5HKGA

Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (fkbp12.6).
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
publication title Total chemical synthesis, refolding, and crystallographic structure of fully active immunophilin calstabin 2 (FKBP12.6).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hkgA00
2PV2A 3VAWA 1EQ3A 1A7XA 1FKBA 2M08A 2OFNA 2UZ5A 1TCOC 2MLXA 3IKDA 5J6EA 2XP6A 3KAIA 1NMVA 4G50A 3O5OA 1KT1A 2XPAA 4ODNA 4DIPA 5HW7A 3OOBA 3UQIA 2VN1A 3PA7A 3UF8A 3O5MA 1YATA 2KFWA 4O2TA 4QT2A 4JFJA 3O5RA 1PINA 3TCZA 4DRJA 3NI6A 2Y78A 3RGCA 3O5PA 5I98A 3UI6A 2ZQUA 1L1PA 4JFMA 1FKJA 2DG3A 5HT1A 1BKFA 4DRNA 3IK8A 3CGMA 4U85A 2DG4A 1D7JA 1P5QA 2RURA 4ODMA 4G2PA 2AWGA 2RUQA 4J4OA 3IKGA 4TW7A 1ROTA 2M1IA 4W9OA 1EYMA 1BL4A 2XP8A 3O5EA 1F40A 3KCEA 4MSPA 3PRDA 1B6CA 3UQAA 1YW5A 5HWBA 3NRKA 1J4HA 2LJ4A 3O5JA 4LAWA 1J4RA 3O5DA 3JYJA 5HW6A 3NTPA 1JNTA 4TYOA 5DIUA 2ZR6A 1FKKA 4J4NA 4N19A 1D7IA 3UI5A 4TW6A 3I6CA 3O5QA 5HWCA 3UQBA 3PRBA 4FN2A 5HUAA 4FAPA 2LPVA 3RFWA 2ZQVA 5DITA 1Q6UA 4DROA 2F2DA 4DRQA 4QT3A 4IQ2A 3WH0A 2VCDA 4JFKA 2ITKA 1FD9A 2F21A 2XP5A 4JFLA 3TC5A 1Q1CA 3JYMA 4JYSA 4LAXA 3UI4A 3FAPA 1FKDA 2ZQSA 3KAFA 4ODOA 4DT4A 5GPGA 4DRPA 3O5IA 5HKGA 4ODQA 4MGVA 5BXJA 1FKLA 1QZ2A 3O5GA 1FKTA 1F8AB 2RUCA 4DRIA 1D6OA 3MDYB 2ZQTA 1HXVA 1N1AA 1NSGA 3EY6A 4ODKA 2PPOA 5B8IC 1J4IA 2KE0A 1KT0A 4BF8A 2DG9A 4DRKA 2MLZA 2RSEA 1R9HA 3CGNA 4IPXA 3KAHA 1FKFA 3KZ7A 1J6YA 1QPFA 5HW8A 3LUOA 1FKRA 4U86A 1FKGA 5DIVA 2XP7A 2ZR5A 2MLYA 2K8IA 2LGOA 1FAPA 2PV3A 3H9RB 4GGQA 4TX0A 5D75A 4U84A 2KR7A 3B7XA 4DRMA 1ZK6A 1Y0OA 2MF9A 1JVWA 2FAPA 2D9FA 4DZ3A 2ZR4A 1ROUA 3IHZA 2Q5AA 1PBKA 2L2SA 2N87A 4ODRA 1U79A 1FKHA 2KI3A 3KADA 3O5KA 2IF4A 4JFIA 2MNTA 4DZ2A 1FJDA 1D7HA 1QPLA 4QIBA 4TW8A 3KABA 4W9QA 3GPKA 4TNSA 2FKEA 4GIVA 2PBCA 2JZVA 1FKIA 1T11A 2KGJA 4C02B 2RQSA 4ODPA 2XPBA 4IQCA 4W9PA 1M5YA 1Q6IA 4DRHA 1C9HA 4DH0A 4ODLA 3ODKA 3JXVA 2XP3A 4LAYA 2F4EA 3KACA 4LAVA 1JNSA 1W26A 3O5LA 1NMWA 2XP9A 3TDBA 2KO7A 2MPHA 3KAGA 4ITZA 4NNRA 3O5FA 1FKSA 2PPPA 2M2AA 4R0XA 5HTGA 1ZCNA 1Q6HA 2PPNA 2RUDA 2LKNA 2XP4A 2PV1A
chains in the Genus database with same CATH superfamily
3VAWA 1E6RA 2AOSA 5J6EA 4G50A 3O5OA 4S3KA 5HBFA 4DIPA 4MNLA 1LL4A 3UQIA 3UF8A 3O5MA 3OA5A 4O2TA 4DRJA 1O6IA 1E15A 3UI6A 1FKJA 2P4VA 3PRAA 4DRNA 4TW7A 4W9OA 1F40A 4XAKA 2QF8A 3WD4A 4Q22A 1ITXA 1J4HA 2LJ4A 3O5JA 4LAWA 4NZCA 1JNTA 3BMBA 3AS0A 4DWSB 3WQVA 1W1VA 3ALGA 1W1PA 2LPVA 1HJVA 1Q6UA 4DRQA 3ARSA 4QT3A 2VCDA 4JFKA 4JFLA 3WL1A 3UI4A 1UR8A 3FAPA 4ODOA 4DT4A 3ARWA 4Z2HA 5BXJA 3BXWA 1QZ2A 2ZQTA 4HBEA 1N1AA 5B8IC 2A3AA 1J4IA 4WKAA 1KT0A 1HJWA 1NWRA 1H0IA 2RSEA 4PTMA 2YBTA 3CGNA 3KZ7A 1J6YA 1FKGA 2ZR5A 2MLYA 3ARYA 2LGOA 1FAPA 3B7XA 4AY1A 1JVWA 1HKKA 2DT0A 2D9FA 2FAPA 4DZ3A 2ZR4A 1ROUA 2EULA 1OGBA 1U79A 1FKHA 1IX5A 4JFIA 2MNTA 4DZ2A 3GTYX 4W9QA 1E6PA 4Z2KA 2JZVA 1FKIA 2RQSA 3PR9A 4W9PA 4IQCA 1M5YA 1JNDA 1C9HA 4ML4A 2XP3A 3ARUA 3ARTA 1ZBVA 3ARRA 1JNSA 1ZBKA 3TDBA 4NNRA 2M2AA 1HJXA 1EHNA 1ZCNA 2DSZA 4IT6A 4JYSA 5HW6A 4P8VA 1E6NA 3G6LA 1NH6A 1EQ3A 1FKBA 2ESCA 3IKDA 3WQWA 1HKIA 3KAIA 1NMVA 1W9VA 2WLYA 1ZL1A 1CTNA 3RM8A 4W5UA 1LQ0A 4QT2A 3O5RA 1PINA 3NI6A 2Y78A 3W4RA 5I98A 2ZQUA 1W9PA 4JFMA 5HT1A 1BKFA 1XRVA 1FFQA 3ARXA 1D7JA 4IT4A 4J4OA 3WD0A 1EYMA 1BL4A 3FXYA 1W1TA 2DSVA 4MSPA 3PRDA 1B6CA 1HKMA 3UQAA 3ARZA 2A3BA 3ALFA 1J4RA 3O5DA 4ZS6A 1ZU8A 2ZR6A 5HWCA 4TW6A 4FN2A 1E44A 5DITA 3CHDA 3WH0A 1SR0A 4IQ2A 2ITKA 3TC5A 2F21A 3JYMA 1FKDA 3WKZA 4ZPWR 5GPGA 3GU0A 3AS2A 1E9LA 4Z2GA 3O5GA 4DRIA 1HXVA 3EY6A 4ODKA 4MPKA 2DG9A 2MLZA 4ZPTR 1QPFA 4LGXA 5HW8A 1GOIA 1WB0A 4TX0A 2O92A 4U84A 4DRMA 1Y0OA 3IHZA 2Q5AA 3WL0A 2KI3A 1XHGA 4Q7NA 1GPFA 4TNSA 2PBCA 1T11A 1X6LA 2KGJA 4KR0B 4Z2JA 3ODKA 1UR9A 3JXVA 4LAVA 1VF8A 4NSBA 4Z2IA 3KAGA 3O5FA 2PPPA 2ETNA 1LG1A 1Q6HA 3B9DA 2PPNA 4P8XA 2PV1A 2G8ZA 1A7XA 1TCOC 2XP6A 3ARPA 4MNJA 1KT1A 4WKFA 5DEZA 3CH9A 1WAWA 4JFJA 4MTVA 1JNEA 3TCZA 3RGCA 3O5PA 4DWSA 2DT1A 1WNOA 4L3NA 2OLHA 1P5QA 2AWGA 1ZB5A 2RUQA 3IKGA 1K9TA 1EIBA 2O9OA 3KCEA 1YW5A 5GQBA 5HWBA 3NRKA 4P8WA 1LL6A 4DWSC 5DIUA 1FKKA 4N19A 1D7IA 1JCHB 1E6ZA 3I6CA 3O5QA 3UQBA 5HUAA 3RFWA 4DROA 2DT3A 2F2DA 1GUVA 1FD9A 1NWSA 3KAFA 3QOKA 4DRPA 2WM0A 5GPRA 2FDMA 3O5IA 5HKGA 4ODQA 4MGVA 1FKTA 1F8AB 2RUCA 1D6OA 4L72B 3WD3A 1NWTA 1NSGA 2PPOA 3WD1A 1TFVA 4MNMA 1LJYA 4IPXA 1FKFA 2F23A 1W9UA 1FKRA 2XP7A 1EDQA 2K8IA 4MNKA 2A3EA 3H9RB 1ZK6A 2B5UB 1PBKA 1NWUA 2N87A 1X6NA 3KADA 3O5KA 2DPEA 2IF4A 4TW8A 4WIWA 1LG2A 2FKEA 4GIVA 3AROA 3RM4A 5DF0A 4C02B 4KQZA 4ODPA 4DRHA 2YBUA 1ZBCA 2WK2A 1KFWA 4DH0A 4LAYA 2PN0A 4Z2LA 3EIPA 3O5LA 1NMWA 2XP9A 1OWQA 2KO7A 3B9AA 4ITZA 3FY1A 4ZPVR 5HTGA 2LKNA 2XP4A 2PV2A 2M08A 2OFNA 2UZ5A 4HARA 2MLXA 5DO2A 4ODNA 2XPAA 4S3JA 5HW7A 3ARQA 3OOBA 5JH8A 2VN1A 3RMEA 3PA7A 1YATA 2KFWA 1D2KA 4URIA 4MAVA 1L1PA 3AQUA 2DG3A 3WD2A 3IK8A 3CGMA 4U85A 3ARVA 2DG4A 2RURA 4ODMA 4G2PA 1ZBWA 1ROTA 1LL7A 2M1IA 4HBOA 2XP8A 3O5EA 2B31A 1OGGA 3B8SA 3CHCA 3AS1A 1W1YA 4DWSD 3JYJA 3NTPA 4TYOA 3UI5A 4J4NA 2DSWA 3G6MA 3PRBA 4FAPA 2ZQVA 4R5EA 2XP5A 3CHEA 1Q1CA 4LAXA 2ZQSA 2WLZA 1FKLA 2G41A 1RD6A 3MDYB 1GRJA 4QZVB 1FFRA 2KE0A 4BF8A 4DRKA 2DT2A 1R9HA 2PI6A 3B9EA 3KAHA 2DSUA 3LUOA 4U86A 5DIVA 3CHFA 4UDMA 2PV3A 4GGQA 5D75A 2KR7A 4P8UA 2MF9A 3WIJA 2IUZA 2L2SA 1H0GA 4ODRA 4WK9A 1FJDA 1D7HA 1SYTA 1QPLA 4QIBA 3KABA 3GPKA 1HKJA 3AS3A 2A3CA 4WKHA 2XPBA 1Q6IA 4ODLA 3RM9A 2F4EA 3KACA 1W26A 2MPHA 1FKSA 4R0XA 4WJXA 3CZ8A 2RUDA
chains in the Genus database with same CATH topology
3VAWA 1E6RA 2AOSA 5J6EA 4G50A 3O5OA 4S3KA 5HBFA 4DIPA 4MNLA 1LL4A 3UQIA 3UF8A 3O5MA 3OA5A 4O2TA 4DRJA 1O6IA 1E15A 3UI6A 1FKJA 3PRAA 4DRNA 4TW7A 4W9OA 1F40A 4XAKA 2QF8A 3WD4A 4Q22A 1ITXA 1J4HA 2LJ4A 3O5JA 4LAWA 4NZCA 1JNTA 3AS0A 4DWSB 3WQVA 1W1VA 3ALGA 1W1PA 2LPVA 1HJVA 1Q6UA 4DRQA 3ARSA 4QT3A 2VCDA 4JFKA 4JFLA 3WL1A 3UI4A 1UR8A 3FAPA 4ODOA 4DT4A 3ARWA 4Z2HA 5BXJA 3BXWA 1QZ2A 2ZQTA 4HBEA 1N1AA 5B8IC 2A3AA 1J4IA 4WKAA 1KT0A 1HJWA 1NWRA 1H0IA 2RSEA 4PTMA 2YBTA 3CGNA 3KZ7A 1J6YA 1FKGA 2ZR5A 2MLYA 3ARYA 2LGOA 1FAPA 3B7XA 4AY1A 1JVWA 1HKKA 2DT0A 2D9FA 2FAPA 4DZ3A 2ZR4A 1ROUA 1OGBA 1U79A 1FKHA 1IX5A 4JFIA 2MNTA 4DZ2A 4W9QA 1E6PA 4Z2KA 2JZVA 1FKIA 2RQSA 3PR9A 4W9PA 4IQCA 1M5YA 1JNDA 1C9HA 4ML4A 2XP3A 3ARUA 3ARTA 1ZBVA 3ARRA 1JNSA 1ZBKA 3TDBA 4NNRA 2M2AA 1HJXA 1EHNA 1ZCNA 2DSZA 4IT6A 4JYSA 5HW6A 4P8VA 1E6NA 3G6LA 1NH6A 1EQ3A 1FKBA 2ESCA 3IKDA 3WQWA 1HKIA 3KAIA 1NMVA 1W9VA 2WLYA 1ZL1A 1CTNA 3RM8A 4W5UA 1LQ0A 4QT2A 3O5RA 1PINA 3NI6A 2Y78A 3W4RA 5I98A 2ZQUA 1W9PA 4JFMA 5HT1A 1BKFA 1XRVA 1FFQA 3ARXA 1D7JA 4IT4A 4J4OA 3WD0A 1EYMA 1BL4A 3FXYA 1W1TA 2DSVA 4MSPA 3PRDA 1B6CA 1HKMA 3UQAA 3ARZA 2A3BA 3ALFA 1J4RA 3O5DA 4ZS6A 1ZU8A 2ZR6A 5HWCA 4TW6A 4FN2A 5DITA 3CHDA 3WH0A 1SR0A 4IQ2A 2ITKA 3TC5A 2F21A 3JYMA 1FKDA 3WKZA 4ZPWR 5GPGA 3AS2A 1E9LA 4Z2GA 3O5GA 4DRIA 1HXVA 3EY6A 4ODKA 4MPKA 2DG9A 2MLZA 4ZPTR 1QPFA 4LGXA 5HW8A 1GOIA 1WB0A 4TX0A 2O92A 4U84A 4DRMA 1Y0OA 3IHZA 2Q5AA 3WL0A 2KI3A 1XHGA 4Q7NA 1GPFA 4TNSA 2PBCA 1T11A 1X6LA 2KGJA 4KR0B 4Z2JA 3ODKA 1UR9A 3JXVA 4LAVA 1VF8A 4NSBA 4Z2IA 3KAGA 3O5FA 2PPPA 1LG1A 1Q6HA 3B9DA 2PPNA 4P8XA 2PV1A 2G8ZA 1A7XA 1TCOC 2XP6A 3ARPA 4MNJA 1KT1A 4WKFA 5DEZA 3CH9A 1WAWA 4JFJA 4MTVA 1JNEA 3TCZA 3RGCA 3O5PA 4DWSA 2DT1A 1WNOA 4L3NA 2OLHA 1P5QA 2AWGA 1ZB5A 2RUQA 3IKGA 1K9TA 1EIBA 2O9OA 3KCEA 1YW5A 5GQBA 5HWBA 3NRKA 4P8WA 1LL6A 4DWSC 5DIUA 1FKKA 4N19A 1D7IA 3UQBA 1E6ZA 3I6CA 3O5QA 5HUAA 3RFWA 4DROA 2DT3A 2F2DA 1GUVA 1FD9A 1NWSA 3KAFA 3QOKA 4DRPA 2WM0A 5GPRA 2FDMA 3O5IA 5HKGA 4ODQA 4MGVA 1FKTA 1F8AB 2RUCA 1D6OA 4L72B 3WD3A 1NWTA 1NSGA 2PPOA 3WD1A 1TFVA 4MNMA 1LJYA 4IPXA 1FKFA 1W9UA 1FKRA 2XP7A 1EDQA 2K8IA 4MNKA 2A3EA 3H9RB 1ZK6A 1PBKA 1NWUA 2N87A 1X6NA 3KADA 3O5KA 2DPEA 2IF4A 4TW8A 4WIWA 1LG2A 2FKEA 4GIVA 3AROA 3RM4A 5DF0A 4C02B 4KQZA 4ODPA 4DRHA 2YBUA 1ZBCA 2WK2A 1KFWA 4DH0A 4LAYA 4Z2LA 3O5LA 1NMWA 2XP9A 1OWQA 2KO7A 3B9AA 4ITZA 3FY1A 4ZPVR 5HTGA 2LKNA 2XP4A 2PV2A 2M08A 2OFNA 2UZ5A 4HARA 2MLXA 5DO2A 4ODNA 2XPAA 4S3JA 5HW7A 3ARQA 3OOBA 5JH8A 2VN1A 3RMEA 3PA7A 1YATA 2KFWA 1D2KA 4URIA 4MAVA 1L1PA 3AQUA 2DG3A 3WD2A 3IK8A 3CGMA 4U85A 3ARVA 2DG4A 2RURA 4ODMA 4G2PA 1ZBWA 1ROTA 1LL7A 2M1IA 4HBOA 2XP8A 3O5EA 2B31A 1OGGA 3B8SA 3CHCA 3AS1A 1W1YA 4DWSD 3JYJA 3NTPA 4TYOA 3UI5A 4J4NA 2DSWA 3G6MA 3PRBA 4FAPA 2ZQVA 4R5EA 2XP5A 3CHEA 1Q1CA 4LAXA 2ZQSA 2WLZA 1FKLA 2G41A 1RD6A 3MDYB 4QZVB 1FFRA 2KE0A 4BF8A 4DRKA 2DT2A 1R9HA 2PI6A 3B9EA 3KAHA 2DSUA 3LUOA 4U86A 5DIVA 3CHFA 2PV3A 4GGQA 5D75A 2KR7A 4P8UA 2MF9A 3WIJA 2IUZA 2L2SA 1H0GA 4ODRA 4WK9A 1FJDA 1D7HA 1SYTA 1QPLA 4QIBA 3KABA 3GPKA 1HKJA 3AS3A 2A3CA 4WKHA 2XPBA 1Q6IA 4ODLA 3RM9A 2F4EA 3KACA 1W26A 2MPHA 1FKSA 4R0XA 4WJXA 3CZ8A 2RUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  3VAW A;  1EQ3 A;  1A7X A;  1FKB A;  2M08 A;  2OFN A;  2UZ5 A;  1TCO C;  2MLX A;  3IKD A;  5J6E A;  2XP6 A;  3KAI A;  1NMV A;  4G50 A;  3O5O A;  1KT1 A;  2XPA A;  4ODN A;  4DIP A;  5HW7 A;  3OOB A;  3UQI A;  2VN1 A;  3PA7 A;  3UF8 A;  3O5M A;  1YAT A;  2KFW A;  4O2T A;  4QT2 A;  4JFJ A;  3O5R A;  1PIN A;  3TCZ A;  4DRJ A;  3NI6 A;  2Y78 A;  3RGC A;  3O5P A;  5I98 A;  3UI6 A;  2ZQU A;  1L1P A;  4JFM A;  1FKJ A;  2DG3 A;  5HT1 A;  1BKF A;  4DRN A;  3IK8 A;  3CGM A;  4U85 A;  2DG4 A;  1D7J A;  1P5Q A;  2RUR A;  4ODM A;  4G2P A;  2AWG A;  2RUQ A;  4J4O A;  3IKG A;  4TW7 A;  1ROT A;  2M1I A;  4W9O A;  1EYM A;  1BL4 A;  2XP8 A;  3O5E A;  1F40 A;  3KCE A;  4MSP A;  3PRD A;  1B6C A;  3UQA A;  1YW5 A;  5HWB A;  3NRK A;  1J4H A;  2LJ4 A;  3O5J A;  4LAW A;  1J4R A;  3O5D A;  3JYJ A;  5HW6 A;  3NTP A;  1JNT A;  4TYO A;  5DIU A;  2ZR6 A;  1FKK A;  4J4N A;  4N19 A;  1D7I A;  3UI5 A;  4TW6 A;  3I6C A;  3O5Q A;  5HWC A;  3UQB A;  3PRB A;  4FN2 A;  5HUA A;  4FAP A;  2LPV A;  3RFW A;  2ZQV A;  5DIT A;  1Q6U A;  4DRO A;  2F2D A;  4DRQ A;  4QT3 A;  4IQ2 A;  3WH0 A;  2VCD A;  4JFK A;  2ITK A;  1FD9 A;  2F21 A;  2XP5 A;  4JFL A;  3TC5 A;  1Q1C A;  3JYM A;  4JYS A;  4LAX A;  3UI4 A;  3FAP A;  1FKD A;  2ZQS A;  3KAF A;  4ODO A;  4DT4 A;  5GPG A;  4DRP A;  3O5I A;  5HKG A;  4ODQ A;  4MGV A;  5BXJ A;  1FKL A;  1QZ2 A;  3O5G A;  1FKT A;  1F8A B;  2RUC A;  4DRI A;  1D6O A;  3MDY B;  2ZQT A;  1HXV A;  1N1A A;  1NSG A;  3EY6 A;  4ODK A;  2PPO A;  5B8I C;  1J4I A;  2KE0 A;  1KT0 A;  4BF8 A;  2DG9 A;  4DRK A;  2MLZ A;  2RSE A;  1R9H A;  3CGN A;  4IPX A;  3KAH A;  1FKF A;  3KZ7 A;  1J6Y A;  1QPF A;  5HW8 A;  3LUO A;  1FKR A;  4U86 A;  1FKG A;  5DIV A;  2XP7 A;  2ZR5 A;  2MLY A;  2K8I A;  2LGO A;  1FAP A;  2PV3 A;  3H9R B;  4GGQ A;  4TX0 A;  5D75 A;  4U84 A;  2KR7 A;  3B7X A;  4DRM A;  1ZK6 A;  1Y0O A;  2MF9 A;  1JVW A;  2FAP A;  2D9F A;  4DZ3 A;  2ZR4 A;  1ROU A;  3IHZ A;  2Q5A A;  1PBK A;  2L2S A;  2N87 A;  4ODR A;  1U79 A;  1FKH A;  2KI3 A;  3KAD A;  3O5K A;  2IF4 A;  4JFI A;  2MNT A;  4DZ2 A;  1FJD A;  1D7H A;  1QPL A;  4QIB A;  4TW8 A;  3KAB A;  4W9Q A;  3GPK A;  4TNS A;  2FKE A;  4GIV A;  2PBC A;  2JZV A;  1FKI A;  1T11 A;  2KGJ A;  4C02 B;  2RQS A;  4ODP A;  2XPB A;  4IQC A;  4W9P A;  1M5Y A;  1Q6I A;  4DRH A;  1C9H A;  4DH0 A;  4ODL A;  3ODK A;  3JXV A;  2XP3 A;  4LAY A;  2F4E A;  3KAC A;  4LAV A;  1JNS A;  1W26 A;  3O5L A;  1NMW A;  2XP9 A;  3TDB A;  2KO7 A;  2MPH A;  3KAG A;  4ITZ A;  4NNR A;  3O5F A;  1FKS A;  2PPP A;  2M2A A;  4R0X A;  5HTG A;  1ZCN A;  1Q6H A;  2PPN A;  2RUD A;  2LKN A;  2XP4 A;  2PV1 A; 
#chains in the Genus database with same CATH topology
 3VAW A;  1E6R A;  2AOS A;  5J6E A;  4G50 A;  3O5O A;  4S3K A;  5HBF A;  4DIP A;  4MNL A;  1LL4 A;  3UQI A;  3UF8 A;  3O5M A;  3OA5 A;  4O2T A;  4DRJ A;  1O6I A;  1E15 A;  3UI6 A;  1FKJ A;  2P4V A;  3PRA A;  4DRN A;  4TW7 A;  4W9O A;  1F40 A;  4XAK A;  2QF8 A;  3WD4 A;  4Q22 A;  1ITX A;  1J4H A;  2LJ4 A;  3O5J A;  4LAW A;  4NZC A;  1JNT A;  3BMB A;  3AS0 A;  4DWS B;  3WQV A;  1W1V A;  3ALG A;  1W1P A;  2LPV A;  1HJV A;  1Q6U A;  4DRQ A;  3ARS A;  4QT3 A;  2VCD A;  4JFK A;  4JFL A;  3WL1 A;  3UI4 A;  1UR8 A;  3FAP A;  4ODO A;  4DT4 A;  3ARW A;  4Z2H A;  5BXJ A;  3BXW A;  1QZ2 A;  2ZQT A;  4HBE A;  1N1A A;  5B8I C;  2A3A A;  1J4I A;  4WKA A;  1KT0 A;  1HJW A;  1NWR A;  1H0I A;  2RSE A;  4PTM A;  2YBT A;  3CGN A;  3KZ7 A;  1J6Y A;  1FKG A;  2ZR5 A;  2MLY A;  3ARY A;  2LGO A;  1FAP A;  3B7X A;  4AY1 A;  1JVW A;  1HKK A;  2DT0 A;  2D9F A;  2FAP A;  4DZ3 A;  2ZR4 A;  1ROU A;  2EUL A;  1OGB A;  1U79 A;  1FKH A;  1IX5 A;  4JFI A;  2MNT A;  4DZ2 A;  3GTY X;  4W9Q A;  1E6P A;  4Z2K A;  2JZV A;  1FKI A;  2RQS A;  3PR9 A;  4W9P A;  4IQC A;  1M5Y A;  1JND A;  1C9H A;  4ML4 A;  2XP3 A;  3ARU A;  3ART A;  1ZBV A;  3ARR A;  1JNS A;  1ZBK A;  3TDB A;  4NNR A;  2M2A A;  1HJX A;  1EHN A;  1ZCN A;  2DSZ A;  4IT6 A;  4JYS A;  5HW6 A;  4P8V A;  1E6N A;  3G6L A;  1NH6 A;  1EQ3 A;  1FKB A;  2ESC A;  3IKD A;  3WQW A;  1HKI A;  3KAI A;  1NMV A;  1W9V A;  2WLY A;  1ZL1 A;  1CTN A;  3RM8 A;  4W5U A;  1LQ0 A;  4QT2 A;  3O5R A;  1PIN A;  3NI6 A;  2Y78 A;  3W4R A;  5I98 A;  2ZQU A;  1W9P A;  4JFM A;  5HT1 A;  1BKF A;  1XRV A;  1FFQ A;  3ARX A;  1D7J A;  4IT4 A;  4J4O A;  3WD0 A;  1EYM A;  1BL4 A;  3FXY A;  1W1T A;  2DSV A;  4MSP A;  3PRD A;  1B6C A;  1HKM A;  3UQA A;  3ARZ A;  2A3B A;  3ALF A;  1J4R A;  3O5D A;  4ZS6 A;  1ZU8 A;  2ZR6 A;  5HWC A;  4TW6 A;  4FN2 A;  1E44 A;  5DIT A;  3CHD A;  3WH0 A;  1SR0 A;  4IQ2 A;  2ITK A;  3TC5 A;  2F21 A;  3JYM A;  1FKD A;  3WKZ A;  4ZPW R;  5GPG A;  3GU0 A;  3AS2 A;  1E9L A;  4Z2G A;  3O5G A;  4DRI A;  1HXV A;  3EY6 A;  4ODK A;  4MPK A;  2DG9 A;  2MLZ A;  4ZPT R;  1QPF A;  4LGX A;  5HW8 A;  1GOI A;  1WB0 A;  4TX0 A;  2O92 A;  4U84 A;  4DRM A;  1Y0O A;  3IHZ A;  2Q5A A;  3WL0 A;  2KI3 A;  1XHG A;  4Q7N A;  1GPF A;  4TNS A;  2PBC A;  1T11 A;  1X6L A;  2KGJ A;  4KR0 B;  4Z2J A;  3ODK A;  1UR9 A;  3JXV A;  4LAV A;  1VF8 A;  4NSB A;  4Z2I A;  3KAG A;  3O5F A;  2PPP A;  2ETN A;  1LG1 A;  1Q6H A;  3B9D A;  2PPN A;  4P8X A;  2PV1 A;  2G8Z A;  1A7X A;  1TCO C;  2XP6 A;  3ARP A;  4MNJ A;  1KT1 A;  4WKF A;  5DEZ A;  3CH9 A;  1WAW A;  4JFJ A;  4MTV A;  1JNE A;  3TCZ A;  3RGC A;  3O5P A;  4DWS A;  2DT1 A;  1WNO A;  4L3N A;  2OLH A;  1P5Q A;  2AWG A;  1ZB5 A;  2RUQ A;  3IKG A;  1K9T A;  1EIB A;  2O9O A;  3KCE A;  1YW5 A;  5GQB A;  5HWB A;  3NRK A;  4P8W A;  1LL6 A;  4DWS C;  5DIU A;  1FKK A;  4N19 A;  1D7I A;  1JCH B;  1E6Z A;  3I6C A;  3O5Q A;  3UQB A;  5HUA A;  3RFW A;  4DRO A;  2DT3 A;  2F2D A;  1GUV A;  1FD9 A;  1NWS A;  3KAF A;  3QOK A;  4DRP A;  2WM0 A;  5GPR A;  2FDM A;  3O5I A;  5HKG A;  4ODQ A;  4MGV A;  1FKT A;  1F8A B;  2RUC A;  1D6O A;  4L72 B;  3WD3 A;  1NWT A;  1NSG A;  2PPO A;  3WD1 A;  1TFV A;  4MNM A;  1LJY A;  4IPX A;  1FKF A;  2F23 A;  1W9U A;  1FKR A;  2XP7 A;  1EDQ A;  2K8I A;  4MNK A;  2A3E A;  3H9R B;  1ZK6 A;  2B5U B;  1PBK A;  1NWU A;  2N87 A;  1X6N A;  3KAD A;  3O5K A;  2DPE A;  2IF4 A;  4TW8 A;  4WIW A;  1LG2 A;  2FKE A;  4GIV A;  3ARO A;  3RM4 A;  5DF0 A;  4C02 B;  4KQZ A;  4ODP A;  4DRH A;  2YBU A;  1ZBC A;  2WK2 A;  1KFW A;  4DH0 A;  4LAY A;  2PN0 A;  4Z2L A;  3EIP A;  3O5L A;  1NMW A;  2XP9 A;  1OWQ A;  2KO7 A;  3B9A A;  4ITZ A;  3FY1 A;  4ZPV R;  5HTG A;  2LKN A;  2XP4 A;  2PV2 A;  2M08 A;  2OFN A;  2UZ5 A;  4HAR A;  2MLX A;  5DO2 A;  4ODN A;  2XPA A;  4S3J A;  5HW7 A;  3ARQ A;  3OOB A;  5JH8 A;  2VN1 A;  3RME A;  3PA7 A;  1YAT A;  2KFW A;  1D2K A;  4URI A;  4MAV A;  1L1P A;  3AQU A;  2DG3 A;  3WD2 A;  3IK8 A;  3CGM A;  4U85 A;  3ARV A;  2DG4 A;  2RUR A;  4ODM A;  4G2P A;  1ZBW A;  1ROT A;  1LL7 A;  2M1I A;  4HBO A;  2XP8 A;  3O5E A;  2B31 A;  1OGG A;  3B8S A;  3CHC A;  3AS1 A;  1W1Y A;  4DWS D;  3JYJ A;  3NTP A;  4TYO A;  3UI5 A;  4J4N A;  2DSW A;  3G6M A;  3PRB A;  4FAP A;  2ZQV A;  4R5E A;  2XP5 A;  3CHE A;  1Q1C A;  4LAX A;  2ZQS A;  2WLZ A;  1FKL A;  2G41 A;  1RD6 A;  3MDY B;  1GRJ A;  4QZV B;  1FFR A;  2KE0 A;  4BF8 A;  4DRK A;  2DT2 A;  1R9H A;  2PI6 A;  3B9E A;  3KAH A;  2DSU A;  3LUO A;  4U86 A;  5DIV A;  3CHF A;  4UDM A;  2PV3 A;  4GGQ A;  5D75 A;  2KR7 A;  4P8U A;  2MF9 A;  3WIJ A;  2IUZ A;  2L2S A;  1H0G A;  4ODR A;  4WK9 A;  1FJD A;  1D7H A;  1SYT A;  1QPL A;  4QIB A;  3KAB A;  3GPK A;  1HKJ A;  3AS3 A;  2A3C A;  4WKH A;  2XPB A;  1Q6I A;  4ODL A;  3RM9 A;  2F4E A;  3KAC A;  1W26 A;  2MPH A;  1FKS A;  4R0X A;  4WJX A;  3CZ8 A;  2RUD A; 
#chains in the Genus database with same CATH homology
 3VAW A;  1E6R A;  2AOS A;  5J6E A;  4G50 A;  3O5O A;  4S3K A;  5HBF A;  4DIP A;  4MNL A;  1LL4 A;  3UQI A;  3UF8 A;  3O5M A;  3OA5 A;  4O2T A;  4DRJ A;  1O6I A;  1E15 A;  3UI6 A;  1FKJ A;  3PRA A;  4DRN A;  4TW7 A;  4W9O A;  1F40 A;  4XAK A;  2QF8 A;  3WD4 A;  4Q22 A;  1ITX A;  1J4H A;  2LJ4 A;  3O5J A;  4LAW A;  4NZC A;  1JNT A;  3AS0 A;  4DWS B;  3WQV A;  1W1V A;  3ALG A;  1W1P A;  2LPV A;  1HJV A;  1Q6U A;  4DRQ A;  3ARS A;  4QT3 A;  2VCD A;  4JFK A;  4JFL A;  3WL1 A;  3UI4 A;  1UR8 A;  3FAP A;  4ODO A;  4DT4 A;  3ARW A;  4Z2H A;  5BXJ A;  3BXW A;  1QZ2 A;  2ZQT A;  4HBE A;  1N1A A;  5B8I C;  2A3A A;  1J4I A;  4WKA A;  1KT0 A;  1HJW A;  1NWR A;  1H0I A;  2RSE A;  4PTM A;  2YBT A;  3CGN A;  3KZ7 A;  1J6Y A;  1FKG A;  2ZR5 A;  2MLY A;  3ARY A;  2LGO A;  1FAP A;  3B7X A;  4AY1 A;  1JVW A;  1HKK A;  2DT0 A;  2D9F A;  2FAP A;  4DZ3 A;  2ZR4 A;  1ROU A;  1OGB A;  1U79 A;  1FKH A;  1IX5 A;  4JFI A;  2MNT A;  4DZ2 A;  4W9Q A;  1E6P A;  4Z2K A;  2JZV A;  1FKI A;  2RQS A;  3PR9 A;  4W9P A;  4IQC A;  1M5Y A;  1JND A;  1C9H A;  4ML4 A;  2XP3 A;  3ARU A;  3ART A;  1ZBV A;  3ARR A;  1JNS A;  1ZBK A;  3TDB A;  4NNR A;  2M2A A;  1HJX A;  1EHN A;  1ZCN A;  2DSZ A;  4IT6 A;  4JYS A;  5HW6 A;  4P8V A;  1E6N A;  3G6L A;  1NH6 A;  1EQ3 A;  1FKB A;  2ESC A;  3IKD A;  3WQW A;  1HKI A;  3KAI A;  1NMV A;  1W9V A;  2WLY A;  1ZL1 A;  1CTN A;  3RM8 A;  4W5U A;  1LQ0 A;  4QT2 A;  3O5R A;  1PIN A;  3NI6 A;  2Y78 A;  3W4R A;  5I98 A;  2ZQU A;  1W9P A;  4JFM A;  5HT1 A;  1BKF A;  1XRV A;  1FFQ A;  3ARX A;  1D7J A;  4IT4 A;  4J4O A;  3WD0 A;  1EYM A;  1BL4 A;  3FXY A;  1W1T A;  2DSV A;  4MSP A;  3PRD A;  1B6C A;  1HKM A;  3UQA A;  3ARZ A;  2A3B A;  3ALF A;  1J4R A;  3O5D A;  4ZS6 A;  1ZU8 A;  2ZR6 A;  5HWC A;  4TW6 A;  4FN2 A;  5DIT A;  3CHD A;  3WH0 A;  1SR0 A;  4IQ2 A;  2ITK A;  3TC5 A;  2F21 A;  3JYM A;  1FKD A;  3WKZ A;  4ZPW R;  5GPG A;  3AS2 A;  1E9L A;  4Z2G A;  3O5G A;  4DRI A;  1HXV A;  3EY6 A;  4ODK A;  4MPK A;  2DG9 A;  2MLZ A;  4ZPT R;  1QPF A;  4LGX A;  5HW8 A;  1GOI A;  1WB0 A;  4TX0 A;  2O92 A;  4U84 A;  4DRM A;  1Y0O A;  3IHZ A;  2Q5A A;  3WL0 A;  2KI3 A;  1XHG A;  4Q7N A;  1GPF A;  4TNS A;  2PBC A;  1T11 A;  1X6L A;  2KGJ A;  4KR0 B;  4Z2J A;  3ODK A;  1UR9 A;  3JXV A;  4LAV A;  1VF8 A;  4NSB A;  4Z2I A;  3KAG A;  3O5F A;  2PPP A;  1LG1 A;  1Q6H A;  3B9D A;  2PPN A;  4P8X A;  2PV1 A;  2G8Z A;  1A7X A;  1TCO C;  2XP6 A;  3ARP A;  4MNJ A;  1KT1 A;  4WKF A;  5DEZ A;  3CH9 A;  1WAW A;  4JFJ A;  4MTV A;  1JNE A;  3TCZ A;  3RGC A;  3O5P A;  4DWS A;  2DT1 A;  1WNO A;  4L3N A;  2OLH A;  1P5Q A;  2AWG A;  1ZB5 A;  2RUQ A;  3IKG A;  1K9T A;  1EIB A;  2O9O A;  3KCE A;  1YW5 A;  5GQB A;  5HWB A;  3NRK A;  4P8W A;  1LL6 A;  4DWS C;  5DIU A;  1FKK A;  4N19 A;  1D7I A;  3UQB A;  1E6Z A;  3I6C A;  3O5Q A;  5HUA A;  3RFW A;  4DRO A;  2DT3 A;  2F2D A;  1GUV A;  1FD9 A;  1NWS A;  3KAF A;  3QOK A;  4DRP A;  2WM0 A;  5GPR A;  2FDM A;  3O5I A;  5HKG A;  4ODQ A;  4MGV A;  1FKT A;  1F8A B;  2RUC A;  1D6O A;  4L72 B;  3WD3 A;  1NWT A;  1NSG A;  2PPO A;  3WD1 A;  1TFV A;  4MNM A;  1LJY A;  4IPX A;  1FKF A;  1W9U A;  1FKR A;  2XP7 A;  1EDQ A;  2K8I A;  4MNK A;  2A3E A;  3H9R B;  1ZK6 A;  1PBK A;  1NWU A;  2N87 A;  1X6N A;  3KAD A;  3O5K A;  2DPE A;  2IF4 A;  4TW8 A;  4WIW A;  1LG2 A;  2FKE A;  4GIV A;  3ARO A;  3RM4 A;  5DF0 A;  4C02 B;  4KQZ A;  4ODP A;  4DRH A;  2YBU A;  1ZBC A;  2WK2 A;  1KFW A;  4DH0 A;  4LAY A;  4Z2L A;  3O5L A;  1NMW A;  2XP9 A;  1OWQ A;  2KO7 A;  3B9A A;  4ITZ A;  3FY1 A;  4ZPV R;  5HTG A;  2LKN A;  2XP4 A;  2PV2 A;  2M08 A;  2OFN A;  2UZ5 A;  4HAR A;  2MLX A;  5DO2 A;  4ODN A;  2XPA A;  4S3J A;  5HW7 A;  3ARQ A;  3OOB A;  5JH8 A;  2VN1 A;  3RME A;  3PA7 A;  1YAT A;  2KFW A;  1D2K A;  4URI A;  4MAV A;  1L1P A;  3AQU A;  2DG3 A;  3WD2 A;  3IK8 A;  3CGM A;  4U85 A;  3ARV A;  2DG4 A;  2RUR A;  4ODM A;  4G2P A;  1ZBW A;  1ROT A;  1LL7 A;  2M1I A;  4HBO A;  2XP8 A;  3O5E A;  2B31 A;  1OGG A;  3B8S A;  3CHC A;  3AS1 A;  1W1Y A;  4DWS D;  3JYJ A;  3NTP A;  4TYO A;  3UI5 A;  4J4N A;  2DSW A;  3G6M A;  3PRB A;  4FAP A;  2ZQV A;  4R5E A;  2XP5 A;  3CHE A;  1Q1C A;  4LAX A;  2ZQS A;  2WLZ A;  1FKL A;  2G41 A;  1RD6 A;  3MDY B;  4QZV B;  1FFR A;  2KE0 A;  4BF8 A;  4DRK A;  2DT2 A;  1R9H A;  2PI6 A;  3B9E A;  3KAH A;  2DSU A;  3LUO A;  4U86 A;  5DIV A;  3CHF A;  2PV3 A;  4GGQ A;  5D75 A;  2KR7 A;  4P8U A;  2MF9 A;  3WIJ A;  2IUZ A;  2L2S A;  1H0G A;  4ODR A;  4WK9 A;  1FJD A;  1D7H A;  1SYT A;  1QPL A;  4QIB A;  3KAB A;  3GPK A;  1HKJ A;  3AS3 A;  2A3C A;  4WKH A;  2XPB A;  1Q6I A;  4ODL A;  3RM9 A;  2F4E A;  3KAC A;  1W26 A;  2MPH A;  1FKS A;  4R0X A;  4WJX A;  3CZ8 A;  2RUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...