1BKFA

Fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformation of Fk506 in X-Ray Structures of its Complexes with Human Recombinant Fkbp12 Mutants
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bkfA00
1T11A 4MSPA 4JFKA 5D75A 3VAWA 2PPNA 3KAGA 4ODLA 3CGNA 4DH0A 3UI4A 2PBCA 2LGOA 3UQBA 2MF9A 1N1AA 2XP8A 3KZ7A 5B8IC 1NMWA 1PBKA 1D6OA 1FJDA 4N19A 1JNTA 3KACA 2MLZA 2M2AA 4GGQA 2FKEA 4JFMA 1ZK6A 3ODKA 3JYJA 3PA7A 5HKGA 2RUDA 2RUQA 4DZ2A 1D7IA 5HUAA 1FKBA 4DRJA 4DT4A 1J4RA 1EYMA 3KCEA 3O5FA 4J4OA 4LAWA 4ODKA 4JFLA 1TCOC 4FN2A 2LPVA 5DIUA 3WH0A 3TC5A 1NMVA 1QPFA 2ZQUA 1U79A 2L2SA 2ZR5A 3O5LA 3O5KA 4MGVA 4C02B 4W9PA 1JVWA 1FKGA 2Q5AA 3IHZA 2DG3A 1KT1A 3NTPA 4DIPA 5J6EA 2N87A 4TW7A 1EQ3A 4ITZA 2VCDA 4J4NA 1Y0OA 4TNSA 4QT2A 2RSEA 1FKRA 1JNSA 5HW7A 2RUCA 1FKTA 1QPLA 3MDYB 1J4IA 1W26A 2F21A 2M1IA 2MLXA 1YATA 1FKKA 3O5EA 1ROTA 3RGCA 3JXVA 3O5IA 4LAXA 2UZ5A 4TYOA 2F4EA 5HWBA 4BF8A 1FKIA 3IK8A 3KABA 3O5DA 4TX0A 4DZ3A 4W9QA 3O5PA 1F8AB 2ITKA 3PRDA 3OOBA 4TW6A 2XP5A 3B7XA 4R0XA 2MPHA 2DG4A 1Q1CA 1FKJA 2PV2A 1B6CA 3KADA 4ODMA 2RQSA 2LKNA 4IPXA 1ZCNA 5I98A 1FKSA 5HW8A 2XP3A 4G2PA 3CGMA 3IKDA 2XPBA 1HXVA 3EY6A 3O5GA 4LAVA 1L1PA 4ODNA 3O5OA 1NSGA 1P5QA 2XP6A 1FKHA 4DRHA 3GPKA 4DRPA 1D7HA 3UQAA 5HWCA 1F40A 4ODRA 3O5JA 3RFWA 2IF4A 3FAPA 3NRKA 5GPGA 4QT3A 1KT0A 1Q6IA 1FD9A 3UF8A 4DRNA 1FKLA 2PPPA 5BXJA 2KE0A 4DRMA 5DITA 5HTGA 1YW5A 1J4HA 2RURA 4TW8A 2KFWA 2M08A 4NNRA 3O5QA 3O5MA 4ODOA 4QIBA 3TDBA 4U84A 1A7XA 2PPOA 4DRIA 3NI6A 1FKDA 2OFNA 2XP9A 1M5YA 1R9HA 4DRQA 2ZQTA 1D7JA 3KAHA 4GIVA 3IKGA 4JFIA 4O2TA 2KI3A 2PV1A 2F2DA 2K8IA 3I6CA 2PV3A 2ZR4A 2VN1A 2MNTA 3JYMA 4IQ2A 4W9OA 4DRKA 1ROUA 2KO7A 3PRBA 4FAPA 4U85A 3TCZA 1J6YA 2XPAA 1BKFA 2Y78A 1FKFA 3O5RA 4LAYA 1Q6HA 4DROA 2JZVA 5HW6A 1PINA 2XP4A 3KAFA 1BL4A 2ZR6A 1Q6UA 5HT1A 4ODQA 2LJ4A 2AWGA 2KR7A 2XP7A 1QZ2A 2ZQVA 4JFJA 3UI5A 2DG9A 3LUOA 3UQIA 4ODPA 2KGJA 4IQCA 3KAIA 1FAPA 2FAPA 4U86A 1C9HA 3H9RB 3UI6A 2D9FA 5DIVA 2ZQSA 4JYSA 2MLYA 4G50A
chains in the Genus database with same CATH superfamily
4JFKA 3CGNA 4MNMA 4DH0A 3ARRA 1LJYA 3UQBA 1N1AA 1PBKA 2OLHA 1UR9A 1LL6A 4JFMA 3ODKA 5HKGA 2RUQA 3ARZA 4ODKA 4LAWA 2YBTA 1TCOC 3ARPA 3WH0A 1KFWA 3TC5A 4MNKA 4C02B 1XRVA 1WB0A 2Q5AA 3ARXA 3IHZA 2N87A 3CZ8A 1FKRA 2FDMA 2RUCA 1E6NA 4Z2KA 1J4IA 1W26A 2M1IA 2MLXA 5DO2A 2DT3A 3GU0A 2UZ5A 1TFVA 5HWBA 1FFRA 1FKIA 3IK8A 3O5PA 3PRDA 3OOBA 4TW6A 3B7XA 3WD0A 2ESCA 1LL4A 1Q1CA 3BMBA 2PV2A 3AS1A 4IPXA 5I98A 5HW8A 1ZBVA 4S3KA 3G6LA 1GUVA 3CGMA 1HXVA 3O5GA 4LAVA 1L1PA 4ODNA 3O5OA 2DT0A 4WKFA 1FKHA 1E6RA 4ODRA 2IF4A 2PN0A 3NRKA 4MPKA 5GPGA 2KE0A 1J4HA 4Z2JA 4L3NA 4MAVA 3NI6A 2OFNA 3KAHA 4GIVA 1E6ZA 3IKGA 4P8UA 2PV1A 4WKHA 3I6CA 3JYMA 1W9VA 2ZR4A 2A3EA 4W5UA 2DSZA 2XPAA 3O5RA 5HW6A 3KAFA 1BL4A 4DWSA 1Q6UA 1WNOA 2AWGA 2KR7A 3RM8A 1W1YA 1OGBA 2DT1A 4DWSC 2DG9A 4ODPA 4R5EA 2FAPA 4U86A 5DIVA 1HKIA 4MSPA 1HJWA 5D75A 3VAWA 2PPNA 3KAGA 4WK9A 4HBEA 2LGOA 4L72B 3B9AA 1NMWA 1D6OA 2ETNA 1FJDA 1JNTA 4XAKA 1JNDA 4AY1A 2IUZA 1H0IA 5HUAA 3AS2A 1J4RA 1EYMA 4J4OA 3O5FA 4FN2A 1NWRA 1ZB5A 1QPFA 3O5LA 2L2SA 5GPRA 4W9PA 1JVWA 1FKGA 4DIPA 4TW7A 2DSUA 2VCDA 4J4NA 4TNSA 1FFQA 1GPFA 4ZS6A 1JNSA 1OWQA 1FKTA 1ZBWA 3WL0A 1YATA 3RGCA 3GTYX 3O5DA 4DZ3A 1E6PA 2ITKA 1ZBKA 2XP5A 4Z2LA 2MPHA 2DG4A 4Q22A 2A3BA 1WAWA 3KADA 4ODMA 2RQSA 3RM4A 2LKNA 3AS0A 4G2PA 3IKDA 1ITXA 2WK2A 3FY1A 3EIPA 2XP6A 4DRHA 1NWTA 5HWCA 3RFWA 3FAPA 1KT0A 1Q6IA 2PPPA 1YW5A 2RURA 3ARUA 3AS3A 3OA5A 3O5QA 3WQWA 4U84A 3CHFA 4HARA 1EHNA 1R9HA 2DT2A 4MNJA 5HTGA 2VN1A 3PR9A 3PRBA 4ML4A 4WJXA 3QOKA 4ZPWR 4IT6A 5GQBA 1JNEA 4IT4A 5HT1A 4ODQA 3ARTA 2XP7A 2ZQVA 1QZ2A 4JFJA 1NH6A 4DWSD 3LUOA 3RMEA 3UQIA 2O9OA 4WKAA 1LG2A 1FAPA 3H9RB 1C9HA 1H0GA 1W1VA 3UI6A 2A3AA 4JYSA 4KR0B 1HKMA 5JH8A 4MNLA 3WIJA 4HBOA 5B8IC 3KACA 2MLZA 2M2AA 4GGQA 2FKEA 3JYJA 1D7IA 3ARWA 1FKBA 4DRJA 2LPVA 5DIUA 1NMVA 5DEZA 1U79A 2DSWA 1O6IA 1KT1A 3NTPA 1EQ3A 4ITZA 1Y0OA 5HW7A 3MDYB 2F21A 1FKKA 1RD6A 1ROTA 4DWSB 3O5IA 4WIWA 4LGXA 3ARVA 4LAXA 4TYOA 2F4EA 1GRJA 3CHCA 3B9EA 4BF8A 3WD2A 4W9QA 1ZL1A 1NWSA 1F8AB 4Q7NA 1HKKA 3ALFA 4R0XA 3CHEA 3B9DA 1B6CA 1W1TA 2XPBA 1W9PA 4DRPA 1D7HA 3ALGA 3UQAA 3O5JA 4P8VA 4QT3A 5BXJA 5DITA 4Z2HA 2G41A 4TW8A 3AROA 2WLZA 1HJVA 2M08A 4ODOA 3O5MA 4QIBA 1ZU8A 1A7XA 2PPOA 4ZPVR 3B8SA 2XP9A 5DF0A 3W4RA 2AOSA 4DRQA 2ZQTA 1XHGA 4JFIA 2EULA 3AQUA 2KI3A 3ARQA 2K8IA 2PV3A 1X6LA 2MNTA 2WLYA 4W9OA 4DRKA 1ROUA 2KO7A 3TCZA 2F23A 1FKFA 2Y78A 4LAYA 1Q6HA 2JZVA 1PINA 2XP4A 3CHDA 1CTNA 2LJ4A 2A3CA 4Z2IA 4Z2GA 3UI5A 2KGJA 3KAIA 2WM0A 1NWUA 2ZQSA 4DRMA 2MLYA 3WD1A 4G50A 1D2KA 2O92A 1T11A 2YBUA 4ODLA 3WL1A 3UI4A 2PBCA 1EIBA 3PRAA 2MF9A 2XP8A 3KZ7A 2B31A 1UR8A 4N19A 1ZK6A 3PA7A 2RUDA 4DZ2A 4DT4A 3KCEA 4JFLA 1IX5A 4MTVA 2ZQUA 2ZR5A 3O5KA 4MGVA 5J6EA 2DG3A 4ZPTR 1EDQA 1E9LA 4QT2A 2RSEA 1QPLA 1SYTA 2DSVA 4NZCA 3O5EA 4URIA 3JXVA 3WQVA 3WKZA 4P8XA 1W1PA 3KABA 1LL7A 4TX0A 4UDMA 2G8ZA 2DPEA 4KQZA 4S3JA 1E15A 4NSBA 1FKJA 3RM9A 1ZCNA 1FKSA 2XP3A 3G6MA 1VF8A 3EY6A 3ARSA 1GOIA 1NSGA 1P5QA 3GPKA 1F40A 5HBFA 4DRNA 1FD9A 3UF8A 2P4VA 1FKLA 4PTMA 2KFWA 3WD4A 3CH9A 1JCHB 4NNRA 3TDBA 1HKJA 4DRIA 1FKDA 1M5YA 3BXWA 4QZVB 1D7JA 4O2TA 2F2DA 4IQ2A 3WD3A 2PI6A 3ARYA 1HJXA 1E44A 4U85A 4FAPA 1J6YA 3FXYA 1BKFA 1OGGA 4DROA 2ZR6A 1K9TA 1ZBCA 2B5UB 4IQCA 1SR0A 1X6NA 2QF8A 1LG1A 1W9UA 2D9FA 1LQ0A 4P8WA
chains in the Genus database with same CATH topology
4JFKA 3CGNA 4MNMA 4DH0A 3ARRA 1LJYA 3UQBA 1N1AA 1PBKA 2OLHA 1UR9A 1LL6A 4JFMA 3ODKA 5HKGA 2RUQA 3ARZA 4ODKA 4LAWA 2YBTA 1TCOC 3ARPA 3WH0A 1KFWA 3TC5A 4MNKA 4C02B 1XRVA 1WB0A 2Q5AA 3ARXA 3IHZA 2N87A 3CZ8A 1FKRA 2FDMA 2RUCA 1E6NA 4Z2KA 1J4IA 1W26A 2M1IA 2MLXA 5DO2A 2DT3A 2UZ5A 1TFVA 5HWBA 1FFRA 1FKIA 3IK8A 3O5PA 3PRDA 3OOBA 4TW6A 3B7XA 3WD0A 2ESCA 1LL4A 1Q1CA 2PV2A 3AS1A 4IPXA 5I98A 5HW8A 1ZBVA 4S3KA 3G6LA 1GUVA 3CGMA 1HXVA 3O5GA 4LAVA 1L1PA 4ODNA 3O5OA 2DT0A 4WKFA 1FKHA 1E6RA 4ODRA 2IF4A 3NRKA 4MPKA 5GPGA 2KE0A 1J4HA 4Z2JA 4L3NA 4MAVA 3NI6A 2OFNA 4GIVA 1E6ZA 3KAHA 3IKGA 4P8UA 2PV1A 4WKHA 3I6CA 3JYMA 1W9VA 2ZR4A 2A3EA 4W5UA 2DSZA 2XPAA 3O5RA 5HW6A 3KAFA 1BL4A 4DWSA 1Q6UA 1WNOA 2AWGA 2KR7A 3RM8A 1W1YA 1OGBA 2DT1A 4DWSC 2DG9A 4ODPA 4R5EA 2FAPA 4U86A 5DIVA 1HKIA 4MSPA 1HJWA 5D75A 3VAWA 2PPNA 3KAGA 4WK9A 4HBEA 2LGOA 4L72B 3B9AA 1NMWA 1D6OA 1FJDA 1JNTA 4XAKA 1JNDA 4AY1A 2IUZA 1H0IA 5HUAA 3AS2A 1J4RA 1EYMA 4J4OA 3O5FA 4FN2A 1NWRA 1ZB5A 1QPFA 3O5LA 2L2SA 5GPRA 4W9PA 1JVWA 1FKGA 4DIPA 4TW7A 2DSUA 2VCDA 4J4NA 4TNSA 1FFQA 1GPFA 4ZS6A 1JNSA 1OWQA 1FKTA 1ZBWA 3WL0A 1YATA 3RGCA 3O5DA 4DZ3A 1E6PA 2ITKA 1ZBKA 2XP5A 4Z2LA 2MPHA 2DG4A 4Q22A 2A3BA 1WAWA 3KADA 4ODMA 2RQSA 3RM4A 2LKNA 3AS0A 4G2PA 3IKDA 1ITXA 2WK2A 3FY1A 2XP6A 4DRHA 1NWTA 5HWCA 3RFWA 3FAPA 1KT0A 1Q6IA 2PPPA 1YW5A 2RURA 3ARUA 3AS3A 3OA5A 3O5QA 3WQWA 4U84A 3CHFA 4HARA 1EHNA 1R9HA 2DT2A 4MNJA 5HTGA 2VN1A 3PR9A 3PRBA 4ML4A 4WJXA 3QOKA 4ZPWR 4IT6A 5GQBA 1JNEA 4IT4A 5HT1A 4ODQA 3ARTA 2XP7A 2ZQVA 1QZ2A 4JFJA 1NH6A 4DWSD 3LUOA 3RMEA 3UQIA 2O9OA 4WKAA 1LG2A 1FAPA 3H9RB 1C9HA 1H0GA 1W1VA 3UI6A 2A3AA 4JYSA 4KR0B 1HKMA 5JH8A 4MNLA 3WIJA 4HBOA 5B8IC 3KACA 2MLZA 2M2AA 4GGQA 2FKEA 3JYJA 1D7IA 3ARWA 1FKBA 4DRJA 2LPVA 5DIUA 1NMVA 5DEZA 1U79A 2DSWA 1O6IA 1KT1A 3NTPA 1EQ3A 4ITZA 1Y0OA 5HW7A 3MDYB 2F21A 1FKKA 1RD6A 1ROTA 4DWSB 3O5IA 4WIWA 4LGXA 3ARVA 4LAXA 4TYOA 2F4EA 3CHCA 3B9EA 4BF8A 3WD2A 4W9QA 1ZL1A 1NWSA 1F8AB 4Q7NA 1HKKA 3ALFA 4R0XA 3CHEA 3B9DA 1B6CA 1W1TA 2XPBA 1W9PA 4DRPA 1D7HA 3ALGA 3UQAA 3O5JA 4P8VA 4QT3A 5BXJA 5DITA 4Z2HA 2G41A 4TW8A 3AROA 2WLZA 1HJVA 2M08A 4ODOA 3O5MA 4QIBA 1ZU8A 1A7XA 2PPOA 4ZPVR 3B8SA 2XP9A 5DF0A 3W4RA 2AOSA 4DRQA 2ZQTA 1XHGA 4JFIA 3AQUA 2KI3A 3ARQA 2K8IA 2PV3A 1X6LA 2MNTA 2WLYA 4W9OA 4DRKA 1ROUA 2KO7A 3TCZA 2Y78A 1FKFA 4LAYA 1Q6HA 2JZVA 1PINA 2XP4A 3CHDA 1CTNA 2LJ4A 2A3CA 4Z2IA 4Z2GA 3UI5A 2KGJA 3KAIA 2WM0A 1NWUA 2ZQSA 4DRMA 2MLYA 3WD1A 4G50A 1D2KA 2O92A 1T11A 2YBUA 4ODLA 3WL1A 3UI4A 2PBCA 1EIBA 3PRAA 2MF9A 2XP8A 3KZ7A 2B31A 1UR8A 4N19A 1ZK6A 3PA7A 2RUDA 4DZ2A 4DT4A 3KCEA 4JFLA 1IX5A 4MTVA 2ZQUA 2ZR5A 3O5KA 4MGVA 5J6EA 2DG3A 4ZPTR 1EDQA 1E9LA 4QT2A 2RSEA 1QPLA 1SYTA 2DSVA 4NZCA 3O5EA 4URIA 3JXVA 3WQVA 3WKZA 4P8XA 1W1PA 3KABA 1LL7A 4TX0A 2G8ZA 2DPEA 4KQZA 4S3JA 1E15A 4NSBA 1FKJA 3RM9A 1ZCNA 1FKSA 2XP3A 3G6MA 1VF8A 3EY6A 3ARSA 1GOIA 1NSGA 1P5QA 3GPKA 1F40A 5HBFA 4DRNA 1FD9A 3UF8A 1FKLA 4PTMA 2KFWA 3WD4A 3CH9A 3TDBA 4NNRA 1HKJA 4DRIA 1FKDA 1M5YA 3BXWA 4QZVB 1D7JA 4O2TA 2F2DA 4IQ2A 3WD3A 2PI6A 3ARYA 1HJXA 4U85A 4FAPA 1J6YA 3FXYA 1BKFA 1OGGA 4DROA 2ZR6A 1K9TA 1ZBCA 4IQCA 1SR0A 1X6NA 2QF8A 1LG1A 1W9UA 2D9FA 1LQ0A 4P8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T11 A;  4MSP A;  4JFK A;  5D75 A;  3VAW A;  2PPN A;  3KAG A;  4ODL A;  3CGN A;  4DH0 A;  3UI4 A;  2PBC A;  2LGO A;  3UQB A;  2MF9 A;  1N1A A;  2XP8 A;  3KZ7 A;  5B8I C;  1NMW A;  1PBK A;  1D6O A;  1FJD A;  4N19 A;  1JNT A;  3KAC A;  2MLZ A;  2M2A A;  4GGQ A;  2FKE A;  4JFM A;  1ZK6 A;  3ODK A;  3JYJ A;  3PA7 A;  5HKG A;  2RUD A;  2RUQ A;  4DZ2 A;  1D7I A;  5HUA A;  1FKB A;  4DRJ A;  4DT4 A;  1J4R A;  1EYM A;  3KCE A;  3O5F A;  4J4O A;  4LAW A;  4ODK A;  4JFL A;  1TCO C;  4FN2 A;  2LPV A;  5DIU A;  3WH0 A;  3TC5 A;  1NMV A;  1QPF A;  2ZQU A;  1U79 A;  2L2S A;  2ZR5 A;  3O5L A;  3O5K A;  4MGV A;  4C02 B;  4W9P A;  1JVW A;  1FKG A;  2Q5A A;  3IHZ A;  2DG3 A;  1KT1 A;  3NTP A;  4DIP A;  5J6E A;  2N87 A;  4TW7 A;  1EQ3 A;  4ITZ A;  2VCD A;  4J4N A;  1Y0O A;  4TNS A;  4QT2 A;  2RSE A;  1FKR A;  1JNS A;  5HW7 A;  2RUC A;  1FKT A;  1QPL A;  3MDY B;  1J4I A;  1W26 A;  2F21 A;  2M1I A;  2MLX A;  1YAT A;  1FKK A;  3O5E A;  1ROT A;  3RGC A;  3JXV A;  3O5I A;  4LAX A;  2UZ5 A;  4TYO A;  2F4E A;  5HWB A;  4BF8 A;  1FKI A;  3IK8 A;  3KAB A;  3O5D A;  4TX0 A;  4DZ3 A;  4W9Q A;  3O5P A;  1F8A B;  2ITK A;  3PRD A;  3OOB A;  4TW6 A;  2XP5 A;  3B7X A;  4R0X A;  2MPH A;  2DG4 A;  1Q1C A;  1FKJ A;  2PV2 A;  1B6C A;  3KAD A;  4ODM A;  2RQS A;  2LKN A;  4IPX A;  1ZCN A;  5I98 A;  1FKS A;  5HW8 A;  2XP3 A;  4G2P A;  3CGM A;  3IKD A;  2XPB A;  1HXV A;  3EY6 A;  3O5G A;  4LAV A;  1L1P A;  4ODN A;  3O5O A;  1NSG A;  1P5Q A;  2XP6 A;  1FKH A;  4DRH A;  3GPK A;  4DRP A;  1D7H A;  3UQA A;  5HWC A;  1F40 A;  4ODR A;  3O5J A;  3RFW A;  2IF4 A;  3FAP A;  3NRK A;  5GPG A;  4QT3 A;  1KT0 A;  1Q6I A;  1FD9 A;  3UF8 A;  4DRN A;  1FKL A;  2PPP A;  5BXJ A;  2KE0 A;  4DRM A;  5DIT A;  5HTG A;  1YW5 A;  1J4H A;  2RUR A;  4TW8 A;  2KFW A;  2M08 A;  4NNR A;  3O5Q A;  3O5M A;  4ODO A;  4QIB A;  3TDB A;  4U84 A;  1A7X A;  2PPO A;  4DRI A;  3NI6 A;  1FKD A;  2OFN A;  2XP9 A;  1M5Y A;  1R9H A;  4DRQ A;  2ZQT A;  1D7J A;  3KAH A;  4GIV A;  3IKG A;  4JFI A;  4O2T A;  2KI3 A;  2PV1 A;  2F2D A;  2K8I A;  3I6C A;  2PV3 A;  2ZR4 A;  2VN1 A;  2MNT A;  3JYM A;  4IQ2 A;  4W9O A;  4DRK A;  1ROU A;  2KO7 A;  3PRB A;  4FAP A;  4U85 A;  3TCZ A;  1J6Y A;  2XPA A;  1BKF A;  2Y78 A;  1FKF A;  3O5R A;  4LAY A;  1Q6H A;  4DRO A;  2JZV A;  5HW6 A;  1PIN A;  2XP4 A;  3KAF A;  1BL4 A;  2ZR6 A;  1Q6U A;  5HT1 A;  4ODQ A;  2LJ4 A;  2AWG A;  2KR7 A;  2XP7 A;  1QZ2 A;  2ZQV A;  4JFJ A;  3UI5 A;  2DG9 A;  3LUO A;  3UQI A;  4ODP A;  2KGJ A;  4IQC A;  3KAI A;  1FAP A;  2FAP A;  4U86 A;  1C9H A;  3H9R B;  3UI6 A;  2D9F A;  5DIV A;  2ZQS A;  4JYS A;  2MLY A;  4G50 A; 
#chains in the Genus database with same CATH topology
 4JFK A;  3CGN A;  4MNM A;  4DH0 A;  3ARR A;  1LJY A;  3UQB A;  1N1A A;  1PBK A;  2OLH A;  1UR9 A;  1LL6 A;  4JFM A;  3ODK A;  5HKG A;  2RUQ A;  3ARZ A;  4ODK A;  4LAW A;  2YBT A;  1TCO C;  3ARP A;  3WH0 A;  1KFW A;  3TC5 A;  4MNK A;  4C02 B;  1XRV A;  1WB0 A;  2Q5A A;  3ARX A;  3IHZ A;  2N87 A;  3CZ8 A;  1FKR A;  2FDM A;  2RUC A;  1E6N A;  4Z2K A;  1J4I A;  1W26 A;  2M1I A;  2MLX A;  5DO2 A;  2DT3 A;  3GU0 A;  2UZ5 A;  1TFV A;  5HWB A;  1FFR A;  1FKI A;  3IK8 A;  3O5P A;  3PRD A;  3OOB A;  4TW6 A;  3B7X A;  3WD0 A;  2ESC A;  1LL4 A;  1Q1C A;  3BMB A;  2PV2 A;  3AS1 A;  4IPX A;  5I98 A;  5HW8 A;  1ZBV A;  4S3K A;  3G6L A;  1GUV A;  3CGM A;  1HXV A;  3O5G A;  4LAV A;  1L1P A;  4ODN A;  3O5O A;  2DT0 A;  4WKF A;  1FKH A;  1E6R A;  4ODR A;  2IF4 A;  2PN0 A;  3NRK A;  4MPK A;  5GPG A;  2KE0 A;  1J4H A;  4Z2J A;  4L3N A;  4MAV A;  3NI6 A;  2OFN A;  3KAH A;  4GIV A;  1E6Z A;  3IKG A;  4P8U A;  2PV1 A;  4WKH A;  3I6C A;  3JYM A;  1W9V A;  2ZR4 A;  2A3E A;  4W5U A;  2DSZ A;  2XPA A;  3O5R A;  5HW6 A;  3KAF A;  1BL4 A;  4DWS A;  1Q6U A;  1WNO A;  2AWG A;  2KR7 A;  3RM8 A;  1W1Y A;  1OGB A;  2DT1 A;  4DWS C;  2DG9 A;  4ODP A;  4R5E A;  2FAP A;  4U86 A;  5DIV A;  1HKI A;  4MSP A;  1HJW A;  5D75 A;  3VAW A;  2PPN A;  3KAG A;  4WK9 A;  4HBE A;  2LGO A;  4L72 B;  3B9A A;  1NMW A;  1D6O A;  2ETN A;  1FJD A;  1JNT A;  4XAK A;  1JND A;  4AY1 A;  2IUZ A;  1H0I A;  5HUA A;  3AS2 A;  1J4R A;  1EYM A;  4J4O A;  3O5F A;  4FN2 A;  1NWR A;  1ZB5 A;  1QPF A;  3O5L A;  2L2S A;  5GPR A;  4W9P A;  1JVW A;  1FKG A;  4DIP A;  4TW7 A;  2DSU A;  2VCD A;  4J4N A;  4TNS A;  1FFQ A;  1GPF A;  4ZS6 A;  1JNS A;  1OWQ A;  1FKT A;  1ZBW A;  3WL0 A;  1YAT A;  3RGC A;  3GTY X;  3O5D A;  4DZ3 A;  1E6P A;  2ITK A;  1ZBK A;  2XP5 A;  4Z2L A;  2MPH A;  2DG4 A;  4Q22 A;  2A3B A;  1WAW A;  3KAD A;  4ODM A;  2RQS A;  3RM4 A;  2LKN A;  3AS0 A;  4G2P A;  3IKD A;  1ITX A;  2WK2 A;  3FY1 A;  3EIP A;  2XP6 A;  4DRH A;  1NWT A;  5HWC A;  3RFW A;  3FAP A;  1KT0 A;  1Q6I A;  2PPP A;  1YW5 A;  2RUR A;  3ARU A;  3AS3 A;  3OA5 A;  3O5Q A;  3WQW A;  4U84 A;  3CHF A;  4HAR A;  1EHN A;  1R9H A;  2DT2 A;  4MNJ A;  5HTG A;  2VN1 A;  3PR9 A;  3PRB A;  4ML4 A;  4WJX A;  3QOK A;  4ZPW R;  4IT6 A;  5GQB A;  1JNE A;  4IT4 A;  5HT1 A;  4ODQ A;  3ART A;  2XP7 A;  2ZQV A;  1QZ2 A;  4JFJ A;  1NH6 A;  4DWS D;  3LUO A;  3RME A;  3UQI A;  2O9O A;  4WKA A;  1LG2 A;  1FAP A;  3H9R B;  1C9H A;  1H0G A;  1W1V A;  3UI6 A;  2A3A A;  4JYS A;  4KR0 B;  1HKM A;  5JH8 A;  4MNL A;  3WIJ A;  4HBO A;  5B8I C;  3KAC A;  2MLZ A;  2M2A A;  4GGQ A;  2FKE A;  3JYJ A;  1D7I A;  3ARW A;  1FKB A;  4DRJ A;  2LPV A;  5DIU A;  1NMV A;  5DEZ A;  1U79 A;  2DSW A;  1O6I A;  1KT1 A;  3NTP A;  1EQ3 A;  4ITZ A;  1Y0O A;  5HW7 A;  3MDY B;  2F21 A;  1FKK A;  1RD6 A;  1ROT A;  4DWS B;  3O5I A;  4WIW A;  4LGX A;  3ARV A;  4LAX A;  4TYO A;  2F4E A;  1GRJ A;  3CHC A;  3B9E A;  4BF8 A;  3WD2 A;  4W9Q A;  1ZL1 A;  1NWS A;  1F8A B;  4Q7N A;  1HKK A;  3ALF A;  4R0X A;  3CHE A;  3B9D A;  1B6C A;  1W1T A;  2XPB A;  1W9P A;  4DRP A;  1D7H A;  3ALG A;  3UQA A;  3O5J A;  4P8V A;  4QT3 A;  5BXJ A;  5DIT A;  4Z2H A;  2G41 A;  4TW8 A;  3ARO A;  2WLZ A;  1HJV A;  2M08 A;  4ODO A;  3O5M A;  4QIB A;  1ZU8 A;  1A7X A;  2PPO A;  4ZPV R;  3B8S A;  2XP9 A;  5DF0 A;  3W4R A;  2AOS A;  4DRQ A;  2ZQT A;  1XHG A;  4JFI A;  2EUL A;  3AQU A;  2KI3 A;  3ARQ A;  2K8I A;  2PV3 A;  1X6L A;  2MNT A;  2WLY A;  4W9O A;  4DRK A;  1ROU A;  2KO7 A;  3TCZ A;  2F23 A;  1FKF A;  2Y78 A;  4LAY A;  1Q6H A;  2JZV A;  1PIN A;  2XP4 A;  3CHD A;  1CTN A;  2LJ4 A;  2A3C A;  4Z2I A;  4Z2G A;  3UI5 A;  2KGJ A;  3KAI A;  2WM0 A;  1NWU A;  2ZQS A;  4DRM A;  2MLY A;  3WD1 A;  4G50 A;  1D2K A;  2O92 A;  1T11 A;  2YBU A;  4ODL A;  3WL1 A;  3UI4 A;  2PBC A;  1EIB A;  3PRA A;  2MF9 A;  2XP8 A;  3KZ7 A;  2B31 A;  1UR8 A;  4N19 A;  1ZK6 A;  3PA7 A;  2RUD A;  4DZ2 A;  4DT4 A;  3KCE A;  4JFL A;  1IX5 A;  4MTV A;  2ZQU A;  2ZR5 A;  3O5K A;  4MGV A;  5J6E A;  2DG3 A;  4ZPT R;  1EDQ A;  1E9L A;  4QT2 A;  2RSE A;  1QPL A;  1SYT A;  2DSV A;  4NZC A;  3O5E A;  4URI A;  3JXV A;  3WQV A;  3WKZ A;  4P8X A;  1W1P A;  3KAB A;  1LL7 A;  4TX0 A;  4UDM A;  2G8Z A;  2DPE A;  4KQZ A;  4S3J A;  1E15 A;  4NSB A;  1FKJ A;  3RM9 A;  1ZCN A;  1FKS A;  2XP3 A;  3G6M A;  1VF8 A;  3EY6 A;  3ARS A;  1GOI A;  1NSG A;  1P5Q A;  3GPK A;  1F40 A;  5HBF A;  4DRN A;  1FD9 A;  3UF8 A;  2P4V A;  1FKL A;  4PTM A;  2KFW A;  3WD4 A;  3CH9 A;  1JCH B;  4NNR A;  3TDB A;  1HKJ A;  4DRI A;  1FKD A;  1M5Y A;  3BXW A;  4QZV B;  1D7J A;  4O2T A;  2F2D A;  4IQ2 A;  3WD3 A;  2PI6 A;  3ARY A;  1HJX A;  1E44 A;  4U85 A;  4FAP A;  1J6Y A;  3FXY A;  1BKF A;  1OGG A;  4DRO A;  2ZR6 A;  1K9T A;  1ZBC A;  2B5U B;  4IQC A;  1SR0 A;  1X6N A;  2QF8 A;  1LG1 A;  1W9U A;  2D9F A;  1LQ0 A;  4P8W A; 
#chains in the Genus database with same CATH homology
 4JFK A;  3CGN A;  4MNM A;  4DH0 A;  3ARR A;  1LJY A;  3UQB A;  1N1A A;  1PBK A;  2OLH A;  1UR9 A;  1LL6 A;  4JFM A;  3ODK A;  5HKG A;  2RUQ A;  3ARZ A;  4ODK A;  4LAW A;  2YBT A;  1TCO C;  3ARP A;  3WH0 A;  1KFW A;  3TC5 A;  4MNK A;  4C02 B;  1XRV A;  1WB0 A;  2Q5A A;  3ARX A;  3IHZ A;  2N87 A;  3CZ8 A;  1FKR A;  2FDM A;  2RUC A;  1E6N A;  4Z2K A;  1J4I A;  1W26 A;  2M1I A;  2MLX A;  5DO2 A;  2DT3 A;  2UZ5 A;  1TFV A;  5HWB A;  1FFR A;  1FKI A;  3IK8 A;  3O5P A;  3PRD A;  3OOB A;  4TW6 A;  3B7X A;  3WD0 A;  2ESC A;  1LL4 A;  1Q1C A;  2PV2 A;  3AS1 A;  4IPX A;  5I98 A;  5HW8 A;  1ZBV A;  4S3K A;  3G6L A;  1GUV A;  3CGM A;  1HXV A;  3O5G A;  4LAV A;  1L1P A;  4ODN A;  3O5O A;  2DT0 A;  4WKF A;  1FKH A;  1E6R A;  4ODR A;  2IF4 A;  3NRK A;  4MPK A;  5GPG A;  2KE0 A;  1J4H A;  4Z2J A;  4L3N A;  4MAV A;  3NI6 A;  2OFN A;  4GIV A;  1E6Z A;  3KAH A;  3IKG A;  4P8U A;  2PV1 A;  4WKH A;  3I6C A;  3JYM A;  1W9V A;  2ZR4 A;  2A3E A;  4W5U A;  2DSZ A;  2XPA A;  3O5R A;  5HW6 A;  3KAF A;  1BL4 A;  4DWS A;  1Q6U A;  1WNO A;  2AWG A;  2KR7 A;  3RM8 A;  1W1Y A;  1OGB A;  2DT1 A;  4DWS C;  2DG9 A;  4ODP A;  4R5E A;  2FAP A;  4U86 A;  5DIV A;  1HKI A;  4MSP A;  1HJW A;  5D75 A;  3VAW A;  2PPN A;  3KAG A;  4WK9 A;  4HBE A;  2LGO A;  4L72 B;  3B9A A;  1NMW A;  1D6O A;  1FJD A;  1JNT A;  4XAK A;  1JND A;  4AY1 A;  2IUZ A;  1H0I A;  5HUA A;  3AS2 A;  1J4R A;  1EYM A;  4J4O A;  3O5F A;  4FN2 A;  1NWR A;  1ZB5 A;  1QPF A;  3O5L A;  2L2S A;  5GPR A;  4W9P A;  1JVW A;  1FKG A;  4DIP A;  4TW7 A;  2DSU A;  2VCD A;  4J4N A;  4TNS A;  1FFQ A;  1GPF A;  4ZS6 A;  1JNS A;  1OWQ A;  1FKT A;  1ZBW A;  3WL0 A;  1YAT A;  3RGC A;  3O5D A;  4DZ3 A;  1E6P A;  2ITK A;  1ZBK A;  2XP5 A;  4Z2L A;  2MPH A;  2DG4 A;  4Q22 A;  2A3B A;  1WAW A;  3KAD A;  4ODM A;  2RQS A;  3RM4 A;  2LKN A;  3AS0 A;  4G2P A;  3IKD A;  1ITX A;  2WK2 A;  3FY1 A;  2XP6 A;  4DRH A;  1NWT A;  5HWC A;  3RFW A;  3FAP A;  1KT0 A;  1Q6I A;  2PPP A;  1YW5 A;  2RUR A;  3ARU A;  3AS3 A;  3OA5 A;  3O5Q A;  3WQW A;  4U84 A;  3CHF A;  4HAR A;  1EHN A;  1R9H A;  2DT2 A;  4MNJ A;  5HTG A;  2VN1 A;  3PR9 A;  3PRB A;  4ML4 A;  4WJX A;  3QOK A;  4ZPW R;  4IT6 A;  5GQB A;  1JNE A;  4IT4 A;  5HT1 A;  4ODQ A;  3ART A;  2XP7 A;  2ZQV A;  1QZ2 A;  4JFJ A;  1NH6 A;  4DWS D;  3LUO A;  3RME A;  3UQI A;  2O9O A;  4WKA A;  1LG2 A;  1FAP A;  3H9R B;  1C9H A;  1H0G A;  1W1V A;  3UI6 A;  2A3A A;  4JYS A;  4KR0 B;  1HKM A;  5JH8 A;  4MNL A;  3WIJ A;  4HBO A;  5B8I C;  3KAC A;  2MLZ A;  2M2A A;  4GGQ A;  2FKE A;  3JYJ A;  1D7I A;  3ARW A;  1FKB A;  4DRJ A;  2LPV A;  5DIU A;  1NMV A;  5DEZ A;  1U79 A;  2DSW A;  1O6I A;  1KT1 A;  3NTP A;  1EQ3 A;  4ITZ A;  1Y0O A;  5HW7 A;  3MDY B;  2F21 A;  1FKK A;  1RD6 A;  1ROT A;  4DWS B;  3O5I A;  4WIW A;  4LGX A;  3ARV A;  4LAX A;  4TYO A;  2F4E A;  3CHC A;  3B9E A;  4BF8 A;  3WD2 A;  4W9Q A;  1ZL1 A;  1NWS A;  1F8A B;  4Q7N A;  1HKK A;  3ALF A;  4R0X A;  3CHE A;  3B9D A;  1B6C A;  1W1T A;  2XPB A;  1W9P A;  4DRP A;  1D7H A;  3ALG A;  3UQA A;  3O5J A;  4P8V A;  4QT3 A;  5BXJ A;  5DIT A;  4Z2H A;  2G41 A;  4TW8 A;  3ARO A;  2WLZ A;  1HJV A;  2M08 A;  4ODO A;  3O5M A;  4QIB A;  1ZU8 A;  1A7X A;  2PPO A;  4ZPV R;  3B8S A;  2XP9 A;  5DF0 A;  3W4R A;  2AOS A;  4DRQ A;  2ZQT A;  1XHG A;  4JFI A;  3AQU A;  2KI3 A;  3ARQ A;  2K8I A;  2PV3 A;  1X6L A;  2MNT A;  2WLY A;  4W9O A;  4DRK A;  1ROU A;  2KO7 A;  3TCZ A;  2Y78 A;  1FKF A;  4LAY A;  1Q6H A;  2JZV A;  1PIN A;  2XP4 A;  3CHD A;  1CTN A;  2LJ4 A;  2A3C A;  4Z2I A;  4Z2G A;  3UI5 A;  2KGJ A;  3KAI A;  2WM0 A;  1NWU A;  2ZQS A;  4DRM A;  2MLY A;  3WD1 A;  4G50 A;  1D2K A;  2O92 A;  1T11 A;  2YBU A;  4ODL A;  3WL1 A;  3UI4 A;  2PBC A;  1EIB A;  3PRA A;  2MF9 A;  2XP8 A;  3KZ7 A;  2B31 A;  1UR8 A;  4N19 A;  1ZK6 A;  3PA7 A;  2RUD A;  4DZ2 A;  4DT4 A;  3KCE A;  4JFL A;  1IX5 A;  4MTV A;  2ZQU A;  2ZR5 A;  3O5K A;  4MGV A;  5J6E A;  2DG3 A;  4ZPT R;  1EDQ A;  1E9L A;  4QT2 A;  2RSE A;  1QPL A;  1SYT A;  2DSV A;  4NZC A;  3O5E A;  4URI A;  3JXV A;  3WQV A;  3WKZ A;  4P8X A;  1W1P A;  3KAB A;  1LL7 A;  4TX0 A;  2G8Z A;  2DPE A;  4KQZ A;  4S3J A;  1E15 A;  4NSB A;  1FKJ A;  3RM9 A;  1ZCN A;  1FKS A;  2XP3 A;  3G6M A;  1VF8 A;  3EY6 A;  3ARS A;  1GOI A;  1NSG A;  1P5Q A;  3GPK A;  1F40 A;  5HBF A;  4DRN A;  1FD9 A;  3UF8 A;  1FKL A;  4PTM A;  2KFW A;  3WD4 A;  3CH9 A;  3TDB A;  4NNR A;  1HKJ A;  4DRI A;  1FKD A;  1M5Y A;  3BXW A;  4QZV B;  1D7J A;  4O2T A;  2F2D A;  4IQ2 A;  3WD3 A;  2PI6 A;  3ARY A;  1HJX A;  4U85 A;  4FAP A;  1J6Y A;  3FXY A;  1BKF A;  1OGG A;  4DRO A;  2ZR6 A;  1K9T A;  1ZBC A;  4IQC A;  1SR0 A;  1X6N A;  2QF8 A;  1LG1 A;  1W9U A;  2D9F A;  1LQ0 A;  4P8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...