIVA 5HW6A 3TCZA 5HW7A 2LGOA 4ML4A 3KAIA 4JFIA 2LKNA 1WAWA 3RMEA 3KZ7A 2KO7A 3FY1A 4PTMA 3CHCA 4ZS6A 2YBUA 1W1YA 1NMWA 1PBKA 4DRJA 4WJXA 4W9QA 2PV1A 4DROA 4R0XA 4URIA 4TW8A 3ARSA 4Z2GA 5B8IC 4C02B 1GUVA 4XAKA 2P4VA 4ODMA 4U86A 1E9LA 1ZL1A 4Q22A 3AS1A 1B6CA 2M2AA 1FFRA 1ZBWA 2WK2A 3TDBA 2B31A 4Z2LA 2MLYA 4G2PA 3JXVA 1H0GA 4HBOA 3UI5A 1Q6IA 1SYTA 1ROTA 4IPXA 4Z2HA 4QZVB 3CH9A 1LL6A 4S3KA 5GQBA 1F8AB 3O5IA
chains in the Genus database with same CATH topology
3WQVA 4DRQA 1J4HA 3ALGA 3UI4A 3WD2A 3I6CA 2KFWA 4MGVA 3MDYB 3KADA 4TX0A 1W1TA 4IQ2A 3O5RA 1W1PA 4P8VA 1VF8A 5HTGA 4DWSD 1WB0A 5DITA 2FKEA 1P5QA 4TNSA 4LAVA 2LJ4A 1D7JA 1EHNA 3B9EA 4HARA 1HJXA 4DT4A 5HWBA 2AWGA 3CZ8A 1NWRA 3O5KA 3WD1A 2RURA 1HKKA 1BL4A 4KR0B 4U84A 1Q6UA 2RUDA 3FXYA 4QIBA 5GPGA 3RM9A 5HUAA 1HJWA 2LPVA 4MNKA 1LL4A 1FKDA 1ITXA 3B9DA 2ITKA 3AS3A 4P8WA 4W5UA 2ZR6A 3RGCA 3W4RA 5HWCA 5HBFA 4ODLA 5D75A 1LG2A 2PPOA 2DG9A 4DIPA 1J4RA 2DT0A 4DRHA 2M08A 1FKTA 4ZPVR 4MNJA 2ZQUA 4DRIA 1YATA 2OLHA 4DZ3A 1NWUA 4NNRA 2A3AA 1QPFA 1JNTA 2FAPA 1J4IA 3ARWA 3WD0A 4J4OA 1W9UA 5DF0A 2XPAA 4MAVA 4MNLA 2Q5AA 3IHZA 4DWSB 4LAXA 1LG1A 4S3JA 2KE0A 3KABA 4HBEA 4ITZA 2A3CA 1LL7A 3IK8A 3PRBA 1FKGA 2A3EA 4LAWA 1EDQA 1KT0A 2XP8A 4MTVA 3PA7A 3UQBA 2ZQSA 1KT1A 1E6PA 3ALFA 1FAPA 1FKRA 3CHFA 1D7IA 2MLZA 4W9OA 1FKSA 3IKGA 3O5EA 2PBCA 2Y78A 4GGQA 3RM8A 1FD9A 1NH6A 4LGXA 3PR9A 1NMVA 3WL0A 1WNOA 1UR9A 3GPKA 4MNMA 1E6NA 1FKFA 1NWTA 1HKMA 4MPKA 2WLYA 2DSZA 3AQUA 3AROA 4AY1A 3O5LA 1W26A 1R9HA 1QZ2A 2XP5A 4ODKA 2A3BA 2PPNA 2XP4A 2PPPA 3FAPA 1NSGA 2O9OA 1RD6A 4IQCA 4IT6A 1L1PA 1T11A 4ZPTR 4U85A 3KACA 4FN2A 3ARTA 4DWSC 3PRAA 1BKFA 3ARZA 3NRKA 3KAHA 2XP7A 2XP9A 2WLZA 2D9FA 4JFLA 2DSVA 1W9PA 1FKHA 2O92A 5J6EA 1D2KA 2ZR5A 3UQAA 3RM4A 1Y0OA 5GPRA 3WD4A 1C9HA 4Z2JA 3O5GA 1GOIA 4IT4A 1UR8A 2YBTA 3KCEA 4Q7NA 1ZU8A 4Z2IA 4WKHA 1W1VA 3OA5A 3WQWA 4DH0A 1M5YA 1X6NA 5BXJA 1D6OA 4JFKA 1FFQA 2M1IA 1FKKA 3WIJA 1E6RA 1ZBVA 2ESCA 3O5DA 2DSUA 4JFMA 3O5JA 1HJVA 2DSWA 4ODNA 4WIWA 5JH8A 2IUZA 2G8ZA 3ARPA 4W9PA 3ARQA 4L72B 2K8IA 4ODOA 2ZQTA 1JNDA 1HXVA 3G6LA 4ODQA 2F21A 5DIVA 3ARXA 4O2TA 4DZ2A 3ARUA 2ZR4A 2RSEA 2XP3A 2UZ5A 4Z2KA 2MF9A 1ZB5A 3NI6A 1O6IA 1D7HA 2PV2A 3G6MA 2N87A 4WKAA 2KR7A 3CHDA 3CGMA 1X6LA 3O5MA 3QOKA 3B7XA 1PINA 1J6YA 4TYOA 1OGBA 3LUOA 1KFWA 4JFJA 4MSPA 3CGNA 2ZQVA 4NSBA 1GPFA 5DEZA 1XRVA 4NZCA 4JYSA 3O5OA 3B8SA 3JYJA 3ARRA 4TW7A 5HKGA 1JNSA 3WKZA 3O5PA 3UI6A 3WD3A 1ZBCA 1FJDA 2L2SA 3ODKA 1ZCNA 1K9TA 2DT1A 2XP6A 4G50A 4FAPA 1YW5A 4P8UA 4ZPWR 3BXWA 3ARYA 2MLXA 4P8XA 5I98A 1EYMA 2VCDA 1JVWA 3VAWA 3OOBA 2DT2A 4DRMA 3UQIA 3EY6A 1F40A 2PV3A 2F2DA 1OGGA 4LAYA 3KAGA 5HT1A 3UF8A 1TFVA 1Q6HA 3RFWA 3AS2A 1OWQA 2MNTA 1XHGA 1Q1CA 1JNEA 1NWSA 3WH0A 4TW6A 3AS0A 1HKJA 1FKIA 1E6ZA 2F4EA 5DO2A 4QT2A 1FKLA 4N19A 4KQZA 1E15A 4ODPA 1FKBA 4QT3A 3WL1A 1ROUA 2KI3A 4DWSA 3O5FA 2XPBA 1SR0A 2DT3A 1QPLA 1LJYA 1W9VA 1EIBA 1H0IA 3CHEA 4ODRA 4R5EA 4BF8A 1ZK6A 2OFNA 2WM0A 4WKFA 2MPHA 4WK9A 1FKJA 2DPEA 3KAFA 2RUCA 3TC5A 1EQ3A 2AOSA 4L3NA 1N1AA 2DG4A 5DIUA 4DRKA 2RUQA 2VN1A 4J4NA 2QF8A 2KGJA 1ZBKA 3H9RB 3NTPA 1CTNA 2RQSA 1IX5A 2FDMA 1U79A 5HW8A 1HKIA 3PRDA 1TCOC 3IKDA 1LQ0A 2IF4A 2DG3A 2G41A 3JYMA 1A7XA 2JZVA 2PI6A 4DRNA 3O5QA 3ARVA 4DRPA 3B9AA 4GIVA 5HW6A 3TCZA 5HW7A 2LGOA 4ML4A 3KAIA 4JFIA 2LKNA 1WAWA 3RMEA 3KZ7A 2KO7A 3FY1A 4PTMA 3CHCA 4ZS6A 2YBUA 1W1YA 1NMWA 1PBKA 4DRJA 4WJXA 4W9QA 2PV1A 4DROA 4R0XA 4URIA 4TW8A 3ARSA 4Z2GA 5B8IC 4C02B 1GUVA 4XAKA 4ODMA 4U86A 1E9LA 1ZL1A 4Q22A 3AS1A 1B6CA 2M2AA 1FFRA 1ZBWA 2WK2A 3TDBA 2B31A 4Z2LA 2MLYA 4G2PA 3JXVA 1H0GA 4HBOA 3UI5A 1Q6IA 1SYTA 1ROTA 4IPXA 4Z2HA 4QZVB 3CH9A 1LL6A 4S3KA 5GQBA 1F8AB 3O5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2T A;  2XPB A;  4DZ2 A;  1QPL A;  3IK8 A;  2ZR4 A;  3PRB A;  4DRQ A;  1J4H A;  1FKG A;  2RSE A;  2XP3 A;  4ODR A;  4LAW A;  4BF8 A;  2UZ5 A;  1ZK6 A;  3UI4 A;  3I6C A;  2MF9 A;  1KT0 A;  2KFW A;  2XP8 A;  3MDY B;  4MGV A;  2OFN A;  3NI6 A;  3KAD A;  3PA7 A;  3UQB A;  2MPH A;  2ZQS A;  1KT1 A;  4TX0 A;  1FKJ A;  1D7H A;  3KAF A;  2PV2 A;  1FAP A;  2RUC A;  3O5R A;  2N87 A;  4IQ2 A;  1FKR A;  3TC5 A;  2KR7 A;  1D7I A;  1EQ3 A;  2MLZ A;  3CGM A;  4W9O A;  1FKS A;  3O5M A;  5HTG A;  1N1A A;  3IKG A;  2DG4 A;  3B7X A;  3O5E A;  2PBC A;  1PIN A;  5DIU A;  2Y78 A;  4GGQ A;  5DIT A;  1J6Y A;  4TYO A;  2FKE A;  4DRK A;  2RUQ A;  1FD9 A;  2VN1 A;  4J4N A;  1P5Q A;  1NMV A;  3LUO A;  4TNS A;  2KGJ A;  3H9R B;  4LAV A;  3NTP A;  2LJ4 A;  3CGN A;  2ZQV A;  4JFJ A;  4MSP A;  3GPK A;  1D7J A;  2RQS A;  1FKF A;  3UQA A;  1U79 A;  5HW8 A;  3O5L A;  1W26 A;  3PRD A;  1TCO C;  3IKD A;  2IF4 A;  2AWG A;  4DT4 A;  4JYS A;  5HWB A;  3O5O A;  1R9H A;  1QZ2 A;  2XP5 A;  4ODK A;  2DG3 A;  2PPN A;  3JYJ A;  3O5K A;  2XP4 A;  3JYM A;  2PPP A;  1A7X A;  2JZV A;  3FAP A;  1NSG A;  2RUR A;  4TW7 A;  1BL4 A;  4IQC A;  3O5P A;  3UI6 A;  4DRN A;  4U84 A;  3O5Q A;  5HKG A;  1Q6U A;  1T11 A;  4DRP A;  1L1P A;  1FJD A;  2RUD A;  2L2S A;  3ODK A;  4QIB A;  3KAC A;  4FN2 A;  4GIV A;  4U85 A;  5GPG A;  3TCZ A;  5HW6 A;  5HW7 A;  1ZCN A;  2LGO A;  2LPV A;  3KAI A;  1BKF A;  1FKD A;  2ITK A;  4JFI A;  2LKN A;  2XP6 A;  4G50 A;  3NRK A;  2ZR6 A;  4FAP A;  3KAH A;  3KZ7 A;  1YW5 A;  2KO7 A;  3RGC A;  2XP7 A;  2XP9 A;  5HWC A;  2D9F A;  4JFL A;  2MLX A;  5I98 A;  4ODL A;  5D75 A;  1FKH A;  1EYM A;  2VCD A;  1JVW A;  5J6E A;  1NMW A;  1PBK A;  2PPO A;  2ZR5 A;  2DG9 A;  3OOB A;  5DIV A;  1Y0O A;  3VAW A;  3UQI A;  4DIP A;  1J4R A;  3EY6 A;  4DRM A;  4DRH A;  2PV3 A;  1F40 A;  2F2D A;  1C9H A;  1FKT A;  2M08 A;  4LAY A;  5HUA A;  4W9Q A;  2PV1 A;  2ZQU A;  4DRO A;  3O5G A;  3KAG A;  5HT1 A;  1YAT A;  4R0X A;  3UF8 A;  4DRI A;  4DZ3 A;  3KCE A;  1Q6H A;  4NNR A;  3RFW A;  4TW8 A;  2MNT A;  1Q1C A;  5B8I C;  4DRJ A;  4C02 B;  4DH0 A;  1M5Y A;  1JNT A;  1QPF A;  2FAP A;  4ODM A;  5BXJ A;  1D6O A;  4JFK A;  1J4I A;  3WH0 A;  4TW6 A;  2M1I A;  1FKK A;  4J4O A;  4U86 A;  1JNS A;  2XPA A;  1B6C A;  2M2A A;  1FKI A;  2F4E A;  2Q5A A;  3IHZ A;  3O5D A;  3TDB A;  2MLY A;  4G2P A;  3JXV A;  4QT2 A;  4JFM A;  4LAX A;  1FKL A;  3O5J A;  3UI5 A;  1Q6I A;  4ODN A;  4N19 A;  4ODP A;  1FKB A;  1ROT A;  4IPX A;  4QT3 A;  1ROU A;  2KE0 A;  4W9P A;  3KAB A;  2K8I A;  2KI3 A;  4ITZ A;  4ODO A;  1F8A B;  2ZQT A;  1HXV A;  3O5F A;  4ODQ A;  2F21 A;  3O5I A; 
#chains in the Genus database with same CATH topology
 3WQV A;  4DRQ A;  1J4H A;  3ALG A;  3UI4 A;  3WD2 A;  3I6C A;  2KFW A;  4MGV A;  3MDY B;  3KAD A;  4TX0 A;  1W1T A;  4IQ2 A;  3O5R A;  1W1P A;  4P8V A;  1VF8 A;  5HTG A;  2ETN A;  4DWS D;  1WB0 A;  5DIT A;  2FKE A;  1P5Q A;  4TNS A;  4LAV A;  2LJ4 A;  1D7J A;  1EHN A;  3B9E A;  4HAR A;  1HJX A;  4DT4 A;  5HWB A;  2AWG A;  3CZ8 A;  1NWR A;  3O5K A;  3WD1 A;  2RUR A;  1HKK A;  1BL4 A;  4KR0 B;  4U84 A;  1Q6U A;  2RUD A;  3FXY A;  4QIB A;  5GPG A;  3RM9 A;  5HUA A;  1HJW A;  2LPV A;  4MNK A;  1LL4 A;  1FKD A;  1ITX A;  3B9D A;  2ITK A;  3AS3 A;  4P8W A;  4W5U A;  2ZR6 A;  3RGC A;  3W4R A;  1JCH B;  5HWC A;  5HBF A;  4ODL A;  5D75 A;  1LG2 A;  2PPO A;  2DG9 A;  4DIP A;  1J4R A;  2DT0 A;  4DRH A;  2M08 A;  1FKT A;  4ZPV R;  4MNJ A;  2ZQU A;  4DRI A;  1YAT A;  2OLH A;  4DZ3 A;  1NWU A;  4NNR A;  2A3A A;  1QPF A;  1JNT A;  2FAP A;  1J4I A;  3ARW A;  3WD0 A;  4J4O A;  1W9U A;  5DF0 A;  2XPA A;  4MAV A;  4MNL A;  2Q5A A;  3IHZ A;  4DWS B;  4LAX A;  1LG1 A;  4S3J A;  2KE0 A;  3KAB A;  4HBE A;  4ITZ A;  2A3C A;  1LL7 A;  3IK8 A;  3PRB A;  1FKG A;  2A3E A;  4LAW A;  1EDQ A;  1E44 A;  1KT0 A;  2XP8 A;  4MTV A;  3PA7 A;  3UQB A;  2ZQS A;  1KT1 A;  1E6P A;  3ALF A;  1FAP A;  1FKR A;  3CHF A;  1D7I A;  2MLZ A;  4W9O A;  1FKS A;  3IKG A;  3O5E A;  2PBC A;  2Y78 A;  4GGQ A;  2EUL A;  3RM8 A;  1FD9 A;  1NH6 A;  4LGX A;  3PR9 A;  1NMV A;  3WL0 A;  1WNO A;  1UR9 A;  3GPK A;  4MNM A;  3BMB A;  1E6N A;  1FKF A;  1NWT A;  1HKM A;  4MPK A;  2WLY A;  2DSZ A;  3AQU A;  3ARO A;  4AY1 A;  3O5L A;  1W26 A;  1R9H A;  1QZ2 A;  2XP5 A;  4ODK A;  2A3B A;  2PPN A;  2XP4 A;  2PPP A;  3FAP A;  1NSG A;  2O9O A;  1RD6 A;  4IQC A;  4IT6 A;  1L1P A;  1T11 A;  4ZPT R;  4U85 A;  3KAC A;  4FN2 A;  3ART A;  4DWS C;  3PRA A;  1BKF A;  3ARZ A;  3NRK A;  3KAH A;  2XP7 A;  2XP9 A;  2WLZ A;  2D9F A;  4JFL A;  2DSV A;  1W9P A;  1FKH A;  2O92 A;  5J6E A;  1D2K A;  2ZR5 A;  3UQA A;  3RM4 A;  1Y0O A;  5GPR A;  3WD4 A;  1C9H A;  4Z2J A;  3O5G A;  1GOI A;  4IT4 A;  1UR8 A;  2YBT A;  3KCE A;  4Q7N A;  1ZU8 A;  4Z2I A;  4WKH A;  1W1V A;  3OA5 A;  2B5U B;  3WQW A;  4DH0 A;  1M5Y A;  1X6N A;  5BXJ A;  1D6O A;  4JFK A;  1FFQ A;  2M1I A;  1FKK A;  3WIJ A;  1E6R A;  1ZBV A;  2ESC A;  3O5D A;  2DSU A;  4JFM A;  3O5J A;  1HJV A;  2DSW A;  4ODN A;  4WIW A;  5JH8 A;  2IUZ A;  2G8Z A;  3ARP A;  4W9P A;  3ARQ A;  4L72 B;  2K8I A;  4ODO A;  2ZQT A;  1JND A;  1HXV A;  3G6L A;  4ODQ A;  2F21 A;  5DIV A;  3ARX A;  4O2T A;  4DZ2 A;  3ARU A;  2ZR4 A;  2RSE A;  2XP3 A;  2UZ5 A;  4Z2K A;  2MF9 A;  3EIP A;  1ZB5 A;  3NI6 A;  1O6I A;  1D7H A;  2PV2 A;  3G6M A;  2N87 A;  4WKA A;  2KR7 A;  3CHD A;  3CGM A;  1X6L A;  3GU0 A;  3O5M A;  3QOK A;  3B7X A;  1PIN A;  1J6Y A;  4TYO A;  1OGB A;  3LUO A;  1KFW A;  4JFJ A;  4MSP A;  3CGN A;  2ZQV A;  4NSB A;  1GPF A;  5DEZ A;  1XRV A;  4NZC A;  4JYS A;  3O5O A;  3GTY X;  3B8S A;  3JYJ A;  3ARR A;  4TW7 A;  5HKG A;  1JNS A;  3WKZ A;  3O5P A;  3UI6 A;  3WD3 A;  1ZBC A;  1FJD A;  2L2S A;  3ODK A;  1ZCN A;  1K9T A;  2DT1 A;  2XP6 A;  4G50 A;  4FAP A;  1YW5 A;  4P8U A;  4ZPW R;  3BXW A;  3ARY A;  2MLX A;  4P8X A;  5I98 A;  1EYM A;  2VCD A;  1JVW A;  3VAW A;  3OOB A;  2DT2 A;  4DRM A;  3UQI A;  3EY6 A;  1F40 A;  2PV3 A;  2F2D A;  1OGG A;  4LAY A;  3KAG A;  5HT1 A;  3UF8 A;  1TFV A;  1Q6H A;  3RFW A;  3AS2 A;  1OWQ A;  2MNT A;  1XHG A;  1Q1C A;  1JNE A;  1NWS A;  3WH0 A;  4TW6 A;  3AS0 A;  1HKJ A;  2F23 A;  1FKI A;  1E6Z A;  2F4E A;  5DO2 A;  4QT2 A;  1FKL A;  4N19 A;  4KQZ A;  1E15 A;  4ODP A;  1FKB A;  4QT3 A;  3WL1 A;  1ROU A;  2KI3 A;  4DWS A;  3O5F A;  2XPB A;  1SR0 A;  2DT3 A;  1QPL A;  1LJY A;  1W9V A;  1EIB A;  1H0I A;  3CHE A;  4ODR A;  4R5E A;  4BF8 A;  1ZK6 A;  2PN0 A;  2OFN A;  2WM0 A;  4WKF A;  2MPH A;  4WK9 A;  1FKJ A;  2DPE A;  3KAF A;  2RUC A;  3TC5 A;  1EQ3 A;  2AOS A;  4L3N A;  1N1A A;  2DG4 A;  5DIU A;  4DRK A;  2RUQ A;  2VN1 A;  4J4N A;  2QF8 A;  1GRJ A;  2KGJ A;  1ZBK A;  3H9R B;  3NTP A;  1CTN A;  2RQS A;  1IX5 A;  2FDM A;  1U79 A;  5HW8 A;  1HKI A;  3PRD A;  1TCO C;  3IKD A;  1LQ0 A;  2IF4 A;  2DG3 A;  2G41 A;  3JYM A;  1A7X A;  2JZV A;  2PI6 A;  4DRN A;  4UDM A;  3O5Q A;  3ARV A;  4DRP A;  3B9A A;  4GIV A;  5HW6 A;  3TCZ A;  5HW7 A;  2LGO A;  4ML4 A;  3KAI A;  4JFI A;  2LKN A;  1WAW A;  3RME A;  3KZ7 A;  2KO7 A;  3FY1 A;  4PTM A;  3CHC A;  4ZS6 A;  2YBU A;  1W1Y A;  1NMW A;  1PBK A;  4DRJ A;  4WJX A;  4W9Q A;  2PV1 A;  4DRO A;  4R0X A;  4URI A;  4TW8 A;  3ARS A;  4Z2G A;  5B8I C;  4C02 B;  1GUV A;  4XAK A;  2P4V A;  4ODM A;  4U86 A;  1E9L A;  1ZL1 A;  4Q22 A;  3AS1 A;  1B6C A;  2M2A A;  1FFR A;  1ZBW A;  2WK2 A;  3TDB A;  2B31 A;  4Z2L A;  2MLY A;  4G2P A;  3JXV A;  1H0G A;  4HBO A;  3UI5 A;  1Q6I A;  1SYT A;  1ROT A;  4IPX A;  4Z2H A;  4QZV B;  3CH9 A;  1LL6 A;  4S3K A;  5GQB A;  1F8A B;  3O5I A; 
#chains in the Genus database with same CATH homology
 3WQV A;  4DRQ A;  1J4H A;  3ALG A;  3UI4 A;  3WD2 A;  3I6C A;  2KFW A;  4MGV A;  3MDY B;  3KAD A;  4TX0 A;  1W1T A;  4IQ2 A;  3O5R A;  1W1P A;  4P8V A;  1VF8 A;  5HTG A;  4DWS D;  1WB0 A;  5DIT A;  2FKE A;  1P5Q A;  4TNS A;  4LAV A;  2LJ4 A;  1D7J A;  1EHN A;  3B9E A;  4HAR A;  1HJX A;  4DT4 A;  5HWB A;  2AWG A;  3CZ8 A;  1NWR A;  3O5K A;  3WD1 A;  2RUR A;  1HKK A;  1BL4 A;  4KR0 B;  4U84 A;  1Q6U A;  2RUD A;  3FXY A;  4QIB A;  5GPG A;  3RM9 A;  5HUA A;  1HJW A;  2LPV A;  4MNK A;  1LL4 A;  1FKD A;  1ITX A;  3B9D A;  2ITK A;  3AS3 A;  4P8W A;  4W5U A;  2ZR6 A;  3RGC A;  3W4R A;  5HWC A;  5HBF A;  4ODL A;  5D75 A;  1LG2 A;  2PPO A;  2DG9 A;  4DIP A;  1J4R A;  2DT0 A;  4DRH A;  2M08 A;  1FKT A;  4ZPV R;  4MNJ A;  2ZQU A;  4DRI A;  1YAT A;  2OLH A;  4DZ3 A;  1NWU A;  4NNR A;  2A3A A;  1QPF A;  1JNT A;  2FAP A;  1J4I A;  3ARW A;  3WD0 A;  4J4O A;  1W9U A;  5DF0 A;  2XPA A;  4MAV A;  4MNL A;  2Q5A A;  3IHZ A;  4DWS B;  4LAX A;  1LG1 A;  4S3J A;  2KE0 A;  3KAB A;  4HBE A;  4ITZ A;  2A3C A;  1LL7 A;  3IK8 A;  3PRB A;  1FKG A;  2A3E A;  4LAW A;  1EDQ A;  1KT0 A;  2XP8 A;  4MTV A;  3PA7 A;  3UQB A;  2ZQS A;  1KT1 A;  1E6P A;  3ALF A;  1FAP A;  1FKR A;  3CHF A;  1D7I A;  2MLZ A;  4W9O A;  1FKS A;  3IKG A;  3O5E A;  2PBC A;  2Y78 A;  4GGQ A;  3RM8 A;  1FD9 A;  1NH6 A;  4LGX A;  3PR9 A;  1NMV A;  3WL0 A;  1WNO A;  1UR9 A;  3GPK A;  4MNM A;  1E6N A;  1FKF A;  1NWT A;  1HKM A;  4MPK A;  2WLY A;  2DSZ A;  3AQU A;  3ARO A;  4AY1 A;  3O5L A;  1W26 A;  1R9H A;  1QZ2 A;  2XP5 A;  4ODK A;  2A3B A;  2PPN A;  2XP4 A;  2PPP A;  3FAP A;  1NSG A;  2O9O A;  1RD6 A;  4IQC A;  4IT6 A;  1L1P A;  1T11 A;  4ZPT R;  4U85 A;  3KAC A;  4FN2 A;  3ART A;  4DWS C;  3PRA A;  1BKF A;  3ARZ A;  3NRK A;  3KAH A;  2XP7 A;  2XP9 A;  2WLZ A;  2D9F A;  4JFL A;  2DSV A;  1W9P A;  1FKH A;  2O92 A;  5J6E A;  1D2K A;  2ZR5 A;  3UQA A;  3RM4 A;  1Y0O A;  5GPR A;  3WD4 A;  1C9H A;  4Z2J A;  3O5G A;  1GOI A;  4IT4 A;  1UR8 A;  2YBT A;  3KCE A;  4Q7N A;  1ZU8 A;  4Z2I A;  4WKH A;  1W1V A;  3OA5 A;  3WQW A;  4DH0 A;  1M5Y A;  1X6N A;  5BXJ A;  1D6O A;  4JFK A;  1FFQ A;  2M1I A;  1FKK A;  3WIJ A;  1E6R A;  1ZBV A;  2ESC A;  3O5D A;  2DSU A;  4JFM A;  3O5J A;  1HJV A;  2DSW A;  4ODN A;  4WIW A;  5JH8 A;  2IUZ A;  2G8Z A;  3ARP A;  4W9P A;  3ARQ A;  4L72 B;  2K8I A;  4ODO A;  2ZQT A;  1JND A;  1HXV A;  3G6L A;  4ODQ A;  2F21 A;  5DIV A;  3ARX A;  4O2T A;  4DZ2 A;  3ARU A;  2ZR4 A;  2RSE A;  2XP3 A;  2UZ5 A;  4Z2K A;  2MF9 A;  1ZB5 A;  3NI6 A;  1O6I A;  1D7H A;  2PV2 A;  3G6M A;  2N87 A;  4WKA A;  2KR7 A;  3CHD A;  3CGM A;  1X6L A;  3O5M A;  3QOK A;  3B7X A;  1PIN A;  1J6Y A;  4TYO A;  1OGB A;  3LUO A;  1KFW A;  4JFJ A;  4MSP A;  3CGN A;  2ZQV A;  4NSB A;  1GPF A;  5DEZ A;  1XRV A;  4NZC A;  4JYS A;  3O5O A;  3B8S A;  3JYJ A;  3ARR A;  4TW7 A;  5HKG A;  1JNS A;  3WKZ A;  3O5P A;  3UI6 A;  3WD3 A;  1ZBC A;  1FJD A;  2L2S A;  3ODK A;  1ZCN A;  1K9T A;  2DT1 A;  2XP6 A;  4G50 A;  4FAP A;  1YW5 A;  4P8U A;  4ZPW R;  3BXW A;  3ARY A;  2MLX A;  4P8X A;  5I98 A;  1EYM A;  2VCD A;  1JVW A;  3VAW A;  3OOB A;  2DT2 A;  4DRM A;  3UQI A;  3EY6 A;  1F40 A;  2PV3 A;  2F2D A;  1OGG A;  4LAY A;  3KAG A;  5HT1 A;  3UF8 A;  1TFV A;  1Q6H A;  3RFW A;  3AS2 A;  1OWQ A;  2MNT A;  1XHG A;  1Q1C A;  1JNE A;  1NWS A;  3WH0 A;  4TW6 A;  3AS0 A;  1HKJ A;  1FKI A;  1E6Z A;  2F4E A;  5DO2 A;  4QT2 A;  1FKL A;  4N19 A;  4KQZ A;  1E15 A;  4ODP A;  1FKB A;  4QT3 A;  3WL1 A;  1ROU A;  2KI3 A;  4DWS A;  3O5F A;  2XPB A;  1SR0 A;  2DT3 A;  1QPL A;  1LJY A;  1W9V A;  1EIB A;  1H0I A;  3CHE A;  4ODR A;  4R5E A;  4BF8 A;  1ZK6 A;  2OFN A;  2WM0 A;  4WKF A;  2MPH A;  4WK9 A;  1FKJ A;  2DPE A;  3KAF A;  2RUC A;  3TC5 A;  1EQ3 A;  2AOS A;  4L3N A;  1N1A A;  2DG4 A;  5DIU A;  4DRK A;  2RUQ A;  2VN1 A;  4J4N A;  2QF8 A;  2KGJ A;  1ZBK A;  3H9R B;  3NTP A;  1CTN A;  2RQS A;  1IX5 A;  2FDM A;  1U79 A;  5HW8 A;  1HKI A;  3PRD A;  1TCO C;  3IKD A;  1LQ0 A;  2IF4 A;  2DG3 A;  2G41 A;  3JYM A;  1A7X A;  2JZV A;  2PI6 A;  4DRN A;  3O5Q A;  3ARV A;  4DRP A;  3B9A A;  4GIV A;  5HW6 A;  3TCZ A;  5HW7 A;  2LGO A;  4ML4 A;  3KAI A;  4JFI A;  2LKN A;  1WAW A;  3RME A;  3KZ7 A;  2KO7 A;  3FY1 A;  4PTM A;  3CHC A;  4ZS6 A;  2YBU A;  1W1Y A;  1NMW A;  1PBK A;  4DRJ A;  4WJX A;  4W9Q A;  2PV1 A;  4DRO A;  4R0X A;  4URI A;  4TW8 A;  3ARS A;  4Z2G A;  5B8I C;  4C02 B;  1GUV A;  4XAK A;  4ODM A;  4U86 A;  1E9L A;  1ZL1 A;  4Q22 A;  3AS1 A;  1B6C A;  2M2A A;  1FFR A;  1ZBW A;  2WK2 A;  3TDB A;  2B31 A;  4Z2L A;  2MLY A;  4G2P A;  3JXV A;  1H0G A;  4HBO A;  3UI5 A;  1Q6I A;  1SYT A;  1ROT A;  4IPX A;  4Z2H A;  4QZV B;  3CH9 A;  1LL6 A;  4S3K A;  5GQB A;  1F8A B;  3O5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...