5HKGA

Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (fkbp12.6).
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
publication title Total chemical synthesis, refolding, and crystallographic structure of fully active immunophilin calstabin 2 (FKBP12.6).
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hkgA00
1A7XA 4NNRA 3KACA 5I98A 1FD9A 3IK8A 1JNSA 4MSPA 2XP6A 2FAPA 4DRKA 1D7HA 1C9HA 3O5KA 4TNSA 2MPHA 1L1PA 4IPXA 2XP8A 1HXVA 5HW6A 3TDBA 1NMVA 4JFJA 2RUQA 4DRPA 4ODKA 1EQ3A 1JVWA 3O5QA 5BXJA 3KCEA 3ODKA 2XPBA 3KAHA 2RUDA 1T11A 3JYMA 2ZQSA 1EYMA 3FAPA 4G50A 4LAWA 4TYOA 3LUOA 4LAYA 3O5EA 4TW8A 1FKFA 3CGNA 4TW7A 2KE0A 3NRKA 3NI6A 1J4HA 3JYJA 2DG3A 3O5IA 4JFIA 3TC5A 1R9HA 2MLXA 3IKGA 3O5JA 4TX0A 1FKJA 1KT0A 4W9PA 4DZ2A 2AWGA 2PBCA 4U86A 2ZR6A 4LAVA 4DRMA 3MDYB 4DH0A 2PPPA 4DRJA 2KR7A 2PV3A 4W9QA 3UQIA 2F4EA 3O5MA 2ZQTA 3KABA 4N19A 3NTPA 4MGVA 2LPVA 4DZ3A 4ODMA 1Q6IA 2ZQVA 2ZR4A 1FKBA 1BL4A 4J4OA 1NMWA 2RQSA 3UI5A 3O5PA 5HTGA 4QT2A 2PPOA 2JZVA 4DRHA 4FAPA 5D75A 2XP5A 3WH0A 1B6CA 4ODNA 4GIVA 2OFNA 4JFKA 5HW8A 3UQBA 5GPGA 1ZK6A 1J6YA 2Q5AA 1ROTA 2KGJA 3UQAA 4J4NA 1W26A 5DIUA 1PBKA 1YW5A 4FN2A 4O2TA 4TW6A 3UI4A 5J6EA 1Q6UA 3KZ7A 3KAGA 2MNTA 2ZR5A 1J4IA 1Y0OA 3OOBA 5HKGA 4W9OA 4JFLA 5HW7A 5HUAA 1FJDA 2KI3A 2D9FA 1QPLA 2XP4A 4DRIA 2L2SA 3IHZA 2LGOA 5DIVA 2UZ5A 2VN1A 3O5DA 3RFWA 4BF8A 4IQ2A 1QZ2A 3O5RA 1FKIA 3O5LA 3UF8A 3O5OA 1FKHA 4ODQA 3O5FA 4ODLA 1TCOC 4DRQA 3UI6A 2XP7A 3O5GA 4ODOA 3EY6A 2MF9A 2DG9A 4LAXA 2M1IA 2F21A 2KFWA 2ZQUA 3PRDA 2XP3A 2N87A 4ITZA 2LJ4A 4DROA 2DG4A 3I6CA 2Y78A 3B7XA 3H9RB 4QT3A 1Q1CA 2PPNA 1F8AB 4G2PA 3KADA 4GGQA 3JXVA 4ODRA 1FKSA 5HWBA 2MLYA 1D7JA 1FAPA 1YATA 2LKNA 4C02B 3IKDA 4R0XA 2VCDA 5B8IC 1KT1A 4ODPA 1U79A 2KO7A 1PINA 3CGMA 4IQCA 4U85A 4JYSA 4QIBA 4U84A 2XPAA 3KAFA 5HWCA 2MLZA 4DRNA 3PRBA 2RUCA 2F2DA 1QPFA 2M2AA 1BKFA 5DITA 1NSGA 1FKGA 3VAWA 2XP9A 2ITKA 3RGCA 3TCZA 1J4RA 4DT4A 2RURA 1FKKA 3GPKA 3KAIA 1Q6HA 4DIPA 2M08A 1ROUA 5HT1A 1F40A 3PA7A 2RSEA 1N1AA 1FKRA 1FKDA 1M5YA 2K8IA 2FKEA 4JFMA 2PV2A 2PV1A 1ZCNA 1D7IA 1JNTA 1P5QA 1FKTA 2IF4A 1D6OA 1FKLA
chains in the Genus database with same CATH superfamily
1ZBVA 3OA5A 1JCHB 5I98A 2WLYA 2PN0A 1D7HA 1C9HA 3G6LA 2RUQA 1HJWA 3KAHA 1E9LA 4TYOA 2A3EA 3FAPA 4URIA 4TW8A 1O6IA 3AS1A 1K9TA 1J4HA 2DT1A 3JYJA 3TC5A 4Z2GA 3CHDA 3O5JA 4WKFA 1NWRA 4QZVB 4U86A 2ZR6A 4IT4A 1E6NA 3WD2A 4DRJA 3O5MA 2DSWA 3KABA 3WQVA 4N19A 3WL0A 1RD6A 3ALGA 4AY1A 2ZQVA 1HJVA 1E15A 2PPOA 2XP5A 2FDMA 4ODNA 4JFKA 1J6YA 5HW8A 5GPGA 1ZK6A 4Z2LA 1W26A 1D2KA 1NH6A 4MTVA 4O2TA 4TW6A 2MNTA 2ZR5A 4WKHA 1Y0OA 4LGXA 1JNEA 4W9OA 1QPLA 4S3JA 2G8ZA 1W9PA 2VN1A 3RFWA 3O5RA 1HKMA 1FKIA 3O5LA 3O5OA 3AS2A 4DRQA 3O5FA 1GUVA 3WIJA 3EY6A 3WQWA 1E44A 4LAXA 2M1IA 4KR0B 2N87A 3ARRA 4MNKA 3WD0A 1Q1CA 4G2PA 3KADA 5HWBA 3JXVA 2MLYA 1YATA 4ZPWR 4DWSB 1SYTA 2A3AA 4IQCA 4QIBA 5HWCA 2F2DA 2YBUA 1FKGA 3EIPA 2RURA 3GPKA 3KAIA 2M08A 4Z2JA 1ZBKA 3PA7A 2OLHA 2K8IA 2F23A 3ARZA 2A3CA 1D7IA 1FKLA 1A7XA 4NNRA 1ZL1A 3IK8A 4MSPA 4NSBA 2FAPA 3O5KA 4TNSA 1LL7A 2MPHA 1L1PA 5GPRA 1LG2A 3O5QA 5BXJA 3KCEA 2XPBA 2RUDA 2A3BA 3JYMA 5JH8A 4HBEA 3LUOA 3O5EA 1W1PA 1X6NA 3ARWA 4MAVA 2DG3A 4P8XA 4JFIA 1R9HA 2ETNA 1KT0A 4W9PA 1NWTA 2AWGA 5GQBA 4DZ2A 4DRMA 4LAVA 3MDYB 2PPPA 2KR7A 1OGBA 4W9QA 2WM0A 1UR9A 2F4EA 3ARYA 1HKJA 4Z2IA 2WLZA 3QOKA 4ODMA 3B9DA 2DSZA 3FY1A 1W1YA 1NMWA 2RQSA 3UI5A 4QT2A 2ESCA 4FAPA 2G41A 1B6CA 4GIVA 2OFNA 1WAWA 3UQAA 3CHFA 1PBKA 1YW5A 5J6EA 3BMBA 3KZ7A 1ZB5A 3KAGA 1FJDA 5HUAA 2D9FA 2DPEA 3AS3A 1VF8A 1CTNA 2UZ5A 3AROA 4BF8A 5DO2A 3UF8A 4ODLA 1TCOC 3O5GA 4ODOA 4XAKA 3ARSA 3PRDA 2XP3A 2DG4A 3I6CA 4Q7NA 4ML4A 3B7XA 3H9RB 4QT3A 4ODRA 1FFQA 4C02B 1FAPA 4IT6A 4W5UA 4WJXA 1KT1A 4DWSD 4U85A 4JYSA 4U84A 2XPAA 3KAFA 4MNJA 3PRBA 1QPFA 4ZS6A 3GU0A 2DSUA 1ZBCA 4P8UA 3GTYX 4WIWA 5DITA 3VAWA 2XP9A 3TCZA 1FKKA 1WB0A 1FFRA 3WKZA 1M5YA 2FKEA 4JFMA 2PV2A 3ARUA 1FKTA 1GOIA 4R5EA 3KACA 3W4RA 1JNSA 2XP6A 1GPFA 4L3NA 4IPXA 1HXVA 1NMVA 4JFJA 4DRPA 1EQ3A 2B31A 2EULA 5HT1A 4LAWA 1T11A 3ARPA 4G50A 4LAYA 1FKFA 3CGNA 4TW7A 3NRKA 3ARVA 1E6RA 3B8SA 1W1TA 3B9EA 1EDQA 1Q6IA 2DT3A 1BL4A 1FKBA 4MNLA 5HTGA 2B5UB 2JZVA 4DRHA 4Q22A 3B9AA 4ZPTR 2IUZA 3PRAA 4KQZA 4WKAA 1J4IA 4MPKA 5HW7A 4JFLA 2AOSA 4DRIA 1GRJA 3IHZA 3CHEA 3O5DA 1QZ2A 2XP7A 4Z2HA 1JNDA 1HJXA 4UDMA 2DG9A 1E6ZA 2ZQUA 4ITZA 4ZPVR 5HW6A 2LJ4A 3AS0A 1F8AB 4DWSC 1D7JA 1XRVA 3WD3A 4R0XA 5B8IC 1H0GA 4ODPA 1U79A 1PINA 1IX5A 1E6PA 2MLZA 2RUCA 2M2AA 1BKFA 2QF8A 3AQUA 5HBFA 1NWUA 1ROUA 1F40A 2RSEA 3PR9A 1UR8A 1ZCNA 5DIUA 1HKKA 1W1VA 1FD9A 4NZCA 4HBOA 3G6MA 4DRKA 2PI6A 2XP8A 3TDBA 2DT2A 4ODKA 1JVWA 1LG1A 3ODKA 2ZQSA 1EYMA 1NWSA 4PTMA 3ARXA 2KE0A 1KFWA 3NI6A 2DSVA 4L72B 4DWSA 3RM4A 3O5IA 2P4VA 3WD4A 2MLXA 3IKGA 4TX0A 1FKJA 3CZ8A 1LL6A 2PBCA 4DH0A 1WNOA 4P8WA 2PV3A 4HARA 3UQIA 4S3KA 1LQ0A 2ZQTA 1TFVA 3NTPA 4MGVA 2LPVA 5DF0A 1W9UA 4DZ3A 2WK2A 2ZR4A 4J4OA 1LL4A 3O5PA 1ITXA 5D75A 3WH0A 3UQBA 1ZU8A 3WD1A 2Q5AA 1ROTA 3CHCA 2KGJA 4J4NA 3BXWA 4FN2A 3UI4A 1Q6UA 3OOBA 5HKGA 3ARTA 2O92A 2KI3A 2XP4A 1ZBWA 2L2SA 5DIVA 2LGOA 3ALFA 1W9VA 4IQ2A 1XHGA 3ARQA 3RM9A 1FKHA 4ODQA 2YBTA 3UI6A 1OGGA 2MF9A 4DROA 2F21A 2KFWA 2Y78A 5DEZA 2PPNA 4GGQA 1FKSA 2LKNA 1EHNA 3IKDA 2VCDA 4MNMA 1OWQA 1X6LA 2KO7A 3CGMA 4WK9A 1HKIA 2O9OA 4DRNA 3RM8A 3RMEA 1NSGA 3RGCA 2ITKA 1J4RA 4DT4A 3FXYA 4DIPA 3CH9A 1Q6HA 4Z2KA 2DT0A 4P8VA 1SR0A 1N1AA 3WL1A 1H0IA 1FKRA 1FKDA 1EIBA 2PV1A 1JNTA 1P5QA 1LJYA 2IF4A 1D6OA
chains in the Genus database with same CATH topology
1ZBVA 3OA5A 5I98A 2WLYA 1D7HA 1C9HA 3G6LA 2RUQA 1HJWA 3KAHA 1E9LA 4TYOA 2A3EA 3FAPA 4URIA 4TW8A 1O6IA 3AS1A 1K9TA 1J4HA 2DT1A 3JYJA 3TC5A 4Z2GA 3CHDA 3O5JA 4WKFA 1NWRA 4QZVB 4U86A 2ZR6A 4IT4A 1E6NA 3WD2A 4DRJA 3O5MA 2DSWA 3KABA 3WQVA 4N19A 3WL0A 1RD6A 3ALGA 4AY1A 2ZQVA 1HJVA 1E15A 2PPOA 2XP5A 2FDMA 4ODNA 4JFKA 1J6YA 5HW8A 5GPGA 1ZK6A 4Z2LA 1W26A 1D2KA 1NH6A 4MTVA 4O2TA 4TW6A 2MNTA 2ZR5A 4WKHA 1Y0OA 4LGXA 1JNEA 4W9OA 1QPLA 4S3JA 2G8ZA 1W9PA 2VN1A 3RFWA 3O5RA 1HKMA 1FKIA 3O5LA 3O5OA 3AS2A 4DRQA 3O5FA 1GUVA 3WIJA 3EY6A 3WQWA 4LAXA 2M1IA 4KR0B 2N87A 3ARRA 4MNKA 3WD0A 1Q1CA 4G2PA 3KADA 5HWBA 3JXVA 2MLYA 1YATA 4ZPWR 4DWSB 1SYTA 2A3AA 4IQCA 4QIBA 5HWCA 2F2DA 2YBUA 1FKGA 2RURA 3GPKA 3KAIA 2M08A 4Z2JA 1ZBKA 3PA7A 2OLHA 2K8IA 3ARZA 2A3CA 1D7IA 1FKLA 1A7XA 4NNRA 1ZL1A 3IK8A 4MSPA 4NSBA 2FAPA 3O5KA 4TNSA 1LL7A 2MPHA 1L1PA 5GPRA 1LG2A 3O5QA 5BXJA 3KCEA 2XPBA 2RUDA 2A3BA 3JYMA 5JH8A 4HBEA 3LUOA 3O5EA 1W1PA 1X6NA 3ARWA 4MAVA 2DG3A 4P8XA 4JFIA 1R9HA 1KT0A 4W9PA 1NWTA 2AWGA 5GQBA 4DZ2A 4DRMA 4LAVA 3MDYB 2PPPA 2KR7A 1OGBA 4W9QA 2WM0A 1UR9A 2F4EA 3ARYA 1HKJA 4Z2IA 2WLZA 3QOKA 4ODMA 3B9DA 2DSZA 3FY1A 1W1YA 1NMWA 2RQSA 3UI5A 4QT2A 2ESCA 4FAPA 2G41A 1B6CA 4GIVA 2OFNA 1WAWA 3UQAA 3CHFA 1PBKA 1YW5A 5J6EA 3KZ7A 1ZB5A 3KAGA 1FJDA 5HUAA 2D9FA 2DPEA 3AS3A 1VF8A 1CTNA 2UZ5A 3AROA 4BF8A 5DO2A 3UF8A 4ODLA 1TCOC 3O5GA 4ODOA 4XAKA 3ARSA 3PRDA 2XP3A 2DG4A 3I6CA 4Q7NA 4ML4A 3B7XA 3H9RB 4QT3A 4ODRA 1FFQA 4C02B 1FAPA 4IT6A 4W5UA 4WJXA 1KT1A 4DWSD 4U85A 4JYSA 4U84A 2XPAA 3KAFA 4MNJA 3PRBA 1QPFA 4ZS6A 2DSUA 1ZBCA 4P8UA 5DITA 4WIWA 3VAWA 2XP9A 3TCZA 1FKKA 1WB0A 1FFRA 3WKZA 1M5YA 2FKEA 4JFMA 2PV2A 3ARUA 1FKTA 1GOIA 4R5EA 3KACA 3W4RA 1JNSA 2XP6A 1GPFA 4L3NA 4IPXA 1HXVA 1NMVA 4JFJA 4DRPA 1EQ3A 2B31A 5HT1A 4LAWA 1T11A 3ARPA 4G50A 4LAYA 1FKFA 3CGNA 4TW7A 3NRKA 3ARVA 1E6RA 3B8SA 1W1TA 3B9EA 1EDQA 1Q6IA 2DT3A 1BL4A 1FKBA 4MNLA 5HTGA 2JZVA 4DRHA 4Q22A 3B9AA 4ZPTR 2IUZA 3PRAA 4KQZA 4WKAA 1J4IA 4MPKA 5HW7A 4JFLA 2AOSA 4DRIA 3IHZA 3CHEA 3O5DA 1QZ2A 2XP7A 4Z2HA 1JNDA 1HJXA 2DG9A 1E6ZA 2ZQUA 4ITZA 4ZPVR 5HW6A 2LJ4A 3AS0A 1F8AB 4DWSC 1D7JA 1XRVA 3WD3A 4R0XA 5B8IC 1H0GA 4ODPA 1U79A 1PINA 1IX5A 1E6PA 2MLZA 2RUCA 2M2AA 1BKFA 2QF8A 3AQUA 5HBFA 1NWUA 1ROUA 1F40A 2RSEA 3PR9A 1UR8A 1ZCNA 5DIUA 1HKKA 1W1VA 1FD9A 4NZCA 4HBOA 3G6MA 4DRKA 2PI6A 2XP8A 3TDBA 2DT2A 4ODKA 1JVWA 1LG1A 3ODKA 2ZQSA 1EYMA 1NWSA 4PTMA 3ARXA 2KE0A 1KFWA 3NI6A 2DSVA 4L72B 4DWSA 3RM4A 3O5IA 3WD4A 2MLXA 3IKGA 4TX0A 1FKJA 3CZ8A 1LL6A 2PBCA 4DH0A 1WNOA 4P8WA 2PV3A 4HARA 3UQIA 4S3KA 1LQ0A 2ZQTA 1TFVA 3NTPA 4MGVA 2LPVA 5DF0A 1W9UA 4DZ3A 2WK2A 2ZR4A 4J4OA 1LL4A 3O5PA 1ITXA 5D75A 3WH0A 3UQBA 1ZU8A 3WD1A 2Q5AA 1ROTA 3CHCA 2KGJA 4J4NA 3BXWA 4FN2A 3UI4A 1Q6UA 3OOBA 5HKGA 3ARTA 2O92A 2KI3A 2XP4A 1ZBWA 2L2SA 5DIVA 2LGOA 3ALFA 1W9VA 4IQ2A 1XHGA 3ARQA 3RM9A 1FKHA 4ODQA 2YBTA 3UI6A 1OGGA 2MF9A 4DROA 2F21A 2KFWA 2Y78A 5DEZA 2PPNA 4GGQA 1FKSA 2LKNA 1EHNA 3IKDA 2VCDA 4MNMA 1OWQA 1X6LA 2KO7A 3CGMA 4WK9A 1HKIA 2O9OA 4DRNA 3RM8A 3RMEA 1NSGA 3RGCA 2ITKA 1J4RA 4DT4A 3FXYA 4DIPA 3CH9A 1Q6HA 4Z2KA 2DT0A 4P8VA 1SR0A 1N1AA 3WL1A 1H0IA 1FKRA 1FKDA 1EIBA 2PV1A 1JNTA 1P5QA 1LJYA 2IF4A 1D6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  4NNR A;  3KAC A;  5I98 A;  1FD9 A;  3IK8 A;  1JNS A;  4MSP A;  2XP6 A;  2FAP A;  4DRK A;  1D7H A;  1C9H A;  3O5K A;  4TNS A;  2MPH A;  1L1P A;  4IPX A;  2XP8 A;  1HXV A;  5HW6 A;  3TDB A;  1NMV A;  4JFJ A;  2RUQ A;  4DRP A;  4ODK A;  1EQ3 A;  1JVW A;  3O5Q A;  5BXJ A;  3KCE A;  3ODK A;  2XPB A;  3KAH A;  2RUD A;  1T11 A;  3JYM A;  2ZQS A;  1EYM A;  3FAP A;  4G50 A;  4LAW A;  4TYO A;  3LUO A;  4LAY A;  3O5E A;  4TW8 A;  1FKF A;  3CGN A;  4TW7 A;  2KE0 A;  3NRK A;  3NI6 A;  1J4H A;  3JYJ A;  2DG3 A;  3O5I A;  4JFI A;  3TC5 A;  1R9H A;  2MLX A;  3IKG A;  3O5J A;  4TX0 A;  1FKJ A;  1KT0 A;  4W9P A;  4DZ2 A;  2AWG A;  2PBC A;  4U86 A;  2ZR6 A;  4LAV A;  4DRM A;  3MDY B;  4DH0 A;  2PPP A;  4DRJ A;  2KR7 A;  2PV3 A;  4W9Q A;  3UQI A;  2F4E A;  3O5M A;  2ZQT A;  3KAB A;  4N19 A;  3NTP A;  4MGV A;  2LPV A;  4DZ3 A;  4ODM A;  1Q6I A;  2ZQV A;  2ZR4 A;  1FKB A;  1BL4 A;  4J4O A;  1NMW A;  2RQS A;  3UI5 A;  3O5P A;  5HTG A;  4QT2 A;  2PPO A;  2JZV A;  4DRH A;  4FAP A;  5D75 A;  2XP5 A;  3WH0 A;  1B6C A;  4ODN A;  4GIV A;  2OFN A;  4JFK A;  5HW8 A;  3UQB A;  5GPG A;  1ZK6 A;  1J6Y A;  2Q5A A;  1ROT A;  2KGJ A;  3UQA A;  4J4N A;  1W26 A;  5DIU A;  1PBK A;  1YW5 A;  4FN2 A;  4O2T A;  4TW6 A;  3UI4 A;  5J6E A;  1Q6U A;  3KZ7 A;  3KAG A;  2MNT A;  2ZR5 A;  1J4I A;  1Y0O A;  3OOB A;  5HKG A;  4W9O A;  4JFL A;  5HW7 A;  5HUA A;  1FJD A;  2KI3 A;  2D9F A;  1QPL A;  2XP4 A;  4DRI A;  2L2S A;  3IHZ A;  2LGO A;  5DIV A;  2UZ5 A;  2VN1 A;  3O5D A;  3RFW A;  4BF8 A;  4IQ2 A;  1QZ2 A;  3O5R A;  1FKI A;  3O5L A;  3UF8 A;  3O5O A;  1FKH A;  4ODQ A;  3O5F A;  4ODL A;  1TCO C;  4DRQ A;  3UI6 A;  2XP7 A;  3O5G A;  4ODO A;  3EY6 A;  2MF9 A;  2DG9 A;  4LAX A;  2M1I A;  2F21 A;  2KFW A;  2ZQU A;  3PRD A;  2XP3 A;  2N87 A;  4ITZ A;  2LJ4 A;  4DRO A;  2DG4 A;  3I6C A;  2Y78 A;  3B7X A;  3H9R B;  4QT3 A;  1Q1C A;  2PPN A;  1F8A B;  4G2P A;  3KAD A;  4GGQ A;  3JXV A;  4ODR A;  1FKS A;  5HWB A;  2MLY A;  1D7J A;  1FAP A;  1YAT A;  2LKN A;  4C02 B;  3IKD A;  4R0X A;  2VCD A;  5B8I C;  1KT1 A;  4ODP A;  1U79 A;  2KO7 A;  1PIN A;  3CGM A;  4IQC A;  4U85 A;  4JYS A;  4QIB A;  4U84 A;  2XPA A;  3KAF A;  5HWC A;  2MLZ A;  4DRN A;  3PRB A;  2RUC A;  2F2D A;  1QPF A;  2M2A A;  1BKF A;  5DIT A;  1NSG A;  1FKG A;  3VAW A;  2XP9 A;  2ITK A;  3RGC A;  3TCZ A;  1J4R A;  4DT4 A;  2RUR A;  1FKK A;  3GPK A;  3KAI A;  1Q6H A;  4DIP A;  2M08 A;  1ROU A;  5HT1 A;  1F40 A;  3PA7 A;  2RSE A;  1N1A A;  1FKR A;  1FKD A;  1M5Y A;  2K8I A;  2FKE A;  4JFM A;  2PV2 A;  2PV1 A;  1ZCN A;  1D7I A;  1JNT A;  1P5Q A;  1FKT A;  2IF4 A;  1D6O A;  1FKL A; 
#chains in the Genus database with same CATH topology
 1ZBV A;  3OA5 A;  1JCH B;  5I98 A;  2WLY A;  2PN0 A;  1D7H A;  1C9H A;  3G6L A;  2RUQ A;  1HJW A;  3KAH A;  1E9L A;  4TYO A;  2A3E A;  3FAP A;  4URI A;  4TW8 A;  1O6I A;  3AS1 A;  1K9T A;  1J4H A;  2DT1 A;  3JYJ A;  3TC5 A;  4Z2G A;  3CHD A;  3O5J A;  4WKF A;  1NWR A;  4QZV B;  4U86 A;  2ZR6 A;  4IT4 A;  1E6N A;  3WD2 A;  4DRJ A;  3O5M A;  2DSW A;  3KAB A;  3WQV A;  4N19 A;  3WL0 A;  1RD6 A;  3ALG A;  4AY1 A;  2ZQV A;  1HJV A;  1E15 A;  2PPO A;  2XP5 A;  2FDM A;  4ODN A;  4JFK A;  1J6Y A;  5HW8 A;  5GPG A;  1ZK6 A;  4Z2L A;  1W26 A;  1D2K A;  1NH6 A;  4MTV A;  4O2T A;  4TW6 A;  2MNT A;  2ZR5 A;  4WKH A;  1Y0O A;  4LGX A;  1JNE A;  4W9O A;  1QPL A;  4S3J A;  2G8Z A;  1W9P A;  2VN1 A;  3RFW A;  3O5R A;  1HKM A;  1FKI A;  3O5L A;  3O5O A;  3AS2 A;  4DRQ A;  3O5F A;  1GUV A;  3WIJ A;  3EY6 A;  3WQW A;  1E44 A;  4LAX A;  2M1I A;  4KR0 B;  2N87 A;  3ARR A;  4MNK A;  3WD0 A;  1Q1C A;  4G2P A;  3KAD A;  5HWB A;  3JXV A;  2MLY A;  1YAT A;  4ZPW R;  4DWS B;  1SYT A;  2A3A A;  4IQC A;  4QIB A;  5HWC A;  2F2D A;  2YBU A;  1FKG A;  3EIP A;  2RUR A;  3GPK A;  3KAI A;  2M08 A;  4Z2J A;  1ZBK A;  3PA7 A;  2OLH A;  2K8I A;  2F23 A;  3ARZ A;  2A3C A;  1D7I A;  1FKL A;  1A7X A;  4NNR A;  1ZL1 A;  3IK8 A;  4MSP A;  4NSB A;  2FAP A;  3O5K A;  4TNS A;  1LL7 A;  2MPH A;  1L1P A;  5GPR A;  1LG2 A;  3O5Q A;  5BXJ A;  3KCE A;  2XPB A;  2RUD A;  2A3B A;  3JYM A;  5JH8 A;  4HBE A;  3LUO A;  3O5E A;  1W1P A;  1X6N A;  3ARW A;  4MAV A;  2DG3 A;  4P8X A;  4JFI A;  1R9H A;  2ETN A;  1KT0 A;  4W9P A;  1NWT A;  2AWG A;  5GQB A;  4DZ2 A;  4DRM A;  4LAV A;  3MDY B;  2PPP A;  2KR7 A;  1OGB A;  4W9Q A;  2WM0 A;  1UR9 A;  2F4E A;  3ARY A;  1HKJ A;  4Z2I A;  2WLZ A;  3QOK A;  4ODM A;  3B9D A;  2DSZ A;  3FY1 A;  1W1Y A;  1NMW A;  2RQS A;  3UI5 A;  4QT2 A;  2ESC A;  4FAP A;  2G41 A;  1B6C A;  4GIV A;  2OFN A;  1WAW A;  3UQA A;  3CHF A;  1PBK A;  1YW5 A;  5J6E A;  3BMB A;  3KZ7 A;  1ZB5 A;  3KAG A;  1FJD A;  5HUA A;  2D9F A;  2DPE A;  3AS3 A;  1VF8 A;  1CTN A;  2UZ5 A;  3ARO A;  4BF8 A;  5DO2 A;  3UF8 A;  4ODL A;  1TCO C;  3O5G A;  4ODO A;  4XAK A;  3ARS A;  3PRD A;  2XP3 A;  2DG4 A;  3I6C A;  4Q7N A;  4ML4 A;  3B7X A;  3H9R B;  4QT3 A;  4ODR A;  1FFQ A;  4C02 B;  1FAP A;  4IT6 A;  4W5U A;  4WJX A;  1KT1 A;  4DWS D;  4U85 A;  4JYS A;  4U84 A;  2XPA A;  3KAF A;  4MNJ A;  3PRB A;  1QPF A;  4ZS6 A;  3GU0 A;  2DSU A;  1ZBC A;  4P8U A;  3GTY X;  4WIW A;  5DIT A;  3VAW A;  2XP9 A;  3TCZ A;  1FKK A;  1WB0 A;  1FFR A;  3WKZ A;  1M5Y A;  2FKE A;  4JFM A;  2PV2 A;  3ARU A;  1FKT A;  1GOI A;  4R5E A;  3KAC A;  3W4R A;  1JNS A;  2XP6 A;  1GPF A;  4L3N A;  4IPX A;  1HXV A;  1NMV A;  4JFJ A;  4DRP A;  1EQ3 A;  2B31 A;  2EUL A;  5HT1 A;  4LAW A;  1T11 A;  3ARP A;  4G50 A;  4LAY A;  1FKF A;  3CGN A;  4TW7 A;  3NRK A;  3ARV A;  1E6R A;  3B8S A;  1W1T A;  3B9E A;  1EDQ A;  1Q6I A;  2DT3 A;  1BL4 A;  1FKB A;  4MNL A;  5HTG A;  2B5U B;  2JZV A;  4DRH A;  4Q22 A;  3B9A A;  4ZPT R;  2IUZ A;  3PRA A;  4KQZ A;  4WKA A;  1J4I A;  4MPK A;  5HW7 A;  4JFL A;  2AOS A;  4DRI A;  1GRJ A;  3IHZ A;  3CHE A;  3O5D A;  1QZ2 A;  2XP7 A;  4Z2H A;  1JND A;  1HJX A;  4UDM A;  2DG9 A;  1E6Z A;  2ZQU A;  4ITZ A;  4ZPV R;  5HW6 A;  2LJ4 A;  3AS0 A;  1F8A B;  4DWS C;  1D7J A;  1XRV A;  3WD3 A;  4R0X A;  5B8I C;  1H0G A;  4ODP A;  1U79 A;  1PIN A;  1IX5 A;  1E6P A;  2MLZ A;  2RUC A;  2M2A A;  1BKF A;  2QF8 A;  3AQU A;  5HBF A;  1NWU A;  1ROU A;  1F40 A;  2RSE A;  3PR9 A;  1UR8 A;  1ZCN A;  5DIU A;  1HKK A;  1W1V A;  1FD9 A;  4NZC A;  4HBO A;  3G6M A;  4DRK A;  2PI6 A;  2XP8 A;  3TDB A;  2DT2 A;  4ODK A;  1JVW A;  1LG1 A;  3ODK A;  2ZQS A;  1EYM A;  1NWS A;  4PTM A;  3ARX A;  2KE0 A;  1KFW A;  3NI6 A;  2DSV A;  4L72 B;  4DWS A;  3RM4 A;  3O5I A;  2P4V A;  3WD4 A;  2MLX A;  3IKG A;  4TX0 A;  1FKJ A;  3CZ8 A;  1LL6 A;  2PBC A;  4DH0 A;  1WNO A;  4P8W A;  2PV3 A;  4HAR A;  3UQI A;  4S3K A;  1LQ0 A;  2ZQT A;  1TFV A;  3NTP A;  4MGV A;  2LPV A;  5DF0 A;  1W9U A;  4DZ3 A;  2WK2 A;  2ZR4 A;  4J4O A;  1LL4 A;  3O5P A;  1ITX A;  5D75 A;  3WH0 A;  3UQB A;  1ZU8 A;  3WD1 A;  2Q5A A;  1ROT A;  3CHC A;  2KGJ A;  4J4N A;  3BXW A;  4FN2 A;  3UI4 A;  1Q6U A;  3OOB A;  5HKG A;  3ART A;  2O92 A;  2KI3 A;  2XP4 A;  1ZBW A;  2L2S A;  5DIV A;  2LGO A;  3ALF A;  1W9V A;  4IQ2 A;  1XHG A;  3ARQ A;  3RM9 A;  1FKH A;  4ODQ A;  2YBT A;  3UI6 A;  1OGG A;  2MF9 A;  4DRO A;  2F21 A;  2KFW A;  2Y78 A;  5DEZ A;  2PPN A;  4GGQ A;  1FKS A;  2LKN A;  1EHN A;  3IKD A;  2VCD A;  4MNM A;  1OWQ A;  1X6L A;  2KO7 A;  3CGM A;  4WK9 A;  1HKI A;  2O9O A;  4DRN A;  3RM8 A;  3RME A;  1NSG A;  3RGC A;  2ITK A;  1J4R A;  4DT4 A;  3FXY A;  4DIP A;  3CH9 A;  1Q6H A;  4Z2K A;  2DT0 A;  4P8V A;  1SR0 A;  1N1A A;  3WL1 A;  1H0I A;  1FKR A;  1FKD A;  1EIB A;  2PV1 A;  1JNT A;  1P5Q A;  1LJY A;  2IF4 A;  1D6O A; 
#chains in the Genus database with same CATH homology
 1ZBV A;  3OA5 A;  5I98 A;  2WLY A;  1D7H A;  1C9H A;  3G6L A;  2RUQ A;  1HJW A;  3KAH A;  1E9L A;  4TYO A;  2A3E A;  3FAP A;  4URI A;  4TW8 A;  1O6I A;  3AS1 A;  1K9T A;  1J4H A;  2DT1 A;  3JYJ A;  3TC5 A;  4Z2G A;  3CHD A;  3O5J A;  4WKF A;  1NWR A;  4QZV B;  4U86 A;  2ZR6 A;  4IT4 A;  1E6N A;  3WD2 A;  4DRJ A;  3O5M A;  2DSW A;  3KAB A;  3WQV A;  4N19 A;  3WL0 A;  1RD6 A;  3ALG A;  4AY1 A;  2ZQV A;  1HJV A;  1E15 A;  2PPO A;  2XP5 A;  2FDM A;  4ODN A;  4JFK A;  1J6Y A;  5HW8 A;  5GPG A;  1ZK6 A;  4Z2L A;  1W26 A;  1D2K A;  1NH6 A;  4MTV A;  4O2T A;  4TW6 A;  2MNT A;  2ZR5 A;  4WKH A;  1Y0O A;  4LGX A;  1JNE A;  4W9O A;  1QPL A;  4S3J A;  2G8Z A;  1W9P A;  2VN1 A;  3RFW A;  3O5R A;  1HKM A;  1FKI A;  3O5L A;  3O5O A;  3AS2 A;  4DRQ A;  3O5F A;  1GUV A;  3WIJ A;  3EY6 A;  3WQW A;  4LAX A;  2M1I A;  4KR0 B;  2N87 A;  3ARR A;  4MNK A;  3WD0 A;  1Q1C A;  4G2P A;  3KAD A;  5HWB A;  3JXV A;  2MLY A;  1YAT A;  4ZPW R;  4DWS B;  1SYT A;  2A3A A;  4IQC A;  4QIB A;  5HWC A;  2F2D A;  2YBU A;  1FKG A;  2RUR A;  3GPK A;  3KAI A;  2M08 A;  4Z2J A;  1ZBK A;  3PA7 A;  2OLH A;  2K8I A;  3ARZ A;  2A3C A;  1D7I A;  1FKL A;  1A7X A;  4NNR A;  1ZL1 A;  3IK8 A;  4MSP A;  4NSB A;  2FAP A;  3O5K A;  4TNS A;  1LL7 A;  2MPH A;  1L1P A;  5GPR A;  1LG2 A;  3O5Q A;  5BXJ A;  3KCE A;  2XPB A;  2RUD A;  2A3B A;  3JYM A;  5JH8 A;  4HBE A;  3LUO A;  3O5E A;  1W1P A;  1X6N A;  3ARW A;  4MAV A;  2DG3 A;  4P8X A;  4JFI A;  1R9H A;  1KT0 A;  4W9P A;  1NWT A;  2AWG A;  5GQB A;  4DZ2 A;  4DRM A;  4LAV A;  3MDY B;  2PPP A;  2KR7 A;  1OGB A;  4W9Q A;  2WM0 A;  1UR9 A;  2F4E A;  3ARY A;  1HKJ A;  4Z2I A;  2WLZ A;  3QOK A;  4ODM A;  3B9D A;  2DSZ A;  3FY1 A;  1W1Y A;  1NMW A;  2RQS A;  3UI5 A;  4QT2 A;  2ESC A;  4FAP A;  2G41 A;  1B6C A;  4GIV A;  2OFN A;  1WAW A;  3UQA A;  3CHF A;  1PBK A;  1YW5 A;  5J6E A;  3KZ7 A;  1ZB5 A;  3KAG A;  1FJD A;  5HUA A;  2D9F A;  2DPE A;  3AS3 A;  1VF8 A;  1CTN A;  2UZ5 A;  3ARO A;  4BF8 A;  5DO2 A;  3UF8 A;  4ODL A;  1TCO C;  3O5G A;  4ODO A;  4XAK A;  3ARS A;  3PRD A;  2XP3 A;  2DG4 A;  3I6C A;  4Q7N A;  4ML4 A;  3B7X A;  3H9R B;  4QT3 A;  4ODR A;  1FFQ A;  4C02 B;  1FAP A;  4IT6 A;  4W5U A;  4WJX A;  1KT1 A;  4DWS D;  4U85 A;  4JYS A;  4U84 A;  2XPA A;  3KAF A;  4MNJ A;  3PRB A;  1QPF A;  4ZS6 A;  2DSU A;  1ZBC A;  4P8U A;  5DIT A;  4WIW A;  3VAW A;  2XP9 A;  3TCZ A;  1FKK A;  1WB0 A;  1FFR A;  3WKZ A;  1M5Y A;  2FKE A;  4JFM A;  2PV2 A;  3ARU A;  1FKT A;  1GOI A;  4R5E A;  3KAC A;  3W4R A;  1JNS A;  2XP6 A;  1GPF A;  4L3N A;  4IPX A;  1HXV A;  1NMV A;  4JFJ A;  4DRP A;  1EQ3 A;  2B31 A;  5HT1 A;  4LAW A;  1T11 A;  3ARP A;  4G50 A;  4LAY A;  1FKF A;  3CGN A;  4TW7 A;  3NRK A;  3ARV A;  1E6R A;  3B8S A;  1W1T A;  3B9E A;  1EDQ A;  1Q6I A;  2DT3 A;  1BL4 A;  1FKB A;  4MNL A;  5HTG A;  2JZV A;  4DRH A;  4Q22 A;  3B9A A;  4ZPT R;  2IUZ A;  3PRA A;  4KQZ A;  4WKA A;  1J4I A;  4MPK A;  5HW7 A;  4JFL A;  2AOS A;  4DRI A;  3IHZ A;  3CHE A;  3O5D A;  1QZ2 A;  2XP7 A;  4Z2H A;  1JND A;  1HJX A;  2DG9 A;  1E6Z A;  2ZQU A;  4ITZ A;  4ZPV R;  5HW6 A;  2LJ4 A;  3AS0 A;  1F8A B;  4DWS C;  1D7J A;  1XRV A;  3WD3 A;  4R0X A;  5B8I C;  1H0G A;  4ODP A;  1U79 A;  1PIN A;  1IX5 A;  1E6P A;  2MLZ A;  2RUC A;  2M2A A;  1BKF A;  2QF8 A;  3AQU A;  5HBF A;  1NWU A;  1ROU A;  1F40 A;  2RSE A;  3PR9 A;  1UR8 A;  1ZCN A;  5DIU A;  1HKK A;  1W1V A;  1FD9 A;  4NZC A;  4HBO A;  3G6M A;  4DRK A;  2PI6 A;  2XP8 A;  3TDB A;  2DT2 A;  4ODK A;  1JVW A;  1LG1 A;  3ODK A;  2ZQS A;  1EYM A;  1NWS A;  4PTM A;  3ARX A;  2KE0 A;  1KFW A;  3NI6 A;  2DSV A;  4L72 B;  4DWS A;  3RM4 A;  3O5I A;  3WD4 A;  2MLX A;  3IKG A;  4TX0 A;  1FKJ A;  3CZ8 A;  1LL6 A;  2PBC A;  4DH0 A;  1WNO A;  4P8W A;  2PV3 A;  4HAR A;  3UQI A;  4S3K A;  1LQ0 A;  2ZQT A;  1TFV A;  3NTP A;  4MGV A;  2LPV A;  5DF0 A;  1W9U A;  4DZ3 A;  2WK2 A;  2ZR4 A;  4J4O A;  1LL4 A;  3O5P A;  1ITX A;  5D75 A;  3WH0 A;  3UQB A;  1ZU8 A;  3WD1 A;  2Q5A A;  1ROT A;  3CHC A;  2KGJ A;  4J4N A;  3BXW A;  4FN2 A;  3UI4 A;  1Q6U A;  3OOB A;  5HKG A;  3ART A;  2O92 A;  2KI3 A;  2XP4 A;  1ZBW A;  2L2S A;  5DIV A;  2LGO A;  3ALF A;  1W9V A;  4IQ2 A;  1XHG A;  3ARQ A;  3RM9 A;  1FKH A;  4ODQ A;  2YBT A;  3UI6 A;  1OGG A;  2MF9 A;  4DRO A;  2F21 A;  2KFW A;  2Y78 A;  5DEZ A;  2PPN A;  4GGQ A;  1FKS A;  2LKN A;  1EHN A;  3IKD A;  2VCD A;  4MNM A;  1OWQ A;  1X6L A;  2KO7 A;  3CGM A;  4WK9 A;  1HKI A;  2O9O A;  4DRN A;  3RM8 A;  3RME A;  1NSG A;  3RGC A;  2ITK A;  1J4R A;  4DT4 A;  3FXY A;  4DIP A;  3CH9 A;  1Q6H A;  4Z2K A;  2DT0 A;  4P8V A;  1SR0 A;  1N1A A;  3WL1 A;  1H0I A;  1FKR A;  1FKD A;  1EIB A;  2PV1 A;  1JNT A;  1P5Q A;  1LJY A;  2IF4 A;  1D6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...