3O5RA

Complex of fk506 with the fk1 domain mutant a19t of fkbp51
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5rA00
2XPAA 2XP8A 3KACA 2ITKA 3OOBA 5HW6A 3IK8A 3KAGA 1R9HA 3NRKA 1U79A 2KO7A 3O5MA 5GPGA 2MLZA 5BXJA 3UQAA 1F40A 1EYMA 2ZR5A 4ODLA 4DRQA 2VCDA 1YATA 3CGMA 4W9PA 2MLXA 4MGVA 4DRJA 1BKFA 4DRKA 3PA7A 2XP9A 2LPVA 3O5EA 1BL4A 1FAPA 2RSEA 3UQIA 3EY6A 4DRPA 2XP7A 3UI6A 1M5YA 1FKDA 3NI6A 4JFJA 3IKGA 4JFLA 4W9OA 2L2SA 1C9HA 2Q5AA 2ZQTA 2FKEA 3FAPA 2IF4A 4GGQA 5I98A 1Q6HA 2UZ5A 1JNTA 3MDYB 1Y0OA 5DITA 4DRMA 5HWBA 1FKJA 3KADA 4O2TA 1KT1A 2PPPA 3O5LA 4TNSA 1EQ3A 2PPOA 2DG3A 2M2AA 4DZ2A 4JFMA 1F8AB 1N1AA 1QZ2A 2F4EA 3KCEA 4LAWA 4QT2A 4FN2A 1B6CA 1D6OA 2XP6A 4LAXA 2XP3A 4ODQA 2LKNA 1J6YA 3GPKA 3O5OA 1J4IA 2M08A 1FJDA 3NTPA 4G50A 5HW7A 2F2DA 3ODKA 3JXVA 4QT3A 1FD9A 1NSGA 2XP5A 4NNRA 2RUQA 2ZQVA 4TW7A 4U84A 5DIVA 5HT1A 4DH0A 1D7JA 3CGNA 3O5IA 3JYMA 2MPHA 1JNSA 3H9RB 1Q6IA 2KE0A 3UF8A 1FKHA 5J6EA 4J4NA 2PV3A 3KAFA 5D75A 3WH0A 2XPBA 1ZK6A 1ZCNA 2MLYA 4C02B 1ROTA 4TW8A 4JFKA 2D9FA 2KFWA 1PINA 1FKGA 3O5KA 4QIBA 1FKBA 4DZ3A 2PPNA 3TCZA 3TDBA 3UQBA 3IKDA 2FAPA 1P5QA 4BF8A 2ZQSA 3IHZA 4LAYA 4DRIA 4DIPA 2JZVA 3RGCA 1QPLA 2PV1A 4DT4A 1FKSA 4LAVA 2MF9A 4TX0A 5HTGA 3RFWA 1QPFA 3I6CA 4IQ2A 4TW6A 4U85A 2VN1A 5B8IC 1D7IA 1NMVA 1J4RA 5HKGA 2PV2A 2M1IA 1D7HA 1ROUA 1JVWA 3O5PA 2AWGA 1FKTA 4IQCA 2DG9A 2ZR4A 3UI5A 2K8IA 3KAHA 1FKLA 4IPXA 4GIVA 3TC5A 2ZQUA 3KZ7A 2F21A 4ITZA 5DIUA 4DROA 4W9QA 2KR7A 3KAIA 1PBKA 3O5FA 5HW8A 4J4OA 2PBCA 1L1PA 1FKIA 1Q6UA 3O5RA 2N87A 2OFNA 1TCOC 3PRBA 1A7XA 4FAPA 2KGJA 3O5DA 4ODOA 2ZR6A 1FKFA 4JYSA 3PRDA 4G2PA 3O5QA 2XP4A 3VAWA 4MSPA 1YW5A 1Q1CA 3JYJA 2RURA 4TYOA 4U86A 1KT0A 4JFIA 3KABA 1W26A 1FKKA 2DG4A 3LUOA 2MNTA 4ODNA 2KI3A 2LJ4A 1NMWA 3UI4A 5HUAA 2Y78A 4ODMA 3B7XA 4ODRA 1HXVA 2LGOA 4DRHA 2RUDA 1T11A 2RQSA 1J4HA 3O5GA 4N19A 4ODPA 4R0XA 5HWCA 1FKRA 4DRNA 3O5JA 2RUCA 4ODKA
chains in the Genus database with same CATH superfamily
2DPEA 4S3JA 3KAGA 3AS0A 3O5MA 1EHNA 5DF0A 4DRQA 2VCDA 1YATA 2B5UB 1BL4A 1FAPA 4DRPA 3EY6A 2DT2A 1NWSA 2XP7A 2DT1A 3IKGA 3PRAA 2EULA 2L2SA 2Q5AA 1OWQA 4GGQA 4DWSC 3MDYB 4NSBA 2PI6A 3ARVA 1FKJA 4O2TA 2PPPA 3AS1A 1EQ3A 2PPOA 4Z2JA 4DZ2A 1QZ2A 3KCEA 4DWSD 3WL0A 4ZPVR 3BXWA 4WKAA 1SR0A 3AROA 1JNDA 2M08A 3NTPA 2F2DA 1FD9A 4NNRA 2XP5A 4U84A 5DIVA 2F23A 3CGNA 1HKMA 2WLZA 2DSWA 1Q6IA 1ZBWA 4Z2HA 2PV3A 3KAFA 1CTNA 4DWSA 4LGXA 4W5UA 4JFKA 2KFWA 1PINA 3PR9A 4P8XA 3ARQA 3ARWA 4BF8A 3IHZA 1NWTA 4LAYA 4ZPWR 1D7IA 3W4RA 2PV2A 2M1IA 3O5PA 3EIPA 1EDQA 5DIUA 5HBFA 4ZPTR 2KR7A 3WD1A 4Z2LA 1HKJA 1WNOA 1XHGA 1TCOC 3O5DA 4JYSA 3ALGA 4UDMA 3O5QA 3VAWA 4TYOA 4JFIA 3KABA 1W26A 1FKKA 2KI3A 2LJ4A 1NMWA 1NWRA 1HXVA 1ZB5A 3O5GA 1J4HA 1UR9A 4DRNA 1NH6A 4ODKA 3NRKA 1U79A 1LJYA 2YBUA 1F40A 2MLXA 2XP9A 3ARZA 3UI6A 4Z2KA 4JFLA 1E9LA 4W9OA 5GPRA 1W1PA 2ZQTA 3CH9A 1JNTA 4WKFA 1Y0OA 4MAVA 4MNMA 4DRMA 2WM0A 3KADA 1KT1A 3O5LA 4P8VA 4Z2GA 4LAWA 3ARSA 1B6CA 1D6OA 2XP6A 2LKNA 1J6YA 1J4IA 1X6LA 4ML4A 1FJDA 5HW7A 3ODKA 3QOKA 3CHDA 5HT1A 4DH0A 2ZQVA 1JNSA 2KE0A 1FKHA 5J6EA 3WH0A 2MLYA 1ROTA 3AQUA 4TW8A 5JH8A 1FKBA 3B9DA 3TDBA 3UQBA 3IKDA 1P5QA 3ARPA 4DIPA 4IT6A 1QPLA 1FKSA 4P8UA 4LAVA 4R5EA 3CHEA 4TX0A 4TW6A 3I6CA 1ZBKA 5B8IC 2P4VA 1D2KA 1FKTA 3ARXA 4IPXA 3WD3A 1W9VA 4MPKA 4HBEA 1H0GA 3ARTA 3FXYA 3KAIA 1PBKA 1O6IA 4MNJA 4L72B 3G6LA 1XRVA 2N87A 2OFNA 1LG2A 4HARA 4FAPA 2ZR6A 1FKFA 1ZL1A 3AS2A 1Q1CA 3OA5A 3JYJA 1ZU8A 2A3BA 3LUOA 1GOIA 2MNTA 4ODNA 1IX5A 1WAWA 5HUAA 3B7XA 5GQBA 2LGOA 1JNEA 2RUDA 3RMEA 4DRHA 4ODPA 4R0XA 1FKRA 4L3NA 1W1TA 1HKIA 3CZ8A 4AY1A 5HW6A 3IK8A 1HJXA 2MLZA 3WQVA 2ZR5A 4ODLA 2G41A 4W9PA 4DRJA 1BKFA 4DRKA 2LPVA 3O5EA 1FFRA 1FKDA 1W9UA 3WD4A 1W9PA 2FKEA 2PN0A 1Q6HA 2WLYA 4MNKA 3FY1A 3B9AA 1LL4A 5DITA 1UR8A 4KR0B 2DG3A 4JFMA 4QT2A 2F4EA 4FN2A 4WJXA 1SYTA 3B8SA 2XP3A 1OGBA 4G50A 3JXVA 2RUQA 4TW7A 1D7JA 3JYMA 4WIWA 2O9OA 2YBTA 3BMBA 3WQWA 3UF8A 2DSUA 3RM8A 2DSVA 4J4NA 4Z2IA 1JCHB 4C02B 4XAKA 3O5KA 1FKGA 4QIBA 1RD6A 2FAPA 2ZQSA 3WL1A 4DT4A 2MF9A 1ITXA 1QPFA 2ESCA 4U85A 2VN1A 1J4RA 2K8IA 3KZ7A 2F21A 4DROA 3ARYA 2O92A 1LQ0A 3O5FA 1W1VA 2PBCA 1HKKA 1FKIA 2AOSA 1GPFA 2OLHA 2KGJA 4ODOA 4DWSB 3PRDA 1E6NA 4G2PA 4Q7NA 2XP4A 4MSPA 3CHFA 1YW5A 1KFWA 2DG4A 3CHCA 2DSZA 1E6ZA 2Y78A 4ODRA 1T11A 1W1YA 4N19A 1GUVA 3WD2A 1EIBA 3O5JA 1E6RA 2RUCA 4S3KA 3AS3A 2XPAA 2XP8A 3KACA 2ITKA 4Q22A 1OGGA 3OOBA 1R9HA 2KO7A 4URIA 5GPGA 5BXJA 3UQAA 1EYMA 1ZBVA 1WB0A 3CGMA 4MGVA 3PA7A 2RSEA 3UQIA 1E6PA 1M5YA 3NI6A 2A3EA 4JFJA 1E15A 1C9HA 3FAPA 2IF4A 5I98A 1HJVA 4MTVA 2UZ5A 1H0IA 5HWBA 1TFVA 1HJWA 4IT4A 4P8WA 4TNSA 4NZCA 2A3CA 5DO2A 3G6MA 2M2AA 1F8AB 1N1AA 1ZBCA 2G8ZA 3GTYX 4LAXA 4ODQA 3GPKA 1GRJA 3O5OA 3ARRA 4QT3A 1VF8A 1NSGA 3O5IA 2MPHA 2WK2A 1LL7A 3H9RB 3WIJA 3WD0A 3ARUA 5D75A 2XPBA 1ZK6A 1ZCNA 2D9FA 4DZ3A 4WKHA 2PPNA 3RM4A 1E44A 3TCZA 1LL6A 4DRIA 2JZVA 3RGCA 2PV1A 1FFQA 2DT0A 5HTGA 3RFWA 1NWUA 4IQ2A 1NMVA 5HKGA 3B9EA 1D7HA 1ROUA 1JVWA 2AWGA 4IQCA 2DG9A 3RM9A 2ZR4A 3UI5A 3KAHA 1FKLA 2DT3A 4GIVA 3TC5A 2ZQUA 5DEZA 1LG1A 4ITZA 4W9QA 4KQZA 5HW8A 2IUZA 4J4OA 2QF8A 1L1PA 1Q6UA 3O5RA 3PRBA 1A7XA 1K9TA 1X6NA 2FDMA 4WK9A 4ZS6A 4QZVB 3GU0A 2RURA 4U86A 1KT0A 2ETNA 3UI4A 2A3AA 4ODMA 2B31A 2RQSA 5HWCA 4HBOA 3WKZA 4MNLA 3ALFA 4PTMA
chains in the Genus database with same CATH topology
2DPEA 4S3JA 3KAGA 3AS0A 3O5MA 1EHNA 5DF0A 4DRQA 2VCDA 1YATA 1BL4A 1FAPA 4DRPA 3EY6A 2DT2A 1NWSA 2XP7A 2DT1A 3IKGA 3PRAA 2L2SA 2Q5AA 1OWQA 4GGQA 4DWSC 3MDYB 4NSBA 2PI6A 3ARVA 1FKJA 4O2TA 2PPPA 3AS1A 1EQ3A 2PPOA 4Z2JA 4DZ2A 1QZ2A 3KCEA 4DWSD 3WL0A 4ZPVR 3BXWA 4WKAA 1SR0A 3AROA 1JNDA 2M08A 3NTPA 2F2DA 1FD9A 4NNRA 2XP5A 4U84A 5DIVA 3CGNA 1HKMA 2WLZA 2DSWA 1Q6IA 1ZBWA 4Z2HA 2PV3A 3KAFA 1CTNA 4DWSA 4LGXA 4W5UA 4JFKA 2KFWA 1PINA 3PR9A 4P8XA 3ARQA 3ARWA 4BF8A 3IHZA 1NWTA 4LAYA 4ZPWR 1D7IA 3W4RA 2PV2A 2M1IA 3O5PA 1EDQA 5DIUA 5HBFA 4ZPTR 2KR7A 3WD1A 4Z2LA 1HKJA 1WNOA 1XHGA 1TCOC 3O5DA 4JYSA 3ALGA 3O5QA 3VAWA 4TYOA 4JFIA 3KABA 1W26A 1FKKA 2KI3A 2LJ4A 1NMWA 1NWRA 1HXVA 1ZB5A 3O5GA 1J4HA 1UR9A 4DRNA 1NH6A 4ODKA 3NRKA 1U79A 1LJYA 2YBUA 1F40A 2MLXA 2XP9A 3ARZA 3UI6A 4Z2KA 4JFLA 1E9LA 4W9OA 5GPRA 1W1PA 2ZQTA 3CH9A 1JNTA 4WKFA 1Y0OA 4MAVA 4MNMA 4DRMA 2WM0A 3KADA 1KT1A 3O5LA 4P8VA 4Z2GA 4LAWA 3ARSA 1B6CA 1D6OA 2XP6A 2LKNA 1J6YA 1J4IA 1X6LA 4ML4A 1FJDA 5HW7A 3ODKA 3QOKA 3CHDA 5HT1A 4DH0A 2ZQVA 1JNSA 2KE0A 1FKHA 5J6EA 3WH0A 2MLYA 1ROTA 3AQUA 4TW8A 5JH8A 1FKBA 3B9DA 3TDBA 3UQBA 3IKDA 1P5QA 3ARPA 4DIPA 4IT6A 1QPLA 1FKSA 4P8UA 4LAVA 4R5EA 3CHEA 4TX0A 4TW6A 3I6CA 1ZBKA 5B8IC 1D2KA 1FKTA 3ARXA 4IPXA 3WD3A 1W9VA 4MPKA 4HBEA 1H0GA 3ARTA 3FXYA 3KAIA 1PBKA 1O6IA 4MNJA 4L72B 3G6LA 1XRVA 2N87A 2OFNA 1LG2A 4HARA 4FAPA 2ZR6A 1FKFA 1ZL1A 3AS2A 1Q1CA 3OA5A 3JYJA 1ZU8A 2A3BA 3LUOA 1GOIA 2MNTA 4ODNA 1IX5A 1WAWA 5HUAA 3B7XA 5GQBA 2LGOA 1JNEA 2RUDA 3RMEA 4DRHA 4ODPA 4R0XA 1FKRA 4L3NA 1W1TA 1HKIA 3CZ8A 4AY1A 5HW6A 3IK8A 1HJXA 2MLZA 3WQVA 2ZR5A 4ODLA 2G41A 4W9PA 4DRJA 1BKFA 4DRKA 2LPVA 3O5EA 1FFRA 1FKDA 1W9UA 3WD4A 1W9PA 2FKEA 1Q6HA 2WLYA 4MNKA 3FY1A 3B9AA 1LL4A 5DITA 1UR8A 4KR0B 2DG3A 4JFMA 4QT2A 2F4EA 4FN2A 4WJXA 1SYTA 3B8SA 2XP3A 1OGBA 4G50A 3JXVA 2RUQA 4TW7A 1D7JA 3JYMA 4WIWA 2O9OA 2YBTA 3WQWA 3UF8A 2DSUA 3RM8A 2DSVA 4J4NA 4Z2IA 4C02B 4XAKA 3O5KA 1FKGA 4QIBA 1RD6A 2FAPA 2ZQSA 3WL1A 4DT4A 2MF9A 1ITXA 1QPFA 2ESCA 4U85A 2VN1A 1J4RA 2K8IA 3KZ7A 2F21A 4DROA 3ARYA 2O92A 1LQ0A 3O5FA 1W1VA 2PBCA 1HKKA 1FKIA 2AOSA 1GPFA 2OLHA 2KGJA 4ODOA 4DWSB 3PRDA 1E6NA 4G2PA 4Q7NA 2XP4A 4MSPA 3CHFA 1YW5A 1KFWA 2DG4A 3CHCA 2DSZA 1E6ZA 2Y78A 4ODRA 1T11A 1W1YA 4N19A 1GUVA 3WD2A 1EIBA 3O5JA 1E6RA 2RUCA 4S3KA 3AS3A 2XPAA 2XP8A 3KACA 2ITKA 4Q22A 1OGGA 3OOBA 1R9HA 2KO7A 4URIA 5GPGA 5BXJA 3UQAA 1EYMA 1ZBVA 1WB0A 3CGMA 4MGVA 3PA7A 2RSEA 3UQIA 1E6PA 1M5YA 3NI6A 2A3EA 4JFJA 1E15A 1C9HA 3FAPA 2IF4A 5I98A 1HJVA 4MTVA 2UZ5A 1H0IA 5HWBA 1TFVA 1HJWA 4IT4A 4P8WA 4TNSA 4NZCA 2A3CA 5DO2A 3G6MA 2M2AA 1F8AB 1N1AA 1ZBCA 2G8ZA 4LAXA 4ODQA 3GPKA 3O5OA 3ARRA 4QT3A 1VF8A 1NSGA 3O5IA 2MPHA 2WK2A 1LL7A 3H9RB 3WIJA 3WD0A 3ARUA 5D75A 2XPBA 1ZK6A 1ZCNA 2D9FA 4DZ3A 4WKHA 2PPNA 3RM4A 3TCZA 1LL6A 4DRIA 2JZVA 3RGCA 2PV1A 1FFQA 2DT0A 5HTGA 3RFWA 1NWUA 4IQ2A 1NMVA 5HKGA 3B9EA 1D7HA 1ROUA 1JVWA 2AWGA 4IQCA 2DG9A 3RM9A 2ZR4A 3UI5A 3KAHA 1FKLA 2DT3A 4GIVA 3TC5A 2ZQUA 5DEZA 1LG1A 4ITZA 4W9QA 4KQZA 5HW8A 2IUZA 4J4OA 2QF8A 1L1PA 1Q6UA 3O5RA 3PRBA 1A7XA 1K9TA 1X6NA 2FDMA 4WK9A 4ZS6A 4QZVB 2RURA 4U86A 1KT0A 3UI4A 2A3AA 4ODMA 2B31A 2RQSA 5HWCA 4HBOA 3WKZA 4MNLA 3ALFA 4PTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPA A;  2XP8 A;  3KAC A;  2ITK A;  3OOB A;  5HW6 A;  3IK8 A;  3KAG A;  1R9H A;  3NRK A;  1U79 A;  2KO7 A;  3O5M A;  5GPG A;  2MLZ A;  5BXJ A;  3UQA A;  1F40 A;  1EYM A;  2ZR5 A;  4ODL A;  4DRQ A;  2VCD A;  1YAT A;  3CGM A;  4W9P A;  2MLX A;  4MGV A;  4DRJ A;  1BKF A;  4DRK A;  3PA7 A;  2XP9 A;  2LPV A;  3O5E A;  1BL4 A;  1FAP A;  2RSE A;  3UQI A;  3EY6 A;  4DRP A;  2XP7 A;  3UI6 A;  1M5Y A;  1FKD A;  3NI6 A;  4JFJ A;  3IKG A;  4JFL A;  4W9O A;  2L2S A;  1C9H A;  2Q5A A;  2ZQT A;  2FKE A;  3FAP A;  2IF4 A;  4GGQ A;  5I98 A;  1Q6H A;  2UZ5 A;  1JNT A;  3MDY B;  1Y0O A;  5DIT A;  4DRM A;  5HWB A;  1FKJ A;  3KAD A;  4O2T A;  1KT1 A;  2PPP A;  3O5L A;  4TNS A;  1EQ3 A;  2PPO A;  2DG3 A;  2M2A A;  4DZ2 A;  4JFM A;  1F8A B;  1N1A A;  1QZ2 A;  2F4E A;  3KCE A;  4LAW A;  4QT2 A;  4FN2 A;  1B6C A;  1D6O A;  2XP6 A;  4LAX A;  2XP3 A;  4ODQ A;  2LKN A;  1J6Y A;  3GPK A;  3O5O A;  1J4I A;  2M08 A;  1FJD A;  3NTP A;  4G50 A;  5HW7 A;  2F2D A;  3ODK A;  3JXV A;  4QT3 A;  1FD9 A;  1NSG A;  2XP5 A;  4NNR A;  2RUQ A;  2ZQV A;  4TW7 A;  4U84 A;  5DIV A;  5HT1 A;  4DH0 A;  1D7J A;  3CGN A;  3O5I A;  3JYM A;  2MPH A;  1JNS A;  3H9R B;  1Q6I A;  2KE0 A;  3UF8 A;  1FKH A;  5J6E A;  4J4N A;  2PV3 A;  3KAF A;  5D75 A;  3WH0 A;  2XPB A;  1ZK6 A;  1ZCN A;  2MLY A;  4C02 B;  1ROT A;  4TW8 A;  4JFK A;  2D9F A;  2KFW A;  1PIN A;  1FKG A;  3O5K A;  4QIB A;  1FKB A;  4DZ3 A;  2PPN A;  3TCZ A;  3TDB A;  3UQB A;  3IKD A;  2FAP A;  1P5Q A;  4BF8 A;  2ZQS A;  3IHZ A;  4LAY A;  4DRI A;  4DIP A;  2JZV A;  3RGC A;  1QPL A;  2PV1 A;  4DT4 A;  1FKS A;  4LAV A;  2MF9 A;  4TX0 A;  5HTG A;  3RFW A;  1QPF A;  3I6C A;  4IQ2 A;  4TW6 A;  4U85 A;  2VN1 A;  5B8I C;  1D7I A;  1NMV A;  1J4R A;  5HKG A;  2PV2 A;  2M1I A;  1D7H A;  1ROU A;  1JVW A;  3O5P A;  2AWG A;  1FKT A;  4IQC A;  2DG9 A;  2ZR4 A;  3UI5 A;  2K8I A;  3KAH A;  1FKL A;  4IPX A;  4GIV A;  3TC5 A;  2ZQU A;  3KZ7 A;  2F21 A;  4ITZ A;  5DIU A;  4DRO A;  4W9Q A;  2KR7 A;  3KAI A;  1PBK A;  3O5F A;  5HW8 A;  4J4O A;  2PBC A;  1L1P A;  1FKI A;  1Q6U A;  3O5R A;  2N87 A;  2OFN A;  1TCO C;  3PRB A;  1A7X A;  4FAP A;  2KGJ A;  3O5D A;  4ODO A;  2ZR6 A;  1FKF A;  4JYS A;  3PRD A;  4G2P A;  3O5Q A;  2XP4 A;  3VAW A;  4MSP A;  1YW5 A;  1Q1C A;  3JYJ A;  2RUR A;  4TYO A;  4U86 A;  1KT0 A;  4JFI A;  3KAB A;  1W26 A;  1FKK A;  2DG4 A;  3LUO A;  2MNT A;  4ODN A;  2KI3 A;  2LJ4 A;  1NMW A;  3UI4 A;  5HUA A;  2Y78 A;  4ODM A;  3B7X A;  4ODR A;  1HXV A;  2LGO A;  4DRH A;  2RUD A;  1T11 A;  2RQS A;  1J4H A;  3O5G A;  4N19 A;  4ODP A;  4R0X A;  5HWC A;  1FKR A;  4DRN A;  3O5J A;  2RUC A;  4ODK A; 
#chains in the Genus database with same CATH topology
 2DPE A;  4S3J A;  3KAG A;  3AS0 A;  3O5M A;  1EHN A;  5DF0 A;  4DRQ A;  2VCD A;  1YAT A;  2B5U B;  1BL4 A;  1FAP A;  4DRP A;  3EY6 A;  2DT2 A;  1NWS A;  2XP7 A;  2DT1 A;  3IKG A;  3PRA A;  2EUL A;  2L2S A;  2Q5A A;  1OWQ A;  4GGQ A;  4DWS C;  3MDY B;  4NSB A;  2PI6 A;  3ARV A;  1FKJ A;  4O2T A;  2PPP A;  3AS1 A;  1EQ3 A;  2PPO A;  4Z2J A;  4DZ2 A;  1QZ2 A;  3KCE A;  4DWS D;  3WL0 A;  4ZPV R;  3BXW A;  4WKA A;  1SR0 A;  3ARO A;  1JND A;  2M08 A;  3NTP A;  2F2D A;  1FD9 A;  4NNR A;  2XP5 A;  4U84 A;  5DIV A;  2F23 A;  3CGN A;  1HKM A;  2WLZ A;  2DSW A;  1Q6I A;  1ZBW A;  4Z2H A;  2PV3 A;  3KAF A;  1CTN A;  4DWS A;  4LGX A;  4W5U A;  4JFK A;  2KFW A;  1PIN A;  3PR9 A;  4P8X A;  3ARQ A;  3ARW A;  4BF8 A;  3IHZ A;  1NWT A;  4LAY A;  4ZPW R;  1D7I A;  3W4R A;  2PV2 A;  2M1I A;  3O5P A;  3EIP A;  1EDQ A;  5DIU A;  5HBF A;  4ZPT R;  2KR7 A;  3WD1 A;  4Z2L A;  1HKJ A;  1WNO A;  1XHG A;  1TCO C;  3O5D A;  4JYS A;  3ALG A;  4UDM A;  3O5Q A;  3VAW A;  4TYO A;  4JFI A;  3KAB A;  1W26 A;  1FKK A;  2KI3 A;  2LJ4 A;  1NMW A;  1NWR A;  1HXV A;  1ZB5 A;  3O5G A;  1J4H A;  1UR9 A;  4DRN A;  1NH6 A;  4ODK A;  3NRK A;  1U79 A;  1LJY A;  2YBU A;  1F40 A;  2MLX A;  2XP9 A;  3ARZ A;  3UI6 A;  4Z2K A;  4JFL A;  1E9L A;  4W9O A;  5GPR A;  1W1P A;  2ZQT A;  3CH9 A;  1JNT A;  4WKF A;  1Y0O A;  4MAV A;  4MNM A;  4DRM A;  2WM0 A;  3KAD A;  1KT1 A;  3O5L A;  4P8V A;  4Z2G A;  4LAW A;  3ARS A;  1B6C A;  1D6O A;  2XP6 A;  2LKN A;  1J6Y A;  1J4I A;  1X6L A;  4ML4 A;  1FJD A;  5HW7 A;  3ODK A;  3QOK A;  3CHD A;  5HT1 A;  4DH0 A;  2ZQV A;  1JNS A;  2KE0 A;  1FKH A;  5J6E A;  3WH0 A;  2MLY A;  1ROT A;  3AQU A;  4TW8 A;  5JH8 A;  1FKB A;  3B9D A;  3TDB A;  3UQB A;  3IKD A;  1P5Q A;  3ARP A;  4DIP A;  4IT6 A;  1QPL A;  1FKS A;  4P8U A;  4LAV A;  4R5E A;  3CHE A;  4TX0 A;  4TW6 A;  3I6C A;  1ZBK A;  5B8I C;  2P4V A;  1D2K A;  1FKT A;  3ARX A;  4IPX A;  3WD3 A;  1W9V A;  4MPK A;  4HBE A;  1H0G A;  3ART A;  3FXY A;  3KAI A;  1PBK A;  1O6I A;  4MNJ A;  4L72 B;  3G6L A;  1XRV A;  2N87 A;  2OFN A;  1LG2 A;  4HAR A;  4FAP A;  2ZR6 A;  1FKF A;  1ZL1 A;  3AS2 A;  1Q1C A;  3OA5 A;  3JYJ A;  1ZU8 A;  2A3B A;  3LUO A;  1GOI A;  2MNT A;  4ODN A;  1IX5 A;  1WAW A;  5HUA A;  3B7X A;  5GQB A;  2LGO A;  1JNE A;  2RUD A;  3RME A;  4DRH A;  4ODP A;  4R0X A;  1FKR A;  4L3N A;  1W1T A;  1HKI A;  3CZ8 A;  4AY1 A;  5HW6 A;  3IK8 A;  1HJX A;  2MLZ A;  3WQV A;  2ZR5 A;  4ODL A;  2G41 A;  4W9P A;  4DRJ A;  1BKF A;  4DRK A;  2LPV A;  3O5E A;  1FFR A;  1FKD A;  1W9U A;  3WD4 A;  1W9P A;  2FKE A;  2PN0 A;  1Q6H A;  2WLY A;  4MNK A;  3FY1 A;  3B9A A;  1LL4 A;  5DIT A;  1UR8 A;  4KR0 B;  2DG3 A;  4JFM A;  4QT2 A;  2F4E A;  4FN2 A;  4WJX A;  1SYT A;  3B8S A;  2XP3 A;  1OGB A;  4G50 A;  3JXV A;  2RUQ A;  4TW7 A;  1D7J A;  3JYM A;  4WIW A;  2O9O A;  2YBT A;  3BMB A;  3WQW A;  3UF8 A;  2DSU A;  3RM8 A;  2DSV A;  4J4N A;  4Z2I A;  1JCH B;  4C02 B;  4XAK A;  3O5K A;  1FKG A;  4QIB A;  1RD6 A;  2FAP A;  2ZQS A;  3WL1 A;  4DT4 A;  2MF9 A;  1ITX A;  1QPF A;  2ESC A;  4U85 A;  2VN1 A;  1J4R A;  2K8I A;  3KZ7 A;  2F21 A;  4DRO A;  3ARY A;  2O92 A;  1LQ0 A;  3O5F A;  1W1V A;  2PBC A;  1HKK A;  1FKI A;  2AOS A;  1GPF A;  2OLH A;  2KGJ A;  4ODO A;  4DWS B;  3PRD A;  1E6N A;  4G2P A;  4Q7N A;  2XP4 A;  4MSP A;  3CHF A;  1YW5 A;  1KFW A;  2DG4 A;  3CHC A;  2DSZ A;  1E6Z A;  2Y78 A;  4ODR A;  1T11 A;  1W1Y A;  4N19 A;  1GUV A;  3WD2 A;  1EIB A;  3O5J A;  1E6R A;  2RUC A;  4S3K A;  3AS3 A;  2XPA A;  2XP8 A;  3KAC A;  2ITK A;  4Q22 A;  1OGG A;  3OOB A;  1R9H A;  2KO7 A;  4URI A;  5GPG A;  5BXJ A;  3UQA A;  1EYM A;  1ZBV A;  1WB0 A;  3CGM A;  4MGV A;  3PA7 A;  2RSE A;  3UQI A;  1E6P A;  1M5Y A;  3NI6 A;  2A3E A;  4JFJ A;  1E15 A;  1C9H A;  3FAP A;  2IF4 A;  5I98 A;  1HJV A;  4MTV A;  2UZ5 A;  1H0I A;  5HWB A;  1TFV A;  1HJW A;  4IT4 A;  4P8W A;  4TNS A;  4NZC A;  2A3C A;  5DO2 A;  3G6M A;  2M2A A;  1F8A B;  1N1A A;  1ZBC A;  2G8Z A;  3GTY X;  4LAX A;  4ODQ A;  3GPK A;  1GRJ A;  3O5O A;  3ARR A;  4QT3 A;  1VF8 A;  1NSG A;  3O5I A;  2MPH A;  2WK2 A;  1LL7 A;  3H9R B;  3WIJ A;  3WD0 A;  3ARU A;  5D75 A;  2XPB A;  1ZK6 A;  1ZCN A;  2D9F A;  4DZ3 A;  4WKH A;  2PPN A;  3RM4 A;  1E44 A;  3TCZ A;  1LL6 A;  4DRI A;  2JZV A;  3RGC A;  2PV1 A;  1FFQ A;  2DT0 A;  5HTG A;  3RFW A;  1NWU A;  4IQ2 A;  1NMV A;  5HKG A;  3B9E A;  1D7H A;  1ROU A;  1JVW A;  2AWG A;  4IQC A;  2DG9 A;  3RM9 A;  2ZR4 A;  3UI5 A;  3KAH A;  1FKL A;  2DT3 A;  4GIV A;  3TC5 A;  2ZQU A;  5DEZ A;  1LG1 A;  4ITZ A;  4W9Q A;  4KQZ A;  5HW8 A;  2IUZ A;  4J4O A;  2QF8 A;  1L1P A;  1Q6U A;  3O5R A;  3PRB A;  1A7X A;  1K9T A;  1X6N A;  2FDM A;  4WK9 A;  4ZS6 A;  4QZV B;  3GU0 A;  2RUR A;  4U86 A;  1KT0 A;  2ETN A;  3UI4 A;  2A3A A;  4ODM A;  2B31 A;  2RQS A;  5HWC A;  4HBO A;  3WKZ A;  4MNL A;  3ALF A;  4PTM A; 
#chains in the Genus database with same CATH homology
 2DPE A;  4S3J A;  3KAG A;  3AS0 A;  3O5M A;  1EHN A;  5DF0 A;  4DRQ A;  2VCD A;  1YAT A;  1BL4 A;  1FAP A;  4DRP A;  3EY6 A;  2DT2 A;  1NWS A;  2XP7 A;  2DT1 A;  3IKG A;  3PRA A;  2L2S A;  2Q5A A;  1OWQ A;  4GGQ A;  4DWS C;  3MDY B;  4NSB A;  2PI6 A;  3ARV A;  1FKJ A;  4O2T A;  2PPP A;  3AS1 A;  1EQ3 A;  2PPO A;  4Z2J A;  4DZ2 A;  1QZ2 A;  3KCE A;  4DWS D;  3WL0 A;  4ZPV R;  3BXW A;  4WKA A;  1SR0 A;  3ARO A;  1JND A;  2M08 A;  3NTP A;  2F2D A;  1FD9 A;  4NNR A;  2XP5 A;  4U84 A;  5DIV A;  3CGN A;  1HKM A;  2WLZ A;  2DSW A;  1Q6I A;  1ZBW A;  4Z2H A;  2PV3 A;  3KAF A;  1CTN A;  4DWS A;  4LGX A;  4W5U A;  4JFK A;  2KFW A;  1PIN A;  3PR9 A;  4P8X A;  3ARQ A;  3ARW A;  4BF8 A;  3IHZ A;  1NWT A;  4LAY A;  4ZPW R;  1D7I A;  3W4R A;  2PV2 A;  2M1I A;  3O5P A;  1EDQ A;  5DIU A;  5HBF A;  4ZPT R;  2KR7 A;  3WD1 A;  4Z2L A;  1HKJ A;  1WNO A;  1XHG A;  1TCO C;  3O5D A;  4JYS A;  3ALG A;  3O5Q A;  3VAW A;  4TYO A;  4JFI A;  3KAB A;  1W26 A;  1FKK A;  2KI3 A;  2LJ4 A;  1NMW A;  1NWR A;  1HXV A;  1ZB5 A;  3O5G A;  1J4H A;  1UR9 A;  4DRN A;  1NH6 A;  4ODK A;  3NRK A;  1U79 A;  1LJY A;  2YBU A;  1F40 A;  2MLX A;  2XP9 A;  3ARZ A;  3UI6 A;  4Z2K A;  4JFL A;  1E9L A;  4W9O A;  5GPR A;  1W1P A;  2ZQT A;  3CH9 A;  1JNT A;  4WKF A;  1Y0O A;  4MAV A;  4MNM A;  4DRM A;  2WM0 A;  3KAD A;  1KT1 A;  3O5L A;  4P8V A;  4Z2G A;  4LAW A;  3ARS A;  1B6C A;  1D6O A;  2XP6 A;  2LKN A;  1J6Y A;  1J4I A;  1X6L A;  4ML4 A;  1FJD A;  5HW7 A;  3ODK A;  3QOK A;  3CHD A;  5HT1 A;  4DH0 A;  2ZQV A;  1JNS A;  2KE0 A;  1FKH A;  5J6E A;  3WH0 A;  2MLY A;  1ROT A;  3AQU A;  4TW8 A;  5JH8 A;  1FKB A;  3B9D A;  3TDB A;  3UQB A;  3IKD A;  1P5Q A;  3ARP A;  4DIP A;  4IT6 A;  1QPL A;  1FKS A;  4P8U A;  4LAV A;  4R5E A;  3CHE A;  4TX0 A;  4TW6 A;  3I6C A;  1ZBK A;  5B8I C;  1D2K A;  1FKT A;  3ARX A;  4IPX A;  3WD3 A;  1W9V A;  4MPK A;  4HBE A;  1H0G A;  3ART A;  3FXY A;  3KAI A;  1PBK A;  1O6I A;  4MNJ A;  4L72 B;  3G6L A;  1XRV A;  2N87 A;  2OFN A;  1LG2 A;  4HAR A;  4FAP A;  2ZR6 A;  1FKF A;  1ZL1 A;  3AS2 A;  1Q1C A;  3OA5 A;  3JYJ A;  1ZU8 A;  2A3B A;  3LUO A;  1GOI A;  2MNT A;  4ODN A;  1IX5 A;  1WAW A;  5HUA A;  3B7X A;  5GQB A;  2LGO A;  1JNE A;  2RUD A;  3RME A;  4DRH A;  4ODP A;  4R0X A;  1FKR A;  4L3N A;  1W1T A;  1HKI A;  3CZ8 A;  4AY1 A;  5HW6 A;  3IK8 A;  1HJX A;  2MLZ A;  3WQV A;  2ZR5 A;  4ODL A;  2G41 A;  4W9P A;  4DRJ A;  1BKF A;  4DRK A;  2LPV A;  3O5E A;  1FFR A;  1FKD A;  1W9U A;  3WD4 A;  1W9P A;  2FKE A;  1Q6H A;  2WLY A;  4MNK A;  3FY1 A;  3B9A A;  1LL4 A;  5DIT A;  1UR8 A;  4KR0 B;  2DG3 A;  4JFM A;  4QT2 A;  2F4E A;  4FN2 A;  4WJX A;  1SYT A;  3B8S A;  2XP3 A;  1OGB A;  4G50 A;  3JXV A;  2RUQ A;  4TW7 A;  1D7J A;  3JYM A;  4WIW A;  2O9O A;  2YBT A;  3WQW A;  3UF8 A;  2DSU A;  3RM8 A;  2DSV A;  4J4N A;  4Z2I A;  4C02 B;  4XAK A;  3O5K A;  1FKG A;  4QIB A;  1RD6 A;  2FAP A;  2ZQS A;  3WL1 A;  4DT4 A;  2MF9 A;  1ITX A;  1QPF A;  2ESC A;  4U85 A;  2VN1 A;  1J4R A;  2K8I A;  3KZ7 A;  2F21 A;  4DRO A;  3ARY A;  2O92 A;  1LQ0 A;  3O5F A;  1W1V A;  2PBC A;  1HKK A;  1FKI A;  2AOS A;  1GPF A;  2OLH A;  2KGJ A;  4ODO A;  4DWS B;  3PRD A;  1E6N A;  4G2P A;  4Q7N A;  2XP4 A;  4MSP A;  3CHF A;  1YW5 A;  1KFW A;  2DG4 A;  3CHC A;  2DSZ A;  1E6Z A;  2Y78 A;  4ODR A;  1T11 A;  1W1Y A;  4N19 A;  1GUV A;  3WD2 A;  1EIB A;  3O5J A;  1E6R A;  2RUC A;  4S3K A;  3AS3 A;  2XPA A;  2XP8 A;  3KAC A;  2ITK A;  4Q22 A;  1OGG A;  3OOB A;  1R9H A;  2KO7 A;  4URI A;  5GPG A;  5BXJ A;  3UQA A;  1EYM A;  1ZBV A;  1WB0 A;  3CGM A;  4MGV A;  3PA7 A;  2RSE A;  3UQI A;  1E6P A;  1M5Y A;  3NI6 A;  2A3E A;  4JFJ A;  1E15 A;  1C9H A;  3FAP A;  2IF4 A;  5I98 A;  1HJV A;  4MTV A;  2UZ5 A;  1H0I A;  5HWB A;  1TFV A;  1HJW A;  4IT4 A;  4P8W A;  4TNS A;  4NZC A;  2A3C A;  5DO2 A;  3G6M A;  2M2A A;  1F8A B;  1N1A A;  1ZBC A;  2G8Z A;  4LAX A;  4ODQ A;  3GPK A;  3O5O A;  3ARR A;  4QT3 A;  1VF8 A;  1NSG A;  3O5I A;  2MPH A;  2WK2 A;  1LL7 A;  3H9R B;  3WIJ A;  3WD0 A;  3ARU A;  5D75 A;  2XPB A;  1ZK6 A;  1ZCN A;  2D9F A;  4DZ3 A;  4WKH A;  2PPN A;  3RM4 A;  3TCZ A;  1LL6 A;  4DRI A;  2JZV A;  3RGC A;  2PV1 A;  1FFQ A;  2DT0 A;  5HTG A;  3RFW A;  1NWU A;  4IQ2 A;  1NMV A;  5HKG A;  3B9E A;  1D7H A;  1ROU A;  1JVW A;  2AWG A;  4IQC A;  2DG9 A;  3RM9 A;  2ZR4 A;  3UI5 A;  3KAH A;  1FKL A;  2DT3 A;  4GIV A;  3TC5 A;  2ZQU A;  5DEZ A;  1LG1 A;  4ITZ A;  4W9Q A;  4KQZ A;  5HW8 A;  2IUZ A;  4J4O A;  2QF8 A;  1L1P A;  1Q6U A;  3O5R A;  3PRB A;  1A7X A;  1K9T A;  1X6N A;  2FDM A;  4WK9 A;  4ZS6 A;  4QZV B;  2RUR A;  4U86 A;  1KT0 A;  3UI4 A;  2A3A A;  4ODM A;  2B31 A;  2RQS A;  5HWC A;  4HBO A;  3WKZ A;  4MNL A;  3ALF A;  4PTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...