2RSEA

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rseA00
1FKDA 1Q1CA 2XP4A 2XP6A 2F4EA 3FAPA 4GIVA 4R0XA 5DIUA 1J4HA 2XP9A 2XPAA 1NMVA 2UZ5A 4ODKA 4DRHA 4IQCA 2ITKA 5BXJA 3TDBA 4DRKA 4QIBA 4JFLA 2RQSA 1ZCNA 3JXVA 1KT0A 3IK8A 3UQIA 2RSEA 2Y78A 2RUDA 4ODMA 5I98A 2M08A 4LAXA 1TCOC 2DG3A 2IF4A 1FKFA 2PV1A 1FKLA 1P5QA 4FN2A 4JFMA 5HT1A 3UI4A 3KAFA 2ZQSA 3UI6A 2PBCA 4IQ2A 2KFWA 4QT3A 2DG4A 2LGOA 3PRBA 2XP7A 4TW7A 1W26A 1JVWA 3RGCA 1EQ3A 2DG9A 1J4RA 1FKGA 2LJ4A 3O5OA 4QT2A 3UQAA 5GPGA 1Q6HA 2K8IA 2N87A 2JZVA 2PPPA 2PV3A 2AWGA 2XP5A 4LAYA 3KAHA 1FKJA 1N1AA 1QPFA 1EYMA 5HW8A 3IHZA 3KACA 3KAGA 1Y0OA 4C02B 3CGMA 4JFKA 2ZR5A 5HUAA 2KO7A 4JFIA 4TW6A 4U84A 4BF8A 3MDYB 2FKEA 4DRPA 1U79A 2MF9A 3B7XA 4O2TA 1JNSA 1F40A 3PRDA 3NRKA 2M1IA 3O5RA 4DZ3A 3IKGA 1A7XA 3O5QA 3O5PA 4G2PA 3O5LA 3KABA 2PPOA 1FKSA 2XPBA 4JFJA 4LAWA 2XP8A 4DH0A 4GGQA 2KE0A 4ITZA 4NNRA 1YATA 2KR7A 3KADA 4U86A 3NTPA 1B6CA 2VCDA 4DRIA 4LAVA 4TYOA 4MGVA 3JYMA 2OFNA 1J4IA 1ZK6A 4DROA 4DRQA 3PA7A 3H9RB 4ODNA 2Q5AA 2RUQA 2MLXA 3LUOA 3O5FA 2F2DA 1BKFA 2LKNA 1D7JA 4ODRA 3ODKA 3O5MA 4TW8A 1F8AB 3VAWA 4DT4A 1L1PA 1FKKA 1T11A 1NMWA 4MSPA 3UF8A 2ZQTA 2ZR4A 2ZQVA 1JNTA 4IPXA 2MLYA 5HWBA 4U85A 2FAPA 4DIPA 1QZ2A 2MPHA 4ODPA 2MNTA 3EY6A 5HKGA 5J6EA 2VN1A 3KCEA 1R9HA 3O5IA 1PINA 1ROUA 2D9FA 1KT1A 5HTGA 2PV2A 4N19A 3UI5A 4G50A 1FKHA 1NSGA 3I6CA 4TNSA 3O5GA 1FD9A 2F21A 1Q6IA 3GPKA 1BL4A 4DRJA 3O5EA 4TX0A 5DIVA 4JYSA 4DZ2A 1FJDA 5DITA 4ODQA 5HW6A 3TC5A 2ZQUA 4ODLA 1D7IA 3O5DA 5HW7A 3KZ7A 3NI6A 1J6YA 1C9HA 2MLZA 4DRMA 1PBKA 3CGNA 4J4NA 1HXVA 2RUCA 4W9PA 3WH0A 2L2SA 1D7HA 2ZR6A 1FKTA 4FAPA 2PPNA 5HWCA 1YW5A 2KGJA 4J4OA 3RFWA 3JYJA 3O5JA 4W9OA 4DRNA 2KI3A 1Q6UA 2LPVA 1QPLA 2RURA 3IKDA 5D75A 3UQBA 1FAPA 3O5KA 1ROTA 1FKIA 2XP3A 4W9QA 5B8IC 2M2AA 1M5YA 3KAIA 3OOBA 1FKBA 4ODOA 1FKRA 1D6OA 3TCZA
chains in the Genus database with same CATH superfamily
1J4HA 2XPAA 2O9OA 4IQCA 4DRKA 1SR0A 3UQIA 4ZPVR 1FKFA 2B31A 2PV1A 4FN2A 3WD0A 3UI6A 2DSWA 2XP7A 3PRBA 1FFQA 4MNLA 1TFVA 4TW7A 1JVWA 4ZPWR 2DG9A 3OA5A 2LJ4A 3AS3A 3UQAA 2K8IA 3GTYX 1N1AA 1QPFA 2B5UB 1EYMA 4KR0B 4DRPA 2DPEA 3PRDA 3NRKA 1GOIA 2M1IA 4P8XA 4DZ3A 2YBTA 3ARYA 2A3BA 1FFRA 2XPBA 4LAWA 4DH0A 4GGQA 2KE0A 1YATA 3QOKA 4DRQA 2DT0A 4MTVA 3H9RB 4DT4A 1D7JA 3ODKA 1EHNA 4Z2GA 1W1PA 1FKKA 1T11A 3UF8A 2ZR4A 1XHGA 1JNTA 3BMBA 1WB0A 4DIPA 2MNTA 3ARSA 3WKZA 5J6EA 1ROUA 1KT1A 4ML4A 2WLZA 4G50A 4TNSA 1HKMA 3O5GA 2F21A 1UR9A 1ZB5A 3WIJA 4TX0A 4JYSA 3B9DA 2ZQUA 4ODLA 1D7IA 5HW7A 1JNEA 3NI6A 3G6LA 1J6YA 4DRMA 3CGNA 4J4NA 2DSVA 5DF0A 2L2SA 4PTMA 4FAPA 4UDMA 1YW5A 2DT3A 3O5JA 3WL1A 1FAPA 3ALGA 4DWSD 5B8IC 1FKBA 4ODOA 3AS1A 1D6OA 4HBOA 1WNOA 3W4RA 1FKDA 3FAPA 4QZVB 2F4EA 4DRHA 1H0IA 4P8UA 2YBUA 4DWSB 1KT0A 2RUDA 2M08A 1P5QA 1ITXA 4DWSC 4IQ2A 2KFWA 4QT3A 2WK2A 1IX5A 1E44A 1W26A 1EQ3A 1LG1A 2FDMA 3O5OA 2G8ZA 5GPGA 2PV3A 1E6RA 1HJWA 4ZS6A 2XP5A 4LAYA 1FKJA 3RMEA 2ZR5A 1HKIA 1W1YA 2KO7A 4TW6A 4U84A 2MF9A 3B7XA 1JNSA 4HARA 4IT6A 3O5RA 3IKGA 1A7XA 1K9TA 4G2PA 2PN0A 3RM9A 4S3JA 4Q22A 3KADA 2WM0A 3FY1A 3NTPA 1KFWA 1B6CA 2O92A 2ESCA 1NWUA 1J4IA 1X6NA 3PA7A 4LGXA 2RUQA 2MLXA 3PR9A 2F2DA 2LKNA 4TW8A 4MSPA 1NMWA 2ZQTA 5DO2A 2ZQVA 3ARTA 1E6ZA 2MLYA 4IPXA 2FAPA 4ODPA 2DSUA 2DT2A 2VN1A 1OGGA 3KCEA 3O5IA 2F23A 3BXWA 2PV2A 4Z2HA 2DT1A 2WLYA 1NSGA 1HKJA 3RM8A 1FD9A 1Q6IA 4DRJA 3WQWA 1FJDA 1LL4A 3O5DA 1SYTA 1HJXA 3KZ7A 1C9HA 1PBKA 1W1VA 3WH0A 4MPKA 1FKTA 3RM4A 4J4OA 3ARWA 4KQZA 1QPLA 5D75A 1NWSA 2XP3A 4W9QA 3KAIA 4WIWA 4S3KA 2XP4A 1LJYA 4HBEA 5I98A 5DIUA 1NMVA 2UZ5A 2EULA 5BXJA 1NWTA 4JFLA 2RQSA 1ZCNA 3JXVA 2Y78A 1TCOC 2IF4A 1FKLA 4MNMA 4JFMA 2PBCA 2DG4A 1NH6A 4XAKA 1E6NA 1J4RA 1FKGA 4Z2JA 2IUZA 1Q6HA 2PPPA 2N87A 1ZBKA 2JZVA 1RD6A 4MNKA 4WK9A 1Y0OA 4C02B 2DSZA 4WKAA 3CHDA 4BF8A 3MDYB 1U79A 4DWSA 3O5QA 1X6LA 1OGBA 1VF8A 1E6PA 2PPOA 2PI6A 4JFJA 2XP8A 5HTGA 2KR7A 4DRIA 2VCDA 4LAVA 2OLHA 4R5EA 1ZK6A 4AY1A 4ODNA 1E15A 1BKFA 4ODRA 1F8AB 5GQBA 1O6IA 2A3EA 1GUVA 5HWBA 3CHCA 5HKGA 2MPHA 2ETNA 3EY6A 3ARZA 3B9AA 1R9HA 2D9FA 4WKHA 4N19A 1FKHA 1W1TA 3GPKA 1BL4A 3O5EA 4DZ2A 5DITA 1NWRA 4ODQA 5HW6A 1W9PA 4P8WA 2P4VA 1ZL1A 2RUCA 4IT4A 1D7HA 2PPNA 3RFWA 3JYJA 4P8VA 1OWQA 2KI3A 1Q6UA 3IKDA 2AOSA 3O5KA 1ROTA 1FKIA 4Z2IA 1M5YA 2G41A 3ARUA 1EIBA 3TCZA 1Q1CA 2XP6A 4R0XA 4GIVA 2XP9A 3WQVA 1LL7A 4ODKA 4Q7NA 3WD2A 1E9LA 2ITKA 3TDBA 4QIBA 3IK8A 2RSEA 3AS2A 4ODMA 4LAXA 1LL6A 2DG3A 5HT1A 3ARPA 3UI4A 3KAFA 2ZQSA 3B9EA 5HBFA 2LGOA 3RGCA 3WD4A 4L3NA 4QT2A 3PRAA 2AWGA 2A3CA 3AS0A 3KAHA 5JH8A 5HW8A 1D2KA 1JCHB 3IHZA 3KACA 3KAGA 3WD3A 3CGMA 4JFKA 3ARRA 1HKKA 1HJVA 5HUAA 4JFIA 1XRVA 2FKEA 4MNJA 4O2TA 1F40A 1H0GA 1GRJA 4URIA 4NSBA 4Z2KA 1JNDA 3O5PA 4W5UA 3WD1A 3GU0A 3O5LA 3KABA 1FKSA 1W9UA 4NZCA 4ITZA 4NNRA 4U86A 4WJXA 4TYOA 4MGVA 1W9VA 3JYMA 2OFNA 4DROA 2Q5AA 3ARQA 3LUOA 3O5FA 1L1PA 3VAWA 4Z2LA 3O5MA 1ZBCA 3EIPA 3CHEA 3B8SA 3CH9A 1UR8A 2QF8A 3AQUA 4U85A 1QZ2A 1EDQA 1ZU8A 3CHFA 1PINA 2A3AA 3G6MA 1ZBWA 3UI5A 1GPFA 3I6CA 1WAWA 5GPRA 3WL0A 5DIVA 4L72B 3ARVA 1CTNA 3ARXA 4ZPTR 3TC5A 5DEZA 2MLZA 4W9PA 1LQ0A 2ZR6A 3ALFA 5HWCA 2KGJA 4W9OA 3CZ8A 4DRNA 1ZBVA 2LPVA 2RURA 3UQBA 4MAVA 2M2AA 3OOBA 3AROA 3FXYA 1LG2A 1FKRA 4WKFA 1HXVA
chains in the Genus database with same CATH topology
1J4HA 2XPAA 2O9OA 4IQCA 4DRKA 1SR0A 3UQIA 4ZPVR 1FKFA 2B31A 2PV1A 4FN2A 3WD0A 3UI6A 2DSWA 2XP7A 3PRBA 1FFQA 4MNLA 1TFVA 4TW7A 1JVWA 4ZPWR 2DG9A 3OA5A 2LJ4A 3AS3A 3UQAA 2K8IA 1N1AA 1QPFA 1EYMA 4KR0B 4DRPA 2DPEA 3PRDA 3NRKA 1GOIA 2M1IA 4P8XA 4DZ3A 2YBTA 3ARYA 2A3BA 1FFRA 2XPBA 4LAWA 4DH0A 4GGQA 2KE0A 1YATA 3QOKA 4DRQA 2DT0A 4MTVA 3H9RB 4DT4A 1D7JA 3ODKA 1EHNA 4Z2GA 1W1PA 1FKKA 1T11A 3UF8A 2ZR4A 1XHGA 1JNTA 1WB0A 4DIPA 2MNTA 3ARSA 3WKZA 5J6EA 1ROUA 1KT1A 4ML4A 2WLZA 4G50A 4TNSA 1HKMA 3O5GA 2F21A 1UR9A 1ZB5A 3WIJA 4TX0A 4JYSA 3B9DA 2ZQUA 4ODLA 1D7IA 5HW7A 1JNEA 3NI6A 3G6LA 1J6YA 4DRMA 3CGNA 4J4NA 2DSVA 5DF0A 2L2SA 4PTMA 4FAPA 1YW5A 2DT3A 3O5JA 3WL1A 1FAPA 3ALGA 4DWSD 5B8IC 1FKBA 4ODOA 3AS1A 1D6OA 4HBOA 1WNOA 3W4RA 1FKDA 3FAPA 4QZVB 2F4EA 4DRHA 1H0IA 4P8UA 2YBUA 4DWSB 1KT0A 2RUDA 2M08A 1P5QA 1ITXA 4DWSC 4IQ2A 2KFWA 4QT3A 2WK2A 1IX5A 1W26A 1EQ3A 1LG1A 2FDMA 3O5OA 2G8ZA 5GPGA 2PV3A 1E6RA 1HJWA 4ZS6A 2XP5A 4LAYA 1FKJA 3RMEA 2ZR5A 1HKIA 1W1YA 2KO7A 4TW6A 4U84A 2MF9A 3B7XA 1JNSA 4HARA 4IT6A 3O5RA 3IKGA 1A7XA 1K9TA 4G2PA 3RM9A 4S3JA 4Q22A 3KADA 2WM0A 3FY1A 3NTPA 1KFWA 1B6CA 2O92A 2ESCA 1NWUA 1J4IA 1X6NA 3PA7A 4LGXA 2RUQA 2MLXA 3PR9A 2F2DA 2LKNA 4TW8A 4MSPA 1NMWA 2ZQTA 5DO2A 2ZQVA 3ARTA 1E6ZA 2MLYA 4IPXA 2FAPA 4ODPA 2DSUA 2DT2A 2VN1A 1OGGA 3KCEA 3O5IA 3BXWA 2PV2A 4Z2HA 2DT1A 2WLYA 1NSGA 1HKJA 3RM8A 1FD9A 1Q6IA 4DRJA 3WQWA 1FJDA 1LL4A 3O5DA 1SYTA 1HJXA 3KZ7A 1C9HA 1PBKA 1W1VA 3WH0A 4MPKA 1FKTA 3RM4A 4J4OA 3ARWA 4KQZA 1QPLA 5D75A 1NWSA 2XP3A 4W9QA 3KAIA 4WIWA 4S3KA 2XP4A 1LJYA 4HBEA 5I98A 5DIUA 1NMVA 2UZ5A 5BXJA 1NWTA 4JFLA 2RQSA 1ZCNA 3JXVA 2Y78A 1TCOC 2IF4A 1FKLA 4MNMA 4JFMA 2PBCA 2DG4A 1NH6A 4XAKA 1E6NA 1J4RA 1FKGA 4Z2JA 2IUZA 1Q6HA 2PPPA 2N87A 1ZBKA 2JZVA 1RD6A 4MNKA 4WK9A 1Y0OA 4C02B 2DSZA 4WKAA 3CHDA 4BF8A 3MDYB 1U79A 4DWSA 3O5QA 1X6LA 1OGBA 1VF8A 1E6PA 2PPOA 2PI6A 4JFJA 2XP8A 5HTGA 2KR7A 4DRIA 2VCDA 4LAVA 2OLHA 4R5EA 1ZK6A 4AY1A 4ODNA 1E15A 1BKFA 4ODRA 1F8AB 5GQBA 1O6IA 2A3EA 1GUVA 5HWBA 3CHCA 5HKGA 2MPHA 3EY6A 3ARZA 3B9AA 1R9HA 2D9FA 4WKHA 4N19A 1FKHA 1W1TA 3GPKA 1BL4A 3O5EA 4DZ2A 5DITA 1NWRA 4ODQA 5HW6A 1W9PA 4P8WA 1ZL1A 2RUCA 4IT4A 1D7HA 2PPNA 3RFWA 3JYJA 4P8VA 1OWQA 2KI3A 1Q6UA 3IKDA 2AOSA 3O5KA 1ROTA 1FKIA 4Z2IA 1M5YA 2G41A 3ARUA 1EIBA 3TCZA 1Q1CA 2XP6A 4R0XA 4GIVA 2XP9A 3WQVA 1LL7A 4ODKA 4Q7NA 3WD2A 1E9LA 2ITKA 3TDBA 4QIBA 3IK8A 2RSEA 3AS2A 4ODMA 4LAXA 1LL6A 2DG3A 5HT1A 3ARPA 3UI4A 3KAFA 2ZQSA 3B9EA 5HBFA 2LGOA 3RGCA 3WD4A 4L3NA 4QT2A 3PRAA 2AWGA 2A3CA 3AS0A 3KAHA 5JH8A 5HW8A 1D2KA 3IHZA 3KACA 3KAGA 3WD3A 3CGMA 4JFKA 3ARRA 1HKKA 1HJVA 5HUAA 4JFIA 1XRVA 2FKEA 4MNJA 4O2TA 1F40A 1H0GA 4URIA 4NSBA 4Z2KA 1JNDA 3O5PA 4W5UA 3WD1A 3O5LA 3KABA 1FKSA 1W9UA 4NZCA 4ITZA 4NNRA 4U86A 4WJXA 4TYOA 4MGVA 1W9VA 3JYMA 2OFNA 4DROA 2Q5AA 3ARQA 3LUOA 3O5FA 1L1PA 3VAWA 4Z2LA 3O5MA 1ZBCA 3CHEA 3B8SA 3CH9A 1UR8A 2QF8A 3AQUA 4U85A 1QZ2A 1EDQA 1ZU8A 3CHFA 1PINA 2A3AA 3G6MA 1ZBWA 3UI5A 1GPFA 3I6CA 1WAWA 5GPRA 3WL0A 5DIVA 4L72B 3ARVA 1CTNA 3ARXA 4ZPTR 3TC5A 5DEZA 2MLZA 4W9PA 1LQ0A 2ZR6A 3ALFA 5HWCA 2KGJA 4W9OA 3CZ8A 4DRNA 1ZBVA 2LPVA 2RURA 3UQBA 4MAVA 2M2AA 3OOBA 3AROA 3FXYA 1LG2A 1FKRA 4WKFA 1HXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKD A;  1Q1C A;  2XP4 A;  2XP6 A;  2F4E A;  3FAP A;  4GIV A;  4R0X A;  5DIU A;  1J4H A;  2XP9 A;  2XPA A;  1NMV A;  2UZ5 A;  4ODK A;  4DRH A;  4IQC A;  2ITK A;  5BXJ A;  3TDB A;  4DRK A;  4QIB A;  4JFL A;  2RQS A;  1ZCN A;  3JXV A;  1KT0 A;  3IK8 A;  3UQI A;  2RSE A;  2Y78 A;  2RUD A;  4ODM A;  5I98 A;  2M08 A;  4LAX A;  1TCO C;  2DG3 A;  2IF4 A;  1FKF A;  2PV1 A;  1FKL A;  1P5Q A;  4FN2 A;  4JFM A;  5HT1 A;  3UI4 A;  3KAF A;  2ZQS A;  3UI6 A;  2PBC A;  4IQ2 A;  2KFW A;  4QT3 A;  2DG4 A;  2LGO A;  3PRB A;  2XP7 A;  4TW7 A;  1W26 A;  1JVW A;  3RGC A;  1EQ3 A;  2DG9 A;  1J4R A;  1FKG A;  2LJ4 A;  3O5O A;  4QT2 A;  3UQA A;  5GPG A;  1Q6H A;  2K8I A;  2N87 A;  2JZV A;  2PPP A;  2PV3 A;  2AWG A;  2XP5 A;  4LAY A;  3KAH A;  1FKJ A;  1N1A A;  1QPF A;  1EYM A;  5HW8 A;  3IHZ A;  3KAC A;  3KAG A;  1Y0O A;  4C02 B;  3CGM A;  4JFK A;  2ZR5 A;  5HUA A;  2KO7 A;  4JFI A;  4TW6 A;  4U84 A;  4BF8 A;  3MDY B;  2FKE A;  4DRP A;  1U79 A;  2MF9 A;  3B7X A;  4O2T A;  1JNS A;  1F40 A;  3PRD A;  3NRK A;  2M1I A;  3O5R A;  4DZ3 A;  3IKG A;  1A7X A;  3O5Q A;  3O5P A;  4G2P A;  3O5L A;  3KAB A;  2PPO A;  1FKS A;  2XPB A;  4JFJ A;  4LAW A;  2XP8 A;  4DH0 A;  4GGQ A;  2KE0 A;  4ITZ A;  4NNR A;  1YAT A;  2KR7 A;  3KAD A;  4U86 A;  3NTP A;  1B6C A;  2VCD A;  4DRI A;  4LAV A;  4TYO A;  4MGV A;  3JYM A;  2OFN A;  1J4I A;  1ZK6 A;  4DRO A;  4DRQ A;  3PA7 A;  3H9R B;  4ODN A;  2Q5A A;  2RUQ A;  2MLX A;  3LUO A;  3O5F A;  2F2D A;  1BKF A;  2LKN A;  1D7J A;  4ODR A;  3ODK A;  3O5M A;  4TW8 A;  1F8A B;  3VAW A;  4DT4 A;  1L1P A;  1FKK A;  1T11 A;  1NMW A;  4MSP A;  3UF8 A;  2ZQT A;  2ZR4 A;  2ZQV A;  1JNT A;  4IPX A;  2MLY A;  5HWB A;  4U85 A;  2FAP A;  4DIP A;  1QZ2 A;  2MPH A;  4ODP A;  2MNT A;  3EY6 A;  5HKG A;  5J6E A;  2VN1 A;  3KCE A;  1R9H A;  3O5I A;  1PIN A;  1ROU A;  2D9F A;  1KT1 A;  5HTG A;  2PV2 A;  4N19 A;  3UI5 A;  4G50 A;  1FKH A;  1NSG A;  3I6C A;  4TNS A;  3O5G A;  1FD9 A;  2F21 A;  1Q6I A;  3GPK A;  1BL4 A;  4DRJ A;  3O5E A;  4TX0 A;  5DIV A;  4JYS A;  4DZ2 A;  1FJD A;  5DIT A;  4ODQ A;  5HW6 A;  3TC5 A;  2ZQU A;  4ODL A;  1D7I A;  3O5D A;  5HW7 A;  3KZ7 A;  3NI6 A;  1J6Y A;  1C9H A;  2MLZ A;  4DRM A;  1PBK A;  3CGN A;  4J4N A;  1HXV A;  2RUC A;  4W9P A;  3WH0 A;  2L2S A;  1D7H A;  2ZR6 A;  1FKT A;  4FAP A;  2PPN A;  5HWC A;  1YW5 A;  2KGJ A;  4J4O A;  3RFW A;  3JYJ A;  3O5J A;  4W9O A;  4DRN A;  2KI3 A;  1Q6U A;  2LPV A;  1QPL A;  2RUR A;  3IKD A;  5D75 A;  3UQB A;  1FAP A;  3O5K A;  1ROT A;  1FKI A;  2XP3 A;  4W9Q A;  5B8I C;  2M2A A;  1M5Y A;  3KAI A;  3OOB A;  1FKB A;  4ODO A;  1FKR A;  1D6O A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 1J4H A;  2XPA A;  2O9O A;  4IQC A;  4DRK A;  1SR0 A;  3UQI A;  4ZPV R;  1FKF A;  2B31 A;  2PV1 A;  4FN2 A;  3WD0 A;  3UI6 A;  2DSW A;  2XP7 A;  3PRB A;  1FFQ A;  4MNL A;  1TFV A;  4TW7 A;  1JVW A;  4ZPW R;  2DG9 A;  3OA5 A;  2LJ4 A;  3AS3 A;  3UQA A;  2K8I A;  3GTY X;  1N1A A;  1QPF A;  2B5U B;  1EYM A;  4KR0 B;  4DRP A;  2DPE A;  3PRD A;  3NRK A;  1GOI A;  2M1I A;  4P8X A;  4DZ3 A;  2YBT A;  3ARY A;  2A3B A;  1FFR A;  2XPB A;  4LAW A;  4DH0 A;  4GGQ A;  2KE0 A;  1YAT A;  3QOK A;  4DRQ A;  2DT0 A;  4MTV A;  3H9R B;  4DT4 A;  1D7J A;  3ODK A;  1EHN A;  4Z2G A;  1W1P A;  1FKK A;  1T11 A;  3UF8 A;  2ZR4 A;  1XHG A;  1JNT A;  3BMB A;  1WB0 A;  4DIP A;  2MNT A;  3ARS A;  3WKZ A;  5J6E A;  1ROU A;  1KT1 A;  4ML4 A;  2WLZ A;  4G50 A;  4TNS A;  1HKM A;  3O5G A;  2F21 A;  1UR9 A;  1ZB5 A;  3WIJ A;  4TX0 A;  4JYS A;  3B9D A;  2ZQU A;  4ODL A;  1D7I A;  5HW7 A;  1JNE A;  3NI6 A;  3G6L A;  1J6Y A;  4DRM A;  3CGN A;  4J4N A;  2DSV A;  5DF0 A;  2L2S A;  4PTM A;  4FAP A;  4UDM A;  1YW5 A;  2DT3 A;  3O5J A;  3WL1 A;  1FAP A;  3ALG A;  4DWS D;  5B8I C;  1FKB A;  4ODO A;  3AS1 A;  1D6O A;  4HBO A;  1WNO A;  3W4R A;  1FKD A;  3FAP A;  4QZV B;  2F4E A;  4DRH A;  1H0I A;  4P8U A;  2YBU A;  4DWS B;  1KT0 A;  2RUD A;  2M08 A;  1P5Q A;  1ITX A;  4DWS C;  4IQ2 A;  2KFW A;  4QT3 A;  2WK2 A;  1IX5 A;  1E44 A;  1W26 A;  1EQ3 A;  1LG1 A;  2FDM A;  3O5O A;  2G8Z A;  5GPG A;  2PV3 A;  1E6R A;  1HJW A;  4ZS6 A;  2XP5 A;  4LAY A;  1FKJ A;  3RME A;  2ZR5 A;  1HKI A;  1W1Y A;  2KO7 A;  4TW6 A;  4U84 A;  2MF9 A;  3B7X A;  1JNS A;  4HAR A;  4IT6 A;  3O5R A;  3IKG A;  1A7X A;  1K9T A;  4G2P A;  2PN0 A;  3RM9 A;  4S3J A;  4Q22 A;  3KAD A;  2WM0 A;  3FY1 A;  3NTP A;  1KFW A;  1B6C A;  2O92 A;  2ESC A;  1NWU A;  1J4I A;  1X6N A;  3PA7 A;  4LGX A;  2RUQ A;  2MLX A;  3PR9 A;  2F2D A;  2LKN A;  4TW8 A;  4MSP A;  1NMW A;  2ZQT A;  5DO2 A;  2ZQV A;  3ART A;  1E6Z A;  2MLY A;  4IPX A;  2FAP A;  4ODP A;  2DSU A;  2DT2 A;  2VN1 A;  1OGG A;  3KCE A;  3O5I A;  2F23 A;  3BXW A;  2PV2 A;  4Z2H A;  2DT1 A;  2WLY A;  1NSG A;  1HKJ A;  3RM8 A;  1FD9 A;  1Q6I A;  4DRJ A;  3WQW A;  1FJD A;  1LL4 A;  3O5D A;  1SYT A;  1HJX A;  3KZ7 A;  1C9H A;  1PBK A;  1W1V A;  3WH0 A;  4MPK A;  1FKT A;  3RM4 A;  4J4O A;  3ARW A;  4KQZ A;  1QPL A;  5D75 A;  1NWS A;  2XP3 A;  4W9Q A;  3KAI A;  4WIW A;  4S3K A;  2XP4 A;  1LJY A;  4HBE A;  5I98 A;  5DIU A;  1NMV A;  2UZ5 A;  2EUL A;  5BXJ A;  1NWT A;  4JFL A;  2RQS A;  1ZCN A;  3JXV A;  2Y78 A;  1TCO C;  2IF4 A;  1FKL A;  4MNM A;  4JFM A;  2PBC A;  2DG4 A;  1NH6 A;  4XAK A;  1E6N A;  1J4R A;  1FKG A;  4Z2J A;  2IUZ A;  1Q6H A;  2PPP A;  2N87 A;  1ZBK A;  2JZV A;  1RD6 A;  4MNK A;  4WK9 A;  1Y0O A;  4C02 B;  2DSZ A;  4WKA A;  3CHD A;  4BF8 A;  3MDY B;  1U79 A;  4DWS A;  3O5Q A;  1X6L A;  1OGB A;  1VF8 A;  1E6P A;  2PPO A;  2PI6 A;  4JFJ A;  2XP8 A;  5HTG A;  2KR7 A;  4DRI A;  2VCD A;  4LAV A;  2OLH A;  4R5E A;  1ZK6 A;  4AY1 A;  4ODN A;  1E15 A;  1BKF A;  4ODR A;  1F8A B;  5GQB A;  1O6I A;  2A3E A;  1GUV A;  5HWB A;  3CHC A;  5HKG A;  2MPH A;  2ETN A;  3EY6 A;  3ARZ A;  3B9A A;  1R9H A;  2D9F A;  4WKH A;  4N19 A;  1FKH A;  1W1T A;  3GPK A;  1BL4 A;  3O5E A;  4DZ2 A;  5DIT A;  1NWR A;  4ODQ A;  5HW6 A;  1W9P A;  4P8W A;  2P4V A;  1ZL1 A;  2RUC A;  4IT4 A;  1D7H A;  2PPN A;  3RFW A;  3JYJ A;  4P8V A;  1OWQ A;  2KI3 A;  1Q6U A;  3IKD A;  2AOS A;  3O5K A;  1ROT A;  1FKI A;  4Z2I A;  1M5Y A;  2G41 A;  3ARU A;  1EIB A;  3TCZ A;  1Q1C A;  2XP6 A;  4R0X A;  4GIV A;  2XP9 A;  3WQV A;  1LL7 A;  4ODK A;  4Q7N A;  3WD2 A;  1E9L A;  2ITK A;  3TDB A;  4QIB A;  3IK8 A;  2RSE A;  3AS2 A;  4ODM A;  4LAX A;  1LL6 A;  2DG3 A;  5HT1 A;  3ARP A;  3UI4 A;  3KAF A;  2ZQS A;  3B9E A;  5HBF A;  2LGO A;  3RGC A;  3WD4 A;  4L3N A;  4QT2 A;  3PRA A;  2AWG A;  2A3C A;  3AS0 A;  3KAH A;  5JH8 A;  5HW8 A;  1D2K A;  1JCH B;  3IHZ A;  3KAC A;  3KAG A;  3WD3 A;  3CGM A;  4JFK A;  3ARR A;  1HKK A;  1HJV A;  5HUA A;  4JFI A;  1XRV A;  2FKE A;  4MNJ A;  4O2T A;  1F40 A;  1H0G A;  1GRJ A;  4URI A;  4NSB A;  4Z2K A;  1JND A;  3O5P A;  4W5U A;  3WD1 A;  3GU0 A;  3O5L A;  3KAB A;  1FKS A;  1W9U A;  4NZC A;  4ITZ A;  4NNR A;  4U86 A;  4WJX A;  4TYO A;  4MGV A;  1W9V A;  3JYM A;  2OFN A;  4DRO A;  2Q5A A;  3ARQ A;  3LUO A;  3O5F A;  1L1P A;  3VAW A;  4Z2L A;  3O5M A;  1ZBC A;  3EIP A;  3CHE A;  3B8S A;  3CH9 A;  1UR8 A;  2QF8 A;  3AQU A;  4U85 A;  1QZ2 A;  1EDQ A;  1ZU8 A;  3CHF A;  1PIN A;  2A3A A;  3G6M A;  1ZBW A;  3UI5 A;  1GPF A;  3I6C A;  1WAW A;  5GPR A;  3WL0 A;  5DIV A;  4L72 B;  3ARV A;  1CTN A;  3ARX A;  4ZPT R;  3TC5 A;  5DEZ A;  2MLZ A;  4W9P A;  1LQ0 A;  2ZR6 A;  3ALF A;  5HWC A;  2KGJ A;  4W9O A;  3CZ8 A;  4DRN A;  1ZBV A;  2LPV A;  2RUR A;  3UQB A;  4MAV A;  2M2A A;  3OOB A;  3ARO A;  3FXY A;  1LG2 A;  1FKR A;  4WKF A;  1HXV A; 
#chains in the Genus database with same CATH homology
 1J4H A;  2XPA A;  2O9O A;  4IQC A;  4DRK A;  1SR0 A;  3UQI A;  4ZPV R;  1FKF A;  2B31 A;  2PV1 A;  4FN2 A;  3WD0 A;  3UI6 A;  2DSW A;  2XP7 A;  3PRB A;  1FFQ A;  4MNL A;  1TFV A;  4TW7 A;  1JVW A;  4ZPW R;  2DG9 A;  3OA5 A;  2LJ4 A;  3AS3 A;  3UQA A;  2K8I A;  1N1A A;  1QPF A;  1EYM A;  4KR0 B;  4DRP A;  2DPE A;  3PRD A;  3NRK A;  1GOI A;  2M1I A;  4P8X A;  4DZ3 A;  2YBT A;  3ARY A;  2A3B A;  1FFR A;  2XPB A;  4LAW A;  4DH0 A;  4GGQ A;  2KE0 A;  1YAT A;  3QOK A;  4DRQ A;  2DT0 A;  4MTV A;  3H9R B;  4DT4 A;  1D7J A;  3ODK A;  1EHN A;  4Z2G A;  1W1P A;  1FKK A;  1T11 A;  3UF8 A;  2ZR4 A;  1XHG A;  1JNT A;  1WB0 A;  4DIP A;  2MNT A;  3ARS A;  3WKZ A;  5J6E A;  1ROU A;  1KT1 A;  4ML4 A;  2WLZ A;  4G50 A;  4TNS A;  1HKM A;  3O5G A;  2F21 A;  1UR9 A;  1ZB5 A;  3WIJ A;  4TX0 A;  4JYS A;  3B9D A;  2ZQU A;  4ODL A;  1D7I A;  5HW7 A;  1JNE A;  3NI6 A;  3G6L A;  1J6Y A;  4DRM A;  3CGN A;  4J4N A;  2DSV A;  5DF0 A;  2L2S A;  4PTM A;  4FAP A;  1YW5 A;  2DT3 A;  3O5J A;  3WL1 A;  1FAP A;  3ALG A;  4DWS D;  5B8I C;  1FKB A;  4ODO A;  3AS1 A;  1D6O A;  4HBO A;  1WNO A;  3W4R A;  1FKD A;  3FAP A;  4QZV B;  2F4E A;  4DRH A;  1H0I A;  4P8U A;  2YBU A;  4DWS B;  1KT0 A;  2RUD A;  2M08 A;  1P5Q A;  1ITX A;  4DWS C;  4IQ2 A;  2KFW A;  4QT3 A;  2WK2 A;  1IX5 A;  1W26 A;  1EQ3 A;  1LG1 A;  2FDM A;  3O5O A;  2G8Z A;  5GPG A;  2PV3 A;  1E6R A;  1HJW A;  4ZS6 A;  2XP5 A;  4LAY A;  1FKJ A;  3RME A;  2ZR5 A;  1HKI A;  1W1Y A;  2KO7 A;  4TW6 A;  4U84 A;  2MF9 A;  3B7X A;  1JNS A;  4HAR A;  4IT6 A;  3O5R A;  3IKG A;  1A7X A;  1K9T A;  4G2P A;  3RM9 A;  4S3J A;  4Q22 A;  3KAD A;  2WM0 A;  3FY1 A;  3NTP A;  1KFW A;  1B6C A;  2O92 A;  2ESC A;  1NWU A;  1J4I A;  1X6N A;  3PA7 A;  4LGX A;  2RUQ A;  2MLX A;  3PR9 A;  2F2D A;  2LKN A;  4TW8 A;  4MSP A;  1NMW A;  2ZQT A;  5DO2 A;  2ZQV A;  3ART A;  1E6Z A;  2MLY A;  4IPX A;  2FAP A;  4ODP A;  2DSU A;  2DT2 A;  2VN1 A;  1OGG A;  3KCE A;  3O5I A;  3BXW A;  2PV2 A;  4Z2H A;  2DT1 A;  2WLY A;  1NSG A;  1HKJ A;  3RM8 A;  1FD9 A;  1Q6I A;  4DRJ A;  3WQW A;  1FJD A;  1LL4 A;  3O5D A;  1SYT A;  1HJX A;  3KZ7 A;  1C9H A;  1PBK A;  1W1V A;  3WH0 A;  4MPK A;  1FKT A;  3RM4 A;  4J4O A;  3ARW A;  4KQZ A;  1QPL A;  5D75 A;  1NWS A;  2XP3 A;  4W9Q A;  3KAI A;  4WIW A;  4S3K A;  2XP4 A;  1LJY A;  4HBE A;  5I98 A;  5DIU A;  1NMV A;  2UZ5 A;  5BXJ A;  1NWT A;  4JFL A;  2RQS A;  1ZCN A;  3JXV A;  2Y78 A;  1TCO C;  2IF4 A;  1FKL A;  4MNM A;  4JFM A;  2PBC A;  2DG4 A;  1NH6 A;  4XAK A;  1E6N A;  1J4R A;  1FKG A;  4Z2J A;  2IUZ A;  1Q6H A;  2PPP A;  2N87 A;  1ZBK A;  2JZV A;  1RD6 A;  4MNK A;  4WK9 A;  1Y0O A;  4C02 B;  2DSZ A;  4WKA A;  3CHD A;  4BF8 A;  3MDY B;  1U79 A;  4DWS A;  3O5Q A;  1X6L A;  1OGB A;  1VF8 A;  1E6P A;  2PPO A;  2PI6 A;  4JFJ A;  2XP8 A;  5HTG A;  2KR7 A;  4DRI A;  2VCD A;  4LAV A;  2OLH A;  4R5E A;  1ZK6 A;  4AY1 A;  4ODN A;  1E15 A;  1BKF A;  4ODR A;  1F8A B;  5GQB A;  1O6I A;  2A3E A;  1GUV A;  5HWB A;  3CHC A;  5HKG A;  2MPH A;  3EY6 A;  3ARZ A;  3B9A A;  1R9H A;  2D9F A;  4WKH A;  4N19 A;  1FKH A;  1W1T A;  3GPK A;  1BL4 A;  3O5E A;  4DZ2 A;  5DIT A;  1NWR A;  4ODQ A;  5HW6 A;  1W9P A;  4P8W A;  1ZL1 A;  2RUC A;  4IT4 A;  1D7H A;  2PPN A;  3RFW A;  3JYJ A;  4P8V A;  1OWQ A;  2KI3 A;  1Q6U A;  3IKD A;  2AOS A;  3O5K A;  1ROT A;  1FKI A;  4Z2I A;  1M5Y A;  2G41 A;  3ARU A;  1EIB A;  3TCZ A;  1Q1C A;  2XP6 A;  4R0X A;  4GIV A;  2XP9 A;  3WQV A;  1LL7 A;  4ODK A;  4Q7N A;  3WD2 A;  1E9L A;  2ITK A;  3TDB A;  4QIB A;  3IK8 A;  2RSE A;  3AS2 A;  4ODM A;  4LAX A;  1LL6 A;  2DG3 A;  5HT1 A;  3ARP A;  3UI4 A;  3KAF A;  2ZQS A;  3B9E A;  5HBF A;  2LGO A;  3RGC A;  3WD4 A;  4L3N A;  4QT2 A;  3PRA A;  2AWG A;  2A3C A;  3AS0 A;  3KAH A;  5JH8 A;  5HW8 A;  1D2K A;  3IHZ A;  3KAC A;  3KAG A;  3WD3 A;  3CGM A;  4JFK A;  3ARR A;  1HKK A;  1HJV A;  5HUA A;  4JFI A;  1XRV A;  2FKE A;  4MNJ A;  4O2T A;  1F40 A;  1H0G A;  4URI A;  4NSB A;  4Z2K A;  1JND A;  3O5P A;  4W5U A;  3WD1 A;  3O5L A;  3KAB A;  1FKS A;  1W9U A;  4NZC A;  4ITZ A;  4NNR A;  4U86 A;  4WJX A;  4TYO A;  4MGV A;  1W9V A;  3JYM A;  2OFN A;  4DRO A;  2Q5A A;  3ARQ A;  3LUO A;  3O5F A;  1L1P A;  3VAW A;  4Z2L A;  3O5M A;  1ZBC A;  3CHE A;  3B8S A;  3CH9 A;  1UR8 A;  2QF8 A;  3AQU A;  4U85 A;  1QZ2 A;  1EDQ A;  1ZU8 A;  3CHF A;  1PIN A;  2A3A A;  3G6M A;  1ZBW A;  3UI5 A;  1GPF A;  3I6C A;  1WAW A;  5GPR A;  3WL0 A;  5DIV A;  4L72 B;  3ARV A;  1CTN A;  3ARX A;  4ZPT R;  3TC5 A;  5DEZ A;  2MLZ A;  4W9P A;  1LQ0 A;  2ZR6 A;  3ALF A;  5HWC A;  2KGJ A;  4W9O A;  3CZ8 A;  4DRN A;  1ZBV A;  2LPV A;  2RUR A;  3UQB A;  4MAV A;  2M2A A;  3OOB A;  3ARO A;  3FXY A;  1LG2 A;  1FKR A;  4WKF A;  1HXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...