1BKFA

Fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
publication title Conformation of Fk506 in X-Ray Structures of its Complexes with Human Recombinant Fkbp12 Mutants
pubmed rcsb
source organism Homo sapiens
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bkfA00
1PINA 3GPKA 1F8AB 4W9QA 4G2PA 1TCOC 1EQ3A 2Y78A 1D7IA 1FKTA 2PPNA 1KT1A 4FN2A 1QPFA 4IQCA 5HW6A 1PBKA 1FAPA 4DRMA 2XP3A 3WH0A 4MGVA 3TCZA 1FD9A 1YW5A 2M2AA 2PBCA 3O5QA 3NI6A 2KFWA 4MSPA 1ROTA 3NTPA 3PA7A 1ZK6A 5DITA 4DZ2A 1L1PA 3JYJA 4TW6A 3RGCA 4DZ3A 2N87A 3O5GA 2FAPA 2KR7A 4JFIA 4DT4A 2PV2A 3O5FA 3OOBA 2UZ5A 2XP8A 5DIVA 4DIPA 1J6YA 1F40A 2K8IA 4JYSA 2RURA 3O5EA 4TNSA 3I6CA 3UI6A 1D7HA 2XPBA 3O5KA 3KACA 1Q6HA 4JFKA 2DG3A 2XP9A 3JXVA 2MPHA 3KAFA 5HT1A 5DIUA 3KZ7A 4DRQA 3RFWA 4TW7A 5HTGA 1C9HA 1NSGA 2RQSA 5J6EA 3EY6A 3TDBA 2FKEA 1NMVA 2PV3A 4LAXA 2LKNA 2ZR6A 4DROA 4JFJA 4IQ2A 1FKSA 4DRHA 3IKDA 2ZQVA 4TX0A 3B7XA 1U79A 2XP5A 2RUDA 4DRKA 4DRPA 3UI4A 2OFNA 2M08A 4C02B 2RSEA 3PRDA 2JZVA 2LGOA 1N1AA 3FAPA 4DRIA 4FAPA 2PPPA 2ZR5A 1D7JA 2KI3A 1FKRA 1Q6IA 5HKGA 4W9PA 4J4OA 4ITZA 2ZQUA 3O5RA 4TW8A 3KAIA 3LUOA 1FKDA 2KO7A 2LPVA 1FKJA 1A7XA 4DH0A 4ODNA 1JNTA 1ZCNA 4ODMA 1Q1CA 3O5JA 3UF8A 1J4RA 1M5YA 1EYMA 3CGMA 3UQBA 5B8IC 3O5DA 2RUQA 4QT2A 4DRNA 2XP4A 3IK8A 4ODQA 4GIVA 4R0XA 1JNSA 5GPGA 1D6OA 2M1IA 1BKFA 3IKGA 1QZ2A 4ODRA 2MF9A 4IPXA 2XPAA 1B6CA 4U84A 4TYOA 3MDYB 1R9HA 2D9FA 1KT0A 4LAYA 3NRKA 5D75A 4LAWA 3UQIA 2F21A 1J4IA 1FKLA 2F2DA 2MLZA 2ZQTA 4JFMA 4BF8A 2DG9A 2MLXA 3UQAA 5HUAA 2IF4A 1FJDA 3TC5A 1FKIA 3H9RB 5HW7A 4N19A 4ODPA 4U86A 2MLYA 1ROUA 1NMWA 1FKGA 4G50A 1FKFA 4LAVA 4NNRA 1Q6UA 3UI5A 2DG4A 3KAHA 1FKKA 2VCDA 2ZQSA 4U85A 4DRJA 1P5QA 4JFLA 4ODOA 3PRBA 2XP7A 1FKHA 2KGJA 4ODKA 2AWGA 2F4EA 2MNTA 1FKBA 4W9OA 3KAGA 4GGQA 1J4HA 4QIBA 5BXJA 1Y0OA 1YATA 3O5MA 5I98A 1T11A 2PPOA 3CGNA 2ZR4A 3ODKA 2Q5AA 3IHZA 4J4NA 2ITKA 3KADA 2XP6A 3O5OA 3O5LA 2RUCA 3O5IA 3VAWA 3KABA 1BL4A 4O2TA 4ODLA 4QT3A 5HWCA 2L2SA 2PV1A 3KCEA 3JYMA 1JVWA 2LJ4A 2KE0A 1W26A 5HWBA 5HW8A 1QPLA 1HXVA 3O5PA 2VN1A
chains in the Genus database with same CATH superfamily
1F8AB 4DWSA 1TCOC 2DT1A 4MNJA 1KT1A 1QPFA 1OGBA 3ARSA 4DRMA 3WH0A 1OGGA 4KQZA 1W1VA 2PBCA 3O5QA 1ROTA 3NTPA 1ZK6A 3FXYA 3RGCA 5JH8A 3FY1A 4DT4A 2PV2A 1IX5A 3O5FA 2UZ5A 1J6YA 1UR8A 4Z2JA 3G6LA 3O5EA 4TNSA 3I6CA 3KACA 3JXVA 5HT1A 5J6EA 1GOIA 1C9HA 1W9VA 3TDBA 1NMVA 2AOSA 4ML4A 4IQ2A 3IKDA 1GRJA 1E6ZA 4DRPA 1NWUA 2DSWA 4C02B 3GU0A 3ALGA 3PR9A 1D7JA 2EULA 4MAVA 3G6MA 3WD2A 1ZU8A 3ALFA 4J4OA 4S3JA 1LG1A 4DWSD 4L72B 3LUOA 2KO7A 3RM4A 1FKJA 1A7XA 2DSUA 4ODNA 1ZCNA 1M5YA 4Z2HA 1CTNA 3O5DA 1XRVA 4P8UA 4IT6A 1BKFA 3RMEA 3BMBA 2MF9A 2DT2A 4TYOA 2D9FA 2F21A 2PN0A 4JFMA 1E44A 2MLXA 2PI6A 3TC5A 4U86A 1ROUA 3ARTA 4NNRA 1FKKA 4U85A 2QF8A 4ODKA 2MNTA 3KAGA 5BXJA 4MNKA 3ARXA 2G41A 4MPKA 3WQWA 3IHZA 3VAWA 1LJYA 4O2TA 4QT3A 5HWCA 2PV1A 5DF0A 1X6LA 1QPLA 4G2PA 4PTMA 1D7IA 2PPNA 4FN2A 4IQCA 1PBKA 3JYJA 4TW6A 3ARRA 2FAPA 2KR7A 4JFIA 4NZCA 5DIVA 4DIPA 2K8IA 4JYSA 1GPFA 3O5KA 4JFKA 2XP9A 3KAFA 5DEZA 4DRQA 3EY6A 2FKEA 3WD4A 4LAXA 2A3BA 3AS3A 3RM8A 4DRKA 2OFNA 2B31A 2RSEA 3CH9A 3WD1A 3FAPA 4FAPA 2PPPA 3RM9A 1FKRA 3AS1A 5HKGA 3ARVA 3PRAA 4ITZA 2DSVA 3O5RA 4AY1A 4TW8A 1FKDA 1FFQA 4WK9A 2LPVA 4DH0A 4ODMA 1JNTA 1Q1CA 3O5JA 1ZBWA 4ZPTR 1EYMA 3CGMA 3AS2A 4ZPWR 2WLZA 3IK8A 3QOKA 4GIVA 4MNMA 3WL1A 1JNDA 3IKGA 1B6CA 4U84A 3MDYB 1FFRA 4LAYA 3NRKA 2ZQTA 2F2DA 1RD6A 2MLZA 5DO2A 1FJDA 2DT0A 2IF4A 3AQUA 5HW7A 2MLYA 4LGXA 4LAVA 1ZBKA 2ZQSA 2VCDA 1P5QA 2XP7A 1FKHA 2P4VA 4KR0B 1LL4A 3WIJA 1FKBA 4GGQA 1NWRA 4QIBA 1YATA 3O5MA 1HKMA 2Q5AA 3ODKA 4J4NA 3KADA 3O5OA 2ESCA 1E6RA 2XP6A 4DWSC 1LL7A 3KABA 2L2SA 3JYMA 4W5UA 1JVWA 5HW8A 1ITXA 2VN1A 2B5UB 3GPKA 2A3CA 2DT3A 1EQ3A 1SYTA 1FKTA 1SR0A 2OLHA 1FAPA 2XP3A 4MGVA 3TCZA 1YW5A 2M2AA 5HUAA 4MSPA 3NI6A 2KFWA 4URIA 3PA7A 5GQBA 5DITA 1D2KA 4DZ3A 5HBFA 2IUZA 1H0GA 1NH6A 3OOBA 2XP8A 3EIPA 4WKAA 1F40A 1EDQA 1HKKA 4WIWA 3UI6A 2XPBA 1ZBVA 1VF8A 2DG3A 1OWQA 2MPHA 3WD0A 3RFWA 3CHEA 1NSGA 2RQSA 2PV3A 2ZR6A 2ETNA 4JFJA 1FKSA 4DRHA 2ZQVA 4TX0A 4XAKA 2XP5A 1H0IA 1JNEA 2RUDA 4IT4A 2M08A 4HBEA 2LGOA 1N1AA 1LG2A 3ARWA 4W9PA 2WM0A 2ZQUA 2YBUA 3ARPA 3KAIA 3ARUA 4P8WA 3UF8A 1J4RA 1WB0A 4Z2LA 1W1TA 1JCHB 2RUQA 3WQVA 1TFVA 1WNOA 1JNSA 3OA5A 1QZ2A 4IPXA 2DSZA 1KT0A 4Z2GA 4WJXA 3UQIA 1J4IA 1EIBA 2DG9A 3ARZA 3H9RB 4DWSB 1NWSA 1HJVA 1E9LA 1NMWA 2A3EA 4G50A 1FKFA 3GTYX 3UI5A 2DG4A 3KAHA 4ODOA 3PRBA 2KGJA 1GUVA 2F4EA 4W9OA 3WD3A 1UR9A 3AROA 4P8XA 5I98A 3B9EA 3O5LA 3O5IA 3B9AA 3O5PA 2A3AA 3CHDA 4QZVB 1PINA 4MTVA 4W9QA 2Y78A 3ARYA 4ZPVR 5HW6A 4UDMA 3CHFA 1FD9A 3UQBA 1HKJA 4DZ2A 1L1PA 1W1PA 2N87A 3O5GA 3B9DA 1E15A 1O6IA 1NWTA 4Q22A 3WKZA 2F23A 1HKIA 2RURA 2FDMA 1D7HA 4NSBA 1WAWA 1KFWA 1Q6HA 1W9PA 2WLYA 5DIUA 3KZ7A 2G8ZA 4TW7A 5HTGA 2LKNA 4DROA 2O92A 1LQ0A 4P8VA 1E6PA 3CHCA 3B7XA 1U79A 4ZS6A 3UI4A 3PRDA 4R5EA 2JZVA 4DRIA 1EHNA 4Z2IA 2ZR5A 1HJXA 2KI3A 1K9TA 1Q6IA 4S3KA 1LL6A 1X6NA 4HARA 4HBOA 1W9UA 2O9OA 1XHGA 2DPEA 1W1YA 5B8IC 4QT2A 4DRNA 2XP4A 3W4RA 4ODQA 4R0XA 4Z2KA 5GPGA 3BXWA 1D6OA 4Q7NA 2M1IA 4ODRA 1ZB5A 2XPAA 4MNLA 5GPRA 3WL0A 1R9HA 1ZL1A 5D75A 4LAWA 1HJWA 4BF8A 3UQAA 1FKLA 1FKIA 4N19A 4ODPA 1FKGA 1Q6UA 2YBTA 3CZ8A 4DRJA 4JFLA 4WKFA 2AWGA 4L3NA 1J4HA 3ARQA 1Y0OA 1T11A 2PPOA 3CGNA 2ZR4A 2WK2A 1ZBCA 2ITKA 2RUCA 4WKHA 1BL4A 4ODLA 3KCEA 3AS0A 5HWBA 2LJ4A 2KE0A 1W26A 3B8SA 1HXVA 1E6NA
chains in the Genus database with same CATH topology
1F8AB 4DWSA 1TCOC 2DT1A 4MNJA 1KT1A 1QPFA 1OGBA 3ARSA 4DRMA 3WH0A 1OGGA 4KQZA 1W1VA 2PBCA 3O5QA 1ROTA 3NTPA 1ZK6A 3FXYA 3RGCA 5JH8A 3FY1A 4DT4A 2PV2A 1IX5A 3O5FA 2UZ5A 1J6YA 1UR8A 4Z2JA 3G6LA 3O5EA 4TNSA 3I6CA 3KACA 3JXVA 5HT1A 5J6EA 1GOIA 1C9HA 1W9VA 3TDBA 1NMVA 2AOSA 4ML4A 4IQ2A 3IKDA 1E6ZA 4DRPA 1NWUA 2DSWA 4C02B 3ALGA 3PR9A 1D7JA 4MAVA 3G6MA 3WD2A 1ZU8A 3ALFA 4J4OA 4S3JA 1LG1A 4DWSD 4L72B 3LUOA 2KO7A 3RM4A 1FKJA 1A7XA 2DSUA 4ODNA 1ZCNA 1M5YA 4Z2HA 1CTNA 3O5DA 1XRVA 4P8UA 4IT6A 1BKFA 3RMEA 2MF9A 2DT2A 4TYOA 2D9FA 2F21A 4JFMA 2MLXA 2PI6A 3TC5A 4U86A 1ROUA 3ARTA 4NNRA 1FKKA 4U85A 2QF8A 4ODKA 2MNTA 3KAGA 5BXJA 4MNKA 3ARXA 2G41A 4MPKA 3WQWA 3IHZA 3VAWA 1LJYA 4O2TA 4QT3A 5HWCA 2PV1A 5DF0A 1X6LA 1QPLA 4G2PA 4PTMA 1D7IA 2PPNA 4FN2A 4IQCA 1PBKA 3JYJA 4TW6A 3ARRA 2FAPA 2KR7A 4JFIA 4NZCA 5DIVA 4DIPA 2K8IA 4JYSA 1GPFA 3O5KA 4JFKA 2XP9A 3KAFA 5DEZA 4DRQA 3EY6A 2FKEA 3WD4A 4LAXA 2A3BA 3AS3A 3RM8A 4DRKA 2OFNA 2B31A 2RSEA 3CH9A 3WD1A 3FAPA 4FAPA 2PPPA 3RM9A 1FKRA 3AS1A 5HKGA 3ARVA 3PRAA 4ITZA 2DSVA 3O5RA 4AY1A 4TW8A 1FKDA 1FFQA 4WK9A 2LPVA 4DH0A 4ODMA 1JNTA 1Q1CA 3O5JA 1ZBWA 4ZPTR 1EYMA 3CGMA 3AS2A 4ZPWR 2WLZA 3IK8A 3QOKA 4GIVA 4MNMA 3WL1A 1JNDA 3IKGA 1B6CA 4U84A 3MDYB 1FFRA 4LAYA 3NRKA 2ZQTA 2F2DA 1RD6A 2MLZA 5DO2A 1FJDA 2DT0A 2IF4A 3AQUA 5HW7A 2MLYA 4LGXA 4LAVA 1ZBKA 2ZQSA 2VCDA 1P5QA 2XP7A 1FKHA 4KR0B 1LL4A 3WIJA 1FKBA 4GGQA 1NWRA 4QIBA 1YATA 3O5MA 1HKMA 2Q5AA 3ODKA 4J4NA 3O5OA 3KADA 2ESCA 1E6RA 2XP6A 4DWSC 1LL7A 3KABA 2L2SA 3JYMA 4W5UA 1JVWA 5HW8A 1ITXA 2VN1A 3GPKA 2A3CA 2DT3A 1EQ3A 1SYTA 1FKTA 1SR0A 2OLHA 1FAPA 2XP3A 4MGVA 3TCZA 1YW5A 2M2AA 5HUAA 4MSPA 3NI6A 2KFWA 4URIA 3PA7A 5GQBA 5DITA 1D2KA 4DZ3A 5HBFA 2IUZA 1H0GA 1NH6A 3OOBA 2XP8A 4WKAA 1F40A 1EDQA 1HKKA 4WIWA 3UI6A 2XPBA 1ZBVA 1VF8A 2DG3A 1OWQA 2MPHA 3WD0A 3RFWA 3CHEA 1NSGA 2RQSA 2PV3A 2ZR6A 4JFJA 1FKSA 4DRHA 2ZQVA 4TX0A 4XAKA 2XP5A 1H0IA 1JNEA 2RUDA 4IT4A 2M08A 4HBEA 2LGOA 1N1AA 1LG2A 3ARWA 4W9PA 2WM0A 2ZQUA 2YBUA 3ARPA 3KAIA 3ARUA 4P8WA 3UF8A 1J4RA 1WB0A 4Z2LA 1W1TA 2RUQA 3WQVA 1TFVA 1WNOA 1JNSA 3OA5A 1QZ2A 4IPXA 2DSZA 1KT0A 4Z2GA 4WJXA 3UQIA 1J4IA 1EIBA 2DG9A 3ARZA 3H9RB 4DWSB 1NWSA 1HJVA 1E9LA 1NMWA 2A3EA 4G50A 1FKFA 3UI5A 2DG4A 3KAHA 4ODOA 3PRBA 2KGJA 1GUVA 2F4EA 4W9OA 3WD3A 1UR9A 3AROA 4P8XA 5I98A 3B9EA 3O5LA 3O5IA 3B9AA 3O5PA 2A3AA 3CHDA 4QZVB 1PINA 4MTVA 4W9QA 2Y78A 3ARYA 4ZPVR 5HW6A 3CHFA 1FD9A 3UQBA 1HKJA 4DZ2A 1L1PA 1W1PA 2N87A 3O5GA 3B9DA 1E15A 1O6IA 1NWTA 4Q22A 3WKZA 1HKIA 2RURA 2FDMA 1D7HA 4NSBA 1WAWA 1KFWA 1Q6HA 1W9PA 2WLYA 5DIUA 3KZ7A 2G8ZA 4TW7A 5HTGA 2LKNA 4DROA 2O92A 1LQ0A 4P8VA 1E6PA 3CHCA 3B7XA 1U79A 4ZS6A 3UI4A 3PRDA 4R5EA 2JZVA 4DRIA 1EHNA 4Z2IA 2ZR5A 1HJXA 2KI3A 1K9TA 1Q6IA 4S3KA 1LL6A 1X6NA 4HARA 4HBOA 1W9UA 2O9OA 1XHGA 2DPEA 1W1YA 5B8IC 4QT2A 4DRNA 2XP4A 3W4RA 4ODQA 4R0XA 4Z2KA 5GPGA 3BXWA 1D6OA 4Q7NA 2M1IA 4ODRA 1ZB5A 2XPAA 4MNLA 5GPRA 3WL0A 1R9HA 1ZL1A 5D75A 4LAWA 1HJWA 4BF8A 3UQAA 1FKLA 1FKIA 4N19A 4ODPA 1FKGA 1Q6UA 2YBTA 3CZ8A 4DRJA 4JFLA 4WKFA 2AWGA 4L3NA 1J4HA 3ARQA 1Y0OA 1T11A 2PPOA 3CGNA 2ZR4A 2WK2A 1ZBCA 2ITKA 2RUCA 4WKHA 1BL4A 4ODLA 3KCEA 3AS0A 5HWBA 2LJ4A 2KE0A 1W26A 3B8SA 1HXVA 1E6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  3GPK A;  1F8A B;  4W9Q A;  4G2P A;  1TCO C;  1EQ3 A;  2Y78 A;  1D7I A;  1FKT A;  2PPN A;  1KT1 A;  4FN2 A;  1QPF A;  4IQC A;  5HW6 A;  1PBK A;  1FAP A;  4DRM A;  2XP3 A;  3WH0 A;  4MGV A;  3TCZ A;  1FD9 A;  1YW5 A;  2M2A A;  2PBC A;  3O5Q A;  3NI6 A;  2KFW A;  4MSP A;  1ROT A;  3NTP A;  3PA7 A;  1ZK6 A;  5DIT A;  4DZ2 A;  1L1P A;  3JYJ A;  4TW6 A;  3RGC A;  4DZ3 A;  2N87 A;  3O5G A;  2FAP A;  2KR7 A;  4JFI A;  4DT4 A;  2PV2 A;  3O5F A;  3OOB A;  2UZ5 A;  2XP8 A;  5DIV A;  4DIP A;  1J6Y A;  1F40 A;  2K8I A;  4JYS A;  2RUR A;  3O5E A;  4TNS A;  3I6C A;  3UI6 A;  1D7H A;  2XPB A;  3O5K A;  3KAC A;  1Q6H A;  4JFK A;  2DG3 A;  2XP9 A;  3JXV A;  2MPH A;  3KAF A;  5HT1 A;  5DIU A;  3KZ7 A;  4DRQ A;  3RFW A;  4TW7 A;  5HTG A;  1C9H A;  1NSG A;  2RQS A;  5J6E A;  3EY6 A;  3TDB A;  2FKE A;  1NMV A;  2PV3 A;  4LAX A;  2LKN A;  2ZR6 A;  4DRO A;  4JFJ A;  4IQ2 A;  1FKS A;  4DRH A;  3IKD A;  2ZQV A;  4TX0 A;  3B7X A;  1U79 A;  2XP5 A;  2RUD A;  4DRK A;  4DRP A;  3UI4 A;  2OFN A;  2M08 A;  4C02 B;  2RSE A;  3PRD A;  2JZV A;  2LGO A;  1N1A A;  3FAP A;  4DRI A;  4FAP A;  2PPP A;  2ZR5 A;  1D7J A;  2KI3 A;  1FKR A;  1Q6I A;  5HKG A;  4W9P A;  4J4O A;  4ITZ A;  2ZQU A;  3O5R A;  4TW8 A;  3KAI A;  3LUO A;  1FKD A;  2KO7 A;  2LPV A;  1FKJ A;  1A7X A;  4DH0 A;  4ODN A;  1JNT A;  1ZCN A;  4ODM A;  1Q1C A;  3O5J A;  3UF8 A;  1J4R A;  1M5Y A;  1EYM A;  3CGM A;  3UQB A;  5B8I C;  3O5D A;  2RUQ A;  4QT2 A;  4DRN A;  2XP4 A;  3IK8 A;  4ODQ A;  4GIV A;  4R0X A;  1JNS A;  5GPG A;  1D6O A;  2M1I A;  1BKF A;  3IKG A;  1QZ2 A;  4ODR A;  2MF9 A;  4IPX A;  2XPA A;  1B6C A;  4U84 A;  4TYO A;  3MDY B;  1R9H A;  2D9F A;  1KT0 A;  4LAY A;  3NRK A;  5D75 A;  4LAW A;  3UQI A;  2F21 A;  1J4I A;  1FKL A;  2F2D A;  2MLZ A;  2ZQT A;  4JFM A;  4BF8 A;  2DG9 A;  2MLX A;  3UQA A;  5HUA A;  2IF4 A;  1FJD A;  3TC5 A;  1FKI A;  3H9R B;  5HW7 A;  4N19 A;  4ODP A;  4U86 A;  2MLY A;  1ROU A;  1NMW A;  1FKG A;  4G50 A;  1FKF A;  4LAV A;  4NNR A;  1Q6U A;  3UI5 A;  2DG4 A;  3KAH A;  1FKK A;  2VCD A;  2ZQS A;  4U85 A;  4DRJ A;  1P5Q A;  4JFL A;  4ODO A;  3PRB A;  2XP7 A;  1FKH A;  2KGJ A;  4ODK A;  2AWG A;  2F4E A;  2MNT A;  1FKB A;  4W9O A;  3KAG A;  4GGQ A;  1J4H A;  4QIB A;  5BXJ A;  1Y0O A;  1YAT A;  3O5M A;  5I98 A;  1T11 A;  2PPO A;  3CGN A;  2ZR4 A;  3ODK A;  2Q5A A;  3IHZ A;  4J4N A;  2ITK A;  3KAD A;  2XP6 A;  3O5O A;  3O5L A;  2RUC A;  3O5I A;  3VAW A;  3KAB A;  1BL4 A;  4O2T A;  4ODL A;  4QT3 A;  5HWC A;  2L2S A;  2PV1 A;  3KCE A;  3JYM A;  1JVW A;  2LJ4 A;  2KE0 A;  1W26 A;  5HWB A;  5HW8 A;  1QPL A;  1HXV A;  3O5P A;  2VN1 A; 
#chains in the Genus database with same CATH topology
 1F8A B;  4DWS A;  1TCO C;  2DT1 A;  4MNJ A;  1KT1 A;  1QPF A;  1OGB A;  3ARS A;  4DRM A;  3WH0 A;  1OGG A;  4KQZ A;  1W1V A;  2PBC A;  3O5Q A;  1ROT A;  3NTP A;  1ZK6 A;  3FXY A;  3RGC A;  5JH8 A;  3FY1 A;  4DT4 A;  2PV2 A;  1IX5 A;  3O5F A;  2UZ5 A;  1J6Y A;  1UR8 A;  4Z2J A;  3G6L A;  3O5E A;  4TNS A;  3I6C A;  3KAC A;  3JXV A;  5HT1 A;  5J6E A;  1GOI A;  1C9H A;  1W9V A;  3TDB A;  1NMV A;  2AOS A;  4ML4 A;  4IQ2 A;  3IKD A;  1GRJ A;  1E6Z A;  4DRP A;  1NWU A;  2DSW A;  4C02 B;  3GU0 A;  3ALG A;  3PR9 A;  1D7J A;  2EUL A;  4MAV A;  3G6M A;  3WD2 A;  1ZU8 A;  3ALF A;  4J4O A;  4S3J A;  1LG1 A;  4DWS D;  4L72 B;  3LUO A;  2KO7 A;  3RM4 A;  1FKJ A;  1A7X A;  2DSU A;  4ODN A;  1ZCN A;  1M5Y A;  4Z2H A;  1CTN A;  3O5D A;  1XRV A;  4P8U A;  4IT6 A;  1BKF A;  3RME A;  3BMB A;  2MF9 A;  2DT2 A;  4TYO A;  2D9F A;  2F21 A;  2PN0 A;  4JFM A;  1E44 A;  2MLX A;  2PI6 A;  3TC5 A;  4U86 A;  1ROU A;  3ART A;  4NNR A;  1FKK A;  4U85 A;  2QF8 A;  4ODK A;  2MNT A;  3KAG A;  5BXJ A;  4MNK A;  3ARX A;  2G41 A;  4MPK A;  3WQW A;  3IHZ A;  3VAW A;  1LJY A;  4O2T A;  4QT3 A;  5HWC A;  2PV1 A;  5DF0 A;  1X6L A;  1QPL A;  4G2P A;  4PTM A;  1D7I A;  2PPN A;  4FN2 A;  4IQC A;  1PBK A;  3JYJ A;  4TW6 A;  3ARR A;  2FAP A;  2KR7 A;  4JFI A;  4NZC A;  5DIV A;  4DIP A;  2K8I A;  4JYS A;  1GPF A;  3O5K A;  4JFK A;  2XP9 A;  3KAF A;  5DEZ A;  4DRQ A;  3EY6 A;  2FKE A;  3WD4 A;  4LAX A;  2A3B A;  3AS3 A;  3RM8 A;  4DRK A;  2OFN A;  2B31 A;  2RSE A;  3CH9 A;  3WD1 A;  3FAP A;  4FAP A;  2PPP A;  3RM9 A;  1FKR A;  3AS1 A;  5HKG A;  3ARV A;  3PRA A;  4ITZ A;  2DSV A;  3O5R A;  4AY1 A;  4TW8 A;  1FKD A;  1FFQ A;  4WK9 A;  2LPV A;  4DH0 A;  4ODM A;  1JNT A;  1Q1C A;  3O5J A;  1ZBW A;  4ZPT R;  1EYM A;  3CGM A;  3AS2 A;  4ZPW R;  2WLZ A;  3IK8 A;  3QOK A;  4GIV A;  4MNM A;  3WL1 A;  1JND A;  3IKG A;  1B6C A;  4U84 A;  3MDY B;  1FFR A;  4LAY A;  3NRK A;  2ZQT A;  2F2D A;  1RD6 A;  2MLZ A;  5DO2 A;  1FJD A;  2DT0 A;  2IF4 A;  3AQU A;  5HW7 A;  2MLY A;  4LGX A;  4LAV A;  1ZBK A;  2ZQS A;  2VCD A;  1P5Q A;  2XP7 A;  1FKH A;  2P4V A;  4KR0 B;  1LL4 A;  3WIJ A;  1FKB A;  4GGQ A;  1NWR A;  4QIB A;  1YAT A;  3O5M A;  1HKM A;  2Q5A A;  3ODK A;  4J4N A;  3KAD A;  3O5O A;  2ESC A;  1E6R A;  2XP6 A;  4DWS C;  1LL7 A;  3KAB A;  2L2S A;  3JYM A;  4W5U A;  1JVW A;  5HW8 A;  1ITX A;  2VN1 A;  2B5U B;  3GPK A;  2A3C A;  2DT3 A;  1EQ3 A;  1SYT A;  1FKT A;  1SR0 A;  2OLH A;  1FAP A;  2XP3 A;  4MGV A;  3TCZ A;  1YW5 A;  2M2A A;  5HUA A;  4MSP A;  3NI6 A;  2KFW A;  4URI A;  3PA7 A;  5GQB A;  5DIT A;  1D2K A;  4DZ3 A;  5HBF A;  2IUZ A;  1H0G A;  1NH6 A;  3OOB A;  2XP8 A;  3EIP A;  4WKA A;  1F40 A;  1EDQ A;  1HKK A;  4WIW A;  3UI6 A;  2XPB A;  1ZBV A;  1VF8 A;  2DG3 A;  1OWQ A;  2MPH A;  3WD0 A;  3RFW A;  3CHE A;  1NSG A;  2RQS A;  2PV3 A;  2ZR6 A;  2ETN A;  4JFJ A;  1FKS A;  4DRH A;  2ZQV A;  4TX0 A;  4XAK A;  2XP5 A;  1H0I A;  1JNE A;  2RUD A;  4IT4 A;  2M08 A;  4HBE A;  2LGO A;  1N1A A;  1LG2 A;  3ARW A;  4W9P A;  2WM0 A;  2ZQU A;  2YBU A;  3ARP A;  3KAI A;  3ARU A;  4P8W A;  3UF8 A;  1J4R A;  1WB0 A;  4Z2L A;  1W1T A;  1JCH B;  2RUQ A;  3WQV A;  1TFV A;  1WNO A;  1JNS A;  3OA5 A;  1QZ2 A;  4IPX A;  2DSZ A;  1KT0 A;  4Z2G A;  4WJX A;  3UQI A;  1J4I A;  1EIB A;  2DG9 A;  3ARZ A;  3H9R B;  4DWS B;  1NWS A;  1HJV A;  1E9L A;  1NMW A;  2A3E A;  4G50 A;  1FKF A;  3GTY X;  3UI5 A;  2DG4 A;  3KAH A;  4ODO A;  3PRB A;  2KGJ A;  1GUV A;  2F4E A;  4W9O A;  3WD3 A;  1UR9 A;  3ARO A;  4P8X A;  5I98 A;  3B9E A;  3O5L A;  3O5I A;  3B9A A;  3O5P A;  2A3A A;  3CHD A;  4QZV B;  1PIN A;  4MTV A;  4W9Q A;  2Y78 A;  3ARY A;  4ZPV R;  5HW6 A;  4UDM A;  3CHF A;  1FD9 A;  3UQB A;  1HKJ A;  4DZ2 A;  1L1P A;  1W1P A;  2N87 A;  3O5G A;  3B9D A;  1E15 A;  1O6I A;  1NWT A;  4Q22 A;  3WKZ A;  2F23 A;  1HKI A;  2RUR A;  2FDM A;  1D7H A;  4NSB A;  1WAW A;  1KFW A;  1Q6H A;  1W9P A;  2WLY A;  5DIU A;  3KZ7 A;  2G8Z A;  4TW7 A;  5HTG A;  2LKN A;  4DRO A;  2O92 A;  1LQ0 A;  4P8V A;  1E6P A;  3CHC A;  3B7X A;  1U79 A;  4ZS6 A;  3UI4 A;  3PRD A;  4R5E A;  2JZV A;  4DRI A;  1EHN A;  4Z2I A;  2ZR5 A;  1HJX A;  2KI3 A;  1K9T A;  1Q6I A;  4S3K A;  1LL6 A;  1X6N A;  4HAR A;  4HBO A;  1W9U A;  2O9O A;  1XHG A;  2DPE A;  1W1Y A;  5B8I C;  4QT2 A;  4DRN A;  2XP4 A;  3W4R A;  4ODQ A;  4R0X A;  4Z2K A;  5GPG A;  3BXW A;  1D6O A;  4Q7N A;  2M1I A;  4ODR A;  1ZB5 A;  2XPA A;  4MNL A;  5GPR A;  3WL0 A;  1R9H A;  1ZL1 A;  5D75 A;  4LAW A;  1HJW A;  4BF8 A;  3UQA A;  1FKL A;  1FKI A;  4N19 A;  4ODP A;  1FKG A;  1Q6U A;  2YBT A;  3CZ8 A;  4DRJ A;  4JFL A;  4WKF A;  2AWG A;  4L3N A;  1J4H A;  3ARQ A;  1Y0O A;  1T11 A;  2PPO A;  3CGN A;  2ZR4 A;  2WK2 A;  1ZBC A;  2ITK A;  2RUC A;  4WKH A;  1BL4 A;  4ODL A;  3KCE A;  3AS0 A;  5HWB A;  2LJ4 A;  2KE0 A;  1W26 A;  3B8S A;  1HXV A;  1E6N A; 
#chains in the Genus database with same CATH homology
 1F8A B;  4DWS A;  1TCO C;  2DT1 A;  4MNJ A;  1KT1 A;  1QPF A;  1OGB A;  3ARS A;  4DRM A;  3WH0 A;  1OGG A;  4KQZ A;  1W1V A;  2PBC A;  3O5Q A;  1ROT A;  3NTP A;  1ZK6 A;  3FXY A;  3RGC A;  5JH8 A;  3FY1 A;  4DT4 A;  2PV2 A;  1IX5 A;  3O5F A;  2UZ5 A;  1J6Y A;  1UR8 A;  4Z2J A;  3G6L A;  3O5E A;  4TNS A;  3I6C A;  3KAC A;  3JXV A;  5HT1 A;  5J6E A;  1GOI A;  1C9H A;  1W9V A;  3TDB A;  1NMV A;  2AOS A;  4ML4 A;  4IQ2 A;  3IKD A;  1E6Z A;  4DRP A;  1NWU A;  2DSW A;  4C02 B;  3ALG A;  3PR9 A;  1D7J A;  4MAV A;  3G6M A;  3WD2 A;  1ZU8 A;  3ALF A;  4J4O A;  4S3J A;  1LG1 A;  4DWS D;  4L72 B;  3LUO A;  2KO7 A;  3RM4 A;  1FKJ A;  1A7X A;  2DSU A;  4ODN A;  1ZCN A;  1M5Y A;  4Z2H A;  1CTN A;  3O5D A;  1XRV A;  4P8U A;  4IT6 A;  1BKF A;  3RME A;  2MF9 A;  2DT2 A;  4TYO A;  2D9F A;  2F21 A;  4JFM A;  2MLX A;  2PI6 A;  3TC5 A;  4U86 A;  1ROU A;  3ART A;  4NNR A;  1FKK A;  4U85 A;  2QF8 A;  4ODK A;  2MNT A;  3KAG A;  5BXJ A;  4MNK A;  3ARX A;  2G41 A;  4MPK A;  3WQW A;  3IHZ A;  3VAW A;  1LJY A;  4O2T A;  4QT3 A;  5HWC A;  2PV1 A;  5DF0 A;  1X6L A;  1QPL A;  4G2P A;  4PTM A;  1D7I A;  2PPN A;  4FN2 A;  4IQC A;  1PBK A;  3JYJ A;  4TW6 A;  3ARR A;  2FAP A;  2KR7 A;  4JFI A;  4NZC A;  5DIV A;  4DIP A;  2K8I A;  4JYS A;  1GPF A;  3O5K A;  4JFK A;  2XP9 A;  3KAF A;  5DEZ A;  4DRQ A;  3EY6 A;  2FKE A;  3WD4 A;  4LAX A;  2A3B A;  3AS3 A;  3RM8 A;  4DRK A;  2OFN A;  2B31 A;  2RSE A;  3CH9 A;  3WD1 A;  3FAP A;  4FAP A;  2PPP A;  3RM9 A;  1FKR A;  3AS1 A;  5HKG A;  3ARV A;  3PRA A;  4ITZ A;  2DSV A;  3O5R A;  4AY1 A;  4TW8 A;  1FKD A;  1FFQ A;  4WK9 A;  2LPV A;  4DH0 A;  4ODM A;  1JNT A;  1Q1C A;  3O5J A;  1ZBW A;  4ZPT R;  1EYM A;  3CGM A;  3AS2 A;  4ZPW R;  2WLZ A;  3IK8 A;  3QOK A;  4GIV A;  4MNM A;  3WL1 A;  1JND A;  3IKG A;  1B6C A;  4U84 A;  3MDY B;  1FFR A;  4LAY A;  3NRK A;  2ZQT A;  2F2D A;  1RD6 A;  2MLZ A;  5DO2 A;  1FJD A;  2DT0 A;  2IF4 A;  3AQU A;  5HW7 A;  2MLY A;  4LGX A;  4LAV A;  1ZBK A;  2ZQS A;  2VCD A;  1P5Q A;  2XP7 A;  1FKH A;  4KR0 B;  1LL4 A;  3WIJ A;  1FKB A;  4GGQ A;  1NWR A;  4QIB A;  1YAT A;  3O5M A;  1HKM A;  2Q5A A;  3ODK A;  4J4N A;  3O5O A;  3KAD A;  2ESC A;  1E6R A;  2XP6 A;  4DWS C;  1LL7 A;  3KAB A;  2L2S A;  3JYM A;  4W5U A;  1JVW A;  5HW8 A;  1ITX A;  2VN1 A;  3GPK A;  2A3C A;  2DT3 A;  1EQ3 A;  1SYT A;  1FKT A;  1SR0 A;  2OLH A;  1FAP A;  2XP3 A;  4MGV A;  3TCZ A;  1YW5 A;  2M2A A;  5HUA A;  4MSP A;  3NI6 A;  2KFW A;  4URI A;  3PA7 A;  5GQB A;  5DIT A;  1D2K A;  4DZ3 A;  5HBF A;  2IUZ A;  1H0G A;  1NH6 A;  3OOB A;  2XP8 A;  4WKA A;  1F40 A;  1EDQ A;  1HKK A;  4WIW A;  3UI6 A;  2XPB A;  1ZBV A;  1VF8 A;  2DG3 A;  1OWQ A;  2MPH A;  3WD0 A;  3RFW A;  3CHE A;  1NSG A;  2RQS A;  2PV3 A;  2ZR6 A;  4JFJ A;  1FKS A;  4DRH A;  2ZQV A;  4TX0 A;  4XAK A;  2XP5 A;  1H0I A;  1JNE A;  2RUD A;  4IT4 A;  2M08 A;  4HBE A;  2LGO A;  1N1A A;  1LG2 A;  3ARW A;  4W9P A;  2WM0 A;  2ZQU A;  2YBU A;  3ARP A;  3KAI A;  3ARU A;  4P8W A;  3UF8 A;  1J4R A;  1WB0 A;  4Z2L A;  1W1T A;  2RUQ A;  3WQV A;  1TFV A;  1WNO A;  1JNS A;  3OA5 A;  1QZ2 A;  4IPX A;  2DSZ A;  1KT0 A;  4Z2G A;  4WJX A;  3UQI A;  1J4I A;  1EIB A;  2DG9 A;  3ARZ A;  3H9R B;  4DWS B;  1NWS A;  1HJV A;  1E9L A;  1NMW A;  2A3E A;  4G50 A;  1FKF A;  3UI5 A;  2DG4 A;  3KAH A;  4ODO A;  3PRB A;  2KGJ A;  1GUV A;  2F4E A;  4W9O A;  3WD3 A;  1UR9 A;  3ARO A;  4P8X A;  5I98 A;  3B9E A;  3O5L A;  3O5I A;  3B9A A;  3O5P A;  2A3A A;  3CHD A;  4QZV B;  1PIN A;  4MTV A;  4W9Q A;  2Y78 A;  3ARY A;  4ZPV R;  5HW6 A;  3CHF A;  1FD9 A;  3UQB A;  1HKJ A;  4DZ2 A;  1L1P A;  1W1P A;  2N87 A;  3O5G A;  3B9D A;  1E15 A;  1O6I A;  1NWT A;  4Q22 A;  3WKZ A;  1HKI A;  2RUR A;  2FDM A;  1D7H A;  4NSB A;  1WAW A;  1KFW A;  1Q6H A;  1W9P A;  2WLY A;  5DIU A;  3KZ7 A;  2G8Z A;  4TW7 A;  5HTG A;  2LKN A;  4DRO A;  2O92 A;  1LQ0 A;  4P8V A;  1E6P A;  3CHC A;  3B7X A;  1U79 A;  4ZS6 A;  3UI4 A;  3PRD A;  4R5E A;  2JZV A;  4DRI A;  1EHN A;  4Z2I A;  2ZR5 A;  1HJX A;  2KI3 A;  1K9T A;  1Q6I A;  4S3K A;  1LL6 A;  1X6N A;  4HAR A;  4HBO A;  1W9U A;  2O9O A;  1XHG A;  2DPE A;  1W1Y A;  5B8I C;  4QT2 A;  4DRN A;  2XP4 A;  3W4R A;  4ODQ A;  4R0X A;  4Z2K A;  5GPG A;  3BXW A;  1D6O A;  4Q7N A;  2M1I A;  4ODR A;  1ZB5 A;  2XPA A;  4MNL A;  5GPR A;  3WL0 A;  1R9H A;  1ZL1 A;  5D75 A;  4LAW A;  1HJW A;  4BF8 A;  3UQA A;  1FKL A;  1FKI A;  4N19 A;  4ODP A;  1FKG A;  1Q6U A;  2YBT A;  3CZ8 A;  4DRJ A;  4JFL A;  4WKF A;  2AWG A;  4L3N A;  1J4H A;  3ARQ A;  1Y0O A;  1T11 A;  2PPO A;  3CGN A;  2ZR4 A;  2WK2 A;  1ZBC A;  2ITK A;  2RUC A;  4WKH A;  1BL4 A;  4ODL A;  3KCE A;  3AS0 A;  5HWB A;  2LJ4 A;  2KE0 A;  1W26 A;  3B8S A;  1HXV A;  1E6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...