3O5QA

Fk1 domain mutant a19t of fkbp51, crystal form iv, in presence of dmso
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5qA00
1B6CA 2K8IA 3VAWA 3UI4A 4DRJA 2MNTA 2IF4A 2MF9A 4ITZA 1FKBA 4G2PA 3EY6A 1L1PA 2ZR4A 4GGQA 2FKEA 3ODKA 3JXVA 1FKHA 1D7JA 4R0XA 4ODOA 2AWGA 4DZ2A 1J6YA 1FKSA 4DRPA 1NMWA 1Q6IA 1FJDA 4TW6A 5J6EA 2XP3A 4JFIA 2ZQVA 3FAPA 1FKTA 5HUAA 1JNTA 1ZCNA 2PV1A 1FD9A 4DH0A 1FKKA 3O5FA 5HW7A 3UQBA 3O5PA 3O5JA 3KABA 1QZ2A 2MLXA 2PBCA 3PRBA 5HTGA 3CGMA 3PRDA 4MSPA 5HW6A 5HWBA 4DIPA 3O5GA 3O5IA 3IKGA 4N19A 3JYMA 2JZVA 5DIVA 1D7IA 2LGOA 2RUCA 4DRIA 4BF8A 4DRHA 4W9QA 1FKRA 1Q6HA 3OOBA 4JFMA 2OFNA 4LAVA 4MGVA 2PPOA 1FKLA 3RGCA 2LJ4A 3O5EA 5DITA 2ITKA 2XP8A 3RFWA 5D75A 4DRMA 3O5LA 5GPGA 3GPKA 1BL4A 1FKGA 2ZQUA 4LAYA 3O5KA 4TW8A 4IQCA 4J4OA 1N1AA 4TW7A 1JNSA 2MLYA 3O5DA 1YATA 2M08A 3CGNA 5HWCA 1F40A 1NMVA 5I98A 1FKIA 1ROTA 1Y0OA 3O5MA 2PV3A 3O5RA 4QT2A 3H9RB 4G50A 1J4IA 1P5QA 1QPLA 1NSGA 1YW5A 2KGJA 2ZQTA 3IKDA 4J4NA 4ODLA 4W9PA 4IQ2A 2XPAA 4GIVA 5DIUA 5HW8A 2RUQA 2M2AA 2LPVA 3UI5A 1FKFA 3KADA 4LAXA 2Y78A 3KZ7A 2XP5A 1ROUA 2F21A 2PPPA 2XP4A 2XP6A 2ZQSA 2ZR5A 1JVWA 2RQSA 2FAPA 3LUOA 1EQ3A 2MPHA 2ZR6A 4ODPA 2PV2A 2Q5AA 1ZK6A 2RUDA 1PINA 1F8AB 2VN1A 4IPXA 4TYOA 3TC5A 1FKJA 3MDYB 2M1IA 3TDBA 3WH0A 2F4EA 4FAPA 1KT0A 4ODNA 1R9HA 4C02B 2D9FA 2UZ5A 1HXVA 4JFLA 1A7XA 1KT1A 1T11A 2RURA 3IHZA 2PPNA 3TCZA 2DG9A 3PA7A 3KAHA 4TNSA 4ODRA 3KACA 5HT1A 4O2TA 4U85A 3NI6A 2KI3A 4JFKA 4U84A 1D6OA 2RSEA 3O5OA 2KE0A 2XP7A 4DRNA 4U86A 1U79A 1FKDA 4DRQA 3I6CA 4ODQA 1BKFA 1W26A 2XPBA 3KCEA 2KFWA 3JYJA 2KO7A 2XP9A 3UI6A 4NNRA 1EYMA 1PBKA 5BXJA 3KAGA 3UF8A 1QPFA 2F2DA 2L2SA 3O5QA 4DRKA 4LAWA 4QT3A 5B8IC 3B7XA 1J4HA 1TCOC 4JFJA 5HKGA 1D7HA 2MLZA 4ODKA 1Q1CA 4TX0A 4DROA 1FAPA 2KR7A 4DZ3A 4QIBA 2DG3A 4DT4A 4W9OA 3NRKA 3IK8A 2DG4A 2N87A 1M5YA 3KAFA 3NTPA 3UQIA 2LKNA 3UQAA 1C9HA 2VCDA 4FN2A 4ODMA 3KAIA 1J4RA 1Q6UA 4JYSA
chains in the Genus database with same CATH superfamily
2DT3A 2MNTA 2IF4A 1FKBA 4G2PA 3WD3A 1GUVA 3EY6A 2DT1A 2FKEA 2ETNA 1FKSA 1KFWA 4DWSD 1GRJA 4TW6A 4DWSC 1FKTA 1FD9A 3FXYA 1QZ2A 4MAVA 2PBCA 1JNDA 1E9LA 3O5GA 3O5IA 1X6NA 4R5EA 2RUCA 4DRIA 4W9QA 4MNMA 3WD1A 4Z2KA 1Q6HA 4JFMA 5DF0A 3RGCA 2LJ4A 1HJXA 5DITA 1W1VA 1BL4A 2AOSA 1FKGA 3O5KA 4WKFA 5HWCA 2WLZA 3WKZA 3CHEA 3O5RA 4QT2A 4G50A 1J4IA 4J4NA 4ODLA 1TFVA 4HBEA 2M2AA 3AS2A 3ARTA 2Y78A 2ZR5A 2PPPA 1LG2A 1JVWA 2RQSA 2FAPA 2DSVA 1GOIA 3ARXA 2O92A 1ZK6A 2RUDA 3OA5A 1F8AB 1HKKA 4NSBA 4TYOA 3WH0A 2M1IA 4FAPA 4C02B 2UZ5A 4Z2IA 4JFLA 1A7XA 1KT1A 1LL7A 1OGBA 2ESCA 4IT6A 1D6OA 2KE0A 4U86A 1U79A 4DRQA 2WLYA 4ODQA 2DPEA 3JYJA 5BXJA 2F23A 1CTNA 3KAGA 2L2SA 4HARA 4QT3A 1HJWA 1J4HA 5HKGA 1FAPA 1E6ZA 4W9OA 3NRKA 3KAFA 3UQIA 2LKNA 4MNLA 4WJXA 4Z2HA 2VCDA 4MNKA 3CH9A 1Q6UA 2DSZA 2K8IA 1HJVA 3ARQA 3UI4A 2MF9A 1W1TA 1D2KA 3JXVA 1FKHA 1D7JA 1WAWA 3PRAA 2A3EA 3WQWA 4MPKA 4Z2GA 1FJDA 3PR9A 2ZQVA 3FAPA 4UDMA 1JNTA 1HKIA 5HW7A 1ZBCA 3UQBA 3AS0A 3CGMA 3PRDA 5HW6A 4S3KA 1D7IA 4BF8A 1VF8A 4LAVA 1E6PA 4MGVA 2ITKA 3O5LA 3GPKA 4LAYA 1JNSA 1N1AA 1W1YA 1EDQA 3RMEA 2M08A 3CGNA 1SYTA 1NMVA 1Y0OA 3B8SA 5JH8A 1ZBKA 1FFRA 2ZQTA 2KGJA 2A3AA 4IQ2A 5DIUA 2RUQA 4AY1A 3KZ7A 2XP5A 2XP4A 3B9DA 2P4VA 3RM9A 2ZR6A 4ODPA 1W1PA 2PV2A 2Q5AA 1PINA 4Q22A 4KR0B 1R9HA 3BXWA 2RURA 3TCZA 2RSEA 3AS1A 1LL4A 2XP7A 1E6RA 1EHNA 2KFWA 3BMBA 4PTMA 1EYMA 1LJYA 4URIA 4LAWA 2IUZA 3B7XA 2FDMA 4ZPTR 2MLZA 4ODKA 1LG1A 4DROA 2KR7A 4DT4A 2DG4A 1M5YA 3FY1A 3RM8A 1LQ0A 4ODMA 3ARWA 3ARUA 3KAIA 1J4RA 4DRJA 1B6CA 4W5UA 3VAWA 4KQZA 3WL1A 3WD2A 3AROA 4GGQA 3ODKA 4R0XA 1WNOA 2AWGA 4MNJA 1HKMA 4DRPA 2WK2A 1NMWA 2XP3A 4Z2JA 5HUAA 1E6NA 1ZCNA 2PV1A 4Q7NA 1ZU8A 3O5PA 3G6MA 2PN0A 3PRBA 1NWUA 5HWBA 4DIPA 5HBFA 3ARZA 3IKGA 4N19A 1RD6A 5DIVA 4DRHA 1FKRA 2B31A 1GPFA 1ZBVA 3OOBA 2PPOA 2OLHA 1FKLA 3O5EA 2XP8A 5D75A 4HBOA 2DT2A 4ZS6A 5GPGA 4DRMA 2ZQUA 4TW8A 4TW7A 4J4OA 2MLYA 3O5DA 1LL6A 4ZPVR 4LGXA 1F40A 1XHGA 5I98A 2PV3A 5DO2A 2B5UB 3IKDA 1P5QA 1NSGA 4W9PA 3CZ8A 2XPAA 4GIVA 5HW8A 2PI6A 3UI5A 1FKFA 1ROUA 2F21A 2XP6A 2ZQSA 1EQ3A 3ARRA 2MPHA 1NWTA 1JNEA 3W4RA 2VN1A 2F4EA 3RM4A 1HXVA 2D9FA 4P8XA 1H0IA 3IHZA 3PA7A 2YBTA 3KAHA 3G6LA 4ODRA 3KACA 5HT1A 4O2TA 1H0GA 4U85A 2KI3A 4JFKA 4U84A 4NZCA 5GQBA 1OGGA 2DSWA 4DRNA 1ZB5A 1E44A 1W26A 2G8ZA 1HKJA 1UR8A 2A3BA 2KO7A 3UI6A 4NNRA 1PBKA 3UF8A 4WIWA 3O5QA 3B9EA 2YBUA 5B8IC 4P8VA 4XAKA 4JFJA 1D7HA 1Q1CA 4L72B 4QIBA 1NH6A 2G41A 1W9PA 2WM0A 3WIJA 3UQAA 4IT4A 1C9HA 1EIBA 4JYSA 4Z2LA 1XRVA 2QF8A 1ZBWA 1UR9A 4ITZA 1L1PA 2ZR4A 3GTYX 4WK9A 4DZ2A 1J6YA 3AQUA 3EIPA 1Q6IA 4DWSA 5J6EA 4JFIA 1W9UA 4DH0A 1FKKA 3O5FA 3O5JA 3KABA 3CHCA 2MLXA 4S3JA 5HTGA 4MSPA 3WD4A 2DSUA 1O6IA 3ALGA 3JYMA 2JZVA 2LGOA 1W9VA 3QOKA 2OFNA 3RFWA 4IQCA 4P8UA 3ARYA 1YATA 3ALFA 1X6LA 1FKIA 1ROTA 3ARVA 3O5MA 1IX5A 5DEZA 3H9RB 4DRKA 1YW5A 1OWQA 1QPLA 5GPRA 1JCHB 2LPVA 3KADA 4LAXA 3WQVA 3CHFA 4ML4A 4ZPWR 4L3NA 3LUOA 1SR0A 1ZL1A 4IPXA 3TC5A 1FKJA 3MDYB 3TDBA 1NWSA 1NWRA 1KT0A 4ODNA 4WKHA 1T11A 1ITXA 2PPNA 2DG9A 1E15A 4TNSA 3NI6A 3O5OA 2DT0A 3B9AA 1FKDA 3I6CA 4P8WA 1BKFA 2XPBA 3KCEA 2A3CA 4MTVA 2XP9A 3ARSA 4QZVB 1QPFA 2F2DA 3CHDA 1K9TA 1WB0A 3ARPA 3WL0A 1TCOC 2O9OA 3AS3A 1FFQA 2EULA 4TX0A 4DZ3A 2DG3A 4WKAA 3IK8A 2N87A 3NTPA 4DWSB 3GU0A 4FN2A 3WD0A 4ODOA
chains in the Genus database with same CATH topology
2DT3A 2MNTA 2IF4A 1FKBA 4G2PA 3WD3A 1GUVA 3EY6A 2DT1A 2FKEA 1FKSA 1KFWA 4DWSD 4TW6A 4DWSC 1FKTA 1FD9A 3FXYA 1QZ2A 4MAVA 2PBCA 1JNDA 1E9LA 3O5GA 3O5IA 1X6NA 4R5EA 2RUCA 4DRIA 4W9QA 4MNMA 3WD1A 4Z2KA 1Q6HA 4JFMA 5DF0A 3RGCA 2LJ4A 1HJXA 5DITA 1W1VA 1BL4A 2AOSA 1FKGA 3O5KA 4WKFA 5HWCA 2WLZA 3WKZA 3CHEA 3O5RA 4QT2A 4G50A 1J4IA 4J4NA 4ODLA 1TFVA 4HBEA 2M2AA 3AS2A 3ARTA 2Y78A 2ZR5A 2PPPA 1LG2A 1JVWA 2RQSA 2FAPA 2DSVA 1GOIA 3ARXA 2O92A 1ZK6A 2RUDA 3OA5A 1F8AB 1HKKA 4NSBA 4TYOA 3WH0A 2M1IA 4FAPA 4C02B 2UZ5A 4Z2IA 4JFLA 1A7XA 1KT1A 1LL7A 1OGBA 2ESCA 4IT6A 1D6OA 2KE0A 4U86A 1U79A 4DRQA 2WLYA 4ODQA 2DPEA 3JYJA 5BXJA 1CTNA 3KAGA 2L2SA 4HARA 4QT3A 1HJWA 1J4HA 5HKGA 1FAPA 1E6ZA 4W9OA 3NRKA 3KAFA 3UQIA 2LKNA 4MNLA 4WJXA 4Z2HA 2VCDA 4MNKA 3CH9A 1Q6UA 2DSZA 2K8IA 1HJVA 3ARQA 3UI4A 2MF9A 1W1TA 1D2KA 3JXVA 1FKHA 1D7JA 1WAWA 3PRAA 2A3EA 3WQWA 4MPKA 4Z2GA 1FJDA 3PR9A 2ZQVA 3FAPA 1JNTA 1HKIA 5HW7A 1ZBCA 3UQBA 3AS0A 3CGMA 3PRDA 5HW6A 4S3KA 1D7IA 4BF8A 1VF8A 4LAVA 1E6PA 4MGVA 2ITKA 3O5LA 3GPKA 4LAYA 1JNSA 1N1AA 1W1YA 1EDQA 3RMEA 2M08A 3CGNA 1SYTA 1NMVA 1Y0OA 3B8SA 5JH8A 1ZBKA 1FFRA 2ZQTA 2KGJA 2A3AA 4IQ2A 5DIUA 2RUQA 4AY1A 3KZ7A 2XP5A 2XP4A 3B9DA 3RM9A 2ZR6A 4ODPA 1W1PA 2PV2A 2Q5AA 1PINA 4Q22A 4KR0B 1R9HA 3BXWA 2RURA 3TCZA 2RSEA 3AS1A 1LL4A 2XP7A 1E6RA 1EHNA 2KFWA 4PTMA 1EYMA 1LJYA 4URIA 4LAWA 2IUZA 3B7XA 2FDMA 4ZPTR 2MLZA 4ODKA 1LG1A 4DROA 2KR7A 4DT4A 2DG4A 1M5YA 3FY1A 3RM8A 1LQ0A 4ODMA 3ARWA 3ARUA 3KAIA 1J4RA 4DRJA 1B6CA 4W5UA 3VAWA 4KQZA 3WL1A 3WD2A 3AROA 4GGQA 3ODKA 4R0XA 1WNOA 2AWGA 4MNJA 1HKMA 4DRPA 2WK2A 1NMWA 2XP3A 4Z2JA 5HUAA 1E6NA 1ZCNA 2PV1A 4Q7NA 1ZU8A 3O5PA 3G6MA 3PRBA 1NWUA 5HWBA 4DIPA 5HBFA 3ARZA 3IKGA 4N19A 1RD6A 5DIVA 4DRHA 1FKRA 2B31A 1GPFA 1ZBVA 3OOBA 2PPOA 2OLHA 1FKLA 3O5EA 2XP8A 5D75A 4HBOA 2DT2A 4ZS6A 5GPGA 4DRMA 2ZQUA 4TW8A 4TW7A 4J4OA 2MLYA 3O5DA 1LL6A 4ZPVR 4LGXA 1F40A 1XHGA 5I98A 2PV3A 5DO2A 3IKDA 1P5QA 1NSGA 4W9PA 3CZ8A 2XPAA 4GIVA 5HW8A 2PI6A 3UI5A 1FKFA 1ROUA 2F21A 2XP6A 2ZQSA 1EQ3A 3ARRA 2MPHA 1NWTA 1JNEA 3W4RA 2VN1A 2F4EA 3RM4A 1HXVA 2D9FA 4P8XA 1H0IA 3IHZA 3PA7A 2YBTA 3KAHA 3G6LA 4ODRA 3KACA 5HT1A 4O2TA 1H0GA 4U85A 2KI3A 4JFKA 4U84A 4NZCA 5GQBA 1OGGA 2DSWA 4DRNA 1ZB5A 1W26A 2G8ZA 1HKJA 1UR8A 2A3BA 2KO7A 3UI6A 4NNRA 1PBKA 3UF8A 4WIWA 3O5QA 3B9EA 2YBUA 5B8IC 4P8VA 4XAKA 4JFJA 1D7HA 1Q1CA 4L72B 4QIBA 1NH6A 2G41A 1W9PA 2WM0A 3WIJA 3UQAA 4IT4A 1C9HA 1EIBA 4JYSA 4Z2LA 1XRVA 2QF8A 1ZBWA 1UR9A 4ITZA 1L1PA 2ZR4A 4WK9A 4DZ2A 1J6YA 3AQUA 1Q6IA 4DWSA 5J6EA 4JFIA 1W9UA 4DH0A 1FKKA 3O5FA 3O5JA 3KABA 3CHCA 2MLXA 4S3JA 5HTGA 4MSPA 3WD4A 2DSUA 1O6IA 3ALGA 3JYMA 2JZVA 2LGOA 1W9VA 3QOKA 2OFNA 3RFWA 4IQCA 4P8UA 3ARYA 1YATA 3ALFA 1X6LA 1FKIA 1ROTA 3ARVA 3O5MA 1IX5A 5DEZA 3H9RB 4DRKA 1YW5A 1OWQA 1QPLA 5GPRA 2LPVA 3KADA 4LAXA 3WQVA 3CHFA 4ML4A 4ZPWR 4L3NA 3LUOA 1SR0A 1ZL1A 4IPXA 3TC5A 1FKJA 3MDYB 3TDBA 1NWSA 1NWRA 1KT0A 4ODNA 4WKHA 1T11A 1ITXA 2PPNA 2DG9A 1E15A 4TNSA 3NI6A 3O5OA 2DT0A 3B9AA 1FKDA 3I6CA 4P8WA 1BKFA 2XPBA 3KCEA 2A3CA 4MTVA 2XP9A 3ARSA 4QZVB 1QPFA 2F2DA 3CHDA 1K9TA 1WB0A 3ARPA 3WL0A 1TCOC 2O9OA 3AS3A 1FFQA 4TX0A 4DZ3A 2DG3A 4WKAA 3IK8A 2N87A 3NTPA 4DWSB 4FN2A 3WD0A 4ODOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6C A;  2K8I A;  3VAW A;  3UI4 A;  4DRJ A;  2MNT A;  2IF4 A;  2MF9 A;  4ITZ A;  1FKB A;  4G2P A;  3EY6 A;  1L1P A;  2ZR4 A;  4GGQ A;  2FKE A;  3ODK A;  3JXV A;  1FKH A;  1D7J A;  4R0X A;  4ODO A;  2AWG A;  4DZ2 A;  1J6Y A;  1FKS A;  4DRP A;  1NMW A;  1Q6I A;  1FJD A;  4TW6 A;  5J6E A;  2XP3 A;  4JFI A;  2ZQV A;  3FAP A;  1FKT A;  5HUA A;  1JNT A;  1ZCN A;  2PV1 A;  1FD9 A;  4DH0 A;  1FKK A;  3O5F A;  5HW7 A;  3UQB A;  3O5P A;  3O5J A;  3KAB A;  1QZ2 A;  2MLX A;  2PBC A;  3PRB A;  5HTG A;  3CGM A;  3PRD A;  4MSP A;  5HW6 A;  5HWB A;  4DIP A;  3O5G A;  3O5I A;  3IKG A;  4N19 A;  3JYM A;  2JZV A;  5DIV A;  1D7I A;  2LGO A;  2RUC A;  4DRI A;  4BF8 A;  4DRH A;  4W9Q A;  1FKR A;  1Q6H A;  3OOB A;  4JFM A;  2OFN A;  4LAV A;  4MGV A;  2PPO A;  1FKL A;  3RGC A;  2LJ4 A;  3O5E A;  5DIT A;  2ITK A;  2XP8 A;  3RFW A;  5D75 A;  4DRM A;  3O5L A;  5GPG A;  3GPK A;  1BL4 A;  1FKG A;  2ZQU A;  4LAY A;  3O5K A;  4TW8 A;  4IQC A;  4J4O A;  1N1A A;  4TW7 A;  1JNS A;  2MLY A;  3O5D A;  1YAT A;  2M08 A;  3CGN A;  5HWC A;  1F40 A;  1NMV A;  5I98 A;  1FKI A;  1ROT A;  1Y0O A;  3O5M A;  2PV3 A;  3O5R A;  4QT2 A;  3H9R B;  4G50 A;  1J4I A;  1P5Q A;  1QPL A;  1NSG A;  1YW5 A;  2KGJ A;  2ZQT A;  3IKD A;  4J4N A;  4ODL A;  4W9P A;  4IQ2 A;  2XPA A;  4GIV A;  5DIU A;  5HW8 A;  2RUQ A;  2M2A A;  2LPV A;  3UI5 A;  1FKF A;  3KAD A;  4LAX A;  2Y78 A;  3KZ7 A;  2XP5 A;  1ROU A;  2F21 A;  2PPP A;  2XP4 A;  2XP6 A;  2ZQS A;  2ZR5 A;  1JVW A;  2RQS A;  2FAP A;  3LUO A;  1EQ3 A;  2MPH A;  2ZR6 A;  4ODP A;  2PV2 A;  2Q5A A;  1ZK6 A;  2RUD A;  1PIN A;  1F8A B;  2VN1 A;  4IPX A;  4TYO A;  3TC5 A;  1FKJ A;  3MDY B;  2M1I A;  3TDB A;  3WH0 A;  2F4E A;  4FAP A;  1KT0 A;  4ODN A;  1R9H A;  4C02 B;  2D9F A;  2UZ5 A;  1HXV A;  4JFL A;  1A7X A;  1KT1 A;  1T11 A;  2RUR A;  3IHZ A;  2PPN A;  3TCZ A;  2DG9 A;  3PA7 A;  3KAH A;  4TNS A;  4ODR A;  3KAC A;  5HT1 A;  4O2T A;  4U85 A;  3NI6 A;  2KI3 A;  4JFK A;  4U84 A;  1D6O A;  2RSE A;  3O5O A;  2KE0 A;  2XP7 A;  4DRN A;  4U86 A;  1U79 A;  1FKD A;  4DRQ A;  3I6C A;  4ODQ A;  1BKF A;  1W26 A;  2XPB A;  3KCE A;  2KFW A;  3JYJ A;  2KO7 A;  2XP9 A;  3UI6 A;  4NNR A;  1EYM A;  1PBK A;  5BXJ A;  3KAG A;  3UF8 A;  1QPF A;  2F2D A;  2L2S A;  3O5Q A;  4DRK A;  4LAW A;  4QT3 A;  5B8I C;  3B7X A;  1J4H A;  1TCO C;  4JFJ A;  5HKG A;  1D7H A;  2MLZ A;  4ODK A;  1Q1C A;  4TX0 A;  4DRO A;  1FAP A;  2KR7 A;  4DZ3 A;  4QIB A;  2DG3 A;  4DT4 A;  4W9O A;  3NRK A;  3IK8 A;  2DG4 A;  2N87 A;  1M5Y A;  3KAF A;  3NTP A;  3UQI A;  2LKN A;  3UQA A;  1C9H A;  2VCD A;  4FN2 A;  4ODM A;  3KAI A;  1J4R A;  1Q6U A;  4JYS A; 
#chains in the Genus database with same CATH topology
 2DT3 A;  2MNT A;  2IF4 A;  1FKB A;  4G2P A;  3WD3 A;  1GUV A;  3EY6 A;  2DT1 A;  2FKE A;  2ETN A;  1FKS A;  1KFW A;  4DWS D;  1GRJ A;  4TW6 A;  4DWS C;  1FKT A;  1FD9 A;  3FXY A;  1QZ2 A;  4MAV A;  2PBC A;  1JND A;  1E9L A;  3O5G A;  3O5I A;  1X6N A;  4R5E A;  2RUC A;  4DRI A;  4W9Q A;  4MNM A;  3WD1 A;  4Z2K A;  1Q6H A;  4JFM A;  5DF0 A;  3RGC A;  2LJ4 A;  1HJX A;  5DIT A;  1W1V A;  1BL4 A;  2AOS A;  1FKG A;  3O5K A;  4WKF A;  5HWC A;  2WLZ A;  3WKZ A;  3CHE A;  3O5R A;  4QT2 A;  4G50 A;  1J4I A;  4J4N A;  4ODL A;  1TFV A;  4HBE A;  2M2A A;  3AS2 A;  3ART A;  2Y78 A;  2ZR5 A;  2PPP A;  1LG2 A;  1JVW A;  2RQS A;  2FAP A;  2DSV A;  1GOI A;  3ARX A;  2O92 A;  1ZK6 A;  2RUD A;  3OA5 A;  1F8A B;  1HKK A;  4NSB A;  4TYO A;  3WH0 A;  2M1I A;  4FAP A;  4C02 B;  2UZ5 A;  4Z2I A;  4JFL A;  1A7X A;  1KT1 A;  1LL7 A;  1OGB A;  2ESC A;  4IT6 A;  1D6O A;  2KE0 A;  4U86 A;  1U79 A;  4DRQ A;  2WLY A;  4ODQ A;  2DPE A;  3JYJ A;  5BXJ A;  2F23 A;  1CTN A;  3KAG A;  2L2S A;  4HAR A;  4QT3 A;  1HJW A;  1J4H A;  5HKG A;  1FAP A;  1E6Z A;  4W9O A;  3NRK A;  3KAF A;  3UQI A;  2LKN A;  4MNL A;  4WJX A;  4Z2H A;  2VCD A;  4MNK A;  3CH9 A;  1Q6U A;  2DSZ A;  2K8I A;  1HJV A;  3ARQ A;  3UI4 A;  2MF9 A;  1W1T A;  1D2K A;  3JXV A;  1FKH A;  1D7J A;  1WAW A;  3PRA A;  2A3E A;  3WQW A;  4MPK A;  4Z2G A;  1FJD A;  3PR9 A;  2ZQV A;  3FAP A;  4UDM A;  1JNT A;  1HKI A;  5HW7 A;  1ZBC A;  3UQB A;  3AS0 A;  3CGM A;  3PRD A;  5HW6 A;  4S3K A;  1D7I A;  4BF8 A;  1VF8 A;  4LAV A;  1E6P A;  4MGV A;  2ITK A;  3O5L A;  3GPK A;  4LAY A;  1JNS A;  1N1A A;  1W1Y A;  1EDQ A;  3RME A;  2M08 A;  3CGN A;  1SYT A;  1NMV A;  1Y0O A;  3B8S A;  5JH8 A;  1ZBK A;  1FFR A;  2ZQT A;  2KGJ A;  2A3A A;  4IQ2 A;  5DIU A;  2RUQ A;  4AY1 A;  3KZ7 A;  2XP5 A;  2XP4 A;  3B9D A;  2P4V A;  3RM9 A;  2ZR6 A;  4ODP A;  1W1P A;  2PV2 A;  2Q5A A;  1PIN A;  4Q22 A;  4KR0 B;  1R9H A;  3BXW A;  2RUR A;  3TCZ A;  2RSE A;  3AS1 A;  1LL4 A;  2XP7 A;  1E6R A;  1EHN A;  2KFW A;  3BMB A;  4PTM A;  1EYM A;  1LJY A;  4URI A;  4LAW A;  2IUZ A;  3B7X A;  2FDM A;  4ZPT R;  2MLZ A;  4ODK A;  1LG1 A;  4DRO A;  2KR7 A;  4DT4 A;  2DG4 A;  1M5Y A;  3FY1 A;  3RM8 A;  1LQ0 A;  4ODM A;  3ARW A;  3ARU A;  3KAI A;  1J4R A;  4DRJ A;  1B6C A;  4W5U A;  3VAW A;  4KQZ A;  3WL1 A;  3WD2 A;  3ARO A;  4GGQ A;  3ODK A;  4R0X A;  1WNO A;  2AWG A;  4MNJ A;  1HKM A;  4DRP A;  2WK2 A;  1NMW A;  2XP3 A;  4Z2J A;  5HUA A;  1E6N A;  1ZCN A;  2PV1 A;  4Q7N A;  1ZU8 A;  3O5P A;  3G6M A;  2PN0 A;  3PRB A;  1NWU A;  5HWB A;  4DIP A;  5HBF A;  3ARZ A;  3IKG A;  4N19 A;  1RD6 A;  5DIV A;  4DRH A;  1FKR A;  2B31 A;  1GPF A;  1ZBV A;  3OOB A;  2PPO A;  2OLH A;  1FKL A;  3O5E A;  2XP8 A;  5D75 A;  4HBO A;  2DT2 A;  4ZS6 A;  5GPG A;  4DRM A;  2ZQU A;  4TW8 A;  4TW7 A;  4J4O A;  2MLY A;  3O5D A;  1LL6 A;  4ZPV R;  4LGX A;  1F40 A;  1XHG A;  5I98 A;  2PV3 A;  5DO2 A;  2B5U B;  3IKD A;  1P5Q A;  1NSG A;  4W9P A;  3CZ8 A;  2XPA A;  4GIV A;  5HW8 A;  2PI6 A;  3UI5 A;  1FKF A;  1ROU A;  2F21 A;  2XP6 A;  2ZQS A;  1EQ3 A;  3ARR A;  2MPH A;  1NWT A;  1JNE A;  3W4R A;  2VN1 A;  2F4E A;  3RM4 A;  1HXV A;  2D9F A;  4P8X A;  1H0I A;  3IHZ A;  3PA7 A;  2YBT A;  3KAH A;  3G6L A;  4ODR A;  3KAC A;  5HT1 A;  4O2T A;  1H0G A;  4U85 A;  2KI3 A;  4JFK A;  4U84 A;  4NZC A;  5GQB A;  1OGG A;  2DSW A;  4DRN A;  1ZB5 A;  1E44 A;  1W26 A;  2G8Z A;  1HKJ A;  1UR8 A;  2A3B A;  2KO7 A;  3UI6 A;  4NNR A;  1PBK A;  3UF8 A;  4WIW A;  3O5Q A;  3B9E A;  2YBU A;  5B8I C;  4P8V A;  4XAK A;  4JFJ A;  1D7H A;  1Q1C A;  4L72 B;  4QIB A;  1NH6 A;  2G41 A;  1W9P A;  2WM0 A;  3WIJ A;  3UQA A;  4IT4 A;  1C9H A;  1EIB A;  4JYS A;  4Z2L A;  1XRV A;  2QF8 A;  1ZBW A;  1UR9 A;  4ITZ A;  1L1P A;  2ZR4 A;  3GTY X;  4WK9 A;  4DZ2 A;  1J6Y A;  3AQU A;  3EIP A;  1Q6I A;  4DWS A;  5J6E A;  4JFI A;  1W9U A;  4DH0 A;  1FKK A;  3O5F A;  3O5J A;  3KAB A;  3CHC A;  2MLX A;  4S3J A;  5HTG A;  4MSP A;  3WD4 A;  2DSU A;  1O6I A;  3ALG A;  3JYM A;  2JZV A;  2LGO A;  1W9V A;  3QOK A;  2OFN A;  3RFW A;  4IQC A;  4P8U A;  3ARY A;  1YAT A;  3ALF A;  1X6L A;  1FKI A;  1ROT A;  3ARV A;  3O5M A;  1IX5 A;  5DEZ A;  3H9R B;  4DRK A;  1YW5 A;  1OWQ A;  1QPL A;  5GPR A;  1JCH B;  2LPV A;  3KAD A;  4LAX A;  3WQV A;  3CHF A;  4ML4 A;  4ZPW R;  4L3N A;  3LUO A;  1SR0 A;  1ZL1 A;  4IPX A;  3TC5 A;  1FKJ A;  3MDY B;  3TDB A;  1NWS A;  1NWR A;  1KT0 A;  4ODN A;  4WKH A;  1T11 A;  1ITX A;  2PPN A;  2DG9 A;  1E15 A;  4TNS A;  3NI6 A;  3O5O A;  2DT0 A;  3B9A A;  1FKD A;  3I6C A;  4P8W A;  1BKF A;  2XPB A;  3KCE A;  2A3C A;  4MTV A;  2XP9 A;  3ARS A;  4QZV B;  1QPF A;  2F2D A;  3CHD A;  1K9T A;  1WB0 A;  3ARP A;  3WL0 A;  1TCO C;  2O9O A;  3AS3 A;  1FFQ A;  2EUL A;  4TX0 A;  4DZ3 A;  2DG3 A;  4WKA A;  3IK8 A;  2N87 A;  3NTP A;  4DWS B;  3GU0 A;  4FN2 A;  3WD0 A;  4ODO A; 
#chains in the Genus database with same CATH homology
 2DT3 A;  2MNT A;  2IF4 A;  1FKB A;  4G2P A;  3WD3 A;  1GUV A;  3EY6 A;  2DT1 A;  2FKE A;  1FKS A;  1KFW A;  4DWS D;  4TW6 A;  4DWS C;  1FKT A;  1FD9 A;  3FXY A;  1QZ2 A;  4MAV A;  2PBC A;  1JND A;  1E9L A;  3O5G A;  3O5I A;  1X6N A;  4R5E A;  2RUC A;  4DRI A;  4W9Q A;  4MNM A;  3WD1 A;  4Z2K A;  1Q6H A;  4JFM A;  5DF0 A;  3RGC A;  2LJ4 A;  1HJX A;  5DIT A;  1W1V A;  1BL4 A;  2AOS A;  1FKG A;  3O5K A;  4WKF A;  5HWC A;  2WLZ A;  3WKZ A;  3CHE A;  3O5R A;  4QT2 A;  4G50 A;  1J4I A;  4J4N A;  4ODL A;  1TFV A;  4HBE A;  2M2A A;  3AS2 A;  3ART A;  2Y78 A;  2ZR5 A;  2PPP A;  1LG2 A;  1JVW A;  2RQS A;  2FAP A;  2DSV A;  1GOI A;  3ARX A;  2O92 A;  1ZK6 A;  2RUD A;  3OA5 A;  1F8A B;  1HKK A;  4NSB A;  4TYO A;  3WH0 A;  2M1I A;  4FAP A;  4C02 B;  2UZ5 A;  4Z2I A;  4JFL A;  1A7X A;  1KT1 A;  1LL7 A;  1OGB A;  2ESC A;  4IT6 A;  1D6O A;  2KE0 A;  4U86 A;  1U79 A;  4DRQ A;  2WLY A;  4ODQ A;  2DPE A;  3JYJ A;  5BXJ A;  1CTN A;  3KAG A;  2L2S A;  4HAR A;  4QT3 A;  1HJW A;  1J4H A;  5HKG A;  1FAP A;  1E6Z A;  4W9O A;  3NRK A;  3KAF A;  3UQI A;  2LKN A;  4MNL A;  4WJX A;  4Z2H A;  2VCD A;  4MNK A;  3CH9 A;  1Q6U A;  2DSZ A;  2K8I A;  1HJV A;  3ARQ A;  3UI4 A;  2MF9 A;  1W1T A;  1D2K A;  3JXV A;  1FKH A;  1D7J A;  1WAW A;  3PRA A;  2A3E A;  3WQW A;  4MPK A;  4Z2G A;  1FJD A;  3PR9 A;  2ZQV A;  3FAP A;  1JNT A;  1HKI A;  5HW7 A;  1ZBC A;  3UQB A;  3AS0 A;  3CGM A;  3PRD A;  5HW6 A;  4S3K A;  1D7I A;  4BF8 A;  1VF8 A;  4LAV A;  1E6P A;  4MGV A;  2ITK A;  3O5L A;  3GPK A;  4LAY A;  1JNS A;  1N1A A;  1W1Y A;  1EDQ A;  3RME A;  2M08 A;  3CGN A;  1SYT A;  1NMV A;  1Y0O A;  3B8S A;  5JH8 A;  1ZBK A;  1FFR A;  2ZQT A;  2KGJ A;  2A3A A;  4IQ2 A;  5DIU A;  2RUQ A;  4AY1 A;  3KZ7 A;  2XP5 A;  2XP4 A;  3B9D A;  3RM9 A;  2ZR6 A;  4ODP A;  1W1P A;  2PV2 A;  2Q5A A;  1PIN A;  4Q22 A;  4KR0 B;  1R9H A;  3BXW A;  2RUR A;  3TCZ A;  2RSE A;  3AS1 A;  1LL4 A;  2XP7 A;  1E6R A;  1EHN A;  2KFW A;  4PTM A;  1EYM A;  1LJY A;  4URI A;  4LAW A;  2IUZ A;  3B7X A;  2FDM A;  4ZPT R;  2MLZ A;  4ODK A;  1LG1 A;  4DRO A;  2KR7 A;  4DT4 A;  2DG4 A;  1M5Y A;  3FY1 A;  3RM8 A;  1LQ0 A;  4ODM A;  3ARW A;  3ARU A;  3KAI A;  1J4R A;  4DRJ A;  1B6C A;  4W5U A;  3VAW A;  4KQZ A;  3WL1 A;  3WD2 A;  3ARO A;  4GGQ A;  3ODK A;  4R0X A;  1WNO A;  2AWG A;  4MNJ A;  1HKM A;  4DRP A;  2WK2 A;  1NMW A;  2XP3 A;  4Z2J A;  5HUA A;  1E6N A;  1ZCN A;  2PV1 A;  4Q7N A;  1ZU8 A;  3O5P A;  3G6M A;  3PRB A;  1NWU A;  5HWB A;  4DIP A;  5HBF A;  3ARZ A;  3IKG A;  4N19 A;  1RD6 A;  5DIV A;  4DRH A;  1FKR A;  2B31 A;  1GPF A;  1ZBV A;  3OOB A;  2PPO A;  2OLH A;  1FKL A;  3O5E A;  2XP8 A;  5D75 A;  4HBO A;  2DT2 A;  4ZS6 A;  5GPG A;  4DRM A;  2ZQU A;  4TW8 A;  4TW7 A;  4J4O A;  2MLY A;  3O5D A;  1LL6 A;  4ZPV R;  4LGX A;  1F40 A;  1XHG A;  5I98 A;  2PV3 A;  5DO2 A;  3IKD A;  1P5Q A;  1NSG A;  4W9P A;  3CZ8 A;  2XPA A;  4GIV A;  5HW8 A;  2PI6 A;  3UI5 A;  1FKF A;  1ROU A;  2F21 A;  2XP6 A;  2ZQS A;  1EQ3 A;  3ARR A;  2MPH A;  1NWT A;  1JNE A;  3W4R A;  2VN1 A;  2F4E A;  3RM4 A;  1HXV A;  2D9F A;  4P8X A;  1H0I A;  3IHZ A;  3PA7 A;  2YBT A;  3KAH A;  3G6L A;  4ODR A;  3KAC A;  5HT1 A;  4O2T A;  1H0G A;  4U85 A;  2KI3 A;  4JFK A;  4U84 A;  4NZC A;  5GQB A;  1OGG A;  2DSW A;  4DRN A;  1ZB5 A;  1W26 A;  2G8Z A;  1HKJ A;  1UR8 A;  2A3B A;  2KO7 A;  3UI6 A;  4NNR A;  1PBK A;  3UF8 A;  4WIW A;  3O5Q A;  3B9E A;  2YBU A;  5B8I C;  4P8V A;  4XAK A;  4JFJ A;  1D7H A;  1Q1C A;  4L72 B;  4QIB A;  1NH6 A;  2G41 A;  1W9P A;  2WM0 A;  3WIJ A;  3UQA A;  4IT4 A;  1C9H A;  1EIB A;  4JYS A;  4Z2L A;  1XRV A;  2QF8 A;  1ZBW A;  1UR9 A;  4ITZ A;  1L1P A;  2ZR4 A;  4WK9 A;  4DZ2 A;  1J6Y A;  3AQU A;  1Q6I A;  4DWS A;  5J6E A;  4JFI A;  1W9U A;  4DH0 A;  1FKK A;  3O5F A;  3O5J A;  3KAB A;  3CHC A;  2MLX A;  4S3J A;  5HTG A;  4MSP A;  3WD4 A;  2DSU A;  1O6I A;  3ALG A;  3JYM A;  2JZV A;  2LGO A;  1W9V A;  3QOK A;  2OFN A;  3RFW A;  4IQC A;  4P8U A;  3ARY A;  1YAT A;  3ALF A;  1X6L A;  1FKI A;  1ROT A;  3ARV A;  3O5M A;  1IX5 A;  5DEZ A;  3H9R B;  4DRK A;  1YW5 A;  1OWQ A;  1QPL A;  5GPR A;  2LPV A;  3KAD A;  4LAX A;  3WQV A;  3CHF A;  4ML4 A;  4ZPW R;  4L3N A;  3LUO A;  1SR0 A;  1ZL1 A;  4IPX A;  3TC5 A;  1FKJ A;  3MDY B;  3TDB A;  1NWS A;  1NWR A;  1KT0 A;  4ODN A;  4WKH A;  1T11 A;  1ITX A;  2PPN A;  2DG9 A;  1E15 A;  4TNS A;  3NI6 A;  3O5O A;  2DT0 A;  3B9A A;  1FKD A;  3I6C A;  4P8W A;  1BKF A;  2XPB A;  3KCE A;  2A3C A;  4MTV A;  2XP9 A;  3ARS A;  4QZV B;  1QPF A;  2F2D A;  3CHD A;  1K9T A;  1WB0 A;  3ARP A;  3WL0 A;  1TCO C;  2O9O A;  3AS3 A;  1FFQ A;  4TX0 A;  4DZ3 A;  2DG3 A;  4WKA A;  3IK8 A;  2N87 A;  3NTP A;  4DWS B;  4FN2 A;  3WD0 A;  4ODO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...