5HKGA

Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (fkbp12.6).
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1B
publication title Total chemical synthesis, refolding, and crystallographic structure of fully active immunophilin calstabin 2 (FKBP12.6).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 25
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5hkgA00
5BXJA 1FKRA 5HW8A 3PRBA 2PPOA 2Y78A 2PV3A 2LPVA 3O5MA 4U85A 1D7HA 2AWGA 2PV1A 1FKFA 3O5GA 4TW7A 4W9QA 3TC5A 3PRDA 4JFKA 4DRIA 1KT0A 1P5QA 2KR7A 3ODKA 3UI5A 4TYOA 4DRHA 4LAXA 1KT1A 4DRJA 1YATA 2ZR6A 3O5FA 1QPLA 2MLYA 1W26A 2KGJA 3KAGA 1BKFA 2RUDA 3O5OA 3KCEA 2XPBA 4ODLA 2DG4A 4IQCA 2F2DA 1D6OA 2PV2A 2RUCA 2DG3A 2PPPA 4W9PA 3IKDA 5B8IC 1EYMA 1FKIA 1T11A 2VN1A 3LUOA 1NMWA 1Q6IA 4J4NA 3UI4A 2IF4A 2RQSA 2N87A 3FAPA 5DIVA 4ODNA 1FKLA 4FAPA 2PPNA 2ZR5A 4DZ2A 3TCZA 2KI3A 4GGQA 3IK8A 3JYJA 2D9FA 2XP3A 3H9RB 3O5DA 1FJDA 1HXVA 1YW5A 4DH0A 4JYSA 4N19A 4LAVA 3OOBA 4JFLA 2MNTA 2MLZA 3UQBA 1Q6HA 1FKGA 2LJ4A 3NRKA 3NI6A 1F40A 4TW8A 5DIUA 2K8IA 1FKHA 4DIPA 1J4HA 1Q1CA 4GIVA 4C02B 3JXVA 3IKGA 2KE0A 1D7JA 4DZ3A 4ODOA 1NSGA 4TX0A 5GPGA 3KAHA 1Q6UA 5HW7A 1J4RA 1TCOC 2M2AA 3O5QA 4ITZA 1FKTA 2XPAA 1ZCNA 4W9OA 3O5JA 5HW6A 1A7XA 1FKKA 3KABA 2MPHA 3GPKA 4ODPA 4U84A 1D7IA 5HTGA 3O5PA 4MSPA 3KAFA 2UZ5A 2LGOA 3O5IA 1QPFA 4QT2A 2XP4A 5HWBA 4DRNA 2F4EA 2XP7A 1JNTA 3O5EA 3KZ7A 1FKSA 1B6CA 2JZVA 2RSEA 2M08A 4LAYA 4O2TA 2RUQA 4DT4A 1U79A 3PA7A 4U86A 4JFJA 4FN2A 1J4IA 1JNSA 3TDBA 2PBCA 3NTPA 3KAIA 4J4OA 4ODKA 1F8AB 2VCDA 3I6CA 2ZR4A 1N1AA 1FAPA 2F21A 2LKNA 2RURA 2XP8A 1PBKA 2ZQUA 3WH0A 3O5LA 3B7XA 1Y0OA 2ZQSA 3O5KA 1FKDA 1EQ3A 4ODMA 4TNSA 5HT1A 3MDYB 3UF8A 4DRQA 3O5RA 4DRKA 5HKGA 4ODRA 2XP6A 4NNRA 4QT3A 4G50A 4BF8A 1FKJA 3RGCA 4JFMA 5HUAA 1L1PA 3UQAA 1ZK6A 2FKEA 3VAWA 3CGNA 4R0XA 2XP9A 1JVWA 2M1IA 4LAWA 2KFWA 1J6YA 1BL4A 4DROA 1FD9A 4JFIA 4MGVA 1R9HA 4TW6A 3JYMA 5HWCA 3KADA 1ROUA 3IHZA 3CGMA 1PINA 2Q5AA 2ZQVA 4QIBA 2DG9A 2FAPA 2XP5A 1ROTA 3EY6A 4IQ2A 3UI6A 3KACA 5I98A 1QZ2A 3UQIA 5J6EA 5DITA 2MF9A 4ODQA 2ITKA 2KO7A 2L2SA 2MLXA 5D75A 4DRMA 2OFNA 1FKBA 3RFWA 4G2PA 4IPXA 2ZQTA 1C9HA 4DRPA 1M5YA 1NMVA
chains in the Genus database with same CATH superfamily
2B31A 3PRBA 4WK9A 3O5MA 3TC5A 1D7HA 2AWGA 3AS0A 1FKFA 4TW7A 4W9QA 1H0IA 3BMBA 4LAXA 2ZR6A 3O5FA 1HKIA 4HBEA 2KGJA 3KAGA 1BKFA 2XPBA 1GUVA 1NWRA 4WIWA 1E6NA 2DG4A 4IQCA 3ARUA 4URIA 2PV2A 2RUCA 2PPPA 4NSBA 1T11A 1NMWA 1Q6IA 3UI4A 4Z2HA 5DIVA 1W9VA 3ALGA 4FAPA 2ZR5A 3B9EA 1VF8A 3JYJA 1XHGA 3FXYA 4PTMA 2D9FA 3H9RB 4LAVA 1W9UA 2MLZA 1FKGA 1F40A 2K8IA 5GPRA 4DIPA 3QOKA 4Z2LA 1GPFA 1NSGA 2DT2A 1TCOC 2M2AA 1HJXA 1SR0A 4Z2JA 1ZCNA 1FKKA 2DT0A 1ITXA 4U84A 1D7IA 3ALFA 2LGOA 3O5IA 1U79A 1E6ZA 1J4IA 4FN2A 2F23A 1JNSA 1LJYA 3RM8A 1FAPA 2XP8A 2ZQUA 1FKDA 4TNSA 3O5RA 1NWUA 5HUAA 4MAVA 3AROA 1RD6A 1O6IA 2AOSA 4R0XA 1OGBA 4LAWA 1FD9A 3JYMA 4S3KA 3KADA 1ZL1A 2DG9A 3EY6A 3UI6A 5I98A 1QZ2A 3UQIA 2L2SA 5DF0A 5D75A 1FKBA 4DRPA 4IPXA 3CGNA 1M5YA 1FKRA 3ARRA 2PV3A 4U85A 1W1PA 3O5GA 2DSZA 2YBUA 1E9LA 3UI5A 1E6PA 1QPLA 2MLYA 3O5OA 4R5EA 1H0GA 1E6RA 4Z2IA 1W1VA 4WKFA 3IKDA 2ETNA 4ZPTR 3WD0A 1EYMA 2VN1A 2DSUA 4Z2GA 2IF4A 3GTYX 3ARXA 1FFRA 2DPEA 1FKLA 4Q22A 4KQZA 4DWSA 2IUZA 4GGQA 1TFVA 3WD2A 2DSVA 3IK8A 2XP3A 1HXVA 1YW5A 1E15A 1HKMA 2G41A 4JYSA 4DH0A 3ARQA 4HBOA 3UQBA 2DT1A 3G6LA 3NI6A 3PRAA 1FKHA 1J4HA 1OWQA 3RM9A 4GIVA 4ODOA 5HW7A 4ITZA 3O5QA 1FKTA 2XPAA 4P8XA 5JH8A 4DWSD 4ODPA 5HTGA 1JCHB 3O5PA 4MSPA 3RM4A 2UZ5A 4WKAA 5HWBA 3CHEA 4HARA 2F4EA 2XP7A 1JNTA 3CZ8A 3KZ7A 4MTVA 4O2TA 2RSEA 5HWCA 2M08A 1GRJA 4DT4A 1EIBA 3PA7A 4U86A 3KAIA 1F8AB 2A3BA 1W1YA 4Z2KA 1N1AA 2F21A 2DT3A 3WL1A 3B7XA 2A3EA 4ODMA 1EQ3A 2PI6A 4DRQA 4DRKA 5HKGA 2XP6A 1FKJA 1L1PA 3UQAA 1NWTA 3VAWA 1K9TA 3AS2A 1JVWA 1J6YA 4DROA 1W1TA 4Q7NA 3CGMA 3RMEA 3B9DA 2PN0A 2MLXA 4P8WA 2ZQTA 2P4VA 5BXJA 1ZBVA 5HW8A 1JNEA 2Y78A 2LPVA 2PV1A 4DRIA 1KT0A 1LG1A 2KR7A 3ODKA 4TYOA 4DRHA 1NWSA 1W26A 4L72B 1X6NA 3WD3A 3KCEA 1EHNA 4ODLA 1IX5A 5GQBA 2F2DA 2O9OA 5B8IC 2A3CA 3LUOA 1HKJA 1HKKA 3FAPA 2ESCA 4ODNA 3TCZA 5DO2A 3CHDA 3WIJA 4N19A 3OOBA 1Q6HA 3AS3A 2LJ4A 1ZU8A 1X6LA 2QF8A 5DIUA 1D2KA 3G6MA 1D7JA 4DZ3A 3KAHA 1J4RA 5HW6A 3B9AA 2MPHA 3GPKA 4KR0B 1QPFA 2XP4A 4QZVB 4DRNA 4MNMA 1FKSA 1B6CA 1LL6A 2JZVA 4LAYA 4WKHA 4JFJA 2PBCA 2A3AA 3B8SA 3NTPA 4J4OA 4ODKA 2VCDA 2G8ZA 1LG2A 3ARPA 2LKNA 2RURA 1PBKA 5HBFA 1Y0OA 2ZQSA 3O5KA 3OA5A 5HT1A 3ARVA 1SYTA 3ARYA 4IT6A 4ODRA 4QT3A 4G50A 4BF8A 3RGCA 3AS1A 2B5UB 1WB0A 1ZK6A 2FKEA 4W5UA 1E44A 2KFWA 3WKZA 4MGVA 4ZPVR 1R9HA 4TW6A 1ROUA 1PINA 4DWSC 1ZB5A 2XP5A 1ROTA 4IQ2A 1EDQA 3FY1A 2KO7A 2OFNA 3RFWA 2PPOA 3BXWA 3CHFA 3PRDA 4JFKA 4P8VA 1P5QA 4ZPWR 3WD4A 1KT1A 1W9PA 4DRJA 1YATA 1ZBWA 2RUDA 3ARWA 1D6OA 4W9PA 2DG3A 1WNOA 1HJVA 4LGXA 4UDMA 1FKIA 4J4NA 2RQSA 2WM0A 2N87A 4NZCA 1ZBKA 4WJXA 2PPNA 4DZ2A 3ARZA 2O92A 2KI3A 1CTNA 1LQ0A 4IT4A 3O5DA 1FJDA 3EIPA 1ZBCA 2FDMA 4JFLA 3WD1A 1KFWA 2MNTA 3ARTA 3NRKA 4TW8A 1GOIA 3GU0A 1OGGA 1Q1CA 4XAKA 2EULA 4C02B 3JXVA 3IKGA 2KE0A 3CHCA 4TX0A 5GPGA 1Q6UA 4ZS6A 1JNDA 4W9OA 3O5JA 1A7XA 3KABA 3AQUA 1UR9A 2WLZA 3KAFA 1WAWA 3CH9A 4QT2A 3O5EA 2RUQA 4MNKA 3PR9A 3TDBA 2WK2A 1LL7A 3I6CA 2ZR4A 4DWSB 2WLYA 4MNJA 3WH0A 3O5LA 3MDYB 3UF8A 4NNRA 1HJWA 4AY1A 1NH6A 4JFMA 5DEZA 2YBTA 3WL0A 4ML4A 3ARSA 4MNLA 2XP9A 2M1IA 1BL4A 1XRVA 4JFIA 4L3NA 3WQWA 3IHZA 4P8UA 4MPKA 2Q5AA 2ZQVA 4QIBA 2FAPA 1UR8A 2DSWA 1FFQA 3KACA 2OLHA 5J6EA 5DITA 2MF9A 4ODQA 2ITKA 4S3JA 1LL4A 3WQVA 3W4RA 4DRMA 4G2PA 1C9HA 1NMVA
chains in the Genus database with same CATH topology
2B31A 3PRBA 4WK9A 3O5MA 3TC5A 1D7HA 2AWGA 3AS0A 1FKFA 4TW7A 4W9QA 1H0IA 4LAXA 2ZR6A 3O5FA 1HKIA 4HBEA 2KGJA 3KAGA 1BKFA 2XPBA 1GUVA 1NWRA 4WIWA 1E6NA 2DG4A 4IQCA 3ARUA 4URIA 2PV2A 2RUCA 2PPPA 4NSBA 1T11A 1NMWA 1Q6IA 3UI4A 4Z2HA 5DIVA 1W9VA 3ALGA 4FAPA 2ZR5A 3B9EA 1VF8A 3JYJA 1XHGA 3FXYA 4PTMA 2D9FA 3H9RB 4LAVA 1W9UA 2MLZA 1FKGA 1F40A 2K8IA 5GPRA 4DIPA 3QOKA 4Z2LA 1GPFA 1NSGA 2DT2A 1TCOC 2M2AA 1HJXA 1SR0A 4Z2JA 1ZCNA 1FKKA 2DT0A 1ITXA 4U84A 1D7IA 3ALFA 2LGOA 3O5IA 1U79A 1E6ZA 1J4IA 4FN2A 1JNSA 1LJYA 3RM8A 1FAPA 2XP8A 2ZQUA 1FKDA 4TNSA 3O5RA 1NWUA 5HUAA 4MAVA 3AROA 1RD6A 1O6IA 2AOSA 4R0XA 1OGBA 4LAWA 1FD9A 3JYMA 4S3KA 3KADA 1ZL1A 2DG9A 3EY6A 3UI6A 5I98A 1QZ2A 3UQIA 2L2SA 5DF0A 5D75A 1FKBA 4DRPA 4IPXA 3CGNA 1M5YA 1FKRA 3ARRA 2PV3A 4U85A 1W1PA 3O5GA 2DSZA 2YBUA 1E9LA 3UI5A 1E6PA 1QPLA 2MLYA 3O5OA 4R5EA 1H0GA 1E6RA 4Z2IA 1W1VA 4WKFA 3IKDA 4ZPTR 3WD0A 1EYMA 2VN1A 2DSUA 4Z2GA 2IF4A 3ARXA 1FFRA 2DPEA 1FKLA 4Q22A 4KQZA 4DWSA 2IUZA 4GGQA 1TFVA 3WD2A 2DSVA 3IK8A 2XP3A 1HXVA 1YW5A 1E15A 1HKMA 2G41A 4JYSA 4DH0A 3ARQA 4HBOA 3UQBA 2DT1A 3G6LA 3NI6A 3PRAA 1FKHA 1J4HA 1OWQA 3RM9A 4GIVA 4ODOA 5HW7A 4ITZA 3O5QA 1FKTA 2XPAA 4P8XA 5JH8A 4DWSD 4ODPA 5HTGA 3O5PA 4MSPA 3RM4A 2UZ5A 4WKAA 5HWBA 3CHEA 4HARA 2F4EA 2XP7A 1JNTA 3CZ8A 3KZ7A 4MTVA 4O2TA 2RSEA 5HWCA 2M08A 4DT4A 1EIBA 3PA7A 4U86A 3KAIA 1F8AB 2A3BA 1W1YA 4Z2KA 1N1AA 2F21A 2DT3A 3WL1A 3B7XA 2A3EA 4ODMA 1EQ3A 2PI6A 4DRQA 4DRKA 5HKGA 2XP6A 1FKJA 1L1PA 3UQAA 1NWTA 3VAWA 1K9TA 3AS2A 1JVWA 1J6YA 4DROA 1W1TA 4Q7NA 3CGMA 3RMEA 3B9DA 2MLXA 4P8WA 2ZQTA 5BXJA 1ZBVA 5HW8A 1JNEA 2Y78A 2LPVA 2PV1A 4DRIA 1KT0A 1LG1A 2KR7A 3ODKA 4TYOA 4DRHA 1NWSA 1W26A 4L72B 1X6NA 3WD3A 3KCEA 1EHNA 4ODLA 1IX5A 5GQBA 2F2DA 2O9OA 5B8IC 2A3CA 3LUOA 1HKJA 1HKKA 3FAPA 2ESCA 4ODNA 3TCZA 5DO2A 3CHDA 3WIJA 4N19A 3OOBA 1Q6HA 3AS3A 2LJ4A 1ZU8A 1X6LA 2QF8A 5DIUA 1D2KA 3G6MA 1D7JA 4DZ3A 3KAHA 1J4RA 5HW6A 3B9AA 2MPHA 3GPKA 4KR0B 1QPFA 2XP4A 4QZVB 4DRNA 4MNMA 1FKSA 1B6CA 1LL6A 2JZVA 4LAYA 4WKHA 4JFJA 2PBCA 2A3AA 3B8SA 3NTPA 4J4OA 4ODKA 2VCDA 2G8ZA 1LG2A 3ARPA 2LKNA 2RURA 1PBKA 5HBFA 1Y0OA 2ZQSA 3O5KA 3OA5A 5HT1A 3ARVA 1SYTA 3ARYA 4IT6A 4ODRA 4QT3A 4G50A 4BF8A 3RGCA 3AS1A 1WB0A 1ZK6A 2FKEA 4W5UA 2KFWA 3WKZA 4MGVA 4ZPVR 1R9HA 4TW6A 1ROUA 1PINA 4DWSC 1ZB5A 2XP5A 1ROTA 4IQ2A 1EDQA 3FY1A 2KO7A 2OFNA 3RFWA 2PPOA 3BXWA 3CHFA 3PRDA 4JFKA 4P8VA 1P5QA 4ZPWR 3WD4A 1KT1A 1W9PA 4DRJA 1YATA 1ZBWA 2RUDA 3ARWA 1D6OA 4W9PA 2DG3A 1WNOA 1HJVA 4LGXA 1FKIA 4J4NA 2RQSA 2WM0A 2N87A 4NZCA 1ZBKA 4WJXA 2PPNA 4DZ2A 3ARZA 2O92A 2KI3A 1CTNA 1LQ0A 4IT4A 3O5DA 1FJDA 1ZBCA 2FDMA 4JFLA 3WD1A 1KFWA 2MNTA 3ARTA 3NRKA 4TW8A 1GOIA 1OGGA 1Q1CA 4XAKA 4C02B 3JXVA 3IKGA 2KE0A 3CHCA 4TX0A 5GPGA 1Q6UA 4ZS6A 1JNDA 4W9OA 3O5JA 1A7XA 3KABA 3AQUA 1UR9A 2WLZA 3KAFA 1WAWA 3CH9A 4QT2A 3O5EA 2RUQA 4MNKA 3PR9A 3TDBA 2WK2A 1LL7A 3I6CA 2ZR4A 4DWSB 2WLYA 4MNJA 3WH0A 3O5LA 3MDYB 3UF8A 4NNRA 1HJWA 4AY1A 1NH6A 4JFMA 5DEZA 2YBTA 3WL0A 4ML4A 3ARSA 4MNLA 2XP9A 2M1IA 1BL4A 1XRVA 4JFIA 4L3NA 3WQWA 3IHZA 4P8UA 4MPKA 2Q5AA 2ZQVA 4QIBA 2FAPA 1UR8A 2DSWA 1FFQA 3KACA 2OLHA 5J6EA 5DITA 2MF9A 4ODQA 2ITKA 4S3JA 1LL4A 3WQVA 3W4RA 4DRMA 4G2PA 1C9HA 1NMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXJ A;  1FKR A;  5HW8 A;  3PRB A;  2PPO A;  2Y78 A;  2PV3 A;  2LPV A;  3O5M A;  4U85 A;  1D7H A;  2AWG A;  2PV1 A;  1FKF A;  3O5G A;  4TW7 A;  4W9Q A;  3TC5 A;  3PRD A;  4JFK A;  4DRI A;  1KT0 A;  1P5Q A;  2KR7 A;  3ODK A;  3UI5 A;  4TYO A;  4DRH A;  4LAX A;  1KT1 A;  4DRJ A;  1YAT A;  2ZR6 A;  3O5F A;  1QPL A;  2MLY A;  1W26 A;  2KGJ A;  3KAG A;  1BKF A;  2RUD A;  3O5O A;  3KCE A;  2XPB A;  4ODL A;  2DG4 A;  4IQC A;  2F2D A;  1D6O A;  2PV2 A;  2RUC A;  2DG3 A;  2PPP A;  4W9P A;  3IKD A;  5B8I C;  1EYM A;  1FKI A;  1T11 A;  2VN1 A;  3LUO A;  1NMW A;  1Q6I A;  4J4N A;  3UI4 A;  2IF4 A;  2RQS A;  2N87 A;  3FAP A;  5DIV A;  4ODN A;  1FKL A;  4FAP A;  2PPN A;  2ZR5 A;  4DZ2 A;  3TCZ A;  2KI3 A;  4GGQ A;  3IK8 A;  3JYJ A;  2D9F A;  2XP3 A;  3H9R B;  3O5D A;  1FJD A;  1HXV A;  1YW5 A;  4DH0 A;  4JYS A;  4N19 A;  4LAV A;  3OOB A;  4JFL A;  2MNT A;  2MLZ A;  3UQB A;  1Q6H A;  1FKG A;  2LJ4 A;  3NRK A;  3NI6 A;  1F40 A;  4TW8 A;  5DIU A;  2K8I A;  1FKH A;  4DIP A;  1J4H A;  1Q1C A;  4GIV A;  4C02 B;  3JXV A;  3IKG A;  2KE0 A;  1D7J A;  4DZ3 A;  4ODO A;  1NSG A;  4TX0 A;  5GPG A;  3KAH A;  1Q6U A;  5HW7 A;  1J4R A;  1TCO C;  2M2A A;  3O5Q A;  4ITZ A;  1FKT A;  2XPA A;  1ZCN A;  4W9O A;  3O5J A;  5HW6 A;  1A7X A;  1FKK A;  3KAB A;  2MPH A;  3GPK A;  4ODP A;  4U84 A;  1D7I A;  5HTG A;  3O5P A;  4MSP A;  3KAF A;  2UZ5 A;  2LGO A;  3O5I A;  1QPF A;  4QT2 A;  2XP4 A;  5HWB A;  4DRN A;  2F4E A;  2XP7 A;  1JNT A;  3O5E A;  3KZ7 A;  1FKS A;  1B6C A;  2JZV A;  2RSE A;  2M08 A;  4LAY A;  4O2T A;  2RUQ A;  4DT4 A;  1U79 A;  3PA7 A;  4U86 A;  4JFJ A;  4FN2 A;  1J4I A;  1JNS A;  3TDB A;  2PBC A;  3NTP A;  3KAI A;  4J4O A;  4ODK A;  1F8A B;  2VCD A;  3I6C A;  2ZR4 A;  1N1A A;  1FAP A;  2F21 A;  2LKN A;  2RUR A;  2XP8 A;  1PBK A;  2ZQU A;  3WH0 A;  3O5L A;  3B7X A;  1Y0O A;  2ZQS A;  3O5K A;  1FKD A;  1EQ3 A;  4ODM A;  4TNS A;  5HT1 A;  3MDY B;  3UF8 A;  4DRQ A;  3O5R A;  4DRK A;  5HKG A;  4ODR A;  2XP6 A;  4NNR A;  4QT3 A;  4G50 A;  4BF8 A;  1FKJ A;  3RGC A;  4JFM A;  5HUA A;  1L1P A;  3UQA A;  1ZK6 A;  2FKE A;  3VAW A;  3CGN A;  4R0X A;  2XP9 A;  1JVW A;  2M1I A;  4LAW A;  2KFW A;  1J6Y A;  1BL4 A;  4DRO A;  1FD9 A;  4JFI A;  4MGV A;  1R9H A;  4TW6 A;  3JYM A;  5HWC A;  3KAD A;  1ROU A;  3IHZ A;  3CGM A;  1PIN A;  2Q5A A;  2ZQV A;  4QIB A;  2DG9 A;  2FAP A;  2XP5 A;  1ROT A;  3EY6 A;  4IQ2 A;  3UI6 A;  3KAC A;  5I98 A;  1QZ2 A;  3UQI A;  5J6E A;  5DIT A;  2MF9 A;  4ODQ A;  2ITK A;  2KO7 A;  2L2S A;  2MLX A;  5D75 A;  4DRM A;  2OFN A;  1FKB A;  3RFW A;  4G2P A;  4IPX A;  2ZQT A;  1C9H A;  4DRP A;  1M5Y A;  1NMV A; 
#chains in the Genus database with same CATH topology
 2B31 A;  3PRB A;  4WK9 A;  3O5M A;  3TC5 A;  1D7H A;  2AWG A;  3AS0 A;  1FKF A;  4TW7 A;  4W9Q A;  1H0I A;  3BMB A;  4LAX A;  2ZR6 A;  3O5F A;  1HKI A;  4HBE A;  2KGJ A;  3KAG A;  1BKF A;  2XPB A;  1GUV A;  1NWR A;  4WIW A;  1E6N A;  2DG4 A;  4IQC A;  3ARU A;  4URI A;  2PV2 A;  2RUC A;  2PPP A;  4NSB A;  1T11 A;  1NMW A;  1Q6I A;  3UI4 A;  4Z2H A;  5DIV A;  1W9V A;  3ALG A;  4FAP A;  2ZR5 A;  3B9E A;  1VF8 A;  3JYJ A;  1XHG A;  3FXY A;  4PTM A;  2D9F A;  3H9R B;  4LAV A;  1W9U A;  2MLZ A;  1FKG A;  1F40 A;  2K8I A;  5GPR A;  4DIP A;  3QOK A;  4Z2L A;  1GPF A;  1NSG A;  2DT2 A;  1TCO C;  2M2A A;  1HJX A;  1SR0 A;  4Z2J A;  1ZCN A;  1FKK A;  2DT0 A;  1ITX A;  4U84 A;  1D7I A;  3ALF A;  2LGO A;  3O5I A;  1U79 A;  1E6Z A;  1J4I A;  4FN2 A;  2F23 A;  1JNS A;  1LJY A;  3RM8 A;  1FAP A;  2XP8 A;  2ZQU A;  1FKD A;  4TNS A;  3O5R A;  1NWU A;  5HUA A;  4MAV A;  3ARO A;  1RD6 A;  1O6I A;  2AOS A;  4R0X A;  1OGB A;  4LAW A;  1FD9 A;  3JYM A;  4S3K A;  3KAD A;  1ZL1 A;  2DG9 A;  3EY6 A;  3UI6 A;  5I98 A;  1QZ2 A;  3UQI A;  2L2S A;  5DF0 A;  5D75 A;  1FKB A;  4DRP A;  4IPX A;  3CGN A;  1M5Y A;  1FKR A;  3ARR A;  2PV3 A;  4U85 A;  1W1P A;  3O5G A;  2DSZ A;  2YBU A;  1E9L A;  3UI5 A;  1E6P A;  1QPL A;  2MLY A;  3O5O A;  4R5E A;  1H0G A;  1E6R A;  4Z2I A;  1W1V A;  4WKF A;  3IKD A;  2ETN A;  4ZPT R;  3WD0 A;  1EYM A;  2VN1 A;  2DSU A;  4Z2G A;  2IF4 A;  3GTY X;  3ARX A;  1FFR A;  2DPE A;  1FKL A;  4Q22 A;  4KQZ A;  4DWS A;  2IUZ A;  4GGQ A;  1TFV A;  3WD2 A;  2DSV A;  3IK8 A;  2XP3 A;  1HXV A;  1YW5 A;  1E15 A;  1HKM A;  2G41 A;  4JYS A;  4DH0 A;  3ARQ A;  4HBO A;  3UQB A;  2DT1 A;  3G6L A;  3NI6 A;  3PRA A;  1FKH A;  1J4H A;  1OWQ A;  3RM9 A;  4GIV A;  4ODO A;  5HW7 A;  4ITZ A;  3O5Q A;  1FKT A;  2XPA A;  4P8X A;  5JH8 A;  4DWS D;  4ODP A;  5HTG A;  1JCH B;  3O5P A;  4MSP A;  3RM4 A;  2UZ5 A;  4WKA A;  5HWB A;  3CHE A;  4HAR A;  2F4E A;  2XP7 A;  1JNT A;  3CZ8 A;  3KZ7 A;  4MTV A;  4O2T A;  2RSE A;  5HWC A;  2M08 A;  1GRJ A;  4DT4 A;  1EIB A;  3PA7 A;  4U86 A;  3KAI A;  1F8A B;  2A3B A;  1W1Y A;  4Z2K A;  1N1A A;  2F21 A;  2DT3 A;  3WL1 A;  3B7X A;  2A3E A;  4ODM A;  1EQ3 A;  2PI6 A;  4DRQ A;  4DRK A;  5HKG A;  2XP6 A;  1FKJ A;  1L1P A;  3UQA A;  1NWT A;  3VAW A;  1K9T A;  3AS2 A;  1JVW A;  1J6Y A;  4DRO A;  1W1T A;  4Q7N A;  3CGM A;  3RME A;  3B9D A;  2PN0 A;  2MLX A;  4P8W A;  2ZQT A;  2P4V A;  5BXJ A;  1ZBV A;  5HW8 A;  1JNE A;  2Y78 A;  2LPV A;  2PV1 A;  4DRI A;  1KT0 A;  1LG1 A;  2KR7 A;  3ODK A;  4TYO A;  4DRH A;  1NWS A;  1W26 A;  4L72 B;  1X6N A;  3WD3 A;  3KCE A;  1EHN A;  4ODL A;  1IX5 A;  5GQB A;  2F2D A;  2O9O A;  5B8I C;  2A3C A;  3LUO A;  1HKJ A;  1HKK A;  3FAP A;  2ESC A;  4ODN A;  3TCZ A;  5DO2 A;  3CHD A;  3WIJ A;  4N19 A;  3OOB A;  1Q6H A;  3AS3 A;  2LJ4 A;  1ZU8 A;  1X6L A;  2QF8 A;  5DIU A;  1D2K A;  3G6M A;  1D7J A;  4DZ3 A;  3KAH A;  1J4R A;  5HW6 A;  3B9A A;  2MPH A;  3GPK A;  4KR0 B;  1QPF A;  2XP4 A;  4QZV B;  4DRN A;  4MNM A;  1FKS A;  1B6C A;  1LL6 A;  2JZV A;  4LAY A;  4WKH A;  4JFJ A;  2PBC A;  2A3A A;  3B8S A;  3NTP A;  4J4O A;  4ODK A;  2VCD A;  2G8Z A;  1LG2 A;  3ARP A;  2LKN A;  2RUR A;  1PBK A;  5HBF A;  1Y0O A;  2ZQS A;  3O5K A;  3OA5 A;  5HT1 A;  3ARV A;  1SYT A;  3ARY A;  4IT6 A;  4ODR A;  4QT3 A;  4G50 A;  4BF8 A;  3RGC A;  3AS1 A;  2B5U B;  1WB0 A;  1ZK6 A;  2FKE A;  4W5U A;  1E44 A;  2KFW A;  3WKZ A;  4MGV A;  4ZPV R;  1R9H A;  4TW6 A;  1ROU A;  1PIN A;  4DWS C;  1ZB5 A;  2XP5 A;  1ROT A;  4IQ2 A;  1EDQ A;  3FY1 A;  2KO7 A;  2OFN A;  3RFW A;  2PPO A;  3BXW A;  3CHF A;  3PRD A;  4JFK A;  4P8V A;  1P5Q A;  4ZPW R;  3WD4 A;  1KT1 A;  1W9P A;  4DRJ A;  1YAT A;  1ZBW A;  2RUD A;  3ARW A;  1D6O A;  4W9P A;  2DG3 A;  1WNO A;  1HJV A;  4LGX A;  4UDM A;  1FKI A;  4J4N A;  2RQS A;  2WM0 A;  2N87 A;  4NZC A;  1ZBK A;  4WJX A;  2PPN A;  4DZ2 A;  3ARZ A;  2O92 A;  2KI3 A;  1CTN A;  1LQ0 A;  4IT4 A;  3O5D A;  1FJD A;  3EIP A;  1ZBC A;  2FDM A;  4JFL A;  3WD1 A;  1KFW A;  2MNT A;  3ART A;  3NRK A;  4TW8 A;  1GOI A;  3GU0 A;  1OGG A;  1Q1C A;  4XAK A;  2EUL A;  4C02 B;  3JXV A;  3IKG A;  2KE0 A;  3CHC A;  4TX0 A;  5GPG A;  1Q6U A;  4ZS6 A;  1JND A;  4W9O A;  3O5J A;  1A7X A;  3KAB A;  3AQU A;  1UR9 A;  2WLZ A;  3KAF A;  1WAW A;  3CH9 A;  4QT2 A;  3O5E A;  2RUQ A;  4MNK A;  3PR9 A;  3TDB A;  2WK2 A;  1LL7 A;  3I6C A;  2ZR4 A;  4DWS B;  2WLY A;  4MNJ A;  3WH0 A;  3O5L A;  3MDY B;  3UF8 A;  4NNR A;  1HJW A;  4AY1 A;  1NH6 A;  4JFM A;  5DEZ A;  2YBT A;  3WL0 A;  4ML4 A;  3ARS A;  4MNL A;  2XP9 A;  2M1I A;  1BL4 A;  1XRV A;  4JFI A;  4L3N A;  3WQW A;  3IHZ A;  4P8U A;  4MPK A;  2Q5A A;  2ZQV A;  4QIB A;  2FAP A;  1UR8 A;  2DSW A;  1FFQ A;  3KAC A;  2OLH A;  5J6E A;  5DIT A;  2MF9 A;  4ODQ A;  2ITK A;  4S3J A;  1LL4 A;  3WQV A;  3W4R A;  4DRM A;  4G2P A;  1C9H A;  1NMV A; 
#chains in the Genus database with same CATH homology
 2B31 A;  3PRB A;  4WK9 A;  3O5M A;  3TC5 A;  1D7H A;  2AWG A;  3AS0 A;  1FKF A;  4TW7 A;  4W9Q A;  1H0I A;  4LAX A;  2ZR6 A;  3O5F A;  1HKI A;  4HBE A;  2KGJ A;  3KAG A;  1BKF A;  2XPB A;  1GUV A;  1NWR A;  4WIW A;  1E6N A;  2DG4 A;  4IQC A;  3ARU A;  4URI A;  2PV2 A;  2RUC A;  2PPP A;  4NSB A;  1T11 A;  1NMW A;  1Q6I A;  3UI4 A;  4Z2H A;  5DIV A;  1W9V A;  3ALG A;  4FAP A;  2ZR5 A;  3B9E A;  1VF8 A;  3JYJ A;  1XHG A;  3FXY A;  4PTM A;  2D9F A;  3H9R B;  4LAV A;  1W9U A;  2MLZ A;  1FKG A;  1F40 A;  2K8I A;  5GPR A;  4DIP A;  3QOK A;  4Z2L A;  1GPF A;  1NSG A;  2DT2 A;  1TCO C;  2M2A A;  1HJX A;  1SR0 A;  4Z2J A;  1ZCN A;  1FKK A;  2DT0 A;  1ITX A;  4U84 A;  1D7I A;  3ALF A;  2LGO A;  3O5I A;  1U79 A;  1E6Z A;  1J4I A;  4FN2 A;  1JNS A;  1LJY A;  3RM8 A;  1FAP A;  2XP8 A;  2ZQU A;  1FKD A;  4TNS A;  3O5R A;  1NWU A;  5HUA A;  4MAV A;  3ARO A;  1RD6 A;  1O6I A;  2AOS A;  4R0X A;  1OGB A;  4LAW A;  1FD9 A;  3JYM A;  4S3K A;  3KAD A;  1ZL1 A;  2DG9 A;  3EY6 A;  3UI6 A;  5I98 A;  1QZ2 A;  3UQI A;  2L2S A;  5DF0 A;  5D75 A;  1FKB A;  4DRP A;  4IPX A;  3CGN A;  1M5Y A;  1FKR A;  3ARR A;  2PV3 A;  4U85 A;  1W1P A;  3O5G A;  2DSZ A;  2YBU A;  1E9L A;  3UI5 A;  1E6P A;  1QPL A;  2MLY A;  3O5O A;  4R5E A;  1H0G A;  1E6R A;  4Z2I A;  1W1V A;  4WKF A;  3IKD A;  4ZPT R;  3WD0 A;  1EYM A;  2VN1 A;  2DSU A;  4Z2G A;  2IF4 A;  3ARX A;  1FFR A;  2DPE A;  1FKL A;  4Q22 A;  4KQZ A;  4DWS A;  2IUZ A;  4GGQ A;  1TFV A;  3WD2 A;  2DSV A;  3IK8 A;  2XP3 A;  1HXV A;  1YW5 A;  1E15 A;  1HKM A;  2G41 A;  4JYS A;  4DH0 A;  3ARQ A;  4HBO A;  3UQB A;  2DT1 A;  3G6L A;  3NI6 A;  3PRA A;  1FKH A;  1J4H A;  1OWQ A;  3RM9 A;  4GIV A;  4ODO A;  5HW7 A;  4ITZ A;  3O5Q A;  1FKT A;  2XPA A;  4P8X A;  5JH8 A;  4DWS D;  4ODP A;  5HTG A;  3O5P A;  4MSP A;  3RM4 A;  2UZ5 A;  4WKA A;  5HWB A;  3CHE A;  4HAR A;  2F4E A;  2XP7 A;  1JNT A;  3CZ8 A;  3KZ7 A;  4MTV A;  4O2T A;  2RSE A;  5HWC A;  2M08 A;  4DT4 A;  1EIB A;  3PA7 A;  4U86 A;  3KAI A;  1F8A B;  2A3B A;  1W1Y A;  4Z2K A;  1N1A A;  2F21 A;  2DT3 A;  3WL1 A;  3B7X A;  2A3E A;  4ODM A;  1EQ3 A;  2PI6 A;  4DRQ A;  4DRK A;  5HKG A;  2XP6 A;  1FKJ A;  1L1P A;  3UQA A;  1NWT A;  3VAW A;  1K9T A;  3AS2 A;  1JVW A;  1J6Y A;  4DRO A;  1W1T A;  4Q7N A;  3CGM A;  3RME A;  3B9D A;  2MLX A;  4P8W A;  2ZQT A;  5BXJ A;  1ZBV A;  5HW8 A;  1JNE A;  2Y78 A;  2LPV A;  2PV1 A;  4DRI A;  1KT0 A;  1LG1 A;  2KR7 A;  3ODK A;  4TYO A;  4DRH A;  1NWS A;  1W26 A;  4L72 B;  1X6N A;  3WD3 A;  3KCE A;  1EHN A;  4ODL A;  1IX5 A;  5GQB A;  2F2D A;  2O9O A;  5B8I C;  2A3C A;  3LUO A;  1HKJ A;  1HKK A;  3FAP A;  2ESC A;  4ODN A;  3TCZ A;  5DO2 A;  3CHD A;  3WIJ A;  4N19 A;  3OOB A;  1Q6H A;  3AS3 A;  2LJ4 A;  1ZU8 A;  1X6L A;  2QF8 A;  5DIU A;  1D2K A;  3G6M A;  1D7J A;  4DZ3 A;  3KAH A;  1J4R A;  5HW6 A;  3B9A A;  2MPH A;  3GPK A;  4KR0 B;  1QPF A;  2XP4 A;  4QZV B;  4DRN A;  4MNM A;  1FKS A;  1B6C A;  1LL6 A;  2JZV A;  4LAY A;  4WKH A;  4JFJ A;  2PBC A;  2A3A A;  3B8S A;  3NTP A;  4J4O A;  4ODK A;  2VCD A;  2G8Z A;  1LG2 A;  3ARP A;  2LKN A;  2RUR A;  1PBK A;  5HBF A;  1Y0O A;  2ZQS A;  3O5K A;  3OA5 A;  5HT1 A;  3ARV A;  1SYT A;  3ARY A;  4IT6 A;  4ODR A;  4QT3 A;  4G50 A;  4BF8 A;  3RGC A;  3AS1 A;  1WB0 A;  1ZK6 A;  2FKE A;  4W5U A;  2KFW A;  3WKZ A;  4MGV A;  4ZPV R;  1R9H A;  4TW6 A;  1ROU A;  1PIN A;  4DWS C;  1ZB5 A;  2XP5 A;  1ROT A;  4IQ2 A;  1EDQ A;  3FY1 A;  2KO7 A;  2OFN A;  3RFW A;  2PPO A;  3BXW A;  3CHF A;  3PRD A;  4JFK A;  4P8V A;  1P5Q A;  4ZPW R;  3WD4 A;  1KT1 A;  1W9P A;  4DRJ A;  1YAT A;  1ZBW A;  2RUD A;  3ARW A;  1D6O A;  4W9P A;  2DG3 A;  1WNO A;  1HJV A;  4LGX A;  1FKI A;  4J4N A;  2RQS A;  2WM0 A;  2N87 A;  4NZC A;  1ZBK A;  4WJX A;  2PPN A;  4DZ2 A;  3ARZ A;  2O92 A;  2KI3 A;  1CTN A;  1LQ0 A;  4IT4 A;  3O5D A;  1FJD A;  1ZBC A;  2FDM A;  4JFL A;  3WD1 A;  1KFW A;  2MNT A;  3ART A;  3NRK A;  4TW8 A;  1GOI A;  1OGG A;  1Q1C A;  4XAK A;  4C02 B;  3JXV A;  3IKG A;  2KE0 A;  3CHC A;  4TX0 A;  5GPG A;  1Q6U A;  4ZS6 A;  1JND A;  4W9O A;  3O5J A;  1A7X A;  3KAB A;  3AQU A;  1UR9 A;  2WLZ A;  3KAF A;  1WAW A;  3CH9 A;  4QT2 A;  3O5E A;  2RUQ A;  4MNK A;  3PR9 A;  3TDB A;  2WK2 A;  1LL7 A;  3I6C A;  2ZR4 A;  4DWS B;  2WLY A;  4MNJ A;  3WH0 A;  3O5L A;  3MDY B;  3UF8 A;  4NNR A;  1HJW A;  4AY1 A;  1NH6 A;  4JFM A;  5DEZ A;  2YBT A;  3WL0 A;  4ML4 A;  3ARS A;  4MNL A;  2XP9 A;  2M1I A;  1BL4 A;  1XRV A;  4JFI A;  4L3N A;  3WQW A;  3IHZ A;  4P8U A;  4MPK A;  2Q5A A;  2ZQV A;  4QIB A;  2FAP A;  1UR8 A;  2DSW A;  1FFQ A;  3KAC A;  2OLH A;  5J6E A;  5DIT A;  2MF9 A;  4ODQ A;  2ITK A;  4S3J A;  1LL4 A;  3WQV A;  3W4R A;  4DRM A;  4G2P A;  1C9H A;  1NMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...