3O5RA

Complex of fk506 with the fk1 domain mutant a19t of fkbp51
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 33
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5rA00
1D7JA 2ZQUA 4DZ3A 3O5KA 1KT1A 2PV1A 1D7IA 5I98A 2RUQA 3PA7A 2PV2A 1PINA 1FKDA 1JVWA 2XPBA 3CGNA 4JFMA 3O5OA 4GIVA 2PPPA 4DROA 4G50A 3MDYB 2PV3A 3RFWA 4ODQA 1JNSA 4DT4A 2Y78A 1YATA 5DIUA 1KT0A 1PBKA 5HW6A 1QPLA 2MLXA 3IK8A 1Q6IA 2RUDA 4DRPA 2MF9A 4DZ2A 2M1IA 2RSEA 3O5FA 4ODNA 3KZ7A 4ODRA 1TCOC 2F2DA 3IHZA 4QT3A 5HT1A 3TC5A 1EQ3A 3WH0A 1JNTA 2ZQVA 1FKLA 1FKBA 2LKNA 3IKGA 2MNTA 4ODOA 1NMVA 1FKHA 4IQ2A 5BXJA 4JFJA 4LAYA 4DRJA 2K8IA 3KADA 1D6OA 1C9HA 2KR7A 1FKGA 2RUCA 1P5QA 2ZR4A 3O5IA 1W26A 2ITKA 2VN1A 4TW7A 5HW8A 2M2AA 4MSPA 3FAPA 5HUAA 2FAPA 2KE0A 3O5QA 1ROUA 2KO7A 4IPXA 1Y0OA 3UI5A 3KAFA 3O5JA 4TYOA 3H9RB 1BL4A 2ZR5A 4JYSA 1J4HA 1ZCNA 3NTPA 3O5PA 3EY6A 4C02B 5B8IC 2L2SA 2PPNA 3O5DA 3UI4A 4DRHA 1FJDA 3KACA 4DH0A 2IF4A 4ODPA 1FKFA 1FKRA 2MLZA 2PBCA 4LAVA 1FKSA 3NRKA 5HW7A 2DG4A 2MPHA 2XP9A 4N19A 4U85A 4G2PA 5J6EA 3KAIA 1EYMA 3O5GA 4TX0A 4W9OA 1D7HA 2LPVA 1A7XA 1FKIA 4TNSA 2DG3A 3O5LA 1J4RA 5DITA 4FN2A 4LAWA 4DRKA 3JXVA 4DRNA 2RURA 3O5MA 5HWBA 2ZR6A 4U86A 2MLYA 4JFKA 3O5RA 4DRMA 5D75A 1BKFA 4U84A 3PRBA 4QT2A 4DRQA 1U79A 1Q6HA 2FKEA 3JYMA 1F40A 2XP6A 4O2TA 3O5EA 4DIPA 1J4IA 4TW6A 5DIVA 4R0XA 2AWGA 1QPFA 1M5YA 2D9FA 1T11A 2XP7A 3KABA 3NI6A 1ROTA 1FAPA 1R9HA 2N87A 4GGQA 2PPOA 2M08A 2RQSA 2UZ5A 4NNRA 1J6YA 2KFWA 3CGMA 4J4OA 3RGCA 3TCZA 2OFNA 3UQAA 1Q6UA 1F8AB 3I6CA 4JFIA 3KAHA 4W9PA 2DG9A 2XPAA 1NSGA 4QIBA 4DRIA 4W9QA 1FKKA 5HKGA 1NMWA 2JZVA 2VCDA 4MGVA 3UQBA 5GPGA 1ZK6A 1YW5A 2XP8A 3PRDA 3UQIA 3KCEA 2F4EA 5HTGA 1Q1CA 4ITZA 2Q5AA 1HXVA 4LAXA 1QZ2A 2LJ4A 5HWCA 4ODMA 1L1PA 4TW8A 2ZQSA 3LUOA 3OOBA 3UF8A 3ODKA 4BF8A 2F21A 1FKJA 4ODLA 4FAPA 2ZQTA 3IKDA 1FKTA 3B7XA 4ODKA 4J4NA 2XP4A 3UI6A 2LGOA 3JYJA 4JFLA 3KAGA 2KI3A 3GPKA 3TDBA 1B6CA 4IQCA 2XP3A 1N1AA 2KGJA 2XP5A 1FD9A 3VAWA
chains in the Genus database with same CATH superfamily
5HBFA 1E6ZA 1HJXA 2PV1A 4S3JA 3PA7A 1PINA 1ZBWA 4NSBA 2KGJA 3O5OA 4G50A 4ODQA 1JNSA 2Y78A 4MPKA 2MLXA 3B9EA 3IK8A 2MF9A 2A3BA 4WK9A 1E44A 3CZ8A 2RSEA 4ODNA 4ODRA 3WD1A 1GPFA 4ZPWR 2DT3A 2P4VA 3BXWA 5BXJA 1WAWA 1C9HA 1E6RA 2VN1A 4TW7A 2M2AA 5HUAA 1HJWA 2KE0A 1ITXA 1ROUA 2KO7A 2B31A 3KAFA 1BL4A 3NTPA 2L2SA 4ODPA 2DSUA 1NWSA 2MLZA 4R5EA 1FKRA 5DEZA 1E6NA 4G2PA 3KAIA 4W9OA 1JNEA 2LPVA 4TNSA 2DG3A 3O5LA 1FFRA 5HWBA 2O9OA 5D75A 1BKFA 4HARA 2XP6A 4O2TA 1F40A 5GPRA 3GU0A 3O5EA 2ETNA 1J4IA 1W9PA 1M5YA 3CHCA 4P8UA 1ROTA 4GGQA 3OA5A 3AS1A 3RGCA 1Q6UA 4P8XA 2OLHA 4JFIA 3KAHA 3G6LA 4L72B 2VCDA 1LL7A 1HKKA 2FDMA 3PRDA 3KCEA 1Q1CA 1E6PA 1TFVA 1L1PA 1KFWA 3ARRA 2ZQSA 1W1VA 2F23A 1HKMA 2XP4A 3JYJA 4IQCA 1FD9A 4WKFA 1D7JA 1D7IA 5I98A 4WKHA 2YBUA 1OGGA 4GIVA 4Q7NA 1O6IA 4DT4A 1PBKA 1QPLA 2AOSA 4DRPA 3RM8A 1H0GA 4Z2JA 2M1IA 4URIA 2F2DA 5HT1A 3WH0A 1JNTA 2ZQVA 2B5UB 3IKGA 2MNTA 4ODOA 3WKZA 3ARXA 1FKHA 1X6LA 4Z2LA 4LAYA 4UDMA 3KADA 1D6OA 1W9VA 2RUCA 4MSPA 5DF0A 1NWTA 4MNKA 2ZR5A 1ZCNA 2QF8A 4ZPTR 4C02B 3UI4A 1ZU8A 1SR0A 3ARZA 2MPHA 5J6EA 1EYMA 2A3AA 4IT4A 1FKIA 5DITA 2ESCA 3JXVA 2RURA 3O5MA 3EIPA 2WM0A 3O5RA 1ZBCA 1SYTA 2WK2A 4DRQA 1U79A 5DO2A 4WJXA 4IT6A 1W1YA 5DIVA 4R0XA 1QPFA 4P8WA 2D9FA 1FAPA 1EHNA 1R9HA 1HJVA 2M08A 1J6YA 4Z2GA 2A3EA 4J4OA 4P8VA 4W9QA 1FKKA 1NMWA 4MTVA 2XP8A 1NH6A 1HKJA 4ITZA 3ARSA 1QZ2A 3ARTA 3ARQA 3WIJA 3CHDA 5JH8A 3OOBA 3UF8A 3AROA 3ODKA 3ARUA 4ODLA 2ZQTA 4J4NA 3ALGA 3UI6A 1CTNA 2KI3A 1XRVA 1B6CA 3PRAA 3VAWA 2ZQUA 4Q22A 3O5KA 1KT1A 1H0IA 1IX5A 4DWSC 2PV2A 1FKDA 2XPBA 4JFMA 2PV3A 3RM9A 1W9UA 5HW6A 1YATA 4QZVB 1Q6IA 3PR9A 4DZ2A 1W1TA 3IHZA 1EIBA 2DSZA 1EQ3A 3AS3A 2LKNA 1GRJA 1NMVA 3CHFA 1FFQA 2G8ZA 4JFJA 4DRJA 2K8IA 3RMEA 1X6NA 3ALFA 3W4RA 3B8SA 4PTMA 2KR7A 1FKGA 2ZR4A 1P5QA 3FXYA 3RM4A 5HW8A 2FAPA 4ZS6A 4IPXA 3WD4A 1Y0OA 1LL4A 3O5JA 4WKAA 3H9RB 3ARPA 1J4HA 3EY6A 5B8IC 2WLYA 2PPNA 1NWUA 3O5DA 4DH0A 4MNJA 1FKSA 3NRKA 2XP9A 2EULA 1WB0A 4DWSA 4MAVA 1WNOA 3GTYX 3O5GA 4TX0A 2DT1A 4WIWA 4LGXA 4DRKA 1OWQA 4DRNA 4U86A 2MLYA 1ZBVA 4HBOA 4U84A 4MNLA 4QT2A 2YBTA 1Q6HA 3JYMA 1W1PA 2PN0A 3CH9A 3WD3A 4DIPA 4TW6A 1LG2A 4Z2KA 3AS2A 1T11A 2XP7A 3ARWA 2A3CA 3WQWA 2N87A 2UZ5A 2RQSA 2KFWA 4DWSD 2OFNA 3UQAA 1XHGA 1F8AB 3ARVA 3I6CA 3WQVA 4W9PA 2XPAA 4QIBA 1NSGA 1HKIA 3UQBA 2DT2A 1ZK6A 5GPGA 5HTGA 2DPEA 2Q5AA 4ODMA 4TW8A 4NZCA 4BF8A 1FKJA 2DSVA 2DT0A 1FKTA 3B7XA 4ODKA 4DWSB 1JNDA 3G6MA 2LGOA 4JFLA 3QOKA 3TDBA 2XP3A 1NWRA 4S3KA 1LL6A 4DZ3A 4XAKA 2RUQA 3CGNA 1JVWA 1LG1A 2PPPA 4DROA 1VF8A 3B9DA 3MDYB 3RFWA 3ARYA 5DIUA 1KT0A 5GQBA 1E9LA 1RD6A 2RUDA 1OGBA 4MNMA 3KZ7A 1TCOC 4QT3A 3TC5A 1FKLA 1FKBA 4ML4A 4IQ2A 2PI6A 2WLZA 2DSWA 3O5IA 1W26A 2ITKA 4KQZA 4KR0B 3FAPA 2IUZA 3O5QA 3UI5A 1EDQA 1ZB5A 4TYOA 4JYSA 3O5PA 4W5UA 4DRHA 1FJDA 3KACA 1LQ0A 2IF4A 1FKFA 3CHEA 2PBCA 1JCHB 4LAVA 5HW7A 2DG4A 3B9AA 4N19A 4U85A 4L3NA 1K9TA 1D7HA 4HBEA 3FY1A 1A7XA 1J4RA 4FN2A 4LAWA 3WD0A 3WL1A 2ZR6A 4JFKA 4DRMA 3PRBA 2FKEA 1LJYA 3AS0A 2AWGA 4ZPVR 3WD2A 2G41A 3KABA 3NI6A 2O92A 3WL0A 2PPOA 1E15A 4NNRA 3CGMA 1D2KA 3TCZA 4Z2IA 1ZBKA 1ZL1A 3BMBA 1GOIA 4Z2HA 2DG9A 4DRIA 5HKGA 1GUVA 4MGVA 2JZVA 1YW5A 3UQIA 2F4EA 4AY1A 1HXVA 4LAXA 2LJ4A 5HWCA 3LUOA 4FAPA 2F21A 1UR8A 3IKDA 1UR9A 3KAGA 3GPKA 1N1AA 3O5FA 3AQUA 2XP5A
chains in the Genus database with same CATH topology
5HBFA 1E6ZA 1HJXA 2PV1A 4S3JA 3PA7A 1PINA 1ZBWA 4NSBA 2KGJA 3O5OA 4G50A 4ODQA 1JNSA 2Y78A 4MPKA 2MLXA 3B9EA 3IK8A 2MF9A 2A3BA 4WK9A 3CZ8A 2RSEA 4ODNA 4ODRA 3WD1A 1GPFA 4ZPWR 2DT3A 3BXWA 5BXJA 1WAWA 1C9HA 1E6RA 2VN1A 4TW7A 2M2AA 5HUAA 1HJWA 2KE0A 1ITXA 1ROUA 2KO7A 2B31A 3KAFA 1BL4A 3NTPA 2L2SA 4ODPA 2DSUA 1NWSA 2MLZA 4R5EA 1FKRA 5DEZA 1E6NA 4G2PA 3KAIA 4W9OA 1JNEA 2LPVA 4TNSA 2DG3A 3O5LA 1FFRA 5HWBA 2O9OA 5D75A 1BKFA 4HARA 2XP6A 4O2TA 1F40A 5GPRA 3O5EA 1J4IA 1W9PA 1M5YA 3CHCA 4P8UA 1ROTA 4GGQA 3OA5A 3AS1A 3RGCA 1Q6UA 4P8XA 2OLHA 4JFIA 3KAHA 3G6LA 4L72B 2VCDA 1LL7A 1HKKA 2FDMA 3PRDA 3KCEA 1Q1CA 1E6PA 1TFVA 1L1PA 1KFWA 3ARRA 2ZQSA 1W1VA 1HKMA 2XP4A 3JYJA 4IQCA 1FD9A 4WKFA 1D7JA 1D7IA 5I98A 4WKHA 2YBUA 1OGGA 4GIVA 4Q7NA 1O6IA 4DT4A 1PBKA 1QPLA 2AOSA 4DRPA 3RM8A 1H0GA 4Z2JA 2M1IA 4URIA 2F2DA 5HT1A 3WH0A 1JNTA 2ZQVA 3IKGA 2MNTA 4ODOA 3WKZA 3ARXA 1FKHA 1X6LA 4Z2LA 4LAYA 3KADA 1D6OA 1W9VA 2RUCA 4MSPA 5DF0A 1NWTA 4MNKA 2ZR5A 1ZCNA 2QF8A 4ZPTR 4C02B 3UI4A 1ZU8A 1SR0A 3ARZA 2MPHA 5J6EA 1EYMA 2A3AA 4IT4A 1FKIA 5DITA 2ESCA 3JXVA 2RURA 3O5MA 2WM0A 3O5RA 1ZBCA 1SYTA 2WK2A 4DRQA 1U79A 5DO2A 4WJXA 4IT6A 1W1YA 5DIVA 4R0XA 1QPFA 4P8WA 2D9FA 1FAPA 1EHNA 1R9HA 1HJVA 2M08A 1J6YA 4Z2GA 2A3EA 4J4OA 4P8VA 4W9QA 1FKKA 1NMWA 4MTVA 2XP8A 1NH6A 1HKJA 4ITZA 3ARSA 1QZ2A 3ARTA 3ARQA 3WIJA 3CHDA 5JH8A 3OOBA 3UF8A 3AROA 3ODKA 3ARUA 4ODLA 2ZQTA 4J4NA 3ALGA 3UI6A 1CTNA 2KI3A 1XRVA 1B6CA 3PRAA 3VAWA 2ZQUA 4Q22A 3O5KA 1KT1A 1H0IA 1IX5A 4DWSC 2PV2A 1FKDA 2XPBA 4JFMA 2PV3A 3RM9A 1W9UA 5HW6A 1YATA 4QZVB 1Q6IA 3PR9A 4DZ2A 1W1TA 3IHZA 1EIBA 2DSZA 1EQ3A 3AS3A 2LKNA 1NMVA 3CHFA 1FFQA 2G8ZA 4JFJA 4DRJA 2K8IA 3RMEA 1X6NA 3ALFA 3W4RA 3B8SA 4PTMA 2KR7A 1FKGA 2ZR4A 1P5QA 3FXYA 3RM4A 5HW8A 2FAPA 4ZS6A 4IPXA 3WD4A 1Y0OA 1LL4A 3O5JA 4WKAA 3H9RB 3ARPA 1J4HA 3EY6A 5B8IC 2WLYA 2PPNA 1NWUA 3O5DA 4DH0A 4MNJA 1FKSA 3NRKA 2XP9A 1WB0A 4DWSA 4MAVA 1WNOA 3O5GA 4TX0A 2DT1A 4WIWA 4LGXA 4DRKA 1OWQA 4DRNA 4U86A 2MLYA 1ZBVA 4HBOA 4U84A 4MNLA 4QT2A 2YBTA 1Q6HA 3JYMA 1W1PA 3CH9A 3WD3A 4DIPA 4TW6A 1LG2A 4Z2KA 3AS2A 1T11A 2XP7A 3ARWA 2A3CA 3WQWA 2N87A 2UZ5A 2RQSA 2KFWA 4DWSD 2OFNA 3UQAA 1XHGA 1F8AB 3ARVA 3I6CA 3WQVA 4W9PA 2XPAA 4QIBA 1NSGA 1HKIA 3UQBA 2DT2A 1ZK6A 5GPGA 5HTGA 2DPEA 2Q5AA 4ODMA 4TW8A 4NZCA 4BF8A 1FKJA 2DSVA 2DT0A 1FKTA 3B7XA 4ODKA 4DWSB 1JNDA 3G6MA 2LGOA 4JFLA 3QOKA 3TDBA 2XP3A 1NWRA 4S3KA 1LL6A 4DZ3A 4XAKA 2RUQA 3CGNA 1JVWA 1LG1A 2PPPA 4DROA 1VF8A 3B9DA 3MDYB 3RFWA 3ARYA 5DIUA 1KT0A 5GQBA 1E9LA 1RD6A 2RUDA 1OGBA 4MNMA 3KZ7A 1TCOC 4QT3A 3TC5A 1FKLA 1FKBA 4ML4A 4IQ2A 2PI6A 2WLZA 2DSWA 3O5IA 1W26A 2ITKA 4KQZA 4KR0B 3FAPA 2IUZA 3O5QA 3UI5A 1EDQA 1ZB5A 4TYOA 4JYSA 3O5PA 4W5UA 4DRHA 1FJDA 3KACA 1LQ0A 2IF4A 1FKFA 3CHEA 2PBCA 4LAVA 5HW7A 2DG4A 3B9AA 4N19A 4U85A 4L3NA 1K9TA 1D7HA 4HBEA 3FY1A 1A7XA 1J4RA 4FN2A 4LAWA 3WD0A 3WL1A 2ZR6A 4JFKA 4DRMA 3PRBA 2FKEA 1LJYA 3AS0A 2AWGA 4ZPVR 3WD2A 2G41A 3KABA 3NI6A 2O92A 3WL0A 2PPOA 1E15A 4NNRA 3CGMA 1D2KA 3TCZA 4Z2IA 1ZBKA 1ZL1A 1GOIA 4Z2HA 2DG9A 4DRIA 5HKGA 1GUVA 4MGVA 2JZVA 1YW5A 3UQIA 2F4EA 4AY1A 1HXVA 4LAXA 2LJ4A 5HWCA 3LUOA 4FAPA 2F21A 1UR8A 3IKDA 1UR9A 3KAGA 3GPKA 1N1AA 3O5FA 3AQUA 2XP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7J A;  2ZQU A;  4DZ3 A;  3O5K A;  1KT1 A;  2PV1 A;  1D7I A;  5I98 A;  2RUQ A;  3PA7 A;  2PV2 A;  1PIN A;  1FKD A;  1JVW A;  2XPB A;  3CGN A;  4JFM A;  3O5O A;  4GIV A;  2PPP A;  4DRO A;  4G50 A;  3MDY B;  2PV3 A;  3RFW A;  4ODQ A;  1JNS A;  4DT4 A;  2Y78 A;  1YAT A;  5DIU A;  1KT0 A;  1PBK A;  5HW6 A;  1QPL A;  2MLX A;  3IK8 A;  1Q6I A;  2RUD A;  4DRP A;  2MF9 A;  4DZ2 A;  2M1I A;  2RSE A;  3O5F A;  4ODN A;  3KZ7 A;  4ODR A;  1TCO C;  2F2D A;  3IHZ A;  4QT3 A;  5HT1 A;  3TC5 A;  1EQ3 A;  3WH0 A;  1JNT A;  2ZQV A;  1FKL A;  1FKB A;  2LKN A;  3IKG A;  2MNT A;  4ODO A;  1NMV A;  1FKH A;  4IQ2 A;  5BXJ A;  4JFJ A;  4LAY A;  4DRJ A;  2K8I A;  3KAD A;  1D6O A;  1C9H A;  2KR7 A;  1FKG A;  2RUC A;  1P5Q A;  2ZR4 A;  3O5I A;  1W26 A;  2ITK A;  2VN1 A;  4TW7 A;  5HW8 A;  2M2A A;  4MSP A;  3FAP A;  5HUA A;  2FAP A;  2KE0 A;  3O5Q A;  1ROU A;  2KO7 A;  4IPX A;  1Y0O A;  3UI5 A;  3KAF A;  3O5J A;  4TYO A;  3H9R B;  1BL4 A;  2ZR5 A;  4JYS A;  1J4H A;  1ZCN A;  3NTP A;  3O5P A;  3EY6 A;  4C02 B;  5B8I C;  2L2S A;  2PPN A;  3O5D A;  3UI4 A;  4DRH A;  1FJD A;  3KAC A;  4DH0 A;  2IF4 A;  4ODP A;  1FKF A;  1FKR A;  2MLZ A;  2PBC A;  4LAV A;  1FKS A;  3NRK A;  5HW7 A;  2DG4 A;  2MPH A;  2XP9 A;  4N19 A;  4U85 A;  4G2P A;  5J6E A;  3KAI A;  1EYM A;  3O5G A;  4TX0 A;  4W9O A;  1D7H A;  2LPV A;  1A7X A;  1FKI A;  4TNS A;  2DG3 A;  3O5L A;  1J4R A;  5DIT A;  4FN2 A;  4LAW A;  4DRK A;  3JXV A;  4DRN A;  2RUR A;  3O5M A;  5HWB A;  2ZR6 A;  4U86 A;  2MLY A;  4JFK A;  3O5R A;  4DRM A;  5D75 A;  1BKF A;  4U84 A;  3PRB A;  4QT2 A;  4DRQ A;  1U79 A;  1Q6H A;  2FKE A;  3JYM A;  1F40 A;  2XP6 A;  4O2T A;  3O5E A;  4DIP A;  1J4I A;  4TW6 A;  5DIV A;  4R0X A;  2AWG A;  1QPF A;  1M5Y A;  2D9F A;  1T11 A;  2XP7 A;  3KAB A;  3NI6 A;  1ROT A;  1FAP A;  1R9H A;  2N87 A;  4GGQ A;  2PPO A;  2M08 A;  2RQS A;  2UZ5 A;  4NNR A;  1J6Y A;  2KFW A;  3CGM A;  4J4O A;  3RGC A;  3TCZ A;  2OFN A;  3UQA A;  1Q6U A;  1F8A B;  3I6C A;  4JFI A;  3KAH A;  4W9P A;  2DG9 A;  2XPA A;  1NSG A;  4QIB A;  4DRI A;  4W9Q A;  1FKK A;  5HKG A;  1NMW A;  2JZV A;  2VCD A;  4MGV A;  3UQB A;  5GPG A;  1ZK6 A;  1YW5 A;  2XP8 A;  3PRD A;  3UQI A;  3KCE A;  2F4E A;  5HTG A;  1Q1C A;  4ITZ A;  2Q5A A;  1HXV A;  4LAX A;  1QZ2 A;  2LJ4 A;  5HWC A;  4ODM A;  1L1P A;  4TW8 A;  2ZQS A;  3LUO A;  3OOB A;  3UF8 A;  3ODK A;  4BF8 A;  2F21 A;  1FKJ A;  4ODL A;  4FAP A;  2ZQT A;  3IKD A;  1FKT A;  3B7X A;  4ODK A;  4J4N A;  2XP4 A;  3UI6 A;  2LGO A;  3JYJ A;  4JFL A;  3KAG A;  2KI3 A;  3GPK A;  3TDB A;  1B6C A;  4IQC A;  2XP3 A;  1N1A A;  2KGJ A;  2XP5 A;  1FD9 A;  3VAW A; 
#chains in the Genus database with same CATH topology
 5HBF A;  1E6Z A;  1HJX A;  2PV1 A;  4S3J A;  3PA7 A;  1PIN A;  1ZBW A;  4NSB A;  2KGJ A;  3O5O A;  4G50 A;  4ODQ A;  1JNS A;  2Y78 A;  4MPK A;  2MLX A;  3B9E A;  3IK8 A;  2MF9 A;  2A3B A;  4WK9 A;  1E44 A;  3CZ8 A;  2RSE A;  4ODN A;  4ODR A;  3WD1 A;  1GPF A;  4ZPW R;  2DT3 A;  2P4V A;  3BXW A;  5BXJ A;  1WAW A;  1C9H A;  1E6R A;  2VN1 A;  4TW7 A;  2M2A A;  5HUA A;  1HJW A;  2KE0 A;  1ITX A;  1ROU A;  2KO7 A;  2B31 A;  3KAF A;  1BL4 A;  3NTP A;  2L2S A;  4ODP A;  2DSU A;  1NWS A;  2MLZ A;  4R5E A;  1FKR A;  5DEZ A;  1E6N A;  4G2P A;  3KAI A;  4W9O A;  1JNE A;  2LPV A;  4TNS A;  2DG3 A;  3O5L A;  1FFR A;  5HWB A;  2O9O A;  5D75 A;  1BKF A;  4HAR A;  2XP6 A;  4O2T A;  1F40 A;  5GPR A;  3GU0 A;  3O5E A;  2ETN A;  1J4I A;  1W9P A;  1M5Y A;  3CHC A;  4P8U A;  1ROT A;  4GGQ A;  3OA5 A;  3AS1 A;  3RGC A;  1Q6U A;  4P8X A;  2OLH A;  4JFI A;  3KAH A;  3G6L A;  4L72 B;  2VCD A;  1LL7 A;  1HKK A;  2FDM A;  3PRD A;  3KCE A;  1Q1C A;  1E6P A;  1TFV A;  1L1P A;  1KFW A;  3ARR A;  2ZQS A;  1W1V A;  2F23 A;  1HKM A;  2XP4 A;  3JYJ A;  4IQC A;  1FD9 A;  4WKF A;  1D7J A;  1D7I A;  5I98 A;  4WKH A;  2YBU A;  1OGG A;  4GIV A;  4Q7N A;  1O6I A;  4DT4 A;  1PBK A;  1QPL A;  2AOS A;  4DRP A;  3RM8 A;  1H0G A;  4Z2J A;  2M1I A;  4URI A;  2F2D A;  5HT1 A;  3WH0 A;  1JNT A;  2ZQV A;  2B5U B;  3IKG A;  2MNT A;  4ODO A;  3WKZ A;  3ARX A;  1FKH A;  1X6L A;  4Z2L A;  4LAY A;  4UDM A;  3KAD A;  1D6O A;  1W9V A;  2RUC A;  4MSP A;  5DF0 A;  1NWT A;  4MNK A;  2ZR5 A;  1ZCN A;  2QF8 A;  4ZPT R;  4C02 B;  3UI4 A;  1ZU8 A;  1SR0 A;  3ARZ A;  2MPH A;  5J6E A;  1EYM A;  2A3A A;  4IT4 A;  1FKI A;  5DIT A;  2ESC A;  3JXV A;  2RUR A;  3O5M A;  3EIP A;  2WM0 A;  3O5R A;  1ZBC A;  1SYT A;  2WK2 A;  4DRQ A;  1U79 A;  5DO2 A;  4WJX A;  4IT6 A;  1W1Y A;  5DIV A;  4R0X A;  1QPF A;  4P8W A;  2D9F A;  1FAP A;  1EHN A;  1R9H A;  1HJV A;  2M08 A;  1J6Y A;  4Z2G A;  2A3E A;  4J4O A;  4P8V A;  4W9Q A;  1FKK A;  1NMW A;  4MTV A;  2XP8 A;  1NH6 A;  1HKJ A;  4ITZ A;  3ARS A;  1QZ2 A;  3ART A;  3ARQ A;  3WIJ A;  3CHD A;  5JH8 A;  3OOB A;  3UF8 A;  3ARO A;  3ODK A;  3ARU A;  4ODL A;  2ZQT A;  4J4N A;  3ALG A;  3UI6 A;  1CTN A;  2KI3 A;  1XRV A;  1B6C A;  3PRA A;  3VAW A;  2ZQU A;  4Q22 A;  3O5K A;  1KT1 A;  1H0I A;  1IX5 A;  4DWS C;  2PV2 A;  1FKD A;  2XPB A;  4JFM A;  2PV3 A;  3RM9 A;  1W9U A;  5HW6 A;  1YAT A;  4QZV B;  1Q6I A;  3PR9 A;  4DZ2 A;  1W1T A;  3IHZ A;  1EIB A;  2DSZ A;  1EQ3 A;  3AS3 A;  2LKN A;  1GRJ A;  1NMV A;  3CHF A;  1FFQ A;  2G8Z A;  4JFJ A;  4DRJ A;  2K8I A;  3RME A;  1X6N A;  3ALF A;  3W4R A;  3B8S A;  4PTM A;  2KR7 A;  1FKG A;  2ZR4 A;  1P5Q A;  3FXY A;  3RM4 A;  5HW8 A;  2FAP A;  4ZS6 A;  4IPX A;  3WD4 A;  1Y0O A;  1LL4 A;  3O5J A;  4WKA A;  3H9R B;  3ARP A;  1J4H A;  3EY6 A;  5B8I C;  2WLY A;  2PPN A;  1NWU A;  3O5D A;  4DH0 A;  4MNJ A;  1FKS A;  3NRK A;  2XP9 A;  2EUL A;  1WB0 A;  4DWS A;  4MAV A;  1WNO A;  3GTY X;  3O5G A;  4TX0 A;  2DT1 A;  4WIW A;  4LGX A;  4DRK A;  1OWQ A;  4DRN A;  4U86 A;  2MLY A;  1ZBV A;  4HBO A;  4U84 A;  4MNL A;  4QT2 A;  2YBT A;  1Q6H A;  3JYM A;  1W1P A;  2PN0 A;  3CH9 A;  3WD3 A;  4DIP A;  4TW6 A;  1LG2 A;  4Z2K A;  3AS2 A;  1T11 A;  2XP7 A;  3ARW A;  2A3C A;  3WQW A;  2N87 A;  2UZ5 A;  2RQS A;  2KFW A;  4DWS D;  2OFN A;  3UQA A;  1XHG A;  1F8A B;  3ARV A;  3I6C A;  3WQV A;  4W9P A;  2XPA A;  4QIB A;  1NSG A;  1HKI A;  3UQB A;  2DT2 A;  1ZK6 A;  5GPG A;  5HTG A;  2DPE A;  2Q5A A;  4ODM A;  4TW8 A;  4NZC A;  4BF8 A;  1FKJ A;  2DSV A;  2DT0 A;  1FKT A;  3B7X A;  4ODK A;  4DWS B;  1JND A;  3G6M A;  2LGO A;  4JFL A;  3QOK A;  3TDB A;  2XP3 A;  1NWR A;  4S3K A;  1LL6 A;  4DZ3 A;  4XAK A;  2RUQ A;  3CGN A;  1JVW A;  1LG1 A;  2PPP A;  4DRO A;  1VF8 A;  3B9D A;  3MDY B;  3RFW A;  3ARY A;  5DIU A;  1KT0 A;  5GQB A;  1E9L A;  1RD6 A;  2RUD A;  1OGB A;  4MNM A;  3KZ7 A;  1TCO C;  4QT3 A;  3TC5 A;  1FKL A;  1FKB A;  4ML4 A;  4IQ2 A;  2PI6 A;  2WLZ A;  2DSW A;  3O5I A;  1W26 A;  2ITK A;  4KQZ A;  4KR0 B;  3FAP A;  2IUZ A;  3O5Q A;  3UI5 A;  1EDQ A;  1ZB5 A;  4TYO A;  4JYS A;  3O5P A;  4W5U A;  4DRH A;  1FJD A;  3KAC A;  1LQ0 A;  2IF4 A;  1FKF A;  3CHE A;  2PBC A;  1JCH B;  4LAV A;  5HW7 A;  2DG4 A;  3B9A A;  4N19 A;  4U85 A;  4L3N A;  1K9T A;  1D7H A;  4HBE A;  3FY1 A;  1A7X A;  1J4R A;  4FN2 A;  4LAW A;  3WD0 A;  3WL1 A;  2ZR6 A;  4JFK A;  4DRM A;  3PRB A;  2FKE A;  1LJY A;  3AS0 A;  2AWG A;  4ZPV R;  3WD2 A;  2G41 A;  3KAB A;  3NI6 A;  2O92 A;  3WL0 A;  2PPO A;  1E15 A;  4NNR A;  3CGM A;  1D2K A;  3TCZ A;  4Z2I A;  1ZBK A;  1ZL1 A;  3BMB A;  1GOI A;  4Z2H A;  2DG9 A;  4DRI A;  5HKG A;  1GUV A;  4MGV A;  2JZV A;  1YW5 A;  3UQI A;  2F4E A;  4AY1 A;  1HXV A;  4LAX A;  2LJ4 A;  5HWC A;  3LUO A;  4FAP A;  2F21 A;  1UR8 A;  3IKD A;  1UR9 A;  3KAG A;  3GPK A;  1N1A A;  3O5F A;  3AQU A;  2XP5 A; 
#chains in the Genus database with same CATH homology
 5HBF A;  1E6Z A;  1HJX A;  2PV1 A;  4S3J A;  3PA7 A;  1PIN A;  1ZBW A;  4NSB A;  2KGJ A;  3O5O A;  4G50 A;  4ODQ A;  1JNS A;  2Y78 A;  4MPK A;  2MLX A;  3B9E A;  3IK8 A;  2MF9 A;  2A3B A;  4WK9 A;  3CZ8 A;  2RSE A;  4ODN A;  4ODR A;  3WD1 A;  1GPF A;  4ZPW R;  2DT3 A;  3BXW A;  5BXJ A;  1WAW A;  1C9H A;  1E6R A;  2VN1 A;  4TW7 A;  2M2A A;  5HUA A;  1HJW A;  2KE0 A;  1ITX A;  1ROU A;  2KO7 A;  2B31 A;  3KAF A;  1BL4 A;  3NTP A;  2L2S A;  4ODP A;  2DSU A;  1NWS A;  2MLZ A;  4R5E A;  1FKR A;  5DEZ A;  1E6N A;  4G2P A;  3KAI A;  4W9O A;  1JNE A;  2LPV A;  4TNS A;  2DG3 A;  3O5L A;  1FFR A;  5HWB A;  2O9O A;  5D75 A;  1BKF A;  4HAR A;  2XP6 A;  4O2T A;  1F40 A;  5GPR A;  3O5E A;  1J4I A;  1W9P A;  1M5Y A;  3CHC A;  4P8U A;  1ROT A;  4GGQ A;  3OA5 A;  3AS1 A;  3RGC A;  1Q6U A;  4P8X A;  2OLH A;  4JFI A;  3KAH A;  3G6L A;  4L72 B;  2VCD A;  1LL7 A;  1HKK A;  2FDM A;  3PRD A;  3KCE A;  1Q1C A;  1E6P A;  1TFV A;  1L1P A;  1KFW A;  3ARR A;  2ZQS A;  1W1V A;  1HKM A;  2XP4 A;  3JYJ A;  4IQC A;  1FD9 A;  4WKF A;  1D7J A;  1D7I A;  5I98 A;  4WKH A;  2YBU A;  1OGG A;  4GIV A;  4Q7N A;  1O6I A;  4DT4 A;  1PBK A;  1QPL A;  2AOS A;  4DRP A;  3RM8 A;  1H0G A;  4Z2J A;  2M1I A;  4URI A;  2F2D A;  5HT1 A;  3WH0 A;  1JNT A;  2ZQV A;  3IKG A;  2MNT A;  4ODO A;  3WKZ A;  3ARX A;  1FKH A;  1X6L A;  4Z2L A;  4LAY A;  3KAD A;  1D6O A;  1W9V A;  2RUC A;  4MSP A;  5DF0 A;  1NWT A;  4MNK A;  2ZR5 A;  1ZCN A;  2QF8 A;  4ZPT R;  4C02 B;  3UI4 A;  1ZU8 A;  1SR0 A;  3ARZ A;  2MPH A;  5J6E A;  1EYM A;  2A3A A;  4IT4 A;  1FKI A;  5DIT A;  2ESC A;  3JXV A;  2RUR A;  3O5M A;  2WM0 A;  3O5R A;  1ZBC A;  1SYT A;  2WK2 A;  4DRQ A;  1U79 A;  5DO2 A;  4WJX A;  4IT6 A;  1W1Y A;  5DIV A;  4R0X A;  1QPF A;  4P8W A;  2D9F A;  1FAP A;  1EHN A;  1R9H A;  1HJV A;  2M08 A;  1J6Y A;  4Z2G A;  2A3E A;  4J4O A;  4P8V A;  4W9Q A;  1FKK A;  1NMW A;  4MTV A;  2XP8 A;  1NH6 A;  1HKJ A;  4ITZ A;  3ARS A;  1QZ2 A;  3ART A;  3ARQ A;  3WIJ A;  3CHD A;  5JH8 A;  3OOB A;  3UF8 A;  3ARO A;  3ODK A;  3ARU A;  4ODL A;  2ZQT A;  4J4N A;  3ALG A;  3UI6 A;  1CTN A;  2KI3 A;  1XRV A;  1B6C A;  3PRA A;  3VAW A;  2ZQU A;  4Q22 A;  3O5K A;  1KT1 A;  1H0I A;  1IX5 A;  4DWS C;  2PV2 A;  1FKD A;  2XPB A;  4JFM A;  2PV3 A;  3RM9 A;  1W9U A;  5HW6 A;  1YAT A;  4QZV B;  1Q6I A;  3PR9 A;  4DZ2 A;  1W1T A;  3IHZ A;  1EIB A;  2DSZ A;  1EQ3 A;  3AS3 A;  2LKN A;  1NMV A;  3CHF A;  1FFQ A;  2G8Z A;  4JFJ A;  4DRJ A;  2K8I A;  3RME A;  1X6N A;  3ALF A;  3W4R A;  3B8S A;  4PTM A;  2KR7 A;  1FKG A;  2ZR4 A;  1P5Q A;  3FXY A;  3RM4 A;  5HW8 A;  2FAP A;  4ZS6 A;  4IPX A;  3WD4 A;  1Y0O A;  1LL4 A;  3O5J A;  4WKA A;  3H9R B;  3ARP A;  1J4H A;  3EY6 A;  5B8I C;  2WLY A;  2PPN A;  1NWU A;  3O5D A;  4DH0 A;  4MNJ A;  1FKS A;  3NRK A;  2XP9 A;  1WB0 A;  4DWS A;  4MAV A;  1WNO A;  3O5G A;  4TX0 A;  2DT1 A;  4WIW A;  4LGX A;  4DRK A;  1OWQ A;  4DRN A;  4U86 A;  2MLY A;  1ZBV A;  4HBO A;  4U84 A;  4MNL A;  4QT2 A;  2YBT A;  1Q6H A;  3JYM A;  1W1P A;  3CH9 A;  3WD3 A;  4DIP A;  4TW6 A;  1LG2 A;  4Z2K A;  3AS2 A;  1T11 A;  2XP7 A;  3ARW A;  2A3C A;  3WQW A;  2N87 A;  2UZ5 A;  2RQS A;  2KFW A;  4DWS D;  2OFN A;  3UQA A;  1XHG A;  1F8A B;  3ARV A;  3I6C A;  3WQV A;  4W9P A;  2XPA A;  4QIB A;  1NSG A;  1HKI A;  3UQB A;  2DT2 A;  1ZK6 A;  5GPG A;  5HTG A;  2DPE A;  2Q5A A;  4ODM A;  4TW8 A;  4NZC A;  4BF8 A;  1FKJ A;  2DSV A;  2DT0 A;  1FKT A;  3B7X A;  4ODK A;  4DWS B;  1JND A;  3G6M A;  2LGO A;  4JFL A;  3QOK A;  3TDB A;  2XP3 A;  1NWR A;  4S3K A;  1LL6 A;  4DZ3 A;  4XAK A;  2RUQ A;  3CGN A;  1JVW A;  1LG1 A;  2PPP A;  4DRO A;  1VF8 A;  3B9D A;  3MDY B;  3RFW A;  3ARY A;  5DIU A;  1KT0 A;  5GQB A;  1E9L A;  1RD6 A;  2RUD A;  1OGB A;  4MNM A;  3KZ7 A;  1TCO C;  4QT3 A;  3TC5 A;  1FKL A;  1FKB A;  4ML4 A;  4IQ2 A;  2PI6 A;  2WLZ A;  2DSW A;  3O5I A;  1W26 A;  2ITK A;  4KQZ A;  4KR0 B;  3FAP A;  2IUZ A;  3O5Q A;  3UI5 A;  1EDQ A;  1ZB5 A;  4TYO A;  4JYS A;  3O5P A;  4W5U A;  4DRH A;  1FJD A;  3KAC A;  1LQ0 A;  2IF4 A;  1FKF A;  3CHE A;  2PBC A;  4LAV A;  5HW7 A;  2DG4 A;  3B9A A;  4N19 A;  4U85 A;  4L3N A;  1K9T A;  1D7H A;  4HBE A;  3FY1 A;  1A7X A;  1J4R A;  4FN2 A;  4LAW A;  3WD0 A;  3WL1 A;  2ZR6 A;  4JFK A;  4DRM A;  3PRB A;  2FKE A;  1LJY A;  3AS0 A;  2AWG A;  4ZPV R;  3WD2 A;  2G41 A;  3KAB A;  3NI6 A;  2O92 A;  3WL0 A;  2PPO A;  1E15 A;  4NNR A;  3CGM A;  1D2K A;  3TCZ A;  4Z2I A;  1ZBK A;  1ZL1 A;  1GOI A;  4Z2H A;  2DG9 A;  4DRI A;  5HKG A;  1GUV A;  4MGV A;  2JZV A;  1YW5 A;  3UQI A;  2F4E A;  4AY1 A;  1HXV A;  4LAX A;  2LJ4 A;  5HWC A;  3LUO A;  4FAP A;  2F21 A;  1UR8 A;  3IKD A;  1UR9 A;  3KAG A;  3GPK A;  1N1A A;  3O5F A;  3AQU A;  2XP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...