2RSEA

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rseA00
4W9QA 4U84A 4DRMA 3KAGA 1FJDA 5HT1A 4ODOA 1A7XA 1Q6IA 1HXVA 5HW6A 1NMVA 2ZQUA 3KAFA 4DRJA 3UF8A 1FKRA 2ITKA 4IQ2A 1F8AB 1FKGA 1F40A 1FKLA 2XP3A 5BXJA 1NMWA 1TCOC 2ZR6A 3JXVA 3O5GA 3CGNA 5HWBA 1U79A 1ZK6A 3KABA 5DIUA 2KE0A 2RQSA 2IF4A 2PPNA 3NTPA 1Q6HA 2MPHA 4DRNA 4ODLA 1PINA 2XP7A 2LKNA 2L2SA 2MNTA 1J4HA 2LGOA 4GGQA 4DRQA 3IK8A 1Y0OA 4ODNA 1B6CA 3B7XA 4U85A 5HKGA 2XP5A 1L1PA 3RFWA 2DG3A 2ZQSA 1D7JA 2MLZA 2PPPA 3RGCA 2PV1A 3FAPA 3KAHA 3CGMA 1JNTA 3UI6A 1FKIA 2AWGA 2VCDA 2N87A 1J4IA 3MDYB 3O5DA 1FD9A 1N1AA 4ODQA 2JZVA 4ODKA 1EYMA 2PPOA 5HUAA 3O5LA 4LAYA 3O5RA 4IPXA 2XP6A 3VAWA 1QPFA 1FKHA 2KR7A 3JYJA 4JFJA 4GIVA 3IKDA 3KAIA 2XP9A 3EY6A 3O5KA 4JFMA 1T11A 4TW6A 3O5EA 2KI3A 4DIPA 4JFIA 1EQ3A 3IKGA 5D75A 4JYSA 2XP8A 3UQBA 4DT4A 1J6YA 2F2DA 2M08A 3O5FA 1JVWA 4JFLA 4MSPA 4O2TA 2MF9A 3UI5A 3O5IA 3ODKA 4TYOA 3PRDA 1M5YA 3KCEA 1KT0A 5HTGA 2M1IA 2XPBA 4N19A 4JFKA 3TCZA 5I98A 5GPGA 2UZ5A 2LJ4A 3O5JA 1QPLA 2F4EA 3UQIA 5B8IC 3O5QA 1ROUA 1JNSA 5DITA 4ITZA 1YW5A 3GPKA 2D9FA 3WH0A 2RSEA 2OFNA 1YATA 1ZCNA 4QT3A 4DH0A 3OOBA 3NRKA 1FAPA 3JYMA 2KFWA 2DG9A 1QZ2A 1R9HA 3O5OA 4LAVA 2RUDA 4LAXA 1FKFA 4ODRA 1FKJA 4ODPA 4QT2A 4C02B 4DRHA 1FKBA 1P5QA 4R0XA 1Q1CA 2ZR5A 1J4RA 2M2AA 2RURA 4DRIA 1BKFA 1FKKA 2XP4A 3UI4A 3UQAA 4DROA 4FN2A 4TNSA 4W9OA 4FAPA 3H9RB 5DIVA 1D7HA 4NNRA 4DZ3A 3NI6A 4LAWA 4ODMA 4DRPA 2FKEA 2LPVA 1Q6UA 1FKSA 1KT1A 1W26A 2KO7A 3KACA 2MLYA 4TW8A 2MLXA 2RUQA 4W9PA 2PBCA 2ZQTA 5J6EA 4IQCA 4DRKA 2VN1A 3KADA 2Y78A 1ROTA 1PBKA 4MGVA 2XPAA 2DG4A 4J4OA 4BF8A 5HW7A 1FKTA 1FKDA 3IHZA 4TW7A 4G2PA 4DZ2A 1D6OA 4G50A 2ZR4A 2ZQVA 2KGJA 2RUCA 3PRBA 2PV2A 3KZ7A 5HW8A 3LUOA 3O5MA 2PV3A 4QIBA 3I6CA 1C9HA 2K8IA 4J4NA 2Q5AA 3O5PA 3TC5A 2F21A 2FAPA 1BL4A 1NSGA 3PA7A 4TX0A 3TDBA 5HWCA 1D7IA 4U86A
chains in the Genus database with same CATH superfamily
1D2KA 4P8WA 3WQWA 1Q6IA 4HBOA 3WIJA 5HW6A 3CHFA 1E15A 2ZQUA 3BXWA 4DRJA 1X6LA 4DWSA 4Z2KA 2YBTA 1CTNA 1JCHB 2XP3A 3WD4A 1NMWA 1LG2A 1RD6A 1ITXA 1ZK6A 3NTPA 4DRNA 1PINA 1ZL1A 1E6ZA 3CHDA 4DRQA 3B7XA 1D7JA 3ALFA 2N87A 3O5DA 3G6MA 1ZBKA 2QF8A 1EYMA 4Z2IA 1H0IA 4IPXA 1QPFA 1SYTA 3EY6A 1ZBVA 2DSZA 3O5EA 2KI3A 1EQ3A 4JFIA 3IKGA 5D75A 4W5UA 1W1YA 2B31A 3GTYX 4O2TA 1ZBCA 2EULA 2MF9A 3PRDA 1W1VA 3WD2A 5HTGA 3TCZA 4JFKA 5GPGA 2LJ4A 4URIA 2F4EA 1ROUA 1JNSA 2WLYA 5DITA 2ETNA 2OFNA 4DH0A 1E6NA 3JYMA 2KFWA 1XHGA 4Z2LA 4LAVA 4ODPA 1WNOA 3ARRA 5HW7A 1WB0A 1FKBA 1Q1CA 2F23A 2M2AA 4DRIA 2RURA 3WL1A 1BKFA 1FKKA 3BMBA 4TNSA 2B5UB 2WLZA 4P8UA 1D7HA 4ODMA 4LAWA 4XAKA 4HARA 2KO7A 1HKKA 3B9AA 2RUQA 2PBCA 2VN1A 2Y78A 1ROTA 4P8XA 4Z2HA 3AS1A 4MNJA 1NWUA 2ZR4A 3PR9A 2KGJA 4J4NA 2AOSA 3TDBA 5HWCA 1H0GA 2G41A 4W9QA 5HT1A 1A7XA 1HXVA 4UDMA 3ARUA 3AS0A 3KAFA 1LG1A 3UF8A 1F8AB 1F40A 5BXJA 1LQ0A 2ESCA 4WKAA 3O5GA 2KE0A 2RQSA 1Q6HA 4ODLA 3GU0A 1J4HA 2WK2A 5GPRA 4U85A 2XP5A 1L1PA 3RFWA 1JNTA 4MNMA 1FKIA 3WD0A 1N1AA 1GOIA 3B9DA 3O5LA 3O5RA 2DPEA 3VAWA 4JFJA 1K9TA 2KR7A 1JNDA 3O5KA 3ARWA 3ARQA 1HJWA 4DT4A 1E44A 2M08A 2WM0A 1JVWA 4JFLA 1M5YA 3KCEA 1SR0A 2XPBA 4N19A 3O5JA 5B8IC 3ARXA 3O5QA 3CHCA 1ZB5A 1NWTA 1YW5A 3GPKA 1OGBA 2A3EA 1OWQA 3CHEA 1FFRA 3OOBA 3NRKA 1FAPA 3OA5A 1QZ2A 4ODRA 3UQBA 1FKFA 4DRHA 4C02B 4DWSC 4R0XA 2XP4A 4DROA 4FAPA 3ARSA 5DIVA 4ZPTR 4NNRA 1GUVA 2FKEA 4R5EA 1W9PA 1FKSA 3KACA 2MLYA 2PI6A 3AROA 3ARYA 3RM4A 4IQCA 3KADA 1HJXA 4IT6A 4Z2JA 1LJYA 1NH6A 4DZ2A 2PV2A 3KZ7A 4QIBA 3I6CA 2O9OA 2F21A 2FAPA 4DWSB 2A3AA 1EDQA 3B9EA 4U84A 4DRMA 3KAGA 1FJDA 4ODOA 2FDMA 1OGGA 3CH9A 3WL0A 2P4VA 3PRAA 2ITKA 4WKHA 1FKGA 3WQVA 1TCOC 2ZR6A 3JXVA 5HWBA 3CGNA 3KABA 2DSWA 2A3BA 2PPNA 3EIPA 2G8ZA 1NWRA 2MPHA 2LKNA 3ALGA 2LGOA 4GGQA 4KQZA 4ODNA 2DT0A 1B6CA 3QOKA 2ZQSA 2PPPA 4MPKA 3KAHA 3CGMA 1J4IA 4KR0B 2JZVA 4ODKA 2O92A 5HUAA 3AQUA 1FKHA 3JYJA 4GIVA 3IKDA 3KAIA 4TW6A 4JFMA 1W9UA 4MNLA 1ZU8A 1WAWA 2F2DA 4MTVA 4MSPA 3O5IA 3ODKA 4TYOA 4IT4A 1KT0A 2UZ5A 2DSUA 1QPLA 4NZCA 3UQIA 1HKJA 1ZCNA 4QT3A 3WH0A 4Z2GA 4QT2A 2DSVA 1P5QA 1J4RA 5JH8A 3UQAA 4WIWA 1UR8A 2DT3A 2IUZA 4DZ3A 4ZPVR 4DRPA 1E9LA 1Q6UA 1KT1A 4TW8A 4MAVA 2ZQTA 3AS3A 1EHNA 1FKDA 3IHZA 4TW7A 1D6OA 2ZQVA 2PN0A 3PRBA 4Q7NA 5HW8A 3WKZA 3LUOA 3O5MA 2PV3A 3PA7A 4AY1A 1D7IA 1UR9A 4U86A 1W1TA 4QZVB 1W9VA 1NMVA 4WK9A 3ARVA 3FXYA 4ZS6A 1FKRA 4IQ2A 3WD3A 4HBEA 1ZBWA 5DEZA 1FKLA 1FFQA 1NWSA 3FY1A 1U79A 5DIUA 1LL6A 2IF4A 2XP7A 2L2SA 2MNTA 3IK8A 1Y0OA 1HJVA 5HKGA 1O6IA 2DG3A 2MLZA 3RGCA 1JNEA 2A3CA 2PV1A 1TFVA 3FAPA 3G6LA 3UI6A 2AWGA 2VCDA 1IX5A 3MDYB 1FD9A 4MNKA 4ODQA 4LGXA 2PPOA 1GPFA 4P8VA 4LAYA 2XP6A 3AS2A 4PTMA 3W4RA 3ARPA 3CZ8A 1E6RA 2XP9A 1VF8A 5GQBA 1T11A 3RM9A 4DIPA 4ML4A 4JYSA 2XP8A 1J6YA 3O5FA 4WKFA 3UI5A 5I98A 2M1IA 5DO2A 5HBFA 3RM8A 3RMEA 1E6PA 4Q22A 4ITZA 1KFWA 2D9FA 2RSEA 1YATA 1GRJA 2DG9A 3O5OA 1R9HA 4LAXA 2RUDA 3ARTA 3ARZA 1FKJA 4L72B 2ZR5A 4WJXA 2DT1A 4S3KA 4DWSD 3UI4A 5DF0A 4FN2A 4W9OA 4L3NA 2YBUA 3H9RB 3NI6A 1HKIA 1X6NA 2LPVA 3B8SA 1W26A 2MLXA 4NSBA 4W9PA 1HKMA 1LL7A 5J6EA 4DRKA 4MGVA 1PBKA 2XPAA 4ZPWR 2DG4A 4J4OA 4BF8A 1FKTA 4G2PA 4G50A 2OLHA 2RUCA 1EIBA 3WD1A 1W1PA 1C9HA 1XRVA 2DT2A 2K8IA 2Q5AA 3O5PA 3TC5A 1BL4A 1NSGA 4TX0A 4S3JA 1LL4A
chains in the Genus database with same CATH topology
1D2KA 4P8WA 3WQWA 1Q6IA 4HBOA 3WIJA 5HW6A 3CHFA 1E15A 2ZQUA 3BXWA 4DRJA 1X6LA 4DWSA 4Z2KA 2YBTA 1CTNA 2XP3A 3WD4A 1NMWA 1LG2A 1RD6A 1ITXA 1ZK6A 3NTPA 4DRNA 1PINA 1ZL1A 1E6ZA 3CHDA 4DRQA 3B7XA 1D7JA 3ALFA 2N87A 3O5DA 3G6MA 1ZBKA 2QF8A 1EYMA 4Z2IA 1H0IA 4IPXA 1QPFA 1SYTA 3EY6A 1ZBVA 2DSZA 3O5EA 2KI3A 1EQ3A 4JFIA 3IKGA 5D75A 4W5UA 1W1YA 2B31A 4O2TA 1ZBCA 2MF9A 3PRDA 1W1VA 3WD2A 5HTGA 3TCZA 4JFKA 5GPGA 2LJ4A 4URIA 2F4EA 1ROUA 1JNSA 2WLYA 5DITA 2OFNA 4DH0A 1E6NA 3JYMA 2KFWA 1XHGA 4Z2LA 4LAVA 4ODPA 1WNOA 3ARRA 5HW7A 1WB0A 1FKBA 1Q1CA 2M2AA 4DRIA 2RURA 3WL1A 1BKFA 1FKKA 4TNSA 2WLZA 4P8UA 1D7HA 4ODMA 4LAWA 4XAKA 4HARA 2KO7A 1HKKA 3B9AA 2RUQA 2PBCA 2VN1A 2Y78A 1ROTA 4P8XA 4Z2HA 3AS1A 4MNJA 1NWUA 2ZR4A 3PR9A 2KGJA 4J4NA 2AOSA 3TDBA 5HWCA 1H0GA 2G41A 4W9QA 5HT1A 1A7XA 1HXVA 3ARUA 3AS0A 3KAFA 1LG1A 3UF8A 1F8AB 1F40A 5BXJA 1LQ0A 2ESCA 4WKAA 3O5GA 2KE0A 2RQSA 1Q6HA 4ODLA 1J4HA 2WK2A 5GPRA 4U85A 2XP5A 1L1PA 3RFWA 1JNTA 4MNMA 1FKIA 3WD0A 1N1AA 1GOIA 3B9DA 3O5LA 3O5RA 2DPEA 3VAWA 4JFJA 1K9TA 2KR7A 1JNDA 3O5KA 3ARWA 3ARQA 1HJWA 4DT4A 2M08A 2WM0A 4JFLA 1JVWA 1M5YA 3KCEA 1SR0A 2XPBA 4N19A 3O5JA 5B8IC 3ARXA 3O5QA 3CHCA 1ZB5A 1NWTA 1YW5A 2A3EA 1OGBA 3GPKA 1OWQA 3CHEA 1FFRA 3OOBA 3NRKA 1FAPA 3OA5A 1QZ2A 4ODRA 3UQBA 1FKFA 4DRHA 4C02B 4DWSC 4R0XA 2XP4A 4DROA 4FAPA 3ARSA 5DIVA 4ZPTR 4NNRA 1GUVA 2FKEA 4R5EA 1W9PA 1FKSA 3KACA 2MLYA 2PI6A 3AROA 3ARYA 3RM4A 4IQCA 3KADA 1HJXA 4IT6A 4Z2JA 1LJYA 1NH6A 4DZ2A 2PV2A 3KZ7A 4QIBA 3I6CA 2O9OA 2F21A 2FAPA 4DWSB 2A3AA 1EDQA 3B9EA 4U84A 4DRMA 3KAGA 1FJDA 4ODOA 2FDMA 1OGGA 3CH9A 3WL0A 3PRAA 2ITKA 4WKHA 1FKGA 3WQVA 1TCOC 2ZR6A 3JXVA 5HWBA 3CGNA 3KABA 2DSWA 2A3BA 2PPNA 2G8ZA 1NWRA 2MPHA 2LKNA 3ALGA 2LGOA 4GGQA 4KQZA 4ODNA 2DT0A 1B6CA 3QOKA 2ZQSA 2PPPA 4MPKA 3KAHA 3CGMA 1J4IA 4KR0B 2JZVA 4ODKA 2O92A 5HUAA 3AQUA 1FKHA 3JYJA 4GIVA 3IKDA 3KAIA 4TW6A 4JFMA 1W9UA 4MNLA 1ZU8A 1WAWA 2F2DA 4MTVA 4MSPA 3O5IA 3ODKA 4TYOA 4IT4A 1KT0A 2UZ5A 2DSUA 1QPLA 4NZCA 3UQIA 1HKJA 1ZCNA 4QT3A 3WH0A 4Z2GA 4QT2A 2DSVA 1P5QA 1J4RA 5JH8A 3UQAA 4WIWA 1UR8A 2DT3A 2IUZA 4DZ3A 4ZPVR 4DRPA 1E9LA 1Q6UA 1KT1A 4TW8A 4MAVA 2ZQTA 3AS3A 1EHNA 1FKDA 3IHZA 4TW7A 1D6OA 2ZQVA 3PRBA 5HW8A 4Q7NA 3WKZA 3LUOA 3O5MA 2PV3A 3PA7A 4AY1A 1D7IA 1UR9A 4U86A 1W1TA 4QZVB 1W9VA 1NMVA 4WK9A 3ARVA 3FXYA 4ZS6A 1FKRA 4IQ2A 3WD3A 4HBEA 1ZBWA 5DEZA 1FKLA 1FFQA 1NWSA 3FY1A 1U79A 5DIUA 1LL6A 2IF4A 2XP7A 2L2SA 2MNTA 3IK8A 1Y0OA 1HJVA 5HKGA 1O6IA 2DG3A 2MLZA 3RGCA 1JNEA 2A3CA 2PV1A 1TFVA 3FAPA 3G6LA 3UI6A 2AWGA 2VCDA 1IX5A 3MDYB 1FD9A 4MNKA 4ODQA 4LGXA 2PPOA 1GPFA 4P8VA 4LAYA 2XP6A 3AS2A 4PTMA 3W4RA 3ARPA 3CZ8A 1E6RA 2XP9A 1VF8A 5GQBA 1T11A 3RM9A 4DIPA 4ML4A 4JYSA 2XP8A 1J6YA 3O5FA 4WKFA 3UI5A 5I98A 2M1IA 5DO2A 5HBFA 3RM8A 3RMEA 1E6PA 4Q22A 4ITZA 1KFWA 2D9FA 2RSEA 1YATA 2DG9A 3O5OA 1R9HA 4LAXA 2RUDA 3ARTA 3ARZA 1FKJA 4L72B 2ZR5A 4WJXA 2DT1A 4S3KA 4DWSD 3UI4A 5DF0A 4FN2A 4W9OA 4L3NA 2YBUA 3H9RB 3NI6A 1HKIA 1X6NA 2LPVA 3B8SA 1W26A 2MLXA 4NSBA 4W9PA 1HKMA 1LL7A 5J6EA 4DRKA 4MGVA 1PBKA 2XPAA 4ZPWR 2DG4A 4J4OA 4BF8A 1FKTA 4G2PA 4G50A 2OLHA 2RUCA 1EIBA 3WD1A 1W1PA 1C9HA 1XRVA 2DT2A 2K8IA 2Q5AA 3O5PA 3TC5A 1BL4A 1NSGA 4TX0A 4S3JA 1LL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  4U84 A;  4DRM A;  3KAG A;  1FJD A;  5HT1 A;  4ODO A;  1A7X A;  1Q6I A;  1HXV A;  5HW6 A;  1NMV A;  2ZQU A;  3KAF A;  4DRJ A;  3UF8 A;  1FKR A;  2ITK A;  4IQ2 A;  1F8A B;  1FKG A;  1F40 A;  1FKL A;  2XP3 A;  5BXJ A;  1NMW A;  1TCO C;  2ZR6 A;  3JXV A;  3O5G A;  3CGN A;  5HWB A;  1U79 A;  1ZK6 A;  3KAB A;  5DIU A;  2KE0 A;  2RQS A;  2IF4 A;  2PPN A;  3NTP A;  1Q6H A;  2MPH A;  4DRN A;  4ODL A;  1PIN A;  2XP7 A;  2LKN A;  2L2S A;  2MNT A;  1J4H A;  2LGO A;  4GGQ A;  4DRQ A;  3IK8 A;  1Y0O A;  4ODN A;  1B6C A;  3B7X A;  4U85 A;  5HKG A;  2XP5 A;  1L1P A;  3RFW A;  2DG3 A;  2ZQS A;  1D7J A;  2MLZ A;  2PPP A;  3RGC A;  2PV1 A;  3FAP A;  3KAH A;  3CGM A;  1JNT A;  3UI6 A;  1FKI A;  2AWG A;  2VCD A;  2N87 A;  1J4I A;  3MDY B;  3O5D A;  1FD9 A;  1N1A A;  4ODQ A;  2JZV A;  4ODK A;  1EYM A;  2PPO A;  5HUA A;  3O5L A;  4LAY A;  3O5R A;  4IPX A;  2XP6 A;  3VAW A;  1QPF A;  1FKH A;  2KR7 A;  3JYJ A;  4JFJ A;  4GIV A;  3IKD A;  3KAI A;  2XP9 A;  3EY6 A;  3O5K A;  4JFM A;  1T11 A;  4TW6 A;  3O5E A;  2KI3 A;  4DIP A;  4JFI A;  1EQ3 A;  3IKG A;  5D75 A;  4JYS A;  2XP8 A;  3UQB A;  4DT4 A;  1J6Y A;  2F2D A;  2M08 A;  3O5F A;  1JVW A;  4JFL A;  4MSP A;  4O2T A;  2MF9 A;  3UI5 A;  3O5I A;  3ODK A;  4TYO A;  3PRD A;  1M5Y A;  3KCE A;  1KT0 A;  5HTG A;  2M1I A;  2XPB A;  4N19 A;  4JFK A;  3TCZ A;  5I98 A;  5GPG A;  2UZ5 A;  2LJ4 A;  3O5J A;  1QPL A;  2F4E A;  3UQI A;  5B8I C;  3O5Q A;  1ROU A;  1JNS A;  5DIT A;  4ITZ A;  1YW5 A;  3GPK A;  2D9F A;  3WH0 A;  2RSE A;  2OFN A;  1YAT A;  1ZCN A;  4QT3 A;  4DH0 A;  3OOB A;  3NRK A;  1FAP A;  3JYM A;  2KFW A;  2DG9 A;  1QZ2 A;  1R9H A;  3O5O A;  4LAV A;  2RUD A;  4LAX A;  1FKF A;  4ODR A;  1FKJ A;  4ODP A;  4QT2 A;  4C02 B;  4DRH A;  1FKB A;  1P5Q A;  4R0X A;  1Q1C A;  2ZR5 A;  1J4R A;  2M2A A;  2RUR A;  4DRI A;  1BKF A;  1FKK A;  2XP4 A;  3UI4 A;  3UQA A;  4DRO A;  4FN2 A;  4TNS A;  4W9O A;  4FAP A;  3H9R B;  5DIV A;  1D7H A;  4NNR A;  4DZ3 A;  3NI6 A;  4LAW A;  4ODM A;  4DRP A;  2FKE A;  2LPV A;  1Q6U A;  1FKS A;  1KT1 A;  1W26 A;  2KO7 A;  3KAC A;  2MLY A;  4TW8 A;  2MLX A;  2RUQ A;  4W9P A;  2PBC A;  2ZQT A;  5J6E A;  4IQC A;  4DRK A;  2VN1 A;  3KAD A;  2Y78 A;  1ROT A;  1PBK A;  4MGV A;  2XPA A;  2DG4 A;  4J4O A;  4BF8 A;  5HW7 A;  1FKT A;  1FKD A;  3IHZ A;  4TW7 A;  4G2P A;  4DZ2 A;  1D6O A;  4G50 A;  2ZR4 A;  2ZQV A;  2KGJ A;  2RUC A;  3PRB A;  2PV2 A;  3KZ7 A;  5HW8 A;  3LUO A;  3O5M A;  2PV3 A;  4QIB A;  3I6C A;  1C9H A;  2K8I A;  4J4N A;  2Q5A A;  3O5P A;  3TC5 A;  2F21 A;  2FAP A;  1BL4 A;  1NSG A;  3PA7 A;  4TX0 A;  3TDB A;  5HWC A;  1D7I A;  4U86 A; 
#chains in the Genus database with same CATH topology
 1D2K A;  4P8W A;  3WQW A;  1Q6I A;  4HBO A;  3WIJ A;  5HW6 A;  3CHF A;  1E15 A;  2ZQU A;  3BXW A;  4DRJ A;  1X6L A;  4DWS A;  4Z2K A;  2YBT A;  1CTN A;  1JCH B;  2XP3 A;  3WD4 A;  1NMW A;  1LG2 A;  1RD6 A;  1ITX A;  1ZK6 A;  3NTP A;  4DRN A;  1PIN A;  1ZL1 A;  1E6Z A;  3CHD A;  4DRQ A;  3B7X A;  1D7J A;  3ALF A;  2N87 A;  3O5D A;  3G6M A;  1ZBK A;  2QF8 A;  1EYM A;  4Z2I A;  1H0I A;  4IPX A;  1QPF A;  1SYT A;  3EY6 A;  1ZBV A;  2DSZ A;  3O5E A;  2KI3 A;  1EQ3 A;  4JFI A;  3IKG A;  5D75 A;  4W5U A;  1W1Y A;  2B31 A;  3GTY X;  4O2T A;  1ZBC A;  2EUL A;  2MF9 A;  3PRD A;  1W1V A;  3WD2 A;  5HTG A;  3TCZ A;  4JFK A;  5GPG A;  2LJ4 A;  4URI A;  2F4E A;  1ROU A;  1JNS A;  2WLY A;  5DIT A;  2ETN A;  2OFN A;  4DH0 A;  1E6N A;  3JYM A;  2KFW A;  1XHG A;  4Z2L A;  4LAV A;  4ODP A;  1WNO A;  3ARR A;  5HW7 A;  1WB0 A;  1FKB A;  1Q1C A;  2F23 A;  2M2A A;  4DRI A;  2RUR A;  3WL1 A;  1BKF A;  1FKK A;  3BMB A;  4TNS A;  2B5U B;  2WLZ A;  4P8U A;  1D7H A;  4ODM A;  4LAW A;  4XAK A;  4HAR A;  2KO7 A;  1HKK A;  3B9A A;  2RUQ A;  2PBC A;  2VN1 A;  2Y78 A;  1ROT A;  4P8X A;  4Z2H A;  3AS1 A;  4MNJ A;  1NWU A;  2ZR4 A;  3PR9 A;  2KGJ A;  4J4N A;  2AOS A;  3TDB A;  5HWC A;  1H0G A;  2G41 A;  4W9Q A;  5HT1 A;  1A7X A;  1HXV A;  4UDM A;  3ARU A;  3AS0 A;  3KAF A;  1LG1 A;  3UF8 A;  1F8A B;  1F40 A;  5BXJ A;  1LQ0 A;  2ESC A;  4WKA A;  3O5G A;  2KE0 A;  2RQS A;  1Q6H A;  4ODL A;  3GU0 A;  1J4H A;  2WK2 A;  5GPR A;  4U85 A;  2XP5 A;  1L1P A;  3RFW A;  1JNT A;  4MNM A;  1FKI A;  3WD0 A;  1N1A A;  1GOI A;  3B9D A;  3O5L A;  3O5R A;  2DPE A;  3VAW A;  4JFJ A;  1K9T A;  2KR7 A;  1JND A;  3O5K A;  3ARW A;  3ARQ A;  1HJW A;  4DT4 A;  1E44 A;  2M08 A;  2WM0 A;  1JVW A;  4JFL A;  1M5Y A;  3KCE A;  1SR0 A;  2XPB A;  4N19 A;  3O5J A;  5B8I C;  3ARX A;  3O5Q A;  3CHC A;  1ZB5 A;  1NWT A;  1YW5 A;  3GPK A;  1OGB A;  2A3E A;  1OWQ A;  3CHE A;  1FFR A;  3OOB A;  3NRK A;  1FAP A;  3OA5 A;  1QZ2 A;  4ODR A;  3UQB A;  1FKF A;  4DRH A;  4C02 B;  4DWS C;  4R0X A;  2XP4 A;  4DRO A;  4FAP A;  3ARS A;  5DIV A;  4ZPT R;  4NNR A;  1GUV A;  2FKE A;  4R5E A;  1W9P A;  1FKS A;  3KAC A;  2MLY A;  2PI6 A;  3ARO A;  3ARY A;  3RM4 A;  4IQC A;  3KAD A;  1HJX A;  4IT6 A;  4Z2J A;  1LJY A;  1NH6 A;  4DZ2 A;  2PV2 A;  3KZ7 A;  4QIB A;  3I6C A;  2O9O A;  2F21 A;  2FAP A;  4DWS B;  2A3A A;  1EDQ A;  3B9E A;  4U84 A;  4DRM A;  3KAG A;  1FJD A;  4ODO A;  2FDM A;  1OGG A;  3CH9 A;  3WL0 A;  2P4V A;  3PRA A;  2ITK A;  4WKH A;  1FKG A;  3WQV A;  1TCO C;  2ZR6 A;  3JXV A;  5HWB A;  3CGN A;  3KAB A;  2DSW A;  2A3B A;  2PPN A;  3EIP A;  2G8Z A;  1NWR A;  2MPH A;  2LKN A;  3ALG A;  2LGO A;  4GGQ A;  4KQZ A;  4ODN A;  2DT0 A;  1B6C A;  3QOK A;  2ZQS A;  2PPP A;  4MPK A;  3KAH A;  3CGM A;  1J4I A;  4KR0 B;  2JZV A;  4ODK A;  2O92 A;  5HUA A;  3AQU A;  1FKH A;  3JYJ A;  4GIV A;  3IKD A;  3KAI A;  4TW6 A;  4JFM A;  1W9U A;  4MNL A;  1ZU8 A;  1WAW A;  2F2D A;  4MTV A;  4MSP A;  3O5I A;  3ODK A;  4TYO A;  4IT4 A;  1KT0 A;  2UZ5 A;  2DSU A;  1QPL A;  4NZC A;  3UQI A;  1HKJ A;  1ZCN A;  4QT3 A;  3WH0 A;  4Z2G A;  4QT2 A;  2DSV A;  1P5Q A;  1J4R A;  5JH8 A;  3UQA A;  4WIW A;  1UR8 A;  2DT3 A;  2IUZ A;  4DZ3 A;  4ZPV R;  4DRP A;  1E9L A;  1Q6U A;  1KT1 A;  4TW8 A;  4MAV A;  2ZQT A;  3AS3 A;  1EHN A;  1FKD A;  3IHZ A;  4TW7 A;  1D6O A;  2ZQV A;  2PN0 A;  3PRB A;  4Q7N A;  5HW8 A;  3WKZ A;  3LUO A;  3O5M A;  2PV3 A;  3PA7 A;  4AY1 A;  1D7I A;  1UR9 A;  4U86 A;  1W1T A;  4QZV B;  1W9V A;  1NMV A;  4WK9 A;  3ARV A;  3FXY A;  4ZS6 A;  1FKR A;  4IQ2 A;  3WD3 A;  4HBE A;  1ZBW A;  5DEZ A;  1FKL A;  1FFQ A;  1NWS A;  3FY1 A;  1U79 A;  5DIU A;  1LL6 A;  2IF4 A;  2XP7 A;  2L2S A;  2MNT A;  3IK8 A;  1Y0O A;  1HJV A;  5HKG A;  1O6I A;  2DG3 A;  2MLZ A;  3RGC A;  1JNE A;  2A3C A;  2PV1 A;  1TFV A;  3FAP A;  3G6L A;  3UI6 A;  2AWG A;  2VCD A;  1IX5 A;  3MDY B;  1FD9 A;  4MNK A;  4ODQ A;  4LGX A;  2PPO A;  1GPF A;  4P8V A;  4LAY A;  2XP6 A;  3AS2 A;  4PTM A;  3W4R A;  3ARP A;  3CZ8 A;  1E6R A;  2XP9 A;  1VF8 A;  5GQB A;  1T11 A;  3RM9 A;  4DIP A;  4ML4 A;  4JYS A;  2XP8 A;  1J6Y A;  3O5F A;  4WKF A;  3UI5 A;  5I98 A;  2M1I A;  5DO2 A;  5HBF A;  3RM8 A;  3RME A;  1E6P A;  4Q22 A;  4ITZ A;  1KFW A;  2D9F A;  2RSE A;  1YAT A;  1GRJ A;  2DG9 A;  3O5O A;  1R9H A;  4LAX A;  2RUD A;  3ART A;  3ARZ A;  1FKJ A;  4L72 B;  2ZR5 A;  4WJX A;  2DT1 A;  4S3K A;  4DWS D;  3UI4 A;  5DF0 A;  4FN2 A;  4W9O A;  4L3N A;  2YBU A;  3H9R B;  3NI6 A;  1HKI A;  1X6N A;  2LPV A;  3B8S A;  1W26 A;  2MLX A;  4NSB A;  4W9P A;  1HKM A;  1LL7 A;  5J6E A;  4DRK A;  4MGV A;  1PBK A;  2XPA A;  4ZPW R;  2DG4 A;  4J4O A;  4BF8 A;  1FKT A;  4G2P A;  4G50 A;  2OLH A;  2RUC A;  1EIB A;  3WD1 A;  1W1P A;  1C9H A;  1XRV A;  2DT2 A;  2K8I A;  2Q5A A;  3O5P A;  3TC5 A;  1BL4 A;  1NSG A;  4TX0 A;  4S3J A;  1LL4 A; 
#chains in the Genus database with same CATH homology
 1D2K A;  4P8W A;  3WQW A;  1Q6I A;  4HBO A;  3WIJ A;  5HW6 A;  3CHF A;  1E15 A;  2ZQU A;  3BXW A;  4DRJ A;  1X6L A;  4DWS A;  4Z2K A;  2YBT A;  1CTN A;  2XP3 A;  3WD4 A;  1NMW A;  1LG2 A;  1RD6 A;  1ITX A;  1ZK6 A;  3NTP A;  4DRN A;  1PIN A;  1ZL1 A;  1E6Z A;  3CHD A;  4DRQ A;  3B7X A;  1D7J A;  3ALF A;  2N87 A;  3O5D A;  3G6M A;  1ZBK A;  2QF8 A;  1EYM A;  4Z2I A;  1H0I A;  4IPX A;  1QPF A;  1SYT A;  3EY6 A;  1ZBV A;  2DSZ A;  3O5E A;  2KI3 A;  1EQ3 A;  4JFI A;  3IKG A;  5D75 A;  4W5U A;  1W1Y A;  2B31 A;  4O2T A;  1ZBC A;  2MF9 A;  3PRD A;  1W1V A;  3WD2 A;  5HTG A;  3TCZ A;  4JFK A;  5GPG A;  2LJ4 A;  4URI A;  2F4E A;  1ROU A;  1JNS A;  2WLY A;  5DIT A;  2OFN A;  4DH0 A;  1E6N A;  3JYM A;  2KFW A;  1XHG A;  4Z2L A;  4LAV A;  4ODP A;  1WNO A;  3ARR A;  5HW7 A;  1WB0 A;  1FKB A;  1Q1C A;  2M2A A;  4DRI A;  2RUR A;  3WL1 A;  1BKF A;  1FKK A;  4TNS A;  2WLZ A;  4P8U A;  1D7H A;  4ODM A;  4LAW A;  4XAK A;  4HAR A;  2KO7 A;  1HKK A;  3B9A A;  2RUQ A;  2PBC A;  2VN1 A;  2Y78 A;  1ROT A;  4P8X A;  4Z2H A;  3AS1 A;  4MNJ A;  1NWU A;  2ZR4 A;  3PR9 A;  2KGJ A;  4J4N A;  2AOS A;  3TDB A;  5HWC A;  1H0G A;  2G41 A;  4W9Q A;  5HT1 A;  1A7X A;  1HXV A;  3ARU A;  3AS0 A;  3KAF A;  1LG1 A;  3UF8 A;  1F8A B;  1F40 A;  5BXJ A;  1LQ0 A;  2ESC A;  4WKA A;  3O5G A;  2KE0 A;  2RQS A;  1Q6H A;  4ODL A;  1J4H A;  2WK2 A;  5GPR A;  4U85 A;  2XP5 A;  1L1P A;  3RFW A;  1JNT A;  4MNM A;  1FKI A;  3WD0 A;  1N1A A;  1GOI A;  3B9D A;  3O5L A;  3O5R A;  2DPE A;  3VAW A;  4JFJ A;  1K9T A;  2KR7 A;  1JND A;  3O5K A;  3ARW A;  3ARQ A;  1HJW A;  4DT4 A;  2M08 A;  2WM0 A;  4JFL A;  1JVW A;  1M5Y A;  3KCE A;  1SR0 A;  2XPB A;  4N19 A;  3O5J A;  5B8I C;  3ARX A;  3O5Q A;  3CHC A;  1ZB5 A;  1NWT A;  1YW5 A;  2A3E A;  1OGB A;  3GPK A;  1OWQ A;  3CHE A;  1FFR A;  3OOB A;  3NRK A;  1FAP A;  3OA5 A;  1QZ2 A;  4ODR A;  3UQB A;  1FKF A;  4DRH A;  4C02 B;  4DWS C;  4R0X A;  2XP4 A;  4DRO A;  4FAP A;  3ARS A;  5DIV A;  4ZPT R;  4NNR A;  1GUV A;  2FKE A;  4R5E A;  1W9P A;  1FKS A;  3KAC A;  2MLY A;  2PI6 A;  3ARO A;  3ARY A;  3RM4 A;  4IQC A;  3KAD A;  1HJX A;  4IT6 A;  4Z2J A;  1LJY A;  1NH6 A;  4DZ2 A;  2PV2 A;  3KZ7 A;  4QIB A;  3I6C A;  2O9O A;  2F21 A;  2FAP A;  4DWS B;  2A3A A;  1EDQ A;  3B9E A;  4U84 A;  4DRM A;  3KAG A;  1FJD A;  4ODO A;  2FDM A;  1OGG A;  3CH9 A;  3WL0 A;  3PRA A;  2ITK A;  4WKH A;  1FKG A;  3WQV A;  1TCO C;  2ZR6 A;  3JXV A;  5HWB A;  3CGN A;  3KAB A;  2DSW A;  2A3B A;  2PPN A;  2G8Z A;  1NWR A;  2MPH A;  2LKN A;  3ALG A;  2LGO A;  4GGQ A;  4KQZ A;  4ODN A;  2DT0 A;  1B6C A;  3QOK A;  2ZQS A;  2PPP A;  4MPK A;  3KAH A;  3CGM A;  1J4I A;  4KR0 B;  2JZV A;  4ODK A;  2O92 A;  5HUA A;  3AQU A;  1FKH A;  3JYJ A;  4GIV A;  3IKD A;  3KAI A;  4TW6 A;  4JFM A;  1W9U A;  4MNL A;  1ZU8 A;  1WAW A;  2F2D A;  4MTV A;  4MSP A;  3O5I A;  3ODK A;  4TYO A;  4IT4 A;  1KT0 A;  2UZ5 A;  2DSU A;  1QPL A;  4NZC A;  3UQI A;  1HKJ A;  1ZCN A;  4QT3 A;  3WH0 A;  4Z2G A;  4QT2 A;  2DSV A;  1P5Q A;  1J4R A;  5JH8 A;  3UQA A;  4WIW A;  1UR8 A;  2DT3 A;  2IUZ A;  4DZ3 A;  4ZPV R;  4DRP A;  1E9L A;  1Q6U A;  1KT1 A;  4TW8 A;  4MAV A;  2ZQT A;  3AS3 A;  1EHN A;  1FKD A;  3IHZ A;  4TW7 A;  1D6O A;  2ZQV A;  3PRB A;  5HW8 A;  4Q7N A;  3WKZ A;  3LUO A;  3O5M A;  2PV3 A;  3PA7 A;  4AY1 A;  1D7I A;  1UR9 A;  4U86 A;  1W1T A;  4QZV B;  1W9V A;  1NMV A;  4WK9 A;  3ARV A;  3FXY A;  4ZS6 A;  1FKR A;  4IQ2 A;  3WD3 A;  4HBE A;  1ZBW A;  5DEZ A;  1FKL A;  1FFQ A;  1NWS A;  3FY1 A;  1U79 A;  5DIU A;  1LL6 A;  2IF4 A;  2XP7 A;  2L2S A;  2MNT A;  3IK8 A;  1Y0O A;  1HJV A;  5HKG A;  1O6I A;  2DG3 A;  2MLZ A;  3RGC A;  1JNE A;  2A3C A;  2PV1 A;  1TFV A;  3FAP A;  3G6L A;  3UI6 A;  2AWG A;  2VCD A;  1IX5 A;  3MDY B;  1FD9 A;  4MNK A;  4ODQ A;  4LGX A;  2PPO A;  1GPF A;  4P8V A;  4LAY A;  2XP6 A;  3AS2 A;  4PTM A;  3W4R A;  3ARP A;  3CZ8 A;  1E6R A;  2XP9 A;  1VF8 A;  5GQB A;  1T11 A;  3RM9 A;  4DIP A;  4ML4 A;  4JYS A;  2XP8 A;  1J6Y A;  3O5F A;  4WKF A;  3UI5 A;  5I98 A;  2M1I A;  5DO2 A;  5HBF A;  3RM8 A;  3RME A;  1E6P A;  4Q22 A;  4ITZ A;  1KFW A;  2D9F A;  2RSE A;  1YAT A;  2DG9 A;  3O5O A;  1R9H A;  4LAX A;  2RUD A;  3ART A;  3ARZ A;  1FKJ A;  4L72 B;  2ZR5 A;  4WJX A;  2DT1 A;  4S3K A;  4DWS D;  3UI4 A;  5DF0 A;  4FN2 A;  4W9O A;  4L3N A;  2YBU A;  3H9R B;  3NI6 A;  1HKI A;  1X6N A;  2LPV A;  3B8S A;  1W26 A;  2MLX A;  4NSB A;  4W9P A;  1HKM A;  1LL7 A;  5J6E A;  4DRK A;  4MGV A;  1PBK A;  2XPA A;  4ZPW R;  2DG4 A;  4J4O A;  4BF8 A;  1FKT A;  4G2P A;  4G50 A;  2OLH A;  2RUC A;  1EIB A;  3WD1 A;  1W1P A;  1C9H A;  1XRV A;  2DT2 A;  2K8I A;  2Q5A A;  3O5P A;  3TC5 A;  1BL4 A;  1NSG A;  4TX0 A;  4S3J A;  1LL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...