1IX5A

Solution structure of the methanococcus thermolithotrophicus fkbp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
MVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional Solution Structure of an Archaeal FKBP with a Dual Function of Peptidyl Prolyl cis-trans Isomerase and Chaperone-like Activities
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Isomerase
molecule keywords FKBP
total genus 17
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1ix5A00
3PR9A 3PRAA 1IX5A
chains in the Genus database with same CATH superfamily
3GU0A 1U79A 3BMBA 3G6MA 1HKKA 5HTGA 5HW8A 3CGNA 4IT4A 4ZS6A 3O5RA 4P8XA 5GPRA 4QT2A 1D2KA 3UI4A 4FAPA 2YBUA 3CHCA 4U85A 2ZQUA 1UR9A 4MNKA 3RM9A 2ZQTA 2FKEA 3LUOA 4IQCA 1WB0A 4U84A 4WKAA 1K9TA 4QZVB 1FKDA 4ODPA 1EQ3A 5DITA 4MGVA 4DRNA 3IKDA 2DT2A 3W4RA 3O5IA 1YATA 3CHDA 4DWSD 4Z2IA 4L3NA 3B9EA 5GQBA 2RUCA 1FKTA 5DO2A 4ZPWR 1HKJA 1A7XA 1GUVA 3OA5A 2KO7A 1FKJA 1NWSA 3O5LA 2F21A 3WIJA 3ARQA 4DWSB 3RFWA 1LL7A 4ODLA 1D7IA 2MPHA 1H0GA 2A3EA 5HWCA 4DRIA 3BXWA 2XP6A 4QT3A 3JXVA 4WKFA 2MLXA 4WKHA 1OGBA 2YBTA 1FKHA 1ZL1A 1W1VA 2OFNA 2MLYA 1R9HA 4DRPA 2DSVA 3IKGA 2A3CA 5B8IC 4PTMA 1W26A 3ARUA 1M5YA 4JFJA 4G50A 2M1IA 3VAWA 3ODKA 1EDQA 2MF9A 5DF0A 3JYJA 2DG3A 2B5UB 4DZ2A 1LQ0A 1HJWA 1Q6HA 3WD1A 1W1YA 1QZ2A 4IT6A 1O6IA 4JFKA 3KAHA 1IX5A 5GPGA 4J4OA 1PINA 3B8SA 3NRKA 2FAPA 1W1TA 2N87A 2XP4A 1RD6A 1X6LA 3IHZA 4GIVA 1FKRA 5DIVA 2DSUA 1Y0OA 1HKIA 3UF8A 1D6OA 1ROUA 4DH0A 2DSZA 4LAXA 4MSPA 3KAGA 2IUZA 4W9PA 4HBOA 4KR0B 1HXVA 4W9QA 1BL4A 3KAIA 1TCOC 4DRMA 1KFWA 2M08A 4HBEA 3IK8A 3O5GA 2L2SA 4P8WA 4DRJA 3ARSA 1UR8A 3WD0A 1LJYA 1ROTA 1CTNA 1E6ZA 4MAVA 4J4NA 1ZK6A 3AS2A 4DWSC 3O5JA 1FKSA 2M2AA 3ARXA 4ODQA 4WIWA 3EY6A 1JCHB 1E6PA 1W9VA 4TW8A 2PV2A 3AS3A 2WLZA 3O5PA 3UI5A 3CHFA 1E6NA 4TW6A 1QPFA 2RQSA 1HJVA 1ZU8A 3KCEA 3WH0A 2AWGA 3AQUA 4S3JA 2UZ5A 4C02B 1ZCNA 3ARZA 1D7HA 1NH6A 1FKIA 2PPPA 1GRJA 4ITZA 3CGMA 3WL1A 1D7JA 3PR9A 3ARVA 2RUDA 1KT1A 1JVWA 2XP8A 4ZPVR 4DWSA 2QF8A 1W9UA 1FFQA 1FKKA 2D9FA 5DEZA 1WAWA 1J4HA 1T11A 4JFLA 1L1PA 1HJXA 3ARPA 3O5OA 4W5UA 1LG2A 3UQAA 1FKFA 1J4IA 2LGOA 4Q22A 1LL4A 1BKFA 3ALFA 4URIA 1FD9A 3TCZA 1ITXA 1FFRA 5I98A 1OGGA 3B9AA 4ODMA 2XP7A 2KFWA 3ARTA 3GPKA 2PPNA 2WLYA 4Z2GA 5BXJA 4HARA 1ZBCA 4P8VA 1GPFA 2DSWA 5DIUA 4GGQA 1QPLA 1J4RA 4LAVA 1WNOA 2WM0A 2ZR5A 3WQWA 4ODRA 4Z2HA 4S3KA 2XP3A 3NI6A 2LKNA 3O5MA 4WK9A 4N19A 2ESCA 2RUQA 4FN2A 2XPAA 5HWBA 2ZR6A 3KABA 1C9HA 3WD3A 4Z2LA 3UQBA 4LGXA 2MNTA 1F40A 2KE0A 1E15A 4DRKA 4TW7A 3EIPA 1NMVA 4P8UA 2JZVA 2G8ZA 1W1PA 1PBKA 1EYMA 3RMEA 4DT4A 5HT1A 4O2TA 4WJXA 2KGJA 1E44A 4IPXA 2Q5AA 1KT0A 2LPVA 2Y78A 2WK2A 3KADA 2PBCA 1ZB5A 5D75A 1NMWA 1J6YA 1Q6IA 2DPEA 4Q7NA 2PV3A 4DZ3A 3JYMA 1B6CA 2OLHA 4ML4A 4UDMA 1FKLA 2KI3A 3FY1A 4NSBA 3AROA 1W9PA 2ETNA 3CHEA 4DROA 2DT0A 3FAPA 3B9DA 4XAKA 2G41A 3B7XA 1ZBVA 1LG1A 4MNMA 5HW7A 3TDBA 2FDMA 4R5EA 3NTPA 3PRDA 3QOKA 2ITKA 2F23A 1TFVA 3FXYA 2DT1A 1H0IA 1HKMA 1ZBKA 2PN0A 4TNSA 1LL6A 2DG4A 1EHNA 4ZPTR 1NWTA 3PRBA 1FJDA 3WKZA 2RURA 1NSGA 1ZBWA 2AOSA 3KAFA 1N1AA 1OWQA 2XPBA 5HBFA 3KZ7A 3AS1A 1EIBA 1XHGA 4ODKA 1XRVA 1GOIA 2PV1A 4BF8A 2B31A 2LJ4A 3CH9A 3MDYB 4QIBA 4L72B 1JNSA 4AY1A 3RGCA 2XP5A 1F8AB 3I6CA 1VF8A 5HW6A 3WD2A 3G6LA 2VCDA 1FKGA 3O5EA 2ZR4A 5HUAA 2ZQSA 1SYTA 2RSEA 4LAWA 1JNDA 1E6RA 4G2PA 4DIPA 2F4EA 3RM4A 2P4VA 3AS0A 3O5DA 1JNEA 3ARYA 3PA7A 4DRQA 1FKBA 1X6NA 2O9OA 1YW5A 3ALGA 4MNJA 3WD4A 3UI6A 4Z2JA 3TC5A 4IQ2A 3ARWA 4ODOA 2EULA 1Q6UA 3H9RB 1NWUA 2A3BA 3UQIA 2IF4A 3WL0A 2DG9A 3CZ8A 3O5KA 4R0XA 4JFMA 1P5QA 4JYSA 3WQVA 5HKGA 3GTYX 5J6EA 2KR7A 3O5QA 3KACA 3OOBA 1SR0A 4U86A 2MLZA 2PI6A 3ARRA 1FAPA 1Q1CA 2ZQVA 4NZCA 4JFIA 4TYOA 4W9OA 3RM8A 3PRAA 4DRHA 2A3AA 4MTVA 2O92A 4KQZA 1NWRA 4MNLA 4MPKA 4LAYA 2F2DA 2PPOA 1E9LA 4Z2KA 4TX0A 1JNTA 5JH8A 2DT3A 4NNRA 2XP9A 2VN1A 4ODNA 2K8IA 3O5FA
chains in the Genus database with same CATH topology
1U79A 3G6MA 1HKKA 5HTGA 5HW8A 3CGNA 4IT4A 4ZS6A 3O5RA 4P8XA 5GPRA 4QT2A 1D2KA 3UI4A 4FAPA 2YBUA 3CHCA 4U85A 2ZQUA 1UR9A 4MNKA 3RM9A 2ZQTA 2FKEA 3LUOA 4IQCA 1WB0A 4U84A 4WKAA 1K9TA 4QZVB 1FKDA 4ODPA 1EQ3A 5DITA 4MGVA 4DRNA 3IKDA 2DT2A 3W4RA 3O5IA 1YATA 3CHDA 4DWSD 4Z2IA 4L3NA 3B9EA 5GQBA 2RUCA 1FKTA 5DO2A 4ZPWR 1HKJA 1A7XA 1GUVA 3OA5A 2KO7A 1FKJA 1NWSA 3O5LA 2F21A 3WIJA 3ARQA 4DWSB 3RFWA 1LL7A 4ODLA 1D7IA 2MPHA 1H0GA 2A3EA 5HWCA 4DRIA 3BXWA 2XP6A 4QT3A 3JXVA 4WKFA 2MLXA 4WKHA 1OGBA 2YBTA 1FKHA 1ZL1A 1W1VA 2OFNA 2MLYA 1R9HA 4DRPA 2DSVA 3IKGA 2A3CA 5B8IC 4PTMA 1W26A 3ARUA 1M5YA 4JFJA 4G50A 2M1IA 3VAWA 3ODKA 1EDQA 2MF9A 5DF0A 3JYJA 2DG3A 4DZ2A 1LQ0A 1HJWA 1Q6HA 3WD1A 1W1YA 1QZ2A 4IT6A 1O6IA 4JFKA 3KAHA 1IX5A 5GPGA 4J4OA 1PINA 3B8SA 3NRKA 2FAPA 1W1TA 2N87A 2XP4A 1RD6A 1X6LA 3IHZA 4GIVA 1FKRA 5DIVA 2DSUA 1Y0OA 1HKIA 3UF8A 1D6OA 1ROUA 4DH0A 2DSZA 4LAXA 4MSPA 3KAGA 2IUZA 4W9PA 4HBOA 4KR0B 1HXVA 4W9QA 1BL4A 3KAIA 1TCOC 4DRMA 1KFWA 2M08A 4HBEA 3IK8A 3O5GA 2L2SA 4P8WA 4DRJA 3ARSA 1UR8A 3WD0A 1LJYA 1ROTA 1CTNA 1E6ZA 4MAVA 4J4NA 1ZK6A 3AS2A 4DWSC 3O5JA 1FKSA 2M2AA 3ARXA 4ODQA 4WIWA 3EY6A 1E6PA 1W9VA 4TW8A 2PV2A 3AS3A 2WLZA 3O5PA 3UI5A 3CHFA 1E6NA 4TW6A 1QPFA 2RQSA 1HJVA 1ZU8A 3KCEA 3WH0A 2AWGA 3AQUA 4S3JA 2UZ5A 4C02B 1ZCNA 3ARZA 1D7HA 1NH6A 1FKIA 2PPPA 4ITZA 3CGMA 3WL1A 1D7JA 3PR9A 3ARVA 2RUDA 1KT1A 1JVWA 2XP8A 4ZPVR 4DWSA 2QF8A 1W9UA 1FFQA 1FKKA 2D9FA 5DEZA 1WAWA 1J4HA 1T11A 4JFLA 1L1PA 1HJXA 3ARPA 3O5OA 4W5UA 1LG2A 3UQAA 1FKFA 1J4IA 2LGOA 4Q22A 1LL4A 1BKFA 3ALFA 4URIA 1FD9A 3TCZA 1ITXA 1FFRA 5I98A 1OGGA 3B9AA 4ODMA 2XP7A 2KFWA 3ARTA 3GPKA 2PPNA 2WLYA 4Z2GA 5BXJA 4HARA 1ZBCA 4P8VA 1GPFA 2DSWA 5DIUA 4GGQA 1QPLA 1J4RA 4LAVA 1WNOA 2WM0A 2ZR5A 3WQWA 4ODRA 4Z2HA 4S3KA 2XP3A 3NI6A 2LKNA 3O5MA 4WK9A 4N19A 2ESCA 2RUQA 4FN2A 2XPAA 5HWBA 2ZR6A 3KABA 1C9HA 3WD3A 4Z2LA 3UQBA 4LGXA 2MNTA 1F40A 2KE0A 1E15A 4DRKA 4TW7A 1NMVA 4P8UA 2JZVA 2G8ZA 1W1PA 1PBKA 1EYMA 3RMEA 4DT4A 5HT1A 4O2TA 4WJXA 2KGJA 4IPXA 2Q5AA 1KT0A 2LPVA 2Y78A 2WK2A 3KADA 2PBCA 1ZB5A 5D75A 1NMWA 1J6YA 1Q6IA 2DPEA 4Q7NA 2PV3A 4DZ3A 3JYMA 1B6CA 2OLHA 4ML4A 1FKLA 2KI3A 3FY1A 4NSBA 3AROA 1W9PA 3CHEA 4DROA 2DT0A 3FAPA 3B9DA 4XAKA 2G41A 3B7XA 1ZBVA 1LG1A 4MNMA 5HW7A 3TDBA 2FDMA 4R5EA 3NTPA 3PRDA 3QOKA 2ITKA 1TFVA 3FXYA 2DT1A 1H0IA 1HKMA 1ZBKA 4TNSA 1LL6A 2DG4A 1EHNA 4ZPTR 1NWTA 3PRBA 1FJDA 3WKZA 2RURA 1NSGA 1ZBWA 2AOSA 3KAFA 1N1AA 1OWQA 2XPBA 5HBFA 3KZ7A 3AS1A 1EIBA 1XHGA 4ODKA 1XRVA 1GOIA 2PV1A 4BF8A 2B31A 2LJ4A 3CH9A 3MDYB 4QIBA 4L72B 1JNSA 4AY1A 3RGCA 2XP5A 1F8AB 3I6CA 1VF8A 5HW6A 3WD2A 3G6LA 2VCDA 1FKGA 3O5EA 2ZR4A 5HUAA 2ZQSA 1SYTA 2RSEA 4LAWA 1JNDA 1E6RA 4G2PA 4DIPA 2F4EA 3RM4A 3AS0A 3O5DA 1JNEA 3ARYA 3PA7A 4DRQA 1FKBA 1X6NA 2O9OA 1YW5A 3ALGA 4MNJA 3WD4A 3UI6A 4Z2JA 3TC5A 4IQ2A 3ARWA 4ODOA 1Q6UA 3H9RB 1NWUA 2A3BA 3UQIA 2IF4A 3WL0A 2DG9A 3CZ8A 3O5KA 4R0XA 4JFMA 1P5QA 4JYSA 3WQVA 5HKGA 5J6EA 2KR7A 3O5QA 3KACA 3OOBA 1SR0A 4U86A 2MLZA 2PI6A 3ARRA 1FAPA 1Q1CA 2ZQVA 4NZCA 4JFIA 4TYOA 4W9OA 3RM8A 3PRAA 4DRHA 2A3AA 4MTVA 2O92A 4KQZA 1NWRA 4MNLA 4MPKA 4LAYA 2F2DA 2PPOA 1E9LA 4Z2KA 4TX0A 1JNTA 5JH8A 2DT3A 4NNRA 2XP9A 2VN1A 4ODNA 2K8IA 3O5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PR9 A;  3PRA A;  1IX5 A; 
#chains in the Genus database with same CATH topology
 3GU0 A;  1U79 A;  3BMB A;  3G6M A;  1HKK A;  5HTG A;  5HW8 A;  3CGN A;  4IT4 A;  4ZS6 A;  3O5R A;  4P8X A;  5GPR A;  4QT2 A;  1D2K A;  3UI4 A;  4FAP A;  2YBU A;  3CHC A;  4U85 A;  2ZQU A;  1UR9 A;  4MNK A;  3RM9 A;  2ZQT A;  2FKE A;  3LUO A;  4IQC A;  1WB0 A;  4U84 A;  4WKA A;  1K9T A;  4QZV B;  1FKD A;  4ODP A;  1EQ3 A;  5DIT A;  4MGV A;  4DRN A;  3IKD A;  2DT2 A;  3W4R A;  3O5I A;  1YAT A;  3CHD A;  4DWS D;  4Z2I A;  4L3N A;  3B9E A;  5GQB A;  2RUC A;  1FKT A;  5DO2 A;  4ZPW R;  1HKJ A;  1A7X A;  1GUV A;  3OA5 A;  2KO7 A;  1FKJ A;  1NWS A;  3O5L A;  2F21 A;  3WIJ A;  3ARQ A;  4DWS B;  3RFW A;  1LL7 A;  4ODL A;  1D7I A;  2MPH A;  1H0G A;  2A3E A;  5HWC A;  4DRI A;  3BXW A;  2XP6 A;  4QT3 A;  3JXV A;  4WKF A;  2MLX A;  4WKH A;  1OGB A;  2YBT A;  1FKH A;  1ZL1 A;  1W1V A;  2OFN A;  2MLY A;  1R9H A;  4DRP A;  2DSV A;  3IKG A;  2A3C A;  5B8I C;  4PTM A;  1W26 A;  3ARU A;  1M5Y A;  4JFJ A;  4G50 A;  2M1I A;  3VAW A;  3ODK A;  1EDQ A;  2MF9 A;  5DF0 A;  3JYJ A;  2DG3 A;  2B5U B;  4DZ2 A;  1LQ0 A;  1HJW A;  1Q6H A;  3WD1 A;  1W1Y A;  1QZ2 A;  4IT6 A;  1O6I A;  4JFK A;  3KAH A;  1IX5 A;  5GPG A;  4J4O A;  1PIN A;  3B8S A;  3NRK A;  2FAP A;  1W1T A;  2N87 A;  2XP4 A;  1RD6 A;  1X6L A;  3IHZ A;  4GIV A;  1FKR A;  5DIV A;  2DSU A;  1Y0O A;  1HKI A;  3UF8 A;  1D6O A;  1ROU A;  4DH0 A;  2DSZ A;  4LAX A;  4MSP A;  3KAG A;  2IUZ A;  4W9P A;  4HBO A;  4KR0 B;  1HXV A;  4W9Q A;  1BL4 A;  3KAI A;  1TCO C;  4DRM A;  1KFW A;  2M08 A;  4HBE A;  3IK8 A;  3O5G A;  2L2S A;  4P8W A;  4DRJ A;  3ARS A;  1UR8 A;  3WD0 A;  1LJY A;  1ROT A;  1CTN A;  1E6Z A;  4MAV A;  4J4N A;  1ZK6 A;  3AS2 A;  4DWS C;  3O5J A;  1FKS A;  2M2A A;  3ARX A;  4ODQ A;  4WIW A;  3EY6 A;  1JCH B;  1E6P A;  1W9V A;  4TW8 A;  2PV2 A;  3AS3 A;  2WLZ A;  3O5P A;  3UI5 A;  3CHF A;  1E6N A;  4TW6 A;  1QPF A;  2RQS A;  1HJV A;  1ZU8 A;  3KCE A;  3WH0 A;  2AWG A;  3AQU A;  4S3J A;  2UZ5 A;  4C02 B;  1ZCN A;  3ARZ A;  1D7H A;  1NH6 A;  1FKI A;  2PPP A;  1GRJ A;  4ITZ A;  3CGM A;  3WL1 A;  1D7J A;  3PR9 A;  3ARV A;  2RUD A;  1KT1 A;  1JVW A;  2XP8 A;  4ZPV R;  4DWS A;  2QF8 A;  1W9U A;  1FFQ A;  1FKK A;  2D9F A;  5DEZ A;  1WAW A;  1J4H A;  1T11 A;  4JFL A;  1L1P A;  1HJX A;  3ARP A;  3O5O A;  4W5U A;  1LG2 A;  3UQA A;  1FKF A;  1J4I A;  2LGO A;  4Q22 A;  1LL4 A;  1BKF A;  3ALF A;  4URI A;  1FD9 A;  3TCZ A;  1ITX A;  1FFR A;  5I98 A;  1OGG A;  3B9A A;  4ODM A;  2XP7 A;  2KFW A;  3ART A;  3GPK A;  2PPN A;  2WLY A;  4Z2G A;  5BXJ A;  4HAR A;  1ZBC A;  4P8V A;  1GPF A;  2DSW A;  5DIU A;  4GGQ A;  1QPL A;  1J4R A;  4LAV A;  1WNO A;  2WM0 A;  2ZR5 A;  3WQW A;  4ODR A;  4Z2H A;  4S3K A;  2XP3 A;  3NI6 A;  2LKN A;  3O5M A;  4WK9 A;  4N19 A;  2ESC A;  2RUQ A;  4FN2 A;  2XPA A;  5HWB A;  2ZR6 A;  3KAB A;  1C9H A;  3WD3 A;  4Z2L A;  3UQB A;  4LGX A;  2MNT A;  1F40 A;  2KE0 A;  1E15 A;  4DRK A;  4TW7 A;  3EIP A;  1NMV A;  4P8U A;  2JZV A;  2G8Z A;  1W1P A;  1PBK A;  1EYM A;  3RME A;  4DT4 A;  5HT1 A;  4O2T A;  4WJX A;  2KGJ A;  1E44 A;  4IPX A;  2Q5A A;  1KT0 A;  2LPV A;  2Y78 A;  2WK2 A;  3KAD A;  2PBC A;  1ZB5 A;  5D75 A;  1NMW A;  1J6Y A;  1Q6I A;  2DPE A;  4Q7N A;  2PV3 A;  4DZ3 A;  3JYM A;  1B6C A;  2OLH A;  4ML4 A;  4UDM A;  1FKL A;  2KI3 A;  3FY1 A;  4NSB A;  3ARO A;  1W9P A;  2ETN A;  3CHE A;  4DRO A;  2DT0 A;  3FAP A;  3B9D A;  4XAK A;  2G41 A;  3B7X A;  1ZBV A;  1LG1 A;  4MNM A;  5HW7 A;  3TDB A;  2FDM A;  4R5E A;  3NTP A;  3PRD A;  3QOK A;  2ITK A;  2F23 A;  1TFV A;  3FXY A;  2DT1 A;  1H0I A;  1HKM A;  1ZBK A;  2PN0 A;  4TNS A;  1LL6 A;  2DG4 A;  1EHN A;  4ZPT R;  1NWT A;  3PRB A;  1FJD A;  3WKZ A;  2RUR A;  1NSG A;  1ZBW A;  2AOS A;  3KAF A;  1N1A A;  1OWQ A;  2XPB A;  5HBF A;  3KZ7 A;  3AS1 A;  1EIB A;  1XHG A;  4ODK A;  1XRV A;  1GOI A;  2PV1 A;  4BF8 A;  2B31 A;  2LJ4 A;  3CH9 A;  3MDY B;  4QIB A;  4L72 B;  1JNS A;  4AY1 A;  3RGC A;  2XP5 A;  1F8A B;  3I6C A;  1VF8 A;  5HW6 A;  3WD2 A;  3G6L A;  2VCD A;  1FKG A;  3O5E A;  2ZR4 A;  5HUA A;  2ZQS A;  1SYT A;  2RSE A;  4LAW A;  1JND A;  1E6R A;  4G2P A;  4DIP A;  2F4E A;  3RM4 A;  2P4V A;  3AS0 A;  3O5D A;  1JNE A;  3ARY A;  3PA7 A;  4DRQ A;  1FKB A;  1X6N A;  2O9O A;  1YW5 A;  3ALG A;  4MNJ A;  3WD4 A;  3UI6 A;  4Z2J A;  3TC5 A;  4IQ2 A;  3ARW A;  4ODO A;  2EUL A;  1Q6U A;  3H9R B;  1NWU A;  2A3B A;  3UQI A;  2IF4 A;  3WL0 A;  2DG9 A;  3CZ8 A;  3O5K A;  4R0X A;  4JFM A;  1P5Q A;  4JYS A;  3WQV A;  5HKG A;  3GTY X;  5J6E A;  2KR7 A;  3O5Q A;  3KAC A;  3OOB A;  1SR0 A;  4U86 A;  2MLZ A;  2PI6 A;  3ARR A;  1FAP A;  1Q1C A;  2ZQV A;  4NZC A;  4JFI A;  4TYO A;  4W9O A;  3RM8 A;  3PRA A;  4DRH A;  2A3A A;  4MTV A;  2O92 A;  4KQZ A;  1NWR A;  4MNL A;  4MPK A;  4LAY A;  2F2D A;  2PPO A;  1E9L A;  4Z2K A;  4TX0 A;  1JNT A;  5JH8 A;  2DT3 A;  4NNR A;  2XP9 A;  2VN1 A;  4ODN A;  2K8I A;  3O5F A; 
#chains in the Genus database with same CATH homology
 1U79 A;  3G6M A;  1HKK A;  5HTG A;  5HW8 A;  3CGN A;  4IT4 A;  4ZS6 A;  3O5R A;  4P8X A;  5GPR A;  4QT2 A;  1D2K A;  3UI4 A;  4FAP A;  2YBU A;  3CHC A;  4U85 A;  2ZQU A;  1UR9 A;  4MNK A;  3RM9 A;  2ZQT A;  2FKE A;  3LUO A;  4IQC A;  1WB0 A;  4U84 A;  4WKA A;  1K9T A;  4QZV B;  1FKD A;  4ODP A;  1EQ3 A;  5DIT A;  4MGV A;  4DRN A;  3IKD A;  2DT2 A;  3W4R A;  3O5I A;  1YAT A;  3CHD A;  4DWS D;  4Z2I A;  4L3N A;  3B9E A;  5GQB A;  2RUC A;  1FKT A;  5DO2 A;  4ZPW R;  1HKJ A;  1A7X A;  1GUV A;  3OA5 A;  2KO7 A;  1FKJ A;  1NWS A;  3O5L A;  2F21 A;  3WIJ A;  3ARQ A;  4DWS B;  3RFW A;  1LL7 A;  4ODL A;  1D7I A;  2MPH A;  1H0G A;  2A3E A;  5HWC A;  4DRI A;  3BXW A;  2XP6 A;  4QT3 A;  3JXV A;  4WKF A;  2MLX A;  4WKH A;  1OGB A;  2YBT A;  1FKH A;  1ZL1 A;  1W1V A;  2OFN A;  2MLY A;  1R9H A;  4DRP A;  2DSV A;  3IKG A;  2A3C A;  5B8I C;  4PTM A;  1W26 A;  3ARU A;  1M5Y A;  4JFJ A;  4G50 A;  2M1I A;  3VAW A;  3ODK A;  1EDQ A;  2MF9 A;  5DF0 A;  3JYJ A;  2DG3 A;  4DZ2 A;  1LQ0 A;  1HJW A;  1Q6H A;  3WD1 A;  1W1Y A;  1QZ2 A;  4IT6 A;  1O6I A;  4JFK A;  3KAH A;  1IX5 A;  5GPG A;  4J4O A;  1PIN A;  3B8S A;  3NRK A;  2FAP A;  1W1T A;  2N87 A;  2XP4 A;  1RD6 A;  1X6L A;  3IHZ A;  4GIV A;  1FKR A;  5DIV A;  2DSU A;  1Y0O A;  1HKI A;  3UF8 A;  1D6O A;  1ROU A;  4DH0 A;  2DSZ A;  4LAX A;  4MSP A;  3KAG A;  2IUZ A;  4W9P A;  4HBO A;  4KR0 B;  1HXV A;  4W9Q A;  1BL4 A;  3KAI A;  1TCO C;  4DRM A;  1KFW A;  2M08 A;  4HBE A;  3IK8 A;  3O5G A;  2L2S A;  4P8W A;  4DRJ A;  3ARS A;  1UR8 A;  3WD0 A;  1LJY A;  1ROT A;  1CTN A;  1E6Z A;  4MAV A;  4J4N A;  1ZK6 A;  3AS2 A;  4DWS C;  3O5J A;  1FKS A;  2M2A A;  3ARX A;  4ODQ A;  4WIW A;  3EY6 A;  1E6P A;  1W9V A;  4TW8 A;  2PV2 A;  3AS3 A;  2WLZ A;  3O5P A;  3UI5 A;  3CHF A;  1E6N A;  4TW6 A;  1QPF A;  2RQS A;  1HJV A;  1ZU8 A;  3KCE A;  3WH0 A;  2AWG A;  3AQU A;  4S3J A;  2UZ5 A;  4C02 B;  1ZCN A;  3ARZ A;  1D7H A;  1NH6 A;  1FKI A;  2PPP A;  4ITZ A;  3CGM A;  3WL1 A;  1D7J A;  3PR9 A;  3ARV A;  2RUD A;  1KT1 A;  1JVW A;  2XP8 A;  4ZPV R;  4DWS A;  2QF8 A;  1W9U A;  1FFQ A;  1FKK A;  2D9F A;  5DEZ A;  1WAW A;  1J4H A;  1T11 A;  4JFL A;  1L1P A;  1HJX A;  3ARP A;  3O5O A;  4W5U A;  1LG2 A;  3UQA A;  1FKF A;  1J4I A;  2LGO A;  4Q22 A;  1LL4 A;  1BKF A;  3ALF A;  4URI A;  1FD9 A;  3TCZ A;  1ITX A;  1FFR A;  5I98 A;  1OGG A;  3B9A A;  4ODM A;  2XP7 A;  2KFW A;  3ART A;  3GPK A;  2PPN A;  2WLY A;  4Z2G A;  5BXJ A;  4HAR A;  1ZBC A;  4P8V A;  1GPF A;  2DSW A;  5DIU A;  4GGQ A;  1QPL A;  1J4R A;  4LAV A;  1WNO A;  2WM0 A;  2ZR5 A;  3WQW A;  4ODR A;  4Z2H A;  4S3K A;  2XP3 A;  3NI6 A;  2LKN A;  3O5M A;  4WK9 A;  4N19 A;  2ESC A;  2RUQ A;  4FN2 A;  2XPA A;  5HWB A;  2ZR6 A;  3KAB A;  1C9H A;  3WD3 A;  4Z2L A;  3UQB A;  4LGX A;  2MNT A;  1F40 A;  2KE0 A;  1E15 A;  4DRK A;  4TW7 A;  1NMV A;  4P8U A;  2JZV A;  2G8Z A;  1W1P A;  1PBK A;  1EYM A;  3RME A;  4DT4 A;  5HT1 A;  4O2T A;  4WJX A;  2KGJ A;  4IPX A;  2Q5A A;  1KT0 A;  2LPV A;  2Y78 A;  2WK2 A;  3KAD A;  2PBC A;  1ZB5 A;  5D75 A;  1NMW A;  1J6Y A;  1Q6I A;  2DPE A;  4Q7N A;  2PV3 A;  4DZ3 A;  3JYM A;  1B6C A;  2OLH A;  4ML4 A;  1FKL A;  2KI3 A;  3FY1 A;  4NSB A;  3ARO A;  1W9P A;  3CHE A;  4DRO A;  2DT0 A;  3FAP A;  3B9D A;  4XAK A;  2G41 A;  3B7X A;  1ZBV A;  1LG1 A;  4MNM A;  5HW7 A;  3TDB A;  2FDM A;  4R5E A;  3NTP A;  3PRD A;  3QOK A;  2ITK A;  1TFV A;  3FXY A;  2DT1 A;  1H0I A;  1HKM A;  1ZBK A;  4TNS A;  1LL6 A;  2DG4 A;  1EHN A;  4ZPT R;  1NWT A;  3PRB A;  1FJD A;  3WKZ A;  2RUR A;  1NSG A;  1ZBW A;  2AOS A;  3KAF A;  1N1A A;  1OWQ A;  2XPB A;  5HBF A;  3KZ7 A;  3AS1 A;  1EIB A;  1XHG A;  4ODK A;  1XRV A;  1GOI A;  2PV1 A;  4BF8 A;  2B31 A;  2LJ4 A;  3CH9 A;  3MDY B;  4QIB A;  4L72 B;  1JNS A;  4AY1 A;  3RGC A;  2XP5 A;  1F8A B;  3I6C A;  1VF8 A;  5HW6 A;  3WD2 A;  3G6L A;  2VCD A;  1FKG A;  3O5E A;  2ZR4 A;  5HUA A;  2ZQS A;  1SYT A;  2RSE A;  4LAW A;  1JND A;  1E6R A;  4G2P A;  4DIP A;  2F4E A;  3RM4 A;  3AS0 A;  3O5D A;  1JNE A;  3ARY A;  3PA7 A;  4DRQ A;  1FKB A;  1X6N A;  2O9O A;  1YW5 A;  3ALG A;  4MNJ A;  3WD4 A;  3UI6 A;  4Z2J A;  3TC5 A;  4IQ2 A;  3ARW A;  4ODO A;  1Q6U A;  3H9R B;  1NWU A;  2A3B A;  3UQI A;  2IF4 A;  3WL0 A;  2DG9 A;  3CZ8 A;  3O5K A;  4R0X A;  4JFM A;  1P5Q A;  4JYS A;  3WQV A;  5HKG A;  5J6E A;  2KR7 A;  3O5Q A;  3KAC A;  3OOB A;  1SR0 A;  4U86 A;  2MLZ A;  2PI6 A;  3ARR A;  1FAP A;  1Q1C A;  2ZQV A;  4NZC A;  4JFI A;  4TYO A;  4W9O A;  3RM8 A;  3PRA A;  4DRH A;  2A3A A;  4MTV A;  2O92 A;  4KQZ A;  1NWR A;  4MNL A;  4MPK A;  4LAY A;  2F2D A;  2PPO A;  1E9L A;  4Z2K A;  4TX0 A;  1JNT A;  5JH8 A;  2DT3 A;  4NNR A;  2XP9 A;  2VN1 A;  4ODN A;  2K8I A;  3O5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...