5HKGA

Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (fkbp12.6).
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Total chemical synthesis, refolding, and crystallographic structure of fully active immunophilin calstabin 2 (FKBP12.6).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hkgA00
5HUAA 1JNSA 3UI5A 1NSGA 1FD9A 4TYOA 5HW8A 4DT4A 1ROUA 3KZ7A 1YATA 3IKGA 3JXVA 2LKNA 3O5PA 4GGQA 3O5IA 3O5KA 1W26A 1FKDA 1ZCNA 3VAWA 4DZ2A 1J6YA 3EY6A 2M2AA 3RFWA 3O5QA 4ODLA 3NTPA 4G2PA 1Q1CA 3O5FA 1BKFA 4ODRA 1FKHA 3RGCA 1J4IA 1Q6HA 2KGJA 3O5MA 2LPVA 3O5EA 2VCDA 1N1AA 3KAGA 1D7HA 1EYMA 2XP5A 3MDYB 2XPBA 3PA7A 3O5LA 2MF9A 1B6CA 2VN1A 2RURA 2UZ5A 4LAXA 3O5DA 4MGVA 3IHZA 3I6CA 1T11A 3TCZA 2OFNA 2ZQTA 2MPHA 4MSPA 3KADA 3KCEA 4TW7A 5HW6A 3O5JA 2FKEA 1KT1A 4QIBA 2M1IA 2MLZA 1FKBA 1Y0OA 3B7XA 3IK8A 4DRNA 4J4NA 1D7IA 2XP6A 3UI4A 3UQIA 4DH0A 1D6OA 3IKDA 4ODNA 5HTGA 5J6EA 5DITA 2KFWA 3UF8A 2PPPA 4DRMA 4TW6A 4DRIA 4QT3A 2M08A 2RUCA 2RUQA 2IF4A 2ITKA 4FN2A 4TNSA 3KACA 4IPXA 3KABA 4TW8A 2MLYA 4ODKA 1ZK6A 2KE0A 1NMVA 1QZ2A 4ODMA 2XP3A 1FKRA 2XP8A 3KAIA 1FKKA 3JYJA 3H9RB 5HT1A 2PPNA 4LAVA 3TC5A 4GIVA 4DROA 1PINA 1FKLA 1F40A 4W9OA 2ZQSA 3TDBA 2RQSA 2D9FA 5B8IC 2ZQUA 2RUDA 2PBCA 5HWBA 4U86A 4LAWA 5DIVA 4W9QA 5I98A 3KAFA 2Q5AA 2RSEA 3CGMA 1L1PA 2MLXA 3PRBA 3OOBA 4ODOA 1J4RA 2N87A 2K8IA 4JFJA 1TCOC 4JFLA 1EQ3A 4DZ3A 1JVWA 1FKGA 4JFMA 2Y78A 4FAPA 5HW7A 1F8AB 1BL4A 5D75A 1PBKA 2ZQVA 3CGNA 2XPAA 1P5QA 3JYMA 4BF8A 3O5RA 1FKTA 4N19A 2DG9A 4ODQA 3UQBA 1ROTA 5HKGA 1R9HA 3UI6A 1FAPA 4DRHA 4W9PA 2ZR4A 4DRKA 4NNRA 3UQAA 3FAPA 1KT0A 2L2SA 1C9HA 2KI3A 2XP7A 5GPGA 1JNTA 1NMWA 2PPOA 2XP4A 3GPKA 1QPLA 1Q6IA 2PV1A 1FKFA 2DG3A 2MNTA 1FJDA 2ZR5A 2JZVA 4O2TA 4ODPA 1FKJA 4JFIA 4DRJA 5HWCA 1FKSA 4TX0A 2AWGA 4U84A 5BXJA 2XP9A 3ODKA 1QPFA 2F2DA 4ITZA 5DIUA 2PV3A 4IQCA 4J4OA 3WH0A 4DIPA 2ZR6A 2DG4A 4C02B 4DRQA 1HXVA 2LGOA 3LUOA 4LAYA 2PV2A 2KO7A 1FKIA 3O5GA 4IQ2A 2F21A 2F4EA 4JYSA 3NRKA 3PRDA 4JFKA 1M5YA 4G50A 1U79A 2LJ4A 1J4HA 3KAHA 2KR7A 3O5OA 4R0XA 1A7XA 4U85A 1D7JA 3NI6A 2FAPA 4QT2A 4DRPA 1Q6UA 1YW5A
chains in the Genus database with same CATH superfamily
2DSUA 1LJYA 5HUAA 4DT4A 3O5PA 1OWQA 2LKNA 3O5IA 3O5KA 1W26A 3VAWA 2QF8A 3EY6A 1SR0A 4G2PA 2A3CA 3O5FA 1FKHA 5JH8A 2KGJA 2DSWA 1GPFA 2XPBA 4WKHA 2UZ5A 3O5DA 1NWSA 1TFVA 5DEZA 1EQ3A 2OFNA 4MSPA 2FKEA 2M1IA 4KQZA 1LL7A 3B7XA 4ZPVR 3IKDA 4ODNA 3RM4A 5GPRA 5J6EA 2KFWA 2PPPA 4DRMA 2B31A 3RMEA 1NWTA 2RUCA 2ITKA 2MLYA 4ODMA 1FKKA 2PPNA 4LAVA 3CH9A 4DROA 2ZQSA 2RQSA 2G41A 2PBCA 5HWBA 3CHCA 2DSVA 3KAFA 1WB0A 2RSEA 1J4RA 4JFJA 4DZ3A 4JFMA 2A3AA 4FAPA 1F8AB 1D2KA 3G6MA 2XPAA 1P5QA 1ROTA 1FAPA 4HARA 4W9PA 4DRKA 2XP7A 1NMWA 2PPOA 2XP4A 3GPKA 2DT0A 2DG3A 3ARTA 4KR0B 4O2TA 1E6PA 4JFIA 4DRJA 4Z2JA 3G6LA 4TX0A 5BXJA 2XP9A 4ZPTR 3ODKA 2F2DA 4P8VA 5DIUA 2PV3A 4IQCA 3WL1A 4C02B 1HXVA 4P8XA 1E9LA 3CHEA 2G8ZA 2F21A 4JYSA 3PRDA 1J4HA 1A7XA 1HJVA 1JNDA 4DRPA 3B9AA 1FD9A 1H0IA 4TYOA 5HW8A 4GGQA 1FKDA 1E44A 4Z2IA 3O5QA 3ARWA 4ODRA 3RGCA 1X6LA 3BMBA 2WLYA 3O5MA 2LPVA 3WQVA 1ZB5A 1D7HA 1EYMA 2XP5A 1EDQA 1B6CA 2FDMA 2RURA 4LAXA 1ZBWA 1HJXA 4MGVA 3IHZA 1T11A 4MPKA 3ARXA 3O5JA 4LGXA 2MLZA 1FKBA 1Y0OA 1SYTA 1W1VA 1LG2A 1NWUA 1X6NA 3AS2A 3WD2A 4XAKA 2B5UB 4QT3A 2RUQA 3ARVA 3PR9A 4MAVA 4TNSA 4WKFA 4DWSD 3WD4A 1NMVA 1JNEA 1ZL1A 2WM0A 3AS3A 3H9RB 4MNMA 1PINA 3W4RA 3TDBA 3WKZA 2ZQUA 3CHDA 4LAWA 5I98A 2Q5AA 4IT4A 4Q22A 3WD0A 4DWSC 4JFLA 3WL0A 4NZCA 2O9OA 4DWSA 5D75A 3RM9A 3QOKA 1PBKA 3JYMA 4BF8A 3O5RA 4N19A 1NWRA 2DG9A 1KFWA 1ZBCA 2WK2A 3FAPA 2L2SA 4NSBA 2KI3A 2PV1A 1FKFA 2MNTA 4S3JA 2F23A 2JZVA 3B8SA 4URIA 4ODPA 3WIJA 2AWGA 3CZ8A 1JCHB 3ARQA 4DIPA 2ZR6A 1LL6A 3OA5A 3LUOA 4LAYA 2PV2A 1FKIA 1ZBVA 2F4EA 1W1PA 4JFKA 1M5YA 1U79A 2KR7A 1D7JA 3NI6A 3GTYX 5HW7A 4DWSB 1NSGA 2YBTA 2PI6A 1E6ZA 3KZ7A 2O92A 1YATA 3JXVA 1J6YA 1CTNA 1H0GA 1ZCNA 4AY1A 4DZ2A 1ZBKA 3NTPA 1Q1CA 1BKFA 3AROA 1EIBA 1WNOA 1J4IA 3WQWA 3B9DA 1XHGA 1N1AA 1XRVA 3KAGA 3PA7A 4WIWA 1LQ0A 1W9UA 3O5LA 5DF0A 2WLZA 4P8UA 3I6CA 3ALGA 2ZQTA 3KCEA 4TW7A 5HW6A 1NH6A 1KT1A 2EULA 3EIPA 2DT1A 4QIBA 4P8WA 4DRNA 2XP6A 4DH0A 1D6OA 5HTGA 4WJXA 1K9TA 1GUVA 4L3NA 2AOSA 3UF8A 4DRIA 4HBOA 2IF4A 2PN0A 3KACA 1ZK6A 1QZ2A 5DO2A 2A3EA 2XP3A 1FKRA 2XP8A 4Q7NA 5HT1A 4GIVA 1FKLA 2D9FA 2A3BA 4U86A 1HJWA 1L1PA 3CGMA 4IT6A 2OLHA 1BL4A 3ARYA 2YBUA 2ZQVA 1ITXA 3ARZA 1FKTA 4ODQA 2P4VA 1IX5A 1FFRA 1HKMA 1VF8A 4MNLA 1E6RA 4NNRA 4QZVB 1C9HA 3ARRA 1OGBA 1JNTA 1QPLA 1E15A 2ESCA 2ZR5A 4PTMA 1W9PA 1QPFA 4ITZA 3WH0A 4DRQA 2LGOA 4WKAA 2IUZA 1OGGA 2KO7A 3NRKA 4G50A 2LJ4A 3KAHA 4U85A 2FAPA 3B9EA 4QT2A 2DT2A 1O6IA 1Q6UA 1YW5A 1HKJA 1JNSA 3UI5A 1ZU8A 1W1TA 1ROUA 1E6NA 3IKGA 3AS1A 4MTVA 2M2AA 3RFWA 5HBFA 3GU0A 4ODLA 1Q6HA 5GQBA 1HKIA 3O5EA 2VCDA 3RM8A 3ALFA 3MDYB 3PRAA 2MF9A 2VN1A 3TCZA 2MPHA 3KADA 4Z2LA 4Z2HA 1WAWA 4L72B 3WD3A 4UDMA 3IK8A 4J4NA 1D7IA 3UQIA 3UI4A 4WK9A 5DITA 4ZPWR 4HBEA 4TW6A 2M08A 1GOIA 4FN2A 3ARPA 4IPXA 4S3KA 3KABA 1LG1A 4TW8A 4ODKA 2KE0A 1W1YA 3KAIA 3WD1A 3ARSA 3JYJA 3TC5A 1F40A 4W9OA 1UR9A 5B8IC 2RUDA 3CHFA 5DIVA 4W9QA 4MNKA 4Z2KA 2MLXA 4MNJA 3PRBA 3OOBA 4ODOA 2N87A 2K8IA 3ARUA 1TCOC 1JVWA 1UR8A 1FKGA 4ML4A 2Y78A 1GRJA 3CGNA 3FXYA 2DPEA 1LL4A 3UQBA 4ZS6A 5HKGA 1R9HA 3UI6A 4DRHA 3UQAA 2ZR4A 1KT0A 3AS0A 1RD6A 5GPGA 1Q6IA 2DSZA 1FJDA 1FFQA 1FKJA 5HWCA 1FKSA 4U84A 1EHNA 1HKKA 4R5EA 3FY1A 2DT3A 4J4OA 2DG4A 2ETNA 1W9VA 3O5GA 4IQ2A 3AQUA 4Z2GA 3O5OA 4R0XA 3BXWA 4W5UA
chains in the Genus database with same CATH topology
2DSUA 1LJYA 5HUAA 4DT4A 3O5PA 1OWQA 2LKNA 3O5IA 3O5KA 1W26A 3VAWA 2QF8A 3EY6A 1SR0A 4G2PA 2A3CA 3O5FA 1FKHA 5JH8A 2KGJA 2DSWA 1GPFA 2XPBA 4WKHA 2UZ5A 3O5DA 1NWSA 1TFVA 5DEZA 1EQ3A 2OFNA 4MSPA 2FKEA 2M1IA 4KQZA 1LL7A 3B7XA 4ZPVR 3IKDA 4ODNA 3RM4A 5GPRA 5J6EA 2KFWA 2PPPA 4DRMA 2B31A 3RMEA 1NWTA 2RUCA 2ITKA 2MLYA 4ODMA 1FKKA 2PPNA 4LAVA 3CH9A 4DROA 2ZQSA 2RQSA 2G41A 2PBCA 5HWBA 3CHCA 2DSVA 3KAFA 1WB0A 2RSEA 1J4RA 4JFJA 4DZ3A 4JFMA 2A3AA 4FAPA 1F8AB 1D2KA 3G6MA 2XPAA 1P5QA 1ROTA 1FAPA 4HARA 4W9PA 4DRKA 2XP7A 1NMWA 2PPOA 2XP4A 3GPKA 2DT0A 2DG3A 3ARTA 4KR0B 4O2TA 1E6PA 4JFIA 4DRJA 4Z2JA 3G6LA 4TX0A 5BXJA 2XP9A 4ZPTR 3ODKA 2F2DA 4P8VA 5DIUA 2PV3A 4IQCA 3WL1A 4C02B 1HXVA 4P8XA 1E9LA 3CHEA 2G8ZA 2F21A 4JYSA 3PRDA 1J4HA 1A7XA 1HJVA 1JNDA 4DRPA 3B9AA 1FD9A 1H0IA 4TYOA 5HW8A 4GGQA 1FKDA 4Z2IA 3O5QA 3ARWA 4ODRA 3RGCA 1X6LA 2WLYA 3O5MA 2LPVA 3WQVA 1ZB5A 1D7HA 1EYMA 2XP5A 1EDQA 1B6CA 2FDMA 2RURA 4LAXA 1ZBWA 1HJXA 4MGVA 3IHZA 1T11A 4MPKA 3ARXA 3O5JA 4LGXA 2MLZA 1FKBA 1Y0OA 1SYTA 1W1VA 1LG2A 1NWUA 1X6NA 3AS2A 3WD2A 4XAKA 4QT3A 2RUQA 3ARVA 3PR9A 4MAVA 4TNSA 4WKFA 4DWSD 3WD4A 1NMVA 1JNEA 1ZL1A 2WM0A 3AS3A 3H9RB 4MNMA 1PINA 3W4RA 3TDBA 3WKZA 2ZQUA 3CHDA 4LAWA 5I98A 2Q5AA 4IT4A 4Q22A 3WD0A 4DWSC 4JFLA 3WL0A 4NZCA 2O9OA 4DWSA 5D75A 3RM9A 3QOKA 1PBKA 3JYMA 4BF8A 3O5RA 4N19A 1NWRA 2DG9A 1KFWA 1ZBCA 2WK2A 3FAPA 2L2SA 4NSBA 2KI3A 2PV1A 1FKFA 2MNTA 4S3JA 2JZVA 3B8SA 4URIA 4ODPA 3WIJA 2AWGA 3CZ8A 3ARQA 4DIPA 2ZR6A 1LL6A 3OA5A 3LUOA 4LAYA 2PV2A 1FKIA 1ZBVA 2F4EA 1W1PA 4JFKA 1M5YA 1U79A 2KR7A 1D7JA 3NI6A 5HW7A 4DWSB 1NSGA 2YBTA 2PI6A 1E6ZA 3KZ7A 2O92A 1YATA 3JXVA 1J6YA 1CTNA 1H0GA 1ZCNA 4AY1A 4DZ2A 1ZBKA 3NTPA 1Q1CA 1BKFA 3AROA 1EIBA 1WNOA 1J4IA 3WQWA 3B9DA 1XHGA 1N1AA 1XRVA 3KAGA 3PA7A 4WIWA 1LQ0A 1W9UA 3O5LA 5DF0A 2WLZA 4P8UA 3I6CA 3ALGA 2ZQTA 3KCEA 4TW7A 5HW6A 1NH6A 1KT1A 4QIBA 2DT1A 4P8WA 4DRNA 2XP6A 4DH0A 1D6OA 5HTGA 4WJXA 1K9TA 1GUVA 4L3NA 2AOSA 3UF8A 4DRIA 4HBOA 2IF4A 3KACA 1ZK6A 1QZ2A 5DO2A 2A3EA 2XP3A 1FKRA 2XP8A 4Q7NA 5HT1A 4GIVA 1FKLA 2D9FA 2A3BA 4U86A 1HJWA 1L1PA 3CGMA 4IT6A 2OLHA 1BL4A 3ARYA 2YBUA 2ZQVA 1ITXA 3ARZA 1FKTA 4ODQA 1IX5A 1FFRA 1HKMA 1VF8A 4MNLA 1E6RA 4NNRA 4QZVB 1C9HA 3ARRA 1OGBA 1JNTA 1QPLA 1E15A 2ESCA 2ZR5A 4PTMA 1W9PA 1QPFA 4ITZA 3WH0A 4DRQA 2LGOA 4WKAA 2IUZA 1OGGA 2KO7A 3NRKA 4G50A 2LJ4A 3KAHA 4U85A 2FAPA 3B9EA 4QT2A 2DT2A 1O6IA 1Q6UA 1YW5A 1HKJA 1JNSA 3UI5A 1ZU8A 1W1TA 1ROUA 1E6NA 3IKGA 3AS1A 4MTVA 2M2AA 3RFWA 5HBFA 4ODLA 1Q6HA 5GQBA 1HKIA 3O5EA 2VCDA 3RM8A 3ALFA 3MDYB 3PRAA 2MF9A 2VN1A 3TCZA 2MPHA 3KADA 4Z2LA 4Z2HA 1WAWA 4L72B 3WD3A 3IK8A 4J4NA 1D7IA 3UQIA 3UI4A 4WK9A 5DITA 4ZPWR 4HBEA 4TW6A 2M08A 1GOIA 4FN2A 3ARPA 4IPXA 4S3KA 3KABA 1LG1A 4TW8A 4ODKA 2KE0A 1W1YA 3KAIA 3WD1A 3ARSA 3JYJA 3TC5A 1F40A 4W9OA 1UR9A 5B8IC 2RUDA 3CHFA 5DIVA 4W9QA 4MNKA 4Z2KA 2MLXA 4MNJA 3PRBA 3OOBA 4ODOA 2N87A 2K8IA 3ARUA 1TCOC 1JVWA 1UR8A 1FKGA 4ML4A 2Y78A 3CGNA 3FXYA 2DPEA 1LL4A 3UQBA 4ZS6A 5HKGA 1R9HA 3UI6A 4DRHA 3UQAA 2ZR4A 1KT0A 3AS0A 1RD6A 5GPGA 1Q6IA 2DSZA 1FJDA 1FFQA 1FKJA 5HWCA 1FKSA 4U84A 1EHNA 1HKKA 4R5EA 3FY1A 2DT3A 4J4OA 2DG4A 1W9VA 3O5GA 4IQ2A 3AQUA 4Z2GA 3O5OA 4R0XA 3BXWA 4W5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HUA A;  1JNS A;  3UI5 A;  1NSG A;  1FD9 A;  4TYO A;  5HW8 A;  4DT4 A;  1ROU A;  3KZ7 A;  1YAT A;  3IKG A;  3JXV A;  2LKN A;  3O5P A;  4GGQ A;  3O5I A;  3O5K A;  1W26 A;  1FKD A;  1ZCN A;  3VAW A;  4DZ2 A;  1J6Y A;  3EY6 A;  2M2A A;  3RFW A;  3O5Q A;  4ODL A;  3NTP A;  4G2P A;  1Q1C A;  3O5F A;  1BKF A;  4ODR A;  1FKH A;  3RGC A;  1J4I A;  1Q6H A;  2KGJ A;  3O5M A;  2LPV A;  3O5E A;  2VCD A;  1N1A A;  3KAG A;  1D7H A;  1EYM A;  2XP5 A;  3MDY B;  2XPB A;  3PA7 A;  3O5L A;  2MF9 A;  1B6C A;  2VN1 A;  2RUR A;  2UZ5 A;  4LAX A;  3O5D A;  4MGV A;  3IHZ A;  3I6C A;  1T11 A;  3TCZ A;  2OFN A;  2ZQT A;  2MPH A;  4MSP A;  3KAD A;  3KCE A;  4TW7 A;  5HW6 A;  3O5J A;  2FKE A;  1KT1 A;  4QIB A;  2M1I A;  2MLZ A;  1FKB A;  1Y0O A;  3B7X A;  3IK8 A;  4DRN A;  4J4N A;  1D7I A;  2XP6 A;  3UI4 A;  3UQI A;  4DH0 A;  1D6O A;  3IKD A;  4ODN A;  5HTG A;  5J6E A;  5DIT A;  2KFW A;  3UF8 A;  2PPP A;  4DRM A;  4TW6 A;  4DRI A;  4QT3 A;  2M08 A;  2RUC A;  2RUQ A;  2IF4 A;  2ITK A;  4FN2 A;  4TNS A;  3KAC A;  4IPX A;  3KAB A;  4TW8 A;  2MLY A;  4ODK A;  1ZK6 A;  2KE0 A;  1NMV A;  1QZ2 A;  4ODM A;  2XP3 A;  1FKR A;  2XP8 A;  3KAI A;  1FKK A;  3JYJ A;  3H9R B;  5HT1 A;  2PPN A;  4LAV A;  3TC5 A;  4GIV A;  4DRO A;  1PIN A;  1FKL A;  1F40 A;  4W9O A;  2ZQS A;  3TDB A;  2RQS A;  2D9F A;  5B8I C;  2ZQU A;  2RUD A;  2PBC A;  5HWB A;  4U86 A;  4LAW A;  5DIV A;  4W9Q A;  5I98 A;  3KAF A;  2Q5A A;  2RSE A;  3CGM A;  1L1P A;  2MLX A;  3PRB A;  3OOB A;  4ODO A;  1J4R A;  2N87 A;  2K8I A;  4JFJ A;  1TCO C;  4JFL A;  1EQ3 A;  4DZ3 A;  1JVW A;  1FKG A;  4JFM A;  2Y78 A;  4FAP A;  5HW7 A;  1F8A B;  1BL4 A;  5D75 A;  1PBK A;  2ZQV A;  3CGN A;  2XPA A;  1P5Q A;  3JYM A;  4BF8 A;  3O5R A;  1FKT A;  4N19 A;  2DG9 A;  4ODQ A;  3UQB A;  1ROT A;  5HKG A;  1R9H A;  3UI6 A;  1FAP A;  4DRH A;  4W9P A;  2ZR4 A;  4DRK A;  4NNR A;  3UQA A;  3FAP A;  1KT0 A;  2L2S A;  1C9H A;  2KI3 A;  2XP7 A;  5GPG A;  1JNT A;  1NMW A;  2PPO A;  2XP4 A;  3GPK A;  1QPL A;  1Q6I A;  2PV1 A;  1FKF A;  2DG3 A;  2MNT A;  1FJD A;  2ZR5 A;  2JZV A;  4O2T A;  4ODP A;  1FKJ A;  4JFI A;  4DRJ A;  5HWC A;  1FKS A;  4TX0 A;  2AWG A;  4U84 A;  5BXJ A;  2XP9 A;  3ODK A;  1QPF A;  2F2D A;  4ITZ A;  5DIU A;  2PV3 A;  4IQC A;  4J4O A;  3WH0 A;  4DIP A;  2ZR6 A;  2DG4 A;  4C02 B;  4DRQ A;  1HXV A;  2LGO A;  3LUO A;  4LAY A;  2PV2 A;  2KO7 A;  1FKI A;  3O5G A;  4IQ2 A;  2F21 A;  2F4E A;  4JYS A;  3NRK A;  3PRD A;  4JFK A;  1M5Y A;  4G50 A;  1U79 A;  2LJ4 A;  1J4H A;  3KAH A;  2KR7 A;  3O5O A;  4R0X A;  1A7X A;  4U85 A;  1D7J A;  3NI6 A;  2FAP A;  4QT2 A;  4DRP A;  1Q6U A;  1YW5 A; 
#chains in the Genus database with same CATH topology
 2DSU A;  1LJY A;  5HUA A;  4DT4 A;  3O5P A;  1OWQ A;  2LKN A;  3O5I A;  3O5K A;  1W26 A;  3VAW A;  2QF8 A;  3EY6 A;  1SR0 A;  4G2P A;  2A3C A;  3O5F A;  1FKH A;  5JH8 A;  2KGJ A;  2DSW A;  1GPF A;  2XPB A;  4WKH A;  2UZ5 A;  3O5D A;  1NWS A;  1TFV A;  5DEZ A;  1EQ3 A;  2OFN A;  4MSP A;  2FKE A;  2M1I A;  4KQZ A;  1LL7 A;  3B7X A;  4ZPV R;  3IKD A;  4ODN A;  3RM4 A;  5GPR A;  5J6E A;  2KFW A;  2PPP A;  4DRM A;  2B31 A;  3RME A;  1NWT A;  2RUC A;  2ITK A;  2MLY A;  4ODM A;  1FKK A;  2PPN A;  4LAV A;  3CH9 A;  4DRO A;  2ZQS A;  2RQS A;  2G41 A;  2PBC A;  5HWB A;  3CHC A;  2DSV A;  3KAF A;  1WB0 A;  2RSE A;  1J4R A;  4JFJ A;  4DZ3 A;  4JFM A;  2A3A A;  4FAP A;  1F8A B;  1D2K A;  3G6M A;  2XPA A;  1P5Q A;  1ROT A;  1FAP A;  4HAR A;  4W9P A;  4DRK A;  2XP7 A;  1NMW A;  2PPO A;  2XP4 A;  3GPK A;  2DT0 A;  2DG3 A;  3ART A;  4KR0 B;  4O2T A;  1E6P A;  4JFI A;  4DRJ A;  4Z2J A;  3G6L A;  4TX0 A;  5BXJ A;  2XP9 A;  4ZPT R;  3ODK A;  2F2D A;  4P8V A;  5DIU A;  2PV3 A;  4IQC A;  3WL1 A;  4C02 B;  1HXV A;  4P8X A;  1E9L A;  3CHE A;  2G8Z A;  2F21 A;  4JYS A;  3PRD A;  1J4H A;  1A7X A;  1HJV A;  1JND A;  4DRP A;  3B9A A;  1FD9 A;  1H0I A;  4TYO A;  5HW8 A;  4GGQ A;  1FKD A;  1E44 A;  4Z2I A;  3O5Q A;  3ARW A;  4ODR A;  3RGC A;  1X6L A;  3BMB A;  2WLY A;  3O5M A;  2LPV A;  3WQV A;  1ZB5 A;  1D7H A;  1EYM A;  2XP5 A;  1EDQ A;  1B6C A;  2FDM A;  2RUR A;  4LAX A;  1ZBW A;  1HJX A;  4MGV A;  3IHZ A;  1T11 A;  4MPK A;  3ARX A;  3O5J A;  4LGX A;  2MLZ A;  1FKB A;  1Y0O A;  1SYT A;  1W1V A;  1LG2 A;  1NWU A;  1X6N A;  3AS2 A;  3WD2 A;  4XAK A;  2B5U B;  4QT3 A;  2RUQ A;  3ARV A;  3PR9 A;  4MAV A;  4TNS A;  4WKF A;  4DWS D;  3WD4 A;  1NMV A;  1JNE A;  1ZL1 A;  2WM0 A;  3AS3 A;  3H9R B;  4MNM A;  1PIN A;  3W4R A;  3TDB A;  3WKZ A;  2ZQU A;  3CHD A;  4LAW A;  5I98 A;  2Q5A A;  4IT4 A;  4Q22 A;  3WD0 A;  4DWS C;  4JFL A;  3WL0 A;  4NZC A;  2O9O A;  4DWS A;  5D75 A;  3RM9 A;  3QOK A;  1PBK A;  3JYM A;  4BF8 A;  3O5R A;  4N19 A;  1NWR A;  2DG9 A;  1KFW A;  1ZBC A;  2WK2 A;  3FAP A;  2L2S A;  4NSB A;  2KI3 A;  2PV1 A;  1FKF A;  2MNT A;  4S3J A;  2F23 A;  2JZV A;  3B8S A;  4URI A;  4ODP A;  3WIJ A;  2AWG A;  3CZ8 A;  1JCH B;  3ARQ A;  4DIP A;  2ZR6 A;  1LL6 A;  3OA5 A;  3LUO A;  4LAY A;  2PV2 A;  1FKI A;  1ZBV A;  2F4E A;  1W1P A;  4JFK A;  1M5Y A;  1U79 A;  2KR7 A;  1D7J A;  3NI6 A;  3GTY X;  5HW7 A;  4DWS B;  1NSG A;  2YBT A;  2PI6 A;  1E6Z A;  3KZ7 A;  2O92 A;  1YAT A;  3JXV A;  1J6Y A;  1CTN A;  1H0G A;  1ZCN A;  4AY1 A;  4DZ2 A;  1ZBK A;  3NTP A;  1Q1C A;  1BKF A;  3ARO A;  1EIB A;  1WNO A;  1J4I A;  3WQW A;  3B9D A;  1XHG A;  1N1A A;  1XRV A;  3KAG A;  3PA7 A;  4WIW A;  1LQ0 A;  1W9U A;  3O5L A;  5DF0 A;  2WLZ A;  4P8U A;  3I6C A;  3ALG A;  2ZQT A;  3KCE A;  4TW7 A;  5HW6 A;  1NH6 A;  1KT1 A;  2EUL A;  3EIP A;  2DT1 A;  4QIB A;  4P8W A;  4DRN A;  2XP6 A;  4DH0 A;  1D6O A;  5HTG A;  4WJX A;  1K9T A;  1GUV A;  4L3N A;  2AOS A;  3UF8 A;  4DRI A;  4HBO A;  2IF4 A;  2PN0 A;  3KAC A;  1ZK6 A;  1QZ2 A;  5DO2 A;  2A3E A;  2XP3 A;  1FKR A;  2XP8 A;  4Q7N A;  5HT1 A;  4GIV A;  1FKL A;  2D9F A;  2A3B A;  4U86 A;  1HJW A;  1L1P A;  3CGM A;  4IT6 A;  2OLH A;  1BL4 A;  3ARY A;  2YBU A;  2ZQV A;  1ITX A;  3ARZ A;  1FKT A;  4ODQ A;  2P4V A;  1IX5 A;  1FFR A;  1HKM A;  1VF8 A;  4MNL A;  1E6R A;  4NNR A;  4QZV B;  1C9H A;  3ARR A;  1OGB A;  1JNT A;  1QPL A;  1E15 A;  2ESC A;  2ZR5 A;  4PTM A;  1W9P A;  1QPF A;  4ITZ A;  3WH0 A;  4DRQ A;  2LGO A;  4WKA A;  2IUZ A;  1OGG A;  2KO7 A;  3NRK A;  4G50 A;  2LJ4 A;  3KAH A;  4U85 A;  2FAP A;  3B9E A;  4QT2 A;  2DT2 A;  1O6I A;  1Q6U A;  1YW5 A;  1HKJ A;  1JNS A;  3UI5 A;  1ZU8 A;  1W1T A;  1ROU A;  1E6N A;  3IKG A;  3AS1 A;  4MTV A;  2M2A A;  3RFW A;  5HBF A;  3GU0 A;  4ODL A;  1Q6H A;  5GQB A;  1HKI A;  3O5E A;  2VCD A;  3RM8 A;  3ALF A;  3MDY B;  3PRA A;  2MF9 A;  2VN1 A;  3TCZ A;  2MPH A;  3KAD A;  4Z2L A;  4Z2H A;  1WAW A;  4L72 B;  3WD3 A;  4UDM A;  3IK8 A;  4J4N A;  1D7I A;  3UQI A;  3UI4 A;  4WK9 A;  5DIT A;  4ZPW R;  4HBE A;  4TW6 A;  2M08 A;  1GOI A;  4FN2 A;  3ARP A;  4IPX A;  4S3K A;  3KAB A;  1LG1 A;  4TW8 A;  4ODK A;  2KE0 A;  1W1Y A;  3KAI A;  3WD1 A;  3ARS A;  3JYJ A;  3TC5 A;  1F40 A;  4W9O A;  1UR9 A;  5B8I C;  2RUD A;  3CHF A;  5DIV A;  4W9Q A;  4MNK A;  4Z2K A;  2MLX A;  4MNJ A;  3PRB A;  3OOB A;  4ODO A;  2N87 A;  2K8I A;  3ARU A;  1TCO C;  1JVW A;  1UR8 A;  1FKG A;  4ML4 A;  2Y78 A;  1GRJ A;  3CGN A;  3FXY A;  2DPE A;  1LL4 A;  3UQB A;  4ZS6 A;  5HKG A;  1R9H A;  3UI6 A;  4DRH A;  3UQA A;  2ZR4 A;  1KT0 A;  3AS0 A;  1RD6 A;  5GPG A;  1Q6I A;  2DSZ A;  1FJD A;  1FFQ A;  1FKJ A;  5HWC A;  1FKS A;  4U84 A;  1EHN A;  1HKK A;  4R5E A;  3FY1 A;  2DT3 A;  4J4O A;  2DG4 A;  2ETN A;  1W9V A;  3O5G A;  4IQ2 A;  3AQU A;  4Z2G A;  3O5O A;  4R0X A;  3BXW A;  4W5U A; 
#chains in the Genus database with same CATH homology
 2DSU A;  1LJY A;  5HUA A;  4DT4 A;  3O5P A;  1OWQ A;  2LKN A;  3O5I A;  3O5K A;  1W26 A;  3VAW A;  2QF8 A;  3EY6 A;  1SR0 A;  4G2P A;  2A3C A;  3O5F A;  1FKH A;  5JH8 A;  2KGJ A;  2DSW A;  1GPF A;  2XPB A;  4WKH A;  2UZ5 A;  3O5D A;  1NWS A;  1TFV A;  5DEZ A;  1EQ3 A;  2OFN A;  4MSP A;  2FKE A;  2M1I A;  4KQZ A;  1LL7 A;  3B7X A;  4ZPV R;  3IKD A;  4ODN A;  3RM4 A;  5GPR A;  5J6E A;  2KFW A;  2PPP A;  4DRM A;  2B31 A;  3RME A;  1NWT A;  2RUC A;  2ITK A;  2MLY A;  4ODM A;  1FKK A;  2PPN A;  4LAV A;  3CH9 A;  4DRO A;  2ZQS A;  2RQS A;  2G41 A;  2PBC A;  5HWB A;  3CHC A;  2DSV A;  3KAF A;  1WB0 A;  2RSE A;  1J4R A;  4JFJ A;  4DZ3 A;  4JFM A;  2A3A A;  4FAP A;  1F8A B;  1D2K A;  3G6M A;  2XPA A;  1P5Q A;  1ROT A;  1FAP A;  4HAR A;  4W9P A;  4DRK A;  2XP7 A;  1NMW A;  2PPO A;  2XP4 A;  3GPK A;  2DT0 A;  2DG3 A;  3ART A;  4KR0 B;  4O2T A;  1E6P A;  4JFI A;  4DRJ A;  4Z2J A;  3G6L A;  4TX0 A;  5BXJ A;  2XP9 A;  4ZPT R;  3ODK A;  2F2D A;  4P8V A;  5DIU A;  2PV3 A;  4IQC A;  3WL1 A;  4C02 B;  1HXV A;  4P8X A;  1E9L A;  3CHE A;  2G8Z A;  2F21 A;  4JYS A;  3PRD A;  1J4H A;  1A7X A;  1HJV A;  1JND A;  4DRP A;  3B9A A;  1FD9 A;  1H0I A;  4TYO A;  5HW8 A;  4GGQ A;  1FKD A;  4Z2I A;  3O5Q A;  3ARW A;  4ODR A;  3RGC A;  1X6L A;  2WLY A;  3O5M A;  2LPV A;  3WQV A;  1ZB5 A;  1D7H A;  1EYM A;  2XP5 A;  1EDQ A;  1B6C A;  2FDM A;  2RUR A;  4LAX A;  1ZBW A;  1HJX A;  4MGV A;  3IHZ A;  1T11 A;  4MPK A;  3ARX A;  3O5J A;  4LGX A;  2MLZ A;  1FKB A;  1Y0O A;  1SYT A;  1W1V A;  1LG2 A;  1NWU A;  1X6N A;  3AS2 A;  3WD2 A;  4XAK A;  4QT3 A;  2RUQ A;  3ARV A;  3PR9 A;  4MAV A;  4TNS A;  4WKF A;  4DWS D;  3WD4 A;  1NMV A;  1JNE A;  1ZL1 A;  2WM0 A;  3AS3 A;  3H9R B;  4MNM A;  1PIN A;  3W4R A;  3TDB A;  3WKZ A;  2ZQU A;  3CHD A;  4LAW A;  5I98 A;  2Q5A A;  4IT4 A;  4Q22 A;  3WD0 A;  4DWS C;  4JFL A;  3WL0 A;  4NZC A;  2O9O A;  4DWS A;  5D75 A;  3RM9 A;  3QOK A;  1PBK A;  3JYM A;  4BF8 A;  3O5R A;  4N19 A;  1NWR A;  2DG9 A;  1KFW A;  1ZBC A;  2WK2 A;  3FAP A;  2L2S A;  4NSB A;  2KI3 A;  2PV1 A;  1FKF A;  2MNT A;  4S3J A;  2JZV A;  3B8S A;  4URI A;  4ODP A;  3WIJ A;  2AWG A;  3CZ8 A;  3ARQ A;  4DIP A;  2ZR6 A;  1LL6 A;  3OA5 A;  3LUO A;  4LAY A;  2PV2 A;  1FKI A;  1ZBV A;  2F4E A;  1W1P A;  4JFK A;  1M5Y A;  1U79 A;  2KR7 A;  1D7J A;  3NI6 A;  5HW7 A;  4DWS B;  1NSG A;  2YBT A;  2PI6 A;  1E6Z A;  3KZ7 A;  2O92 A;  1YAT A;  3JXV A;  1J6Y A;  1CTN A;  1H0G A;  1ZCN A;  4AY1 A;  4DZ2 A;  1ZBK A;  3NTP A;  1Q1C A;  1BKF A;  3ARO A;  1EIB A;  1WNO A;  1J4I A;  3WQW A;  3B9D A;  1XHG A;  1N1A A;  1XRV A;  3KAG A;  3PA7 A;  4WIW A;  1LQ0 A;  1W9U A;  3O5L A;  5DF0 A;  2WLZ A;  4P8U A;  3I6C A;  3ALG A;  2ZQT A;  3KCE A;  4TW7 A;  5HW6 A;  1NH6 A;  1KT1 A;  4QIB A;  2DT1 A;  4P8W A;  4DRN A;  2XP6 A;  4DH0 A;  1D6O A;  5HTG A;  4WJX A;  1K9T A;  1GUV A;  4L3N A;  2AOS A;  3UF8 A;  4DRI A;  4HBO A;  2IF4 A;  3KAC A;  1ZK6 A;  1QZ2 A;  5DO2 A;  2A3E A;  2XP3 A;  1FKR A;  2XP8 A;  4Q7N A;  5HT1 A;  4GIV A;  1FKL A;  2D9F A;  2A3B A;  4U86 A;  1HJW A;  1L1P A;  3CGM A;  4IT6 A;  2OLH A;  1BL4 A;  3ARY A;  2YBU A;  2ZQV A;  1ITX A;  3ARZ A;  1FKT A;  4ODQ A;  1IX5 A;  1FFR A;  1HKM A;  1VF8 A;  4MNL A;  1E6R A;  4NNR A;  4QZV B;  1C9H A;  3ARR A;  1OGB A;  1JNT A;  1QPL A;  1E15 A;  2ESC A;  2ZR5 A;  4PTM A;  1W9P A;  1QPF A;  4ITZ A;  3WH0 A;  4DRQ A;  2LGO A;  4WKA A;  2IUZ A;  1OGG A;  2KO7 A;  3NRK A;  4G50 A;  2LJ4 A;  3KAH A;  4U85 A;  2FAP A;  3B9E A;  4QT2 A;  2DT2 A;  1O6I A;  1Q6U A;  1YW5 A;  1HKJ A;  1JNS A;  3UI5 A;  1ZU8 A;  1W1T A;  1ROU A;  1E6N A;  3IKG A;  3AS1 A;  4MTV A;  2M2A A;  3RFW A;  5HBF A;  4ODL A;  1Q6H A;  5GQB A;  1HKI A;  3O5E A;  2VCD A;  3RM8 A;  3ALF A;  3MDY B;  3PRA A;  2MF9 A;  2VN1 A;  3TCZ A;  2MPH A;  3KAD A;  4Z2L A;  4Z2H A;  1WAW A;  4L72 B;  3WD3 A;  3IK8 A;  4J4N A;  1D7I A;  3UQI A;  3UI4 A;  4WK9 A;  5DIT A;  4ZPW R;  4HBE A;  4TW6 A;  2M08 A;  1GOI A;  4FN2 A;  3ARP A;  4IPX A;  4S3K A;  3KAB A;  1LG1 A;  4TW8 A;  4ODK A;  2KE0 A;  1W1Y A;  3KAI A;  3WD1 A;  3ARS A;  3JYJ A;  3TC5 A;  1F40 A;  4W9O A;  1UR9 A;  5B8I C;  2RUD A;  3CHF A;  5DIV A;  4W9Q A;  4MNK A;  4Z2K A;  2MLX A;  4MNJ A;  3PRB A;  3OOB A;  4ODO A;  2N87 A;  2K8I A;  3ARU A;  1TCO C;  1JVW A;  1UR8 A;  1FKG A;  4ML4 A;  2Y78 A;  3CGN A;  3FXY A;  2DPE A;  1LL4 A;  3UQB A;  4ZS6 A;  5HKG A;  1R9H A;  3UI6 A;  4DRH A;  3UQA A;  2ZR4 A;  1KT0 A;  3AS0 A;  1RD6 A;  5GPG A;  1Q6I A;  2DSZ A;  1FJD A;  1FFQ A;  1FKJ A;  5HWC A;  1FKS A;  4U84 A;  1EHN A;  1HKK A;  4R5E A;  3FY1 A;  2DT3 A;  4J4O A;  2DG4 A;  1W9V A;  3O5G A;  4IQ2 A;  3AQU A;  4Z2G A;  3O5O A;  4R0X A;  3BXW A;  4W5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...