1IX5A

Solution structure of the methanococcus thermolithotrophicus fkbp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
MVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP
publication title Three-dimensional Solution Structure of an Archaeal FKBP with a Dual Function of Peptidyl Prolyl cis-trans Isomerase and Chaperone-like Activities
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Isomerase
total genus 17
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1ix5A00
3PR9A 3PRAA 1IX5A
chains in the Genus database with same CATH superfamily
5HT1A 1W1TA 1ZB5A 4ZS6A 3IHZA 4WK9A 1ROTA 4JFKA 4W9QA 2VN1A 1L1PA 3CHDA 4S3JA 2LJ4A 2DG3A 1LG1A 2XP5A 2B31A 2F21A 2ESCA 2P4VA 3FXYA 4P8XA 4DROA 1J6YA 2MLZA 1QPLA 2MNTA 1FKDA 4MGVA 2PV2A 1XHGA 4L3NA 1JNEA 4TW6A 2RUQA 1TFVA 1H0GA 3O5IA 2DPEA 4ODPA 3FY1A 1HXVA 4O2TA 3B9EA 3VAWA 3WIJA 2LKNA 2KFWA 2DG9A 4MSPA 4N19A 2XP3A 2XPBA 2RQSA 1HKJA 4ODLA 3IK8A 3UF8A 4W9PA 1UR9A 2G41A 4MPKA 4QT2A 1A7XA 3RM4A 2A3EA 1BKFA 1J4RA 1B6CA 3RMEA 1ITXA 3ARRA 4PTMA 4U85A 3KACA 1ROUA 2ZQTA 2MLXA 3AQUA 3KAGA 3QOKA 4P8WA 4WJXA 4GGQA 2MF9A 2KE0A 4Q7NA 3IKDA 3MDYB 4LAXA 1PBKA 4TX0A 5HW8A 4WKAA 2D9FA 2KR7A 4IQ2A 3O5OA 2RURA 3WD1A 3ARZA 2F4EA 1C9HA 2O9OA 2JZVA 2B5UB 4DWSA 1OGGA 1W26A 3TCZA 1HKKA 1D6OA 2G8ZA 1XRVA 1R9HA 3I6CA 2PN0A 1W1YA 1LL7A 4JFIA 1SR0A 5HWBA 2EULA 1T11A 3WD2A 1P5QA 2FKEA 3ARUA 4WKFA 4DZ2A 1NH6A 2A3AA 3GU0A 3KAFA 4MAVA 2L2SA 4GIVA 3UQBA 2A3CA 4JYSA 3TC5A 3KAHA 4DRPA 4JFJA 1M5YA 2ETNA 2RUCA 2Y78A 4JFLA 4W5UA 4ODOA 3UI6A 2ITKA 1E15A 1CTNA 5DEZA 3WD3A 3ARWA 2Q5AA 1RD6A 3NRKA 4DRIA 1W1VA 2LPVA 1KT0A 3AS3A 2ZR5A 1LG2A 3RGCA 1GRJA 1FJDA 1FKLA 4ZPWR 1F40A 2XPAA 5B8IC 1JVWA 5HWCA 4P8VA 4Q22A 3AS0A 1FKRA 1FKSA 1TCOC 4Z2GA 4DT4A 4ODRA 1ZBVA 1KFWA 3ARYA 2PV3A 4UDMA 2OLHA 2K8IA 1FKJA 4Z2IA 2ZQVA 3O5QA 5HW7A 1KT1A 2ZR6A 1HJWA 4NZCA 1EQ3A 4LAVA 1FD9A 4QIBA 3ALGA 4IQCA 1FFRA 2IF4A 3NTPA 1HKMA 3B9AA 5DF0A 1JNDA 1LL4A 1FAPA 3BMBA 4JFMA 3ARQA 2DSWA 4MNMA 2KO7A 5GQBA 1J4HA 1D7HA 2M1IA 1NWUA 3CHEA 3H9RB 4ZPVR 4Z2KA 2WK2A 1NMVA 2AWGA 1ZCNA 1E44A 1EHNA 2MPHA 4ODKA 3RM9A 1Y0OA 3EIPA 4HBOA 4IT4A 2PV1A 2UZ5A 4DH0A 3B9DA 3O5GA 3WD4A 2DT2A 4QT3A 4DRQA 2PPNA 1FFQA 1LQ0A 3AROA 4URIA 3LUOA 2WLZA 5HW6A 2FDMA 4DRMA 4Z2HA 3KADA 1LL6A 4G2PA 4IT6A 3O5RA 1NWSA 4U86A 3ARVA 1NMWA 1PINA 5D75A 4ITZA 2ZR4A 3O5DA 4TYOA 3RFWA 3GPKA 3ARPA 2DSUA 1EYMA 4IPXA 2ZQSA 2AOSA 5HKGA 4R5EA 3WQVA 2F23A 4ML4A 4TW8A 1FKKA 2PI6A 1YW5A 5DIVA 3G6MA 2M2AA 4DRNA 2PPPA 2DT3A 1O6IA 3UI4A 3WD0A 5J6EA 1EIBA 1HJXA 4J4NA 5HUAA 1WNOA 4DRHA 1GUVA 4KQZA 2M08A 2XP7A 4WIWA 3NI6A 4MNKA 3FAPA 1QPFA 5HTGA 4XAKA 3WL0A 3OOBA 1UR8A 4ZPTR 5BXJA 1LJYA 2XP8A 2LGOA 2XP4A 5I98A 4U84A 2MLYA 4S3KA 3BXWA 1U79A 1ZL1A 4DWSB 1WAWA 2O92A 3PRAA 1JNSA 4NNRA 3RM8A 1D2KA 3CGNA 3O5PA 1JNTA 3CGMA 5GPRA 4FAPA 4WKHA 3WH0A 1ZBKA 2DG4A 3TDBA 1Q6HA 3WQWA 2WLYA 5DITA 3B7XA 1FKBA 3O5JA 4HARA 1SYTA 1FKGA 3G6LA 3PRBA 3JYJA 1BL4A 1Q6UA 4C02B 3KCEA 2OFNA 1J4IA 1W1PA 1H0IA 1OGBA 1X6LA 1W9UA 4DIPA 3CH9A 3B8SA 2DT1A 3O5FA 4MNLA 3ALFA 3O5MA 1X6NA 2FAPA 1E6ZA 3AS1A 3ARSA 4Z2LA 4TW7A 3EY6A 4DRJA 1GOIA 3CZ8A 2DSVA 4W9OA 4ODMA 4Z2JA 1GPFA 4G50A 4QZVB 1W9PA 2PPOA 4LAWA 3O5EA 4J4OA 1E6PA 3UQIA 4TNSA 2KI3A 3KAIA 4DRKA 1ZK6A 3UQAA 1OWQA 3PR9A 4BF8A 1YATA 1Q1CA 1VF8A 3PA7A 3OA5A 1ZBWA 4MNJA 4P8UA 3KABA 5DO2A 2ZQUA 3UI5A 3CHCA 1FKTA 1NWTA 2F2DA 1IX5A 3WL1A 3ODKA 2PBCA 2A3BA 1Q6IA 4L72B 4DWSD 4KR0B 2N87A 1D7JA 1W9VA 2WM0A 1ZU8A 2QF8A 1E9LA 1FKIA 1FKHA 2DSZA 3ARXA 2DT0A 3O5KA 4DZ3A 1FKFA 1HJVA 1EDQA 3GTYX 4FN2A 5JH8A 4LAYA 5HBFA 4ODQA 2YBUA 2XP6A 1K9TA 1HKIA 3PRDA 2RSEA 3WKZA 1QZ2A 1N1AA 3JYMA 2VCDA 4LGXA 3CHFA 1NSGA 3KZ7A 5GPGA 3JXVA 1E6RA 4DWSC 1ZBCA 4ODNA 2YBTA 1WB0A 3O5LA 5DIUA 2XP9A 1NWRA 1JCHB 1F8AB 3AS2A 3IKGA 4HBEA 4R0XA 2IUZA 3ARTA 1E6NA 3W4RA 4MTVA 4NSBA 4AY1A 1D7IA 2RUDA 2KGJA
chains in the Genus database with same CATH topology
5HT1A 1W1TA 1ZB5A 4ZS6A 3IHZA 4WK9A 1ROTA 4JFKA 4W9QA 2VN1A 1L1PA 3CHDA 4S3JA 2LJ4A 2DG3A 1LG1A 2XP5A 2B31A 2F21A 2ESCA 3FXYA 4P8XA 4DROA 1J6YA 2MLZA 1QPLA 2MNTA 1FKDA 4MGVA 2PV2A 1XHGA 4L3NA 1JNEA 4TW6A 2RUQA 1TFVA 1H0GA 3O5IA 2DPEA 4ODPA 3FY1A 1HXVA 4O2TA 3B9EA 3VAWA 3WIJA 2LKNA 2KFWA 2DG9A 4MSPA 4N19A 2XP3A 2XPBA 2RQSA 1HKJA 4ODLA 3IK8A 3UF8A 4W9PA 1UR9A 2G41A 4MPKA 4QT2A 1A7XA 3RM4A 2A3EA 1BKFA 1J4RA 1B6CA 3RMEA 1ITXA 3ARRA 4PTMA 4U85A 3KACA 1ROUA 2ZQTA 2MLXA 3AQUA 3KAGA 3QOKA 4P8WA 4WJXA 4GGQA 2MF9A 2KE0A 4Q7NA 3IKDA 3MDYB 4LAXA 1PBKA 4TX0A 5HW8A 4WKAA 2D9FA 2KR7A 4IQ2A 3O5OA 2RURA 3WD1A 3ARZA 2F4EA 1C9HA 2O9OA 2JZVA 4DWSA 1OGGA 1W26A 3TCZA 1HKKA 1D6OA 2G8ZA 1XRVA 1R9HA 3I6CA 1W1YA 1LL7A 4JFIA 1SR0A 5HWBA 3WD2A 1T11A 1P5QA 2FKEA 3ARUA 4WKFA 4DZ2A 1NH6A 2A3AA 4MAVA 3KAFA 2L2SA 4GIVA 3UQBA 2A3CA 4JYSA 3TC5A 3KAHA 4DRPA 4JFJA 1M5YA 2RUCA 2Y78A 4JFLA 4W5UA 4ODOA 3UI6A 2ITKA 1E15A 1CTNA 5DEZA 3WD3A 3ARWA 2Q5AA 1RD6A 3NRKA 4DRIA 1W1VA 2LPVA 1KT0A 3AS3A 2ZR5A 1LG2A 3RGCA 1FJDA 1FKLA 4ZPWR 1F40A 2XPAA 5B8IC 1JVWA 5HWCA 4P8VA 4Q22A 3AS0A 1FKRA 1FKSA 1TCOC 4Z2GA 4DT4A 4ODRA 1ZBVA 1KFWA 3ARYA 2PV3A 2OLHA 2K8IA 1FKJA 4Z2IA 2ZQVA 3O5QA 5HW7A 1KT1A 2ZR6A 1HJWA 4NZCA 1EQ3A 4LAVA 1FD9A 4QIBA 3ALGA 4IQCA 1FFRA 2IF4A 3NTPA 1HKMA 3B9AA 5DF0A 1JNDA 1LL4A 1FAPA 4JFMA 3ARQA 2DSWA 4MNMA 2KO7A 5GQBA 1J4HA 1D7HA 2M1IA 1NWUA 3CHEA 3H9RB 4ZPVR 4Z2KA 2WK2A 1NMVA 2AWGA 1ZCNA 1EHNA 2MPHA 4ODKA 3RM9A 1Y0OA 4HBOA 4IT4A 2PV1A 2UZ5A 4DH0A 3B9DA 3O5GA 3WD4A 2DT2A 4QT3A 4DRQA 2PPNA 1FFQA 1LQ0A 3AROA 4URIA 3LUOA 2WLZA 5HW6A 2FDMA 4DRMA 4Z2HA 3KADA 1LL6A 4G2PA 4IT6A 3O5RA 1NWSA 4U86A 3ARVA 1NMWA 1PINA 5D75A 4ITZA 2ZR4A 3O5DA 4TYOA 3RFWA 3GPKA 3ARPA 2DSUA 1EYMA 4IPXA 2ZQSA 2AOSA 5HKGA 4R5EA 3WQVA 4ML4A 4TW8A 1FKKA 2PI6A 1YW5A 5DIVA 3G6MA 2M2AA 4DRNA 2PPPA 2DT3A 1O6IA 3UI4A 3WD0A 5J6EA 1EIBA 1HJXA 4J4NA 5HUAA 1WNOA 4DRHA 1GUVA 4KQZA 2M08A 2XP7A 4WIWA 3NI6A 4MNKA 3FAPA 1QPFA 5HTGA 4XAKA 3WL0A 3OOBA 1UR8A 4ZPTR 5BXJA 1LJYA 2XP8A 2LGOA 2XP4A 5I98A 4U84A 2MLYA 4S3KA 3BXWA 1U79A 1ZL1A 4DWSB 1WAWA 2O92A 3PRAA 1JNSA 4NNRA 3RM8A 1D2KA 3CGNA 3O5PA 1JNTA 3CGMA 5GPRA 4FAPA 4WKHA 3WH0A 1ZBKA 2DG4A 3TDBA 1Q6HA 3WQWA 2WLYA 5DITA 3B7XA 1FKBA 3O5JA 4HARA 1SYTA 1FKGA 3G6LA 3PRBA 3JYJA 1BL4A 1Q6UA 4C02B 3KCEA 2OFNA 1J4IA 1W1PA 1H0IA 1OGBA 1X6LA 1W9UA 4DIPA 3CH9A 3B8SA 2DT1A 3O5FA 4MNLA 3ALFA 3O5MA 1X6NA 2FAPA 1E6ZA 3AS1A 3ARSA 4Z2LA 4TW7A 3EY6A 4DRJA 1GOIA 3CZ8A 2DSVA 4W9OA 4ODMA 4Z2JA 1GPFA 4G50A 4QZVB 1W9PA 2PPOA 4LAWA 3O5EA 4J4OA 1E6PA 3UQIA 4TNSA 2KI3A 3KAIA 4DRKA 1ZK6A 3UQAA 1OWQA 3PR9A 4BF8A 1YATA 1Q1CA 1VF8A 3PA7A 3OA5A 1ZBWA 4MNJA 4P8UA 3KABA 5DO2A 2ZQUA 3UI5A 3CHCA 1FKTA 1NWTA 2F2DA 1IX5A 3WL1A 3ODKA 2PBCA 2A3BA 1Q6IA 4L72B 4DWSD 4KR0B 2N87A 1D7JA 1W9VA 2WM0A 1ZU8A 2QF8A 1E9LA 1FKIA 1FKHA 2DSZA 3ARXA 2DT0A 3O5KA 4DZ3A 1FKFA 1HJVA 1EDQA 4FN2A 5JH8A 4LAYA 5HBFA 4ODQA 2YBUA 2XP6A 1K9TA 1HKIA 3PRDA 2RSEA 3WKZA 1QZ2A 1N1AA 3JYMA 2VCDA 4LGXA 3CHFA 1NSGA 3KZ7A 5GPGA 3JXVA 1E6RA 4DWSC 1ZBCA 4ODNA 2YBTA 1WB0A 3O5LA 5DIUA 2XP9A 1NWRA 1F8AB 3AS2A 3IKGA 4HBEA 4R0XA 2IUZA 3ARTA 1E6NA 3W4RA 4MTVA 4NSBA 4AY1A 1D7IA 2RUDA 2KGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PR9 A;  3PRA A;  1IX5 A; 
#chains in the Genus database with same CATH topology
 5HT1 A;  1W1T A;  1ZB5 A;  4ZS6 A;  3IHZ A;  4WK9 A;  1ROT A;  4JFK A;  4W9Q A;  2VN1 A;  1L1P A;  3CHD A;  4S3J A;  2LJ4 A;  2DG3 A;  1LG1 A;  2XP5 A;  2B31 A;  2F21 A;  2ESC A;  2P4V A;  3FXY A;  4P8X A;  4DRO A;  1J6Y A;  2MLZ A;  1QPL A;  2MNT A;  1FKD A;  4MGV A;  2PV2 A;  1XHG A;  4L3N A;  1JNE A;  4TW6 A;  2RUQ A;  1TFV A;  1H0G A;  3O5I A;  2DPE A;  4ODP A;  3FY1 A;  1HXV A;  4O2T A;  3B9E A;  3VAW A;  3WIJ A;  2LKN A;  2KFW A;  2DG9 A;  4MSP A;  4N19 A;  2XP3 A;  2XPB A;  2RQS A;  1HKJ A;  4ODL A;  3IK8 A;  3UF8 A;  4W9P A;  1UR9 A;  2G41 A;  4MPK A;  4QT2 A;  1A7X A;  3RM4 A;  2A3E A;  1BKF A;  1J4R A;  1B6C A;  3RME A;  1ITX A;  3ARR A;  4PTM A;  4U85 A;  3KAC A;  1ROU A;  2ZQT A;  2MLX A;  3AQU A;  3KAG A;  3QOK A;  4P8W A;  4WJX A;  4GGQ A;  2MF9 A;  2KE0 A;  4Q7N A;  3IKD A;  3MDY B;  4LAX A;  1PBK A;  4TX0 A;  5HW8 A;  4WKA A;  2D9F A;  2KR7 A;  4IQ2 A;  3O5O A;  2RUR A;  3WD1 A;  3ARZ A;  2F4E A;  1C9H A;  2O9O A;  2JZV A;  2B5U B;  4DWS A;  1OGG A;  1W26 A;  3TCZ A;  1HKK A;  1D6O A;  2G8Z A;  1XRV A;  1R9H A;  3I6C A;  2PN0 A;  1W1Y A;  1LL7 A;  4JFI A;  1SR0 A;  5HWB A;  2EUL A;  1T11 A;  3WD2 A;  1P5Q A;  2FKE A;  3ARU A;  4WKF A;  4DZ2 A;  1NH6 A;  2A3A A;  3GU0 A;  3KAF A;  4MAV A;  2L2S A;  4GIV A;  3UQB A;  2A3C A;  4JYS A;  3TC5 A;  3KAH A;  4DRP A;  4JFJ A;  1M5Y A;  2ETN A;  2RUC A;  2Y78 A;  4JFL A;  4W5U A;  4ODO A;  3UI6 A;  2ITK A;  1E15 A;  1CTN A;  5DEZ A;  3WD3 A;  3ARW A;  2Q5A A;  1RD6 A;  3NRK A;  4DRI A;  1W1V A;  2LPV A;  1KT0 A;  3AS3 A;  2ZR5 A;  1LG2 A;  3RGC A;  1GRJ A;  1FJD A;  1FKL A;  4ZPW R;  1F40 A;  2XPA A;  5B8I C;  1JVW A;  5HWC A;  4P8V A;  4Q22 A;  3AS0 A;  1FKR A;  1FKS A;  1TCO C;  4Z2G A;  4DT4 A;  4ODR A;  1ZBV A;  1KFW A;  3ARY A;  2PV3 A;  4UDM A;  2OLH A;  2K8I A;  1FKJ A;  4Z2I A;  2ZQV A;  3O5Q A;  5HW7 A;  1KT1 A;  2ZR6 A;  1HJW A;  4NZC A;  1EQ3 A;  4LAV A;  1FD9 A;  4QIB A;  3ALG A;  4IQC A;  1FFR A;  2IF4 A;  3NTP A;  1HKM A;  3B9A A;  5DF0 A;  1JND A;  1LL4 A;  1FAP A;  3BMB A;  4JFM A;  3ARQ A;  2DSW A;  4MNM A;  2KO7 A;  5GQB A;  1J4H A;  1D7H A;  2M1I A;  1NWU A;  3CHE A;  3H9R B;  4ZPV R;  4Z2K A;  2WK2 A;  1NMV A;  2AWG A;  1ZCN A;  1E44 A;  1EHN A;  2MPH A;  4ODK A;  3RM9 A;  1Y0O A;  3EIP A;  4HBO A;  4IT4 A;  2PV1 A;  2UZ5 A;  4DH0 A;  3B9D A;  3O5G A;  3WD4 A;  2DT2 A;  4QT3 A;  4DRQ A;  2PPN A;  1FFQ A;  1LQ0 A;  3ARO A;  4URI A;  3LUO A;  2WLZ A;  5HW6 A;  2FDM A;  4DRM A;  4Z2H A;  3KAD A;  1LL6 A;  4G2P A;  4IT6 A;  3O5R A;  1NWS A;  4U86 A;  3ARV A;  1NMW A;  1PIN A;  5D75 A;  4ITZ A;  2ZR4 A;  3O5D A;  4TYO A;  3RFW A;  3GPK A;  3ARP A;  2DSU A;  1EYM A;  4IPX A;  2ZQS A;  2AOS A;  5HKG A;  4R5E A;  3WQV A;  2F23 A;  4ML4 A;  4TW8 A;  1FKK A;  2PI6 A;  1YW5 A;  5DIV A;  3G6M A;  2M2A A;  4DRN A;  2PPP A;  2DT3 A;  1O6I A;  3UI4 A;  3WD0 A;  5J6E A;  1EIB A;  1HJX A;  4J4N A;  5HUA A;  1WNO A;  4DRH A;  1GUV A;  4KQZ A;  2M08 A;  2XP7 A;  4WIW A;  3NI6 A;  4MNK A;  3FAP A;  1QPF A;  5HTG A;  4XAK A;  3WL0 A;  3OOB A;  1UR8 A;  4ZPT R;  5BXJ A;  1LJY A;  2XP8 A;  2LGO A;  2XP4 A;  5I98 A;  4U84 A;  2MLY A;  4S3K A;  3BXW A;  1U79 A;  1ZL1 A;  4DWS B;  1WAW A;  2O92 A;  3PRA A;  1JNS A;  4NNR A;  3RM8 A;  1D2K A;  3CGN A;  3O5P A;  1JNT A;  3CGM A;  5GPR A;  4FAP A;  4WKH A;  3WH0 A;  1ZBK A;  2DG4 A;  3TDB A;  1Q6H A;  3WQW A;  2WLY A;  5DIT A;  3B7X A;  1FKB A;  3O5J A;  4HAR A;  1SYT A;  1FKG A;  3G6L A;  3PRB A;  3JYJ A;  1BL4 A;  1Q6U A;  4C02 B;  3KCE A;  2OFN A;  1J4I A;  1W1P A;  1H0I A;  1OGB A;  1X6L A;  1W9U A;  4DIP A;  3CH9 A;  3B8S A;  2DT1 A;  3O5F A;  4MNL A;  3ALF A;  3O5M A;  1X6N A;  2FAP A;  1E6Z A;  3AS1 A;  3ARS A;  4Z2L A;  4TW7 A;  3EY6 A;  4DRJ A;  1GOI A;  3CZ8 A;  2DSV A;  4W9O A;  4ODM A;  4Z2J A;  1GPF A;  4G50 A;  4QZV B;  1W9P A;  2PPO A;  4LAW A;  3O5E A;  4J4O A;  1E6P A;  3UQI A;  4TNS A;  2KI3 A;  3KAI A;  4DRK A;  1ZK6 A;  3UQA A;  1OWQ A;  3PR9 A;  4BF8 A;  1YAT A;  1Q1C A;  1VF8 A;  3PA7 A;  3OA5 A;  1ZBW A;  4MNJ A;  4P8U A;  3KAB A;  5DO2 A;  2ZQU A;  3UI5 A;  3CHC A;  1FKT A;  1NWT A;  2F2D A;  1IX5 A;  3WL1 A;  3ODK A;  2PBC A;  2A3B A;  1Q6I A;  4L72 B;  4DWS D;  4KR0 B;  2N87 A;  1D7J A;  1W9V A;  2WM0 A;  1ZU8 A;  2QF8 A;  1E9L A;  1FKI A;  1FKH A;  2DSZ A;  3ARX A;  2DT0 A;  3O5K A;  4DZ3 A;  1FKF A;  1HJV A;  1EDQ A;  3GTY X;  4FN2 A;  5JH8 A;  4LAY A;  5HBF A;  4ODQ A;  2YBU A;  2XP6 A;  1K9T A;  1HKI A;  3PRD A;  2RSE A;  3WKZ A;  1QZ2 A;  1N1A A;  3JYM A;  2VCD A;  4LGX A;  3CHF A;  1NSG A;  3KZ7 A;  5GPG A;  3JXV A;  1E6R A;  4DWS C;  1ZBC A;  4ODN A;  2YBT A;  1WB0 A;  3O5L A;  5DIU A;  2XP9 A;  1NWR A;  1JCH B;  1F8A B;  3AS2 A;  3IKG A;  4HBE A;  4R0X A;  2IUZ A;  3ART A;  1E6N A;  3W4R A;  4MTV A;  4NSB A;  4AY1 A;  1D7I A;  2RUD A;  2KGJ A; 
#chains in the Genus database with same CATH homology
 5HT1 A;  1W1T A;  1ZB5 A;  4ZS6 A;  3IHZ A;  4WK9 A;  1ROT A;  4JFK A;  4W9Q A;  2VN1 A;  1L1P A;  3CHD A;  4S3J A;  2LJ4 A;  2DG3 A;  1LG1 A;  2XP5 A;  2B31 A;  2F21 A;  2ESC A;  3FXY A;  4P8X A;  4DRO A;  1J6Y A;  2MLZ A;  1QPL A;  2MNT A;  1FKD A;  4MGV A;  2PV2 A;  1XHG A;  4L3N A;  1JNE A;  4TW6 A;  2RUQ A;  1TFV A;  1H0G A;  3O5I A;  2DPE A;  4ODP A;  3FY1 A;  1HXV A;  4O2T A;  3B9E A;  3VAW A;  3WIJ A;  2LKN A;  2KFW A;  2DG9 A;  4MSP A;  4N19 A;  2XP3 A;  2XPB A;  2RQS A;  1HKJ A;  4ODL A;  3IK8 A;  3UF8 A;  4W9P A;  1UR9 A;  2G41 A;  4MPK A;  4QT2 A;  1A7X A;  3RM4 A;  2A3E A;  1BKF A;  1J4R A;  1B6C A;  3RME A;  1ITX A;  3ARR A;  4PTM A;  4U85 A;  3KAC A;  1ROU A;  2ZQT A;  2MLX A;  3AQU A;  3KAG A;  3QOK A;  4P8W A;  4WJX A;  4GGQ A;  2MF9 A;  2KE0 A;  4Q7N A;  3IKD A;  3MDY B;  4LAX A;  1PBK A;  4TX0 A;  5HW8 A;  4WKA A;  2D9F A;  2KR7 A;  4IQ2 A;  3O5O A;  2RUR A;  3WD1 A;  3ARZ A;  2F4E A;  1C9H A;  2O9O A;  2JZV A;  4DWS A;  1OGG A;  1W26 A;  3TCZ A;  1HKK A;  1D6O A;  2G8Z A;  1XRV A;  1R9H A;  3I6C A;  1W1Y A;  1LL7 A;  4JFI A;  1SR0 A;  5HWB A;  3WD2 A;  1T11 A;  1P5Q A;  2FKE A;  3ARU A;  4WKF A;  4DZ2 A;  1NH6 A;  2A3A A;  4MAV A;  3KAF A;  2L2S A;  4GIV A;  3UQB A;  2A3C A;  4JYS A;  3TC5 A;  3KAH A;  4DRP A;  4JFJ A;  1M5Y A;  2RUC A;  2Y78 A;  4JFL A;  4W5U A;  4ODO A;  3UI6 A;  2ITK A;  1E15 A;  1CTN A;  5DEZ A;  3WD3 A;  3ARW A;  2Q5A A;  1RD6 A;  3NRK A;  4DRI A;  1W1V A;  2LPV A;  1KT0 A;  3AS3 A;  2ZR5 A;  1LG2 A;  3RGC A;  1FJD A;  1FKL A;  4ZPW R;  1F40 A;  2XPA A;  5B8I C;  1JVW A;  5HWC A;  4P8V A;  4Q22 A;  3AS0 A;  1FKR A;  1FKS A;  1TCO C;  4Z2G A;  4DT4 A;  4ODR A;  1ZBV A;  1KFW A;  3ARY A;  2PV3 A;  2OLH A;  2K8I A;  1FKJ A;  4Z2I A;  2ZQV A;  3O5Q A;  5HW7 A;  1KT1 A;  2ZR6 A;  1HJW A;  4NZC A;  1EQ3 A;  4LAV A;  1FD9 A;  4QIB A;  3ALG A;  4IQC A;  1FFR A;  2IF4 A;  3NTP A;  1HKM A;  3B9A A;  5DF0 A;  1JND A;  1LL4 A;  1FAP A;  4JFM A;  3ARQ A;  2DSW A;  4MNM A;  2KO7 A;  5GQB A;  1J4H A;  1D7H A;  2M1I A;  1NWU A;  3CHE A;  3H9R B;  4ZPV R;  4Z2K A;  2WK2 A;  1NMV A;  2AWG A;  1ZCN A;  1EHN A;  2MPH A;  4ODK A;  3RM9 A;  1Y0O A;  4HBO A;  4IT4 A;  2PV1 A;  2UZ5 A;  4DH0 A;  3B9D A;  3O5G A;  3WD4 A;  2DT2 A;  4QT3 A;  4DRQ A;  2PPN A;  1FFQ A;  1LQ0 A;  3ARO A;  4URI A;  3LUO A;  2WLZ A;  5HW6 A;  2FDM A;  4DRM A;  4Z2H A;  3KAD A;  1LL6 A;  4G2P A;  4IT6 A;  3O5R A;  1NWS A;  4U86 A;  3ARV A;  1NMW A;  1PIN A;  5D75 A;  4ITZ A;  2ZR4 A;  3O5D A;  4TYO A;  3RFW A;  3GPK A;  3ARP A;  2DSU A;  1EYM A;  4IPX A;  2ZQS A;  2AOS A;  5HKG A;  4R5E A;  3WQV A;  4ML4 A;  4TW8 A;  1FKK A;  2PI6 A;  1YW5 A;  5DIV A;  3G6M A;  2M2A A;  4DRN A;  2PPP A;  2DT3 A;  1O6I A;  3UI4 A;  3WD0 A;  5J6E A;  1EIB A;  1HJX A;  4J4N A;  5HUA A;  1WNO A;  4DRH A;  1GUV A;  4KQZ A;  2M08 A;  2XP7 A;  4WIW A;  3NI6 A;  4MNK A;  3FAP A;  1QPF A;  5HTG A;  4XAK A;  3WL0 A;  3OOB A;  1UR8 A;  4ZPT R;  5BXJ A;  1LJY A;  2XP8 A;  2LGO A;  2XP4 A;  5I98 A;  4U84 A;  2MLY A;  4S3K A;  3BXW A;  1U79 A;  1ZL1 A;  4DWS B;  1WAW A;  2O92 A;  3PRA A;  1JNS A;  4NNR A;  3RM8 A;  1D2K A;  3CGN A;  3O5P A;  1JNT A;  3CGM A;  5GPR A;  4FAP A;  4WKH A;  3WH0 A;  1ZBK A;  2DG4 A;  3TDB A;  1Q6H A;  3WQW A;  2WLY A;  5DIT A;  3B7X A;  1FKB A;  3O5J A;  4HAR A;  1SYT A;  1FKG A;  3G6L A;  3PRB A;  3JYJ A;  1BL4 A;  1Q6U A;  4C02 B;  3KCE A;  2OFN A;  1J4I A;  1W1P A;  1H0I A;  1OGB A;  1X6L A;  1W9U A;  4DIP A;  3CH9 A;  3B8S A;  2DT1 A;  3O5F A;  4MNL A;  3ALF A;  3O5M A;  1X6N A;  2FAP A;  1E6Z A;  3AS1 A;  3ARS A;  4Z2L A;  4TW7 A;  3EY6 A;  4DRJ A;  1GOI A;  3CZ8 A;  2DSV A;  4W9O A;  4ODM A;  4Z2J A;  1GPF A;  4G50 A;  4QZV B;  1W9P A;  2PPO A;  4LAW A;  3O5E A;  4J4O A;  1E6P A;  3UQI A;  4TNS A;  2KI3 A;  3KAI A;  4DRK A;  1ZK6 A;  3UQA A;  1OWQ A;  3PR9 A;  4BF8 A;  1YAT A;  1Q1C A;  1VF8 A;  3PA7 A;  3OA5 A;  1ZBW A;  4MNJ A;  4P8U A;  3KAB A;  5DO2 A;  2ZQU A;  3UI5 A;  3CHC A;  1FKT A;  1NWT A;  2F2D A;  1IX5 A;  3WL1 A;  3ODK A;  2PBC A;  2A3B A;  1Q6I A;  4L72 B;  4DWS D;  4KR0 B;  2N87 A;  1D7J A;  1W9V A;  2WM0 A;  1ZU8 A;  2QF8 A;  1E9L A;  1FKI A;  1FKH A;  2DSZ A;  3ARX A;  2DT0 A;  3O5K A;  4DZ3 A;  1FKF A;  1HJV A;  1EDQ A;  4FN2 A;  5JH8 A;  4LAY A;  5HBF A;  4ODQ A;  2YBU A;  2XP6 A;  1K9T A;  1HKI A;  3PRD A;  2RSE A;  3WKZ A;  1QZ2 A;  1N1A A;  3JYM A;  2VCD A;  4LGX A;  3CHF A;  1NSG A;  3KZ7 A;  5GPG A;  3JXV A;  1E6R A;  4DWS C;  1ZBC A;  4ODN A;  2YBT A;  1WB0 A;  3O5L A;  5DIU A;  2XP9 A;  1NWR A;  1F8A B;  3AS2 A;  3IKG A;  4HBE A;  4R0X A;  2IUZ A;  3ART A;  1E6N A;  3W4R A;  4MTV A;  4NSB A;  4AY1 A;  1D7I A;  2RUD A;  2KGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...