1BKFA

Fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDKNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformation of Fk506 in X-Ray Structures of its Complexes with Human Recombinant Fkbp12 Mutants
pubmed rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1bkfA00
1ZCNA 3LUOA 1QPLA 2XP3A 5D75A 1T11A 5DITA 4DIPA 2PV3A 1BL4A 2LPVA 2KO7A 1J6YA 2PPNA 2RSEA 2XPAA 4LAYA 4JFJA 2F2DA 4FAPA 1L1PA 4U85A 4DRIA 4TW8A 3GPKA 2JZVA 3CGMA 4J4OA 5GPGA 1NSGA 1TCOC 4DRQA 2KE0A 2XPBA 3O5LA 2MLZA 1N1AA 4TNSA 4TYOA 1FKKA 5HTGA 3I6CA 4QT3A 1D6OA 4LAVA 3NTPA 2UZ5A 4JYSA 1FKJA 1FAPA 4LAWA 3O5FA 1KT1A 2KR7A 4LAXA 1FKTA 4ODOA 4QT2A 4TW7A 4W9PA 2RUQA 3RFWA 3RGCA 2ZQTA 1QZ2A 1Q6IA 4IQ2A 3O5RA 1Q6UA 1YW5A 1JNTA 4O2TA 3IKGA 4W9OA 5HW6A 3PRDA 5HUAA 2LJ4A 3O5GA 4JFKA 3UI6A 1FKIA 1Q6HA 2MLXA 2RUDA 2Y78A 4JFMA 4BF8A 1Y0OA 3O5JA 3O5OA 3KACA 4JFIA 4QIBA 4DRJA 4DRPA 3JYMA 3KABA 4C02B 4ODNA 2N87A 3B7XA 3IKDA 2Q5AA 4DZ3A 1FKFA 4GIVA 1FKGA 5HKGA 3KAHA 1J4RA 1PBKA 4GGQA 4NNRA 3KAGA 3KAFA 4W9QA 3IK8A 2MLYA 3KCEA 4MGVA 4ODRA 1J4HA 2L2SA 4FN2A 2DG3A 4DRHA 5BXJA 3O5QA 2FAPA 3UQAA 2ZR6A 4G2PA 3VAWA 2RQSA 4U84A 3JYJA 2XP5A 4DZ2A 4ODQA 2VN1A 1D7HA 1HXVA 4G50A 1BKFA 1JVWA 2LGOA 3UQIA 5HWBA 1FKHA 2PPOA 2RUCA 2IF4A 5B8IC 2PV2A 4JFLA 4DH0A 2F21A 4ODMA 2MNTA 4TX0A 4DT4A 1FKSA 1Q1CA 2OFNA 3ODKA 2KGJA 2XP9A 3O5IA 1EYMA 5DIVA 2M1IA 2XP7A 1FD9A 4N19A 3TCZA 1J4IA 4DROA 1M5YA 2XP6A 1FKLA 3H9RB 4R0XA 3TDBA 3KZ7A 2VCDA 5I98A 1F40A 5J6EA 3CGNA 3WH0A 3KAIA 5HWCA 1NMWA 2M2AA 4ODKA 1JNSA 1W26A 3O5DA 4DRMA 1FKRA 3UI5A 1FKDA 2D9FA 4IPXA 2ZQUA 1QPFA 2KFWA 2FKEA 2DG9A 2LKNA 3FAPA 2PV1A 3NI6A 3OOBA 4J4NA 5HW7A 3O5KA 4MSPA 2MF9A 2KI3A 1FKBA 3IHZA 1D7IA 1R9HA 3MDYB 1U79A 2RURA 5DIUA 3TC5A 1NMVA 1C9HA 1F8AB 1ROTA 2PPPA 1D7JA 4DRKA 1PINA 4U86A 4IQCA 1KT0A 5HT1A 2ZR5A 3UI4A 2MPHA 4ITZA 4DRNA 1YATA 1B6CA 3UF8A 5HW8A 3PA7A 3O5PA 1EQ3A 2PBCA 1A7XA 2F4EA 4ODPA 2ZR4A 1ROUA 2K8IA 2ITKA 2M08A 4ODLA 1P5QA 3PRBA 3EY6A 3KADA 3NRKA 3JXVA 3O5EA 1ZK6A 4TW6A 2AWGA 1FJDA 2DG4A 3O5MA 2ZQVA 2XP8A 2ZQSA 3UQBA 2XP4A
chains in the Genus database with same CATH superfamily
1ZCNA 2XP3A 1T11A 5DITA 1BL4A 4LAYA 1GRJA 5GPRA 1O6IA 4FAPA 1L1PA 4U85A 3CGMA 4J4OA 3WL1A 4Z2GA 2KE0A 2DSVA 1FFQA 1LJYA 4R5EA 4LAVA 2B31A 1FKJA 2EULA 3O5FA 2KR7A 4TW7A 1F40A 1VF8A 2ZQTA 3BMBA 1Q6IA 1QZ2A 4O2TA 3RMEA 1Q6UA 3CH9A 1JNTA 2WM0A 4W9OA 5HW6A 3UI6A 2RUDA 4JFMA 3O5OA 3FY1A 3O5JA 4JFIA 4DRPA 1FFRA 1RD6A 1GOIA 1FKGA 4UDMA 1EDQA 3AS3A 4W9QA 4L3NA 5BXJA 3KCEA 4ODRA 4DRHA 2L2SA 3FXYA 2ZR6A 2VN1A 1HXVA 4Z2JA 3AQUA 1BKFA 3UQIA 1W1TA 2PPOA 2RUCA 4PTMA 4DH0A 1WB0A 4Q22A 2AOSA 4Z2KA 1NH6A 1EYMA 2M1IA 1FD9A 1FKLA 1WAWA 2ESCA 1IX5A 3CGNA 4AY1A 3KAIA 1W26A 4DRMA 3UI5A 1FKDA 1E44A 1NWRA 2YBTA 3FAPA 5HW7A 2DG9A 2PV1A 3PRAA 5DF0A 1D7IA 3CHCA 1R9HA 3CHEA 3WQVA 1NMVA 4KQZA 2PPPA 1D7JA 1PINA 4U86A 4ZS6A 4ZPWR 4S3KA 3UI4A 5JH8A 4P8UA 1EQ3A 4ODPA 1ROUA 3G6LA 4ODLA 2DPEA 3JXVA 3O5EA 4TW6A 4URIA 1FJDA 3ALFA 3O5MA 2ZQVA 2XP8A 3LUOA 4DWSC 2OLHA 2XPAA 2PN0A 1SYTA 2F2DA 1K9TA 1NSGA 1TCOC 3ARRA 4WKFA 4TYOA 2WLYA 1FKKA 3I6CA 1JCHB 4JYSA 1LL6A 1FAPA 4QT2A 4DWSA 2QF8A 3B9AA 1FKTA 3PR9A 3RFWA 3RGCA 1HKMA 2WK2A 1W1PA 3IKGA 2LJ4A 1FKIA 1Q6HA 1W1YA 5DEZA 1W1VA 4DRJA 3ARUA 3KABA 4ODNA 1HJVA 4DZ3A 4WIWA 1FKFA 3KAFA 4MGVA 1J4HA 4FN2A 2PI6A 2G41A 3VAWA 4U84A 3G6MA 1E6ZA 2XP5A 2DT0A 4ODQA 3WKZA 4MNJA 2PV2A 4ZPVR 3WD0A 4ODMA 2MNTA 4TX0A 4DT4A 2OFNA 1ZBVA 2XP9A 1GPFA 5DIVA 1XHGA 3TCZA 1M5YA 2XP6A 3H9RB 3ARVA 1E6NA 2VCDA 1OGGA 2B5UB 3WH0A 5HWCA 1NMWA 2M2AA 4ODKA 1JNSA 1ZBKA 1FKRA 2ZQUA 2LKNA 1EHNA 2DT3A 1W9UA 2KI3A 1FKBA 1E9LA 1ITXA 5DIUA 4DWSD 4MPKA 1HKKA 4DRKA 1WNOA 1KT0A 3CHFA 1B6CA 1D2KA 2PBCA 1A7XA 4MNLA 2M08A 1P5QA 3EY6A 3KADA 1H0GA 3B8SA 1X6LA 2DG4A 4HBOA 1W9PA 2ZQSA 3UQBA 2XP4A 1QPLA 4WJXA 4DIPA 2LPVA 4DWSB 2PPNA 4W5UA 3RM8A 3QOKA 2WLZA 1LL4A 3GPKA 2JZVA 4TW8A 5GPGA 4DRQA 2MLZA 4TNSA 1HKIA 3ARXA 5HTGA 4MNKA 1XRVA 1GUVA 4IT6A 1OWQA 1HKJA 4LAXA 4IT4A 4W9PA 1NWSA 2RUQA 3ARZA 4IQ2A 3O5RA 3O5GA 4JFKA 1Y0OA 2YBUA 4QIBA 3JYMA 2Q5AA 3WD4A 4GGQA 1J4RA 1PBKA 2A3BA 4NNRA 3KAGA 2G8ZA 1SR0A 3ARSA 3IK8A 2MLYA 1ZU8A 2DG3A 5HBFA 1NWTA 3O5QA 3UQAA 2FDMA 2O92A 4DZ2A 4Z2IA 4S3JA 1D7HA 1JVWA 1FKHA 2IF4A 1FKSA 2DSZA 3WIJA 3WD2A 1HJXA 3ODKA 2KGJA 1LQ0A 1UR9A 1LG2A 2DT1A 2XP7A 1J4IA 2ETNA 3ARYA 4R0XA 5I98A 3RM9A 3CZ8A 4WKHA 3O5DA 4NZCA 4IPXA 1QPFA 2FKEA 2P4VA 3NI6A 4J4NA 2A3EA 3IHZA 4Q7NA 3MDYB 4MNMA 1U79A 2RURA 2IUZA 3TC5A 5GQBA 1ROTA 4NSBA 2F23A 5DO2A 5HT1A 1TFVA 4DRNA 4KR0B 2MPHA 3BXWA 3UF8A 3PA7A 3AROA 2F4EA 2ZR4A 2K8IA 2ITKA 4Z2LA 3WD1A 1ZK6A 2AWGA 1ZL1A 5D75A 1NWUA 1J6YA 2PV3A 3EIPA 2KO7A 2RSEA 4JFJA 3OA5A 3ARWA 3WL0A 4DRIA 4WK9A 3AS2A 2XPBA 3O5LA 1N1AA 2DSUA 2O9OA 4L72B 4QT3A 1D6OA 3NTPA 2UZ5A 4LAWA 3GTYX 4ODOA 1KT1A 1ZBWA 4QZVB 1EIBA 1CTNA 1YW5A 4XAKA 3PRDA 5HUAA 1UR8A 2MLXA 2Y78A 4BF8A 3KACA 1KFWA 4C02B 3AS1A 2N87A 3B7XA 3IKDA 1H0IA 3RM4A 4GIVA 1JNEA 5HKGA 3KAHA 1OGBA 4WKAA 1E15A 4LGXA 1ZB5A 2A3AA 2FAPA 4G2PA 2RQSA 3JYJA 3WD3A 1HJWA 2A3CA 3ARQA 4G50A 1E6PA 1E6RA 2LGOA 5HWBA 5B8IC 4MAVA 4JFLA 2F21A 2DT2A 3ALGA 1Q1CA 3CHDA 1LL7A 3O5IA 2DSWA 4N19A 3B9DA 4DROA 3WQWA 3TDBA 3KZ7A 3W4RA 4Z2HA 3B9EA 5J6EA 3ARTA 1LG1A 4HBEA 2D9FA 3OOBA 1W9VA 2KFWA 4P8VA 1ZBCA 1X6NA 3O5KA 4MSPA 2MF9A 1JNDA 3AS0A 3GU0A 4P8WA 1C9HA 1F8AB 4MTVA 4ML4A 4IQCA 4P8XA 2ZR5A 4ITZA 5HW8A 1YATA 3O5PA 3PRBA 3NRKA 3ARPA 4HARA 4ZPTR
chains in the Genus database with same CATH topology
1ZCNA 2XP3A 1T11A 5DITA 1BL4A 4LAYA 5GPRA 1O6IA 4FAPA 1L1PA 4U85A 3CGMA 4J4OA 3WL1A 4Z2GA 2KE0A 2DSVA 1FFQA 1LJYA 4R5EA 4LAVA 2B31A 1FKJA 4TW7A 3O5FA 2KR7A 1F40A 1VF8A 2ZQTA 1Q6IA 1QZ2A 4O2TA 3RMEA 1Q6UA 3CH9A 1JNTA 2WM0A 4W9OA 5HW6A 3UI6A 2RUDA 4JFMA 3O5OA 3FY1A 3O5JA 4JFIA 4DRPA 1FFRA 1RD6A 1GOIA 1FKGA 1EDQA 3AS3A 4W9QA 4L3NA 5BXJA 3KCEA 4ODRA 4DRHA 2L2SA 3FXYA 2ZR6A 2VN1A 1HXVA 4Z2JA 3AQUA 1BKFA 3UQIA 1W1TA 2PPOA 2RUCA 4PTMA 4DH0A 1WB0A 4Q22A 2AOSA 4Z2KA 1NH6A 1EYMA 2M1IA 1FD9A 1FKLA 1WAWA 2ESCA 1IX5A 3CGNA 4AY1A 3KAIA 1W26A 4DRMA 3UI5A 1FKDA 2YBTA 1NWRA 3FAPA 5HW7A 2DG9A 2PV1A 3PRAA 5DF0A 1D7IA 3CHCA 1R9HA 3CHEA 3WQVA 1NMVA 4KQZA 2PPPA 1D7JA 1PINA 4U86A 4ZS6A 4ZPWR 4S3KA 3UI4A 5JH8A 4P8UA 1EQ3A 4ODPA 1ROUA 3G6LA 4ODLA 2DPEA 3JXVA 3O5EA 4TW6A 4URIA 1FJDA 3ALFA 3O5MA 2ZQVA 2XP8A 3LUOA 4DWSC 2OLHA 2XPAA 1SYTA 2F2DA 1K9TA 1NSGA 1TCOC 3ARRA 4WKFA 4TYOA 2WLYA 1FKKA 3I6CA 4JYSA 1LL6A 1FAPA 4QT2A 4DWSA 2QF8A 3B9AA 1FKTA 3PR9A 3RFWA 3RGCA 1HKMA 2WK2A 1W1PA 3IKGA 2LJ4A 1FKIA 1Q6HA 1W1YA 5DEZA 1W1VA 4DRJA 3ARUA 3KABA 4ODNA 1HJVA 4DZ3A 4WIWA 1FKFA 3KAFA 4MGVA 1J4HA 4FN2A 2PI6A 2G41A 3VAWA 4U84A 3G6MA 1E6ZA 2XP5A 2DT0A 4ODQA 3WKZA 4MNJA 2PV2A 4ZPVR 3WD0A 4ODMA 2MNTA 4TX0A 4DT4A 2OFNA 1ZBVA 2XP9A 1GPFA 5DIVA 1XHGA 3TCZA 1M5YA 2XP6A 3H9RB 3ARVA 1E6NA 2VCDA 1OGGA 3WH0A 5HWCA 1NMWA 2M2AA 4ODKA 1JNSA 1ZBKA 1FKRA 2ZQUA 2LKNA 1EHNA 2DT3A 1W9UA 2KI3A 1FKBA 1E9LA 1ITXA 5DIUA 4DWSD 4MPKA 1HKKA 4DRKA 1WNOA 1KT0A 3CHFA 1B6CA 1D2KA 2PBCA 1A7XA 4MNLA 2M08A 1P5QA 3EY6A 3KADA 1H0GA 3B8SA 1X6LA 2DG4A 4HBOA 1W9PA 2ZQSA 3UQBA 2XP4A 1QPLA 4WJXA 4DIPA 2LPVA 4DWSB 2PPNA 4W5UA 3RM8A 3QOKA 2WLZA 1LL4A 3GPKA 2JZVA 4TW8A 5GPGA 4DRQA 2MLZA 4TNSA 1HKIA 3ARXA 5HTGA 4MNKA 1XRVA 1GUVA 4IT6A 1OWQA 1HKJA 4LAXA 4IT4A 4W9PA 1NWSA 2RUQA 3ARZA 4IQ2A 3O5RA 3O5GA 4JFKA 1Y0OA 2YBUA 4QIBA 3JYMA 2Q5AA 3WD4A 4GGQA 1J4RA 1PBKA 2A3BA 4NNRA 3KAGA 2G8ZA 1SR0A 3ARSA 3IK8A 2MLYA 1ZU8A 2DG3A 5HBFA 1NWTA 3O5QA 3UQAA 2FDMA 2O92A 4DZ2A 4Z2IA 4S3JA 1D7HA 1JVWA 1FKHA 2IF4A 1FKSA 2DSZA 3WIJA 3WD2A 1HJXA 3ODKA 2KGJA 1LQ0A 1UR9A 1LG2A 2DT1A 2XP7A 1J4IA 3ARYA 4R0XA 5I98A 3RM9A 3CZ8A 4WKHA 3O5DA 4NZCA 4IPXA 1QPFA 2FKEA 3NI6A 4J4NA 2A3EA 3IHZA 4Q7NA 3MDYB 4MNMA 1U79A 2RURA 2IUZA 3TC5A 5GQBA 1ROTA 4NSBA 5DO2A 5HT1A 1TFVA 4DRNA 4KR0B 2MPHA 3BXWA 3UF8A 3PA7A 3AROA 2F4EA 2ZR4A 2K8IA 2ITKA 4Z2LA 3WD1A 1ZK6A 2AWGA 1ZL1A 5D75A 1NWUA 1J6YA 2PV3A 2KO7A 2RSEA 4JFJA 3OA5A 3ARWA 3WL0A 4DRIA 4WK9A 3AS2A 2XPBA 3O5LA 1N1AA 2DSUA 2O9OA 4L72B 4QT3A 1D6OA 3NTPA 2UZ5A 4LAWA 4ODOA 1KT1A 1ZBWA 4QZVB 1EIBA 1CTNA 1YW5A 4XAKA 3PRDA 5HUAA 1UR8A 2MLXA 2Y78A 4BF8A 3KACA 1KFWA 4C02B 3AS1A 2N87A 3B7XA 3IKDA 1H0IA 3RM4A 4GIVA 1JNEA 5HKGA 3KAHA 1OGBA 4WKAA 1E15A 4LGXA 1ZB5A 2A3AA 2FAPA 4G2PA 2RQSA 3JYJA 3WD3A 1HJWA 2A3CA 3ARQA 4G50A 1E6PA 1E6RA 2LGOA 5HWBA 5B8IC 4MAVA 4JFLA 2F21A 2DT2A 3ALGA 1Q1CA 3CHDA 1LL7A 3O5IA 2DSWA 4N19A 3B9DA 4DROA 3WQWA 3TDBA 3KZ7A 3W4RA 4Z2HA 3B9EA 5J6EA 3ARTA 1LG1A 4HBEA 2D9FA 3OOBA 1W9VA 2KFWA 4P8VA 1ZBCA 1X6NA 3O5KA 4MSPA 2MF9A 1JNDA 3AS0A 4P8WA 1C9HA 1F8AB 4MTVA 4ML4A 4IQCA 4P8XA 2ZR5A 4ITZA 5HW8A 1YATA 3O5PA 3PRBA 3NRKA 3ARPA 4HARA 4ZPTR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  3LUO A;  1QPL A;  2XP3 A;  5D75 A;  1T11 A;  5DIT A;  4DIP A;  2PV3 A;  1BL4 A;  2LPV A;  2KO7 A;  1J6Y A;  2PPN A;  2RSE A;  2XPA A;  4LAY A;  4JFJ A;  2F2D A;  4FAP A;  1L1P A;  4U85 A;  4DRI A;  4TW8 A;  3GPK A;  2JZV A;  3CGM A;  4J4O A;  5GPG A;  1NSG A;  1TCO C;  4DRQ A;  2KE0 A;  2XPB A;  3O5L A;  2MLZ A;  1N1A A;  4TNS A;  4TYO A;  1FKK A;  5HTG A;  3I6C A;  4QT3 A;  1D6O A;  4LAV A;  3NTP A;  2UZ5 A;  4JYS A;  1FKJ A;  1FAP A;  4LAW A;  3O5F A;  1KT1 A;  2KR7 A;  4LAX A;  1FKT A;  4ODO A;  4QT2 A;  4TW7 A;  4W9P A;  2RUQ A;  3RFW A;  3RGC A;  2ZQT A;  1QZ2 A;  1Q6I A;  4IQ2 A;  3O5R A;  1Q6U A;  1YW5 A;  1JNT A;  4O2T A;  3IKG A;  4W9O A;  5HW6 A;  3PRD A;  5HUA A;  2LJ4 A;  3O5G A;  4JFK A;  3UI6 A;  1FKI A;  1Q6H A;  2MLX A;  2RUD A;  2Y78 A;  4JFM A;  4BF8 A;  1Y0O A;  3O5J A;  3O5O A;  3KAC A;  4JFI A;  4QIB A;  4DRJ A;  4DRP A;  3JYM A;  3KAB A;  4C02 B;  4ODN A;  2N87 A;  3B7X A;  3IKD A;  2Q5A A;  4DZ3 A;  1FKF A;  4GIV A;  1FKG A;  5HKG A;  3KAH A;  1J4R A;  1PBK A;  4GGQ A;  4NNR A;  3KAG A;  3KAF A;  4W9Q A;  3IK8 A;  2MLY A;  3KCE A;  4MGV A;  4ODR A;  1J4H A;  2L2S A;  4FN2 A;  2DG3 A;  4DRH A;  5BXJ A;  3O5Q A;  2FAP A;  3UQA A;  2ZR6 A;  4G2P A;  3VAW A;  2RQS A;  4U84 A;  3JYJ A;  2XP5 A;  4DZ2 A;  4ODQ A;  2VN1 A;  1D7H A;  1HXV A;  4G50 A;  1BKF A;  1JVW A;  2LGO A;  3UQI A;  5HWB A;  1FKH A;  2PPO A;  2RUC A;  2IF4 A;  5B8I C;  2PV2 A;  4JFL A;  4DH0 A;  2F21 A;  4ODM A;  2MNT A;  4TX0 A;  4DT4 A;  1FKS A;  1Q1C A;  2OFN A;  3ODK A;  2KGJ A;  2XP9 A;  3O5I A;  1EYM A;  5DIV A;  2M1I A;  2XP7 A;  1FD9 A;  4N19 A;  3TCZ A;  1J4I A;  4DRO A;  1M5Y A;  2XP6 A;  1FKL A;  3H9R B;  4R0X A;  3TDB A;  3KZ7 A;  2VCD A;  5I98 A;  1F40 A;  5J6E A;  3CGN A;  3WH0 A;  3KAI A;  5HWC A;  1NMW A;  2M2A A;  4ODK A;  1JNS A;  1W26 A;  3O5D A;  4DRM A;  1FKR A;  3UI5 A;  1FKD A;  2D9F A;  4IPX A;  2ZQU A;  1QPF A;  2KFW A;  2FKE A;  2DG9 A;  2LKN A;  3FAP A;  2PV1 A;  3NI6 A;  3OOB A;  4J4N A;  5HW7 A;  3O5K A;  4MSP A;  2MF9 A;  2KI3 A;  1FKB A;  3IHZ A;  1D7I A;  1R9H A;  3MDY B;  1U79 A;  2RUR A;  5DIU A;  3TC5 A;  1NMV A;  1C9H A;  1F8A B;  1ROT A;  2PPP A;  1D7J A;  4DRK A;  1PIN A;  4U86 A;  4IQC A;  1KT0 A;  5HT1 A;  2ZR5 A;  3UI4 A;  2MPH A;  4ITZ A;  4DRN A;  1YAT A;  1B6C A;  3UF8 A;  5HW8 A;  3PA7 A;  3O5P A;  1EQ3 A;  2PBC A;  1A7X A;  2F4E A;  4ODP A;  2ZR4 A;  1ROU A;  2K8I A;  2ITK A;  2M08 A;  4ODL A;  1P5Q A;  3PRB A;  3EY6 A;  3KAD A;  3NRK A;  3JXV A;  3O5E A;  1ZK6 A;  4TW6 A;  2AWG A;  1FJD A;  2DG4 A;  3O5M A;  2ZQV A;  2XP8 A;  2ZQS A;  3UQB A;  2XP4 A; 
#chains in the Genus database with same CATH topology
 1ZCN A;  2XP3 A;  1T11 A;  5DIT A;  1BL4 A;  4LAY A;  1GRJ A;  5GPR A;  1O6I A;  4FAP A;  1L1P A;  4U85 A;  3CGM A;  4J4O A;  3WL1 A;  4Z2G A;  2KE0 A;  2DSV A;  1FFQ A;  1LJY A;  4R5E A;  4LAV A;  2B31 A;  1FKJ A;  2EUL A;  3O5F A;  2KR7 A;  4TW7 A;  1F40 A;  1VF8 A;  2ZQT A;  3BMB A;  1Q6I A;  1QZ2 A;  4O2T A;  3RME A;  1Q6U A;  3CH9 A;  1JNT A;  2WM0 A;  4W9O A;  5HW6 A;  3UI6 A;  2RUD A;  4JFM A;  3O5O A;  3FY1 A;  3O5J A;  4JFI A;  4DRP A;  1FFR A;  1RD6 A;  1GOI A;  1FKG A;  4UDM A;  1EDQ A;  3AS3 A;  4W9Q A;  4L3N A;  5BXJ A;  3KCE A;  4ODR A;  4DRH A;  2L2S A;  3FXY A;  2ZR6 A;  2VN1 A;  1HXV A;  4Z2J A;  3AQU A;  1BKF A;  3UQI A;  1W1T A;  2PPO A;  2RUC A;  4PTM A;  4DH0 A;  1WB0 A;  4Q22 A;  2AOS A;  4Z2K A;  1NH6 A;  1EYM A;  2M1I A;  1FD9 A;  1FKL A;  1WAW A;  2ESC A;  1IX5 A;  3CGN A;  4AY1 A;  3KAI A;  1W26 A;  4DRM A;  3UI5 A;  1FKD A;  1E44 A;  1NWR A;  2YBT A;  3FAP A;  5HW7 A;  2DG9 A;  2PV1 A;  3PRA A;  5DF0 A;  1D7I A;  3CHC A;  1R9H A;  3CHE A;  3WQV A;  1NMV A;  4KQZ A;  2PPP A;  1D7J A;  1PIN A;  4U86 A;  4ZS6 A;  4ZPW R;  4S3K A;  3UI4 A;  5JH8 A;  4P8U A;  1EQ3 A;  4ODP A;  1ROU A;  3G6L A;  4ODL A;  2DPE A;  3JXV A;  3O5E A;  4TW6 A;  4URI A;  1FJD A;  3ALF A;  3O5M A;  2ZQV A;  2XP8 A;  3LUO A;  4DWS C;  2OLH A;  2XPA A;  2PN0 A;  1SYT A;  2F2D A;  1K9T A;  1NSG A;  1TCO C;  3ARR A;  4WKF A;  4TYO A;  2WLY A;  1FKK A;  3I6C A;  1JCH B;  4JYS A;  1LL6 A;  1FAP A;  4QT2 A;  4DWS A;  2QF8 A;  3B9A A;  1FKT A;  3PR9 A;  3RFW A;  3RGC A;  1HKM A;  2WK2 A;  1W1P A;  3IKG A;  2LJ4 A;  1FKI A;  1Q6H A;  1W1Y A;  5DEZ A;  1W1V A;  4DRJ A;  3ARU A;  3KAB A;  4ODN A;  1HJV A;  4DZ3 A;  4WIW A;  1FKF A;  3KAF A;  4MGV A;  1J4H A;  4FN2 A;  2PI6 A;  2G41 A;  3VAW A;  4U84 A;  3G6M A;  1E6Z A;  2XP5 A;  2DT0 A;  4ODQ A;  3WKZ A;  4MNJ A;  2PV2 A;  4ZPV R;  3WD0 A;  4ODM A;  2MNT A;  4TX0 A;  4DT4 A;  2OFN A;  1ZBV A;  2XP9 A;  1GPF A;  5DIV A;  1XHG A;  3TCZ A;  1M5Y A;  2XP6 A;  3H9R B;  3ARV A;  1E6N A;  2VCD A;  1OGG A;  2B5U B;  3WH0 A;  5HWC A;  1NMW A;  2M2A A;  4ODK A;  1JNS A;  1ZBK A;  1FKR A;  2ZQU A;  2LKN A;  1EHN A;  2DT3 A;  1W9U A;  2KI3 A;  1FKB A;  1E9L A;  1ITX A;  5DIU A;  4DWS D;  4MPK A;  1HKK A;  4DRK A;  1WNO A;  1KT0 A;  3CHF A;  1B6C A;  1D2K A;  2PBC A;  1A7X A;  4MNL A;  2M08 A;  1P5Q A;  3EY6 A;  3KAD A;  1H0G A;  3B8S A;  1X6L A;  2DG4 A;  4HBO A;  1W9P A;  2ZQS A;  3UQB A;  2XP4 A;  1QPL A;  4WJX A;  4DIP A;  2LPV A;  4DWS B;  2PPN A;  4W5U A;  3RM8 A;  3QOK A;  2WLZ A;  1LL4 A;  3GPK A;  2JZV A;  4TW8 A;  5GPG A;  4DRQ A;  2MLZ A;  4TNS A;  1HKI A;  3ARX A;  5HTG A;  4MNK A;  1XRV A;  1GUV A;  4IT6 A;  1OWQ A;  1HKJ A;  4LAX A;  4IT4 A;  4W9P A;  1NWS A;  2RUQ A;  3ARZ A;  4IQ2 A;  3O5R A;  3O5G A;  4JFK A;  1Y0O A;  2YBU A;  4QIB A;  3JYM A;  2Q5A A;  3WD4 A;  4GGQ A;  1J4R A;  1PBK A;  2A3B A;  4NNR A;  3KAG A;  2G8Z A;  1SR0 A;  3ARS A;  3IK8 A;  2MLY A;  1ZU8 A;  2DG3 A;  5HBF A;  1NWT A;  3O5Q A;  3UQA A;  2FDM A;  2O92 A;  4DZ2 A;  4Z2I A;  4S3J A;  1D7H A;  1JVW A;  1FKH A;  2IF4 A;  1FKS A;  2DSZ A;  3WIJ A;  3WD2 A;  1HJX A;  3ODK A;  2KGJ A;  1LQ0 A;  1UR9 A;  1LG2 A;  2DT1 A;  2XP7 A;  1J4I A;  2ETN A;  3ARY A;  4R0X A;  5I98 A;  3RM9 A;  3CZ8 A;  4WKH A;  3O5D A;  4NZC A;  4IPX A;  1QPF A;  2FKE A;  2P4V A;  3NI6 A;  4J4N A;  2A3E A;  3IHZ A;  4Q7N A;  3MDY B;  4MNM A;  1U79 A;  2RUR A;  2IUZ A;  3TC5 A;  5GQB A;  1ROT A;  4NSB A;  2F23 A;  5DO2 A;  5HT1 A;  1TFV A;  4DRN A;  4KR0 B;  2MPH A;  3BXW A;  3UF8 A;  3PA7 A;  3ARO A;  2F4E A;  2ZR4 A;  2K8I A;  2ITK A;  4Z2L A;  3WD1 A;  1ZK6 A;  2AWG A;  1ZL1 A;  5D75 A;  1NWU A;  1J6Y A;  2PV3 A;  3EIP A;  2KO7 A;  2RSE A;  4JFJ A;  3OA5 A;  3ARW A;  3WL0 A;  4DRI A;  4WK9 A;  3AS2 A;  2XPB A;  3O5L A;  1N1A A;  2DSU A;  2O9O A;  4L72 B;  4QT3 A;  1D6O A;  3NTP A;  2UZ5 A;  4LAW A;  3GTY X;  4ODO A;  1KT1 A;  1ZBW A;  4QZV B;  1EIB A;  1CTN A;  1YW5 A;  4XAK A;  3PRD A;  5HUA A;  1UR8 A;  2MLX A;  2Y78 A;  4BF8 A;  3KAC A;  1KFW A;  4C02 B;  3AS1 A;  2N87 A;  3B7X A;  3IKD A;  1H0I A;  3RM4 A;  4GIV A;  1JNE A;  5HKG A;  3KAH A;  1OGB A;  4WKA A;  1E15 A;  4LGX A;  1ZB5 A;  2A3A A;  2FAP A;  4G2P A;  2RQS A;  3JYJ A;  3WD3 A;  1HJW A;  2A3C A;  3ARQ A;  4G50 A;  1E6P A;  1E6R A;  2LGO A;  5HWB A;  5B8I C;  4MAV A;  4JFL A;  2F21 A;  2DT2 A;  3ALG A;  1Q1C A;  3CHD A;  1LL7 A;  3O5I A;  2DSW A;  4N19 A;  3B9D A;  4DRO A;  3WQW A;  3TDB A;  3KZ7 A;  3W4R A;  4Z2H A;  3B9E A;  5J6E A;  3ART A;  1LG1 A;  4HBE A;  2D9F A;  3OOB A;  1W9V A;  2KFW A;  4P8V A;  1ZBC A;  1X6N A;  3O5K A;  4MSP A;  2MF9 A;  1JND A;  3AS0 A;  3GU0 A;  4P8W A;  1C9H A;  1F8A B;  4MTV A;  4ML4 A;  4IQC A;  4P8X A;  2ZR5 A;  4ITZ A;  5HW8 A;  1YAT A;  3O5P A;  3PRB A;  3NRK A;  3ARP A;  4HAR A;  4ZPT R; 
#chains in the Genus database with same CATH homology
 1ZCN A;  2XP3 A;  1T11 A;  5DIT A;  1BL4 A;  4LAY A;  5GPR A;  1O6I A;  4FAP A;  1L1P A;  4U85 A;  3CGM A;  4J4O A;  3WL1 A;  4Z2G A;  2KE0 A;  2DSV A;  1FFQ A;  1LJY A;  4R5E A;  4LAV A;  2B31 A;  1FKJ A;  4TW7 A;  3O5F A;  2KR7 A;  1F40 A;  1VF8 A;  2ZQT A;  1Q6I A;  1QZ2 A;  4O2T A;  3RME A;  1Q6U A;  3CH9 A;  1JNT A;  2WM0 A;  4W9O A;  5HW6 A;  3UI6 A;  2RUD A;  4JFM A;  3O5O A;  3FY1 A;  3O5J A;  4JFI A;  4DRP A;  1FFR A;  1RD6 A;  1GOI A;  1FKG A;  1EDQ A;  3AS3 A;  4W9Q A;  4L3N A;  5BXJ A;  3KCE A;  4ODR A;  4DRH A;  2L2S A;  3FXY A;  2ZR6 A;  2VN1 A;  1HXV A;  4Z2J A;  3AQU A;  1BKF A;  3UQI A;  1W1T A;  2PPO A;  2RUC A;  4PTM A;  4DH0 A;  1WB0 A;  4Q22 A;  2AOS A;  4Z2K A;  1NH6 A;  1EYM A;  2M1I A;  1FD9 A;  1FKL A;  1WAW A;  2ESC A;  1IX5 A;  3CGN A;  4AY1 A;  3KAI A;  1W26 A;  4DRM A;  3UI5 A;  1FKD A;  2YBT A;  1NWR A;  3FAP A;  5HW7 A;  2DG9 A;  2PV1 A;  3PRA A;  5DF0 A;  1D7I A;  3CHC A;  1R9H A;  3CHE A;  3WQV A;  1NMV A;  4KQZ A;  2PPP A;  1D7J A;  1PIN A;  4U86 A;  4ZS6 A;  4ZPW R;  4S3K A;  3UI4 A;  5JH8 A;  4P8U A;  1EQ3 A;  4ODP A;  1ROU A;  3G6L A;  4ODL A;  2DPE A;  3JXV A;  3O5E A;  4TW6 A;  4URI A;  1FJD A;  3ALF A;  3O5M A;  2ZQV A;  2XP8 A;  3LUO A;  4DWS C;  2OLH A;  2XPA A;  1SYT A;  2F2D A;  1K9T A;  1NSG A;  1TCO C;  3ARR A;  4WKF A;  4TYO A;  2WLY A;  1FKK A;  3I6C A;  4JYS A;  1LL6 A;  1FAP A;  4QT2 A;  4DWS A;  2QF8 A;  3B9A A;  1FKT A;  3PR9 A;  3RFW A;  3RGC A;  1HKM A;  2WK2 A;  1W1P A;  3IKG A;  2LJ4 A;  1FKI A;  1Q6H A;  1W1Y A;  5DEZ A;  1W1V A;  4DRJ A;  3ARU A;  3KAB A;  4ODN A;  1HJV A;  4DZ3 A;  4WIW A;  1FKF A;  3KAF A;  4MGV A;  1J4H A;  4FN2 A;  2PI6 A;  2G41 A;  3VAW A;  4U84 A;  3G6M A;  1E6Z A;  2XP5 A;  2DT0 A;  4ODQ A;  3WKZ A;  4MNJ A;  2PV2 A;  4ZPV R;  3WD0 A;  4ODM A;  2MNT A;  4TX0 A;  4DT4 A;  2OFN A;  1ZBV A;  2XP9 A;  1GPF A;  5DIV A;  1XHG A;  3TCZ A;  1M5Y A;  2XP6 A;  3H9R B;  3ARV A;  1E6N A;  2VCD A;  1OGG A;  3WH0 A;  5HWC A;  1NMW A;  2M2A A;  4ODK A;  1JNS A;  1ZBK A;  1FKR A;  2ZQU A;  2LKN A;  1EHN A;  2DT3 A;  1W9U A;  2KI3 A;  1FKB A;  1E9L A;  1ITX A;  5DIU A;  4DWS D;  4MPK A;  1HKK A;  4DRK A;  1WNO A;  1KT0 A;  3CHF A;  1B6C A;  1D2K A;  2PBC A;  1A7X A;  4MNL A;  2M08 A;  1P5Q A;  3EY6 A;  3KAD A;  1H0G A;  3B8S A;  1X6L A;  2DG4 A;  4HBO A;  1W9P A;  2ZQS A;  3UQB A;  2XP4 A;  1QPL A;  4WJX A;  4DIP A;  2LPV A;  4DWS B;  2PPN A;  4W5U A;  3RM8 A;  3QOK A;  2WLZ A;  1LL4 A;  3GPK A;  2JZV A;  4TW8 A;  5GPG A;  4DRQ A;  2MLZ A;  4TNS A;  1HKI A;  3ARX A;  5HTG A;  4MNK A;  1XRV A;  1GUV A;  4IT6 A;  1OWQ A;  1HKJ A;  4LAX A;  4IT4 A;  4W9P A;  1NWS A;  2RUQ A;  3ARZ A;  4IQ2 A;  3O5R A;  3O5G A;  4JFK A;  1Y0O A;  2YBU A;  4QIB A;  3JYM A;  2Q5A A;  3WD4 A;  4GGQ A;  1J4R A;  1PBK A;  2A3B A;  4NNR A;  3KAG A;  2G8Z A;  1SR0 A;  3ARS A;  3IK8 A;  2MLY A;  1ZU8 A;  2DG3 A;  5HBF A;  1NWT A;  3O5Q A;  3UQA A;  2FDM A;  2O92 A;  4DZ2 A;  4Z2I A;  4S3J A;  1D7H A;  1JVW A;  1FKH A;  2IF4 A;  1FKS A;  2DSZ A;  3WIJ A;  3WD2 A;  1HJX A;  3ODK A;  2KGJ A;  1LQ0 A;  1UR9 A;  1LG2 A;  2DT1 A;  2XP7 A;  1J4I A;  3ARY A;  4R0X A;  5I98 A;  3RM9 A;  3CZ8 A;  4WKH A;  3O5D A;  4NZC A;  4IPX A;  1QPF A;  2FKE A;  3NI6 A;  4J4N A;  2A3E A;  3IHZ A;  4Q7N A;  3MDY B;  4MNM A;  1U79 A;  2RUR A;  2IUZ A;  3TC5 A;  5GQB A;  1ROT A;  4NSB A;  5DO2 A;  5HT1 A;  1TFV A;  4DRN A;  4KR0 B;  2MPH A;  3BXW A;  3UF8 A;  3PA7 A;  3ARO A;  2F4E A;  2ZR4 A;  2K8I A;  2ITK A;  4Z2L A;  3WD1 A;  1ZK6 A;  2AWG A;  1ZL1 A;  5D75 A;  1NWU A;  1J6Y A;  2PV3 A;  2KO7 A;  2RSE A;  4JFJ A;  3OA5 A;  3ARW A;  3WL0 A;  4DRI A;  4WK9 A;  3AS2 A;  2XPB A;  3O5L A;  1N1A A;  2DSU A;  2O9O A;  4L72 B;  4QT3 A;  1D6O A;  3NTP A;  2UZ5 A;  4LAW A;  4ODO A;  1KT1 A;  1ZBW A;  4QZV B;  1EIB A;  1CTN A;  1YW5 A;  4XAK A;  3PRD A;  5HUA A;  1UR8 A;  2MLX A;  2Y78 A;  4BF8 A;  3KAC A;  1KFW A;  4C02 B;  3AS1 A;  2N87 A;  3B7X A;  3IKD A;  1H0I A;  3RM4 A;  4GIV A;  1JNE A;  5HKG A;  3KAH A;  1OGB A;  4WKA A;  1E15 A;  4LGX A;  1ZB5 A;  2A3A A;  2FAP A;  4G2P A;  2RQS A;  3JYJ A;  3WD3 A;  1HJW A;  2A3C A;  3ARQ A;  4G50 A;  1E6P A;  1E6R A;  2LGO A;  5HWB A;  5B8I C;  4MAV A;  4JFL A;  2F21 A;  2DT2 A;  3ALG A;  1Q1C A;  3CHD A;  1LL7 A;  3O5I A;  2DSW A;  4N19 A;  3B9D A;  4DRO A;  3WQW A;  3TDB A;  3KZ7 A;  3W4R A;  4Z2H A;  3B9E A;  5J6E A;  3ART A;  1LG1 A;  4HBE A;  2D9F A;  3OOB A;  1W9V A;  2KFW A;  4P8V A;  1ZBC A;  1X6N A;  3O5K A;  4MSP A;  2MF9 A;  1JND A;  3AS0 A;  4P8W A;  1C9H A;  1F8A B;  4MTV A;  4ML4 A;  4IQC A;  4P8X A;  2ZR5 A;  4ITZ A;  5HW8 A;  1YAT A;  3O5P A;  3PRB A;  3NRK A;  3ARP A;  4HAR A;  4ZPT R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...