5HKGA

Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (fkbp12.6).
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
publication title Total chemical synthesis, refolding, and crystallographic structure of fully active immunophilin calstabin 2 (FKBP12.6).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hkgA00
4ODMA 1M5YA 3O5RA 2DG3A 3KZ7A 2ZQTA 2KI3A 4QIBA 2ZQSA 5HUAA 4TX0A 1PBKA 2KFWA 3NI6A 1FKTA 1BKFA 2M2AA 1U79A 3KAIA 3O5DA 4DRIA 1QPLA 4IPXA 4TNSA 3KAHA 5BXJA 2F2DA 2XPAA 4TYOA 2L2SA 3KAGA 1ZK6A 1NMWA 4TW6A 3VAWA 1FKIA 1FKFA 2PBCA 3ODKA 4U86A 5HT1A 5B8IC 1FKHA 1FKBA 2VN1A 4LAXA 4W9QA 3TCZA 1FKRA 3O5EA 3TDBA 4DRKA 4DRHA 1JVWA 3UQAA 3CGNA 2KE0A 2XPBA 3B7XA 3CGMA 4DRPA 1ZCNA 2PV3A 2ZR6A 3I6CA 2PPPA 3RFWA 2JZVA 3UI5A 4GIVA 1FKKA 3UI6A 2MNTA 2ZR4A 4W9PA 4DRMA 4ODLA 2MLYA 1C9HA 3O5OA 3KADA 4FN2A 1FKSA 5GPGA 1ROUA 2LGOA 2FAPA 3IK8A 1FJDA 1EQ3A 4JFKA 2RUQA 5D75A 1F40A 3O5PA 4GGQA 1JNTA 4IQ2A 3MDYB 4MGVA 4ODRA 4R0XA 1FKJA 4U85A 4ODNA 4NNRA 2F4EA 1TCOC 2IF4A 3JYMA 3H9RB 3NTPA 1FD9A 5HW8A 2LJ4A 2LPVA 4LAYA 3JXVA 3WH0A 2KR7A 1J6YA 4LAWA 4ODOA 1FAPA 1KT0A 2RUDA 1FKLA 4DZ3A 3UQBA 1Q6UA 4DT4A 4ODPA 3FAPA 3O5GA 4TW8A 1Q6IA 4U84A 3UI4A 2M08A 3KACA 2XP5A 2ZQUA 2XP7A 2DG4A 2FKEA 3GPKA 3KABA 4N19A 2MPHA 1A7XA 4JYSA 1D7JA 1ROTA 3O5KA 4ODQA 2PV2A 4IQCA 4ODKA 4JFIA 2XP9A 4DH0A 1W26A 3O5IA 4DRJA 2VCDA 1P5QA 1Q1CA 2RQSA 3PA7A 3PRBA 5HWBA 4C02B 1HXVA 3LUOA 2PV1A 4FAPA 5I98A 4JFJA 1NMVA 4J4NA 5HKGA 1Q6HA 1YW5A 4TW7A 2KGJA 2M1IA 1N1AA 3KCEA 4DROA 4DIPA 5J6EA 1J4RA 2RSEA 2XP3A 2Y78A 1T11A 3O5QA 3KAFA 2ITKA 3RGCA 1F8AB 2Q5AA 2XP4A 2RUCA 1D6OA 1FKDA 1QZ2A 3OOBA 4DRQA 2DG9A 3IKDA 5DIUA 1D7IA 2UZ5A 5HW6A 2OFNA 4LAVA 5DITA 5HWCA 1L1PA 4J4OA 2ZR5A 3JYJA 4DZ2A 1J4IA 2K8IA 4MSPA 3PRDA 1JNSA 3EY6A 4QT3A 2MF9A 1B6CA 2N87A 4O2TA 1D7HA 1BL4A 2LKNA 2XP8A 3O5JA 4G50A 4QT2A 1NSGA 2XP6A 5DIVA 3IHZA 1EYMA 3IKGA 4BF8A 2MLXA 1Y0OA 3NRKA 1J4HA 2PPNA 2KO7A 2MLZA 5HTGA 1KT1A 3UQIA 3O5LA 4DRNA 1QPFA 5HW7A 2F21A 3UF8A 1FKGA 3O5MA 4G2PA 4JFMA 2ZQVA 3O5FA 2PPOA 4ITZA 3TC5A 1R9HA 1PINA 4W9OA 4JFLA 1YATA 2RURA 2D9FA 2AWGA
chains in the Genus database with same CATH superfamily
1WNOA 3B9DA 4Z2JA 4QIBA 3WL0A 2KFWA 2DSWA 3KAIA 1QPLA 4TNSA 5BXJA 2L2SA 4XAKA 1X6NA 1K9TA 4WKFA 3ODKA 1VF8A 4LAXA 3TCZA 1FKRA 1W9VA 1HJWA 4DRHA 2WLYA 3CHFA 3CGNA 3ARPA 4IT4A 4MTVA 4DRPA 1ZCNA 3RFWA 3UI6A 2ZR4A 1TFVA 2MLYA 1LQ0A 1FKSA 1CTNA 1ROUA 2A3AA 2FAPA 2LGOA 4WIWA 2QF8A 1EQ3A 5HBFA 1W1TA 1JNTA 1ZBKA 4IQ2A 1E44A 4ODNA 4S3JA 2F4EA 3CZ8A 2DSZA 4KR0B 2YBUA 3WQWA 3JXVA 3WH0A 4LAWA 4ODPA 3B9EA 3FAPA 3UI4A 3KACA 3GPKA 4N19A 1ZU8A 4JYSA 4ODKA 2B31A 4FAPA 5GQBA 1JNEA 3WL1A 2XP3A 2PI6A 2DT1A 1ZBVA 3AS1A 1D6OA 1QZ2A 3OOBA 1GRJA 2DG9A 5DIUA 2DSVA 4LAVA 5HWCA 3CHEA 3EY6A 4O2TA 4QT2A 1SR0A 4DWSB 1Y0OA 1J4HA 3G6MA 3OA5A 4MNKA 1JCHB 3RM9A 1KT1A 3UQIA 2ESCA 2F21A 1ZL1A 1D2KA 2ZQVA 3O5FA 1E6PA 1EDQA 2PPOA 4MNJA 2YBTA 3ARRA 3CH9A 3ARYA 2AWGA 4ODMA 1LL7A 2DG3A 4ZPTR 2ZQTA 3ARZA 1PBKA 3NI6A 5DO2A 2FDMA 2M2AA 1U79A 3ARUA 1O6IA 4P8UA 4IPXA 1E15A 3ARXA 4MAVA 1LG1A 1NMWA 5DEZA 1FKHA 3W4RA 5GPRA 4Z2KA 3O5EA 1JVWA 4W5UA 1XRVA 3CGMA 4Z2LA 3I6CA 1H0IA 4Q7NA 4DRMA 4Z2GA 3WQVA 1C9HA 3O5OA 3KADA 4FN2A 1ZBWA 3AS2A 1FJDA 4URIA 1ZB5A 4MNLA 1F40A 4ZS6A 2DT0A 4MGVA 1LG2A 2G41A 2G8ZA 4ODRA 4U85A 3RM4A 1TCOC 3ARSA 3H9RB 2LJ4A 2LPVA 3AROA 2AOSA 1NWRA 3ARWA 4KQZA 1HKIA 1FAPA 4DZ3A 4AY1A 4TW8A 2XP5A 2XP7A 2DG4A 1A7XA 4P8WA 4ODQA 2XP9A 3WD4A 2RQSA 1RD6A 4C02B 1HXVA 1NMVA 4J4NA 1W9UA 4TW7A 1N1AA 3KCEA 4DROA 4DIPA 2Y78A 2A3CA 2Q5AA 1LJYA 2UZ5A 1LL4A 5DITA 1L1PA 1HJVA 1WAWA 2ZR5A 3JYJA 2K8IA 4MSPA 3PRDA 1JNSA 4QT3A 4DWSD 2MF9A 3CHCA 2ETNA 1BL4A 1LL6A 4G50A 4LGXA 2O9OA 3IKGA 2PPNA 2KO7A 4DRNA 2DT2A 3ARTA 4L3NA 5HW7A 4MNMA 1E6NA 3ALFA 2A3BA 3IKDA 1M5YA 3O5RA 3KZ7A 2KI3A 2ZQSA 3GU0A 4TX0A 1FKTA 1BKFA 1HKKA 4DRIA 1KFWA 2XPAA 4TYOA 4TW6A 3KAGA 3WD1A 1FKFA 2PBCA 4U86A 5HT1A 5B8IC 2VN1A 2DT3A 4DRKA 1X6LA 4ZPVR 2XPBA 3B7XA 1UR8A 2PPPA 4WKAA 3UI5A 1FKKA 4WJXA 3G6LA 4Z2IA 3IK8A 5D75A 4GGQA 1NWUA 4R0XA 1FKJA 4NNRA 3AS3A 3BMBA 2PN0A 3B8SA 1SYTA 4ODOA 1KT0A 2DPEA 1FKLA 2RUDA 1Q6UA 3O5GA 4U84A 3ARVA 2FKEA 1GUVA 1OWQA 1NWSA 1D7JA 2F23A 4IQCA 1W26A 1Q1CA 1E6RA 3PRBA 4Q22A 2PV1A 3AQUA 2B5UB 1E6ZA 1JNDA 1Q6HA 2DSUA 3ALGA 5JH8A 1J4RA 1T11A 3O5QA 2ITKA 3GTYX 2OLHA 1ZBCA 1FFQA 4J4OA 1J4IA 3PR9A 3FY1A 2A3EA 1B6CA 2N87A 4P8VA 2XP6A 4BF8A 2MLXA 3NRKA 4HBEA 5DF0A 5HTGA 1QPFA 1FKGA 3O5MA 4G2PA 4ITZA 3TC5A 1PINA 4W9OA 4JFLA 4IT6A 2RURA 4L72B 2WLZA 1H0GA 4WKHA 2EULA 3WD0A 3O5DA 3BXWA 3KAHA 2F2DA 1ZK6A 4WK9A 3VAWA 1FKIA 2P4VA 1XHGA 4R5EA 1FKBA 3B9AA 4DWSC 3EIPA 4W9QA 1OGGA 3TDBA 3UQAA 2KE0A 1E9LA 4DWSA 1GPFA 2PV3A 2ZR6A 2JZVA 4GIVA 4P8XA 2WM0A 2MNTA 4W9PA 4ODLA 5GPGA 4JFKA 2RUQA 3O5PA 3WD2A 3MDYB 3CHDA 4S3KA 3WD3A 2IF4A 3JYMA 5HW8A 3NTPA 1FD9A 3WIJA 4LAYA 2O92A 2KR7A 1NH6A 1J6YA 3UQBA 3RM8A 4DT4A 2IUZA 1Q6IA 1W1PA 3PRAA 2M08A 3KABA 2ZQUA 4UDMA 5DIVA 1IX5A 5HUAA 1OGBA 2MPHA 3WKZA 3O5KA 1ROTA 4Z2HA 1W9PA 2PV2A 4DRJA 4JFIA 3O5IA 2VCDA 1P5QA 3PA7A 4ML4A 4ZPWR 5HWBA 3LUOA 4MPKA 4PTMA 5I98A 4JFJA 1HKJA 5HKGA 1ITXA 1YW5A 2KGJA 2M1IA 4HARA 3AS0A 5J6EA 2RSEA 3KAFA 4NSBA 1W1YA 3RGCA 3RMEA 1F8AB 5HW6A 2XP4A 2RUCA 1FKDA 4DRQA 3ARQA 4QZVB 1D7IA 1EIBA 2OFNA 1FFRA 3FXYA 4DZ2A 1UR9A 4NZCA 3QOKA 1WB0A 1D7HA 2LKNA 2XP8A 3O5JA 4DH0A 1NSGA 1W1VA 1EYMA 1HKMA 3IHZA 2MLZA 2WK2A 3O5LA 1GOIA 3UF8A 1EHNA 4JFMA 1NWTA 1R9HA 1HJXA 1YATA 2D9FA 4HBOA
chains in the Genus database with same CATH topology
1WNOA 3B9DA 4Z2JA 4QIBA 3WL0A 2KFWA 2DSWA 3KAIA 1QPLA 4TNSA 5BXJA 2L2SA 4XAKA 1X6NA 1K9TA 4WKFA 3ODKA 1VF8A 4LAXA 3TCZA 1FKRA 1W9VA 1HJWA 4DRHA 2WLYA 3CHFA 3CGNA 3ARPA 4IT4A 4MTVA 4DRPA 1ZCNA 3RFWA 3UI6A 2ZR4A 1TFVA 2MLYA 1LQ0A 1FKSA 1CTNA 1ROUA 2A3AA 2FAPA 2LGOA 4WIWA 2QF8A 1EQ3A 5HBFA 1W1TA 1JNTA 1ZBKA 4IQ2A 4ODNA 4S3JA 2F4EA 3CZ8A 2DSZA 4KR0B 2YBUA 3WQWA 3JXVA 3WH0A 4LAWA 4ODPA 3B9EA 3FAPA 3UI4A 3KACA 3GPKA 4N19A 1ZU8A 4JYSA 4ODKA 2B31A 4FAPA 5GQBA 1JNEA 3WL1A 2XP3A 2PI6A 2DT1A 1ZBVA 3AS1A 1D6OA 1QZ2A 3OOBA 2DG9A 5DIUA 2DSVA 4LAVA 5HWCA 3CHEA 3EY6A 4O2TA 4QT2A 1SR0A 4DWSB 1Y0OA 1J4HA 3G6MA 3OA5A 4MNKA 3RM9A 1KT1A 3UQIA 2ESCA 2F21A 1ZL1A 1D2KA 2ZQVA 3O5FA 1E6PA 1EDQA 2PPOA 4MNJA 2YBTA 3ARRA 3CH9A 3ARYA 2AWGA 4ODMA 1LL7A 2DG3A 4ZPTR 2ZQTA 3ARZA 1PBKA 3NI6A 5DO2A 2FDMA 2M2AA 1U79A 3ARUA 1O6IA 4P8UA 4IPXA 1E15A 3ARXA 4MAVA 1LG1A 1NMWA 5DEZA 1FKHA 3W4RA 5GPRA 4Z2KA 3O5EA 1JVWA 4W5UA 1XRVA 3CGMA 4Z2LA 3I6CA 1H0IA 4Q7NA 4DRMA 4Z2GA 3WQVA 1C9HA 3O5OA 3KADA 4FN2A 1ZBWA 3AS2A 1FJDA 4URIA 1ZB5A 4MNLA 1F40A 4ZS6A 2DT0A 4MGVA 1LG2A 2G41A 2G8ZA 4ODRA 4U85A 3RM4A 1TCOC 3ARSA 3H9RB 2LJ4A 2LPVA 3AROA 2AOSA 1NWRA 3ARWA 4KQZA 1HKIA 1FAPA 4DZ3A 4AY1A 4TW8A 2XP5A 2XP7A 2DG4A 1A7XA 4P8WA 4ODQA 2XP9A 3WD4A 2RQSA 1RD6A 4C02B 1HXVA 1NMVA 4J4NA 1W9UA 4TW7A 1N1AA 3KCEA 4DROA 4DIPA 2Y78A 2A3CA 2Q5AA 1LJYA 2UZ5A 1LL4A 5DITA 1L1PA 1HJVA 1WAWA 2ZR5A 3JYJA 2K8IA 4MSPA 3PRDA 1JNSA 4QT3A 4DWSD 2MF9A 3CHCA 1BL4A 1LL6A 4G50A 4LGXA 2O9OA 3IKGA 2PPNA 2KO7A 4DRNA 2DT2A 3ARTA 4L3NA 5HW7A 4MNMA 1E6NA 3ALFA 2A3BA 3IKDA 1M5YA 3O5RA 3KZ7A 2KI3A 2ZQSA 4TX0A 1FKTA 1BKFA 1HKKA 4DRIA 1KFWA 2XPAA 4TYOA 4TW6A 3KAGA 3WD1A 1FKFA 2PBCA 4U86A 5HT1A 5B8IC 2VN1A 2DT3A 4DRKA 1X6LA 4ZPVR 2XPBA 3B7XA 1UR8A 2PPPA 4WKAA 3UI5A 1FKKA 4WJXA 3G6LA 4Z2IA 3IK8A 5D75A 4GGQA 1NWUA 4R0XA 1FKJA 4NNRA 3AS3A 3B8SA 1SYTA 4ODOA 1KT0A 2DPEA 1FKLA 2RUDA 1Q6UA 3O5GA 4U84A 3ARVA 2FKEA 1GUVA 1OWQA 1NWSA 1D7JA 4IQCA 1W26A 1Q1CA 1E6RA 3PRBA 4Q22A 2PV1A 3AQUA 1E6ZA 1JNDA 1Q6HA 2DSUA 3ALGA 5JH8A 1J4RA 1T11A 3O5QA 2ITKA 2OLHA 1ZBCA 1FFQA 4J4OA 1J4IA 3PR9A 3FY1A 2A3EA 1B6CA 2N87A 4P8VA 2XP6A 4BF8A 2MLXA 3NRKA 4HBEA 5DF0A 5HTGA 1QPFA 1FKGA 3O5MA 4G2PA 4ITZA 3TC5A 1PINA 4W9OA 4JFLA 4IT6A 2RURA 4L72B 2WLZA 1H0GA 4WKHA 3WD0A 3O5DA 3BXWA 3KAHA 2F2DA 1ZK6A 4WK9A 3VAWA 1FKIA 1XHGA 4R5EA 1FKBA 3B9AA 4DWSC 4W9QA 1OGGA 3TDBA 3UQAA 2KE0A 1E9LA 4DWSA 1GPFA 2PV3A 2ZR6A 2JZVA 4GIVA 4P8XA 2WM0A 2MNTA 4W9PA 4ODLA 5GPGA 4JFKA 2RUQA 3O5PA 3WD2A 3MDYB 3CHDA 4S3KA 3WD3A 2IF4A 3JYMA 5HW8A 3NTPA 1FD9A 3WIJA 4LAYA 2O92A 2KR7A 1NH6A 1J6YA 3UQBA 3RM8A 4DT4A 2IUZA 1Q6IA 1W1PA 3PRAA 2M08A 3KABA 2ZQUA 5DIVA 1IX5A 5HUAA 1OGBA 2MPHA 3WKZA 3O5KA 1ROTA 4Z2HA 1W9PA 2PV2A 4DRJA 4JFIA 3O5IA 2VCDA 1P5QA 3PA7A 4ML4A 4ZPWR 5HWBA 3LUOA 4MPKA 4PTMA 5I98A 4JFJA 1HKJA 5HKGA 1ITXA 1YW5A 2KGJA 2M1IA 4HARA 3AS0A 5J6EA 2RSEA 3KAFA 4NSBA 1W1YA 3RGCA 3RMEA 1F8AB 5HW6A 2XP4A 2RUCA 1FKDA 4DRQA 3ARQA 4QZVB 1D7IA 1EIBA 2OFNA 1FFRA 3FXYA 4DZ2A 1UR9A 4NZCA 3QOKA 1WB0A 1D7HA 2LKNA 2XP8A 3O5JA 4DH0A 1NSGA 1W1VA 1EYMA 1HKMA 3IHZA 2MLZA 2WK2A 3O5LA 1GOIA 3UF8A 1EHNA 4JFMA 1NWTA 1R9HA 1HJXA 1YATA 2D9FA 4HBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODM A;  1M5Y A;  3O5R A;  2DG3 A;  3KZ7 A;  2ZQT A;  2KI3 A;  4QIB A;  2ZQS A;  5HUA A;  4TX0 A;  1PBK A;  2KFW A;  3NI6 A;  1FKT A;  1BKF A;  2M2A A;  1U79 A;  3KAI A;  3O5D A;  4DRI A;  1QPL A;  4IPX A;  4TNS A;  3KAH A;  5BXJ A;  2F2D A;  2XPA A;  4TYO A;  2L2S A;  3KAG A;  1ZK6 A;  1NMW A;  4TW6 A;  3VAW A;  1FKI A;  1FKF A;  2PBC A;  3ODK A;  4U86 A;  5HT1 A;  5B8I C;  1FKH A;  1FKB A;  2VN1 A;  4LAX A;  4W9Q A;  3TCZ A;  1FKR A;  3O5E A;  3TDB A;  4DRK A;  4DRH A;  1JVW A;  3UQA A;  3CGN A;  2KE0 A;  2XPB A;  3B7X A;  3CGM A;  4DRP A;  1ZCN A;  2PV3 A;  2ZR6 A;  3I6C A;  2PPP A;  3RFW A;  2JZV A;  3UI5 A;  4GIV A;  1FKK A;  3UI6 A;  2MNT A;  2ZR4 A;  4W9P A;  4DRM A;  4ODL A;  2MLY A;  1C9H A;  3O5O A;  3KAD A;  4FN2 A;  1FKS A;  5GPG A;  1ROU A;  2LGO A;  2FAP A;  3IK8 A;  1FJD A;  1EQ3 A;  4JFK A;  2RUQ A;  5D75 A;  1F40 A;  3O5P A;  4GGQ A;  1JNT A;  4IQ2 A;  3MDY B;  4MGV A;  4ODR A;  4R0X A;  1FKJ A;  4U85 A;  4ODN A;  4NNR A;  2F4E A;  1TCO C;  2IF4 A;  3JYM A;  3H9R B;  3NTP A;  1FD9 A;  5HW8 A;  2LJ4 A;  2LPV A;  4LAY A;  3JXV A;  3WH0 A;  2KR7 A;  1J6Y A;  4LAW A;  4ODO A;  1FAP A;  1KT0 A;  2RUD A;  1FKL A;  4DZ3 A;  3UQB A;  1Q6U A;  4DT4 A;  4ODP A;  3FAP A;  3O5G A;  4TW8 A;  1Q6I A;  4U84 A;  3UI4 A;  2M08 A;  3KAC A;  2XP5 A;  2ZQU A;  2XP7 A;  2DG4 A;  2FKE A;  3GPK A;  3KAB A;  4N19 A;  2MPH A;  1A7X A;  4JYS A;  1D7J A;  1ROT A;  3O5K A;  4ODQ A;  2PV2 A;  4IQC A;  4ODK A;  4JFI A;  2XP9 A;  4DH0 A;  1W26 A;  3O5I A;  4DRJ A;  2VCD A;  1P5Q A;  1Q1C A;  2RQS A;  3PA7 A;  3PRB A;  5HWB A;  4C02 B;  1HXV A;  3LUO A;  2PV1 A;  4FAP A;  5I98 A;  4JFJ A;  1NMV A;  4J4N A;  5HKG A;  1Q6H A;  1YW5 A;  4TW7 A;  2KGJ A;  2M1I A;  1N1A A;  3KCE A;  4DRO A;  4DIP A;  5J6E A;  1J4R A;  2RSE A;  2XP3 A;  2Y78 A;  1T11 A;  3O5Q A;  3KAF A;  2ITK A;  3RGC A;  1F8A B;  2Q5A A;  2XP4 A;  2RUC A;  1D6O A;  1FKD A;  1QZ2 A;  3OOB A;  4DRQ A;  2DG9 A;  3IKD A;  5DIU A;  1D7I A;  2UZ5 A;  5HW6 A;  2OFN A;  4LAV A;  5DIT A;  5HWC A;  1L1P A;  4J4O A;  2ZR5 A;  3JYJ A;  4DZ2 A;  1J4I A;  2K8I A;  4MSP A;  3PRD A;  1JNS A;  3EY6 A;  4QT3 A;  2MF9 A;  1B6C A;  2N87 A;  4O2T A;  1D7H A;  1BL4 A;  2LKN A;  2XP8 A;  3O5J A;  4G50 A;  4QT2 A;  1NSG A;  2XP6 A;  5DIV A;  3IHZ A;  1EYM A;  3IKG A;  4BF8 A;  2MLX A;  1Y0O A;  3NRK A;  1J4H A;  2PPN A;  2KO7 A;  2MLZ A;  5HTG A;  1KT1 A;  3UQI A;  3O5L A;  4DRN A;  1QPF A;  5HW7 A;  2F21 A;  3UF8 A;  1FKG A;  3O5M A;  4G2P A;  4JFM A;  2ZQV A;  3O5F A;  2PPO A;  4ITZ A;  3TC5 A;  1R9H A;  1PIN A;  4W9O A;  4JFL A;  1YAT A;  2RUR A;  2D9F A;  2AWG A; 
#chains in the Genus database with same CATH topology
 1WNO A;  3B9D A;  4Z2J A;  4QIB A;  3WL0 A;  2KFW A;  2DSW A;  3KAI A;  1QPL A;  4TNS A;  5BXJ A;  2L2S A;  4XAK A;  1X6N A;  1K9T A;  4WKF A;  3ODK A;  1VF8 A;  4LAX A;  3TCZ A;  1FKR A;  1W9V A;  1HJW A;  4DRH A;  2WLY A;  3CHF A;  3CGN A;  3ARP A;  4IT4 A;  4MTV A;  4DRP A;  1ZCN A;  3RFW A;  3UI6 A;  2ZR4 A;  1TFV A;  2MLY A;  1LQ0 A;  1FKS A;  1CTN A;  1ROU A;  2A3A A;  2FAP A;  2LGO A;  4WIW A;  2QF8 A;  1EQ3 A;  5HBF A;  1W1T A;  1JNT A;  1ZBK A;  4IQ2 A;  1E44 A;  4ODN A;  4S3J A;  2F4E A;  3CZ8 A;  2DSZ A;  4KR0 B;  2YBU A;  3WQW A;  3JXV A;  3WH0 A;  4LAW A;  4ODP A;  3B9E A;  3FAP A;  3UI4 A;  3KAC A;  3GPK A;  4N19 A;  1ZU8 A;  4JYS A;  4ODK A;  2B31 A;  4FAP A;  5GQB A;  1JNE A;  3WL1 A;  2XP3 A;  2PI6 A;  2DT1 A;  1ZBV A;  3AS1 A;  1D6O A;  1QZ2 A;  3OOB A;  1GRJ A;  2DG9 A;  5DIU A;  2DSV A;  4LAV A;  5HWC A;  3CHE A;  3EY6 A;  4O2T A;  4QT2 A;  1SR0 A;  4DWS B;  1Y0O A;  1J4H A;  3G6M A;  3OA5 A;  4MNK A;  1JCH B;  3RM9 A;  1KT1 A;  3UQI A;  2ESC A;  2F21 A;  1ZL1 A;  1D2K A;  2ZQV A;  3O5F A;  1E6P A;  1EDQ A;  2PPO A;  4MNJ A;  2YBT A;  3ARR A;  3CH9 A;  3ARY A;  2AWG A;  4ODM A;  1LL7 A;  2DG3 A;  4ZPT R;  2ZQT A;  3ARZ A;  1PBK A;  3NI6 A;  5DO2 A;  2FDM A;  2M2A A;  1U79 A;  3ARU A;  1O6I A;  4P8U A;  4IPX A;  1E15 A;  3ARX A;  4MAV A;  1LG1 A;  1NMW A;  5DEZ A;  1FKH A;  3W4R A;  5GPR A;  4Z2K A;  3O5E A;  1JVW A;  4W5U A;  1XRV A;  3CGM A;  4Z2L A;  3I6C A;  1H0I A;  4Q7N A;  4DRM A;  4Z2G A;  3WQV A;  1C9H A;  3O5O A;  3KAD A;  4FN2 A;  1ZBW A;  3AS2 A;  1FJD A;  4URI A;  1ZB5 A;  4MNL A;  1F40 A;  4ZS6 A;  2DT0 A;  4MGV A;  1LG2 A;  2G41 A;  2G8Z A;  4ODR A;  4U85 A;  3RM4 A;  1TCO C;  3ARS A;  3H9R B;  2LJ4 A;  2LPV A;  3ARO A;  2AOS A;  1NWR A;  3ARW A;  4KQZ A;  1HKI A;  1FAP A;  4DZ3 A;  4AY1 A;  4TW8 A;  2XP5 A;  2XP7 A;  2DG4 A;  1A7X A;  4P8W A;  4ODQ A;  2XP9 A;  3WD4 A;  2RQS A;  1RD6 A;  4C02 B;  1HXV A;  1NMV A;  4J4N A;  1W9U A;  4TW7 A;  1N1A A;  3KCE A;  4DRO A;  4DIP A;  2Y78 A;  2A3C A;  2Q5A A;  1LJY A;  2UZ5 A;  1LL4 A;  5DIT A;  1L1P A;  1HJV A;  1WAW A;  2ZR5 A;  3JYJ A;  2K8I A;  4MSP A;  3PRD A;  1JNS A;  4QT3 A;  4DWS D;  2MF9 A;  3CHC A;  2ETN A;  1BL4 A;  1LL6 A;  4G50 A;  4LGX A;  2O9O A;  3IKG A;  2PPN A;  2KO7 A;  4DRN A;  2DT2 A;  3ART A;  4L3N A;  5HW7 A;  4MNM A;  1E6N A;  3ALF A;  2A3B A;  3IKD A;  1M5Y A;  3O5R A;  3KZ7 A;  2KI3 A;  2ZQS A;  3GU0 A;  4TX0 A;  1FKT A;  1BKF A;  1HKK A;  4DRI A;  1KFW A;  2XPA A;  4TYO A;  4TW6 A;  3KAG A;  3WD1 A;  1FKF A;  2PBC A;  4U86 A;  5HT1 A;  5B8I C;  2VN1 A;  2DT3 A;  4DRK A;  1X6L A;  4ZPV R;  2XPB A;  3B7X A;  1UR8 A;  2PPP A;  4WKA A;  3UI5 A;  1FKK A;  4WJX A;  3G6L A;  4Z2I A;  3IK8 A;  5D75 A;  4GGQ A;  1NWU A;  4R0X A;  1FKJ A;  4NNR A;  3AS3 A;  3BMB A;  2PN0 A;  3B8S A;  1SYT A;  4ODO A;  1KT0 A;  2DPE A;  1FKL A;  2RUD A;  1Q6U A;  3O5G A;  4U84 A;  3ARV A;  2FKE A;  1GUV A;  1OWQ A;  1NWS A;  1D7J A;  2F23 A;  4IQC A;  1W26 A;  1Q1C A;  1E6R A;  3PRB A;  4Q22 A;  2PV1 A;  3AQU A;  2B5U B;  1E6Z A;  1JND A;  1Q6H A;  2DSU A;  3ALG A;  5JH8 A;  1J4R A;  1T11 A;  3O5Q A;  2ITK A;  3GTY X;  2OLH A;  1ZBC A;  1FFQ A;  4J4O A;  1J4I A;  3PR9 A;  3FY1 A;  2A3E A;  1B6C A;  2N87 A;  4P8V A;  2XP6 A;  4BF8 A;  2MLX A;  3NRK A;  4HBE A;  5DF0 A;  5HTG A;  1QPF A;  1FKG A;  3O5M A;  4G2P A;  4ITZ A;  3TC5 A;  1PIN A;  4W9O A;  4JFL A;  4IT6 A;  2RUR A;  4L72 B;  2WLZ A;  1H0G A;  4WKH A;  2EUL A;  3WD0 A;  3O5D A;  3BXW A;  3KAH A;  2F2D A;  1ZK6 A;  4WK9 A;  3VAW A;  1FKI A;  2P4V A;  1XHG A;  4R5E A;  1FKB A;  3B9A A;  4DWS C;  3EIP A;  4W9Q A;  1OGG A;  3TDB A;  3UQA A;  2KE0 A;  1E9L A;  4DWS A;  1GPF A;  2PV3 A;  2ZR6 A;  2JZV A;  4GIV A;  4P8X A;  2WM0 A;  2MNT A;  4W9P A;  4ODL A;  5GPG A;  4JFK A;  2RUQ A;  3O5P A;  3WD2 A;  3MDY B;  3CHD A;  4S3K A;  3WD3 A;  2IF4 A;  3JYM A;  5HW8 A;  3NTP A;  1FD9 A;  3WIJ A;  4LAY A;  2O92 A;  2KR7 A;  1NH6 A;  1J6Y A;  3UQB A;  3RM8 A;  4DT4 A;  2IUZ A;  1Q6I A;  1W1P A;  3PRA A;  2M08 A;  3KAB A;  2ZQU A;  4UDM A;  5DIV A;  1IX5 A;  5HUA A;  1OGB A;  2MPH A;  3WKZ A;  3O5K A;  1ROT A;  4Z2H A;  1W9P A;  2PV2 A;  4DRJ A;  4JFI A;  3O5I A;  2VCD A;  1P5Q A;  3PA7 A;  4ML4 A;  4ZPW R;  5HWB A;  3LUO A;  4MPK A;  4PTM A;  5I98 A;  4JFJ A;  1HKJ A;  5HKG A;  1ITX A;  1YW5 A;  2KGJ A;  2M1I A;  4HAR A;  3AS0 A;  5J6E A;  2RSE A;  3KAF A;  4NSB A;  1W1Y A;  3RGC A;  3RME A;  1F8A B;  5HW6 A;  2XP4 A;  2RUC A;  1FKD A;  4DRQ A;  3ARQ A;  4QZV B;  1D7I A;  1EIB A;  2OFN A;  1FFR A;  3FXY A;  4DZ2 A;  1UR9 A;  4NZC A;  3QOK A;  1WB0 A;  1D7H A;  2LKN A;  2XP8 A;  3O5J A;  4DH0 A;  1NSG A;  1W1V A;  1EYM A;  1HKM A;  3IHZ A;  2MLZ A;  2WK2 A;  3O5L A;  1GOI A;  3UF8 A;  1EHN A;  4JFM A;  1NWT A;  1R9H A;  1HJX A;  1YAT A;  2D9F A;  4HBO A; 
#chains in the Genus database with same CATH homology
 1WNO A;  3B9D A;  4Z2J A;  4QIB A;  3WL0 A;  2KFW A;  2DSW A;  3KAI A;  1QPL A;  4TNS A;  5BXJ A;  2L2S A;  4XAK A;  1X6N A;  1K9T A;  4WKF A;  3ODK A;  1VF8 A;  4LAX A;  3TCZ A;  1FKR A;  1W9V A;  1HJW A;  4DRH A;  2WLY A;  3CHF A;  3CGN A;  3ARP A;  4IT4 A;  4MTV A;  4DRP A;  1ZCN A;  3RFW A;  3UI6 A;  2ZR4 A;  1TFV A;  2MLY A;  1LQ0 A;  1FKS A;  1CTN A;  1ROU A;  2A3A A;  2FAP A;  2LGO A;  4WIW A;  2QF8 A;  1EQ3 A;  5HBF A;  1W1T A;  1JNT A;  1ZBK A;  4IQ2 A;  4ODN A;  4S3J A;  2F4E A;  3CZ8 A;  2DSZ A;  4KR0 B;  2YBU A;  3WQW A;  3JXV A;  3WH0 A;  4LAW A;  4ODP A;  3B9E A;  3FAP A;  3UI4 A;  3KAC A;  3GPK A;  4N19 A;  1ZU8 A;  4JYS A;  4ODK A;  2B31 A;  4FAP A;  5GQB A;  1JNE A;  3WL1 A;  2XP3 A;  2PI6 A;  2DT1 A;  1ZBV A;  3AS1 A;  1D6O A;  1QZ2 A;  3OOB A;  2DG9 A;  5DIU A;  2DSV A;  4LAV A;  5HWC A;  3CHE A;  3EY6 A;  4O2T A;  4QT2 A;  1SR0 A;  4DWS B;  1Y0O A;  1J4H A;  3G6M A;  3OA5 A;  4MNK A;  3RM9 A;  1KT1 A;  3UQI A;  2ESC A;  2F21 A;  1ZL1 A;  1D2K A;  2ZQV A;  3O5F A;  1E6P A;  1EDQ A;  2PPO A;  4MNJ A;  2YBT A;  3ARR A;  3CH9 A;  3ARY A;  2AWG A;  4ODM A;  1LL7 A;  2DG3 A;  4ZPT R;  2ZQT A;  3ARZ A;  1PBK A;  3NI6 A;  5DO2 A;  2FDM A;  2M2A A;  1U79 A;  3ARU A;  1O6I A;  4P8U A;  4IPX A;  1E15 A;  3ARX A;  4MAV A;  1LG1 A;  1NMW A;  5DEZ A;  1FKH A;  3W4R A;  5GPR A;  4Z2K A;  3O5E A;  1JVW A;  4W5U A;  1XRV A;  3CGM A;  4Z2L A;  3I6C A;  1H0I A;  4Q7N A;  4DRM A;  4Z2G A;  3WQV A;  1C9H A;  3O5O A;  3KAD A;  4FN2 A;  1ZBW A;  3AS2 A;  1FJD A;  4URI A;  1ZB5 A;  4MNL A;  1F40 A;  4ZS6 A;  2DT0 A;  4MGV A;  1LG2 A;  2G41 A;  2G8Z A;  4ODR A;  4U85 A;  3RM4 A;  1TCO C;  3ARS A;  3H9R B;  2LJ4 A;  2LPV A;  3ARO A;  2AOS A;  1NWR A;  3ARW A;  4KQZ A;  1HKI A;  1FAP A;  4DZ3 A;  4AY1 A;  4TW8 A;  2XP5 A;  2XP7 A;  2DG4 A;  1A7X A;  4P8W A;  4ODQ A;  2XP9 A;  3WD4 A;  2RQS A;  1RD6 A;  4C02 B;  1HXV A;  1NMV A;  4J4N A;  1W9U A;  4TW7 A;  1N1A A;  3KCE A;  4DRO A;  4DIP A;  2Y78 A;  2A3C A;  2Q5A A;  1LJY A;  2UZ5 A;  1LL4 A;  5DIT A;  1L1P A;  1HJV A;  1WAW A;  2ZR5 A;  3JYJ A;  2K8I A;  4MSP A;  3PRD A;  1JNS A;  4QT3 A;  4DWS D;  2MF9 A;  3CHC A;  1BL4 A;  1LL6 A;  4G50 A;  4LGX A;  2O9O A;  3IKG A;  2PPN A;  2KO7 A;  4DRN A;  2DT2 A;  3ART A;  4L3N A;  5HW7 A;  4MNM A;  1E6N A;  3ALF A;  2A3B A;  3IKD A;  1M5Y A;  3O5R A;  3KZ7 A;  2KI3 A;  2ZQS A;  4TX0 A;  1FKT A;  1BKF A;  1HKK A;  4DRI A;  1KFW A;  2XPA A;  4TYO A;  4TW6 A;  3KAG A;  3WD1 A;  1FKF A;  2PBC A;  4U86 A;  5HT1 A;  5B8I C;  2VN1 A;  2DT3 A;  4DRK A;  1X6L A;  4ZPV R;  2XPB A;  3B7X A;  1UR8 A;  2PPP A;  4WKA A;  3UI5 A;  1FKK A;  4WJX A;  3G6L A;  4Z2I A;  3IK8 A;  5D75 A;  4GGQ A;  1NWU A;  4R0X A;  1FKJ A;  4NNR A;  3AS3 A;  3B8S A;  1SYT A;  4ODO A;  1KT0 A;  2DPE A;  1FKL A;  2RUD A;  1Q6U A;  3O5G A;  4U84 A;  3ARV A;  2FKE A;  1GUV A;  1OWQ A;  1NWS A;  1D7J A;  4IQC A;  1W26 A;  1Q1C A;  1E6R A;  3PRB A;  4Q22 A;  2PV1 A;  3AQU A;  1E6Z A;  1JND A;  1Q6H A;  2DSU A;  3ALG A;  5JH8 A;  1J4R A;  1T11 A;  3O5Q A;  2ITK A;  2OLH A;  1ZBC A;  1FFQ A;  4J4O A;  1J4I A;  3PR9 A;  3FY1 A;  2A3E A;  1B6C A;  2N87 A;  4P8V A;  2XP6 A;  4BF8 A;  2MLX A;  3NRK A;  4HBE A;  5DF0 A;  5HTG A;  1QPF A;  1FKG A;  3O5M A;  4G2P A;  4ITZ A;  3TC5 A;  1PIN A;  4W9O A;  4JFL A;  4IT6 A;  2RUR A;  4L72 B;  2WLZ A;  1H0G A;  4WKH A;  3WD0 A;  3O5D A;  3BXW A;  3KAH A;  2F2D A;  1ZK6 A;  4WK9 A;  3VAW A;  1FKI A;  1XHG A;  4R5E A;  1FKB A;  3B9A A;  4DWS C;  4W9Q A;  1OGG A;  3TDB A;  3UQA A;  2KE0 A;  1E9L A;  4DWS A;  1GPF A;  2PV3 A;  2ZR6 A;  2JZV A;  4GIV A;  4P8X A;  2WM0 A;  2MNT A;  4W9P A;  4ODL A;  5GPG A;  4JFK A;  2RUQ A;  3O5P A;  3WD2 A;  3MDY B;  3CHD A;  4S3K A;  3WD3 A;  2IF4 A;  3JYM A;  5HW8 A;  3NTP A;  1FD9 A;  3WIJ A;  4LAY A;  2O92 A;  2KR7 A;  1NH6 A;  1J6Y A;  3UQB A;  3RM8 A;  4DT4 A;  2IUZ A;  1Q6I A;  1W1P A;  3PRA A;  2M08 A;  3KAB A;  2ZQU A;  5DIV A;  1IX5 A;  5HUA A;  1OGB A;  2MPH A;  3WKZ A;  3O5K A;  1ROT A;  4Z2H A;  1W9P A;  2PV2 A;  4DRJ A;  4JFI A;  3O5I A;  2VCD A;  1P5Q A;  3PA7 A;  4ML4 A;  4ZPW R;  5HWB A;  3LUO A;  4MPK A;  4PTM A;  5I98 A;  4JFJ A;  1HKJ A;  5HKG A;  1ITX A;  1YW5 A;  2KGJ A;  2M1I A;  4HAR A;  3AS0 A;  5J6E A;  2RSE A;  3KAF A;  4NSB A;  1W1Y A;  3RGC A;  3RME A;  1F8A B;  5HW6 A;  2XP4 A;  2RUC A;  1FKD A;  4DRQ A;  3ARQ A;  4QZV B;  1D7I A;  1EIB A;  2OFN A;  1FFR A;  3FXY A;  4DZ2 A;  1UR9 A;  4NZC A;  3QOK A;  1WB0 A;  1D7H A;  2LKN A;  2XP8 A;  3O5J A;  4DH0 A;  1NSG A;  1W1V A;  1EYM A;  1HKM A;  3IHZ A;  2MLZ A;  2WK2 A;  3O5L A;  1GOI A;  3UF8 A;  1EHN A;  4JFM A;  1NWT A;  1R9H A;  1HJX A;  1YAT A;  2D9F A;  4HBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...