2RSEA

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rseA00
5DIUA 2RURA 4DRKA 4ODLA 2JZVA 4TW7A 5DITA 2XP7A 3IHZA 3KABA 1W26A 4J4NA 4QT3A 1FKSA 3VAWA 5BXJA 4DZ2A 1A7XA 1FKLA 5HWCA 1D7JA 1ZK6A 2PV2A 3MDYB 4G2PA 4J4OA 1FJDA 2LKNA 3TC5A 2IF4A 2DG4A 1FKKA 2RUDA 2XP9A 3O5FA 3O5IA 4BF8A 4R0XA 2N87A 4O2TA 2ZQUA 4DRIA 5B8IC 2Q5AA 1FKHA 1KT1A 1FKTA 4U84A 4DRPA 1R9HA 3I6CA 3PRBA 1C9HA 1M5YA 1YATA 2L2SA 2LGOA 3KCEA 5HWBA 4QT2A 2XPAA 4ODMA 3CGNA 3O5GA 1J4HA 4DRQA 2KGJA 4W9OA 3KADA 4LAXA 1JNSA 4ODNA 4C02B 1D7IA 3KAFA 3FAPA 2FKEA 4ODPA 2MLZA 1FKJA 1FKRA 2RUQA 3O5OA 3OOBA 2M2AA 2M08A 2PV1A 3JYMA 3WH0A 2F2DA 1ROTA 3IK8A 4ODQA 4DIPA 4DH0A 1FKGA 2F4EA 2KE0A 1F8AB 1U79A 4G50A 1N1AA 2D9FA 3CGMA 4FN2A 4IQ2A 4JYSA 5HTGA 3UQIA 2PBCA 3O5QA 1FKDA 5I98A 3TDBA 1QPLA 1ZCNA 4DRJA 4DRMA 1Y0OA 2M1IA 3LUOA 2XPBA 2Y78A 2ZQTA 1D7HA 4JFLA 2MLYA 1FKIA 2ZR5A 3O5RA 2MF9A 1FKFA 1BL4A 2XP8A 3O5JA 2KFWA 1J4IA 2ZQSA 2MNTA 4IPXA 4N19A 4ODOA 1HXVA 3IKDA 5HW8A 3UI6A 2LPVA 1KT0A 4DROA 4JFKA 3O5PA 4MSPA 5HUAA 2FAPA 3KACA 4JFMA 4ODKA 4TNSA 1J4RA 1PINA 4NNRA 5GPGA 3UI4A 2PPOA 3NRKA 1T11A 2XP6A 1Q6HA 2OFNA 1J6YA 4LAWA 3UI5A 2ZR4A 4TW6A 1QZ2A 3O5LA 4QIBA 2AWGA 5HW7A 2MLXA 1BKFA 1NMWA 1YW5A 2RQSA 5DIVA 2VCDA 1TCOC 4JFIA 1JVWA 3H9RB 1Q6IA 2DG9A 1JNTA 2PV3A 3JYJA 4GGQA 3ODKA 1FAPA 3O5DA 1P5QA 2ITKA 4U85A 2VN1A 5HW6A 4W9QA 3KAHA 2KO7A 3O5EA 3PA7A 4ODRA 1EYMA 2PPPA 4DT4A 5J6EA 3UQBA 4DRNA 2XP4A 3PRDA 2UZ5A 2PPNA 1PBKA 5D75A 2XP3A 3NTPA 1EQ3A 3B7XA 3UF8A 3JXVA 3KAGA 4FAPA 2ZQVA 3EY6A 3O5MA 1FKBA 2KI3A 2RSEA 2MPHA 1B6CA 1Q1CA 1QPFA 4DRHA 1Q6UA 2ZR6A 2XP5A 3IKGA 5HKGA 4LAYA 1NSGA 1FD9A 4GIVA 4TW8A 3TCZA 3RGCA 3KZ7A 2F21A 3RFWA 4TX0A 2KR7A 3UQAA 2LJ4A 3KAIA 4MGVA 4IQCA 4TYOA 5HT1A 4DZ3A 4W9PA 1L1PA 1F40A 3NI6A 3O5KA 1ROUA 4LAVA 2K8IA 4JFJA 4ITZA 2RUCA 4U86A 3GPKA 1D6OA 1NMVA 2DG3A
chains in the Genus database with same CATH superfamily
5DIUA 2RURA 4MNMA 2A3CA 3WKZA 5DF0A 1HKJA 5BXJA 4DZ2A 5HWCA 2F23A 3MDYB 2B31A 4J4OA 2LKNA 4ZPVR 2IF4A 2DG4A 3W4RA 2DSZA 4MTVA 2DPEA 4O2TA 5B8IC 2Q5AA 4HBEA 1FKTA 4Q7NA 1OGGA 3WD0A 4ZS6A 2G8ZA 1E15A 2LGOA 1UR8A 1NWRA 3EIPA 1JNSA 2KGJA 3FAPA 4ODPA 3O5OA 1W1TA 2PV1A 3JYMA 2F2DA 2A3AA 4DH0A 1NWTA 1U79A 4WKHA 2DT1A 1GOIA 1LL6A 4DRMA 2XPBA 2Y78A 2ZQTA 1D7HA 3CHFA 1HXVA 4N19A 2ZQSA 3B9AA 3IKDA 1ZBVA 1H0IA 2FAPA 5HUAA 5GPGA 1PINA 4NNRA 4Q22A 2PPOA 1E6ZA 2XP6A 3UI5A 4DWSD 3RMEA 2AWGA 3WD1A 2MLXA 4L72B 2RQSA 3GTYX 2DG9A 4MNJA 2ESCA 1FAPA 2ITKA 1HKIA 4W9QA 2OLHA 3UQBA 3RM4A 4P8VA 4P8UA 4PTMA 4P8WA 5D75A 3NTPA 3B7XA 3B8SA 1VF8A 4S3JA 3EY6A 2KI3A 5DEZA 1B6CA 4DRHA 1Q6UA 2B5UB 2XP5A 3IKGA 5GPRA 4GIVA 2DT3A 2FDMA 3RGCA 1HKKA 3UQAA 4IQCA 1ITXA 3NI6A 1ROUA 2K8IA 1WAWA 1NMVA 5JH8A 4DRKA 2JZVA 4WJXA 4J4NA 1W26A 1E6PA 1A7XA 1D7JA 1W1VA 1ZK6A 4AY1A 1EHNA 2XP9A 3O5FA 4BF8A 4MPKA 2ZQUA 3ARRA 2O92A 4LGXA 4DRPA 3PRBA 1RD6A 1C9HA 5DO2A 1YATA 2L2SA 4MNKA 5HWBA 1NWUA 2XPAA 1J4HA 3WIJA 4ODNA 4C02B 3KAFA 1LJYA 4ZPWR 3WQVA 1W1YA 2M08A 1ZBWA 4DIPA 2F4EA 3ARXA 2KE0A 1F8AB 4G50A 1N1AA 4IQ2A 5HTGA 3QOKA 3AS3A 2DSWA 1Y0OA 4JFLA 3O5RA 1FKFA 4DWSC 2KFWA 4ODOA 3UI6A 1KT0A 4DROA 4JFKA 3KACA 4JFMA 4ODKA 4TNSA 1J4RA 4WK9A 1T11A 1Q6HA 2OFNA 2ZR4A 3O5LA 4QIBA 4S3KA 1EDQA 5HW7A 1LL4A 3WQWA 1JVWA 3H9RB 1Q6IA 4Z2JA 4DWSB 3JYJA 1P5QA 4U85A 4Z2GA 4DWSA 5HW6A 3O5EA 4ODRA 4DT4A 2XP4A 3PRDA 3KAGA 1GUVA 3G6LA 1D2KA 1Q1CA 3CHCA 1ZB5A 4TW8A 5GQBA 3KZ7A 3ARPA 2WM0A 2KR7A 3WD4A 2LJ4A 4MGVA 1L1PA 1JNEA 2RUCA 3GPKA 2DG3A 4URIA 4ODLA 1HKMA 4TW7A 5DITA 3GU0A 3IHZA 4QT3A 3VAWA 1XRVA 2A3EA 2PI6A 4G2PA 1FJDA 3ALFA 4KQZA 1FKKA 2RUDA 1FFRA 3ALGA 4R0XA 3ARVA 1JCHB 3WD2A 1FKHA 1GPFA 1HJVA 1NWSA 3I6CA 1M5YA 3ARUA 3KCEA 3CGNA 4W9OA 3KADA 4LAXA 1JNDA 1KFWA 1FKJA 1FKRA 2RUQA 2M2AA 3WH0A 1FKGA 4QZVB 3WL0A 3PR9A 2D9FA 3CGMA 1HJWA 3G6MA 4ML4A 3UQIA 1FKDA 5I98A 1ZCNA 4XAKA 3CZ8A 2M1IA 1GRJA 1WB0A 1SR0A 3WD3A 4Z2HA 1FFQA 4Z2IA 3O5JA 5HW8A 1SYTA 4NZCA 3RM8A 2DT0A 3UI4A 3WL1A 3ARYA 3CHEA 3NRKA 4Z2KA 4TW6A 1LG2A 1QZ2A 1H0GA 1BKFA 5DIVA 2G41A 2PN0A 1JNTA 2PV3A 2AOSA 3O5DA 2DSVA 3KAHA 2KO7A 3PA7A 2PPPA 3FY1A 2PPNA 1E44A 1PBKA 1EQ3A 4MAVA 3AS1A 3JXVA 4FAPA 3AQUA 1ZU8A 1W9VA 2RSEA 2MPHA 1QPFA 3AS2A 3CH9A 4HBOA 4LAYA 4UDMA 3TCZA 2F21A 4TX0A 2ETNA 3KAIA 5HT1A 4W9PA 4JFJA 4ITZA 4R5EA 2DSUA 4U86A 1HJXA 3B9EA 3ARSA 3ARTA 5HBFA 2WLZA 2XP7A 2O9OA 3KABA 1FKSA 4Z2LA 2YBTA 1FKLA 2PV2A 3TC5A 4NSBA 3O5IA 2N87A 4KR0B 1W9PA 2DT2A 4DRIA 1KT1A 4U84A 4HARA 2IUZA 1X6LA 1R9HA 1UR9A 4P8XA 2A3BA 4WKAA 4QT2A 2WLYA 4ODMA 3O5GA 4DRQA 1E6NA 3ARQA 1LG1A 1D7IA 2FKEA 2MLZA 3OOBA 3BXWA 2WK2A 1ROTA 3IK8A 4ODQA 4ZPTR 1IX5A 4FN2A 4L3NA 1OGBA 4JYSA 2PBCA 3O5QA 4WKFA 3TDBA 1QPLA 4DRJA 3ARWA 1W9UA 3FXYA 3LUOA 3AROA 3AS0A 2MLYA 1FKIA 2ZR5A 2MF9A 1BL4A 2XP8A 1J4IA 4IPXA 1OWQA 2MNTA 1TFVA 2LPVA 3CHDA 1ZBKA 3O5PA 4MSPA 2QF8A 4IT6A 1NH6A 3RM9A 1J6YA 4LAWA 1WNOA 1E6RA 1LQ0A 4WIWA 4IT4A 1NMWA 1YW5A 1CTNA 2VCDA 1TCOC 1ZL1A 4JFIA 3ARZA 3B9DA 3ODKA 4GGQA 2P4VA 3OA5A 2VN1A 4W5UA 5J6EA 1EYMA 1LL7A 1XHGA 4DRNA 2EULA 2UZ5A 1W1PA 2XP3A 3UF8A 1K9TA 2ZQVA 3O5MA 1FKBA 2YBUA 2ZR6A 5HKGA 1NSGA 1FD9A 3BMBA 1X6NA 3RFWA 4TYOA 4DZ3A 1F40A 3O5KA 1O6IA 4LAVA 1E9LA 1EIBA 1ZBCA 1D6OA 3PRAA 4MNLA
chains in the Genus database with same CATH topology
5DIUA 2RURA 4MNMA 2A3CA 3WKZA 5DF0A 1HKJA 5BXJA 4DZ2A 5HWCA 3MDYB 2B31A 4J4OA 2LKNA 4ZPVR 2IF4A 2DG4A 3W4RA 2DSZA 4MTVA 2DPEA 4O2TA 5B8IC 2Q5AA 4HBEA 1FKTA 4Q7NA 1OGGA 3WD0A 4ZS6A 2G8ZA 1E15A 2LGOA 1UR8A 1NWRA 1JNSA 2KGJA 3FAPA 4ODPA 3O5OA 1W1TA 2PV1A 3JYMA 2F2DA 2A3AA 4DH0A 1NWTA 1U79A 4WKHA 2DT1A 1GOIA 1LL6A 4DRMA 2XPBA 2Y78A 2ZQTA 1D7HA 3CHFA 1HXVA 4N19A 2ZQSA 3B9AA 3IKDA 1ZBVA 1H0IA 2FAPA 5HUAA 5GPGA 1PINA 4NNRA 4Q22A 2PPOA 1E6ZA 2XP6A 3UI5A 4DWSD 3RMEA 2AWGA 3WD1A 2MLXA 4L72B 2RQSA 2DG9A 4MNJA 2ESCA 1FAPA 2ITKA 1HKIA 4W9QA 2OLHA 3UQBA 3RM4A 4P8VA 4P8UA 4PTMA 4P8WA 5D75A 3NTPA 3B7XA 3B8SA 1VF8A 4S3JA 3EY6A 2KI3A 5DEZA 1B6CA 4DRHA 1Q6UA 2XP5A 3IKGA 5GPRA 4GIVA 2DT3A 2FDMA 3RGCA 1HKKA 3UQAA 4IQCA 1ITXA 3NI6A 1ROUA 2K8IA 1WAWA 1NMVA 5JH8A 4DRKA 2JZVA 4WJXA 4J4NA 1W26A 1E6PA 1A7XA 1D7JA 1W1VA 1ZK6A 4AY1A 1EHNA 2XP9A 3O5FA 4BF8A 4MPKA 2ZQUA 3ARRA 2O92A 4LGXA 4DRPA 3PRBA 1RD6A 1C9HA 5DO2A 1YATA 2L2SA 4MNKA 5HWBA 1NWUA 2XPAA 1J4HA 3WIJA 4ODNA 4C02B 3KAFA 1LJYA 4ZPWR 3WQVA 1W1YA 2M08A 1ZBWA 4DIPA 2F4EA 3ARXA 2KE0A 1F8AB 4G50A 1N1AA 4IQ2A 5HTGA 3QOKA 3AS3A 2DSWA 1Y0OA 4JFLA 3O5RA 1FKFA 4DWSC 2KFWA 4ODOA 3UI6A 1KT0A 4DROA 4JFKA 3KACA 4JFMA 4ODKA 4TNSA 1J4RA 4WK9A 1T11A 1Q6HA 2OFNA 2ZR4A 3O5LA 4QIBA 4S3KA 1EDQA 5HW7A 1LL4A 3WQWA 1JVWA 3H9RB 1Q6IA 4Z2JA 4DWSB 3JYJA 1P5QA 4U85A 4Z2GA 4DWSA 5HW6A 3O5EA 4ODRA 4DT4A 2XP4A 3PRDA 3KAGA 1GUVA 3G6LA 1D2KA 1Q1CA 3CHCA 1ZB5A 4TW8A 5GQBA 3KZ7A 3ARPA 2WM0A 2KR7A 3WD4A 2LJ4A 4MGVA 1L1PA 1JNEA 2RUCA 3GPKA 2DG3A 4URIA 4ODLA 1HKMA 4TW7A 5DITA 3IHZA 4QT3A 3VAWA 1XRVA 2A3EA 2PI6A 4G2PA 1FJDA 3ALFA 4KQZA 1FKKA 2RUDA 1FFRA 3ALGA 4R0XA 3ARVA 3WD2A 1FKHA 1GPFA 1HJVA 1NWSA 3I6CA 1M5YA 3ARUA 3KCEA 3CGNA 4W9OA 3KADA 4LAXA 1JNDA 1KFWA 1FKJA 1FKRA 2RUQA 2M2AA 3WH0A 1FKGA 4QZVB 3WL0A 3PR9A 2D9FA 3CGMA 1HJWA 3G6MA 4ML4A 3UQIA 1FKDA 5I98A 1ZCNA 4XAKA 3CZ8A 2M1IA 1WB0A 1SR0A 3WD3A 4Z2HA 1FFQA 4Z2IA 3O5JA 5HW8A 1SYTA 4NZCA 3RM8A 2DT0A 3UI4A 3WL1A 3ARYA 3CHEA 3NRKA 4Z2KA 4TW6A 1LG2A 1QZ2A 1H0GA 1BKFA 5DIVA 2G41A 1JNTA 2PV3A 2AOSA 3O5DA 2DSVA 3KAHA 2KO7A 3PA7A 2PPPA 3FY1A 2PPNA 1PBKA 1EQ3A 4MAVA 3AS1A 3JXVA 4FAPA 3AQUA 1ZU8A 1W9VA 2RSEA 2MPHA 1QPFA 3AS2A 3CH9A 4HBOA 4LAYA 3TCZA 2F21A 4TX0A 3KAIA 5HT1A 4W9PA 4JFJA 4ITZA 4R5EA 2DSUA 4U86A 1HJXA 3B9EA 3ARSA 3ARTA 5HBFA 2WLZA 2XP7A 2O9OA 3KABA 1FKSA 4Z2LA 2YBTA 1FKLA 2PV2A 3TC5A 4NSBA 3O5IA 2N87A 4KR0B 1W9PA 2DT2A 4DRIA 1KT1A 4U84A 4HARA 2IUZA 1X6LA 1R9HA 1UR9A 4P8XA 2A3BA 4WKAA 4QT2A 2WLYA 4ODMA 3O5GA 4DRQA 1E6NA 3ARQA 1LG1A 1D7IA 2FKEA 2MLZA 3OOBA 3BXWA 2WK2A 1ROTA 3IK8A 4ODQA 4ZPTR 1IX5A 4FN2A 4L3NA 1OGBA 4JYSA 2PBCA 3O5QA 4WKFA 3TDBA 1QPLA 4DRJA 3ARWA 1W9UA 3FXYA 3LUOA 3AROA 3AS0A 2MLYA 1FKIA 2ZR5A 2MF9A 1BL4A 2XP8A 1J4IA 4IPXA 1OWQA 2MNTA 1TFVA 2LPVA 3CHDA 1ZBKA 3O5PA 4MSPA 2QF8A 4IT6A 1NH6A 3RM9A 1J6YA 4LAWA 1WNOA 1E6RA 1LQ0A 4WIWA 4IT4A 1NMWA 1YW5A 1CTNA 2VCDA 1TCOC 1ZL1A 4JFIA 3ARZA 3B9DA 3ODKA 4GGQA 3OA5A 2VN1A 4W5UA 5J6EA 1EYMA 1LL7A 1XHGA 4DRNA 2UZ5A 1W1PA 2XP3A 3UF8A 1K9TA 2ZQVA 3O5MA 1FKBA 2YBUA 2ZR6A 5HKGA 1NSGA 1FD9A 1X6NA 3RFWA 4TYOA 4DZ3A 1F40A 3O5KA 1O6IA 4LAVA 1E9LA 1EIBA 1ZBCA 1D6OA 3PRAA 4MNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIU A;  2RUR A;  4DRK A;  4ODL A;  2JZV A;  4TW7 A;  5DIT A;  2XP7 A;  3IHZ A;  3KAB A;  1W26 A;  4J4N A;  4QT3 A;  1FKS A;  3VAW A;  5BXJ A;  4DZ2 A;  1A7X A;  1FKL A;  5HWC A;  1D7J A;  1ZK6 A;  2PV2 A;  3MDY B;  4G2P A;  4J4O A;  1FJD A;  2LKN A;  3TC5 A;  2IF4 A;  2DG4 A;  1FKK A;  2RUD A;  2XP9 A;  3O5F A;  3O5I A;  4BF8 A;  4R0X A;  2N87 A;  4O2T A;  2ZQU A;  4DRI A;  5B8I C;  2Q5A A;  1FKH A;  1KT1 A;  1FKT A;  4U84 A;  4DRP A;  1R9H A;  3I6C A;  3PRB A;  1C9H A;  1M5Y A;  1YAT A;  2L2S A;  2LGO A;  3KCE A;  5HWB A;  4QT2 A;  2XPA A;  4ODM A;  3CGN A;  3O5G A;  1J4H A;  4DRQ A;  2KGJ A;  4W9O A;  3KAD A;  4LAX A;  1JNS A;  4ODN A;  4C02 B;  1D7I A;  3KAF A;  3FAP A;  2FKE A;  4ODP A;  2MLZ A;  1FKJ A;  1FKR A;  2RUQ A;  3O5O A;  3OOB A;  2M2A A;  2M08 A;  2PV1 A;  3JYM A;  3WH0 A;  2F2D A;  1ROT A;  3IK8 A;  4ODQ A;  4DIP A;  4DH0 A;  1FKG A;  2F4E A;  2KE0 A;  1F8A B;  1U79 A;  4G50 A;  1N1A A;  2D9F A;  3CGM A;  4FN2 A;  4IQ2 A;  4JYS A;  5HTG A;  3UQI A;  2PBC A;  3O5Q A;  1FKD A;  5I98 A;  3TDB A;  1QPL A;  1ZCN A;  4DRJ A;  4DRM A;  1Y0O A;  2M1I A;  3LUO A;  2XPB A;  2Y78 A;  2ZQT A;  1D7H A;  4JFL A;  2MLY A;  1FKI A;  2ZR5 A;  3O5R A;  2MF9 A;  1FKF A;  1BL4 A;  2XP8 A;  3O5J A;  2KFW A;  1J4I A;  2ZQS A;  2MNT A;  4IPX A;  4N19 A;  4ODO A;  1HXV A;  3IKD A;  5HW8 A;  3UI6 A;  2LPV A;  1KT0 A;  4DRO A;  4JFK A;  3O5P A;  4MSP A;  5HUA A;  2FAP A;  3KAC A;  4JFM A;  4ODK A;  4TNS A;  1J4R A;  1PIN A;  4NNR A;  5GPG A;  3UI4 A;  2PPO A;  3NRK A;  1T11 A;  2XP6 A;  1Q6H A;  2OFN A;  1J6Y A;  4LAW A;  3UI5 A;  2ZR4 A;  4TW6 A;  1QZ2 A;  3O5L A;  4QIB A;  2AWG A;  5HW7 A;  2MLX A;  1BKF A;  1NMW A;  1YW5 A;  2RQS A;  5DIV A;  2VCD A;  1TCO C;  4JFI A;  1JVW A;  3H9R B;  1Q6I A;  2DG9 A;  1JNT A;  2PV3 A;  3JYJ A;  4GGQ A;  3ODK A;  1FAP A;  3O5D A;  1P5Q A;  2ITK A;  4U85 A;  2VN1 A;  5HW6 A;  4W9Q A;  3KAH A;  2KO7 A;  3O5E A;  3PA7 A;  4ODR A;  1EYM A;  2PPP A;  4DT4 A;  5J6E A;  3UQB A;  4DRN A;  2XP4 A;  3PRD A;  2UZ5 A;  2PPN A;  1PBK A;  5D75 A;  2XP3 A;  3NTP A;  1EQ3 A;  3B7X A;  3UF8 A;  3JXV A;  3KAG A;  4FAP A;  2ZQV A;  3EY6 A;  3O5M A;  1FKB A;  2KI3 A;  2RSE A;  2MPH A;  1B6C A;  1Q1C A;  1QPF A;  4DRH A;  1Q6U A;  2ZR6 A;  2XP5 A;  3IKG A;  5HKG A;  4LAY A;  1NSG A;  1FD9 A;  4GIV A;  4TW8 A;  3TCZ A;  3RGC A;  3KZ7 A;  2F21 A;  3RFW A;  4TX0 A;  2KR7 A;  3UQA A;  2LJ4 A;  3KAI A;  4MGV A;  4IQC A;  4TYO A;  5HT1 A;  4DZ3 A;  4W9P A;  1L1P A;  1F40 A;  3NI6 A;  3O5K A;  1ROU A;  4LAV A;  2K8I A;  4JFJ A;  4ITZ A;  2RUC A;  4U86 A;  3GPK A;  1D6O A;  1NMV A;  2DG3 A; 
#chains in the Genus database with same CATH topology
 5DIU A;  2RUR A;  4MNM A;  2A3C A;  3WKZ A;  5DF0 A;  1HKJ A;  5BXJ A;  4DZ2 A;  5HWC A;  2F23 A;  3MDY B;  2B31 A;  4J4O A;  2LKN A;  4ZPV R;  2IF4 A;  2DG4 A;  3W4R A;  2DSZ A;  4MTV A;  2DPE A;  4O2T A;  5B8I C;  2Q5A A;  4HBE A;  1FKT A;  4Q7N A;  1OGG A;  3WD0 A;  4ZS6 A;  2G8Z A;  1E15 A;  2LGO A;  1UR8 A;  1NWR A;  3EIP A;  1JNS A;  2KGJ A;  3FAP A;  4ODP A;  3O5O A;  1W1T A;  2PV1 A;  3JYM A;  2F2D A;  2A3A A;  4DH0 A;  1NWT A;  1U79 A;  4WKH A;  2DT1 A;  1GOI A;  1LL6 A;  4DRM A;  2XPB A;  2Y78 A;  2ZQT A;  1D7H A;  3CHF A;  1HXV A;  4N19 A;  2ZQS A;  3B9A A;  3IKD A;  1ZBV A;  1H0I A;  2FAP A;  5HUA A;  5GPG A;  1PIN A;  4NNR A;  4Q22 A;  2PPO A;  1E6Z A;  2XP6 A;  3UI5 A;  4DWS D;  3RME A;  2AWG A;  3WD1 A;  2MLX A;  4L72 B;  2RQS A;  3GTY X;  2DG9 A;  4MNJ A;  2ESC A;  1FAP A;  2ITK A;  1HKI A;  4W9Q A;  2OLH A;  3UQB A;  3RM4 A;  4P8V A;  4P8U A;  4PTM A;  4P8W A;  5D75 A;  3NTP A;  3B7X A;  3B8S A;  1VF8 A;  4S3J A;  3EY6 A;  2KI3 A;  5DEZ A;  1B6C A;  4DRH A;  1Q6U A;  2B5U B;  2XP5 A;  3IKG A;  5GPR A;  4GIV A;  2DT3 A;  2FDM A;  3RGC A;  1HKK A;  3UQA A;  4IQC A;  1ITX A;  3NI6 A;  1ROU A;  2K8I A;  1WAW A;  1NMV A;  5JH8 A;  4DRK A;  2JZV A;  4WJX A;  4J4N A;  1W26 A;  1E6P A;  1A7X A;  1D7J A;  1W1V A;  1ZK6 A;  4AY1 A;  1EHN A;  2XP9 A;  3O5F A;  4BF8 A;  4MPK A;  2ZQU A;  3ARR A;  2O92 A;  4LGX A;  4DRP A;  3PRB A;  1RD6 A;  1C9H A;  5DO2 A;  1YAT A;  2L2S A;  4MNK A;  5HWB A;  1NWU A;  2XPA A;  1J4H A;  3WIJ A;  4ODN A;  4C02 B;  3KAF A;  1LJY A;  4ZPW R;  3WQV A;  1W1Y A;  2M08 A;  1ZBW A;  4DIP A;  2F4E A;  3ARX A;  2KE0 A;  1F8A B;  4G50 A;  1N1A A;  4IQ2 A;  5HTG A;  3QOK A;  3AS3 A;  2DSW A;  1Y0O A;  4JFL A;  3O5R A;  1FKF A;  4DWS C;  2KFW A;  4ODO A;  3UI6 A;  1KT0 A;  4DRO A;  4JFK A;  3KAC A;  4JFM A;  4ODK A;  4TNS A;  1J4R A;  4WK9 A;  1T11 A;  1Q6H A;  2OFN A;  2ZR4 A;  3O5L A;  4QIB A;  4S3K A;  1EDQ A;  5HW7 A;  1LL4 A;  3WQW A;  1JVW A;  3H9R B;  1Q6I A;  4Z2J A;  4DWS B;  3JYJ A;  1P5Q A;  4U85 A;  4Z2G A;  4DWS A;  5HW6 A;  3O5E A;  4ODR A;  4DT4 A;  2XP4 A;  3PRD A;  3KAG A;  1GUV A;  3G6L A;  1D2K A;  1Q1C A;  3CHC A;  1ZB5 A;  4TW8 A;  5GQB A;  3KZ7 A;  3ARP A;  2WM0 A;  2KR7 A;  3WD4 A;  2LJ4 A;  4MGV A;  1L1P A;  1JNE A;  2RUC A;  3GPK A;  2DG3 A;  4URI A;  4ODL A;  1HKM A;  4TW7 A;  5DIT A;  3GU0 A;  3IHZ A;  4QT3 A;  3VAW A;  1XRV A;  2A3E A;  2PI6 A;  4G2P A;  1FJD A;  3ALF A;  4KQZ A;  1FKK A;  2RUD A;  1FFR A;  3ALG A;  4R0X A;  3ARV A;  1JCH B;  3WD2 A;  1FKH A;  1GPF A;  1HJV A;  1NWS A;  3I6C A;  1M5Y A;  3ARU A;  3KCE A;  3CGN A;  4W9O A;  3KAD A;  4LAX A;  1JND A;  1KFW A;  1FKJ A;  1FKR A;  2RUQ A;  2M2A A;  3WH0 A;  1FKG A;  4QZV B;  3WL0 A;  3PR9 A;  2D9F A;  3CGM A;  1HJW A;  3G6M A;  4ML4 A;  3UQI A;  1FKD A;  5I98 A;  1ZCN A;  4XAK A;  3CZ8 A;  2M1I A;  1GRJ A;  1WB0 A;  1SR0 A;  3WD3 A;  4Z2H A;  1FFQ A;  4Z2I A;  3O5J A;  5HW8 A;  1SYT A;  4NZC A;  3RM8 A;  2DT0 A;  3UI4 A;  3WL1 A;  3ARY A;  3CHE A;  3NRK A;  4Z2K A;  4TW6 A;  1LG2 A;  1QZ2 A;  1H0G A;  1BKF A;  5DIV A;  2G41 A;  2PN0 A;  1JNT A;  2PV3 A;  2AOS A;  3O5D A;  2DSV A;  3KAH A;  2KO7 A;  3PA7 A;  2PPP A;  3FY1 A;  2PPN A;  1E44 A;  1PBK A;  1EQ3 A;  4MAV A;  3AS1 A;  3JXV A;  4FAP A;  3AQU A;  1ZU8 A;  1W9V A;  2RSE A;  2MPH A;  1QPF A;  3AS2 A;  3CH9 A;  4HBO A;  4LAY A;  4UDM A;  3TCZ A;  2F21 A;  4TX0 A;  2ETN A;  3KAI A;  5HT1 A;  4W9P A;  4JFJ A;  4ITZ A;  4R5E A;  2DSU A;  4U86 A;  1HJX A;  3B9E A;  3ARS A;  3ART A;  5HBF A;  2WLZ A;  2XP7 A;  2O9O A;  3KAB A;  1FKS A;  4Z2L A;  2YBT A;  1FKL A;  2PV2 A;  3TC5 A;  4NSB A;  3O5I A;  2N87 A;  4KR0 B;  1W9P A;  2DT2 A;  4DRI A;  1KT1 A;  4U84 A;  4HAR A;  2IUZ A;  1X6L A;  1R9H A;  1UR9 A;  4P8X A;  2A3B A;  4WKA A;  4QT2 A;  2WLY A;  4ODM A;  3O5G A;  4DRQ A;  1E6N A;  3ARQ A;  1LG1 A;  1D7I A;  2FKE A;  2MLZ A;  3OOB A;  3BXW A;  2WK2 A;  1ROT A;  3IK8 A;  4ODQ A;  4ZPT R;  1IX5 A;  4FN2 A;  4L3N A;  1OGB A;  4JYS A;  2PBC A;  3O5Q A;  4WKF A;  3TDB A;  1QPL A;  4DRJ A;  3ARW A;  1W9U A;  3FXY A;  3LUO A;  3ARO A;  3AS0 A;  2MLY A;  1FKI A;  2ZR5 A;  2MF9 A;  1BL4 A;  2XP8 A;  1J4I A;  4IPX A;  1OWQ A;  2MNT A;  1TFV A;  2LPV A;  3CHD A;  1ZBK A;  3O5P A;  4MSP A;  2QF8 A;  4IT6 A;  1NH6 A;  3RM9 A;  1J6Y A;  4LAW A;  1WNO A;  1E6R A;  1LQ0 A;  4WIW A;  4IT4 A;  1NMW A;  1YW5 A;  1CTN A;  2VCD A;  1TCO C;  1ZL1 A;  4JFI A;  3ARZ A;  3B9D A;  3ODK A;  4GGQ A;  2P4V A;  3OA5 A;  2VN1 A;  4W5U A;  5J6E A;  1EYM A;  1LL7 A;  1XHG A;  4DRN A;  2EUL A;  2UZ5 A;  1W1P A;  2XP3 A;  3UF8 A;  1K9T A;  2ZQV A;  3O5M A;  1FKB A;  2YBU A;  2ZR6 A;  5HKG A;  1NSG A;  1FD9 A;  3BMB A;  1X6N A;  3RFW A;  4TYO A;  4DZ3 A;  1F40 A;  3O5K A;  1O6I A;  4LAV A;  1E9L A;  1EIB A;  1ZBC A;  1D6O A;  3PRA A;  4MNL A; 
#chains in the Genus database with same CATH homology
 5DIU A;  2RUR A;  4MNM A;  2A3C A;  3WKZ A;  5DF0 A;  1HKJ A;  5BXJ A;  4DZ2 A;  5HWC A;  3MDY B;  2B31 A;  4J4O A;  2LKN A;  4ZPV R;  2IF4 A;  2DG4 A;  3W4R A;  2DSZ A;  4MTV A;  2DPE A;  4O2T A;  5B8I C;  2Q5A A;  4HBE A;  1FKT A;  4Q7N A;  1OGG A;  3WD0 A;  4ZS6 A;  2G8Z A;  1E15 A;  2LGO A;  1UR8 A;  1NWR A;  1JNS A;  2KGJ A;  3FAP A;  4ODP A;  3O5O A;  1W1T A;  2PV1 A;  3JYM A;  2F2D A;  2A3A A;  4DH0 A;  1NWT A;  1U79 A;  4WKH A;  2DT1 A;  1GOI A;  1LL6 A;  4DRM A;  2XPB A;  2Y78 A;  2ZQT A;  1D7H A;  3CHF A;  1HXV A;  4N19 A;  2ZQS A;  3B9A A;  3IKD A;  1ZBV A;  1H0I A;  2FAP A;  5HUA A;  5GPG A;  1PIN A;  4NNR A;  4Q22 A;  2PPO A;  1E6Z A;  2XP6 A;  3UI5 A;  4DWS D;  3RME A;  2AWG A;  3WD1 A;  2MLX A;  4L72 B;  2RQS A;  2DG9 A;  4MNJ A;  2ESC A;  1FAP A;  2ITK A;  1HKI A;  4W9Q A;  2OLH A;  3UQB A;  3RM4 A;  4P8V A;  4P8U A;  4PTM A;  4P8W A;  5D75 A;  3NTP A;  3B7X A;  3B8S A;  1VF8 A;  4S3J A;  3EY6 A;  2KI3 A;  5DEZ A;  1B6C A;  4DRH A;  1Q6U A;  2XP5 A;  3IKG A;  5GPR A;  4GIV A;  2DT3 A;  2FDM A;  3RGC A;  1HKK A;  3UQA A;  4IQC A;  1ITX A;  3NI6 A;  1ROU A;  2K8I A;  1WAW A;  1NMV A;  5JH8 A;  4DRK A;  2JZV A;  4WJX A;  4J4N A;  1W26 A;  1E6P A;  1A7X A;  1D7J A;  1W1V A;  1ZK6 A;  4AY1 A;  1EHN A;  2XP9 A;  3O5F A;  4BF8 A;  4MPK A;  2ZQU A;  3ARR A;  2O92 A;  4LGX A;  4DRP A;  3PRB A;  1RD6 A;  1C9H A;  5DO2 A;  1YAT A;  2L2S A;  4MNK A;  5HWB A;  1NWU A;  2XPA A;  1J4H A;  3WIJ A;  4ODN A;  4C02 B;  3KAF A;  1LJY A;  4ZPW R;  3WQV A;  1W1Y A;  2M08 A;  1ZBW A;  4DIP A;  2F4E A;  3ARX A;  2KE0 A;  1F8A B;  4G50 A;  1N1A A;  4IQ2 A;  5HTG A;  3QOK A;  3AS3 A;  2DSW A;  1Y0O A;  4JFL A;  3O5R A;  1FKF A;  4DWS C;  2KFW A;  4ODO A;  3UI6 A;  1KT0 A;  4DRO A;  4JFK A;  3KAC A;  4JFM A;  4ODK A;  4TNS A;  1J4R A;  4WK9 A;  1T11 A;  1Q6H A;  2OFN A;  2ZR4 A;  3O5L A;  4QIB A;  4S3K A;  1EDQ A;  5HW7 A;  1LL4 A;  3WQW A;  1JVW A;  3H9R B;  1Q6I A;  4Z2J A;  4DWS B;  3JYJ A;  1P5Q A;  4U85 A;  4Z2G A;  4DWS A;  5HW6 A;  3O5E A;  4ODR A;  4DT4 A;  2XP4 A;  3PRD A;  3KAG A;  1GUV A;  3G6L A;  1D2K A;  1Q1C A;  3CHC A;  1ZB5 A;  4TW8 A;  5GQB A;  3KZ7 A;  3ARP A;  2WM0 A;  2KR7 A;  3WD4 A;  2LJ4 A;  4MGV A;  1L1P A;  1JNE A;  2RUC A;  3GPK A;  2DG3 A;  4URI A;  4ODL A;  1HKM A;  4TW7 A;  5DIT A;  3IHZ A;  4QT3 A;  3VAW A;  1XRV A;  2A3E A;  2PI6 A;  4G2P A;  1FJD A;  3ALF A;  4KQZ A;  1FKK A;  2RUD A;  1FFR A;  3ALG A;  4R0X A;  3ARV A;  3WD2 A;  1FKH A;  1GPF A;  1HJV A;  1NWS A;  3I6C A;  1M5Y A;  3ARU A;  3KCE A;  3CGN A;  4W9O A;  3KAD A;  4LAX A;  1JND A;  1KFW A;  1FKJ A;  1FKR A;  2RUQ A;  2M2A A;  3WH0 A;  1FKG A;  4QZV B;  3WL0 A;  3PR9 A;  2D9F A;  3CGM A;  1HJW A;  3G6M A;  4ML4 A;  3UQI A;  1FKD A;  5I98 A;  1ZCN A;  4XAK A;  3CZ8 A;  2M1I A;  1WB0 A;  1SR0 A;  3WD3 A;  4Z2H A;  1FFQ A;  4Z2I A;  3O5J A;  5HW8 A;  1SYT A;  4NZC A;  3RM8 A;  2DT0 A;  3UI4 A;  3WL1 A;  3ARY A;  3CHE A;  3NRK A;  4Z2K A;  4TW6 A;  1LG2 A;  1QZ2 A;  1H0G A;  1BKF A;  5DIV A;  2G41 A;  1JNT A;  2PV3 A;  2AOS A;  3O5D A;  2DSV A;  3KAH A;  2KO7 A;  3PA7 A;  2PPP A;  3FY1 A;  2PPN A;  1PBK A;  1EQ3 A;  4MAV A;  3AS1 A;  3JXV A;  4FAP A;  3AQU A;  1ZU8 A;  1W9V A;  2RSE A;  2MPH A;  1QPF A;  3AS2 A;  3CH9 A;  4HBO A;  4LAY A;  3TCZ A;  2F21 A;  4TX0 A;  3KAI A;  5HT1 A;  4W9P A;  4JFJ A;  4ITZ A;  4R5E A;  2DSU A;  4U86 A;  1HJX A;  3B9E A;  3ARS A;  3ART A;  5HBF A;  2WLZ A;  2XP7 A;  2O9O A;  3KAB A;  1FKS A;  4Z2L A;  2YBT A;  1FKL A;  2PV2 A;  3TC5 A;  4NSB A;  3O5I A;  2N87 A;  4KR0 B;  1W9P A;  2DT2 A;  4DRI A;  1KT1 A;  4U84 A;  4HAR A;  2IUZ A;  1X6L A;  1R9H A;  1UR9 A;  4P8X A;  2A3B A;  4WKA A;  4QT2 A;  2WLY A;  4ODM A;  3O5G A;  4DRQ A;  1E6N A;  3ARQ A;  1LG1 A;  1D7I A;  2FKE A;  2MLZ A;  3OOB A;  3BXW A;  2WK2 A;  1ROT A;  3IK8 A;  4ODQ A;  4ZPT R;  1IX5 A;  4FN2 A;  4L3N A;  1OGB A;  4JYS A;  2PBC A;  3O5Q A;  4WKF A;  3TDB A;  1QPL A;  4DRJ A;  3ARW A;  1W9U A;  3FXY A;  3LUO A;  3ARO A;  3AS0 A;  2MLY A;  1FKI A;  2ZR5 A;  2MF9 A;  1BL4 A;  2XP8 A;  1J4I A;  4IPX A;  1OWQ A;  2MNT A;  1TFV A;  2LPV A;  3CHD A;  1ZBK A;  3O5P A;  4MSP A;  2QF8 A;  4IT6 A;  1NH6 A;  3RM9 A;  1J6Y A;  4LAW A;  1WNO A;  1E6R A;  1LQ0 A;  4WIW A;  4IT4 A;  1NMW A;  1YW5 A;  1CTN A;  2VCD A;  1TCO C;  1ZL1 A;  4JFI A;  3ARZ A;  3B9D A;  3ODK A;  4GGQ A;  3OA5 A;  2VN1 A;  4W5U A;  5J6E A;  1EYM A;  1LL7 A;  1XHG A;  4DRN A;  2UZ5 A;  1W1P A;  2XP3 A;  3UF8 A;  1K9T A;  2ZQV A;  3O5M A;  1FKB A;  2YBU A;  2ZR6 A;  5HKG A;  1NSG A;  1FD9 A;  1X6N A;  3RFW A;  4TYO A;  4DZ3 A;  1F40 A;  3O5K A;  1O6I A;  4LAV A;  1E9L A;  1EIB A;  1ZBC A;  1D6O A;  3PRA A;  4MNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...