1IX5A

Solution structure of the methanococcus thermolithotrophicus fkbp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
151
structure length
151
Chain Sequence
b'MVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP
publication title Three-dimensional Solution Structure of an Archaeal FKBP with a Dual Function of Peptidyl Prolyl cis-trans Isomerase and Chaperone-like Activities
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Isomerase
total genus 17
structure length 151
sequence length 151
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.80 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1ix5A00
1IX5A 3PRAA 3PR9A
chains in the Genus database with same CATH superfamily
3CHFA 1ZBVA 2VCDA 2M08A 1D6OA 3B9AA 1D2KA 4QT3A 3AROA 3OOBA 2F2DA 1ZU8A 1EYMA 4WJXA 4JFJA 1KT1A 3EIPA 1OWQA 2ZQUA 4NNRA 5HW6A 1XHGA 1N1AA 2LKNA 2ESCA 2WLYA 2MLYA 4TYOA 4G50A 4Z2HA 1FKSA 1GRJA 2WK2A 4FN2A 2A3CA 4S3JA 2MLZA 2MF9A 4Z2JA 5JH8A 2A3EA 1LG2A 3UI4A 3ARPA 3RM4A 1W9UA 4LAYA 2ITKA 1LJYA 4URIA 1RD6A 1H0GA 1W1YA 4WKAA 2XP4A 4TW7A 3KACA 3ARQA 4W5UA 1E6NA 4ZPTR 4MSPA 3IHZA 3UQIA 1L1PA 1E15A 3ARRA 2N87A 2OLHA 2LJ4A 1B6CA 1OGBA 3ARSA 4Q7NA 3KAFA 4U86A 2M2AA 2RUDA 2KO7A 4DWSC 1HKIA 3ARWA 4L72B 4UDMA 4W9QA 4Z2GA 2DG4A 4C02B 1ZBKA 2DT1A 1FJDA 4KQZA 1J4HA 2D9FA 1FFRA 1FKBA 3RFWA 3UI6A 1HKKA 3TDBA 5GPRA 1HKMA 4QZVB 1C9HA 4HARA 1HXVA 3RGCA 3WD3A 1D7IA 3LUOA 4MGVA 4DWSA 4WK9A 2XPAA 3WL0A 2ZQVA 2RURA 1M5YA 2PV3A 4Z2LA 4ODPA 2XP5A 4WIWA 1JNEA 1ROTA 1E9LA 4N19A 2DT0A 1JNTA 3PR9A 4MPKA 3CGMA 3O5PA 5DEZA 1A7XA 4ODRA 4W9OA 1H0IA 2KGJA 2KI3A 3NTPA 1ITXA 2FKEA 1K9TA 1QPLA 4ZPWR 4GIVA 3O5LA 4ODKA 1BKFA 2KR7A 1FKRA 3ODKA 2PPOA 2IUZA 4DT4A 4LAXA 2PN0A 2DPEA 3B8SA 2AOSA 2F23A 4ML4A 1U79A 2YBUA 1WB0A 3RM8A 1SYTA 1T11A 1NWSA 2DG3A 1F40A 1UR8A 4XAKA 1ZK6A 2DT2A 3O5QA 4MNKA 4KR0B 4Z2IA 1JNDA 4O2TA 1UR9A 1LG1A 1J4IA 3QOKA 1FKJA 3BMBA 1LL6A 1NMVA 1Q6HA 4JYSA 4MNMA 1ZBCA 1W9PA 4P8WA 1FKGA 3PRBA 4P8XA 1FKHA 3NRKA 3CHDA 2VN1A 1EHNA 4ODOA 5DIVA 1QZ2A 1WNOA 1X6LA 1E6RA 2DSZA 3MDYB 1J6YA 1PBKA 5GPGA 2DG9A 3AS2A 3JYMA 3ARUA 4WKFA 2EULA 1X6NA 5BXJA 5DIUA 1FAPA 3WD1A 2FAPA 5HTGA 3UF8A 3GPKA 1HKJA 4DRPA 4W9PA 1NWTA 4HBEA 4WKHA 3B9EA 3NI6A 4DWSD 2XP7A 1F8AB 4J4OA 2IF4A 4ITZA 4DZ2A 1VF8A 4R0XA 3KAHA 1BL4A 1NWRA 2Y78A 4MTVA 2PPNA 2A3BA 3WL1A 2O92A 1J4RA 3O5DA 2WLZA 3O5IA 4NSBA 1NWUA 2G41A 1FKKA 1QPFA 3UQBA 1ZL1A 3KZ7A 3VAWA 3B9DA 4ODNA 3GU0A 2M1IA 1CTNA 1Y0OA 2XPBA 1D7HA 3O5EA 4QT2A 4DRQA 2ETNA 4JFMA 1TFVA 3ARYA 4L3NA 4JFLA 4TW6A 3UQAA 2KFWA 4J4NA 4DRMA 2DSVA 4TNSA 2DSWA 3G6LA 4TX0A 4PTMA 1FFQA 4JFKA 3KABA 4LGXA 2PBCA 3IKDA 1HJWA 4S3KA 2RUCA 1HJXA 1HJVA 1FKIA 3O5MA 3TC5A 4ODMA 4BF8A 3G6MA 3WH0A 3O5OA 2L2SA 1FD9A 2PV2A 3B7XA 3FAPA 2O9OA 3FXYA 1FKFA 3AS0A 4ZPVR 1E6ZA 2K8IA 3I6CA 4DIPA 2YBTA 2XP9A 1ROUA 3ARZA 4DRKA 4NZCA 2MNTA 4LAWA 3O5JA 1Q1CA 1TCOC 2XP8A 3WD4A 1E6PA 5DF0A 2Q5AA 3O5FA 3RM9A 5HWCA 3WQVA 2LPVA 2B5UB 4ODQA 5HWBA 1W1TA 4Z2KA 1GUVA 5HBFA 1JCHB 1SR0A 1EIBA 2PV1A 3AQUA 3UI5A 4QIBA 3O5KA 2QF8A 3ALFA 1ZB5A 3AS3A 4MNLA 2RSEA 3FY1A 1OGGA 4ZS6A 3ARVA 2UZ5A 3JXVA 4DRHA 1YW5A 2OFNA 1W26A 5HW7A 2DSUA 3KADA 3O5RA 1JNSA 3PA7A 3RMEA 4IQ2A 3IK8A 1JVWA 1ZBWA 3CHCA 2B31A 5I98A 4MNJA 1LQ0A 1Q6IA 3PRAA 1O6IA 4TW8A 4DRJA 3IKGA 1EQ3A 2P4VA 4GGQA 2AWGA 1NSGA 1ZCNA 2JZVA 1WAWA 5DO2A 1FKLA 4LAVA 3CZ8A 3O5GA 3CH9A 4MAVA 2MPHA 1GPFA 3ARXA 1XRVA 4IT4A 4U85A 1GOIA 3KAIA 1EDQA 1KT0A 2MLXA 1YATA 3WKZA 2KE0A 2F4EA 3WQWA 1KFWA 1FKTA 3WD2A 5B8IC 2RQSA 2ZQSA 1FKDA 4DWSB 2G8ZA 2PI6A 1W1VA 1Q6UA 3AS1A 2PPPA 3H9RB 4IQCA 2XP3A 4P8VA 5DITA 4IPXA 2RUQA 2ZR6A 5HW8A 2ZQTA 4G2PA 1W9VA 2WM0A 1W1PA 4DROA 1IX5A 3EY6A 1D7JA 2A3AA 2XP6A 3CHEA 5J6EA 5GQBA 3W4RA 4DRIA 4HBOA 3BXWA 4FAPA 3WD0A 5D75A 2LGOA 4IT6A 3CGNA 4DRNA 2FDMA 4Q22A 1NMWA 1NH6A 3JYJA 3PRDA 3ALGA 4DH0A 3KAGA 4AY1A 4JFIA 3GTYX 4ODLA 3OA5A 4P8UA 1LL7A 3KCEA 5HT1A 2ZR4A 1E44A 1P5QA 3ARTA 3WIJA 1PINA 3TCZA 4U84A 2DT3A 1LL4A 2F21A 4R5EA 1R9HA 5HKGA 4DZ3A 2ZR5A 5HUAA
chains in the Genus database with same CATH topology
3CHFA 1ZBVA 2VCDA 2M08A 1D6OA 3B9AA 1D2KA 4QT3A 3AROA 3OOBA 2F2DA 1ZU8A 1EYMA 4WJXA 4JFJA 1KT1A 1OWQA 2ZQUA 4NNRA 5HW6A 1XHGA 1N1AA 2LKNA 2ESCA 2WLYA 2MLYA 4TYOA 4G50A 4Z2HA 1FKSA 2WK2A 4FN2A 2A3CA 4S3JA 2MLZA 2MF9A 4Z2JA 5JH8A 2A3EA 1LG2A 3UI4A 3ARPA 3RM4A 1W9UA 4LAYA 2ITKA 1LJYA 4URIA 1RD6A 1H0GA 1W1YA 4WKAA 2XP4A 4TW7A 3KACA 3ARQA 4W5UA 1E6NA 4ZPTR 4MSPA 3IHZA 3UQIA 1L1PA 1E15A 3ARRA 2N87A 2OLHA 2LJ4A 1B6CA 1OGBA 3ARSA 4Q7NA 3KAFA 4U86A 2M2AA 2RUDA 2KO7A 4DWSC 1HKIA 3ARWA 4L72B 4W9QA 4Z2GA 2DG4A 4C02B 1ZBKA 2DT1A 1FJDA 4KQZA 1J4HA 2D9FA 1FFRA 1FKBA 3RFWA 3UI6A 1HKKA 3TDBA 5GPRA 1HKMA 4QZVB 1C9HA 4HARA 1HXVA 3RGCA 3WD3A 1D7IA 3LUOA 4MGVA 4DWSA 4WK9A 2XPAA 3WL0A 2ZQVA 2RURA 1M5YA 2PV3A 4Z2LA 4ODPA 2XP5A 4WIWA 1JNEA 1ROTA 1E9LA 4N19A 2DT0A 1JNTA 3PR9A 4MPKA 3CGMA 3O5PA 5DEZA 1A7XA 4ODRA 4W9OA 1H0IA 2KGJA 2KI3A 3NTPA 1ITXA 2FKEA 1K9TA 1QPLA 4ZPWR 4GIVA 3O5LA 4ODKA 1BKFA 2KR7A 1FKRA 3ODKA 2PPOA 2IUZA 4DT4A 4LAXA 2DPEA 3B8SA 2AOSA 4ML4A 1U79A 2YBUA 1WB0A 3RM8A 1SYTA 1T11A 1NWSA 2DG3A 1F40A 1UR8A 4XAKA 1ZK6A 2DT2A 3O5QA 4MNKA 4KR0B 4Z2IA 1JNDA 4O2TA 1UR9A 1LG1A 1J4IA 3QOKA 1FKJA 1LL6A 1NMVA 1Q6HA 4JYSA 4MNMA 1ZBCA 1W9PA 4P8WA 1FKGA 3PRBA 4P8XA 1FKHA 3NRKA 3CHDA 2VN1A 1EHNA 4ODOA 5DIVA 1QZ2A 1WNOA 1X6LA 1E6RA 2DSZA 3MDYB 1J6YA 1PBKA 5GPGA 2DG9A 3AS2A 3JYMA 3ARUA 4WKFA 1X6NA 5BXJA 5DIUA 1FAPA 3WD1A 2FAPA 5HTGA 3UF8A 3GPKA 1HKJA 4DRPA 4W9PA 1NWTA 4HBEA 4WKHA 3B9EA 3NI6A 4DWSD 2XP7A 1F8AB 4J4OA 2IF4A 4ITZA 4DZ2A 1VF8A 4R0XA 3KAHA 1BL4A 1NWRA 2Y78A 4MTVA 2PPNA 2A3BA 3WL1A 2O92A 1J4RA 3O5DA 2WLZA 3O5IA 4NSBA 1NWUA 2G41A 1FKKA 1QPFA 3UQBA 1ZL1A 3KZ7A 3VAWA 3B9DA 4ODNA 2M1IA 1CTNA 1Y0OA 2XPBA 1D7HA 3O5EA 4QT2A 4DRQA 4JFMA 1TFVA 3ARYA 4L3NA 4JFLA 4TW6A 3UQAA 2KFWA 4J4NA 4DRMA 2DSVA 4TNSA 2DSWA 3G6LA 4TX0A 4PTMA 1FFQA 4JFKA 3KABA 4LGXA 2PBCA 3IKDA 1HJWA 4S3KA 2RUCA 1HJXA 1HJVA 1FKIA 3O5MA 3TC5A 4ODMA 4BF8A 3G6MA 3WH0A 3O5OA 2L2SA 1FD9A 2PV2A 3B7XA 3FAPA 2O9OA 3FXYA 1FKFA 3AS0A 4ZPVR 1E6ZA 2K8IA 3I6CA 4DIPA 2YBTA 2XP9A 1ROUA 3ARZA 4DRKA 4NZCA 2MNTA 4LAWA 3O5JA 1Q1CA 1TCOC 2XP8A 3WD4A 1E6PA 5DF0A 2Q5AA 3O5FA 3RM9A 5HWCA 3WQVA 2LPVA 4ODQA 5HWBA 1W1TA 4Z2KA 1GUVA 5HBFA 1SR0A 1EIBA 2PV1A 3AQUA 3UI5A 4QIBA 3O5KA 2QF8A 3ALFA 1ZB5A 3AS3A 4MNLA 2RSEA 3FY1A 1OGGA 4ZS6A 3ARVA 2UZ5A 3JXVA 4DRHA 1YW5A 2OFNA 1W26A 5HW7A 2DSUA 3KADA 3O5RA 1JNSA 3PA7A 3RMEA 4IQ2A 3IK8A 1JVWA 1ZBWA 3CHCA 2B31A 5I98A 4MNJA 1LQ0A 1Q6IA 3PRAA 1O6IA 4TW8A 4DRJA 3IKGA 1EQ3A 4GGQA 2AWGA 1NSGA 1ZCNA 2JZVA 1WAWA 5DO2A 1FKLA 4LAVA 3CZ8A 3O5GA 3CH9A 4MAVA 2MPHA 1GPFA 3ARXA 1XRVA 4IT4A 4U85A 1GOIA 3KAIA 1EDQA 1KT0A 2MLXA 1YATA 3WKZA 2KE0A 2F4EA 3WQWA 1KFWA 1FKTA 3WD2A 5B8IC 2RQSA 2ZQSA 1FKDA 4DWSB 2G8ZA 2PI6A 1W1VA 1Q6UA 3AS1A 2PPPA 3H9RB 4IQCA 2XP3A 4P8VA 5DITA 4IPXA 2RUQA 2ZR6A 5HW8A 2ZQTA 4G2PA 1W9VA 2WM0A 1W1PA 4DROA 1IX5A 3EY6A 1D7JA 2A3AA 2XP6A 3CHEA 5J6EA 5GQBA 3W4RA 4DRIA 4HBOA 3BXWA 4FAPA 3WD0A 5D75A 2LGOA 4IT6A 3CGNA 4DRNA 2FDMA 4Q22A 1NMWA 1NH6A 3JYJA 3PRDA 3ALGA 4DH0A 3KAGA 4AY1A 4JFIA 4ODLA 3OA5A 4P8UA 1LL7A 3KCEA 5HT1A 2ZR4A 1P5QA 3ARTA 3WIJA 1PINA 3TCZA 4U84A 2DT3A 1LL4A 2F21A 4R5EA 1R9HA 5HKGA 4DZ3A 2ZR5A 5HUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX5 A;  3PRA A;  3PR9 A; 
#chains in the Genus database with same CATH topology
 3CHF A;  1ZBV A;  2VCD A;  2M08 A;  1D6O A;  3B9A A;  1D2K A;  4QT3 A;  3ARO A;  3OOB A;  2F2D A;  1ZU8 A;  1EYM A;  4WJX A;  4JFJ A;  1KT1 A;  3EIP A;  1OWQ A;  2ZQU A;  4NNR A;  5HW6 A;  1XHG A;  1N1A A;  2LKN A;  2ESC A;  2WLY A;  2MLY A;  4TYO A;  4G50 A;  4Z2H A;  1FKS A;  1GRJ A;  2WK2 A;  4FN2 A;  2A3C A;  4S3J A;  2MLZ A;  2MF9 A;  4Z2J A;  5JH8 A;  2A3E A;  1LG2 A;  3UI4 A;  3ARP A;  3RM4 A;  1W9U A;  4LAY A;  2ITK A;  1LJY A;  4URI A;  1RD6 A;  1H0G A;  1W1Y A;  4WKA A;  2XP4 A;  4TW7 A;  3KAC A;  3ARQ A;  4W5U A;  1E6N A;  4ZPT R;  4MSP A;  3IHZ A;  3UQI A;  1L1P A;  1E15 A;  3ARR A;  2N87 A;  2OLH A;  2LJ4 A;  1B6C A;  1OGB A;  3ARS A;  4Q7N A;  3KAF A;  4U86 A;  2M2A A;  2RUD A;  2KO7 A;  4DWS C;  1HKI A;  3ARW A;  4L72 B;  4UDM A;  4W9Q A;  4Z2G A;  2DG4 A;  4C02 B;  1ZBK A;  2DT1 A;  1FJD A;  4KQZ A;  1J4H A;  2D9F A;  1FFR A;  1FKB A;  3RFW A;  3UI6 A;  1HKK A;  3TDB A;  5GPR A;  1HKM A;  4QZV B;  1C9H A;  4HAR A;  1HXV A;  3RGC A;  3WD3 A;  1D7I A;  3LUO A;  4MGV A;  4DWS A;  4WK9 A;  2XPA A;  3WL0 A;  2ZQV A;  2RUR A;  1M5Y A;  2PV3 A;  4Z2L A;  4ODP A;  2XP5 A;  4WIW A;  1JNE A;  1ROT A;  1E9L A;  4N19 A;  2DT0 A;  1JNT A;  3PR9 A;  4MPK A;  3CGM A;  3O5P A;  5DEZ A;  1A7X A;  4ODR A;  4W9O A;  1H0I A;  2KGJ A;  2KI3 A;  3NTP A;  1ITX A;  2FKE A;  1K9T A;  1QPL A;  4ZPW R;  4GIV A;  3O5L A;  4ODK A;  1BKF A;  2KR7 A;  1FKR A;  3ODK A;  2PPO A;  2IUZ A;  4DT4 A;  4LAX A;  2PN0 A;  2DPE A;  3B8S A;  2AOS A;  2F23 A;  4ML4 A;  1U79 A;  2YBU A;  1WB0 A;  3RM8 A;  1SYT A;  1T11 A;  1NWS A;  2DG3 A;  1F40 A;  1UR8 A;  4XAK A;  1ZK6 A;  2DT2 A;  3O5Q A;  4MNK A;  4KR0 B;  4Z2I A;  1JND A;  4O2T A;  1UR9 A;  1LG1 A;  1J4I A;  3QOK A;  1FKJ A;  3BMB A;  1LL6 A;  1NMV A;  1Q6H A;  4JYS A;  4MNM A;  1ZBC A;  1W9P A;  4P8W A;  1FKG A;  3PRB A;  4P8X A;  1FKH A;  3NRK A;  3CHD A;  2VN1 A;  1EHN A;  4ODO A;  5DIV A;  1QZ2 A;  1WNO A;  1X6L A;  1E6R A;  2DSZ A;  3MDY B;  1J6Y A;  1PBK A;  5GPG A;  2DG9 A;  3AS2 A;  3JYM A;  3ARU A;  4WKF A;  2EUL A;  1X6N A;  5BXJ A;  5DIU A;  1FAP A;  3WD1 A;  2FAP A;  5HTG A;  3UF8 A;  3GPK A;  1HKJ A;  4DRP A;  4W9P A;  1NWT A;  4HBE A;  4WKH A;  3B9E A;  3NI6 A;  4DWS D;  2XP7 A;  1F8A B;  4J4O A;  2IF4 A;  4ITZ A;  4DZ2 A;  1VF8 A;  4R0X A;  3KAH A;  1BL4 A;  1NWR A;  2Y78 A;  4MTV A;  2PPN A;  2A3B A;  3WL1 A;  2O92 A;  1J4R A;  3O5D A;  2WLZ A;  3O5I A;  4NSB A;  1NWU A;  2G41 A;  1FKK A;  1QPF A;  3UQB A;  1ZL1 A;  3KZ7 A;  3VAW A;  3B9D A;  4ODN A;  3GU0 A;  2M1I A;  1CTN A;  1Y0O A;  2XPB A;  1D7H A;  3O5E A;  4QT2 A;  4DRQ A;  2ETN A;  4JFM A;  1TFV A;  3ARY A;  4L3N A;  4JFL A;  4TW6 A;  3UQA A;  2KFW A;  4J4N A;  4DRM A;  2DSV A;  4TNS A;  2DSW A;  3G6L A;  4TX0 A;  4PTM A;  1FFQ A;  4JFK A;  3KAB A;  4LGX A;  2PBC A;  3IKD A;  1HJW A;  4S3K A;  2RUC A;  1HJX A;  1HJV A;  1FKI A;  3O5M A;  3TC5 A;  4ODM A;  4BF8 A;  3G6M A;  3WH0 A;  3O5O A;  2L2S A;  1FD9 A;  2PV2 A;  3B7X A;  3FAP A;  2O9O A;  3FXY A;  1FKF A;  3AS0 A;  4ZPV R;  1E6Z A;  2K8I A;  3I6C A;  4DIP A;  2YBT A;  2XP9 A;  1ROU A;  3ARZ A;  4DRK A;  4NZC A;  2MNT A;  4LAW A;  3O5J A;  1Q1C A;  1TCO C;  2XP8 A;  3WD4 A;  1E6P A;  5DF0 A;  2Q5A A;  3O5F A;  3RM9 A;  5HWC A;  3WQV A;  2LPV A;  2B5U B;  4ODQ A;  5HWB A;  1W1T A;  4Z2K A;  1GUV A;  5HBF A;  1JCH B;  1SR0 A;  1EIB A;  2PV1 A;  3AQU A;  3UI5 A;  4QIB A;  3O5K A;  2QF8 A;  3ALF A;  1ZB5 A;  3AS3 A;  4MNL A;  2RSE A;  3FY1 A;  1OGG A;  4ZS6 A;  3ARV A;  2UZ5 A;  3JXV A;  4DRH A;  1YW5 A;  2OFN A;  1W26 A;  5HW7 A;  2DSU A;  3KAD A;  3O5R A;  1JNS A;  3PA7 A;  3RME A;  4IQ2 A;  3IK8 A;  1JVW A;  1ZBW A;  3CHC A;  2B31 A;  5I98 A;  4MNJ A;  1LQ0 A;  1Q6I A;  3PRA A;  1O6I A;  4TW8 A;  4DRJ A;  3IKG A;  1EQ3 A;  2P4V A;  4GGQ A;  2AWG A;  1NSG A;  1ZCN A;  2JZV A;  1WAW A;  5DO2 A;  1FKL A;  4LAV A;  3CZ8 A;  3O5G A;  3CH9 A;  4MAV A;  2MPH A;  1GPF A;  3ARX A;  1XRV A;  4IT4 A;  4U85 A;  1GOI A;  3KAI A;  1EDQ A;  1KT0 A;  2MLX A;  1YAT A;  3WKZ A;  2KE0 A;  2F4E A;  3WQW A;  1KFW A;  1FKT A;  3WD2 A;  5B8I C;  2RQS A;  2ZQS A;  1FKD A;  4DWS B;  2G8Z A;  2PI6 A;  1W1V A;  1Q6U A;  3AS1 A;  2PPP A;  3H9R B;  4IQC A;  2XP3 A;  4P8V A;  5DIT A;  4IPX A;  2RUQ A;  2ZR6 A;  5HW8 A;  2ZQT A;  4G2P A;  1W9V A;  2WM0 A;  1W1P A;  4DRO A;  1IX5 A;  3EY6 A;  1D7J A;  2A3A A;  2XP6 A;  3CHE A;  5J6E A;  5GQB A;  3W4R A;  4DRI A;  4HBO A;  3BXW A;  4FAP A;  3WD0 A;  5D75 A;  2LGO A;  4IT6 A;  3CGN A;  4DRN A;  2FDM A;  4Q22 A;  1NMW A;  1NH6 A;  3JYJ A;  3PRD A;  3ALG A;  4DH0 A;  3KAG A;  4AY1 A;  4JFI A;  3GTY X;  4ODL A;  3OA5 A;  4P8U A;  1LL7 A;  3KCE A;  5HT1 A;  2ZR4 A;  1E44 A;  1P5Q A;  3ART A;  3WIJ A;  1PIN A;  3TCZ A;  4U84 A;  2DT3 A;  1LL4 A;  2F21 A;  4R5E A;  1R9H A;  5HKG A;  4DZ3 A;  2ZR5 A;  5HUA A; 
#chains in the Genus database with same CATH homology
 3CHF A;  1ZBV A;  2VCD A;  2M08 A;  1D6O A;  3B9A A;  1D2K A;  4QT3 A;  3ARO A;  3OOB A;  2F2D A;  1ZU8 A;  1EYM A;  4WJX A;  4JFJ A;  1KT1 A;  1OWQ A;  2ZQU A;  4NNR A;  5HW6 A;  1XHG A;  1N1A A;  2LKN A;  2ESC A;  2WLY A;  2MLY A;  4TYO A;  4G50 A;  4Z2H A;  1FKS A;  2WK2 A;  4FN2 A;  2A3C A;  4S3J A;  2MLZ A;  2MF9 A;  4Z2J A;  5JH8 A;  2A3E A;  1LG2 A;  3UI4 A;  3ARP A;  3RM4 A;  1W9U A;  4LAY A;  2ITK A;  1LJY A;  4URI A;  1RD6 A;  1H0G A;  1W1Y A;  4WKA A;  2XP4 A;  4TW7 A;  3KAC A;  3ARQ A;  4W5U A;  1E6N A;  4ZPT R;  4MSP A;  3IHZ A;  3UQI A;  1L1P A;  1E15 A;  3ARR A;  2N87 A;  2OLH A;  2LJ4 A;  1B6C A;  1OGB A;  3ARS A;  4Q7N A;  3KAF A;  4U86 A;  2M2A A;  2RUD A;  2KO7 A;  4DWS C;  1HKI A;  3ARW A;  4L72 B;  4W9Q A;  4Z2G A;  2DG4 A;  4C02 B;  1ZBK A;  2DT1 A;  1FJD A;  4KQZ A;  1J4H A;  2D9F A;  1FFR A;  1FKB A;  3RFW A;  3UI6 A;  1HKK A;  3TDB A;  5GPR A;  1HKM A;  4QZV B;  1C9H A;  4HAR A;  1HXV A;  3RGC A;  3WD3 A;  1D7I A;  3LUO A;  4MGV A;  4DWS A;  4WK9 A;  2XPA A;  3WL0 A;  2ZQV A;  2RUR A;  1M5Y A;  2PV3 A;  4Z2L A;  4ODP A;  2XP5 A;  4WIW A;  1JNE A;  1ROT A;  1E9L A;  4N19 A;  2DT0 A;  1JNT A;  3PR9 A;  4MPK A;  3CGM A;  3O5P A;  5DEZ A;  1A7X A;  4ODR A;  4W9O A;  1H0I A;  2KGJ A;  2KI3 A;  3NTP A;  1ITX A;  2FKE A;  1K9T A;  1QPL A;  4ZPW R;  4GIV A;  3O5L A;  4ODK A;  1BKF A;  2KR7 A;  1FKR A;  3ODK A;  2PPO A;  2IUZ A;  4DT4 A;  4LAX A;  2DPE A;  3B8S A;  2AOS A;  4ML4 A;  1U79 A;  2YBU A;  1WB0 A;  3RM8 A;  1SYT A;  1T11 A;  1NWS A;  2DG3 A;  1F40 A;  1UR8 A;  4XAK A;  1ZK6 A;  2DT2 A;  3O5Q A;  4MNK A;  4KR0 B;  4Z2I A;  1JND A;  4O2T A;  1UR9 A;  1LG1 A;  1J4I A;  3QOK A;  1FKJ A;  1LL6 A;  1NMV A;  1Q6H A;  4JYS A;  4MNM A;  1ZBC A;  1W9P A;  4P8W A;  1FKG A;  3PRB A;  4P8X A;  1FKH A;  3NRK A;  3CHD A;  2VN1 A;  1EHN A;  4ODO A;  5DIV A;  1QZ2 A;  1WNO A;  1X6L A;  1E6R A;  2DSZ A;  3MDY B;  1J6Y A;  1PBK A;  5GPG A;  2DG9 A;  3AS2 A;  3JYM A;  3ARU A;  4WKF A;  1X6N A;  5BXJ A;  5DIU A;  1FAP A;  3WD1 A;  2FAP A;  5HTG A;  3UF8 A;  3GPK A;  1HKJ A;  4DRP A;  4W9P A;  1NWT A;  4HBE A;  4WKH A;  3B9E A;  3NI6 A;  4DWS D;  2XP7 A;  1F8A B;  4J4O A;  2IF4 A;  4ITZ A;  4DZ2 A;  1VF8 A;  4R0X A;  3KAH A;  1BL4 A;  1NWR A;  2Y78 A;  4MTV A;  2PPN A;  2A3B A;  3WL1 A;  2O92 A;  1J4R A;  3O5D A;  2WLZ A;  3O5I A;  4NSB A;  1NWU A;  2G41 A;  1FKK A;  1QPF A;  3UQB A;  1ZL1 A;  3KZ7 A;  3VAW A;  3B9D A;  4ODN A;  2M1I A;  1CTN A;  1Y0O A;  2XPB A;  1D7H A;  3O5E A;  4QT2 A;  4DRQ A;  4JFM A;  1TFV A;  3ARY A;  4L3N A;  4JFL A;  4TW6 A;  3UQA A;  2KFW A;  4J4N A;  4DRM A;  2DSV A;  4TNS A;  2DSW A;  3G6L A;  4TX0 A;  4PTM A;  1FFQ A;  4JFK A;  3KAB A;  4LGX A;  2PBC A;  3IKD A;  1HJW A;  4S3K A;  2RUC A;  1HJX A;  1HJV A;  1FKI A;  3O5M A;  3TC5 A;  4ODM A;  4BF8 A;  3G6M A;  3WH0 A;  3O5O A;  2L2S A;  1FD9 A;  2PV2 A;  3B7X A;  3FAP A;  2O9O A;  3FXY A;  1FKF A;  3AS0 A;  4ZPV R;  1E6Z A;  2K8I A;  3I6C A;  4DIP A;  2YBT A;  2XP9 A;  1ROU A;  3ARZ A;  4DRK A;  4NZC A;  2MNT A;  4LAW A;  3O5J A;  1Q1C A;  1TCO C;  2XP8 A;  3WD4 A;  1E6P A;  5DF0 A;  2Q5A A;  3O5F A;  3RM9 A;  5HWC A;  3WQV A;  2LPV A;  4ODQ A;  5HWB A;  1W1T A;  4Z2K A;  1GUV A;  5HBF A;  1SR0 A;  1EIB A;  2PV1 A;  3AQU A;  3UI5 A;  4QIB A;  3O5K A;  2QF8 A;  3ALF A;  1ZB5 A;  3AS3 A;  4MNL A;  2RSE A;  3FY1 A;  1OGG A;  4ZS6 A;  3ARV A;  2UZ5 A;  3JXV A;  4DRH A;  1YW5 A;  2OFN A;  1W26 A;  5HW7 A;  2DSU A;  3KAD A;  3O5R A;  1JNS A;  3PA7 A;  3RME A;  4IQ2 A;  3IK8 A;  1JVW A;  1ZBW A;  3CHC A;  2B31 A;  5I98 A;  4MNJ A;  1LQ0 A;  1Q6I A;  3PRA A;  1O6I A;  4TW8 A;  4DRJ A;  3IKG A;  1EQ3 A;  4GGQ A;  2AWG A;  1NSG A;  1ZCN A;  2JZV A;  1WAW A;  5DO2 A;  1FKL A;  4LAV A;  3CZ8 A;  3O5G A;  3CH9 A;  4MAV A;  2MPH A;  1GPF A;  3ARX A;  1XRV A;  4IT4 A;  4U85 A;  1GOI A;  3KAI A;  1EDQ A;  1KT0 A;  2MLX A;  1YAT A;  3WKZ A;  2KE0 A;  2F4E A;  3WQW A;  1KFW A;  1FKT A;  3WD2 A;  5B8I C;  2RQS A;  2ZQS A;  1FKD A;  4DWS B;  2G8Z A;  2PI6 A;  1W1V A;  1Q6U A;  3AS1 A;  2PPP A;  3H9R B;  4IQC A;  2XP3 A;  4P8V A;  5DIT A;  4IPX A;  2RUQ A;  2ZR6 A;  5HW8 A;  2ZQT A;  4G2P A;  1W9V A;  2WM0 A;  1W1P A;  4DRO A;  1IX5 A;  3EY6 A;  1D7J A;  2A3A A;  2XP6 A;  3CHE A;  5J6E A;  5GQB A;  3W4R A;  4DRI A;  4HBO A;  3BXW A;  4FAP A;  3WD0 A;  5D75 A;  2LGO A;  4IT6 A;  3CGN A;  4DRN A;  2FDM A;  4Q22 A;  1NMW A;  1NH6 A;  3JYJ A;  3PRD A;  3ALG A;  4DH0 A;  3KAG A;  4AY1 A;  4JFI A;  4ODL A;  3OA5 A;  4P8U A;  1LL7 A;  3KCE A;  5HT1 A;  2ZR4 A;  1P5Q A;  3ART A;  3WIJ A;  1PIN A;  3TCZ A;  4U84 A;  2DT3 A;  1LL4 A;  2F21 A;  4R5E A;  1R9H A;  5HKG A;  4DZ3 A;  2ZR5 A;  5HUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...