1BKFA

Fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
molecule tags Isomerase
source organism Homo sapiens
publication title Conformation of Fk506 in X-Ray Structures of its Complexes with Human Recombinant Fkbp12 Mutants
pubmed rcsb
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bkfA00
4N19A 2RUCA 2RUQA 2MLXA 4DROA 1TCOC 1FKIA 3CGMA 4W9OA 3UQIA 4ODLA 1Q6UA 2OFNA 1FKSA 4QT2A 1ZCNA 4LAWA 4TYOA 1FKFA 2LKNA 1FKLA 1FKGA 3O5EA 4JFKA 4R0XA 1D7HA 4TW8A 5DIUA 2KFWA 1J4IA 3TCZA 2AWGA 4G50A 1ROUA 4FAPA 4DRQA 4DRHA 2XP4A 3RGCA 1Q6IA 3O5KA 4TX0A 1J6YA 4W9PA 1FKKA 3UQAA 1EQ3A 3LUOA 3MDYB 4G2PA 5HWCA 2F4EA 1D7JA 3OOBA 1JVWA 2ZR4A 3O5GA 2M1IA 4ODRA 4TNSA 5HWBA 5HW7A 1FKHA 2K8IA 3O5FA 4JFMA 3ODKA 1D7IA 1FKJA 1U79A 1B6CA 2DG3A 4JFIA 4ODKA 4U86A 2F21A 4O2TA 4DZ2A 1BL4A 2JZVA 2KR7A 2Q5AA 4DT4A 4JFLA 3KAIA 4J4NA 3IK8A 1F8AB 4DRNA 2PV3A 3KAHA 2KI3A 4JFJA 2M2AA 3NTPA 2PPNA 2RURA 1R9HA 2ZR5A 3JXVA 4LAVA 1PINA 4GGQA 4IQCA 4IPXA 2XPAA 2LJ4A 2DG9A 4DZ3A 4DRKA 2FAPA 2N87A 5HW6A 3KABA 1ROTA 5B8IC 1FKRA 2XP7A 4NNRA 3O5QA 4DRJA 3GPKA 4QT3A 2PV1A 4ODMA 4ODNA 1L1PA 2MPHA 1YW5A 1Q6HA 3B7XA 4U84A 3EY6A 4MSPA 5D75A 3IKGA 2ZQVA 3O5PA 3O5JA 2LGOA 3VAWA 4BF8A 4DH0A 2PV2A 4DIPA 5HW8A 1A7XA 2RUDA 2ZR6A 5GPGA 4IQ2A 1FAPA 5DITA 2F2DA 1EYMA 1PBKA 2MLYA 4J4OA 1JNTA 2KO7A 2KE0A 4C02B 1T11A 4DRMA 1FKDA 1HXVA 1BKFA 3NI6A 3O5OA 2ITKA 4LAYA 4W9QA 2XP8A 1NMVA 2D9FA 5HUAA 5J6EA 2UZ5A 3I6CA 3IHZA 1NMWA 2DG4A 1FD9A 3O5LA 2RQSA 3KAGA 3UI6A 1C9HA 1P5QA 3TC5A 3UI4A 3O5RA 2MNTA 3PRBA 3KACA 4JYSA 3TDBA 1FJDA 1KT1A 1J4RA 3UQBA 3NRKA 3JYMA 2FKEA 5DIVA 4ODPA 2MLZA 2XP9A 1Q1CA 2RSEA 2Y78A 3CGNA 3KCEA 4U85A 3UI5A 4MGVA 2ZQSA 1FKTA 3O5MA 3KADA 2ZQTA 3JYJA 4ODQA 4GIVA 1F40A 1D6OA 2IF4A 2PBCA 2XP6A 3H9RB 2XP3A 4FN2A 3RFWA 1W26A 2PPPA 1YATA 1N1AA 3PRDA 5I98A 1M5YA 1Y0OA 2M08A 2MF9A 3FAPA 2LPVA 4DRPA 2L2SA 3PA7A 1JNSA 3WH0A 3IKDA 1ZK6A 5HT1A 4QIBA 5HKGA 2KGJA 2ZQUA 3KZ7A 3O5IA 5BXJA 4DRIA 2VN1A 2XPBA 4LAXA 3UF8A 1J4HA 1QPFA 1QZ2A 3KAFA 1KT0A 2XP5A 3O5DA 4ODOA 4TW7A 5HTGA 1FKBA 2PPOA 2VCDA 4TW6A 4ITZA 1QPLA 1NSGA
chains in the Genus database with same CATH superfamily
4N19A 2DSWA 3CGMA 3WKZA 4ODLA 2OFNA 1FKSA 1FFRA 4JFKA 4TW8A 1JNDA 3RM4A 1H0IA 1TFVA 2AWGA 1ROUA 4DRQA 4Z2GA 3RGCA 2O92A 1FKKA 4W9PA 1D2KA 1EQ3A 3MDYB 3WD2A 1JCHB 4ODRA 2B5UB 4TNSA 5HW7A 1FKHA 5HWBA 1FKJA 4JFIA 4AY1A 1GUVA 3BXWA 2DT2A 1LJYA 4P8XA 4W5UA 3EIPA 2Q5AA 3KAIA 4J4NA 2WM0A 1O6IA 4DRNA 4JFJA 1OWQA 1ZB5A 2PPNA 2DT1A 4IT6A 2ZR5A 1E9LA 2DSUA 2DG9A 4L3NA 4DZ3A 3WD3A 1HJXA 3GU0A 2MPHA 1Q6HA 3EY6A 2ETNA 1W1TA 3IKGA 2LGOA 4BF8A 2PV2A 3ARTA 4ZPWR 1A7XA 1FAPA 2F2DA 2MLYA 1PBKA 3ARSA 2KE0A 3RMEA 4XAKA 5J6EA 1NMVA 5DO2A 1ZBWA 2DG4A 3KAGA 3UI6A 3RM9A 3O5RA 1ZBVA 2IUZA 2WLYA 3NRKA 3JYMA 1ZL1A 3KCEA 4Z2JA 3WQVA 3JYJA 4ODQA 4Z2LA 4Z2HA 1D6OA 2XP6A 3H9RB 1ZBCA 2PPPA 1EDQA 1E6NA 1M5YA 1IX5A 2L2SA 3ARVA 1JNSA 1OGGA 4NZCA 2KGJA 2O9OA 3W4RA 3O5IA 1WB0A 2XP5A 4TW7A 5HTGA 1FKBA 3B9AA 4ODNA 4ITZA 4DRPA 2RUCA 1LG2A 1FKIA 2EULA 1Q6UA 1FKFA 3ARUA 4G50A 2YBUA 3WQWA 5DEZA 4DRHA 1Q6IA 4TX0A 4DWSB 3ARQA 4PTMA 2ZR4A 4JFMA 2K8IA 3O5FA 1U79A 4ODKA 4U86A 2F21A 3CHEA 3B9DA 3G6MA 4DT4A 4JFLA 3FY1A 4LGXA 3KAHA 2KI3A 4ZS6A 2RURA 1ITXA 4LAVA 4GGQA 3AQUA 2LJ4A 4DRKA 2AOSA 5B8IC 4S3KA 4Q22A 3WD4A 4DRJA 4QT3A 1YW5A 4U84A 3B8SA 4MSPA 3CHFA 2ZQVA 3VAWA 1HJVA 3ALGA 2RUDA 5GPGA 5DITA 3WL0A 1EYMA 4ZPTR 1T11A 4DRMA 1FKDA 1HKJA 4P8WA 1HXVA 1BKFA 3NI6A 4W9QA 5HUAA 1NH6A 3I6CA 1EHNA 4MNKA 4DWSD 1P5QA 3TDBA 1FJDA 1J4RA 3WIJA 1GRJA 4ODPA 1Q1CA 2RSEA 2DSZA 3O5MA 3FXYA 5GQBA 3B9EA 2XP3A 1YATA 1Y0OA 2MF9A 4UDMA 1W1PA 3AS1A 1KFWA 1ZK6A 5HT1A 3CHCA 5HKGA 4MNLA 3KZ7A 5BXJA 1E44A 2VN1A 4ML4A 3CHDA 1ZU8A 4LAXA 1J4HA 1QZ2A 4ODOA 3WD1A 1UR8A 2A3EA 4HBEA 2G8ZA 4WKAA 1QPLA 4NSBA 4MAVA 3WD0A 3UQIA 4WKHA 3OA5A 2G41A 4QT2A 1ZCNA 4LAWA 2LKNA 3ARZA 1FKLA 1D7HA 2KFWA 1J4IA 1UR9A 3PRAA 4FAPA 1NWSA 1NWUA 2XP4A 4Z2IA 3O5KA 4P8UA 5HWCA 3OOBA 4DWSA 3ALFA 1RD6A 1B6CA 1BL4A 3ARYA 1W1YA 1F8AB 1HKMA 4P8VA 1JNEA 1R9HA 3JXVA 4MTVA 1PINA 4IQCA 4WJXA 1WNOA 4IPXA 2FAPA 2YBTA 3KABA 5HW6A 2XP7A 3O5QA 1FFQA 1XRVA 4L72B 1L1PA 4ZPVR 1H0GA 1EIBA 4DH0A 2DT0A 5HW8A 3ARXA 2ZR6A 4MNMA 1LQ0A 1W9VA 3PR9A 4J4OA 2ESCA 1JNTA 1SR0A 3CZ8A 2ITKA 5JH8A 2D9FA 2UZ5A 3IHZA 1NMWA 1FD9A 4IT4A 1C9HA 3TC5A 2MNTA 2A3CA 3PRBA 3KACA 4JYSA 1LG1A 1KT1A 3G6LA 2P4VA 5DIVA 2MLZA 3CGNA 2Y78A 4U85A 4MGVA 4S3JA 1FKTA 3KADA 4GIVA 1F40A 2PBCA 4FN2A 1W26A 1HJWA 2QF8A 3WL1A 2M08A 3AS2A 3FAPA 2LPVA 2PN0A 3PA7A 3IKDA 1K9TA 4QIBA 4KQZA 4DRIA 5DF0A 1KT0A 3O5DA 2PPOA 4TW6A 1NSGA 4ODMA 1W9PA 2RUQA 1HKIA 3QOKA 2MLXA 4DROA 1TCOC 4W9OA 1W9UA 2FDMA 4TYOA 1FKGA 3O5EA 4R0XA 1E6PA 5DIUA 1LL4A 4Q7NA 1NWRA 2A3AA 3TCZA 5HBFA 3UQAA 3LUOA 4G2PA 2F4EA 1D7JA 1JVWA 3O5GA 1J6YA 2M1IA 1LL7A 3ODKA 1D7IA 2DG3A 4O2TA 4DZ2A 2JZVA 2KR7A 1E6RA 2DPEA 1GPFA 3IK8A 1VF8A 2PV3A 4MPKA 1XHGA 2M2AA 1LL6A 3NTPA 4Z2KA 2XPAA 2N87A 2WK2A 1ROTA 1NWTA 1FKRA 3ARWA 4NNRA 2DSVA 3GPKA 3AROA 4DWSC 2PV1A 2F23A 3B7XA 5D75A 3O5PA 3O5JA 4MNJA 4DIPA 3AS3A 1HKKA 5GPRA 4IQ2A 2KO7A 4C02B 3BMBA 4WK9A 2A3BA 1CTNA 4LAYA 2WLZA 3O5OA 2XP8A 4HBOA 4URIA 1WAWA 3O5LA 2PI6A 2RQSA 3UI4A 3ARRA 4HARA 4KR0B 3CH9A 3UQBA 4QZVB 2FKEA 1X6LA 2XP9A 3RM8A 3UI5A 3AS0A 2ZQSA 1SYTA 2DT3A 2ZQTA 4R5EA 1E6ZA 2IF4A 1E15A 3GTYX 3RFWA 1N1AA 4WKFA 3PRDA 5I98A 1W1VA 2B31A 3WH0A 2ZQUA 3ARPA 4WIWA 1X6NA 2OLHA 1GOIA 2XPBA 3UF8A 1QPFA 3KAFA 1ZBKA 2VCDA 1OGBA
chains in the Genus database with same CATH topology
4N19A 2DSWA 3CGMA 3WKZA 4ODLA 2OFNA 1FKSA 1FFRA 4JFKA 4TW8A 1JNDA 3RM4A 1H0IA 1TFVA 2AWGA 1ROUA 4DRQA 4Z2GA 3RGCA 2O92A 1FKKA 4W9PA 1D2KA 1EQ3A 3MDYB 3WD2A 4ODRA 4TNSA 5HWBA 5HW7A 1FKHA 1FKJA 4JFIA 4AY1A 1GUVA 3BXWA 2DT2A 1LJYA 4P8XA 4W5UA 2Q5AA 3KAIA 4J4NA 2WM0A 1O6IA 4DRNA 4JFJA 1OWQA 1ZB5A 2PPNA 2DT1A 4IT6A 2ZR5A 1E9LA 2DSUA 2DG9A 4L3NA 4DZ3A 3WD3A 1HJXA 2MPHA 1Q6HA 3EY6A 1W1TA 3IKGA 2LGOA 4BF8A 2PV2A 3ARTA 4ZPWR 1A7XA 1FAPA 2F2DA 2MLYA 1PBKA 3ARSA 2KE0A 3RMEA 4XAKA 5J6EA 1NMVA 5DO2A 1ZBWA 2DG4A 3KAGA 3UI6A 3RM9A 3O5RA 1ZBVA 2IUZA 2WLYA 3NRKA 3JYMA 1ZL1A 3KCEA 4Z2JA 3WQVA 3JYJA 4ODQA 4Z2LA 4Z2HA 1D6OA 2XP6A 3H9RB 1ZBCA 2PPPA 1EDQA 1E6NA 1M5YA 1IX5A 2L2SA 3ARVA 1JNSA 1OGGA 4NZCA 2KGJA 2O9OA 3W4RA 3O5IA 1WB0A 2XP5A 4TW7A 5HTGA 1FKBA 3B9AA 4ODNA 4ITZA 4DRPA 2RUCA 1LG2A 1FKIA 1Q6UA 1FKFA 3ARUA 4G50A 2YBUA 3WQWA 5DEZA 4DRHA 1Q6IA 4TX0A 4DWSB 3ARQA 4PTMA 2ZR4A 4JFMA 2K8IA 3O5FA 1U79A 4ODKA 4U86A 2F21A 3CHEA 3B9DA 3G6MA 4DT4A 4JFLA 3FY1A 4LGXA 3KAHA 2KI3A 4ZS6A 2RURA 1ITXA 4LAVA 4GGQA 3AQUA 2LJ4A 4DRKA 2AOSA 5B8IC 4S3KA 4Q22A 3WD4A 4DRJA 4QT3A 1YW5A 4U84A 3B8SA 4MSPA 3CHFA 2ZQVA 3VAWA 1HJVA 3ALGA 2RUDA 5GPGA 5DITA 3WL0A 1EYMA 4ZPTR 1T11A 4DRMA 1FKDA 1HKJA 4P8WA 1HXVA 1BKFA 3NI6A 4W9QA 5HUAA 1NH6A 3I6CA 1EHNA 4MNKA 4DWSD 1P5QA 3TDBA 1FJDA 1J4RA 3WIJA 4ODPA 1Q1CA 2RSEA 2DSZA 3O5MA 3FXYA 5GQBA 3B9EA 2XP3A 1YATA 1Y0OA 2MF9A 1W1PA 3AS1A 1KFWA 1ZK6A 5HT1A 3CHCA 5HKGA 4MNLA 3KZ7A 5BXJA 2VN1A 4ML4A 3WD1A 3CHDA 1ZU8A 4LAXA 1J4HA 1QZ2A 4ODOA 1UR8A 2A3EA 4HBEA 2G8ZA 4WKAA 1QPLA 4NSBA 4MAVA 3WD0A 3UQIA 4WKHA 3OA5A 2G41A 4QT2A 1ZCNA 4LAWA 2LKNA 3ARZA 1FKLA 1D7HA 2KFWA 1J4IA 1UR9A 3PRAA 4FAPA 1NWSA 1NWUA 2XP4A 4Z2IA 3O5KA 4P8UA 5HWCA 3OOBA 4DWSA 3ALFA 1RD6A 1B6CA 1BL4A 3ARYA 1W1YA 1F8AB 1HKMA 4P8VA 1JNEA 1R9HA 3JXVA 4MTVA 1PINA 4IQCA 4WJXA 1WNOA 4IPXA 2FAPA 2YBTA 3KABA 5HW6A 2XP7A 3O5QA 1FFQA 1XRVA 4L72B 1L1PA 4ZPVR 1H0GA 1EIBA 4DH0A 2DT0A 5HW8A 3ARXA 2ZR6A 4MNMA 1LQ0A 1W9VA 3PR9A 4J4OA 2ESCA 1JNTA 1SR0A 3CZ8A 2ITKA 5JH8A 2D9FA 2UZ5A 3IHZA 1NMWA 1FD9A 4IT4A 1C9HA 3TC5A 2MNTA 2A3CA 3PRBA 3KACA 4JYSA 1LG1A 1KT1A 3G6LA 5DIVA 2MLZA 3CGNA 2Y78A 4U85A 4MGVA 4S3JA 1FKTA 3KADA 4GIVA 1F40A 2PBCA 4FN2A 1W26A 1HJWA 2QF8A 3WL1A 2M08A 3AS2A 3FAPA 2LPVA 3PA7A 3IKDA 1K9TA 4QIBA 4KQZA 4DRIA 5DF0A 1KT0A 3O5DA 2PPOA 4TW6A 1NSGA 4ODMA 1W9PA 2RUQA 1HKIA 3QOKA 2MLXA 4DROA 1TCOC 4W9OA 1W9UA 2FDMA 4TYOA 1FKGA 3O5EA 4R0XA 1E6PA 5DIUA 1LL4A 4Q7NA 1NWRA 2A3AA 3TCZA 5HBFA 3UQAA 3LUOA 4G2PA 2F4EA 1D7JA 1JVWA 3O5GA 1J6YA 2M1IA 1LL7A 3ODKA 1D7IA 2DG3A 4O2TA 4DZ2A 2JZVA 2KR7A 1E6RA 2DPEA 1GPFA 3IK8A 1VF8A 2PV3A 4MPKA 1XHGA 2M2AA 1LL6A 3NTPA 4Z2KA 2XPAA 2N87A 2WK2A 1ROTA 1NWTA 1FKRA 3ARWA 4NNRA 2DSVA 3GPKA 3AROA 4DWSC 2PV1A 3B7XA 5D75A 3O5PA 3O5JA 4MNJA 4DIPA 3AS3A 1HKKA 5GPRA 4IQ2A 2KO7A 4C02B 4WK9A 2A3BA 1CTNA 4LAYA 2WLZA 3O5OA 2XP8A 4HBOA 4URIA 1WAWA 3O5LA 2PI6A 2RQSA 3UI4A 3ARRA 4HARA 4KR0B 3CH9A 3UQBA 4QZVB 2FKEA 1X6LA 2XP9A 3RM8A 3UI5A 3AS0A 2ZQSA 1SYTA 2DT3A 2ZQTA 4R5EA 1E6ZA 2IF4A 1E15A 3RFWA 1N1AA 4WKFA 3PRDA 5I98A 1W1VA 2B31A 3WH0A 2ZQUA 3ARPA 4WIWA 1X6NA 2OLHA 1GOIA 2XPBA 3UF8A 1QPFA 3KAFA 1ZBKA 2VCDA 1OGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N19 A;  2RUC A;  2RUQ A;  2MLX A;  4DRO A;  1TCO C;  1FKI A;  3CGM A;  4W9O A;  3UQI A;  4ODL A;  1Q6U A;  2OFN A;  1FKS A;  4QT2 A;  1ZCN A;  4LAW A;  4TYO A;  1FKF A;  2LKN A;  1FKL A;  1FKG A;  3O5E A;  4JFK A;  4R0X A;  1D7H A;  4TW8 A;  5DIU A;  2KFW A;  1J4I A;  3TCZ A;  2AWG A;  4G50 A;  1ROU A;  4FAP A;  4DRQ A;  4DRH A;  2XP4 A;  3RGC A;  1Q6I A;  3O5K A;  4TX0 A;  1J6Y A;  4W9P A;  1FKK A;  3UQA A;  1EQ3 A;  3LUO A;  3MDY B;  4G2P A;  5HWC A;  2F4E A;  1D7J A;  3OOB A;  1JVW A;  2ZR4 A;  3O5G A;  2M1I A;  4ODR A;  4TNS A;  5HWB A;  5HW7 A;  1FKH A;  2K8I A;  3O5F A;  4JFM A;  3ODK A;  1D7I A;  1FKJ A;  1U79 A;  1B6C A;  2DG3 A;  4JFI A;  4ODK A;  4U86 A;  2F21 A;  4O2T A;  4DZ2 A;  1BL4 A;  2JZV A;  2KR7 A;  2Q5A A;  4DT4 A;  4JFL A;  3KAI A;  4J4N A;  3IK8 A;  1F8A B;  4DRN A;  2PV3 A;  3KAH A;  2KI3 A;  4JFJ A;  2M2A A;  3NTP A;  2PPN A;  2RUR A;  1R9H A;  2ZR5 A;  3JXV A;  4LAV A;  1PIN A;  4GGQ A;  4IQC A;  4IPX A;  2XPA A;  2LJ4 A;  2DG9 A;  4DZ3 A;  4DRK A;  2FAP A;  2N87 A;  5HW6 A;  3KAB A;  1ROT A;  5B8I C;  1FKR A;  2XP7 A;  4NNR A;  3O5Q A;  4DRJ A;  3GPK A;  4QT3 A;  2PV1 A;  4ODM A;  4ODN A;  1L1P A;  2MPH A;  1YW5 A;  1Q6H A;  3B7X A;  4U84 A;  3EY6 A;  4MSP A;  5D75 A;  3IKG A;  2ZQV A;  3O5P A;  3O5J A;  2LGO A;  3VAW A;  4BF8 A;  4DH0 A;  2PV2 A;  4DIP A;  5HW8 A;  1A7X A;  2RUD A;  2ZR6 A;  5GPG A;  4IQ2 A;  1FAP A;  5DIT A;  2F2D A;  1EYM A;  1PBK A;  2MLY A;  4J4O A;  1JNT A;  2KO7 A;  2KE0 A;  4C02 B;  1T11 A;  4DRM A;  1FKD A;  1HXV A;  1BKF A;  3NI6 A;  3O5O A;  2ITK A;  4LAY A;  4W9Q A;  2XP8 A;  1NMV A;  2D9F A;  5HUA A;  5J6E A;  2UZ5 A;  3I6C A;  3IHZ A;  1NMW A;  2DG4 A;  1FD9 A;  3O5L A;  2RQS A;  3KAG A;  3UI6 A;  1C9H A;  1P5Q A;  3TC5 A;  3UI4 A;  3O5R A;  2MNT A;  3PRB A;  3KAC A;  4JYS A;  3TDB A;  1FJD A;  1KT1 A;  1J4R A;  3UQB A;  3NRK A;  3JYM A;  2FKE A;  5DIV A;  4ODP A;  2MLZ A;  2XP9 A;  1Q1C A;  2RSE A;  2Y78 A;  3CGN A;  3KCE A;  4U85 A;  3UI5 A;  4MGV A;  2ZQS A;  1FKT A;  3O5M A;  3KAD A;  2ZQT A;  3JYJ A;  4ODQ A;  4GIV A;  1F40 A;  1D6O A;  2IF4 A;  2PBC A;  2XP6 A;  3H9R B;  2XP3 A;  4FN2 A;  3RFW A;  1W26 A;  2PPP A;  1YAT A;  1N1A A;  3PRD A;  5I98 A;  1M5Y A;  1Y0O A;  2M08 A;  2MF9 A;  3FAP A;  2LPV A;  4DRP A;  2L2S A;  3PA7 A;  1JNS A;  3WH0 A;  3IKD A;  1ZK6 A;  5HT1 A;  4QIB A;  5HKG A;  2KGJ A;  2ZQU A;  3KZ7 A;  3O5I A;  5BXJ A;  4DRI A;  2VN1 A;  2XPB A;  4LAX A;  3UF8 A;  1J4H A;  1QPF A;  1QZ2 A;  3KAF A;  1KT0 A;  2XP5 A;  3O5D A;  4ODO A;  4TW7 A;  5HTG A;  1FKB A;  2PPO A;  2VCD A;  4TW6 A;  4ITZ A;  1QPL A;  1NSG A; 
#chains in the Genus database with same CATH topology
 4N19 A;  2DSW A;  3CGM A;  3WKZ A;  4ODL A;  2OFN A;  1FKS A;  1FFR A;  4JFK A;  4TW8 A;  1JND A;  3RM4 A;  1H0I A;  1TFV A;  2AWG A;  1ROU A;  4DRQ A;  4Z2G A;  3RGC A;  2O92 A;  1FKK A;  4W9P A;  1D2K A;  1EQ3 A;  3MDY B;  3WD2 A;  1JCH B;  4ODR A;  2B5U B;  4TNS A;  5HW7 A;  1FKH A;  5HWB A;  1FKJ A;  4JFI A;  4AY1 A;  1GUV A;  3BXW A;  2DT2 A;  1LJY A;  4P8X A;  4W5U A;  3EIP A;  2Q5A A;  3KAI A;  4J4N A;  2WM0 A;  1O6I A;  4DRN A;  4JFJ A;  1OWQ A;  1ZB5 A;  2PPN A;  2DT1 A;  4IT6 A;  2ZR5 A;  1E9L A;  2DSU A;  2DG9 A;  4L3N A;  4DZ3 A;  3WD3 A;  1HJX A;  3GU0 A;  2MPH A;  1Q6H A;  3EY6 A;  2ETN A;  1W1T A;  3IKG A;  2LGO A;  4BF8 A;  2PV2 A;  3ART A;  4ZPW R;  1A7X A;  1FAP A;  2F2D A;  2MLY A;  1PBK A;  3ARS A;  2KE0 A;  3RME A;  4XAK A;  5J6E A;  1NMV A;  5DO2 A;  1ZBW A;  2DG4 A;  3KAG A;  3UI6 A;  3RM9 A;  3O5R A;  1ZBV A;  2IUZ A;  2WLY A;  3NRK A;  3JYM A;  1ZL1 A;  3KCE A;  4Z2J A;  3WQV A;  3JYJ A;  4ODQ A;  4Z2L A;  4Z2H A;  1D6O A;  2XP6 A;  3H9R B;  1ZBC A;  2PPP A;  1EDQ A;  1E6N A;  1M5Y A;  1IX5 A;  2L2S A;  3ARV A;  1JNS A;  1OGG A;  4NZC A;  2KGJ A;  2O9O A;  3W4R A;  3O5I A;  1WB0 A;  2XP5 A;  4TW7 A;  5HTG A;  1FKB A;  3B9A A;  4ODN A;  4ITZ A;  4DRP A;  2RUC A;  1LG2 A;  1FKI A;  2EUL A;  1Q6U A;  1FKF A;  3ARU A;  4G50 A;  2YBU A;  3WQW A;  5DEZ A;  4DRH A;  1Q6I A;  4TX0 A;  4DWS B;  3ARQ A;  4PTM A;  2ZR4 A;  4JFM A;  2K8I A;  3O5F A;  1U79 A;  4ODK A;  4U86 A;  2F21 A;  3CHE A;  3B9D A;  3G6M A;  4DT4 A;  4JFL A;  3FY1 A;  4LGX A;  3KAH A;  2KI3 A;  4ZS6 A;  2RUR A;  1ITX A;  4LAV A;  4GGQ A;  3AQU A;  2LJ4 A;  4DRK A;  2AOS A;  5B8I C;  4S3K A;  4Q22 A;  3WD4 A;  4DRJ A;  4QT3 A;  1YW5 A;  4U84 A;  3B8S A;  4MSP A;  3CHF A;  2ZQV A;  3VAW A;  1HJV A;  3ALG A;  2RUD A;  5GPG A;  5DIT A;  3WL0 A;  1EYM A;  4ZPT R;  1T11 A;  4DRM A;  1FKD A;  1HKJ A;  4P8W A;  1HXV A;  1BKF A;  3NI6 A;  4W9Q A;  5HUA A;  1NH6 A;  3I6C A;  1EHN A;  4MNK A;  4DWS D;  1P5Q A;  3TDB A;  1FJD A;  1J4R A;  3WIJ A;  1GRJ A;  4ODP A;  1Q1C A;  2RSE A;  2DSZ A;  3O5M A;  3FXY A;  5GQB A;  3B9E A;  2XP3 A;  1YAT A;  1Y0O A;  2MF9 A;  4UDM A;  1W1P A;  3AS1 A;  1KFW A;  1ZK6 A;  5HT1 A;  3CHC A;  5HKG A;  4MNL A;  3KZ7 A;  5BXJ A;  1E44 A;  2VN1 A;  4ML4 A;  3CHD A;  1ZU8 A;  4LAX A;  1J4H A;  1QZ2 A;  4ODO A;  3WD1 A;  1UR8 A;  2A3E A;  4HBE A;  2G8Z A;  4WKA A;  1QPL A;  4NSB A;  4MAV A;  3WD0 A;  3UQI A;  4WKH A;  3OA5 A;  2G41 A;  4QT2 A;  1ZCN A;  4LAW A;  2LKN A;  3ARZ A;  1FKL A;  1D7H A;  2KFW A;  1J4I A;  1UR9 A;  3PRA A;  4FAP A;  1NWS A;  1NWU A;  2XP4 A;  4Z2I A;  3O5K A;  4P8U A;  5HWC A;  3OOB A;  4DWS A;  3ALF A;  1RD6 A;  1B6C A;  1BL4 A;  3ARY A;  1W1Y A;  1F8A B;  1HKM A;  4P8V A;  1JNE A;  1R9H A;  3JXV A;  4MTV A;  1PIN A;  4IQC A;  4WJX A;  1WNO A;  4IPX A;  2FAP A;  2YBT A;  3KAB A;  5HW6 A;  2XP7 A;  3O5Q A;  1FFQ A;  1XRV A;  4L72 B;  1L1P A;  4ZPV R;  1H0G A;  1EIB A;  4DH0 A;  2DT0 A;  5HW8 A;  3ARX A;  2ZR6 A;  4MNM A;  1LQ0 A;  1W9V A;  3PR9 A;  4J4O A;  2ESC A;  1JNT A;  1SR0 A;  3CZ8 A;  2ITK A;  5JH8 A;  2D9F A;  2UZ5 A;  3IHZ A;  1NMW A;  1FD9 A;  4IT4 A;  1C9H A;  3TC5 A;  2MNT A;  2A3C A;  3PRB A;  3KAC A;  4JYS A;  1LG1 A;  1KT1 A;  3G6L A;  2P4V A;  5DIV A;  2MLZ A;  3CGN A;  2Y78 A;  4U85 A;  4MGV A;  4S3J A;  1FKT A;  3KAD A;  4GIV A;  1F40 A;  2PBC A;  4FN2 A;  1W26 A;  1HJW A;  2QF8 A;  3WL1 A;  2M08 A;  3AS2 A;  3FAP A;  2LPV A;  2PN0 A;  3PA7 A;  3IKD A;  1K9T A;  4QIB A;  4KQZ A;  4DRI A;  5DF0 A;  1KT0 A;  3O5D A;  2PPO A;  4TW6 A;  1NSG A;  4ODM A;  1W9P A;  2RUQ A;  1HKI A;  3QOK A;  2MLX A;  4DRO A;  1TCO C;  4W9O A;  1W9U A;  2FDM A;  4TYO A;  1FKG A;  3O5E A;  4R0X A;  1E6P A;  5DIU A;  1LL4 A;  4Q7N A;  1NWR A;  2A3A A;  3TCZ A;  5HBF A;  3UQA A;  3LUO A;  4G2P A;  2F4E A;  1D7J A;  1JVW A;  3O5G A;  1J6Y A;  2M1I A;  1LL7 A;  3ODK A;  1D7I A;  2DG3 A;  4O2T A;  4DZ2 A;  2JZV A;  2KR7 A;  1E6R A;  2DPE A;  1GPF A;  3IK8 A;  1VF8 A;  2PV3 A;  4MPK A;  1XHG A;  2M2A A;  1LL6 A;  3NTP A;  4Z2K A;  2XPA A;  2N87 A;  2WK2 A;  1ROT A;  1NWT A;  1FKR A;  3ARW A;  4NNR A;  2DSV A;  3GPK A;  3ARO A;  4DWS C;  2PV1 A;  2F23 A;  3B7X A;  5D75 A;  3O5P A;  3O5J A;  4MNJ A;  4DIP A;  3AS3 A;  1HKK A;  5GPR A;  4IQ2 A;  2KO7 A;  4C02 B;  3BMB A;  4WK9 A;  2A3B A;  1CTN A;  4LAY A;  2WLZ A;  3O5O A;  2XP8 A;  4HBO A;  4URI A;  1WAW A;  3O5L A;  2PI6 A;  2RQS A;  3UI4 A;  3ARR A;  4HAR A;  4KR0 B;  3CH9 A;  3UQB A;  4QZV B;  2FKE A;  1X6L A;  2XP9 A;  3RM8 A;  3UI5 A;  3AS0 A;  2ZQS A;  1SYT A;  2DT3 A;  2ZQT A;  4R5E A;  1E6Z A;  2IF4 A;  1E15 A;  3GTY X;  3RFW A;  1N1A A;  4WKF A;  3PRD A;  5I98 A;  1W1V A;  2B31 A;  3WH0 A;  2ZQU A;  3ARP A;  4WIW A;  1X6N A;  2OLH A;  1GOI A;  2XPB A;  3UF8 A;  1QPF A;  3KAF A;  1ZBK A;  2VCD A;  1OGB A; 
#chains in the Genus database with same CATH homology
 4N19 A;  2DSW A;  3CGM A;  3WKZ A;  4ODL A;  2OFN A;  1FKS A;  1FFR A;  4JFK A;  4TW8 A;  1JND A;  3RM4 A;  1H0I A;  1TFV A;  2AWG A;  1ROU A;  4DRQ A;  4Z2G A;  3RGC A;  2O92 A;  1FKK A;  4W9P A;  1D2K A;  1EQ3 A;  3MDY B;  3WD2 A;  4ODR A;  4TNS A;  5HWB A;  5HW7 A;  1FKH A;  1FKJ A;  4JFI A;  4AY1 A;  1GUV A;  3BXW A;  2DT2 A;  1LJY A;  4P8X A;  4W5U A;  2Q5A A;  3KAI A;  4J4N A;  2WM0 A;  1O6I A;  4DRN A;  4JFJ A;  1OWQ A;  1ZB5 A;  2PPN A;  2DT1 A;  4IT6 A;  2ZR5 A;  1E9L A;  2DSU A;  2DG9 A;  4L3N A;  4DZ3 A;  3WD3 A;  1HJX A;  2MPH A;  1Q6H A;  3EY6 A;  1W1T A;  3IKG A;  2LGO A;  4BF8 A;  2PV2 A;  3ART A;  4ZPW R;  1A7X A;  1FAP A;  2F2D A;  2MLY A;  1PBK A;  3ARS A;  2KE0 A;  3RME A;  4XAK A;  5J6E A;  1NMV A;  5DO2 A;  1ZBW A;  2DG4 A;  3KAG A;  3UI6 A;  3RM9 A;  3O5R A;  1ZBV A;  2IUZ A;  2WLY A;  3NRK A;  3JYM A;  1ZL1 A;  3KCE A;  4Z2J A;  3WQV A;  3JYJ A;  4ODQ A;  4Z2L A;  4Z2H A;  1D6O A;  2XP6 A;  3H9R B;  1ZBC A;  2PPP A;  1EDQ A;  1E6N A;  1M5Y A;  1IX5 A;  2L2S A;  3ARV A;  1JNS A;  1OGG A;  4NZC A;  2KGJ A;  2O9O A;  3W4R A;  3O5I A;  1WB0 A;  2XP5 A;  4TW7 A;  5HTG A;  1FKB A;  3B9A A;  4ODN A;  4ITZ A;  4DRP A;  2RUC A;  1LG2 A;  1FKI A;  1Q6U A;  1FKF A;  3ARU A;  4G50 A;  2YBU A;  3WQW A;  5DEZ A;  4DRH A;  1Q6I A;  4TX0 A;  4DWS B;  3ARQ A;  4PTM A;  2ZR4 A;  4JFM A;  2K8I A;  3O5F A;  1U79 A;  4ODK A;  4U86 A;  2F21 A;  3CHE A;  3B9D A;  3G6M A;  4DT4 A;  4JFL A;  3FY1 A;  4LGX A;  3KAH A;  2KI3 A;  4ZS6 A;  2RUR A;  1ITX A;  4LAV A;  4GGQ A;  3AQU A;  2LJ4 A;  4DRK A;  2AOS A;  5B8I C;  4S3K A;  4Q22 A;  3WD4 A;  4DRJ A;  4QT3 A;  1YW5 A;  4U84 A;  3B8S A;  4MSP A;  3CHF A;  2ZQV A;  3VAW A;  1HJV A;  3ALG A;  2RUD A;  5GPG A;  5DIT A;  3WL0 A;  1EYM A;  4ZPT R;  1T11 A;  4DRM A;  1FKD A;  1HKJ A;  4P8W A;  1HXV A;  1BKF A;  3NI6 A;  4W9Q A;  5HUA A;  1NH6 A;  3I6C A;  1EHN A;  4MNK A;  4DWS D;  1P5Q A;  3TDB A;  1FJD A;  1J4R A;  3WIJ A;  4ODP A;  1Q1C A;  2RSE A;  2DSZ A;  3O5M A;  3FXY A;  5GQB A;  3B9E A;  2XP3 A;  1YAT A;  1Y0O A;  2MF9 A;  1W1P A;  3AS1 A;  1KFW A;  1ZK6 A;  5HT1 A;  3CHC A;  5HKG A;  4MNL A;  3KZ7 A;  5BXJ A;  2VN1 A;  4ML4 A;  3WD1 A;  3CHD A;  1ZU8 A;  4LAX A;  1J4H A;  1QZ2 A;  4ODO A;  1UR8 A;  2A3E A;  4HBE A;  2G8Z A;  4WKA A;  1QPL A;  4NSB A;  4MAV A;  3WD0 A;  3UQI A;  4WKH A;  3OA5 A;  2G41 A;  4QT2 A;  1ZCN A;  4LAW A;  2LKN A;  3ARZ A;  1FKL A;  1D7H A;  2KFW A;  1J4I A;  1UR9 A;  3PRA A;  4FAP A;  1NWS A;  1NWU A;  2XP4 A;  4Z2I A;  3O5K A;  4P8U A;  5HWC A;  3OOB A;  4DWS A;  3ALF A;  1RD6 A;  1B6C A;  1BL4 A;  3ARY A;  1W1Y A;  1F8A B;  1HKM A;  4P8V A;  1JNE A;  1R9H A;  3JXV A;  4MTV A;  1PIN A;  4IQC A;  4WJX A;  1WNO A;  4IPX A;  2FAP A;  2YBT A;  3KAB A;  5HW6 A;  2XP7 A;  3O5Q A;  1FFQ A;  1XRV A;  4L72 B;  1L1P A;  4ZPV R;  1H0G A;  1EIB A;  4DH0 A;  2DT0 A;  5HW8 A;  3ARX A;  2ZR6 A;  4MNM A;  1LQ0 A;  1W9V A;  3PR9 A;  4J4O A;  2ESC A;  1JNT A;  1SR0 A;  3CZ8 A;  2ITK A;  5JH8 A;  2D9F A;  2UZ5 A;  3IHZ A;  1NMW A;  1FD9 A;  4IT4 A;  1C9H A;  3TC5 A;  2MNT A;  2A3C A;  3PRB A;  3KAC A;  4JYS A;  1LG1 A;  1KT1 A;  3G6L A;  5DIV A;  2MLZ A;  3CGN A;  2Y78 A;  4U85 A;  4MGV A;  4S3J A;  1FKT A;  3KAD A;  4GIV A;  1F40 A;  2PBC A;  4FN2 A;  1W26 A;  1HJW A;  2QF8 A;  3WL1 A;  2M08 A;  3AS2 A;  3FAP A;  2LPV A;  3PA7 A;  3IKD A;  1K9T A;  4QIB A;  4KQZ A;  4DRI A;  5DF0 A;  1KT0 A;  3O5D A;  2PPO A;  4TW6 A;  1NSG A;  4ODM A;  1W9P A;  2RUQ A;  1HKI A;  3QOK A;  2MLX A;  4DRO A;  1TCO C;  4W9O A;  1W9U A;  2FDM A;  4TYO A;  1FKG A;  3O5E A;  4R0X A;  1E6P A;  5DIU A;  1LL4 A;  4Q7N A;  1NWR A;  2A3A A;  3TCZ A;  5HBF A;  3UQA A;  3LUO A;  4G2P A;  2F4E A;  1D7J A;  1JVW A;  3O5G A;  1J6Y A;  2M1I A;  1LL7 A;  3ODK A;  1D7I A;  2DG3 A;  4O2T A;  4DZ2 A;  2JZV A;  2KR7 A;  1E6R A;  2DPE A;  1GPF A;  3IK8 A;  1VF8 A;  2PV3 A;  4MPK A;  1XHG A;  2M2A A;  1LL6 A;  3NTP A;  4Z2K A;  2XPA A;  2N87 A;  2WK2 A;  1ROT A;  1NWT A;  1FKR A;  3ARW A;  4NNR A;  2DSV A;  3GPK A;  3ARO A;  4DWS C;  2PV1 A;  3B7X A;  5D75 A;  3O5P A;  3O5J A;  4MNJ A;  4DIP A;  3AS3 A;  1HKK A;  5GPR A;  4IQ2 A;  2KO7 A;  4C02 B;  4WK9 A;  2A3B A;  1CTN A;  4LAY A;  2WLZ A;  3O5O A;  2XP8 A;  4HBO A;  4URI A;  1WAW A;  3O5L A;  2PI6 A;  2RQS A;  3UI4 A;  3ARR A;  4HAR A;  4KR0 B;  3CH9 A;  3UQB A;  4QZV B;  2FKE A;  1X6L A;  2XP9 A;  3RM8 A;  3UI5 A;  3AS0 A;  2ZQS A;  1SYT A;  2DT3 A;  2ZQT A;  4R5E A;  1E6Z A;  2IF4 A;  1E15 A;  3RFW A;  1N1A A;  4WKF A;  3PRD A;  5I98 A;  1W1V A;  2B31 A;  3WH0 A;  2ZQU A;  3ARP A;  4WIW A;  1X6N A;  2OLH A;  1GOI A;  2XPB A;  3UF8 A;  1QPF A;  3KAF A;  1ZBK A;  2VCD A;  1OGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...