1IX5A

Solution structure of the methanococcus thermolithotrophicus fkbp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
MVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP
publication title Three-dimensional Solution Structure of an Archaeal FKBP with a Dual Function of Peptidyl Prolyl cis-trans Isomerase and Chaperone-like Activities
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
total genus 17
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1ix5A00
3PRAA 1IX5A 3PR9A
chains in the Genus database with same CATH superfamily
1E6NA 4DIPA 1X6LA 4P8WA 4IQCA 4GIVA 1FKDA 4XAKA 4WKFA 3BXWA 3KABA 3UQIA 2PV1A 3KACA 2XPBA 3O5EA 4L3NA 2F2DA 1FJDA 4GGQA 2DG4A 3CHEA 4ODRA 1FKHA 2RURA 3O5PA 4FAPA 3CHFA 2DT3A 4TX0A 3WKZA 1LG1A 4P8XA 2OFNA 2F21A 3NRKA 4DRNA 2FDMA 2M1IA 3O5MA 3ARQA 1FKRA 1FKIA 2DSWA 3O5LA 3AS3A 1E6ZA 2RQSA 4Z2LA 2DSZA 3WQWA 3RM8A 3WL1A 5J6EA 4DRHA 4WJXA 3GPKA 1FKSA 3UQBA 4JFKA 3O5RA 3ARVA 2YBTA 4Q7NA 2ZR6A 1NH6A 1BKFA 3RGCA 1NWTA 1FKBA 4J4NA 1LJYA 3O5IA 4DRMA 1W1TA 4Q22A 3B7XA 2LPVA 3AS0A 4MNLA 1J6YA 2ZQTA 3CH9A 2A3AA 2XP5A 1ZBKA 4NNRA 4QT3A 3UI5A 2PPOA 4DWSA 2ZQSA 1FKGA 3IHZA 3IKDA 1EQ3A 2K8IA 3B9AA 5DITA 1B6CA 3KZ7A 1QPFA 4DRPA 2XPAA 3ARUA 1LG2A 1WAWA 2A3CA 1JNDA 4MSPA 2DT0A 3H9RB 4ODKA 4Z2JA 1Q6UA 3QOKA 3ARPA 4MPKA 4BF8A 4TYOA 3CZ8A 3ARZA 1NWSA 1FKKA 3ARYA 1SR0A 1D6OA 1RD6A 1W9UA 2P4VA 3O5FA 1Q1CA 3WD1A 1HJVA 3WD4A 1FKFA 3KCEA 5HWBA 1E6PA 2EULA 5GPRA 4C02B 1R9HA 3O5JA 1E9LA 2DPEA 4WK9A 5HTGA 1SYTA 5DIUA 2ESCA 4DT4A 4P8UA 3RMEA 1FKTA 4TW7A 1ZBCA 2PV3A 1W1YA 1XHGA 5HW7A 2WLZA 4PTMA 3UQAA 1F8AB 3GU0A 1ZBWA 2M08A 4QT2A 1LL4A 3JYJA 2WLYA 4ODMA 4Z2IA 4QZVB 2PBCA 1A7XA 1GRJA 1ZU8A 1OGGA 1D7HA 3AQUA 5DEZA 1Q6IA 1TCOC 1LL7A 4ODOA 2AOSA 1FAPA 2B5UB 2ETNA 4JFJA 1JNEA 2A3EA 1EYMA 4WKAA 2ZQVA 1FD9A 4DRKA 3LUOA 2AWGA 1NMVA 3ODKA 2KO7A 2QF8A 4UDMA 1T11A 3PR9A 1QPLA 2ZQUA 3WL0A 4IPXA 3KAIA 1ITXA 2N87A 1EHNA 4JFIA 3KAFA 5D75A 4ZPTR 2DT1A 1E15A 2KE0A 2VCDA 2MNTA 2XP7A 2RUCA 3OOBA 2JZVA 5JH8A 4MNJA 4DROA 4WKHA 3CHDA 2ZR5A 3BMBA 4ODQA 1U79A 2WK2A 2ZR4A 2Y78A 3WD3A 1ROTA 2A3BA 4G2PA 4JFLA 4MNKA 4DWSD 1LL6A 1HJXA 1X6NA 3ARSA 3RM9A 3UF8A 4Z2GA 1EIBA 1ZK6A 2PI6A 1GUVA 2LKNA 1L1PA 2FKEA 3PRAA 3WIJA 4DRJA 4FN2A 4TW8A 2O92A 2MLZA 4DWSB 4WIWA 4W5UA 2IUZA 4URIA 4NSBA 2PN0A 1ZCNA 2MF9A 1PBKA 4ML4A 1D7JA 3KAGA 3W4RA 4P8VA 3UI4A 2LGOA 4DRQA 3OA5A 3NI6A 1HXVA 3O5QA 3ALGA 1HKMA 1VF8A 3NTPA 4IQ2A 3GTYX 3I6CA 2DSUA 4G50A 1KT1A 3B9DA 3G6LA 3ARRA 1BL4A 4DZ3A 1WNOA 5HKGA 1N1AA 3IK8A 4DWSC 2PV2A 3WQVA 3O5OA 3EY6A 3AS1A 3CGNA 3PA7A 3PRBA 2ITKA 4LAVA 4NZCA 5HW6A 3PRDA 2F4EA 1GPFA 2MLXA 3B9EA 1J4IA 1UR9A 1Y0OA 5HUAA 1OGBA 1Q6HA 1HJWA 3VAWA 1O6IA 2YBUA 3KADA 3TDBA 4U86A 1W1VA 4MTVA 4DH0A 1W9PA 2MLYA 1K9TA 5GQBA 4Z2KA 4S3JA 1JNSA 3WD2A 2DSVA 1ZL1A 2O9OA 3RM4A 3ALFA 1D7IA 2PPNA 4Z2HA 1FFQA 1GOIA 1ZB5A 2XP4A 4LAWA 3FY1A 1KT0A 2DG9A 1F40A 1KFWA 4L72B 5DO2A 3ARWA 5GPGA 2DT2A 1HKKA 1CTNA 2G8ZA 1NSGA 3O5GA 4LAXA 3CGMA 2KGJA 1NMWA 1ROUA 1YATA 4N19A 3ARTA 4U85A 1P5QA 2XP6A 5B8IC 5HWCA 1W26A 1HKJA 1J4RA 1PINA 4JFMA 5I98A 2WM0A 1IX5A 4ITZA 3O5KA 2F23A 2Q5AA 1H0GA 1JVWA 4AY1A 1D2KA 3O5DA 4IT4A 1JNTA 4KQZA 5DF0A 2RUQA 4LAYA 4ODPA 5HT1A 3FXYA 4JYSA 4ODNA 4LGXA 4DRIA 4HBOA 1OWQA 2MPHA 2G41A 2M2AA 4ODLA 3KAHA 5DIVA 2FAPA 1W9VA 4TNSA 1J4HA 2UZ5A 4U84A 3UI6A 4R5EA 1YW5A 1NWUA 3TCZA 1EDQA 4MAVA 4W9QA 2D9FA 3AS2A 3WH0A 2PPPA 4ZPVR 2RSEA 1FKJA 1FKLA 3FAPA 3JXVA 4S3KA 1JCHB 2RUDA 3EIPA 4TW6A 2KFWA 3RFWA 2KI3A 1FFRA 4O2TA 1NWRA 2B31A 2IF4A 4ZPWR 2DG3A 4KR0B 4HARA 2XP8A 4W9OA 4R0XA 4HBEA 4J4OA 5HBFA 5BXJA 4QIBA 1ZBVA 3TC5A 3CHCA 2VN1A 3G6MA 1QZ2A 1H0IA 2LJ4A 3IKGA 3JYMA 1UR8A 1M5YA 5HW8A 2XP9A 2OLHA 4MNMA 1LQ0A 1W1PA 3B8SA 4IT6A 1E6RA 1XRVA 3WD0A 3MDYB 4W9PA 2L2SA 2KR7A 4MGVA 1TFVA 1HKIA 1WB0A 2XP3A 3ARXA 4ZS6A 4DZ2A 1E44A 1C9HA 3AROA
chains in the Genus database with same CATH topology
1E6NA 4DIPA 1X6LA 4P8WA 4IQCA 4GIVA 1FKDA 4XAKA 4WKFA 3BXWA 3KABA 3UQIA 2PV1A 3KACA 2XPBA 3O5EA 4L3NA 2F2DA 1FJDA 4GGQA 2DG4A 3CHEA 4ODRA 1FKHA 2RURA 3O5PA 4FAPA 3CHFA 2DT3A 4TX0A 3WKZA 1LG1A 4P8XA 2OFNA 2F21A 3NRKA 4DRNA 2FDMA 2M1IA 3O5MA 3ARQA 1FKRA 1FKIA 2DSWA 3O5LA 3AS3A 1E6ZA 2RQSA 4Z2LA 2DSZA 3WQWA 3RM8A 3WL1A 5J6EA 4DRHA 4WJXA 3GPKA 1FKSA 3UQBA 4JFKA 3O5RA 3ARVA 2YBTA 4Q7NA 2ZR6A 1NH6A 1BKFA 3RGCA 1NWTA 1FKBA 4J4NA 1LJYA 3O5IA 4DRMA 1W1TA 4Q22A 3B7XA 2LPVA 3AS0A 4MNLA 1J6YA 2ZQTA 3CH9A 2A3AA 2XP5A 1ZBKA 4NNRA 4QT3A 3UI5A 2PPOA 4DWSA 2ZQSA 1FKGA 3IHZA 3IKDA 1EQ3A 2K8IA 3B9AA 5DITA 1B6CA 3KZ7A 1QPFA 4DRPA 2XPAA 3ARUA 1LG2A 1WAWA 2A3CA 1JNDA 4MSPA 2DT0A 3H9RB 4ODKA 4Z2JA 1Q6UA 3QOKA 3ARPA 4MPKA 4BF8A 4TYOA 3CZ8A 3ARZA 1NWSA 1FKKA 3ARYA 1SR0A 1D6OA 1RD6A 1W9UA 3O5FA 1Q1CA 3WD1A 1HJVA 3WD4A 1FKFA 3KCEA 5HWBA 1E6PA 5GPRA 4C02B 1R9HA 3O5JA 1E9LA 2DPEA 4WK9A 5HTGA 1SYTA 5DIUA 2ESCA 4DT4A 4P8UA 3RMEA 1FKTA 4TW7A 1ZBCA 2PV3A 1W1YA 1XHGA 5HW7A 2WLZA 4PTMA 3UQAA 1F8AB 1ZBWA 2M08A 4QT2A 1LL4A 3JYJA 2WLYA 4ODMA 4Z2IA 4QZVB 2PBCA 1A7XA 1ZU8A 1OGGA 1D7HA 3AQUA 5DEZA 1Q6IA 1TCOC 1LL7A 4ODOA 2AOSA 1FAPA 4JFJA 1JNEA 2A3EA 1EYMA 4WKAA 2ZQVA 1FD9A 4DRKA 3LUOA 2AWGA 1NMVA 3ODKA 2KO7A 2QF8A 1T11A 3PR9A 1QPLA 2ZQUA 3WL0A 4IPXA 3KAIA 1ITXA 2N87A 1EHNA 4JFIA 3KAFA 5D75A 4ZPTR 2DT1A 1E15A 2KE0A 2VCDA 2MNTA 2XP7A 2RUCA 3OOBA 2JZVA 5JH8A 4MNJA 4DROA 4WKHA 3CHDA 2ZR5A 4ODQA 1U79A 2WK2A 2ZR4A 2Y78A 3WD3A 1ROTA 2A3BA 4G2PA 4JFLA 4MNKA 4DWSD 1LL6A 1HJXA 1X6NA 3ARSA 3RM9A 3UF8A 4Z2GA 1EIBA 1ZK6A 2PI6A 1GUVA 2LKNA 1L1PA 2FKEA 3PRAA 3WIJA 4DRJA 4FN2A 4TW8A 2O92A 2MLZA 4DWSB 4WIWA 4W5UA 2IUZA 4URIA 4NSBA 1ZCNA 2MF9A 1PBKA 4ML4A 1D7JA 3KAGA 3W4RA 4P8VA 3UI4A 2LGOA 4DRQA 3OA5A 3NI6A 1HXVA 3O5QA 3ALGA 1HKMA 1VF8A 3NTPA 4IQ2A 3I6CA 2DSUA 4G50A 1KT1A 3B9DA 3G6LA 3ARRA 1BL4A 4DZ3A 1WNOA 5HKGA 1N1AA 3IK8A 4DWSC 2PV2A 3WQVA 3O5OA 3EY6A 3AS1A 3CGNA 3PA7A 3PRBA 2ITKA 4LAVA 4NZCA 5HW6A 3PRDA 2F4EA 1GPFA 2MLXA 3B9EA 1J4IA 1UR9A 1Y0OA 5HUAA 1OGBA 1Q6HA 1HJWA 3VAWA 1O6IA 2YBUA 3KADA 3TDBA 4U86A 1W1VA 4MTVA 4DH0A 1W9PA 2MLYA 1K9TA 5GQBA 4Z2KA 4S3JA 1JNSA 3WD2A 2DSVA 1ZL1A 2O9OA 3RM4A 3ALFA 1D7IA 2PPNA 4Z2HA 1FFQA 1GOIA 1ZB5A 2XP4A 4LAWA 3FY1A 1KT0A 2DG9A 1F40A 1KFWA 4L72B 5DO2A 3ARWA 5GPGA 2DT2A 1HKKA 1CTNA 2G8ZA 1NSGA 3O5GA 4LAXA 3CGMA 2KGJA 1NMWA 1ROUA 1YATA 4N19A 3ARTA 4U85A 1P5QA 2XP6A 5B8IC 5HWCA 1W26A 1HKJA 1J4RA 1PINA 4JFMA 5I98A 2WM0A 1IX5A 4ITZA 3O5KA 2Q5AA 1H0GA 1JVWA 4AY1A 1D2KA 3O5DA 4IT4A 1JNTA 4KQZA 5DF0A 2RUQA 4LAYA 4ODPA 5HT1A 3FXYA 4JYSA 4ODNA 4LGXA 4DRIA 4HBOA 1OWQA 2MPHA 2G41A 2M2AA 4ODLA 3KAHA 5DIVA 2FAPA 1W9VA 4TNSA 1J4HA 2UZ5A 4U84A 3UI6A 4R5EA 1YW5A 1NWUA 3TCZA 1EDQA 4MAVA 4W9QA 2D9FA 3AS2A 3WH0A 2PPPA 4ZPVR 2RSEA 1FKJA 1FKLA 3FAPA 3JXVA 4S3KA 4TW6A 2RUDA 3RFWA 2KFWA 2KI3A 1FFRA 4O2TA 1NWRA 2B31A 2IF4A 4ZPWR 2DG3A 4KR0B 4HARA 2XP8A 4W9OA 4R0XA 4HBEA 4J4OA 5HBFA 5BXJA 4QIBA 1ZBVA 3TC5A 3CHCA 2VN1A 3G6MA 1QZ2A 1H0IA 2LJ4A 3IKGA 3JYMA 1UR8A 1M5YA 5HW8A 2XP9A 2OLHA 4MNMA 1LQ0A 1W1PA 3B8SA 4IT6A 1E6RA 1XRVA 3WD0A 3MDYB 4W9PA 2L2SA 2KR7A 4MGVA 1TFVA 1HKIA 1WB0A 2XP3A 3ARXA 4ZS6A 4DZ2A 1C9HA 3AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRA A;  1IX5 A;  3PR9 A; 
#chains in the Genus database with same CATH topology
 1E6N A;  4DIP A;  1X6L A;  4P8W A;  4IQC A;  4GIV A;  1FKD A;  4XAK A;  4WKF A;  3BXW A;  3KAB A;  3UQI A;  2PV1 A;  3KAC A;  2XPB A;  3O5E A;  4L3N A;  2F2D A;  1FJD A;  4GGQ A;  2DG4 A;  3CHE A;  4ODR A;  1FKH A;  2RUR A;  3O5P A;  4FAP A;  3CHF A;  2DT3 A;  4TX0 A;  3WKZ A;  1LG1 A;  4P8X A;  2OFN A;  2F21 A;  3NRK A;  4DRN A;  2FDM A;  2M1I A;  3O5M A;  3ARQ A;  1FKR A;  1FKI A;  2DSW A;  3O5L A;  3AS3 A;  1E6Z A;  2RQS A;  4Z2L A;  2DSZ A;  3WQW A;  3RM8 A;  3WL1 A;  5J6E A;  4DRH A;  4WJX A;  3GPK A;  1FKS A;  3UQB A;  4JFK A;  3O5R A;  3ARV A;  2YBT A;  4Q7N A;  2ZR6 A;  1NH6 A;  1BKF A;  3RGC A;  1NWT A;  1FKB A;  4J4N A;  1LJY A;  3O5I A;  4DRM A;  1W1T A;  4Q22 A;  3B7X A;  2LPV A;  3AS0 A;  4MNL A;  1J6Y A;  2ZQT A;  3CH9 A;  2A3A A;  2XP5 A;  1ZBK A;  4NNR A;  4QT3 A;  3UI5 A;  2PPO A;  4DWS A;  2ZQS A;  1FKG A;  3IHZ A;  3IKD A;  1EQ3 A;  2K8I A;  3B9A A;  5DIT A;  1B6C A;  3KZ7 A;  1QPF A;  4DRP A;  2XPA A;  3ARU A;  1LG2 A;  1WAW A;  2A3C A;  1JND A;  4MSP A;  2DT0 A;  3H9R B;  4ODK A;  4Z2J A;  1Q6U A;  3QOK A;  3ARP A;  4MPK A;  4BF8 A;  4TYO A;  3CZ8 A;  3ARZ A;  1NWS A;  1FKK A;  3ARY A;  1SR0 A;  1D6O A;  1RD6 A;  1W9U A;  2P4V A;  3O5F A;  1Q1C A;  3WD1 A;  1HJV A;  3WD4 A;  1FKF A;  3KCE A;  5HWB A;  1E6P A;  2EUL A;  5GPR A;  4C02 B;  1R9H A;  3O5J A;  1E9L A;  2DPE A;  4WK9 A;  5HTG A;  1SYT A;  5DIU A;  2ESC A;  4DT4 A;  4P8U A;  3RME A;  1FKT A;  4TW7 A;  1ZBC A;  2PV3 A;  1W1Y A;  1XHG A;  5HW7 A;  2WLZ A;  4PTM A;  3UQA A;  1F8A B;  3GU0 A;  1ZBW A;  2M08 A;  4QT2 A;  1LL4 A;  3JYJ A;  2WLY A;  4ODM A;  4Z2I A;  4QZV B;  2PBC A;  1A7X A;  1GRJ A;  1ZU8 A;  1OGG A;  1D7H A;  3AQU A;  5DEZ A;  1Q6I A;  1TCO C;  1LL7 A;  4ODO A;  2AOS A;  1FAP A;  2B5U B;  2ETN A;  4JFJ A;  1JNE A;  2A3E A;  1EYM A;  4WKA A;  2ZQV A;  1FD9 A;  4DRK A;  3LUO A;  2AWG A;  1NMV A;  3ODK A;  2KO7 A;  2QF8 A;  4UDM A;  1T11 A;  3PR9 A;  1QPL A;  2ZQU A;  3WL0 A;  4IPX A;  3KAI A;  1ITX A;  2N87 A;  1EHN A;  4JFI A;  3KAF A;  5D75 A;  4ZPT R;  2DT1 A;  1E15 A;  2KE0 A;  2VCD A;  2MNT A;  2XP7 A;  2RUC A;  3OOB A;  2JZV A;  5JH8 A;  4MNJ A;  4DRO A;  4WKH A;  3CHD A;  2ZR5 A;  3BMB A;  4ODQ A;  1U79 A;  2WK2 A;  2ZR4 A;  2Y78 A;  3WD3 A;  1ROT A;  2A3B A;  4G2P A;  4JFL A;  4MNK A;  4DWS D;  1LL6 A;  1HJX A;  1X6N A;  3ARS A;  3RM9 A;  3UF8 A;  4Z2G A;  1EIB A;  1ZK6 A;  2PI6 A;  1GUV A;  2LKN A;  1L1P A;  2FKE A;  3PRA A;  3WIJ A;  4DRJ A;  4FN2 A;  4TW8 A;  2O92 A;  2MLZ A;  4DWS B;  4WIW A;  4W5U A;  2IUZ A;  4URI A;  4NSB A;  2PN0 A;  1ZCN A;  2MF9 A;  1PBK A;  4ML4 A;  1D7J A;  3KAG A;  3W4R A;  4P8V A;  3UI4 A;  2LGO A;  4DRQ A;  3OA5 A;  3NI6 A;  1HXV A;  3O5Q A;  3ALG A;  1HKM A;  1VF8 A;  3NTP A;  4IQ2 A;  3GTY X;  3I6C A;  2DSU A;  4G50 A;  1KT1 A;  3B9D A;  3G6L A;  3ARR A;  1BL4 A;  4DZ3 A;  1WNO A;  5HKG A;  1N1A A;  3IK8 A;  4DWS C;  2PV2 A;  3WQV A;  3O5O A;  3EY6 A;  3AS1 A;  3CGN A;  3PA7 A;  3PRB A;  2ITK A;  4LAV A;  4NZC A;  5HW6 A;  3PRD A;  2F4E A;  1GPF A;  2MLX A;  3B9E A;  1J4I A;  1UR9 A;  1Y0O A;  5HUA A;  1OGB A;  1Q6H A;  1HJW A;  3VAW A;  1O6I A;  2YBU A;  3KAD A;  3TDB A;  4U86 A;  1W1V A;  4MTV A;  4DH0 A;  1W9P A;  2MLY A;  1K9T A;  5GQB A;  4Z2K A;  4S3J A;  1JNS A;  3WD2 A;  2DSV A;  1ZL1 A;  2O9O A;  3RM4 A;  3ALF A;  1D7I A;  2PPN A;  4Z2H A;  1FFQ A;  1GOI A;  1ZB5 A;  2XP4 A;  4LAW A;  3FY1 A;  1KT0 A;  2DG9 A;  1F40 A;  1KFW A;  4L72 B;  5DO2 A;  3ARW A;  5GPG A;  2DT2 A;  1HKK A;  1CTN A;  2G8Z A;  1NSG A;  3O5G A;  4LAX A;  3CGM A;  2KGJ A;  1NMW A;  1ROU A;  1YAT A;  4N19 A;  3ART A;  4U85 A;  1P5Q A;  2XP6 A;  5B8I C;  5HWC A;  1W26 A;  1HKJ A;  1J4R A;  1PIN A;  4JFM A;  5I98 A;  2WM0 A;  1IX5 A;  4ITZ A;  3O5K A;  2F23 A;  2Q5A A;  1H0G A;  1JVW A;  4AY1 A;  1D2K A;  3O5D A;  4IT4 A;  1JNT A;  4KQZ A;  5DF0 A;  2RUQ A;  4LAY A;  4ODP A;  5HT1 A;  3FXY A;  4JYS A;  4ODN A;  4LGX A;  4DRI A;  4HBO A;  1OWQ A;  2MPH A;  2G41 A;  2M2A A;  4ODL A;  3KAH A;  5DIV A;  2FAP A;  1W9V A;  4TNS A;  1J4H A;  2UZ5 A;  4U84 A;  3UI6 A;  4R5E A;  1YW5 A;  1NWU A;  3TCZ A;  1EDQ A;  4MAV A;  4W9Q A;  2D9F A;  3AS2 A;  3WH0 A;  2PPP A;  4ZPV R;  2RSE A;  1FKJ A;  1FKL A;  3FAP A;  3JXV A;  4S3K A;  1JCH B;  2RUD A;  3EIP A;  4TW6 A;  2KFW A;  3RFW A;  2KI3 A;  1FFR A;  4O2T A;  1NWR A;  2B31 A;  2IF4 A;  4ZPW R;  2DG3 A;  4KR0 B;  4HAR A;  2XP8 A;  4W9O A;  4R0X A;  4HBE A;  4J4O A;  5HBF A;  5BXJ A;  4QIB A;  1ZBV A;  3TC5 A;  3CHC A;  2VN1 A;  3G6M A;  1QZ2 A;  1H0I A;  2LJ4 A;  3IKG A;  3JYM A;  1UR8 A;  1M5Y A;  5HW8 A;  2XP9 A;  2OLH A;  4MNM A;  1LQ0 A;  1W1P A;  3B8S A;  4IT6 A;  1E6R A;  1XRV A;  3WD0 A;  3MDY B;  4W9P A;  2L2S A;  2KR7 A;  4MGV A;  1TFV A;  1HKI A;  1WB0 A;  2XP3 A;  3ARX A;  4ZS6 A;  4DZ2 A;  1E44 A;  1C9H A;  3ARO A; 
#chains in the Genus database with same CATH homology
 1E6N A;  4DIP A;  1X6L A;  4P8W A;  4IQC A;  4GIV A;  1FKD A;  4XAK A;  4WKF A;  3BXW A;  3KAB A;  3UQI A;  2PV1 A;  3KAC A;  2XPB A;  3O5E A;  4L3N A;  2F2D A;  1FJD A;  4GGQ A;  2DG4 A;  3CHE A;  4ODR A;  1FKH A;  2RUR A;  3O5P A;  4FAP A;  3CHF A;  2DT3 A;  4TX0 A;  3WKZ A;  1LG1 A;  4P8X A;  2OFN A;  2F21 A;  3NRK A;  4DRN A;  2FDM A;  2M1I A;  3O5M A;  3ARQ A;  1FKR A;  1FKI A;  2DSW A;  3O5L A;  3AS3 A;  1E6Z A;  2RQS A;  4Z2L A;  2DSZ A;  3WQW A;  3RM8 A;  3WL1 A;  5J6E A;  4DRH A;  4WJX A;  3GPK A;  1FKS A;  3UQB A;  4JFK A;  3O5R A;  3ARV A;  2YBT A;  4Q7N A;  2ZR6 A;  1NH6 A;  1BKF A;  3RGC A;  1NWT A;  1FKB A;  4J4N A;  1LJY A;  3O5I A;  4DRM A;  1W1T A;  4Q22 A;  3B7X A;  2LPV A;  3AS0 A;  4MNL A;  1J6Y A;  2ZQT A;  3CH9 A;  2A3A A;  2XP5 A;  1ZBK A;  4NNR A;  4QT3 A;  3UI5 A;  2PPO A;  4DWS A;  2ZQS A;  1FKG A;  3IHZ A;  3IKD A;  1EQ3 A;  2K8I A;  3B9A A;  5DIT A;  1B6C A;  3KZ7 A;  1QPF A;  4DRP A;  2XPA A;  3ARU A;  1LG2 A;  1WAW A;  2A3C A;  1JND A;  4MSP A;  2DT0 A;  3H9R B;  4ODK A;  4Z2J A;  1Q6U A;  3QOK A;  3ARP A;  4MPK A;  4BF8 A;  4TYO A;  3CZ8 A;  3ARZ A;  1NWS A;  1FKK A;  3ARY A;  1SR0 A;  1D6O A;  1RD6 A;  1W9U A;  3O5F A;  1Q1C A;  3WD1 A;  1HJV A;  3WD4 A;  1FKF A;  3KCE A;  5HWB A;  1E6P A;  5GPR A;  4C02 B;  1R9H A;  3O5J A;  1E9L A;  2DPE A;  4WK9 A;  5HTG A;  1SYT A;  5DIU A;  2ESC A;  4DT4 A;  4P8U A;  3RME A;  1FKT A;  4TW7 A;  1ZBC A;  2PV3 A;  1W1Y A;  1XHG A;  5HW7 A;  2WLZ A;  4PTM A;  3UQA A;  1F8A B;  1ZBW A;  2M08 A;  4QT2 A;  1LL4 A;  3JYJ A;  2WLY A;  4ODM A;  4Z2I A;  4QZV B;  2PBC A;  1A7X A;  1ZU8 A;  1OGG A;  1D7H A;  3AQU A;  5DEZ A;  1Q6I A;  1TCO C;  1LL7 A;  4ODO A;  2AOS A;  1FAP A;  4JFJ A;  1JNE A;  2A3E A;  1EYM A;  4WKA A;  2ZQV A;  1FD9 A;  4DRK A;  3LUO A;  2AWG A;  1NMV A;  3ODK A;  2KO7 A;  2QF8 A;  1T11 A;  3PR9 A;  1QPL A;  2ZQU A;  3WL0 A;  4IPX A;  3KAI A;  1ITX A;  2N87 A;  1EHN A;  4JFI A;  3KAF A;  5D75 A;  4ZPT R;  2DT1 A;  1E15 A;  2KE0 A;  2VCD A;  2MNT A;  2XP7 A;  2RUC A;  3OOB A;  2JZV A;  5JH8 A;  4MNJ A;  4DRO A;  4WKH A;  3CHD A;  2ZR5 A;  4ODQ A;  1U79 A;  2WK2 A;  2ZR4 A;  2Y78 A;  3WD3 A;  1ROT A;  2A3B A;  4G2P A;  4JFL A;  4MNK A;  4DWS D;  1LL6 A;  1HJX A;  1X6N A;  3ARS A;  3RM9 A;  3UF8 A;  4Z2G A;  1EIB A;  1ZK6 A;  2PI6 A;  1GUV A;  2LKN A;  1L1P A;  2FKE A;  3PRA A;  3WIJ A;  4DRJ A;  4FN2 A;  4TW8 A;  2O92 A;  2MLZ A;  4DWS B;  4WIW A;  4W5U A;  2IUZ A;  4URI A;  4NSB A;  1ZCN A;  2MF9 A;  1PBK A;  4ML4 A;  1D7J A;  3KAG A;  3W4R A;  4P8V A;  3UI4 A;  2LGO A;  4DRQ A;  3OA5 A;  3NI6 A;  1HXV A;  3O5Q A;  3ALG A;  1HKM A;  1VF8 A;  3NTP A;  4IQ2 A;  3I6C A;  2DSU A;  4G50 A;  1KT1 A;  3B9D A;  3G6L A;  3ARR A;  1BL4 A;  4DZ3 A;  1WNO A;  5HKG A;  1N1A A;  3IK8 A;  4DWS C;  2PV2 A;  3WQV A;  3O5O A;  3EY6 A;  3AS1 A;  3CGN A;  3PA7 A;  3PRB A;  2ITK A;  4LAV A;  4NZC A;  5HW6 A;  3PRD A;  2F4E A;  1GPF A;  2MLX A;  3B9E A;  1J4I A;  1UR9 A;  1Y0O A;  5HUA A;  1OGB A;  1Q6H A;  1HJW A;  3VAW A;  1O6I A;  2YBU A;  3KAD A;  3TDB A;  4U86 A;  1W1V A;  4MTV A;  4DH0 A;  1W9P A;  2MLY A;  1K9T A;  5GQB A;  4Z2K A;  4S3J A;  1JNS A;  3WD2 A;  2DSV A;  1ZL1 A;  2O9O A;  3RM4 A;  3ALF A;  1D7I A;  2PPN A;  4Z2H A;  1FFQ A;  1GOI A;  1ZB5 A;  2XP4 A;  4LAW A;  3FY1 A;  1KT0 A;  2DG9 A;  1F40 A;  1KFW A;  4L72 B;  5DO2 A;  3ARW A;  5GPG A;  2DT2 A;  1HKK A;  1CTN A;  2G8Z A;  1NSG A;  3O5G A;  4LAX A;  3CGM A;  2KGJ A;  1NMW A;  1ROU A;  1YAT A;  4N19 A;  3ART A;  4U85 A;  1P5Q A;  2XP6 A;  5B8I C;  5HWC A;  1W26 A;  1HKJ A;  1J4R A;  1PIN A;  4JFM A;  5I98 A;  2WM0 A;  1IX5 A;  4ITZ A;  3O5K A;  2Q5A A;  1H0G A;  1JVW A;  4AY1 A;  1D2K A;  3O5D A;  4IT4 A;  1JNT A;  4KQZ A;  5DF0 A;  2RUQ A;  4LAY A;  4ODP A;  5HT1 A;  3FXY A;  4JYS A;  4ODN A;  4LGX A;  4DRI A;  4HBO A;  1OWQ A;  2MPH A;  2G41 A;  2M2A A;  4ODL A;  3KAH A;  5DIV A;  2FAP A;  1W9V A;  4TNS A;  1J4H A;  2UZ5 A;  4U84 A;  3UI6 A;  4R5E A;  1YW5 A;  1NWU A;  3TCZ A;  1EDQ A;  4MAV A;  4W9Q A;  2D9F A;  3AS2 A;  3WH0 A;  2PPP A;  4ZPV R;  2RSE A;  1FKJ A;  1FKL A;  3FAP A;  3JXV A;  4S3K A;  4TW6 A;  2RUD A;  3RFW A;  2KFW A;  2KI3 A;  1FFR A;  4O2T A;  1NWR A;  2B31 A;  2IF4 A;  4ZPW R;  2DG3 A;  4KR0 B;  4HAR A;  2XP8 A;  4W9O A;  4R0X A;  4HBE A;  4J4O A;  5HBF A;  5BXJ A;  4QIB A;  1ZBV A;  3TC5 A;  3CHC A;  2VN1 A;  3G6M A;  1QZ2 A;  1H0I A;  2LJ4 A;  3IKG A;  3JYM A;  1UR8 A;  1M5Y A;  5HW8 A;  2XP9 A;  2OLH A;  4MNM A;  1LQ0 A;  1W1P A;  3B8S A;  4IT6 A;  1E6R A;  1XRV A;  3WD0 A;  3MDY B;  4W9P A;  2L2S A;  2KR7 A;  4MGV A;  1TFV A;  1HKI A;  1WB0 A;  2XP3 A;  3ARX A;  4ZS6 A;  4DZ2 A;  1C9H A;  3ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...