3O5RA

Complex of fk506 with the fk1 domain mutant a19t of fkbp51
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 33
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5rA00
2PPPA 1FD9A 2PPOA 2IF4A 3I6CA 2XP3A 4LAXA 4TX0A 3UF8A 4U85A 5HKGA 1BL4A 4JYSA 1FAPA 3ODKA 4J4NA 4JFIA 2KO7A 1D7JA 1J6YA 4TNSA 2L2SA 1BKFA 1C9HA 2LGOA 2RQSA 2UZ5A 2M1IA 3IK8A 4ODKA 4ODLA 2PPNA 2MLYA 4G50A 5D75A 5I98A 3JYJA 4DT4A 1FKDA 5BXJA 2Y78A 4LAVA 3O5OA 2JZVA 3WH0A 1KT1A 1FKSA 2KR7A 3KAGA 4W9PA 3RGCA 2MNTA 1F8AB 2F2DA 2PBCA 3CGMA 1NSGA 3NRKA 3O5EA 3PRBA 3UQIA 2N87A 1P5QA 2RURA 1NMWA 4IQCA 3UQBA 4TYOA 4DRJA 4MGVA 2XP6A 3B7XA 2KI3A 5HT1A 3KAFA 1FKFA 3JXVA 2MLZA 2PV1A 4JFMA 5DITA 3FAPA 4GGQA 4LAWA 5HW6A 1D6OA 1QPLA 1ZCNA 4LAYA 1KT0A 2MLXA 4IQ2A 4U86A 3KAIA 2KE0A 5HWBA 5HW7A 3NI6A 2M2AA 1FKGA 1FKKA 2OFNA 3KAHA 1N1AA 1J4RA 4R0XA 2ZQUA 1Q6HA 2DG9A 2VN1A 1Q6UA 3KABA 3O5JA 3O5QA 3PA7A 2D9FA 4ODRA 1EQ3A 2RSEA 1TCOC 3GPKA 4DRNA 1JVWA 2ZQVA 2RUDA 4DRPA 2XP9A 1L1PA 1A7XA 2PV3A 5J6EA 2K8IA 4U84A 1J4IA 1J4HA 1U79A 1Y0OA 3IHZA 3CGNA 5DIVA 4ODMA 4O2TA 4DZ2A 4QT3A 3UI6A 2LJ4A 1ZK6A 2RUCA 3O5GA 4GIVA 4ITZA 2ZR4A 3UI4A 5HWCA 4DZ3A 5B8IC 4BF8A 2DG3A 2M08A 3H9RB 1ROUA 4JFLA 5DIUA 1F40A 2PV2A 1T11A 1NMVA 3TC5A 3MDYB 3KADA 2ZQTA 1D7HA 2XP7A 4W9OA 2RUQA 2AWGA 1D7IA 4N19A 1Q6IA 3IKDA 3O5MA 1FKRA 2XP8A 4ODPA 1Q1CA 1M5YA 1EYMA 1JNTA 1FJDA 3KACA 4DIPA 4DRMA 4QIBA 1FKIA 1W26A 4ODNA 1HXVA 2ITKA 1JNSA 1FKLA 3O5KA 4IPXA 3TDBA 4DRKA 2MF9A 1FKTA 2VCDA 2Q5AA 3O5LA 3O5IA 4DH0A 4FN2A 3VAWA 2ZQSA 4TW7A 4G2PA 4DRQA 4FAPA 5GPGA 3RFWA 1PINA 1ROTA 2KGJA 4J4OA 2KFWA 2XPBA 3IKGA 2FKEA 4NNRA 5HUAA 3PRDA 4DRHA 3KZ7A 2F21A 2XPAA 4DROA 4JFKA 2MPHA 1FKBA 3EY6A 2LKNA 3UI5A 2FAPA 2XP5A 1QZ2A 4TW8A 2F4EA 3O5DA 4C02B 1FKHA 1FKJA 4QT2A 5HW8A 3KCEA 3O5FA 4DRIA 2ZR5A 5HTGA 1R9HA 1B6CA 1YATA 3OOBA 3JYMA 3UQAA 4MSPA 3LUOA 3O5PA 2LPVA 1PBKA 2XP4A 2DG4A 4ODQA 1QPFA 4JFJA 4ODOA 3O5RA 4TW6A 3TCZA 3NTPA 1YW5A 2ZR6A 4W9QA
chains in the Genus database with same CATH superfamily
2DT3A 3AQUA 4QZVB 3UF8A 4U85A 1ITXA 4J4NA 3WQVA 1D7JA 4URIA 1J6YA 2F23A 1EHNA 2RQSA 4L3NA 2PPNA 4DT4A 1FKDA 1EIBA 4ZPVR 1KT1A 3ARZA 1TFVA 3RGCA 1F8AB 2PBCA 2PI6A 3CGMA 3NRKA 4Q7NA 1NMWA 2KI3A 3WD0A 3FAPA 4R5EA 2MLXA 3KAIA 1CTNA 1RD6A 2M2AA 1FKKA 4ZPTR 3WD1A 2OFNA 3BMBA 1N1AA 1J4RA 4PTMA 3O5JA 3AROA 2ESCA 1TCOC 4MNMA 2XP9A 1A7XA 2K8IA 3AS0A 1J4IA 1J4HA 5DIVA 2DSWA 3CGNA 4ODMA 3ARYA 3WQWA 4DZ2A 4Z2JA 3ARTA 4QT3A 2RUCA 4DWSD 1ZBWA 2DT2A 1HKJA 1ROUA 2PV2A 1NWSA 2A3CA 3MDYB 4IT4A 2ZQTA 2RUQA 4N19A 2XP8A 1H0GA 4ODPA 4P8VA 3ARRA 4WJXA 3KACA 4DRMA 2PN0A 1OGGA 3OA5A 1FKLA 3O5KA 4IPXA 2MF9A 1E9LA 2Q5AA 3O5LA 3O5IA 5GQBA 3RFWA 1PINA 1E6RA 2KGJA 2XPBA 3PRDA 4DRHA 2F21A 1W1VA 4JFKA 3EY6A 2FAPA 2XP5A 4TW8A 3WIJA 3KCEA 1NH6A 2O92A 3OOBA 3RM8A 5DF0A 4MSPA 3LUOA 3UQAA 3TCZA 4TW6A 3G6MA 3W4RA 2PPPA 1FD9A 3I6CA 4TX0A 1UR9A 4JYSA 2KO7A 4WIWA 2B31A 1W1TA 2M1IA 3EIPA 4ODKA 4ODLA 2MLYA 4MTVA 5I98A 3CHCA 3JYJA 5BXJA 1EDQA 2JZVA 3KAGA 2FDMA 2G8ZA 2F2DA 3WL1A 1FFRA 2N87A 4TYOA 1JNEA 3B7XA 5HT1A 3KAFA 5DITA 2MLZA 3GTYX 4LAWA 5HW6A 1D6OA 1QPLA 4LAYA 2DT0A 3QOKA 1GOIA 2DT1A 1FFQA 1E6NA 3NI6A 3KAHA 4HBOA 3G6LA 2ZQUA 2QF8A 3O5QA 3KABA 1Q6UA 1EQ3A 2RSEA 1W9VA 2RUDA 3B9DA 2PV3A 5J6EA 5JH8A 3IHZA 2WM0A 1D2KA 1LL6A 3UI6A 4DWSA 4MNLA 5HWCA 2ZR4A 3B9AA 1E44A 2WLZA 4Q22A 2M08A 3TC5A 3KADA 4W9OA 1ZU8A 2AWGA 3AS1A 3IKDA 4ZS6A 1M5YA 4HBEA 4L72B 4IT6A 3AS3A 4DIPA 1W26A 1X6LA 4DRKA 5DO2A 1FKTA 2VCDA 1E15A 4FN2A 2ZQSA 4TW7A 1ROTA 1SR0A 2IUZA 3KZ7A 2MPHA 2YBUA 5B8IC 3RM9A 4C02B 4QT2A 1WAWA 3O5FA 4DRIA 1OWQA 1R9HA 1YATA 3CHEA 4LGXA 4KR0B 2LPVA 1QPFA 4WKFA 4JFJA 4Z2IA 2ZR6A 2P4VA 3WD4A 2PPOA 2IF4A 4LAXA 4WKAA 5HKGA 1FAPA 1ZBKA 2DSVA 3ODKA 3CH9A 4JFIA 2YBTA 4W5UA 2L2SA 1LQ0A 5HBFA 2LGOA 3IK8A 1NWTA 4UDMA 4G50A 3ARWA 5D75A 3O5OA 3WH0A 3FXYA 4W9PA 2DSUA 2MNTA 3PRAA 1HKIA 3O5EA 1ZBVA 4XAKA 1P5QA 2RURA 4IQCA 3UQBA 2XP6A 2WLYA 1FKFA 3JXVA 3CHFA 4ZPWR 2G41A 4GGQA 4P8XA 4KQZA 1ZCNA 3BXWA 4IQ2A 4U86A 1KFWA 2KE0A 3WD2A 5GPRA 5HW7A 1WNOA 1WB0A 4NZCA 4R0XA 3ARSA 4ODRA 1LG2A 2D9FA 3GPKA 4DRNA 1JVWA 1NWRA 3GU0A 3CHDA 1ZB5A 1O6IA 3CZ8A 3WKZA 4ITZA 3ARQA 4ML4A 4NSBA 4BF8A 3ARUA 4Z2LA 4JFLA 5DIUA 3RM4A 1F40A 4S3KA 3AS2A 1OGBA 1W1PA 4WKHA 1Q6IA 2EULA 1FKRA 3PR9A 4MAVA 1FJDA 4Z2GA 4QIBA 1HXVA 4WK9A 2ETNA 1ZL1A 1E6PA 1HKKA 4DH0A 1HJWA 5GPGA 2KFWA 3IKGA 2FKEA 4NNRA 4DROA 1FKBA 1QZ2A 2F4EA 3O5DA 1H0IA 1FKJA 1XHGA 5HW8A 4MPKA 2ZR5A 1B6CA 2WK2A 3JYMA 2XP4A 1IX5A 2DG4A 4ODOA 1W9PA 3NTPA 1YW5A 4W9QA 2A3EA 2XP3A 1BL4A 3B8SA 2B5UB 4TNSA 1BKFA 5DEZA 3WL0A 1C9HA 2UZ5A 4HARA 3FY1A 1JCHB 2Y78A 2DPEA 4LAVA 2DSZA 4P8UA 1FKSA 2KR7A 1NSGA 3UQIA 3PRBA 2A3AA 4MGVA 1HJXA 2OLHA 2PV1A 3ARVA 4JFMA 1SYTA 1LJYA 1KT0A 1UR8A 4DWSC 1GPFA 5HWBA 1FKGA 4AY1A 4MNKA 3WD3A 1Q6HA 2DG9A 2VN1A 3PA7A 1L1PA 2ZQVA 1X6NA 4DRPA 4U84A 1U79A 1Y0OA 1GRJA 4O2TA 4MNJA 2LJ4A 1ZK6A 3O5GA 4GIVA 3UI4A 4DZ3A 2A3BA 2DG3A 4Z2HA 3H9RB 3ARXA 1T11A 1LL7A 2O9OA 1GUVA 1NMVA 3ARPA 1D7HA 2XP7A 3B9EA 4P8WA 1D7IA 1LL4A 3O5MA 1Q1CA 1EYMA 1JNTA 1LG1A 4Z2KA 1FKIA 3ALGA 3RMEA 4ODNA 2ITKA 1JNSA 3TDBA 1W1YA 4DRQA 3VAWA 4G2PA 4FAPA 4J4OA 5HUAA 1ZBCA 3ALFA 1JNDA 2XPAA 1W9UA 1K9TA 1XRVA 4DRJA 2LKNA 3UI5A 1FKHA 4DWSB 1HJVA 5HTGA 1NWUA 3O5PA 1PBKA 2AOSA 4ODQA 4S3JA 1E6ZA 3O5RA 1HKMA 1VF8A
chains in the Genus database with same CATH topology
2DT3A 3AQUA 4QZVB 3UF8A 4U85A 1ITXA 4J4NA 3WQVA 1D7JA 4URIA 1J6YA 1EHNA 2RQSA 4L3NA 2PPNA 4DT4A 1FKDA 1EIBA 4ZPVR 1KT1A 3ARZA 1TFVA 3RGCA 1F8AB 2PBCA 2PI6A 3CGMA 3NRKA 4Q7NA 1NMWA 2KI3A 3WD0A 3FAPA 4R5EA 2MLXA 3KAIA 1CTNA 1RD6A 2M2AA 1FKKA 4ZPTR 3WD1A 2OFNA 1N1AA 1J4RA 4PTMA 3O5JA 3AROA 2ESCA 1TCOC 4MNMA 2XP9A 1A7XA 2K8IA 3AS0A 1J4IA 1J4HA 5DIVA 2DSWA 3CGNA 4ODMA 3ARYA 3WQWA 4DZ2A 4Z2JA 3ARTA 4QT3A 2RUCA 4DWSD 1ZBWA 2DT2A 1HKJA 1ROUA 2PV2A 1NWSA 2A3CA 3MDYB 4IT4A 2ZQTA 2RUQA 4N19A 2XP8A 1H0GA 4ODPA 4P8VA 3ARRA 4WJXA 3KACA 4DRMA 1OGGA 3OA5A 1FKLA 3O5KA 4IPXA 2MF9A 1E9LA 2Q5AA 3O5LA 3O5IA 5GQBA 3RFWA 1PINA 1E6RA 2KGJA 2XPBA 3PRDA 4DRHA 2F21A 1W1VA 4JFKA 3EY6A 2FAPA 2XP5A 4TW8A 3WIJA 3KCEA 1NH6A 2O92A 3OOBA 3RM8A 5DF0A 4MSPA 3LUOA 3UQAA 3TCZA 4TW6A 3G6MA 3W4RA 2PPPA 1FD9A 3I6CA 4TX0A 1UR9A 4JYSA 2KO7A 4WIWA 2B31A 1W1TA 2M1IA 4ODKA 4ODLA 2MLYA 4MTVA 5I98A 3CHCA 3JYJA 5BXJA 1EDQA 2JZVA 3KAGA 2FDMA 2G8ZA 2F2DA 3WL1A 1FFRA 2N87A 4TYOA 1JNEA 3B7XA 5HT1A 3KAFA 5DITA 2MLZA 4LAWA 5HW6A 1D6OA 1QPLA 4LAYA 2DT0A 3QOKA 1GOIA 2DT1A 1FFQA 1E6NA 3NI6A 3KAHA 4HBOA 3G6LA 2ZQUA 2QF8A 3O5QA 3KABA 1Q6UA 1EQ3A 2RSEA 1W9VA 2RUDA 3B9DA 2PV3A 5J6EA 5JH8A 3IHZA 2WM0A 1D2KA 1LL6A 3UI6A 4DWSA 4MNLA 5HWCA 2ZR4A 3B9AA 2WLZA 4Q22A 2M08A 3TC5A 3KADA 4W9OA 1ZU8A 2AWGA 3AS1A 3IKDA 4ZS6A 1M5YA 4HBEA 4L72B 4IT6A 3AS3A 4DIPA 1W26A 1X6LA 4DRKA 5DO2A 1FKTA 2VCDA 1E15A 4FN2A 2ZQSA 4TW7A 1ROTA 1SR0A 2IUZA 3KZ7A 2MPHA 2YBUA 5B8IC 3RM9A 4C02B 4QT2A 1WAWA 3O5FA 4DRIA 1OWQA 1R9HA 1YATA 3CHEA 4LGXA 4KR0B 2LPVA 1QPFA 4WKFA 4JFJA 4Z2IA 2ZR6A 3WD4A 2PPOA 2IF4A 4LAXA 4WKAA 5HKGA 1FAPA 1ZBKA 2DSVA 3ODKA 3CH9A 4JFIA 2YBTA 4W5UA 2L2SA 1LQ0A 5HBFA 2LGOA 3IK8A 1NWTA 4G50A 3ARWA 5D75A 3O5OA 3WH0A 3FXYA 4W9PA 2DSUA 2MNTA 3PRAA 1HKIA 3O5EA 1ZBVA 4XAKA 1P5QA 2RURA 4IQCA 3UQBA 2XP6A 2WLYA 1FKFA 3JXVA 3CHFA 4ZPWR 2G41A 4GGQA 4P8XA 4KQZA 1ZCNA 3BXWA 4IQ2A 4U86A 1KFWA 2KE0A 3WD2A 5GPRA 5HW7A 1WNOA 1WB0A 4NZCA 4R0XA 3ARSA 4ODRA 1LG2A 2D9FA 3GPKA 4DRNA 1JVWA 1NWRA 3CHDA 1ZB5A 1O6IA 3CZ8A 3WKZA 4ITZA 3ARQA 4ML4A 4NSBA 4BF8A 3ARUA 4Z2LA 4JFLA 5DIUA 3RM4A 1F40A 4S3KA 3AS2A 1OGBA 1W1PA 4WKHA 1Q6IA 1FKRA 3PR9A 4MAVA 1FJDA 4Z2GA 4QIBA 1HXVA 4WK9A 1ZL1A 1E6PA 1HKKA 4DH0A 1HJWA 5GPGA 2KFWA 3IKGA 2FKEA 4NNRA 4DROA 1FKBA 1QZ2A 2F4EA 3O5DA 1H0IA 1FKJA 1XHGA 5HW8A 4MPKA 2ZR5A 1B6CA 2WK2A 3JYMA 2XP4A 1IX5A 2DG4A 4ODOA 3NTPA 1W9PA 1YW5A 4W9QA 2A3EA 2XP3A 1BL4A 3B8SA 4TNSA 1BKFA 5DEZA 3WL0A 1C9HA 2UZ5A 4HARA 3FY1A 2Y78A 2DPEA 4LAVA 2DSZA 4P8UA 1FKSA 2KR7A 1NSGA 3UQIA 3PRBA 2A3AA 4MGVA 1HJXA 2OLHA 2PV1A 3ARVA 4JFMA 1SYTA 1LJYA 1KT0A 1UR8A 4DWSC 1GPFA 5HWBA 1FKGA 4AY1A 4MNKA 3WD3A 1Q6HA 2DG9A 2VN1A 3PA7A 1L1PA 2ZQVA 1X6NA 4DRPA 4U84A 1U79A 1Y0OA 4O2TA 4MNJA 2LJ4A 1ZK6A 3O5GA 4GIVA 3UI4A 4DZ3A 2A3BA 2DG3A 4Z2HA 3H9RB 3ARXA 1T11A 1LL7A 2O9OA 1GUVA 1NMVA 3ARPA 1D7HA 2XP7A 3B9EA 4P8WA 1D7IA 1LL4A 3O5MA 1Q1CA 1EYMA 1JNTA 1LG1A 4Z2KA 1FKIA 3ALGA 3RMEA 4ODNA 2ITKA 1JNSA 3TDBA 1W1YA 4DRQA 3VAWA 4G2PA 4FAPA 4J4OA 5HUAA 1ZBCA 3ALFA 1JNDA 2XPAA 1W9UA 1K9TA 1XRVA 4DRJA 2LKNA 3UI5A 1FKHA 4DWSB 1HJVA 5HTGA 1NWUA 3O5PA 1PBKA 2AOSA 4ODQA 4S3JA 1E6ZA 3O5RA 1HKMA 1VF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPP A;  1FD9 A;  2PPO A;  2IF4 A;  3I6C A;  2XP3 A;  4LAX A;  4TX0 A;  3UF8 A;  4U85 A;  5HKG A;  1BL4 A;  4JYS A;  1FAP A;  3ODK A;  4J4N A;  4JFI A;  2KO7 A;  1D7J A;  1J6Y A;  4TNS A;  2L2S A;  1BKF A;  1C9H A;  2LGO A;  2RQS A;  2UZ5 A;  2M1I A;  3IK8 A;  4ODK A;  4ODL A;  2PPN A;  2MLY A;  4G50 A;  5D75 A;  5I98 A;  3JYJ A;  4DT4 A;  1FKD A;  5BXJ A;  2Y78 A;  4LAV A;  3O5O A;  2JZV A;  3WH0 A;  1KT1 A;  1FKS A;  2KR7 A;  3KAG A;  4W9P A;  3RGC A;  2MNT A;  1F8A B;  2F2D A;  2PBC A;  3CGM A;  1NSG A;  3NRK A;  3O5E A;  3PRB A;  3UQI A;  2N87 A;  1P5Q A;  2RUR A;  1NMW A;  4IQC A;  3UQB A;  4TYO A;  4DRJ A;  4MGV A;  2XP6 A;  3B7X A;  2KI3 A;  5HT1 A;  3KAF A;  1FKF A;  3JXV A;  2MLZ A;  2PV1 A;  4JFM A;  5DIT A;  3FAP A;  4GGQ A;  4LAW A;  5HW6 A;  1D6O A;  1QPL A;  1ZCN A;  4LAY A;  1KT0 A;  2MLX A;  4IQ2 A;  4U86 A;  3KAI A;  2KE0 A;  5HWB A;  5HW7 A;  3NI6 A;  2M2A A;  1FKG A;  1FKK A;  2OFN A;  3KAH A;  1N1A A;  1J4R A;  4R0X A;  2ZQU A;  1Q6H A;  2DG9 A;  2VN1 A;  1Q6U A;  3KAB A;  3O5J A;  3O5Q A;  3PA7 A;  2D9F A;  4ODR A;  1EQ3 A;  2RSE A;  1TCO C;  3GPK A;  4DRN A;  1JVW A;  2ZQV A;  2RUD A;  4DRP A;  2XP9 A;  1L1P A;  1A7X A;  2PV3 A;  5J6E A;  2K8I A;  4U84 A;  1J4I A;  1J4H A;  1U79 A;  1Y0O A;  3IHZ A;  3CGN A;  5DIV A;  4ODM A;  4O2T A;  4DZ2 A;  4QT3 A;  3UI6 A;  2LJ4 A;  1ZK6 A;  2RUC A;  3O5G A;  4GIV A;  4ITZ A;  2ZR4 A;  3UI4 A;  5HWC A;  4DZ3 A;  5B8I C;  4BF8 A;  2DG3 A;  2M08 A;  3H9R B;  1ROU A;  4JFL A;  5DIU A;  1F40 A;  2PV2 A;  1T11 A;  1NMV A;  3TC5 A;  3MDY B;  3KAD A;  2ZQT A;  1D7H A;  2XP7 A;  4W9O A;  2RUQ A;  2AWG A;  1D7I A;  4N19 A;  1Q6I A;  3IKD A;  3O5M A;  1FKR A;  2XP8 A;  4ODP A;  1Q1C A;  1M5Y A;  1EYM A;  1JNT A;  1FJD A;  3KAC A;  4DIP A;  4DRM A;  4QIB A;  1FKI A;  1W26 A;  4ODN A;  1HXV A;  2ITK A;  1JNS A;  1FKL A;  3O5K A;  4IPX A;  3TDB A;  4DRK A;  2MF9 A;  1FKT A;  2VCD A;  2Q5A A;  3O5L A;  3O5I A;  4DH0 A;  4FN2 A;  3VAW A;  2ZQS A;  4TW7 A;  4G2P A;  4DRQ A;  4FAP A;  5GPG A;  3RFW A;  1PIN A;  1ROT A;  2KGJ A;  4J4O A;  2KFW A;  2XPB A;  3IKG A;  2FKE A;  4NNR A;  5HUA A;  3PRD A;  4DRH A;  3KZ7 A;  2F21 A;  2XPA A;  4DRO A;  4JFK A;  2MPH A;  1FKB A;  3EY6 A;  2LKN A;  3UI5 A;  2FAP A;  2XP5 A;  1QZ2 A;  4TW8 A;  2F4E A;  3O5D A;  4C02 B;  1FKH A;  1FKJ A;  4QT2 A;  5HW8 A;  3KCE A;  3O5F A;  4DRI A;  2ZR5 A;  5HTG A;  1R9H A;  1B6C A;  1YAT A;  3OOB A;  3JYM A;  3UQA A;  4MSP A;  3LUO A;  3O5P A;  2LPV A;  1PBK A;  2XP4 A;  2DG4 A;  4ODQ A;  1QPF A;  4JFJ A;  4ODO A;  3O5R A;  4TW6 A;  3TCZ A;  3NTP A;  1YW5 A;  2ZR6 A;  4W9Q A; 
#chains in the Genus database with same CATH topology
 2DT3 A;  3AQU A;  4QZV B;  3UF8 A;  4U85 A;  1ITX A;  4J4N A;  3WQV A;  1D7J A;  4URI A;  1J6Y A;  2F23 A;  1EHN A;  2RQS A;  4L3N A;  2PPN A;  4DT4 A;  1FKD A;  1EIB A;  4ZPV R;  1KT1 A;  3ARZ A;  1TFV A;  3RGC A;  1F8A B;  2PBC A;  2PI6 A;  3CGM A;  3NRK A;  4Q7N A;  1NMW A;  2KI3 A;  3WD0 A;  3FAP A;  4R5E A;  2MLX A;  3KAI A;  1CTN A;  1RD6 A;  2M2A A;  1FKK A;  4ZPT R;  3WD1 A;  2OFN A;  3BMB A;  1N1A A;  1J4R A;  4PTM A;  3O5J A;  3ARO A;  2ESC A;  1TCO C;  4MNM A;  2XP9 A;  1A7X A;  2K8I A;  3AS0 A;  1J4I A;  1J4H A;  5DIV A;  2DSW A;  3CGN A;  4ODM A;  3ARY A;  3WQW A;  4DZ2 A;  4Z2J A;  3ART A;  4QT3 A;  2RUC A;  4DWS D;  1ZBW A;  2DT2 A;  1HKJ A;  1ROU A;  2PV2 A;  1NWS A;  2A3C A;  3MDY B;  4IT4 A;  2ZQT A;  2RUQ A;  4N19 A;  2XP8 A;  1H0G A;  4ODP A;  4P8V A;  3ARR A;  4WJX A;  3KAC A;  4DRM A;  2PN0 A;  1OGG A;  3OA5 A;  1FKL A;  3O5K A;  4IPX A;  2MF9 A;  1E9L A;  2Q5A A;  3O5L A;  3O5I A;  5GQB A;  3RFW A;  1PIN A;  1E6R A;  2KGJ A;  2XPB A;  3PRD A;  4DRH A;  2F21 A;  1W1V A;  4JFK A;  3EY6 A;  2FAP A;  2XP5 A;  4TW8 A;  3WIJ A;  3KCE A;  1NH6 A;  2O92 A;  3OOB A;  3RM8 A;  5DF0 A;  4MSP A;  3LUO A;  3UQA A;  3TCZ A;  4TW6 A;  3G6M A;  3W4R A;  2PPP A;  1FD9 A;  3I6C A;  4TX0 A;  1UR9 A;  4JYS A;  2KO7 A;  4WIW A;  2B31 A;  1W1T A;  2M1I A;  3EIP A;  4ODK A;  4ODL A;  2MLY A;  4MTV A;  5I98 A;  3CHC A;  3JYJ A;  5BXJ A;  1EDQ A;  2JZV A;  3KAG A;  2FDM A;  2G8Z A;  2F2D A;  3WL1 A;  1FFR A;  2N87 A;  4TYO A;  1JNE A;  3B7X A;  5HT1 A;  3KAF A;  5DIT A;  2MLZ A;  3GTY X;  4LAW A;  5HW6 A;  1D6O A;  1QPL A;  4LAY A;  2DT0 A;  3QOK A;  1GOI A;  2DT1 A;  1FFQ A;  1E6N A;  3NI6 A;  3KAH A;  4HBO A;  3G6L A;  2ZQU A;  2QF8 A;  3O5Q A;  3KAB A;  1Q6U A;  1EQ3 A;  2RSE A;  1W9V A;  2RUD A;  3B9D A;  2PV3 A;  5J6E A;  5JH8 A;  3IHZ A;  2WM0 A;  1D2K A;  1LL6 A;  3UI6 A;  4DWS A;  4MNL A;  5HWC A;  2ZR4 A;  3B9A A;  1E44 A;  2WLZ A;  4Q22 A;  2M08 A;  3TC5 A;  3KAD A;  4W9O A;  1ZU8 A;  2AWG A;  3AS1 A;  3IKD A;  4ZS6 A;  1M5Y A;  4HBE A;  4L72 B;  4IT6 A;  3AS3 A;  4DIP A;  1W26 A;  1X6L A;  4DRK A;  5DO2 A;  1FKT A;  2VCD A;  1E15 A;  4FN2 A;  2ZQS A;  4TW7 A;  1ROT A;  1SR0 A;  2IUZ A;  3KZ7 A;  2MPH A;  2YBU A;  5B8I C;  3RM9 A;  4C02 B;  4QT2 A;  1WAW A;  3O5F A;  4DRI A;  1OWQ A;  1R9H A;  1YAT A;  3CHE A;  4LGX A;  4KR0 B;  2LPV A;  1QPF A;  4WKF A;  4JFJ A;  4Z2I A;  2ZR6 A;  2P4V A;  3WD4 A;  2PPO A;  2IF4 A;  4LAX A;  4WKA A;  5HKG A;  1FAP A;  1ZBK A;  2DSV A;  3ODK A;  3CH9 A;  4JFI A;  2YBT A;  4W5U A;  2L2S A;  1LQ0 A;  5HBF A;  2LGO A;  3IK8 A;  1NWT A;  4UDM A;  4G50 A;  3ARW A;  5D75 A;  3O5O A;  3WH0 A;  3FXY A;  4W9P A;  2DSU A;  2MNT A;  3PRA A;  1HKI A;  3O5E A;  1ZBV A;  4XAK A;  1P5Q A;  2RUR A;  4IQC A;  3UQB A;  2XP6 A;  2WLY A;  1FKF A;  3JXV A;  3CHF A;  4ZPW R;  2G41 A;  4GGQ A;  4P8X A;  4KQZ A;  1ZCN A;  3BXW A;  4IQ2 A;  4U86 A;  1KFW A;  2KE0 A;  3WD2 A;  5GPR A;  5HW7 A;  1WNO A;  1WB0 A;  4NZC A;  4R0X A;  3ARS A;  4ODR A;  1LG2 A;  2D9F A;  3GPK A;  4DRN A;  1JVW A;  1NWR A;  3GU0 A;  3CHD A;  1ZB5 A;  1O6I A;  3CZ8 A;  3WKZ A;  4ITZ A;  3ARQ A;  4ML4 A;  4NSB A;  4BF8 A;  3ARU A;  4Z2L A;  4JFL A;  5DIU A;  3RM4 A;  1F40 A;  4S3K A;  3AS2 A;  1OGB A;  1W1P A;  4WKH A;  1Q6I A;  2EUL A;  1FKR A;  3PR9 A;  4MAV A;  1FJD A;  4Z2G A;  4QIB A;  1HXV A;  4WK9 A;  2ETN A;  1ZL1 A;  1E6P A;  1HKK A;  4DH0 A;  1HJW A;  5GPG A;  2KFW A;  3IKG A;  2FKE A;  4NNR A;  4DRO A;  1FKB A;  1QZ2 A;  2F4E A;  3O5D A;  1H0I A;  1FKJ A;  1XHG A;  5HW8 A;  4MPK A;  2ZR5 A;  1B6C A;  2WK2 A;  3JYM A;  2XP4 A;  1IX5 A;  2DG4 A;  4ODO A;  1W9P A;  3NTP A;  1YW5 A;  4W9Q A;  2A3E A;  2XP3 A;  1BL4 A;  3B8S A;  2B5U B;  4TNS A;  1BKF A;  5DEZ A;  3WL0 A;  1C9H A;  2UZ5 A;  4HAR A;  3FY1 A;  1JCH B;  2Y78 A;  2DPE A;  4LAV A;  2DSZ A;  4P8U A;  1FKS A;  2KR7 A;  1NSG A;  3UQI A;  3PRB A;  2A3A A;  4MGV A;  1HJX A;  2OLH A;  2PV1 A;  3ARV A;  4JFM A;  1SYT A;  1LJY A;  1KT0 A;  1UR8 A;  4DWS C;  1GPF A;  5HWB A;  1FKG A;  4AY1 A;  4MNK A;  3WD3 A;  1Q6H A;  2DG9 A;  2VN1 A;  3PA7 A;  1L1P A;  2ZQV A;  1X6N A;  4DRP A;  4U84 A;  1U79 A;  1Y0O A;  1GRJ A;  4O2T A;  4MNJ A;  2LJ4 A;  1ZK6 A;  3O5G A;  4GIV A;  3UI4 A;  4DZ3 A;  2A3B A;  2DG3 A;  4Z2H A;  3H9R B;  3ARX A;  1T11 A;  1LL7 A;  2O9O A;  1GUV A;  1NMV A;  3ARP A;  1D7H A;  2XP7 A;  3B9E A;  4P8W A;  1D7I A;  1LL4 A;  3O5M A;  1Q1C A;  1EYM A;  1JNT A;  1LG1 A;  4Z2K A;  1FKI A;  3ALG A;  3RME A;  4ODN A;  2ITK A;  1JNS A;  3TDB A;  1W1Y A;  4DRQ A;  3VAW A;  4G2P A;  4FAP A;  4J4O A;  5HUA A;  1ZBC A;  3ALF A;  1JND A;  2XPA A;  1W9U A;  1K9T A;  1XRV A;  4DRJ A;  2LKN A;  3UI5 A;  1FKH A;  4DWS B;  1HJV A;  5HTG A;  1NWU A;  3O5P A;  1PBK A;  2AOS A;  4ODQ A;  4S3J A;  1E6Z A;  3O5R A;  1HKM A;  1VF8 A; 
#chains in the Genus database with same CATH homology
 2DT3 A;  3AQU A;  4QZV B;  3UF8 A;  4U85 A;  1ITX A;  4J4N A;  3WQV A;  1D7J A;  4URI A;  1J6Y A;  1EHN A;  2RQS A;  4L3N A;  2PPN A;  4DT4 A;  1FKD A;  1EIB A;  4ZPV R;  1KT1 A;  3ARZ A;  1TFV A;  3RGC A;  1F8A B;  2PBC A;  2PI6 A;  3CGM A;  3NRK A;  4Q7N A;  1NMW A;  2KI3 A;  3WD0 A;  3FAP A;  4R5E A;  2MLX A;  3KAI A;  1CTN A;  1RD6 A;  2M2A A;  1FKK A;  4ZPT R;  3WD1 A;  2OFN A;  1N1A A;  1J4R A;  4PTM A;  3O5J A;  3ARO A;  2ESC A;  1TCO C;  4MNM A;  2XP9 A;  1A7X A;  2K8I A;  3AS0 A;  1J4I A;  1J4H A;  5DIV A;  2DSW A;  3CGN A;  4ODM A;  3ARY A;  3WQW A;  4DZ2 A;  4Z2J A;  3ART A;  4QT3 A;  2RUC A;  4DWS D;  1ZBW A;  2DT2 A;  1HKJ A;  1ROU A;  2PV2 A;  1NWS A;  2A3C A;  3MDY B;  4IT4 A;  2ZQT A;  2RUQ A;  4N19 A;  2XP8 A;  1H0G A;  4ODP A;  4P8V A;  3ARR A;  4WJX A;  3KAC A;  4DRM A;  1OGG A;  3OA5 A;  1FKL A;  3O5K A;  4IPX A;  2MF9 A;  1E9L A;  2Q5A A;  3O5L A;  3O5I A;  5GQB A;  3RFW A;  1PIN A;  1E6R A;  2KGJ A;  2XPB A;  3PRD A;  4DRH A;  2F21 A;  1W1V A;  4JFK A;  3EY6 A;  2FAP A;  2XP5 A;  4TW8 A;  3WIJ A;  3KCE A;  1NH6 A;  2O92 A;  3OOB A;  3RM8 A;  5DF0 A;  4MSP A;  3LUO A;  3UQA A;  3TCZ A;  4TW6 A;  3G6M A;  3W4R A;  2PPP A;  1FD9 A;  3I6C A;  4TX0 A;  1UR9 A;  4JYS A;  2KO7 A;  4WIW A;  2B31 A;  1W1T A;  2M1I A;  4ODK A;  4ODL A;  2MLY A;  4MTV A;  5I98 A;  3CHC A;  3JYJ A;  5BXJ A;  1EDQ A;  2JZV A;  3KAG A;  2FDM A;  2G8Z A;  2F2D A;  3WL1 A;  1FFR A;  2N87 A;  4TYO A;  1JNE A;  3B7X A;  5HT1 A;  3KAF A;  5DIT A;  2MLZ A;  4LAW A;  5HW6 A;  1D6O A;  1QPL A;  4LAY A;  2DT0 A;  3QOK A;  1GOI A;  2DT1 A;  1FFQ A;  1E6N A;  3NI6 A;  3KAH A;  4HBO A;  3G6L A;  2ZQU A;  2QF8 A;  3O5Q A;  3KAB A;  1Q6U A;  1EQ3 A;  2RSE A;  1W9V A;  2RUD A;  3B9D A;  2PV3 A;  5J6E A;  5JH8 A;  3IHZ A;  2WM0 A;  1D2K A;  1LL6 A;  3UI6 A;  4DWS A;  4MNL A;  5HWC A;  2ZR4 A;  3B9A A;  2WLZ A;  4Q22 A;  2M08 A;  3TC5 A;  3KAD A;  4W9O A;  1ZU8 A;  2AWG A;  3AS1 A;  3IKD A;  4ZS6 A;  1M5Y A;  4HBE A;  4L72 B;  4IT6 A;  3AS3 A;  4DIP A;  1W26 A;  1X6L A;  4DRK A;  5DO2 A;  1FKT A;  2VCD A;  1E15 A;  4FN2 A;  2ZQS A;  4TW7 A;  1ROT A;  1SR0 A;  2IUZ A;  3KZ7 A;  2MPH A;  2YBU A;  5B8I C;  3RM9 A;  4C02 B;  4QT2 A;  1WAW A;  3O5F A;  4DRI A;  1OWQ A;  1R9H A;  1YAT A;  3CHE A;  4LGX A;  4KR0 B;  2LPV A;  1QPF A;  4WKF A;  4JFJ A;  4Z2I A;  2ZR6 A;  3WD4 A;  2PPO A;  2IF4 A;  4LAX A;  4WKA A;  5HKG A;  1FAP A;  1ZBK A;  2DSV A;  3ODK A;  3CH9 A;  4JFI A;  2YBT A;  4W5U A;  2L2S A;  1LQ0 A;  5HBF A;  2LGO A;  3IK8 A;  1NWT A;  4G50 A;  3ARW A;  5D75 A;  3O5O A;  3WH0 A;  3FXY A;  4W9P A;  2DSU A;  2MNT A;  3PRA A;  1HKI A;  3O5E A;  1ZBV A;  4XAK A;  1P5Q A;  2RUR A;  4IQC A;  3UQB A;  2XP6 A;  2WLY A;  1FKF A;  3JXV A;  3CHF A;  4ZPW R;  2G41 A;  4GGQ A;  4P8X A;  4KQZ A;  1ZCN A;  3BXW A;  4IQ2 A;  4U86 A;  1KFW A;  2KE0 A;  3WD2 A;  5GPR A;  5HW7 A;  1WNO A;  1WB0 A;  4NZC A;  4R0X A;  3ARS A;  4ODR A;  1LG2 A;  2D9F A;  3GPK A;  4DRN A;  1JVW A;  1NWR A;  3CHD A;  1ZB5 A;  1O6I A;  3CZ8 A;  3WKZ A;  4ITZ A;  3ARQ A;  4ML4 A;  4NSB A;  4BF8 A;  3ARU A;  4Z2L A;  4JFL A;  5DIU A;  3RM4 A;  1F40 A;  4S3K A;  3AS2 A;  1OGB A;  1W1P A;  4WKH A;  1Q6I A;  1FKR A;  3PR9 A;  4MAV A;  1FJD A;  4Z2G A;  4QIB A;  1HXV A;  4WK9 A;  1ZL1 A;  1E6P A;  1HKK A;  4DH0 A;  1HJW A;  5GPG A;  2KFW A;  3IKG A;  2FKE A;  4NNR A;  4DRO A;  1FKB A;  1QZ2 A;  2F4E A;  3O5D A;  1H0I A;  1FKJ A;  1XHG A;  5HW8 A;  4MPK A;  2ZR5 A;  1B6C A;  2WK2 A;  3JYM A;  2XP4 A;  1IX5 A;  2DG4 A;  4ODO A;  3NTP A;  1W9P A;  1YW5 A;  4W9Q A;  2A3E A;  2XP3 A;  1BL4 A;  3B8S A;  4TNS A;  1BKF A;  5DEZ A;  3WL0 A;  1C9H A;  2UZ5 A;  4HAR A;  3FY1 A;  2Y78 A;  2DPE A;  4LAV A;  2DSZ A;  4P8U A;  1FKS A;  2KR7 A;  1NSG A;  3UQI A;  3PRB A;  2A3A A;  4MGV A;  1HJX A;  2OLH A;  2PV1 A;  3ARV A;  4JFM A;  1SYT A;  1LJY A;  1KT0 A;  1UR8 A;  4DWS C;  1GPF A;  5HWB A;  1FKG A;  4AY1 A;  4MNK A;  3WD3 A;  1Q6H A;  2DG9 A;  2VN1 A;  3PA7 A;  1L1P A;  2ZQV A;  1X6N A;  4DRP A;  4U84 A;  1U79 A;  1Y0O A;  4O2T A;  4MNJ A;  2LJ4 A;  1ZK6 A;  3O5G A;  4GIV A;  3UI4 A;  4DZ3 A;  2A3B A;  2DG3 A;  4Z2H A;  3H9R B;  3ARX A;  1T11 A;  1LL7 A;  2O9O A;  1GUV A;  1NMV A;  3ARP A;  1D7H A;  2XP7 A;  3B9E A;  4P8W A;  1D7I A;  1LL4 A;  3O5M A;  1Q1C A;  1EYM A;  1JNT A;  1LG1 A;  4Z2K A;  1FKI A;  3ALG A;  3RME A;  4ODN A;  2ITK A;  1JNS A;  3TDB A;  1W1Y A;  4DRQ A;  3VAW A;  4G2P A;  4FAP A;  4J4O A;  5HUA A;  1ZBC A;  3ALF A;  1JND A;  2XPA A;  1W9U A;  1K9T A;  1XRV A;  4DRJ A;  2LKN A;  3UI5 A;  1FKH A;  4DWS B;  1HJV A;  5HTG A;  1NWU A;  3O5P A;  1PBK A;  2AOS A;  4ODQ A;  4S3J A;  1E6Z A;  3O5R A;  1HKM A;  1VF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...