1BKFA

Fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Conformation of Fk506 in X-Ray Structures of its Complexes with Human Recombinant Fkbp12 Mutants
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bkfA00
5HKGA 1D7HA 1J4RA 1JVWA 3ODKA 4JFKA 1ROUA 1NSGA 2PV3A 4ODLA 4U84A 1FKHA 4W9QA 3O5QA 1KT0A 4DRMA 2PPNA 2XP5A 1J6YA 1L1PA 4JFLA 4LAXA 3KAFA 2LJ4A 4BF8A 3GPKA 1FKKA 4DT4A 4MSPA 1BKFA 2RQSA 1QPLA 2XPBA 1EYMA 3O5KA 4N19A 1P5QA 5HT1A 3JXVA 3PRDA 3KAGA 2ITKA 2LGOA 3NI6A 3PRBA 5B8IC 3CGMA 1FKGA 3KCEA 4QT3A 2VCDA 2RUDA 2LKNA 3B7XA 3CGNA 2KFWA 2XP7A 1F40A 2DG3A 3O5DA 3I6CA 4IQCA 4C02B 1FKSA 3O5FA 1Q6IA 4DRKA 3PA7A 5HW8A 1FAPA 1M5YA 3KZ7A 2XP9A 5HUAA 1C9HA 1Q6HA 2F21A 5HW7A 3JYJA 1Y0OA 2KR7A 4IPXA 2MNTA 2MLXA 4DH0A 3RGCA 2VN1A 3OOBA 1R9HA 1EQ3A 1FKDA 1QPFA 2Y78A 1B6CA 3NRKA 4R0XA 1TCOC 3KABA 4TW6A 4DRJA 2XPAA 4ODRA 2FKEA 2KO7A 3EY6A 2FAPA 4TYOA 2M1IA 1Q1CA 1T11A 4ITZA 3IKGA 4JFJA 1W26A 4DRIA 4NNRA 4JFIA 1BL4A 2PBCA 2ZQVA 3IHZA 4JFMA 4ODKA 4QT2A 4DRHA 5BXJA 1FKTA 4G50A 3UQIA 4W9PA 4DZ2A 1D7JA 2JZVA 1NMVA 1FJDA 3UI4A 2K8IA 3O5OA 2M08A 2L2SA 2Q5AA 3KACA 1F8AB 1FKIA 2RUCA 3O5PA 2M2AA 4G2PA 1J4HA 4TX0A 3JYMA 2KGJA 3MDYB 4U85A 2PPPA 3NTPA 4J4NA 1D7IA 2XP3A 4GIVA 3RFWA 1QZ2A 4DROA 1NMWA 2DG4A 3VAWA 3O5JA 4GGQA 4LAYA 5HTGA 3O5LA 1A7XA 3IKDA 3O5RA 4JYSA 3UI6A 4DIPA 5HWBA 2XP6A 3KAIA 1JNSA 4ODQA 2LPVA 1YW5A 4O2TA 5GPGA 1JNTA 2PV2A 1D6OA 4LAVA 5DIVA 5HW6A 3UI5A 2OFNA 1ZK6A 1FD9A 1YATA 3KAHA 2XP4A 3O5MA 2RURA 2ZQSA 2D9FA 2UZ5A 4TNSA 4U86A 4W9OA 4MGVA 2F4EA 1J4IA 2IF4A 2MLYA 2ZR5A 4J4OA 1PINA 4LAWA 3WH0A 5HWCA 1KT1A 2AWGA 3TC5A 3O5GA 1PBKA 2DG9A 3H9RB 4FAPA 4DZ3A 2ZQTA 1U79A 2KE0A 3FAPA 4DRPA 2MPHA 3O5EA 1FKRA 2RUQA 4TW8A 1ROTA 2PPOA 5DITA 1FKLA 1N1AA 4ODMA 5DIUA 3UQBA 4IQ2A 2ZQUA 4DRQA 2MF9A 5J6EA 3LUOA 5I98A 4QIBA 1ZCNA 3KADA 2PV1A 5D75A 2ZR4A 3TCZA 2XP8A 1HXVA 2N87A 1FKFA 1FKBA 2ZR6A 4ODNA 3UQAA 4FN2A 2F2DA 2KI3A 1Q6UA 3O5IA 4ODOA 3UF8A 1FKJA 4DRNA 4ODPA 3TDBA 2RSEA 3IK8A 4TW7A 2MLZA
chains in the Genus database with same CATH superfamily
5HKGA 1UR8A 2O9OA 2PPNA 2XP5A 4JFLA 4BF8A 2LJ4A 3GPKA 4MSPA 4N19A 3JXVA 3PRBA 3AS1A 3NI6A 3KCEA 1HKMA 2LKNA 2YBTA 3CGNA 2KFWA 1E6ZA 2A3BA 3I6CA 4IQCA 1OGGA 3PRAA 3WKZA 1FKSA 3O5FA 4DRKA 3ARYA 1C9HA 4HBOA 2B31A 1JNEA 1Y0OA 4Z2LA 2MLXA 3OOBA 5JH8A 1QPFA 4NSBA 1NWTA 3NRKA 4AY1A 2PN0A 4R0XA 4TW6A 1HJVA 1WB0A 2KO7A 1LL6A 2M1IA 1Q1CA 4JFJA 3IHZA 4QT2A 4JFMA 4ML4A 5BXJA 3ARZA 3UQIA 4HARA 4KQZA 1NMVA 3ARSA 1FJDA 3CZ8A 2RUCA 4TX0A 4W5UA 4J4NA 1D7IA 1QZ2A 4DWSD 3VAWA 3O5LA 1A7XA 4MPKA 1K9TA 4WK9A 4LAVA 3W4RA 2OFNA 1ZK6A 5DF0A 3KAHA 3RM8A 2XP4A 2ZQSA 2D9FA 2UZ5A 4WJXA 4DWSC 4MGVA 3WH0A 2IF4A 2DSZA 2MLYA 2DG9A 4FAPA 3H9RB 2ZQTA 1U79A 2RUQA 1N1AA 3WD1A 5DIUA 4L3NA 4DRQA 4P8VA 1E15A 3B9DA 1NWSA 5D75A 1HXVA 1FKFA 2ZR6A 3UF8A 4DRNA 4Q7NA 1D7HA 1JVWA 4U84A 2EULA 1ZBKA 1FKKA 3RM4A 3O5KA 3PRDA 2ITKA 2LGOA 3CGMA 2VCDA 4WKFA 3WD4A 3AROA 1F40A 2DG3A 2WK2A 3B8SA 1Q6IA 5HW8A 3KZ7A 1W1TA 1Q6HA 4IPXA 2MNTA 2AOSA 4DH0A 2VN1A 4WKHA 1HJWA 1LQ0A 1B6CA 1E44A 3KABA 3AS2A 2FKEA 2WLZA 1E6NA 4TYOA 4ITZA 1T11A 1LG2A 3IKGA 1LG1A 4NNRA 3ALFA 2ZQVA 4MTVA 4ODKA 2G8ZA 4MNKA 2DSUA 4G50A 3ARRA 1GUVA 1VF8A 2JZVA 4Z2JA 2K8IA 1IX5A 3O5PA 4G2PA 1J4HA 1NWUA 3MDYB 1W9PA 1NWRA 1XHGA 3WD0A 1HKJA 4S3KA 5HBFA 2XP3A 4GIVA 1OWQA 3B9AA 5DO2A 4JYSA 3UI6A 4DIPA 1JNSA 5GPRA 1YW5A 4O2TA 5GPGA 4R5EA 1D6OA 5HW6A 1E6RA 3WQVA 3O5MA 1WNOA 4LAWA 1WAWA 5HWCA 3O5GA 1PBKA 1FKRA 4DRPA 2DT2A 4IT6A 3OA5A 1W1VA 4PTMA 1ZBVA 1ZU8A 4ODMA 4MNJA 2ZQUA 4Z2IA 5I98A 3RM9A 4S3JA 5GQBA 3CHFA 2ZR4A 2DT0A 2ESCA 1FKBA 4ODNA 3UQAA 1Q6UA 1FFRA 4NZCA 1FKJA 3IK8A 3FXYA 4TW7A 4JFKA 1J4RA 3ODKA 2PV3A 5DEZA 1FKHA 4W9QA 1KT0A 4DRMA 4Q22A 4LAXA 3KAFA 2G41A 1BKFA 2XPBA 1QPLA 1EYMA 3WIJA 5HT1A 1KFWA 3KAGA 4QT3A 3ARWA 3B7XA 4ZPVR 2XP7A 4DWSA 1E9LA 4QZVB 3PA7A 2DSVA 2WM0A 1ZBCA 4KR0B 1GRJA 3RGCA 3WD2A 1R9HA 1EQ3A 1FKDA 3GTYX 3ARTA 3WD3A 2XPAA 1XRVA 1W1PA 2FAPA 1W26A 4JFIA 4DRHA 1D2KA 4DZ2A 4ZPTR 3UI4A 3O5OA 4MAVA 2Q5AA 3KACA 1F8AB 1FKIA 4IT4A 4URIA 4L72B 2WLYA 3JYMA 2KGJA 4U85A 1EDQA 2PPPA 1W1YA 4DROA 1NMWA 2DG4A 4GGQA 1O6IA 2PI6A 5HWBA 2YBUA 3ALGA 3B9EA 2LPVA 2F23A 5DIVA 4ZPWR 1ITXA 1YATA 4U86A 2RURA 4W9OA 3EIPA 2ZR5A 1J4IA 1LJYA 1PINA 1KT1A 4DZ3A 1NH6A 2MPHA 3O5EA 4TW8A 3AQUA 1E6PA 1FFQA 5DITA 1JCHB 4P8UA 4WIWA 3UQBA 4DWSB 5J6EA 3AS0A 1ZCNA 3GU0A 3KADA 4Z2KA 1SR0A 3TCZA 2XP8A 4ZS6A 4P8XA 4FN2A 2F2DA 2KI3A 4XAKA 4ODOA 4UDMA 1HJXA 3BMBA 1ROUA 1NSGA 4ODLA 3QOKA 3O5QA 4P8WA 1J6YA 1L1PA 1JNDA 4DT4A 1LL4A 3ARXA 2RQSA 1P5QA 3CHDA 2DT1A 3G6MA 5B8IC 1ZB5A 1FKGA 3WQWA 2RUDA 3O5DA 2A3EA 1W9VA 4C02B 3BXWA 1HKKA 1FAPA 1M5YA 5HUAA 2XP9A 3CHEA 1HKIA 3G6LA 2F21A 3ARVA 5HW7A 3JYJA 2KR7A 2OLHA 2Y78A 1ZL1A 1EHNA 3CHCA 1TCOC 2IUZA 3CH9A 3FY1A 4DRJA 1GPFA 4ODRA 3EY6A 4DRIA 3AS3A 1BL4A 2PBCA 1FKTA 1OGBA 4W9PA 3RMEA 1D7JA 1EIBA 1UR9A 1X6LA 2DSWA 4MNMA 1X6NA 2M08A 2L2SA 3WL1A 2A3CA 2M2AA 1ZBWA 2O92A 1W9UA 3ARQA 3NTPA 4Z2GA 3ARUA 3RFWA 3O5JA 4LAYA 1H0GA 5HTGA 3PR9A 1LL7A 3IKDA 3O5RA 4MNLA 2A3AA 2XP6A 3KAIA 4ODQA 1RD6A 1JNTA 2PV2A 4Z2HA 3UI5A 2B5UB 1SYTA 1FD9A 1CTNA 2DPEA 4TNSA 2QF8A 2F4EA 2P4VA 4J4OA 1GOIA 2AWGA 3TC5A 2KE0A 3FAPA 1ROTA 2PPOA 1FKLA 4HBEA 4IQ2A 4LGXA 2MF9A 3LUOA 2DT3A 4QIBA 4WKAA 2FDMA 2PV1A 3ARPA 2N87A 3WL0A 2ETNA 1H0IA 3O5IA 1TFVA 4ODPA 3TDBA 2RSEA 2MLZA
chains in the Genus database with same CATH topology
5HKGA 1UR8A 2O9OA 2PPNA 2XP5A 4JFLA 4BF8A 2LJ4A 3GPKA 4MSPA 4N19A 3JXVA 3PRBA 3AS1A 3NI6A 3KCEA 1HKMA 2LKNA 2YBTA 3CGNA 2KFWA 1E6ZA 2A3BA 3I6CA 4IQCA 1OGGA 3PRAA 3WKZA 1FKSA 3O5FA 4DRKA 3ARYA 1C9HA 4HBOA 2B31A 1JNEA 1Y0OA 4Z2LA 2MLXA 3OOBA 5JH8A 1QPFA 4NSBA 1NWTA 3NRKA 4AY1A 4R0XA 4TW6A 1HJVA 1WB0A 2KO7A 1LL6A 2M1IA 1Q1CA 4JFJA 3IHZA 4QT2A 4JFMA 4ML4A 5BXJA 3ARZA 3UQIA 4HARA 4KQZA 1NMVA 3ARSA 1FJDA 3CZ8A 2RUCA 4TX0A 4W5UA 4J4NA 1D7IA 1QZ2A 4DWSD 3VAWA 3O5LA 1A7XA 4MPKA 1K9TA 4WK9A 4LAVA 3W4RA 2OFNA 1ZK6A 5DF0A 3KAHA 3RM8A 2XP4A 2ZQSA 2D9FA 2UZ5A 4WJXA 4DWSC 4MGVA 3WH0A 2IF4A 2DSZA 2MLYA 2DG9A 4FAPA 3H9RB 2ZQTA 1U79A 2RUQA 1N1AA 3WD1A 5DIUA 4L3NA 4DRQA 4P8VA 1E15A 3B9DA 1NWSA 5D75A 1HXVA 1FKFA 2ZR6A 3UF8A 4DRNA 4Q7NA 1D7HA 1JVWA 4U84A 1ZBKA 1FKKA 3RM4A 3O5KA 3PRDA 2ITKA 2LGOA 3CGMA 2VCDA 4WKFA 3WD4A 3AROA 1F40A 2DG3A 2WK2A 3B8SA 1Q6IA 5HW8A 3KZ7A 1W1TA 1Q6HA 4IPXA 2MNTA 2AOSA 4DH0A 2VN1A 4WKHA 1HJWA 1LQ0A 1B6CA 3KABA 3AS2A 2FKEA 2WLZA 1E6NA 4TYOA 4ITZA 1T11A 1LG2A 3IKGA 1LG1A 4NNRA 3ALFA 2ZQVA 4MTVA 4ODKA 2G8ZA 4MNKA 2DSUA 4G50A 3ARRA 1GUVA 1VF8A 2JZVA 4Z2JA 2K8IA 1IX5A 3O5PA 4G2PA 1J4HA 1NWUA 3MDYB 1W9PA 1NWRA 1XHGA 3WD0A 1HKJA 4S3KA 5HBFA 2XP3A 4GIVA 1OWQA 3B9AA 5DO2A 4JYSA 3UI6A 4DIPA 1JNSA 5GPRA 1YW5A 4O2TA 5GPGA 4R5EA 1D6OA 5HW6A 1E6RA 3WQVA 3O5MA 1WNOA 4LAWA 1WAWA 5HWCA 3O5GA 1PBKA 1FKRA 4DRPA 2DT2A 4IT6A 3OA5A 1W1VA 4PTMA 1ZBVA 1ZU8A 4ODMA 4MNJA 2ZQUA 4Z2IA 5I98A 3RM9A 4S3JA 5GQBA 3CHFA 2ZR4A 2DT0A 2ESCA 1FKBA 4ODNA 3UQAA 1Q6UA 1FFRA 4NZCA 1FKJA 3IK8A 3FXYA 4TW7A 4JFKA 1J4RA 3ODKA 2PV3A 5DEZA 1FKHA 4W9QA 1KT0A 4DRMA 4Q22A 4LAXA 3KAFA 2G41A 1BKFA 2XPBA 1QPLA 1EYMA 3WIJA 5HT1A 1KFWA 3KAGA 4QT3A 3ARWA 3B7XA 4ZPVR 2XP7A 4DWSA 1E9LA 4QZVB 3PA7A 2DSVA 2WM0A 1ZBCA 4KR0B 3RGCA 3WD2A 1R9HA 1EQ3A 1FKDA 3ARTA 3WD3A 2XPAA 1XRVA 1W1PA 2FAPA 1W26A 4JFIA 4DRHA 1D2KA 4DZ2A 4ZPTR 3UI4A 3O5OA 4MAVA 2Q5AA 3KACA 1F8AB 1FKIA 4IT4A 4URIA 4L72B 2WLYA 3JYMA 2KGJA 4U85A 1EDQA 2PPPA 1W1YA 4DROA 1NMWA 2DG4A 4GGQA 1O6IA 2PI6A 5HWBA 2YBUA 3ALGA 3B9EA 2LPVA 5DIVA 4ZPWR 1ITXA 1YATA 4U86A 2RURA 4W9OA 2ZR5A 1J4IA 1LJYA 1PINA 1KT1A 4DZ3A 1NH6A 2MPHA 3O5EA 4TW8A 3AQUA 1E6PA 1FFQA 5DITA 4P8UA 4WIWA 3UQBA 4DWSB 5J6EA 3AS0A 1ZCNA 3KADA 4Z2KA 1SR0A 3TCZA 2XP8A 4ZS6A 4P8XA 4FN2A 2F2DA 2KI3A 4XAKA 4ODOA 1HJXA 1ROUA 1NSGA 4ODLA 3QOKA 3O5QA 4P8WA 1J6YA 1L1PA 1JNDA 4DT4A 1LL4A 3ARXA 2RQSA 1P5QA 3CHDA 2DT1A 3G6MA 5B8IC 1ZB5A 1FKGA 3WQWA 2RUDA 3O5DA 2A3EA 1W9VA 4C02B 3BXWA 1HKKA 1FAPA 1M5YA 5HUAA 2XP9A 3CHEA 1HKIA 3G6LA 2F21A 3ARVA 5HW7A 3JYJA 2KR7A 2OLHA 2Y78A 1ZL1A 1EHNA 3CHCA 1TCOC 2IUZA 3CH9A 3FY1A 4DRJA 1GPFA 4ODRA 3EY6A 4DRIA 3AS3A 1BL4A 2PBCA 1FKTA 1OGBA 4W9PA 3RMEA 1D7JA 1EIBA 1UR9A 1X6LA 2DSWA 4MNMA 1X6NA 2M08A 2L2SA 3WL1A 2A3CA 2M2AA 1ZBWA 2O92A 1W9UA 3ARQA 3NTPA 4Z2GA 3ARUA 3RFWA 3O5JA 4LAYA 1H0GA 5HTGA 3PR9A 1LL7A 3IKDA 3O5RA 4MNLA 2A3AA 2XP6A 3KAIA 4ODQA 1RD6A 1JNTA 2PV2A 4Z2HA 3UI5A 1SYTA 1FD9A 1CTNA 2DPEA 4TNSA 2F4EA 2QF8A 4J4OA 1GOIA 2AWGA 3TC5A 2KE0A 3FAPA 1ROTA 2PPOA 1FKLA 4HBEA 4IQ2A 4LGXA 2MF9A 3LUOA 2DT3A 4QIBA 4WKAA 2FDMA 2PV1A 3ARPA 2N87A 3WL0A 1H0IA 3O5IA 1TFVA 4ODPA 3TDBA 2RSEA 2MLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKG A;  1D7H A;  1J4R A;  1JVW A;  3ODK A;  4JFK A;  1ROU A;  1NSG A;  2PV3 A;  4ODL A;  4U84 A;  1FKH A;  4W9Q A;  3O5Q A;  1KT0 A;  4DRM A;  2PPN A;  2XP5 A;  1J6Y A;  1L1P A;  4JFL A;  4LAX A;  3KAF A;  2LJ4 A;  4BF8 A;  3GPK A;  1FKK A;  4DT4 A;  4MSP A;  1BKF A;  2RQS A;  1QPL A;  2XPB A;  1EYM A;  3O5K A;  4N19 A;  1P5Q A;  5HT1 A;  3JXV A;  3PRD A;  3KAG A;  2ITK A;  2LGO A;  3NI6 A;  3PRB A;  5B8I C;  3CGM A;  1FKG A;  3KCE A;  4QT3 A;  2VCD A;  2RUD A;  2LKN A;  3B7X A;  3CGN A;  2KFW A;  2XP7 A;  1F40 A;  2DG3 A;  3O5D A;  3I6C A;  4IQC A;  4C02 B;  1FKS A;  3O5F A;  1Q6I A;  4DRK A;  3PA7 A;  5HW8 A;  1FAP A;  1M5Y A;  3KZ7 A;  2XP9 A;  5HUA A;  1C9H A;  1Q6H A;  2F21 A;  5HW7 A;  3JYJ A;  1Y0O A;  2KR7 A;  4IPX A;  2MNT A;  2MLX A;  4DH0 A;  3RGC A;  2VN1 A;  3OOB A;  1R9H A;  1EQ3 A;  1FKD A;  1QPF A;  2Y78 A;  1B6C A;  3NRK A;  4R0X A;  1TCO C;  3KAB A;  4TW6 A;  4DRJ A;  2XPA A;  4ODR A;  2FKE A;  2KO7 A;  3EY6 A;  2FAP A;  4TYO A;  2M1I A;  1Q1C A;  1T11 A;  4ITZ A;  3IKG A;  4JFJ A;  1W26 A;  4DRI A;  4NNR A;  4JFI A;  1BL4 A;  2PBC A;  2ZQV A;  3IHZ A;  4JFM A;  4ODK A;  4QT2 A;  4DRH A;  5BXJ A;  1FKT A;  4G50 A;  3UQI A;  4W9P A;  4DZ2 A;  1D7J A;  2JZV A;  1NMV A;  1FJD A;  3UI4 A;  2K8I A;  3O5O A;  2M08 A;  2L2S A;  2Q5A A;  3KAC A;  1F8A B;  1FKI A;  2RUC A;  3O5P A;  2M2A A;  4G2P A;  1J4H A;  4TX0 A;  3JYM A;  2KGJ A;  3MDY B;  4U85 A;  2PPP A;  3NTP A;  4J4N A;  1D7I A;  2XP3 A;  4GIV A;  3RFW A;  1QZ2 A;  4DRO A;  1NMW A;  2DG4 A;  3VAW A;  3O5J A;  4GGQ A;  4LAY A;  5HTG A;  3O5L A;  1A7X A;  3IKD A;  3O5R A;  4JYS A;  3UI6 A;  4DIP A;  5HWB A;  2XP6 A;  3KAI A;  1JNS A;  4ODQ A;  2LPV A;  1YW5 A;  4O2T A;  5GPG A;  1JNT A;  2PV2 A;  1D6O A;  4LAV A;  5DIV A;  5HW6 A;  3UI5 A;  2OFN A;  1ZK6 A;  1FD9 A;  1YAT A;  3KAH A;  2XP4 A;  3O5M A;  2RUR A;  2ZQS A;  2D9F A;  2UZ5 A;  4TNS A;  4U86 A;  4W9O A;  4MGV A;  2F4E A;  1J4I A;  2IF4 A;  2MLY A;  2ZR5 A;  4J4O A;  1PIN A;  4LAW A;  3WH0 A;  5HWC A;  1KT1 A;  2AWG A;  3TC5 A;  3O5G A;  1PBK A;  2DG9 A;  3H9R B;  4FAP A;  4DZ3 A;  2ZQT A;  1U79 A;  2KE0 A;  3FAP A;  4DRP A;  2MPH A;  3O5E A;  1FKR A;  2RUQ A;  4TW8 A;  1ROT A;  2PPO A;  5DIT A;  1FKL A;  1N1A A;  4ODM A;  5DIU A;  3UQB A;  4IQ2 A;  2ZQU A;  4DRQ A;  2MF9 A;  5J6E A;  3LUO A;  5I98 A;  4QIB A;  1ZCN A;  3KAD A;  2PV1 A;  5D75 A;  2ZR4 A;  3TCZ A;  2XP8 A;  1HXV A;  2N87 A;  1FKF A;  1FKB A;  2ZR6 A;  4ODN A;  3UQA A;  4FN2 A;  2F2D A;  2KI3 A;  1Q6U A;  3O5I A;  4ODO A;  3UF8 A;  1FKJ A;  4DRN A;  4ODP A;  3TDB A;  2RSE A;  3IK8 A;  4TW7 A;  2MLZ A; 
#chains in the Genus database with same CATH topology
 5HKG A;  1UR8 A;  2O9O A;  2PPN A;  2XP5 A;  4JFL A;  4BF8 A;  2LJ4 A;  3GPK A;  4MSP A;  4N19 A;  3JXV A;  3PRB A;  3AS1 A;  3NI6 A;  3KCE A;  1HKM A;  2LKN A;  2YBT A;  3CGN A;  2KFW A;  1E6Z A;  2A3B A;  3I6C A;  4IQC A;  1OGG A;  3PRA A;  3WKZ A;  1FKS A;  3O5F A;  4DRK A;  3ARY A;  1C9H A;  4HBO A;  2B31 A;  1JNE A;  1Y0O A;  4Z2L A;  2MLX A;  3OOB A;  5JH8 A;  1QPF A;  4NSB A;  1NWT A;  3NRK A;  4AY1 A;  2PN0 A;  4R0X A;  4TW6 A;  1HJV A;  1WB0 A;  2KO7 A;  1LL6 A;  2M1I A;  1Q1C A;  4JFJ A;  3IHZ A;  4QT2 A;  4JFM A;  4ML4 A;  5BXJ A;  3ARZ A;  3UQI A;  4HAR A;  4KQZ A;  1NMV A;  3ARS A;  1FJD A;  3CZ8 A;  2RUC A;  4TX0 A;  4W5U A;  4J4N A;  1D7I A;  1QZ2 A;  4DWS D;  3VAW A;  3O5L A;  1A7X A;  4MPK A;  1K9T A;  4WK9 A;  4LAV A;  3W4R A;  2OFN A;  1ZK6 A;  5DF0 A;  3KAH A;  3RM8 A;  2XP4 A;  2ZQS A;  2D9F A;  2UZ5 A;  4WJX A;  4DWS C;  4MGV A;  3WH0 A;  2IF4 A;  2DSZ A;  2MLY A;  2DG9 A;  4FAP A;  3H9R B;  2ZQT A;  1U79 A;  2RUQ A;  1N1A A;  3WD1 A;  5DIU A;  4L3N A;  4DRQ A;  4P8V A;  1E15 A;  3B9D A;  1NWS A;  5D75 A;  1HXV A;  1FKF A;  2ZR6 A;  3UF8 A;  4DRN A;  4Q7N A;  1D7H A;  1JVW A;  4U84 A;  2EUL A;  1ZBK A;  1FKK A;  3RM4 A;  3O5K A;  3PRD A;  2ITK A;  2LGO A;  3CGM A;  2VCD A;  4WKF A;  3WD4 A;  3ARO A;  1F40 A;  2DG3 A;  2WK2 A;  3B8S A;  1Q6I A;  5HW8 A;  3KZ7 A;  1W1T A;  1Q6H A;  4IPX A;  2MNT A;  2AOS A;  4DH0 A;  2VN1 A;  4WKH A;  1HJW A;  1LQ0 A;  1B6C A;  1E44 A;  3KAB A;  3AS2 A;  2FKE A;  2WLZ A;  1E6N A;  4TYO A;  4ITZ A;  1T11 A;  1LG2 A;  3IKG A;  1LG1 A;  4NNR A;  3ALF A;  2ZQV A;  4MTV A;  4ODK A;  2G8Z A;  4MNK A;  2DSU A;  4G50 A;  3ARR A;  1GUV A;  1VF8 A;  2JZV A;  4Z2J A;  2K8I A;  1IX5 A;  3O5P A;  4G2P A;  1J4H A;  1NWU A;  3MDY B;  1W9P A;  1NWR A;  1XHG A;  3WD0 A;  1HKJ A;  4S3K A;  5HBF A;  2XP3 A;  4GIV A;  1OWQ A;  3B9A A;  5DO2 A;  4JYS A;  3UI6 A;  4DIP A;  1JNS A;  5GPR A;  1YW5 A;  4O2T A;  5GPG A;  4R5E A;  1D6O A;  5HW6 A;  1E6R A;  3WQV A;  3O5M A;  1WNO A;  4LAW A;  1WAW A;  5HWC A;  3O5G A;  1PBK A;  1FKR A;  4DRP A;  2DT2 A;  4IT6 A;  3OA5 A;  1W1V A;  4PTM A;  1ZBV A;  1ZU8 A;  4ODM A;  4MNJ A;  2ZQU A;  4Z2I A;  5I98 A;  3RM9 A;  4S3J A;  5GQB A;  3CHF A;  2ZR4 A;  2DT0 A;  2ESC A;  1FKB A;  4ODN A;  3UQA A;  1Q6U A;  1FFR A;  4NZC A;  1FKJ A;  3IK8 A;  3FXY A;  4TW7 A;  4JFK A;  1J4R A;  3ODK A;  2PV3 A;  5DEZ A;  1FKH A;  4W9Q A;  1KT0 A;  4DRM A;  4Q22 A;  4LAX A;  3KAF A;  2G41 A;  1BKF A;  2XPB A;  1QPL A;  1EYM A;  3WIJ A;  5HT1 A;  1KFW A;  3KAG A;  4QT3 A;  3ARW A;  3B7X A;  4ZPV R;  2XP7 A;  4DWS A;  1E9L A;  4QZV B;  3PA7 A;  2DSV A;  2WM0 A;  1ZBC A;  4KR0 B;  1GRJ A;  3RGC A;  3WD2 A;  1R9H A;  1EQ3 A;  1FKD A;  3GTY X;  3ART A;  3WD3 A;  2XPA A;  1XRV A;  1W1P A;  2FAP A;  1W26 A;  4JFI A;  4DRH A;  1D2K A;  4DZ2 A;  4ZPT R;  3UI4 A;  3O5O A;  4MAV A;  2Q5A A;  3KAC A;  1F8A B;  1FKI A;  4IT4 A;  4URI A;  4L72 B;  2WLY A;  3JYM A;  2KGJ A;  4U85 A;  1EDQ A;  2PPP A;  1W1Y A;  4DRO A;  1NMW A;  2DG4 A;  4GGQ A;  1O6I A;  2PI6 A;  5HWB A;  2YBU A;  3ALG A;  3B9E A;  2LPV A;  2F23 A;  5DIV A;  4ZPW R;  1ITX A;  1YAT A;  4U86 A;  2RUR A;  4W9O A;  3EIP A;  2ZR5 A;  1J4I A;  1LJY A;  1PIN A;  1KT1 A;  4DZ3 A;  1NH6 A;  2MPH A;  3O5E A;  4TW8 A;  3AQU A;  1E6P A;  1FFQ A;  5DIT A;  1JCH B;  4P8U A;  4WIW A;  3UQB A;  4DWS B;  5J6E A;  3AS0 A;  1ZCN A;  3GU0 A;  3KAD A;  4Z2K A;  1SR0 A;  3TCZ A;  2XP8 A;  4ZS6 A;  4P8X A;  4FN2 A;  2F2D A;  2KI3 A;  4XAK A;  4ODO A;  4UDM A;  1HJX A;  3BMB A;  1ROU A;  1NSG A;  4ODL A;  3QOK A;  3O5Q A;  4P8W A;  1J6Y A;  1L1P A;  1JND A;  4DT4 A;  1LL4 A;  3ARX A;  2RQS A;  1P5Q A;  3CHD A;  2DT1 A;  3G6M A;  5B8I C;  1ZB5 A;  1FKG A;  3WQW A;  2RUD A;  3O5D A;  2A3E A;  1W9V A;  4C02 B;  3BXW A;  1HKK A;  1FAP A;  1M5Y A;  5HUA A;  2XP9 A;  3CHE A;  1HKI A;  3G6L A;  2F21 A;  3ARV A;  5HW7 A;  3JYJ A;  2KR7 A;  2OLH A;  2Y78 A;  1ZL1 A;  1EHN A;  3CHC A;  1TCO C;  2IUZ A;  3CH9 A;  3FY1 A;  4DRJ A;  1GPF A;  4ODR A;  3EY6 A;  4DRI A;  3AS3 A;  1BL4 A;  2PBC A;  1FKT A;  1OGB A;  4W9P A;  3RME A;  1D7J A;  1EIB A;  1UR9 A;  1X6L A;  2DSW A;  4MNM A;  1X6N A;  2M08 A;  2L2S A;  3WL1 A;  2A3C A;  2M2A A;  1ZBW A;  2O92 A;  1W9U A;  3ARQ A;  3NTP A;  4Z2G A;  3ARU A;  3RFW A;  3O5J A;  4LAY A;  1H0G A;  5HTG A;  3PR9 A;  1LL7 A;  3IKD A;  3O5R A;  4MNL A;  2A3A A;  2XP6 A;  3KAI A;  4ODQ A;  1RD6 A;  1JNT A;  2PV2 A;  4Z2H A;  3UI5 A;  2B5U B;  1SYT A;  1FD9 A;  1CTN A;  2DPE A;  4TNS A;  2QF8 A;  2F4E A;  2P4V A;  4J4O A;  1GOI A;  2AWG A;  3TC5 A;  2KE0 A;  3FAP A;  1ROT A;  2PPO A;  1FKL A;  4HBE A;  4IQ2 A;  4LGX A;  2MF9 A;  3LUO A;  2DT3 A;  4QIB A;  4WKA A;  2FDM A;  2PV1 A;  3ARP A;  2N87 A;  3WL0 A;  2ETN A;  1H0I A;  3O5I A;  1TFV A;  4ODP A;  3TDB A;  2RSE A;  2MLZ A; 
#chains in the Genus database with same CATH homology
 5HKG A;  1UR8 A;  2O9O A;  2PPN A;  2XP5 A;  4JFL A;  4BF8 A;  2LJ4 A;  3GPK A;  4MSP A;  4N19 A;  3JXV A;  3PRB A;  3AS1 A;  3NI6 A;  3KCE A;  1HKM A;  2LKN A;  2YBT A;  3CGN A;  2KFW A;  1E6Z A;  2A3B A;  3I6C A;  4IQC A;  1OGG A;  3PRA A;  3WKZ A;  1FKS A;  3O5F A;  4DRK A;  3ARY A;  1C9H A;  4HBO A;  2B31 A;  1JNE A;  1Y0O A;  4Z2L A;  2MLX A;  3OOB A;  5JH8 A;  1QPF A;  4NSB A;  1NWT A;  3NRK A;  4AY1 A;  4R0X A;  4TW6 A;  1HJV A;  1WB0 A;  2KO7 A;  1LL6 A;  2M1I A;  1Q1C A;  4JFJ A;  3IHZ A;  4QT2 A;  4JFM A;  4ML4 A;  5BXJ A;  3ARZ A;  3UQI A;  4HAR A;  4KQZ A;  1NMV A;  3ARS A;  1FJD A;  3CZ8 A;  2RUC A;  4TX0 A;  4W5U A;  4J4N A;  1D7I A;  1QZ2 A;  4DWS D;  3VAW A;  3O5L A;  1A7X A;  4MPK A;  1K9T A;  4WK9 A;  4LAV A;  3W4R A;  2OFN A;  1ZK6 A;  5DF0 A;  3KAH A;  3RM8 A;  2XP4 A;  2ZQS A;  2D9F A;  2UZ5 A;  4WJX A;  4DWS C;  4MGV A;  3WH0 A;  2IF4 A;  2DSZ A;  2MLY A;  2DG9 A;  4FAP A;  3H9R B;  2ZQT A;  1U79 A;  2RUQ A;  1N1A A;  3WD1 A;  5DIU A;  4L3N A;  4DRQ A;  4P8V A;  1E15 A;  3B9D A;  1NWS A;  5D75 A;  1HXV A;  1FKF A;  2ZR6 A;  3UF8 A;  4DRN A;  4Q7N A;  1D7H A;  1JVW A;  4U84 A;  1ZBK A;  1FKK A;  3RM4 A;  3O5K A;  3PRD A;  2ITK A;  2LGO A;  3CGM A;  2VCD A;  4WKF A;  3WD4 A;  3ARO A;  1F40 A;  2DG3 A;  2WK2 A;  3B8S A;  1Q6I A;  5HW8 A;  3KZ7 A;  1W1T A;  1Q6H A;  4IPX A;  2MNT A;  2AOS A;  4DH0 A;  2VN1 A;  4WKH A;  1HJW A;  1LQ0 A;  1B6C A;  3KAB A;  3AS2 A;  2FKE A;  2WLZ A;  1E6N A;  4TYO A;  4ITZ A;  1T11 A;  1LG2 A;  3IKG A;  1LG1 A;  4NNR A;  3ALF A;  2ZQV A;  4MTV A;  4ODK A;  2G8Z A;  4MNK A;  2DSU A;  4G50 A;  3ARR A;  1GUV A;  1VF8 A;  2JZV A;  4Z2J A;  2K8I A;  1IX5 A;  3O5P A;  4G2P A;  1J4H A;  1NWU A;  3MDY B;  1W9P A;  1NWR A;  1XHG A;  3WD0 A;  1HKJ A;  4S3K A;  5HBF A;  2XP3 A;  4GIV A;  1OWQ A;  3B9A A;  5DO2 A;  4JYS A;  3UI6 A;  4DIP A;  1JNS A;  5GPR A;  1YW5 A;  4O2T A;  5GPG A;  4R5E A;  1D6O A;  5HW6 A;  1E6R A;  3WQV A;  3O5M A;  1WNO A;  4LAW A;  1WAW A;  5HWC A;  3O5G A;  1PBK A;  1FKR A;  4DRP A;  2DT2 A;  4IT6 A;  3OA5 A;  1W1V A;  4PTM A;  1ZBV A;  1ZU8 A;  4ODM A;  4MNJ A;  2ZQU A;  4Z2I A;  5I98 A;  3RM9 A;  4S3J A;  5GQB A;  3CHF A;  2ZR4 A;  2DT0 A;  2ESC A;  1FKB A;  4ODN A;  3UQA A;  1Q6U A;  1FFR A;  4NZC A;  1FKJ A;  3IK8 A;  3FXY A;  4TW7 A;  4JFK A;  1J4R A;  3ODK A;  2PV3 A;  5DEZ A;  1FKH A;  4W9Q A;  1KT0 A;  4DRM A;  4Q22 A;  4LAX A;  3KAF A;  2G41 A;  1BKF A;  2XPB A;  1QPL A;  1EYM A;  3WIJ A;  5HT1 A;  1KFW A;  3KAG A;  4QT3 A;  3ARW A;  3B7X A;  4ZPV R;  2XP7 A;  4DWS A;  1E9L A;  4QZV B;  3PA7 A;  2DSV A;  2WM0 A;  1ZBC A;  4KR0 B;  3RGC A;  3WD2 A;  1R9H A;  1EQ3 A;  1FKD A;  3ART A;  3WD3 A;  2XPA A;  1XRV A;  1W1P A;  2FAP A;  1W26 A;  4JFI A;  4DRH A;  1D2K A;  4DZ2 A;  4ZPT R;  3UI4 A;  3O5O A;  4MAV A;  2Q5A A;  3KAC A;  1F8A B;  1FKI A;  4IT4 A;  4URI A;  4L72 B;  2WLY A;  3JYM A;  2KGJ A;  4U85 A;  1EDQ A;  2PPP A;  1W1Y A;  4DRO A;  1NMW A;  2DG4 A;  4GGQ A;  1O6I A;  2PI6 A;  5HWB A;  2YBU A;  3ALG A;  3B9E A;  2LPV A;  5DIV A;  4ZPW R;  1ITX A;  1YAT A;  4U86 A;  2RUR A;  4W9O A;  2ZR5 A;  1J4I A;  1LJY A;  1PIN A;  1KT1 A;  4DZ3 A;  1NH6 A;  2MPH A;  3O5E A;  4TW8 A;  3AQU A;  1E6P A;  1FFQ A;  5DIT A;  4P8U A;  4WIW A;  3UQB A;  4DWS B;  5J6E A;  3AS0 A;  1ZCN A;  3KAD A;  4Z2K A;  1SR0 A;  3TCZ A;  2XP8 A;  4ZS6 A;  4P8X A;  4FN2 A;  2F2D A;  2KI3 A;  4XAK A;  4ODO A;  1HJX A;  1ROU A;  1NSG A;  4ODL A;  3QOK A;  3O5Q A;  4P8W A;  1J6Y A;  1L1P A;  1JND A;  4DT4 A;  1LL4 A;  3ARX A;  2RQS A;  1P5Q A;  3CHD A;  2DT1 A;  3G6M A;  5B8I C;  1ZB5 A;  1FKG A;  3WQW A;  2RUD A;  3O5D A;  2A3E A;  1W9V A;  4C02 B;  3BXW A;  1HKK A;  1FAP A;  1M5Y A;  5HUA A;  2XP9 A;  3CHE A;  1HKI A;  3G6L A;  2F21 A;  3ARV A;  5HW7 A;  3JYJ A;  2KR7 A;  2OLH A;  2Y78 A;  1ZL1 A;  1EHN A;  3CHC A;  1TCO C;  2IUZ A;  3CH9 A;  3FY1 A;  4DRJ A;  1GPF A;  4ODR A;  3EY6 A;  4DRI A;  3AS3 A;  1BL4 A;  2PBC A;  1FKT A;  1OGB A;  4W9P A;  3RME A;  1D7J A;  1EIB A;  1UR9 A;  1X6L A;  2DSW A;  4MNM A;  1X6N A;  2M08 A;  2L2S A;  3WL1 A;  2A3C A;  2M2A A;  1ZBW A;  2O92 A;  1W9U A;  3ARQ A;  3NTP A;  4Z2G A;  3ARU A;  3RFW A;  3O5J A;  4LAY A;  1H0G A;  5HTG A;  3PR9 A;  1LL7 A;  3IKD A;  3O5R A;  4MNL A;  2A3A A;  2XP6 A;  3KAI A;  4ODQ A;  1RD6 A;  1JNT A;  2PV2 A;  4Z2H A;  3UI5 A;  1SYT A;  1FD9 A;  1CTN A;  2DPE A;  4TNS A;  2F4E A;  2QF8 A;  4J4O A;  1GOI A;  2AWG A;  3TC5 A;  2KE0 A;  3FAP A;  1ROT A;  2PPO A;  1FKL A;  4HBE A;  4IQ2 A;  4LGX A;  2MF9 A;  3LUO A;  2DT3 A;  4QIB A;  4WKA A;  2FDM A;  2PV1 A;  3ARP A;  2N87 A;  3WL0 A;  1H0I A;  3O5I A;  1TFV A;  4ODP A;  3TDB A;  2RSE A;  2MLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...