3O5RA

Complex of fk506 with the fk1 domain mutant a19t of fkbp51
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 33
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5rA00
4BF8A 4N19A 4LAYA 4ODOA 1FKLA 1W26A 5GPGA 4ODRA 1JNTA 1ROUA 4MSPA 4U85A 4W9QA 3O5RA 1L1PA 1QZ2A 3IKGA 2PBCA 4DZ3A 2Y78A 3UI5A 3OOBA 1J6YA 5BXJA 2KGJA 2ZR4A 2XP4A 1FKIA 3O5QA 3IKDA 4NNRA 4JFKA 2MLXA 3UI6A 4U86A 2Q5AA 3JYJA 5I98A 2VN1A 1J4IA 2M1IA 4DRHA 2RSEA 4W9PA 2MLYA 2F21A 4J4NA 1YW5A 1J4RA 4DROA 2PV3A 1PBKA 2XP3A 1YATA 3KAHA 4G2PA 4DRJA 4JFMA 4JFLA 2K8IA 2XP5A 3UF8A 3LUOA 4DH0A 1D7JA 4IQ2A 2M2AA 1R9HA 2RUCA 4LAWA 3NI6A 3WH0A 1FKFA 3CGNA 3MDYB 2MLZA 1FKRA 3VAWA 1ROTA 4W9OA 4DRIA 1NMWA 3UQBA 4DRPA 2IF4A 2KI3A 1FD9A 2XP7A 2KR7A 3PRDA 1EQ3A 2XPAA 5HKGA 5HWCA 2UZ5A 2KE0A 1D7HA 1D7IA 2KFWA 2ZQVA 1Q1CA 4GIVA 4DRMA 2VCDA 2XPBA 4QIBA 2ZQTA 2MF9A 2L2SA 2OFNA 2ZR6A 3KAGA 4ITZA 4ODMA 4DT4A 5HUAA 3UQAA 2F4EA 3KABA 2LKNA 2M08A 4IPXA 5HT1A 3RFWA 4DRKA 2RUDA 2D9FA 2ZQUA 3KADA 5HW8A 3GPKA 2LJ4A 5HTGA 2FKEA 4JFJA 3TCZA 4R0XA 1FAPA 1BKFA 2RURA 2XP6A 4JFIA 3O5MA 3I6CA 4QT3A 4TNSA 2PPOA 2XP9A 1FKGA 3FAPA 3KACA 4DZ2A 2FAPA 2DG4A 4ODLA 2AWGA 3O5PA 2DG9A 1C9HA 5B8IC 3PA7A 1JVWA 2PPPA 3O5JA 4FN2A 1Q6UA 1Q6IA 3ODKA 5DIUA 2MPHA 3O5EA 1M5YA 2RUQA 1T11A 2PV1A 3JYMA 3PRBA 4U84A 1Y0OA 1B6CA 3IHZA 2ZR5A 5D75A 1FKTA 3UI4A 1U79A 4GGQA 4TW7A 4ODKA 2MNTA 3UQIA 3O5IA 3CGMA 3TDBA 1FKBA 1QPLA 2ITKA 3O5FA 4O2TA 2KO7A 3KAIA 3KZ7A 3B7XA 4MGVA 2RQSA 1NMVA 4JYSA 4LAXA 3O5OA 5HW6A 3O5DA 1BL4A 4TW8A 1J4HA 3KCEA 1F8AB 3RGCA 2LGOA 4ODQA 1KT1A 1FKKA 1FKHA 3NRKA 4TW6A 2DG3A 1Q6HA 2F2DA 3O5GA 5DIVA 5J6EA 1FJDA 1JNSA 2JZVA 4C02B 4IQCA 1P5QA 2N87A 3EY6A 1PINA 4DRNA 4TX0A 1EYMA 1ZK6A 1FKDA 2PV2A 1FKSA 4DRQA 3IK8A 5HW7A 1KT0A 3H9RB 5HWBA 1QPFA 4LAVA 1NSGA 2PPNA 5DITA 2ZQSA 4QT2A 1HXVA 3KAFA 2XP8A 3JXVA 1ZCNA 3NTPA 4DIPA 4FAPA 4ODNA 3O5KA 4G50A 4ODPA 1F40A 1A7XA 4TYOA 1D6OA 3O5LA 1TCOC 3TC5A 1N1AA 4J4OA 1FKJA 2LPVA
chains in the Genus database with same CATH superfamily
4BF8A 2EULA 4MSPA 3RMEA 1HJVA 1L1PA 2Y78A 2PN0A 1ZBWA 2XP4A 4JFKA 2Q5AA 3WD3A 4MPKA 4DRHA 2RSEA 4W9PA 4DROA 3KAHA 4WKAA 1YATA 4XAKA 4G2PA 4DRJA 3FXYA 3MDYB 2DT1A 4WK9A 1IX5A 4W9OA 2XP7A 1HKJA 1ZBKA 1E6NA 4L72B 4GIVA 4DWSC 2ZQTA 4ODMA 2F4EA 3KABA 4MAVA 4IPXA 4DWSD 4DWSB 2ZQUA 3B9AA 1LL4A 3GPKA 1FFQA 5HTGA 2FKEA 2O9OA 1SYTA 1LL7A 3G6LA 4QT3A 2FDMA 3KACA 4ZS6A 2FAPA 3CZ8A 2DG4A 2DG9A 3WKZA 3GU0A 4HARA 3ODKA 4UDMA 1M5YA 2RUQA 3WD1A 1KFWA 1O6IA 3ARSA 3RM8A 5D75A 4TW7A 3AS1A 2MNTA 3TDBA 1FKBA 1QPLA 4P8VA 4Z2GA 2DPEA 4Q22A 1XHGA 4Q7NA 3ARXA 1ZL1A 3NRKA 1Q6HA 1FJDA 4IQCA 4Z2KA 3EY6A 1PINA 1EYMA 1FKDA 2PV2A 3IK8A 1QPFA 4QT2A 1HKIA 1H0GA 3NTPA 1ITXA 4ODPA 1F40A 1A7XA 2A3AA 4R5EA 1WB0A 2QF8A 5DF0A 1FKLA 1D2KA 1JNTA 3ARPA 4U85A 3WD2A 4NZCA 3IKGA 4KR0B 2PBCA 4DWSA 1WAWA 3OOBA 1J6YA 4WKFA 3CHEA 1FKIA 1W1PA 3IKDA 3ARVA 5I98A 4HBOA 2VN1A 3WD4A 3WQWA 2M1IA 2PV3A 3UF8A 3LUOA 4DH0A 1D7JA 3AROA 4WKHA 1R9HA 2RUCA 1FKFA 3CGNA 4PTMA 1NMWA 3UQBA 5DEZA 2XPAA 2KE0A 1D7HA 4DRMA 2L2SA 4ITZA 5HUAA 2LKNA 4DRKA 2RUDA 1K9TA 3KADA 3BMBA 5HW8A 2LJ4A 4S3KA 3TCZA 1BKFA 1GRJA 3O5MA 4TNSA 3CHDA 1FFRA 3FAPA 4DZ2A 4ODLA 3O5PA 2A3BA 3AS3A 3G6MA 1JVWA 4P8WA 4KQZA 1NWRA 1H0IA 2MPHA 3O5EA 2PV1A 4U84A 1HJXA 1B6CA 3UI4A 4ODKA 1EDQA 3O5IA 3ALFA 3CGMA 3ARRA 2AOSA 4O2TA 1W1YA 4MGVA 4L3NA 4TW8A 4WJXA 4Z2JA 1X6NA 1KT1A 2F23A 4C02B 4DRNA 4TX0A 1ZK6A 4DRQA 4MNJA 2ETNA 4LAVA 1GPFA 1NSGA 2PPNA 2XP8A 2DSZA 3O5KA 3AQUA 4IT4A 4TYOA 1OGGA 3TC5A 1N1AA 2LPVA 4Z2LA 1W26A 3FY1A 5GPGA 4ODRA 3O5RA 4W5UA 1QZ2A 3RM9A 2KGJA 2O92A 4NNRA 3O5QA 2PI6A 2MLXA 1J4IA 2F21A 4J4NA 1YW5A 1E6RA 2XP5A 3GTYX 2M2AA 2P4VA 3WH0A 3NI6A 2IUZA 2MLZA 1FKRA 1X6LA 1UR8A 1JCHB 4DRPA 2IF4A 1FD9A 4MNMA 5HKGA 2YBTA 4QZVB 3RM4A 2ZQVA 1Q1CA 2VCDA 2XPBA 4QIBA 1HJWA 2MF9A 2OFNA 2ZR6A 5GPRA 4DT4A 2M08A 2B31A 3RFWA 2D9FA 4WIWA 1FAPA 2WLZA 2XP6A 4JFIA 3I6CA 1E44A 1OWQA 2PPOA 3ALGA 1OGBA 2AWGA 1E15A 2B5UB 5B8IC 2PPPA 1Q6UA 3WD0A 4LGXA 1EIBA 2DSUA 1RD6A 1T11A 2G41A 1FKTA 1U79A 4GGQA 1W9PA 4ZPVR 1SR0A 1W9UA 4P8UA 2ITKA 1NWUA 3KAIA 3KZ7A 1LG1A 2RQSA 3O5OA 1NWTA 5GQBA 1BL4A 3AS2A 1J4HA 3KCEA 1F8AB 4ZPWR 3B9EA 2LGOA 4ODQA 1ZBVA 1FKKA 1FKHA 2DG3A 2F2DA 3O5GA 5DIVA 4URIA 1JNSA 4MNLA 2N87A 2G8ZA 5HWBA 3ARYA 1HXVA 2DSWA 1LJYA 3KAFA 1JNEA 1ZCNA 4FAPA 4ODNA 4MTVA 5DO2A 4MNKA 2A3EA 3ARTA 1D6OA 3O5LA 2OLHA 4N19A 4LAYA 4ODOA 1LG2A 4Z2IA 1ROUA 2WK2A 3B9DA 4W9QA 1W9VA 4DZ3A 3UI5A 5BXJA 1E6ZA 1HKKA 2ZR4A 3WL1A 3UI6A 4U86A 3JYJA 4Z2HA 4ML4A 2MLYA 1NWSA 1CTNA 1J4RA 2DSVA 1PBKA 2XP3A 3CHCA 4HBEA 4JFMA 4JFLA 2K8IA 1W1TA 4IQ2A 4LAWA 3W4RA 1VF8A 3VAWA 1ROTA 4AY1A 4DRIA 2WM0A 4IT6A 1GUVA 2KI3A 3ARWA 3PRDA 2KR7A 3OA5A 3PR9A 1EQ3A 5HWCA 2DT3A 1D7IA 4NSBA 3ARZA 2KFWA 3KAGA 3UQAA 3WL0A 2A3CA 1E9LA 3WIJA 5HT1A 1HKMA 3CH9A 1W1VA 1NH6A 4ZPTR 4JFJA 4R0XA 1LL6A 2RURA 1TFVA 2XP9A 1FKGA 1UR9A 1C9HA 3PA7A 2WLYA 3O5JA 4FN2A 1Q6IA 3AS0A 5DIUA 3QOKA 3CHFA 2ESCA 3JYMA 3PRBA 1Y0OA 3IHZA 1EHNA 2ZR5A 3ARQA 3UQIA 3ARUA 3O5FA 1FKJA 2KO7A 3B7XA 1GOIA 1NMVA 4JYSA 4LAXA 5HW6A 3O5DA 3BXWA 2DT2A 4S3JA 3RGCA 1ZB5A 4P8XA 5JH8A 4TW6A 3PRAA 1E6PA 5HBFA 5J6EA 1ZU8A 2JZVA 1P5QA 1FKSA 5HW7A 2YBUA 1KT0A 3H9RB 5DITA 2ZQSA 3WQVA 1LQ0A 3EIPA 3JXVA 4DIPA 1JNDA 1WNOA 3B8SA 4G50A 1XRVA 2DT0A 1TCOC 2UZ5A 4J4OA 1ZBCA
chains in the Genus database with same CATH topology
4BF8A 4MSPA 3RMEA 1HJVA 1L1PA 2Y78A 1ZBWA 2XP4A 4JFKA 2Q5AA 3WD3A 4MPKA 4DRHA 2RSEA 4W9PA 4DROA 3KAHA 4WKAA 1YATA 4XAKA 4G2PA 4DRJA 3FXYA 3MDYB 2DT1A 4WK9A 1IX5A 4W9OA 2XP7A 1HKJA 1ZBKA 1E6NA 4L72B 4GIVA 4DWSC 2ZQTA 4ODMA 2F4EA 3KABA 4MAVA 4IPXA 4DWSD 4DWSB 2ZQUA 3B9AA 1LL4A 3GPKA 1FFQA 5HTGA 2FKEA 2O9OA 1SYTA 1LL7A 3G6LA 4QT3A 2FDMA 3KACA 4ZS6A 2FAPA 3CZ8A 2DG4A 2DG9A 3WKZA 4HARA 3ODKA 1M5YA 2RUQA 3WD1A 1KFWA 1O6IA 3ARSA 3RM8A 5D75A 4TW7A 3AS1A 2MNTA 3TDBA 1FKBA 1QPLA 4P8VA 4Z2GA 2DPEA 4Q22A 1XHGA 4Q7NA 3ARXA 1ZL1A 3NRKA 1Q6HA 1FJDA 4IQCA 4Z2KA 3EY6A 1PINA 1EYMA 1FKDA 2PV2A 3IK8A 1QPFA 4QT2A 1HKIA 1H0GA 3NTPA 1ITXA 4ODPA 1F40A 1A7XA 2A3AA 4R5EA 1WB0A 2QF8A 5DF0A 1FKLA 1D2KA 1JNTA 3ARPA 4U85A 3WD2A 4NZCA 3IKGA 4KR0B 2PBCA 4DWSA 1WAWA 3OOBA 1J6YA 4WKFA 3CHEA 1FKIA 1W1PA 3IKDA 3ARVA 5I98A 4HBOA 2VN1A 3WD4A 3WQWA 2M1IA 2PV3A 3UF8A 3LUOA 4DH0A 1D7JA 3AROA 4WKHA 1R9HA 2RUCA 1FKFA 3CGNA 4PTMA 1NMWA 3UQBA 5DEZA 2XPAA 2KE0A 1D7HA 4DRMA 2L2SA 4ITZA 5HUAA 2LKNA 4DRKA 2RUDA 1K9TA 3KADA 5HW8A 2LJ4A 4S3KA 3TCZA 1BKFA 3O5MA 4TNSA 3CHDA 1FFRA 3FAPA 4DZ2A 4ODLA 3O5PA 2A3BA 3AS3A 3G6MA 1JVWA 4P8WA 4KQZA 1NWRA 1H0IA 2MPHA 3O5EA 2PV1A 4U84A 1HJXA 1B6CA 3UI4A 4ODKA 1EDQA 3O5IA 3ALFA 3CGMA 3ARRA 2AOSA 4O2TA 1W1YA 4MGVA 4L3NA 4TW8A 4WJXA 4Z2JA 1X6NA 1KT1A 4C02B 4DRNA 4TX0A 1ZK6A 4DRQA 4MNJA 4LAVA 1GPFA 1NSGA 2PPNA 2XP8A 2DSZA 3O5KA 3AQUA 4IT4A 4TYOA 1OGGA 3TC5A 1N1AA 2LPVA 4Z2LA 1W26A 3FY1A 5GPGA 4ODRA 3O5RA 4W5UA 1QZ2A 3RM9A 2KGJA 2O92A 4NNRA 3O5QA 2PI6A 2MLXA 1J4IA 2F21A 4J4NA 1YW5A 1E6RA 2XP5A 2M2AA 3WH0A 3NI6A 2IUZA 2MLZA 1FKRA 1X6LA 1UR8A 4DRPA 2IF4A 1FD9A 4MNMA 5HKGA 2YBTA 4QZVB 3RM4A 2ZQVA 1Q1CA 2VCDA 2XPBA 4QIBA 1HJWA 2MF9A 2OFNA 2ZR6A 5GPRA 4DT4A 2M08A 2B31A 3RFWA 2D9FA 4WIWA 1FAPA 2WLZA 2XP6A 4JFIA 3I6CA 1OWQA 2PPOA 3ALGA 1OGBA 2AWGA 1E15A 5B8IC 2PPPA 1Q6UA 3WD0A 4LGXA 1EIBA 2DSUA 1RD6A 1T11A 2G41A 1FKTA 1U79A 4GGQA 1W9PA 4ZPVR 1SR0A 1W9UA 4P8UA 2ITKA 1NWUA 3KAIA 3KZ7A 1LG1A 2RQSA 3O5OA 1NWTA 5GQBA 1BL4A 3AS2A 1J4HA 3KCEA 1F8AB 4ZPWR 3B9EA 2LGOA 4ODQA 1ZBVA 1FKKA 1FKHA 2DG3A 2F2DA 3O5GA 5DIVA 4URIA 1JNSA 4MNLA 2N87A 2G8ZA 5HWBA 3ARYA 1HXVA 2DSWA 1LJYA 3KAFA 1JNEA 1ZCNA 4FAPA 4ODNA 4MTVA 5DO2A 4MNKA 2A3EA 3ARTA 1D6OA 3O5LA 2OLHA 4N19A 4LAYA 4ODOA 1LG2A 4Z2IA 1ROUA 2WK2A 3B9DA 4W9QA 1W9VA 4DZ3A 3UI5A 5BXJA 1E6ZA 1HKKA 2ZR4A 3WL1A 3UI6A 4U86A 3JYJA 4Z2HA 4ML4A 2MLYA 1NWSA 1CTNA 1J4RA 2DSVA 1PBKA 2XP3A 3CHCA 4HBEA 4JFMA 4JFLA 2K8IA 1W1TA 4IQ2A 4LAWA 3W4RA 1VF8A 3VAWA 1ROTA 4AY1A 4DRIA 2WM0A 4IT6A 1GUVA 2KI3A 3ARWA 3PRDA 2KR7A 3OA5A 3PR9A 1EQ3A 5HWCA 2DT3A 1D7IA 4NSBA 3ARZA 2KFWA 3KAGA 3UQAA 3WL0A 2A3CA 1E9LA 3WIJA 5HT1A 1HKMA 3CH9A 1W1VA 1NH6A 4ZPTR 4JFJA 4R0XA 1LL6A 2RURA 1TFVA 2XP9A 1FKGA 1UR9A 1C9HA 3PA7A 2WLYA 3O5JA 4FN2A 1Q6IA 3AS0A 5DIUA 3QOKA 3CHFA 2ESCA 3JYMA 3PRBA 1Y0OA 3IHZA 1EHNA 2ZR5A 3ARQA 3UQIA 3ARUA 3O5FA 1FKJA 2KO7A 3B7XA 1GOIA 1NMVA 4JYSA 4LAXA 5HW6A 3O5DA 3BXWA 2DT2A 4S3JA 3RGCA 1ZB5A 4P8XA 5JH8A 4TW6A 3PRAA 1E6PA 5HBFA 5J6EA 1ZU8A 2JZVA 1P5QA 1FKSA 5HW7A 2YBUA 1KT0A 3H9RB 5DITA 2ZQSA 3WQVA 1LQ0A 4DIPA 3JXVA 1JNDA 1WNOA 3B8SA 4G50A 1XRVA 2DT0A 1TCOC 2UZ5A 4J4OA 1ZBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BF8 A;  4N19 A;  4LAY A;  4ODO A;  1FKL A;  1W26 A;  5GPG A;  4ODR A;  1JNT A;  1ROU A;  4MSP A;  4U85 A;  4W9Q A;  3O5R A;  1L1P A;  1QZ2 A;  3IKG A;  2PBC A;  4DZ3 A;  2Y78 A;  3UI5 A;  3OOB A;  1J6Y A;  5BXJ A;  2KGJ A;  2ZR4 A;  2XP4 A;  1FKI A;  3O5Q A;  3IKD A;  4NNR A;  4JFK A;  2MLX A;  3UI6 A;  4U86 A;  2Q5A A;  3JYJ A;  5I98 A;  2VN1 A;  1J4I A;  2M1I A;  4DRH A;  2RSE A;  4W9P A;  2MLY A;  2F21 A;  4J4N A;  1YW5 A;  1J4R A;  4DRO A;  2PV3 A;  1PBK A;  2XP3 A;  1YAT A;  3KAH A;  4G2P A;  4DRJ A;  4JFM A;  4JFL A;  2K8I A;  2XP5 A;  3UF8 A;  3LUO A;  4DH0 A;  1D7J A;  4IQ2 A;  2M2A A;  1R9H A;  2RUC A;  4LAW A;  3NI6 A;  3WH0 A;  1FKF A;  3CGN A;  3MDY B;  2MLZ A;  1FKR A;  3VAW A;  1ROT A;  4W9O A;  4DRI A;  1NMW A;  3UQB A;  4DRP A;  2IF4 A;  2KI3 A;  1FD9 A;  2XP7 A;  2KR7 A;  3PRD A;  1EQ3 A;  2XPA A;  5HKG A;  5HWC A;  2UZ5 A;  2KE0 A;  1D7H A;  1D7I A;  2KFW A;  2ZQV A;  1Q1C A;  4GIV A;  4DRM A;  2VCD A;  2XPB A;  4QIB A;  2ZQT A;  2MF9 A;  2L2S A;  2OFN A;  2ZR6 A;  3KAG A;  4ITZ A;  4ODM A;  4DT4 A;  5HUA A;  3UQA A;  2F4E A;  3KAB A;  2LKN A;  2M08 A;  4IPX A;  5HT1 A;  3RFW A;  4DRK A;  2RUD A;  2D9F A;  2ZQU A;  3KAD A;  5HW8 A;  3GPK A;  2LJ4 A;  5HTG A;  2FKE A;  4JFJ A;  3TCZ A;  4R0X A;  1FAP A;  1BKF A;  2RUR A;  2XP6 A;  4JFI A;  3O5M A;  3I6C A;  4QT3 A;  4TNS A;  2PPO A;  2XP9 A;  1FKG A;  3FAP A;  3KAC A;  4DZ2 A;  2FAP A;  2DG4 A;  4ODL A;  2AWG A;  3O5P A;  2DG9 A;  1C9H A;  5B8I C;  3PA7 A;  1JVW A;  2PPP A;  3O5J A;  4FN2 A;  1Q6U A;  1Q6I A;  3ODK A;  5DIU A;  2MPH A;  3O5E A;  1M5Y A;  2RUQ A;  1T11 A;  2PV1 A;  3JYM A;  3PRB A;  4U84 A;  1Y0O A;  1B6C A;  3IHZ A;  2ZR5 A;  5D75 A;  1FKT A;  3UI4 A;  1U79 A;  4GGQ A;  4TW7 A;  4ODK A;  2MNT A;  3UQI A;  3O5I A;  3CGM A;  3TDB A;  1FKB A;  1QPL A;  2ITK A;  3O5F A;  4O2T A;  2KO7 A;  3KAI A;  3KZ7 A;  3B7X A;  4MGV A;  2RQS A;  1NMV A;  4JYS A;  4LAX A;  3O5O A;  5HW6 A;  3O5D A;  1BL4 A;  4TW8 A;  1J4H A;  3KCE A;  1F8A B;  3RGC A;  2LGO A;  4ODQ A;  1KT1 A;  1FKK A;  1FKH A;  3NRK A;  4TW6 A;  2DG3 A;  1Q6H A;  2F2D A;  3O5G A;  5DIV A;  5J6E A;  1FJD A;  1JNS A;  2JZV A;  4C02 B;  4IQC A;  1P5Q A;  2N87 A;  3EY6 A;  1PIN A;  4DRN A;  4TX0 A;  1EYM A;  1ZK6 A;  1FKD A;  2PV2 A;  1FKS A;  4DRQ A;  3IK8 A;  5HW7 A;  1KT0 A;  3H9R B;  5HWB A;  1QPF A;  4LAV A;  1NSG A;  2PPN A;  5DIT A;  2ZQS A;  4QT2 A;  1HXV A;  3KAF A;  2XP8 A;  3JXV A;  1ZCN A;  3NTP A;  4DIP A;  4FAP A;  4ODN A;  3O5K A;  4G50 A;  4ODP A;  1F40 A;  1A7X A;  4TYO A;  1D6O A;  3O5L A;  1TCO C;  3TC5 A;  1N1A A;  4J4O A;  1FKJ A;  2LPV A; 
#chains in the Genus database with same CATH topology
 4BF8 A;  2EUL A;  4MSP A;  3RME A;  1HJV A;  1L1P A;  2Y78 A;  2PN0 A;  1ZBW A;  2XP4 A;  4JFK A;  2Q5A A;  3WD3 A;  4MPK A;  4DRH A;  2RSE A;  4W9P A;  4DRO A;  3KAH A;  4WKA A;  1YAT A;  4XAK A;  4G2P A;  4DRJ A;  3FXY A;  3MDY B;  2DT1 A;  4WK9 A;  1IX5 A;  4W9O A;  2XP7 A;  1HKJ A;  1ZBK A;  1E6N A;  4L72 B;  4GIV A;  4DWS C;  2ZQT A;  4ODM A;  2F4E A;  3KAB A;  4MAV A;  4IPX A;  4DWS D;  4DWS B;  2ZQU A;  3B9A A;  1LL4 A;  3GPK A;  1FFQ A;  5HTG A;  2FKE A;  2O9O A;  1SYT A;  1LL7 A;  3G6L A;  4QT3 A;  2FDM A;  3KAC A;  4ZS6 A;  2FAP A;  3CZ8 A;  2DG4 A;  2DG9 A;  3WKZ A;  3GU0 A;  4HAR A;  3ODK A;  4UDM A;  1M5Y A;  2RUQ A;  3WD1 A;  1KFW A;  1O6I A;  3ARS A;  3RM8 A;  5D75 A;  4TW7 A;  3AS1 A;  2MNT A;  3TDB A;  1FKB A;  1QPL A;  4P8V A;  4Z2G A;  2DPE A;  4Q22 A;  1XHG A;  4Q7N A;  3ARX A;  1ZL1 A;  3NRK A;  1Q6H A;  1FJD A;  4IQC A;  4Z2K A;  3EY6 A;  1PIN A;  1EYM A;  1FKD A;  2PV2 A;  3IK8 A;  1QPF A;  4QT2 A;  1HKI A;  1H0G A;  3NTP A;  1ITX A;  4ODP A;  1F40 A;  1A7X A;  2A3A A;  4R5E A;  1WB0 A;  2QF8 A;  5DF0 A;  1FKL A;  1D2K A;  1JNT A;  3ARP A;  4U85 A;  3WD2 A;  4NZC A;  3IKG A;  4KR0 B;  2PBC A;  4DWS A;  1WAW A;  3OOB A;  1J6Y A;  4WKF A;  3CHE A;  1FKI A;  1W1P A;  3IKD A;  3ARV A;  5I98 A;  4HBO A;  2VN1 A;  3WD4 A;  3WQW A;  2M1I A;  2PV3 A;  3UF8 A;  3LUO A;  4DH0 A;  1D7J A;  3ARO A;  4WKH A;  1R9H A;  2RUC A;  1FKF A;  3CGN A;  4PTM A;  1NMW A;  3UQB A;  5DEZ A;  2XPA A;  2KE0 A;  1D7H A;  4DRM A;  2L2S A;  4ITZ A;  5HUA A;  2LKN A;  4DRK A;  2RUD A;  1K9T A;  3KAD A;  3BMB A;  5HW8 A;  2LJ4 A;  4S3K A;  3TCZ A;  1BKF A;  1GRJ A;  3O5M A;  4TNS A;  3CHD A;  1FFR A;  3FAP A;  4DZ2 A;  4ODL A;  3O5P A;  2A3B A;  3AS3 A;  3G6M A;  1JVW A;  4P8W A;  4KQZ A;  1NWR A;  1H0I A;  2MPH A;  3O5E A;  2PV1 A;  4U84 A;  1HJX A;  1B6C A;  3UI4 A;  4ODK A;  1EDQ A;  3O5I A;  3ALF A;  3CGM A;  3ARR A;  2AOS A;  4O2T A;  1W1Y A;  4MGV A;  4L3N A;  4TW8 A;  4WJX A;  4Z2J A;  1X6N A;  1KT1 A;  2F23 A;  4C02 B;  4DRN A;  4TX0 A;  1ZK6 A;  4DRQ A;  4MNJ A;  2ETN A;  4LAV A;  1GPF A;  1NSG A;  2PPN A;  2XP8 A;  2DSZ A;  3O5K A;  3AQU A;  4IT4 A;  4TYO A;  1OGG A;  3TC5 A;  1N1A A;  2LPV A;  4Z2L A;  1W26 A;  3FY1 A;  5GPG A;  4ODR A;  3O5R A;  4W5U A;  1QZ2 A;  3RM9 A;  2KGJ A;  2O92 A;  4NNR A;  3O5Q A;  2PI6 A;  2MLX A;  1J4I A;  2F21 A;  4J4N A;  1YW5 A;  1E6R A;  2XP5 A;  3GTY X;  2M2A A;  2P4V A;  3WH0 A;  3NI6 A;  2IUZ A;  2MLZ A;  1FKR A;  1X6L A;  1UR8 A;  1JCH B;  4DRP A;  2IF4 A;  1FD9 A;  4MNM A;  5HKG A;  2YBT A;  4QZV B;  3RM4 A;  2ZQV A;  1Q1C A;  2VCD A;  2XPB A;  4QIB A;  1HJW A;  2MF9 A;  2OFN A;  2ZR6 A;  5GPR A;  4DT4 A;  2M08 A;  2B31 A;  3RFW A;  2D9F A;  4WIW A;  1FAP A;  2WLZ A;  2XP6 A;  4JFI A;  3I6C A;  1E44 A;  1OWQ A;  2PPO A;  3ALG A;  1OGB A;  2AWG A;  1E15 A;  2B5U B;  5B8I C;  2PPP A;  1Q6U A;  3WD0 A;  4LGX A;  1EIB A;  2DSU A;  1RD6 A;  1T11 A;  2G41 A;  1FKT A;  1U79 A;  4GGQ A;  1W9P A;  4ZPV R;  1SR0 A;  1W9U A;  4P8U A;  2ITK A;  1NWU A;  3KAI A;  3KZ7 A;  1LG1 A;  2RQS A;  3O5O A;  1NWT A;  5GQB A;  1BL4 A;  3AS2 A;  1J4H A;  3KCE A;  1F8A B;  4ZPW R;  3B9E A;  2LGO A;  4ODQ A;  1ZBV A;  1FKK A;  1FKH A;  2DG3 A;  2F2D A;  3O5G A;  5DIV A;  4URI A;  1JNS A;  4MNL A;  2N87 A;  2G8Z A;  5HWB A;  3ARY A;  1HXV A;  2DSW A;  1LJY A;  3KAF A;  1JNE A;  1ZCN A;  4FAP A;  4ODN A;  4MTV A;  5DO2 A;  4MNK A;  2A3E A;  3ART A;  1D6O A;  3O5L A;  2OLH A;  4N19 A;  4LAY A;  4ODO A;  1LG2 A;  4Z2I A;  1ROU A;  2WK2 A;  3B9D A;  4W9Q A;  1W9V A;  4DZ3 A;  3UI5 A;  5BXJ A;  1E6Z A;  1HKK A;  2ZR4 A;  3WL1 A;  3UI6 A;  4U86 A;  3JYJ A;  4Z2H A;  4ML4 A;  2MLY A;  1NWS A;  1CTN A;  1J4R A;  2DSV A;  1PBK A;  2XP3 A;  3CHC A;  4HBE A;  4JFM A;  4JFL A;  2K8I A;  1W1T A;  4IQ2 A;  4LAW A;  3W4R A;  1VF8 A;  3VAW A;  1ROT A;  4AY1 A;  4DRI A;  2WM0 A;  4IT6 A;  1GUV A;  2KI3 A;  3ARW A;  3PRD A;  2KR7 A;  3OA5 A;  3PR9 A;  1EQ3 A;  5HWC A;  2DT3 A;  1D7I A;  4NSB A;  3ARZ A;  2KFW A;  3KAG A;  3UQA A;  3WL0 A;  2A3C A;  1E9L A;  3WIJ A;  5HT1 A;  1HKM A;  3CH9 A;  1W1V A;  1NH6 A;  4ZPT R;  4JFJ A;  4R0X A;  1LL6 A;  2RUR A;  1TFV A;  2XP9 A;  1FKG A;  1UR9 A;  1C9H A;  3PA7 A;  2WLY A;  3O5J A;  4FN2 A;  1Q6I A;  3AS0 A;  5DIU A;  3QOK A;  3CHF A;  2ESC A;  3JYM A;  3PRB A;  1Y0O A;  3IHZ A;  1EHN A;  2ZR5 A;  3ARQ A;  3UQI A;  3ARU A;  3O5F A;  1FKJ A;  2KO7 A;  3B7X A;  1GOI A;  1NMV A;  4JYS A;  4LAX A;  5HW6 A;  3O5D A;  3BXW A;  2DT2 A;  4S3J A;  3RGC A;  1ZB5 A;  4P8X A;  5JH8 A;  4TW6 A;  3PRA A;  1E6P A;  5HBF A;  5J6E A;  1ZU8 A;  2JZV A;  1P5Q A;  1FKS A;  5HW7 A;  2YBU A;  1KT0 A;  3H9R B;  5DIT A;  2ZQS A;  3WQV A;  1LQ0 A;  3EIP A;  3JXV A;  4DIP A;  1JND A;  1WNO A;  3B8S A;  4G50 A;  1XRV A;  2DT0 A;  1TCO C;  2UZ5 A;  4J4O A;  1ZBC A; 
#chains in the Genus database with same CATH homology
 4BF8 A;  4MSP A;  3RME A;  1HJV A;  1L1P A;  2Y78 A;  1ZBW A;  2XP4 A;  4JFK A;  2Q5A A;  3WD3 A;  4MPK A;  4DRH A;  2RSE A;  4W9P A;  4DRO A;  3KAH A;  4WKA A;  1YAT A;  4XAK A;  4G2P A;  4DRJ A;  3FXY A;  3MDY B;  2DT1 A;  4WK9 A;  1IX5 A;  4W9O A;  2XP7 A;  1HKJ A;  1ZBK A;  1E6N A;  4L72 B;  4GIV A;  4DWS C;  2ZQT A;  4ODM A;  2F4E A;  3KAB A;  4MAV A;  4IPX A;  4DWS D;  4DWS B;  2ZQU A;  3B9A A;  1LL4 A;  3GPK A;  1FFQ A;  5HTG A;  2FKE A;  2O9O A;  1SYT A;  1LL7 A;  3G6L A;  4QT3 A;  2FDM A;  3KAC A;  4ZS6 A;  2FAP A;  3CZ8 A;  2DG4 A;  2DG9 A;  3WKZ A;  4HAR A;  3ODK A;  1M5Y A;  2RUQ A;  3WD1 A;  1KFW A;  1O6I A;  3ARS A;  3RM8 A;  5D75 A;  4TW7 A;  3AS1 A;  2MNT A;  3TDB A;  1FKB A;  1QPL A;  4P8V A;  4Z2G A;  2DPE A;  4Q22 A;  1XHG A;  4Q7N A;  3ARX A;  1ZL1 A;  3NRK A;  1Q6H A;  1FJD A;  4IQC A;  4Z2K A;  3EY6 A;  1PIN A;  1EYM A;  1FKD A;  2PV2 A;  3IK8 A;  1QPF A;  4QT2 A;  1HKI A;  1H0G A;  3NTP A;  1ITX A;  4ODP A;  1F40 A;  1A7X A;  2A3A A;  4R5E A;  1WB0 A;  2QF8 A;  5DF0 A;  1FKL A;  1D2K A;  1JNT A;  3ARP A;  4U85 A;  3WD2 A;  4NZC A;  3IKG A;  4KR0 B;  2PBC A;  4DWS A;  1WAW A;  3OOB A;  1J6Y A;  4WKF A;  3CHE A;  1FKI A;  1W1P A;  3IKD A;  3ARV A;  5I98 A;  4HBO A;  2VN1 A;  3WD4 A;  3WQW A;  2M1I A;  2PV3 A;  3UF8 A;  3LUO A;  4DH0 A;  1D7J A;  3ARO A;  4WKH A;  1R9H A;  2RUC A;  1FKF A;  3CGN A;  4PTM A;  1NMW A;  3UQB A;  5DEZ A;  2XPA A;  2KE0 A;  1D7H A;  4DRM A;  2L2S A;  4ITZ A;  5HUA A;  2LKN A;  4DRK A;  2RUD A;  1K9T A;  3KAD A;  5HW8 A;  2LJ4 A;  4S3K A;  3TCZ A;  1BKF A;  3O5M A;  4TNS A;  3CHD A;  1FFR A;  3FAP A;  4DZ2 A;  4ODL A;  3O5P A;  2A3B A;  3AS3 A;  3G6M A;  1JVW A;  4P8W A;  4KQZ A;  1NWR A;  1H0I A;  2MPH A;  3O5E A;  2PV1 A;  4U84 A;  1HJX A;  1B6C A;  3UI4 A;  4ODK A;  1EDQ A;  3O5I A;  3ALF A;  3CGM A;  3ARR A;  2AOS A;  4O2T A;  1W1Y A;  4MGV A;  4L3N A;  4TW8 A;  4WJX A;  4Z2J A;  1X6N A;  1KT1 A;  4C02 B;  4DRN A;  4TX0 A;  1ZK6 A;  4DRQ A;  4MNJ A;  4LAV A;  1GPF A;  1NSG A;  2PPN A;  2XP8 A;  2DSZ A;  3O5K A;  3AQU A;  4IT4 A;  4TYO A;  1OGG A;  3TC5 A;  1N1A A;  2LPV A;  4Z2L A;  1W26 A;  3FY1 A;  5GPG A;  4ODR A;  3O5R A;  4W5U A;  1QZ2 A;  3RM9 A;  2KGJ A;  2O92 A;  4NNR A;  3O5Q A;  2PI6 A;  2MLX A;  1J4I A;  2F21 A;  4J4N A;  1YW5 A;  1E6R A;  2XP5 A;  2M2A A;  3WH0 A;  3NI6 A;  2IUZ A;  2MLZ A;  1FKR A;  1X6L A;  1UR8 A;  4DRP A;  2IF4 A;  1FD9 A;  4MNM A;  5HKG A;  2YBT A;  4QZV B;  3RM4 A;  2ZQV A;  1Q1C A;  2VCD A;  2XPB A;  4QIB A;  1HJW A;  2MF9 A;  2OFN A;  2ZR6 A;  5GPR A;  4DT4 A;  2M08 A;  2B31 A;  3RFW A;  2D9F A;  4WIW A;  1FAP A;  2WLZ A;  2XP6 A;  4JFI A;  3I6C A;  1OWQ A;  2PPO A;  3ALG A;  1OGB A;  2AWG A;  1E15 A;  5B8I C;  2PPP A;  1Q6U A;  3WD0 A;  4LGX A;  1EIB A;  2DSU A;  1RD6 A;  1T11 A;  2G41 A;  1FKT A;  1U79 A;  4GGQ A;  1W9P A;  4ZPV R;  1SR0 A;  1W9U A;  4P8U A;  2ITK A;  1NWU A;  3KAI A;  3KZ7 A;  1LG1 A;  2RQS A;  3O5O A;  1NWT A;  5GQB A;  1BL4 A;  3AS2 A;  1J4H A;  3KCE A;  1F8A B;  4ZPW R;  3B9E A;  2LGO A;  4ODQ A;  1ZBV A;  1FKK A;  1FKH A;  2DG3 A;  2F2D A;  3O5G A;  5DIV A;  4URI A;  1JNS A;  4MNL A;  2N87 A;  2G8Z A;  5HWB A;  3ARY A;  1HXV A;  2DSW A;  1LJY A;  3KAF A;  1JNE A;  1ZCN A;  4FAP A;  4ODN A;  4MTV A;  5DO2 A;  4MNK A;  2A3E A;  3ART A;  1D6O A;  3O5L A;  2OLH A;  4N19 A;  4LAY A;  4ODO A;  1LG2 A;  4Z2I A;  1ROU A;  2WK2 A;  3B9D A;  4W9Q A;  1W9V A;  4DZ3 A;  3UI5 A;  5BXJ A;  1E6Z A;  1HKK A;  2ZR4 A;  3WL1 A;  3UI6 A;  4U86 A;  3JYJ A;  4Z2H A;  4ML4 A;  2MLY A;  1NWS A;  1CTN A;  1J4R A;  2DSV A;  1PBK A;  2XP3 A;  3CHC A;  4HBE A;  4JFM A;  4JFL A;  2K8I A;  1W1T A;  4IQ2 A;  4LAW A;  3W4R A;  1VF8 A;  3VAW A;  1ROT A;  4AY1 A;  4DRI A;  2WM0 A;  4IT6 A;  1GUV A;  2KI3 A;  3ARW A;  3PRD A;  2KR7 A;  3OA5 A;  3PR9 A;  1EQ3 A;  5HWC A;  2DT3 A;  1D7I A;  4NSB A;  3ARZ A;  2KFW A;  3KAG A;  3UQA A;  3WL0 A;  2A3C A;  1E9L A;  3WIJ A;  5HT1 A;  1HKM A;  3CH9 A;  1W1V A;  1NH6 A;  4ZPT R;  4JFJ A;  4R0X A;  1LL6 A;  2RUR A;  1TFV A;  2XP9 A;  1FKG A;  1UR9 A;  1C9H A;  3PA7 A;  2WLY A;  3O5J A;  4FN2 A;  1Q6I A;  3AS0 A;  5DIU A;  3QOK A;  3CHF A;  2ESC A;  3JYM A;  3PRB A;  1Y0O A;  3IHZ A;  1EHN A;  2ZR5 A;  3ARQ A;  3UQI A;  3ARU A;  3O5F A;  1FKJ A;  2KO7 A;  3B7X A;  1GOI A;  1NMV A;  4JYS A;  4LAX A;  5HW6 A;  3O5D A;  3BXW A;  2DT2 A;  4S3J A;  3RGC A;  1ZB5 A;  4P8X A;  5JH8 A;  4TW6 A;  3PRA A;  1E6P A;  5HBF A;  5J6E A;  1ZU8 A;  2JZV A;  1P5Q A;  1FKS A;  5HW7 A;  2YBU A;  1KT0 A;  3H9R B;  5DIT A;  2ZQS A;  3WQV A;  1LQ0 A;  4DIP A;  3JXV A;  1JND A;  1WNO A;  3B8S A;  4G50 A;  1XRV A;  2DT0 A;  1TCO C;  2UZ5 A;  4J4O A;  1ZBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...