1BKFA

Fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Conformation of Fk506 in X-Ray Structures of its Complexes with Human Recombinant Fkbp12 Mutants
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bkfA00
1PINA 2XPBA 5HT1A 4IQCA 2ZQVA 4DZ2A 5HTGA 1FKDA 1JVWA 2KR7A 2M1IA 1A7XA 4ODQA 2XPAA 4C02B 4G2PA 2DG3A 2MF9A 1D7HA 3MDYB 3O5FA 3UQBA 2ZQTA 3KAGA 4N19A 2XP8A 2ITKA 1Q6IA 5HWBA 4J4OA 3LUOA 5DITA 2XP4A 4W9QA 1Q6HA 4LAVA 1N1AA 5HW7A 2PV2A 4TX0A 2OFNA 1P5QA 5HW8A 3PRBA 2Y78A 3IKGA 2D9FA 2F4EA 4ODPA 1J4IA 2UZ5A 2KE0A 2PV3A 5B8IC 4GIVA 2XP9A 1TCOC 2LJ4A 3O5LA 1EQ3A 1F40A 3H9RB 1B6CA 3O5EA 3TDBA 1HXVA 4DIPA 1FKIA 1KT1A 1YATA 3IHZA 3O5MA 4R0XA 3JYJA 3IK8A 3O5PA 3WH0A 4LAYA 3OOBA 4TW8A 5HW6A 4JFKA 1ZK6A 3CGMA 2ZQUA 1KT0A 2RQSA 4QT2A 1PBKA 1L1PA 1FKKA 5DIUA 2RUCA 2ZR6A 1NMWA 3FAPA 3NTPA 5D75A 5I98A 2PBCA 2PV1A 3O5RA 2RUQA 1QPFA 3KZ7A 2KO7A 3IKDA 1FKLA 1R9HA 3O5JA 2MLXA 4ODNA 2N87A 2DG4A 2PPPA 3NRKA 4U85A 3I6CA 1U79A 4FAPA 4DRNA 2MLZA 3KAIA 1FKHA 4DROA 1JNTA 1T11A 3GPKA 2RUDA 4ODRA 4QIBA 3O5GA 3O5QA 3UF8A 4JFIA 2M2AA 1ROTA 1FKJA 3KADA 3ODKA 4JYSA 3PRDA 1EYMA 4TW7A 2DG9A 4J4NA 1Q6UA 4JFLA 3TCZA 3KAFA 3NI6A 3RFWA 3UI4A 4U86A 2MPHA 4MSPA 3O5IA 4TW6A 2PPNA 3RGCA 1ZCNA 2MLYA 4ODKA 1J6YA 1YW5A 4DRQA 2LKNA 1JNSA 3O5KA 2F21A 2AWGA 4DRPA 4W9OA 1NSGA 2F2DA 4G50A 3O5OA 1FJDA 2VCDA 4O2TA 3O5DA 1D7JA 5DIVA 4MGVA 5HUAA 1QZ2A 1QPLA 1Q1CA 1FKGA 3B7XA 4JFMA 4LAXA 5HKGA 2KI3A 2M08A 5BXJA 4DRIA 3TC5A 1FD9A 4ODMA 2FKEA 4U84A 4IPXA 2K8IA 3KCEA 1F8AB 2LPVA 4TYOA 2IF4A 1FKSA 4IQ2A 4TNSA 2JZVA 3KAHA 3KACA 2FAPA 1NMVA 4GGQA 3CGNA 1M5YA 4DT4A 1Y0OA 4DZ3A 4DRJA 2ZQSA 3JYMA 5J6EA 1W26A 1BL4A 1FKTA 3UI5A 2L2SA 2KFWA 1FKRA 4JFJA 2RSEA 3UQIA 1D6OA 2LGOA 2Q5AA 4DRMA 2PPOA 2MNTA 3VAWA 1J4RA 3UQAA 1C9HA 5HWCA 3JXVA 1D7IA 4DRKA 1J4HA 1FKFA 2XP7A 4ODLA 1FAPA 2RURA 4NNRA 2XP6A 4ITZA 2XP5A 3PA7A 4LAWA 4ODOA 4QT3A 4W9PA 2XP3A 1ROUA 4FN2A 2ZR4A 1FKBA 2VN1A 3UI6A 1BKFA 3EY6A 3KABA 5GPGA 2KGJA 4DRHA 4BF8A 4DH0A 2ZR5A
chains in the Genus database with same CATH superfamily
4IQCA 4L3NA 2ZQVA 2A3BA 5HTGA 2OLHA 2M1IA 3CZ8A 1GUVA 2MF9A 1D7HA 3B9EA 3FY1A 3QOKA 3WQWA 3OA5A 2O92A 4J4OA 3LUOA 4P8XA 4W9QA 5HW7A 4Q22A 4TX0A 2OFNA 1EDQA 3IKGA 1J4IA 1ZBCA 4LGXA 2XP9A 2LJ4A 3H9RB 3TDBA 3JYJA 3IK8A 4IT4A 2YBTA 1KFWA 1EIBA 1ZU8A 1KT0A 1PBKA 2ZR6A 1ZB5A 3CHEA 5D75A 2RUQA 3IKDA 1FKLA 1R9HA 3O5JA 1LG1A 4ODNA 2PPPA 1U79A 4Z2GA 4DRNA 4DROA 2A3AA 2WLZA 2PN0A 3CHCA 3RMEA 1EYMA 4JFLA 1LJYA 4U86A 2MPHA 4MNKA 1ZCNA 1J6YA 4P8UA 2LKNA 1JNSA 2F21A 4DRPA 4ML4A 4ZPVR 5DIVA 4QZVB 1QZ2A 4JFMA 3TC5A 2K8IA 2AOSA 1FKSA 3B9DA 2B5UB 4DRJA 2ZQSA 1BL4A 2ETNA 2KFWA 4JFJA 2WK2A 2PPOA 4DWSB 1LL4A 3CHFA 1K9TA 1UR9A 1W1TA 1X6LA 2FDMA 4ODLA 1E9LA 2RURA 4NNRA 2XP5A 1W9UA 1ROUA 4DRHA 4DH0A 2ZR5A 2F23A 4WK9A 2WLYA 5HT1A 2QF8A 1JVWA 4ODQA 4DWSA 4DWSD 2XPAA 3W4RA 4AY1A 3MDYB 4WIWA 2ZQTA 4N19A 2XP8A 5HWBA 2XP4A 1GRJA 1OGGA 1N1AA 3WD1A 1P5QA 4MAVA 1JNEA 1ZBWA 2F4EA 2UZ5A 3ARUA 1B6CA 2YBUA 1HXVA 4DIPA 4WJXA 1KT1A 1YATA 4R0XA 4IT6A 3B9AA 3ARXA 3OOBA 4P8VA 4JFKA 1WNOA 1ZK6A 1VF8A 4QT2A 1LL7A 5DIUA 2RUCA 4WKHA 3ARWA 1LG2A 1NWTA 1OGBA 2ESCA 2N87A 2DG4A 4U85A 3I6CA 4FAPA 4Z2LA 1JCHB 1FKHA 3WIJA 1T11A 4JFIA 4S3KA 4Z2KA 4W5UA 3ODKA 3CHDA 4TW7A 4J4NA 1Q6UA 3AS1A 3KAFA 3ARZA 1YW5A 3ARTA 3WL1A 4Z2JA 3CH9A 2DPEA 3WQVA 4G50A 2EULA 3ARVA 1HJWA 4R5EA 1QPLA 1Q1CA 3B7XA 1HJXA 4LAXA 4KR0B 5BXJA 3RM4A 4ODMA 4U84A 3WD2A 2DT3A 3KCEA 4TYOA 4IQ2A 4TNSA 3KACA 4GGQA 3CGNA 1OWQA 1Y0OA 3G6LA 4WKFA 3WD4A 3UQIA 1D6OA 2Q5AA 2PI6A 4MTVA 4WKAA 1J4RA 1E6ZA 5JH8A 3JXVA 1LL6A 3GU0A 4ITZA 4ODOA 4LAWA 4FN2A 3ARPA 1BKFA 5GPGA 3KABA 2A3CA 1HKMA 1PINA 4DZ2A 5GPRA 1W9PA 1A7XA 1TFVA 4C02B 1HKKA 1GOIA 2DG3A 1LQ0A 4HBEA 1W9VA 1E15A 4ZPWR 3BXWA 4PTMA 2PV2A 5HW8A 1NWSA 3PRBA 2D9FA 4ODPA 2KE0A 2PV3A 4GIVA 1TCOC 3O5LA 1F40A 1ZBKA 4HBOA 1FKIA 3IHZA 3O5MA 4L72B 3WH0A 4DT4A 2G41A 3O5PA 4TW8A 2DT2A 5HW6A 3ARQA 3WKZA 1IX5A 2ZQUA 2RQSA 1E6NA 3WD0A 1L1PA 2DSVA 2O9OA 4URIA 1HJVA 1H0GA 3NTPA 4UDMA 5I98A 2IUZA 3O5RA 1QPFA 3KZ7A 3ARSA 1RD6A 1XHGA 2KO7A 3BMBA 3WD3A 3NRKA 1JNTA 4MNLA 2RUDA 4ODRA 4QIBA 3UF8A 1ROTA 3KADA 1EHNA 3UI4A 3NI6A 3AROA 4MSPA 3O5IA 4TW6A 1NWRA 4MNJA 2PPNA 4DRQA 3O5KA 1ZL1A 4MNMA 1NSGA 3ARYA 2F2DA 1FJDA 4DWSC 2VCDA 1D7JA 4MGVA 5HUAA 1H0IA 1FKGA 3ALGA 2DT0A 5HKGA 2DT1A 2KI3A 4DRIA 1FD9A 3AQUA 1HKIA 2WM0A 1F8AB 4ZPTR 1W1PA 1NH6A 1HKJA 2JZVA 1ITXA 1WAWA 2FAPA 1NMVA 1M5YA 1O6IA 5DF0A 5J6EA 1FKRA 2RSEA 2P4VA 2LGOA 4P8WA 4DRMA 5HBFA 1WB0A 1C9HA 5HWCA 4DRKA 5DEZA 1FFQA 2XP6A 4QT3A 4W9PA 2XP3A 3UI6A 3ARRA 4BF8A 2XPBA 1FKDA 1W1VA 2KR7A 4G2PA 3PR9A 3O5FA 3UQBA 3KAGA 1D2KA 2ITKA 1Q6IA 2DSUA 3RM9A 5DITA 1Q6HA 1E44A 4LAVA 1E6PA 1SYTA 2Y78A 1NWUA 5B8IC 1EQ3A 3O5EA 4HARA 3FXYA 4LAYA 3CGMA 1FKKA 3AS0A 1X6NA 1NMWA 2DSZA 3FAPA 2PBCA 2PV1A 5DO2A 4Z2IA 2MLXA 1JNDA 2MLZA 3KAIA 2A3EA 3GPKA 3O5GA 3O5QA 2M2AA 1FKJA 3PRAA 3AS3A 1FFRA 4JYSA 4NZCA 3PRDA 5GQBA 2DG9A 3TCZA 3RFWA 4S3JA 1GPFA 3B8SA 3RGCA 4MPKA 2MLYA 4ODKA 2G8ZA 2AWGA 4W9OA 1CTNA 3O5OA 1E6RA 2DSWA 4O2TA 1ZBVA 3G6MA 3O5DA 4XAKA 3EIPA 4Z2HA 4KQZA 2M08A 2FKEA 4IPXA 2LPVA 4NSBA 2IF4A 1SR0A 3KAHA 1W1YA 1UR8A 4DZ3A 3JYMA 1W26A 3UI5A 1FKTA 2L2SA 4ZS6A 1XRVA 2MNTA 3VAWA 3UQAA 3ALFA 4Q7NA 1D7IA 1J4HA 1FKFA 2XP7A 1FAPA 3GTYX 3WL0A 2B31A 3PA7A 3RM8A 3AS2A 2ZR4A 1FKBA 2VN1A 3EY6A 2KGJA
chains in the Genus database with same CATH topology
4IQCA 4L3NA 2ZQVA 2A3BA 5HTGA 2OLHA 2M1IA 3CZ8A 1GUVA 2MF9A 1D7HA 3B9EA 3FY1A 3QOKA 3WQWA 3OA5A 2O92A 4J4OA 3LUOA 4P8XA 4W9QA 5HW7A 4Q22A 4TX0A 2OFNA 1EDQA 3IKGA 1J4IA 1ZBCA 4LGXA 2XP9A 2LJ4A 3H9RB 3TDBA 3JYJA 3IK8A 4IT4A 2YBTA 1KFWA 1EIBA 1ZU8A 1KT0A 1PBKA 2ZR6A 1ZB5A 3CHEA 5D75A 2RUQA 3IKDA 1FKLA 1R9HA 3O5JA 1LG1A 4ODNA 2PPPA 1U79A 4Z2GA 4DRNA 4DROA 2A3AA 2WLZA 3CHCA 3RMEA 1EYMA 4JFLA 1LJYA 4U86A 2MPHA 4MNKA 1ZCNA 1J6YA 4P8UA 2LKNA 1JNSA 2F21A 4DRPA 4ML4A 4ZPVR 5DIVA 4QZVB 1QZ2A 4JFMA 3TC5A 2K8IA 2AOSA 1FKSA 3B9DA 4DRJA 2ZQSA 1BL4A 2KFWA 4JFJA 2WK2A 2PPOA 4DWSB 1LL4A 3CHFA 1K9TA 1UR9A 1W1TA 1X6LA 2FDMA 4ODLA 1E9LA 2RURA 4NNRA 2XP5A 1W9UA 1ROUA 4DRHA 4DH0A 2ZR5A 4WK9A 2WLYA 5HT1A 2QF8A 1JVWA 4ODQA 4DWSA 4DWSD 2XPAA 3W4RA 4AY1A 3MDYB 4WIWA 2ZQTA 4N19A 2XP8A 5HWBA 2XP4A 1OGGA 1N1AA 3WD1A 1P5QA 4MAVA 1JNEA 1ZBWA 2F4EA 2UZ5A 3ARUA 1B6CA 2YBUA 1HXVA 4DIPA 4WJXA 1KT1A 1YATA 4R0XA 4IT6A 3B9AA 3ARXA 3OOBA 4P8VA 4JFKA 1WNOA 1ZK6A 1VF8A 4QT2A 1LL7A 5DIUA 2RUCA 4WKHA 3ARWA 1LG2A 1NWTA 1OGBA 2ESCA 2N87A 2DG4A 4U85A 3I6CA 4FAPA 4Z2LA 1FKHA 3WIJA 1T11A 4JFIA 4S3KA 4Z2KA 4W5UA 3ODKA 3CHDA 4TW7A 4J4NA 1Q6UA 3AS1A 3KAFA 3ARZA 1YW5A 3ARTA 3WL1A 4Z2JA 3CH9A 2DPEA 3WQVA 4G50A 3ARVA 1HJWA 4R5EA 1QPLA 1Q1CA 3B7XA 1HJXA 4LAXA 4KR0B 5BXJA 3RM4A 4ODMA 4U84A 3WD2A 2DT3A 3KCEA 4TYOA 4IQ2A 4TNSA 3KACA 4GGQA 3CGNA 1OWQA 1Y0OA 3G6LA 4WKFA 3WD4A 3UQIA 1D6OA 2Q5AA 2PI6A 4MTVA 4WKAA 1J4RA 1E6ZA 5JH8A 3JXVA 1LL6A 4ITZA 4ODOA 4LAWA 4FN2A 3ARPA 1BKFA 5GPGA 3KABA 2A3CA 1HKMA 1PINA 4DZ2A 5GPRA 1W9PA 1A7XA 1TFVA 4C02B 1HKKA 1GOIA 2DG3A 1LQ0A 4HBEA 1W9VA 1E15A 4ZPWR 3BXWA 4PTMA 2PV2A 5HW8A 1NWSA 3PRBA 2D9FA 4ODPA 2KE0A 2PV3A 4GIVA 1TCOC 3O5LA 1F40A 1ZBKA 4HBOA 1FKIA 3IHZA 3O5MA 4L72B 3WH0A 4DT4A 2G41A 3O5PA 4TW8A 2DT2A 5HW6A 3ARQA 3WKZA 1IX5A 2ZQUA 2RQSA 1E6NA 3WD0A 1L1PA 2DSVA 2O9OA 4URIA 1HJVA 3NTPA 1H0GA 5I98A 2IUZA 3O5RA 1QPFA 3KZ7A 3ARSA 1RD6A 1XHGA 2KO7A 3WD3A 3NRKA 1JNTA 4MNLA 2RUDA 4ODRA 4QIBA 3UF8A 1ROTA 3KADA 1EHNA 3UI4A 3NI6A 3AROA 4MSPA 3O5IA 4TW6A 1NWRA 4MNJA 2PPNA 4DRQA 3O5KA 1ZL1A 4MNMA 1NSGA 3ARYA 2F2DA 1FJDA 4DWSC 2VCDA 1D7JA 4MGVA 5HUAA 1H0IA 1FKGA 3ALGA 2DT0A 5HKGA 2DT1A 2KI3A 4DRIA 1FD9A 3AQUA 1HKIA 2WM0A 1F8AB 4ZPTR 1W1PA 1NH6A 1HKJA 2JZVA 1ITXA 1WAWA 2FAPA 1NMVA 1M5YA 1O6IA 5DF0A 5J6EA 1FKRA 2RSEA 2LGOA 4P8WA 4DRMA 5HBFA 1WB0A 1C9HA 5HWCA 4DRKA 5DEZA 1FFQA 2XP6A 4QT3A 4W9PA 2XP3A 3UI6A 3ARRA 4BF8A 2XPBA 1FKDA 1W1VA 2KR7A 4G2PA 3PR9A 3O5FA 3UQBA 3KAGA 1D2KA 2ITKA 1Q6IA 2DSUA 3RM9A 5DITA 1Q6HA 4LAVA 1E6PA 1SYTA 2Y78A 1NWUA 5B8IC 1EQ3A 3O5EA 4HARA 3FXYA 4LAYA 3CGMA 1FKKA 3AS0A 1X6NA 1NMWA 2DSZA 3FAPA 2PBCA 2PV1A 5DO2A 4Z2IA 2MLXA 1JNDA 2MLZA 3KAIA 2A3EA 3GPKA 3O5GA 3O5QA 2M2AA 1FKJA 3PRAA 3AS3A 1FFRA 4JYSA 4NZCA 3PRDA 5GQBA 2DG9A 3TCZA 3RFWA 4S3JA 1GPFA 3B8SA 3RGCA 4MPKA 2MLYA 4ODKA 2G8ZA 2AWGA 4W9OA 1CTNA 3O5OA 1E6RA 2DSWA 4O2TA 1ZBVA 3G6MA 3O5DA 4XAKA 4Z2HA 4KQZA 2M08A 2FKEA 4IPXA 2LPVA 4NSBA 2IF4A 1SR0A 3KAHA 1W1YA 1UR8A 4DZ3A 3JYMA 1W26A 3UI5A 1FKTA 2L2SA 4ZS6A 1XRVA 2MNTA 3VAWA 3UQAA 3ALFA 4Q7NA 1D7IA 1J4HA 1FKFA 2XP7A 1FAPA 3WL0A 2B31A 3PA7A 3RM8A 3AS2A 2ZR4A 1FKBA 2VN1A 3EY6A 2KGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  2XPB A;  5HT1 A;  4IQC A;  2ZQV A;  4DZ2 A;  5HTG A;  1FKD A;  1JVW A;  2KR7 A;  2M1I A;  1A7X A;  4ODQ A;  2XPA A;  4C02 B;  4G2P A;  2DG3 A;  2MF9 A;  1D7H A;  3MDY B;  3O5F A;  3UQB A;  2ZQT A;  3KAG A;  4N19 A;  2XP8 A;  2ITK A;  1Q6I A;  5HWB A;  4J4O A;  3LUO A;  5DIT A;  2XP4 A;  4W9Q A;  1Q6H A;  4LAV A;  1N1A A;  5HW7 A;  2PV2 A;  4TX0 A;  2OFN A;  1P5Q A;  5HW8 A;  3PRB A;  2Y78 A;  3IKG A;  2D9F A;  2F4E A;  4ODP A;  1J4I A;  2UZ5 A;  2KE0 A;  2PV3 A;  5B8I C;  4GIV A;  2XP9 A;  1TCO C;  2LJ4 A;  3O5L A;  1EQ3 A;  1F40 A;  3H9R B;  1B6C A;  3O5E A;  3TDB A;  1HXV A;  4DIP A;  1FKI A;  1KT1 A;  1YAT A;  3IHZ A;  3O5M A;  4R0X A;  3JYJ A;  3IK8 A;  3O5P A;  3WH0 A;  4LAY A;  3OOB A;  4TW8 A;  5HW6 A;  4JFK A;  1ZK6 A;  3CGM A;  2ZQU A;  1KT0 A;  2RQS A;  4QT2 A;  1PBK A;  1L1P A;  1FKK A;  5DIU A;  2RUC A;  2ZR6 A;  1NMW A;  3FAP A;  3NTP A;  5D75 A;  5I98 A;  2PBC A;  2PV1 A;  3O5R A;  2RUQ A;  1QPF A;  3KZ7 A;  2KO7 A;  3IKD A;  1FKL A;  1R9H A;  3O5J A;  2MLX A;  4ODN A;  2N87 A;  2DG4 A;  2PPP A;  3NRK A;  4U85 A;  3I6C A;  1U79 A;  4FAP A;  4DRN A;  2MLZ A;  3KAI A;  1FKH A;  4DRO A;  1JNT A;  1T11 A;  3GPK A;  2RUD A;  4ODR A;  4QIB A;  3O5G A;  3O5Q A;  3UF8 A;  4JFI A;  2M2A A;  1ROT A;  1FKJ A;  3KAD A;  3ODK A;  4JYS A;  3PRD A;  1EYM A;  4TW7 A;  2DG9 A;  4J4N A;  1Q6U A;  4JFL A;  3TCZ A;  3KAF A;  3NI6 A;  3RFW A;  3UI4 A;  4U86 A;  2MPH A;  4MSP A;  3O5I A;  4TW6 A;  2PPN A;  3RGC A;  1ZCN A;  2MLY A;  4ODK A;  1J6Y A;  1YW5 A;  4DRQ A;  2LKN A;  1JNS A;  3O5K A;  2F21 A;  2AWG A;  4DRP A;  4W9O A;  1NSG A;  2F2D A;  4G50 A;  3O5O A;  1FJD A;  2VCD A;  4O2T A;  3O5D A;  1D7J A;  5DIV A;  4MGV A;  5HUA A;  1QZ2 A;  1QPL A;  1Q1C A;  1FKG A;  3B7X A;  4JFM A;  4LAX A;  5HKG A;  2KI3 A;  2M08 A;  5BXJ A;  4DRI A;  3TC5 A;  1FD9 A;  4ODM A;  2FKE A;  4U84 A;  4IPX A;  2K8I A;  3KCE A;  1F8A B;  2LPV A;  4TYO A;  2IF4 A;  1FKS A;  4IQ2 A;  4TNS A;  2JZV A;  3KAH A;  3KAC A;  2FAP A;  1NMV A;  4GGQ A;  3CGN A;  1M5Y A;  4DT4 A;  1Y0O A;  4DZ3 A;  4DRJ A;  2ZQS A;  3JYM A;  5J6E A;  1W26 A;  1BL4 A;  1FKT A;  3UI5 A;  2L2S A;  2KFW A;  1FKR A;  4JFJ A;  2RSE A;  3UQI A;  1D6O A;  2LGO A;  2Q5A A;  4DRM A;  2PPO A;  2MNT A;  3VAW A;  1J4R A;  3UQA A;  1C9H A;  5HWC A;  3JXV A;  1D7I A;  4DRK A;  1J4H A;  1FKF A;  2XP7 A;  4ODL A;  1FAP A;  2RUR A;  4NNR A;  2XP6 A;  4ITZ A;  2XP5 A;  3PA7 A;  4LAW A;  4ODO A;  4QT3 A;  4W9P A;  2XP3 A;  1ROU A;  4FN2 A;  2ZR4 A;  1FKB A;  2VN1 A;  3UI6 A;  1BKF A;  3EY6 A;  3KAB A;  5GPG A;  2KGJ A;  4DRH A;  4BF8 A;  4DH0 A;  2ZR5 A; 
#chains in the Genus database with same CATH topology
 4IQC A;  4L3N A;  2ZQV A;  2A3B A;  5HTG A;  2OLH A;  2M1I A;  3CZ8 A;  1GUV A;  2MF9 A;  1D7H A;  3B9E A;  3FY1 A;  3QOK A;  3WQW A;  3OA5 A;  2O92 A;  4J4O A;  3LUO A;  4P8X A;  4W9Q A;  5HW7 A;  4Q22 A;  4TX0 A;  2OFN A;  1EDQ A;  3IKG A;  1J4I A;  1ZBC A;  4LGX A;  2XP9 A;  2LJ4 A;  3H9R B;  3TDB A;  3JYJ A;  3IK8 A;  4IT4 A;  2YBT A;  1KFW A;  1EIB A;  1ZU8 A;  1KT0 A;  1PBK A;  2ZR6 A;  1ZB5 A;  3CHE A;  5D75 A;  2RUQ A;  3IKD A;  1FKL A;  1R9H A;  3O5J A;  1LG1 A;  4ODN A;  2PPP A;  1U79 A;  4Z2G A;  4DRN A;  4DRO A;  2A3A A;  2WLZ A;  2PN0 A;  3CHC A;  3RME A;  1EYM A;  4JFL A;  1LJY A;  4U86 A;  2MPH A;  4MNK A;  1ZCN A;  1J6Y A;  4P8U A;  2LKN A;  1JNS A;  2F21 A;  4DRP A;  4ML4 A;  4ZPV R;  5DIV A;  4QZV B;  1QZ2 A;  4JFM A;  3TC5 A;  2K8I A;  2AOS A;  1FKS A;  3B9D A;  2B5U B;  4DRJ A;  2ZQS A;  1BL4 A;  2ETN A;  2KFW A;  4JFJ A;  2WK2 A;  2PPO A;  4DWS B;  1LL4 A;  3CHF A;  1K9T A;  1UR9 A;  1W1T A;  1X6L A;  2FDM A;  4ODL A;  1E9L A;  2RUR A;  4NNR A;  2XP5 A;  1W9U A;  1ROU A;  4DRH A;  4DH0 A;  2ZR5 A;  2F23 A;  4WK9 A;  2WLY A;  5HT1 A;  2QF8 A;  1JVW A;  4ODQ A;  4DWS A;  4DWS D;  2XPA A;  3W4R A;  4AY1 A;  3MDY B;  4WIW A;  2ZQT A;  4N19 A;  2XP8 A;  5HWB A;  2XP4 A;  1GRJ A;  1OGG A;  1N1A A;  3WD1 A;  1P5Q A;  4MAV A;  1JNE A;  1ZBW A;  2F4E A;  2UZ5 A;  3ARU A;  1B6C A;  2YBU A;  1HXV A;  4DIP A;  4WJX A;  1KT1 A;  1YAT A;  4R0X A;  4IT6 A;  3B9A A;  3ARX A;  3OOB A;  4P8V A;  4JFK A;  1WNO A;  1ZK6 A;  1VF8 A;  4QT2 A;  1LL7 A;  5DIU A;  2RUC A;  4WKH A;  3ARW A;  1LG2 A;  1NWT A;  1OGB A;  2ESC A;  2N87 A;  2DG4 A;  4U85 A;  3I6C A;  4FAP A;  4Z2L A;  1JCH B;  1FKH A;  3WIJ A;  1T11 A;  4JFI A;  4S3K A;  4Z2K A;  4W5U A;  3ODK A;  3CHD A;  4TW7 A;  4J4N A;  1Q6U A;  3AS1 A;  3KAF A;  3ARZ A;  1YW5 A;  3ART A;  3WL1 A;  4Z2J A;  3CH9 A;  2DPE A;  3WQV A;  4G50 A;  2EUL A;  3ARV A;  1HJW A;  4R5E A;  1QPL A;  1Q1C A;  3B7X A;  1HJX A;  4LAX A;  4KR0 B;  5BXJ A;  3RM4 A;  4ODM A;  4U84 A;  3WD2 A;  2DT3 A;  3KCE A;  4TYO A;  4IQ2 A;  4TNS A;  3KAC A;  4GGQ A;  3CGN A;  1OWQ A;  1Y0O A;  3G6L A;  4WKF A;  3WD4 A;  3UQI A;  1D6O A;  2Q5A A;  2PI6 A;  4MTV A;  4WKA A;  1J4R A;  1E6Z A;  5JH8 A;  3JXV A;  1LL6 A;  3GU0 A;  4ITZ A;  4ODO A;  4LAW A;  4FN2 A;  3ARP A;  1BKF A;  5GPG A;  3KAB A;  2A3C A;  1HKM A;  1PIN A;  4DZ2 A;  5GPR A;  1W9P A;  1A7X A;  1TFV A;  4C02 B;  1HKK A;  1GOI A;  2DG3 A;  1LQ0 A;  4HBE A;  1W9V A;  1E15 A;  4ZPW R;  3BXW A;  4PTM A;  2PV2 A;  5HW8 A;  1NWS A;  3PRB A;  2D9F A;  4ODP A;  2KE0 A;  2PV3 A;  4GIV A;  1TCO C;  3O5L A;  1F40 A;  1ZBK A;  4HBO A;  1FKI A;  3IHZ A;  3O5M A;  4L72 B;  3WH0 A;  4DT4 A;  2G41 A;  3O5P A;  4TW8 A;  2DT2 A;  5HW6 A;  3ARQ A;  3WKZ A;  1IX5 A;  2ZQU A;  2RQS A;  1E6N A;  3WD0 A;  1L1P A;  2DSV A;  2O9O A;  4URI A;  1HJV A;  1H0G A;  3NTP A;  4UDM A;  5I98 A;  2IUZ A;  3O5R A;  1QPF A;  3KZ7 A;  3ARS A;  1RD6 A;  1XHG A;  2KO7 A;  3BMB A;  3WD3 A;  3NRK A;  1JNT A;  4MNL A;  2RUD A;  4ODR A;  4QIB A;  3UF8 A;  1ROT A;  3KAD A;  1EHN A;  3UI4 A;  3NI6 A;  3ARO A;  4MSP A;  3O5I A;  4TW6 A;  1NWR A;  4MNJ A;  2PPN A;  4DRQ A;  3O5K A;  1ZL1 A;  4MNM A;  1NSG A;  3ARY A;  2F2D A;  1FJD A;  4DWS C;  2VCD A;  1D7J A;  4MGV A;  5HUA A;  1H0I A;  1FKG A;  3ALG A;  2DT0 A;  5HKG A;  2DT1 A;  2KI3 A;  4DRI A;  1FD9 A;  3AQU A;  1HKI A;  2WM0 A;  1F8A B;  4ZPT R;  1W1P A;  1NH6 A;  1HKJ A;  2JZV A;  1ITX A;  1WAW A;  2FAP A;  1NMV A;  1M5Y A;  1O6I A;  5DF0 A;  5J6E A;  1FKR A;  2RSE A;  2P4V A;  2LGO A;  4P8W A;  4DRM A;  5HBF A;  1WB0 A;  1C9H A;  5HWC A;  4DRK A;  5DEZ A;  1FFQ A;  2XP6 A;  4QT3 A;  4W9P A;  2XP3 A;  3UI6 A;  3ARR A;  4BF8 A;  2XPB A;  1FKD A;  1W1V A;  2KR7 A;  4G2P A;  3PR9 A;  3O5F A;  3UQB A;  3KAG A;  1D2K A;  2ITK A;  1Q6I A;  2DSU A;  3RM9 A;  5DIT A;  1Q6H A;  1E44 A;  4LAV A;  1E6P A;  1SYT A;  2Y78 A;  1NWU A;  5B8I C;  1EQ3 A;  3O5E A;  4HAR A;  3FXY A;  4LAY A;  3CGM A;  1FKK A;  3AS0 A;  1X6N A;  1NMW A;  2DSZ A;  3FAP A;  2PBC A;  2PV1 A;  5DO2 A;  4Z2I A;  2MLX A;  1JND A;  2MLZ A;  3KAI A;  2A3E A;  3GPK A;  3O5G A;  3O5Q A;  2M2A A;  1FKJ A;  3PRA A;  3AS3 A;  1FFR A;  4JYS A;  4NZC A;  3PRD A;  5GQB A;  2DG9 A;  3TCZ A;  3RFW A;  4S3J A;  1GPF A;  3B8S A;  3RGC A;  4MPK A;  2MLY A;  4ODK A;  2G8Z A;  2AWG A;  4W9O A;  1CTN A;  3O5O A;  1E6R A;  2DSW A;  4O2T A;  1ZBV A;  3G6M A;  3O5D A;  4XAK A;  3EIP A;  4Z2H A;  4KQZ A;  2M08 A;  2FKE A;  4IPX A;  2LPV A;  4NSB A;  2IF4 A;  1SR0 A;  3KAH A;  1W1Y A;  1UR8 A;  4DZ3 A;  3JYM A;  1W26 A;  3UI5 A;  1FKT A;  2L2S A;  4ZS6 A;  1XRV A;  2MNT A;  3VAW A;  3UQA A;  3ALF A;  4Q7N A;  1D7I A;  1J4H A;  1FKF A;  2XP7 A;  1FAP A;  3GTY X;  3WL0 A;  2B31 A;  3PA7 A;  3RM8 A;  3AS2 A;  2ZR4 A;  1FKB A;  2VN1 A;  3EY6 A;  2KGJ A; 
#chains in the Genus database with same CATH homology
 4IQC A;  4L3N A;  2ZQV A;  2A3B A;  5HTG A;  2OLH A;  2M1I A;  3CZ8 A;  1GUV A;  2MF9 A;  1D7H A;  3B9E A;  3FY1 A;  3QOK A;  3WQW A;  3OA5 A;  2O92 A;  4J4O A;  3LUO A;  4P8X A;  4W9Q A;  5HW7 A;  4Q22 A;  4TX0 A;  2OFN A;  1EDQ A;  3IKG A;  1J4I A;  1ZBC A;  4LGX A;  2XP9 A;  2LJ4 A;  3H9R B;  3TDB A;  3JYJ A;  3IK8 A;  4IT4 A;  2YBT A;  1KFW A;  1EIB A;  1ZU8 A;  1KT0 A;  1PBK A;  2ZR6 A;  1ZB5 A;  3CHE A;  5D75 A;  2RUQ A;  3IKD A;  1FKL A;  1R9H A;  3O5J A;  1LG1 A;  4ODN A;  2PPP A;  1U79 A;  4Z2G A;  4DRN A;  4DRO A;  2A3A A;  2WLZ A;  3CHC A;  3RME A;  1EYM A;  4JFL A;  1LJY A;  4U86 A;  2MPH A;  4MNK A;  1ZCN A;  1J6Y A;  4P8U A;  2LKN A;  1JNS A;  2F21 A;  4DRP A;  4ML4 A;  4ZPV R;  5DIV A;  4QZV B;  1QZ2 A;  4JFM A;  3TC5 A;  2K8I A;  2AOS A;  1FKS A;  3B9D A;  4DRJ A;  2ZQS A;  1BL4 A;  2KFW A;  4JFJ A;  2WK2 A;  2PPO A;  4DWS B;  1LL4 A;  3CHF A;  1K9T A;  1UR9 A;  1W1T A;  1X6L A;  2FDM A;  4ODL A;  1E9L A;  2RUR A;  4NNR A;  2XP5 A;  1W9U A;  1ROU A;  4DRH A;  4DH0 A;  2ZR5 A;  4WK9 A;  2WLY A;  5HT1 A;  2QF8 A;  1JVW A;  4ODQ A;  4DWS A;  4DWS D;  2XPA A;  3W4R A;  4AY1 A;  3MDY B;  4WIW A;  2ZQT A;  4N19 A;  2XP8 A;  5HWB A;  2XP4 A;  1OGG A;  1N1A A;  3WD1 A;  1P5Q A;  4MAV A;  1JNE A;  1ZBW A;  2F4E A;  2UZ5 A;  3ARU A;  1B6C A;  2YBU A;  1HXV A;  4DIP A;  4WJX A;  1KT1 A;  1YAT A;  4R0X A;  4IT6 A;  3B9A A;  3ARX A;  3OOB A;  4P8V A;  4JFK A;  1WNO A;  1ZK6 A;  1VF8 A;  4QT2 A;  1LL7 A;  5DIU A;  2RUC A;  4WKH A;  3ARW A;  1LG2 A;  1NWT A;  1OGB A;  2ESC A;  2N87 A;  2DG4 A;  4U85 A;  3I6C A;  4FAP A;  4Z2L A;  1FKH A;  3WIJ A;  1T11 A;  4JFI A;  4S3K A;  4Z2K A;  4W5U A;  3ODK A;  3CHD A;  4TW7 A;  4J4N A;  1Q6U A;  3AS1 A;  3KAF A;  3ARZ A;  1YW5 A;  3ART A;  3WL1 A;  4Z2J A;  3CH9 A;  2DPE A;  3WQV A;  4G50 A;  3ARV A;  1HJW A;  4R5E A;  1QPL A;  1Q1C A;  3B7X A;  1HJX A;  4LAX A;  4KR0 B;  5BXJ A;  3RM4 A;  4ODM A;  4U84 A;  3WD2 A;  2DT3 A;  3KCE A;  4TYO A;  4IQ2 A;  4TNS A;  3KAC A;  4GGQ A;  3CGN A;  1OWQ A;  1Y0O A;  3G6L A;  4WKF A;  3WD4 A;  3UQI A;  1D6O A;  2Q5A A;  2PI6 A;  4MTV A;  4WKA A;  1J4R A;  1E6Z A;  5JH8 A;  3JXV A;  1LL6 A;  4ITZ A;  4ODO A;  4LAW A;  4FN2 A;  3ARP A;  1BKF A;  5GPG A;  3KAB A;  2A3C A;  1HKM A;  1PIN A;  4DZ2 A;  5GPR A;  1W9P A;  1A7X A;  1TFV A;  4C02 B;  1HKK A;  1GOI A;  2DG3 A;  1LQ0 A;  4HBE A;  1W9V A;  1E15 A;  4ZPW R;  3BXW A;  4PTM A;  2PV2 A;  5HW8 A;  1NWS A;  3PRB A;  2D9F A;  4ODP A;  2KE0 A;  2PV3 A;  4GIV A;  1TCO C;  3O5L A;  1F40 A;  1ZBK A;  4HBO A;  1FKI A;  3IHZ A;  3O5M A;  4L72 B;  3WH0 A;  4DT4 A;  2G41 A;  3O5P A;  4TW8 A;  2DT2 A;  5HW6 A;  3ARQ A;  3WKZ A;  1IX5 A;  2ZQU A;  2RQS A;  1E6N A;  3WD0 A;  1L1P A;  2DSV A;  2O9O A;  4URI A;  1HJV A;  3NTP A;  1H0G A;  5I98 A;  2IUZ A;  3O5R A;  1QPF A;  3KZ7 A;  3ARS A;  1RD6 A;  1XHG A;  2KO7 A;  3WD3 A;  3NRK A;  1JNT A;  4MNL A;  2RUD A;  4ODR A;  4QIB A;  3UF8 A;  1ROT A;  3KAD A;  1EHN A;  3UI4 A;  3NI6 A;  3ARO A;  4MSP A;  3O5I A;  4TW6 A;  1NWR A;  4MNJ A;  2PPN A;  4DRQ A;  3O5K A;  1ZL1 A;  4MNM A;  1NSG A;  3ARY A;  2F2D A;  1FJD A;  4DWS C;  2VCD A;  1D7J A;  4MGV A;  5HUA A;  1H0I A;  1FKG A;  3ALG A;  2DT0 A;  5HKG A;  2DT1 A;  2KI3 A;  4DRI A;  1FD9 A;  3AQU A;  1HKI A;  2WM0 A;  1F8A B;  4ZPT R;  1W1P A;  1NH6 A;  1HKJ A;  2JZV A;  1ITX A;  1WAW A;  2FAP A;  1NMV A;  1M5Y A;  1O6I A;  5DF0 A;  5J6E A;  1FKR A;  2RSE A;  2LGO A;  4P8W A;  4DRM A;  5HBF A;  1WB0 A;  1C9H A;  5HWC A;  4DRK A;  5DEZ A;  1FFQ A;  2XP6 A;  4QT3 A;  4W9P A;  2XP3 A;  3UI6 A;  3ARR A;  4BF8 A;  2XPB A;  1FKD A;  1W1V A;  2KR7 A;  4G2P A;  3PR9 A;  3O5F A;  3UQB A;  3KAG A;  1D2K A;  2ITK A;  1Q6I A;  2DSU A;  3RM9 A;  5DIT A;  1Q6H A;  4LAV A;  1E6P A;  1SYT A;  2Y78 A;  1NWU A;  5B8I C;  1EQ3 A;  3O5E A;  4HAR A;  3FXY A;  4LAY A;  3CGM A;  1FKK A;  3AS0 A;  1X6N A;  1NMW A;  2DSZ A;  3FAP A;  2PBC A;  2PV1 A;  5DO2 A;  4Z2I A;  2MLX A;  1JND A;  2MLZ A;  3KAI A;  2A3E A;  3GPK A;  3O5G A;  3O5Q A;  2M2A A;  1FKJ A;  3PRA A;  3AS3 A;  1FFR A;  4JYS A;  4NZC A;  3PRD A;  5GQB A;  2DG9 A;  3TCZ A;  3RFW A;  4S3J A;  1GPF A;  3B8S A;  3RGC A;  4MPK A;  2MLY A;  4ODK A;  2G8Z A;  2AWG A;  4W9O A;  1CTN A;  3O5O A;  1E6R A;  2DSW A;  4O2T A;  1ZBV A;  3G6M A;  3O5D A;  4XAK A;  4Z2H A;  4KQZ A;  2M08 A;  2FKE A;  4IPX A;  2LPV A;  4NSB A;  2IF4 A;  1SR0 A;  3KAH A;  1W1Y A;  1UR8 A;  4DZ3 A;  3JYM A;  1W26 A;  3UI5 A;  1FKT A;  2L2S A;  4ZS6 A;  1XRV A;  2MNT A;  3VAW A;  3UQA A;  3ALF A;  4Q7N A;  1D7I A;  1J4H A;  1FKF A;  2XP7 A;  1FAP A;  3WL0 A;  2B31 A;  3PA7 A;  3RM8 A;  3AS2 A;  2ZR4 A;  1FKB A;  2VN1 A;  3EY6 A;  2KGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...