3O5QA

Fk1 domain mutant a19t of fkbp51, crystal form iv, in presence of dmso
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5qA00
2PV2A 3KADA 1T11A 1U79A 3UI4A 3JXVA 2DG3A 2ZQSA 1FKBA 2RURA 4QT3A 1FKDA 1D7JA 2XP8A 1FKHA 3KCEA 3O5OA 3O5PA 1EYMA 1BKFA 4J4NA 3FAPA 2Q5AA 3IK8A 1J4HA 3O5GA 4LAWA 2KI3A 4O2TA 3RGCA 2IF4A 3O5LA 1KT1A 4DRNA 2FKEA 2MNTA 3H9RB 4JFJA 4W9PA 2RQSA 2ITKA 3B7XA 4ODPA 2ZR4A 3UF8A 1FKRA 3NRKA 2XP5A 4G2PA 1ROUA 1YW5A 2LKNA 1L1PA 5DIVA 4MGVA 3UQBA 1JVWA 4DRIA 3UQAA 1D7IA 2PPOA 2M08A 3TDBA 3UI6A 2PPNA 2MLYA 2N87A 4LAXA 4JFKA 3PA7A 4GGQA 1N1AA 4LAVA 2MF9A 5BXJA 1F40A 3UI5A 2KO7A 1Q6HA 5HKGA 3I6CA 2D9FA 5B8IC 4ODQA 4BF8A 1ZK6A 3GPKA 5DITA 1EQ3A 4W9QA 4W9OA 2RSEA 2XPAA 2XP9A 5I98A 4QIBA 2LJ4A 4TW8A 4TYOA 1Q1CA 2RUDA 3PRBA 3RFWA 4DRJA 2VCDA 2XP6A 3WH0A 1QPLA 2F4EA 4MSPA 1Q6IA 2FAPA 1YATA 2OFNA 2PBCA 3PRDA 4N19A 1J4RA 4TW7A 2KGJA 1NMVA 4QT2A 1Q6UA 2ZQTA 1FD9A 4DZ3A 2UZ5A 5HUAA 2VN1A 4ODMA 4DIPA 2ZQVA 3KAIA 5GPGA 1R9HA 1FKKA 1TCOC 1W26A 2DG9A 1F8AB 2KFWA 4JFIA 2XPBA 3IKGA 3TC5A 4ODLA 4IQ2A 1A7XA 4LAYA 2ZR5A 1ROTA 2PV3A 2KR7A 2K8IA 5HW6A 2M1IA 3VAWA 2RUCA 1FKSA 4U84A 3MDYB 3O5EA 4JFLA 2Y78A 1J4IA 3EY6A 3TCZA 3UQIA 1FJDA 4ODOA 2M2AA 3KABA 4DRKA 4DROA 4G50A 3IHZA 4DRHA 4ITZA 2MLZA 3O5DA 3O5IA 5HTGA 1Y0OA 5J6EA 5HW8A 4R0XA 3O5JA 1D7HA 4U85A 3NI6A 2MPHA 2LPVA 1ZCNA 3OOBA 3O5KA 3CGMA 4C02B 2F21A 4IPXA 3NTPA 4TNSA 4ODRA 2XP4A 3O5QA 4GIVA 4ODKA 2XP7A 1FKIA 4DRMA 2LGOA 3LUOA 4JFMA 5HW7A 1JNSA 3CGNA 4DT4A 3JYMA 2JZVA 1HXVA 3KZ7A 1FAPA 1M5YA 2PV1A 1QPFA 1QZ2A 2ZR6A 3JYJA 4DZ2A 1J6YA 3KAHA 4FAPA 3O5FA 1B6CA 1FKFA 2KE0A 2DG4A 3KACA 3O5MA 4DH0A 1FKGA 2XP3A 2ZQUA 4FN2A 2PPPA 4NNRA 1JNTA 1KT0A 2MLXA 3O5RA 4ODNA 1P5QA 5D75A 1BL4A 1FKTA 1FKJA 1PBKA 3KAFA 4TX0A 4DRQA 4DRPA 2RUQA 5HWBA 5HWCA 5HT1A 2F2DA 1PINA 4TW6A 5DIUA 3IKDA 4U86A 4J4OA 2AWGA 3ODKA 2L2SA 1NSGA 1C9HA 1NMWA 4JYSA 3KAGA 4IQCA 1D6OA 1FKLA
chains in the Genus database with same CATH superfamily
1W9UA 2OLHA 3RM4A 2DG3A 1EHNA 2ZQSA 4QT3A 4LAWA 4ZPTR 3VAWA 3O5GA 1NWSA 2IF4A 1LL4A 2RQSA 2ZR4A 2DSUA 4G2PA 1NH6A 1YW5A 2LKNA 1ZB5A 3UQAA 2WLYA 2M08A 3WL1A 2PPNA 4P8VA 4JFKA 3QOKA 1WAWA 1ZL1A 2D9FA 4WIWA 4ODQA 1GUVA 1UR8A 3GTYX 2RUDA 1QPLA 1ZBVA 2F4EA 4MNJA 1J4RA 1EDQA 1Q6UA 4LGXA 2VN1A 4DIPA 1W9VA 1FKKA 1W26A 4JFIA 2XPBA 1XRVA 4ODLA 2ZR5A 2PI6A 2RUCA 3O5EA 3GU0A 1E15A 4MNMA 2M2AA 4WK9A 2A3AA 3O5DA 3O5IA 1W1VA 3O5JA 2WK2A 2YBUA 2MPHA 2YBTA 1IX5A 3OOBA 1E6NA 1HJVA 4ODRA 3WKZA 2XP7A 1FKIA 4DRMA 2LGOA 5HW7A 4DWSB 3ARQA 1FFRA 3FY1A 1H0IA 2DT1A 1FAPA 3ARVA 4HBEA 1GOIA 1QZ2A 4QZVB 2DG4A 1NWUA 4L72B 1FKGA 2A3BA 3G6LA 4NNRA 2MLXA 3CHFA 4MTVA 1H0GA 2WLZA 1BL4A 1FKTA 5HWBA 1E9LA 2F2DA 1HJWA 3FXYA 5DIUA 4U86A 2AWGA 5JH8A 4IQCA 3ODKA 4L3NA 3WD1A 4DRIA 2DT0A 3AROA 3UI4A 3JXVA 1FKBA 1X6LA 2RURA 3KCEA 2XP8A 3ARRA 3FAPA 3IK8A 2KI3A 3CHEA 4DRNA 2FKEA 2MNTA 4JFJA 3NRKA 2XP5A 1L1PA 2P4VA 3ARXA 3UQBA 4Z2KA 1D7IA 2PPOA 1OGBA 1E6RA 1HKKA 3ARWA 5BXJA 1LQ0A 1F40A 2KO7A 3WD3A 3ALFA 5HKGA 1JNEA 3I6CA 4W9OA 2RSEA 3RM9A 2PN0A 1EIBA 2XPAA 4QIBA 4DRJA 3CHDA 3ARPA 4MSPA 3AS0A 2FAPA 1YATA 1VF8A 1E6ZA 1NMVA 2ZQTA 4IT6A 3KAIA 2DG9A 3B9EA 3IKGA 4ZS6A 1HKIA 4LAYA 2AOSA 2K8IA 4W5UA 4JFLA 3TCZA 4Z2GA 4S3JA 3KABA 3WD0A 4DRHA 1JCHB 5HTGA 1CTNA 2ETNA 4U85A 1D7HA 3OA5A 1ZCNA 2F21A 4URIA 1D2KA 2XP4A 4ODKA 4DWSC 4JFMA 3W4RA 4DT4A 3JYMA 1LG2A 3B8SA 4WKAA 1M5YA 2PV1A 2ZR6A 1SR0A 3AS1A 3O5FA 1B6CA 2KE0A 3O5MA 2ZQUA 4FN2A 2PPPA 1NWRA 3WQVA 3O5RA 3ARZA 4Z2LA 4DRQA 1PBKA 4TX0A 4TW6A 2QF8A 1JNDA 1W9PA 2L2SA 2A3EA 2WM0A 2PV2A 1T11A 1U79A 3WD2A 4HBOA 4S3KA 2DSWA 1FKDA 3O5PA 1EYMA 2O9OA 1J4HA 5DEZA 2G8ZA 4XAKA 3PRAA 3WIJA 3ARYA 4NZCA 2ITKA 3B7XA 1E44A 3B9DA 3UF8A 1FKRA 3ARSA 3CHCA 5DIVA 3EIPA 3TDBA 3UI6A 2MLYA 2N87A 4GGQA 4MAVA 2MF9A 1Q6HA 3AQUA 1ZK6A 4P8XA 2XP9A 4WKHA 5I98A 2LJ4A 4TW8A 1ZU8A 1Q1CA 3PRBA 4TYOA 3WQWA 2XP6A 3WH0A 1Q6IA 2OFNA 2PBCA 4N19A 4TW7A 2KGJA 1D6OA 3BXWA 5HUAA 4ODMA 1ZBWA 2ZQVA 5GPGA 1HJXA 3AS3A 1R9HA 3TC5A 1W1YA 4IQ2A 1A7XA 2KR7A 1K9TA 4R5EA 5DF0A 1FKSA 4U84A 3G6MA 3AS2A 1J4IA 1FJDA 4DRKA 3IHZA 4ITZA 5J6EA 5HW8A 4R0XA 3CGMA 4IPXA 5GQBA 3BMBA 3NTPA 2FDMA 4GIVA 1KFWA 4KR0B 3RMEA 3CGNA 1LL7A 1WB0A 2JZVA 3KZ7A 4ML4A 3JYJA 1QPFA 2ESCA 1XHGA 1J6YA 3KAHA 1ZBKA 3KACA 4DH0A 2XP3A 1JNTA 1KT0A 4ODNA 1X6NA 3KAFA 4DRPA 5HWCA 5HT1A 3WD4A 3IKDA 4UDMA 1GRJA 1E6PA 1NMWA 4Q22A 3KAGA 1FKLA 4DWSD 3ARUA 3KADA 1WNOA 2IUZA 3CH9A 3RM8A 1TFVA 3O5OA 1D7JA 1FKHA 2B5UB 1BKFA 2DSVA 2DT3A 2Q5AA 1LL6A 1OGGA 4J4NA 4O2TA 3RGCA 2DSZA 3O5LA 1KT1A 4WJXA 3H9RB 4W9PA 4ODPA 4Z2HA 4Q7NA 1ROUA 1OWQA 4MGVA 1JVWA 3ALGA 1NWTA 4LAXA 3PA7A 4LAVA 1N1AA 3UI5A 1W1PA 3B9AA 5B8IC 4WKFA 4BF8A 3GPKA 5DITA 1EQ3A 4W9QA 1LJYA 1LG1A 4HARA 3RFWA 4ZPWR 2B31A 2VCDA 3CZ8A 3PRDA 4P8WA 4QT2A 1FD9A 4DZ3A 2UZ5A 2F23A 3ARTA 4Z2IA 4NSBA 1TCOC 2KFWA 1ITXA 1F8AB 2DPEA 1ROTA 2PV3A 1SYTA 5HW6A 2M1IA 1W1TA 3MDYB 2A3CA 2Y78A 3EY6A 3UQIA 5GPRA 4ODOA 4PTMA 4MPKA 4DROA 4G50A 2MLZA 4DWSA 1Y0OA 1HKMA 4AY1A 4P8UA 3NI6A 2LPVA 3WL0A 4C02B 3O5KA 4TNSA 1ZBCA 2DT2A 3O5QA 3LUOA 1JNSA 4Z2JA 4KQZA 5HBFA 4MNLA 1HXVA 4MNKA 1GPFA 4IT4A 4DZ2A 4FAPA 1FKFA 1HKJA 5DO2A 1P5QA 5D75A 1UR9A 1RD6A 1FKJA 3PR9A 2RUQA 1O6IA 1PINA 4ZPVR 1FFQA 4J4OA 1NSGA 1C9HA 2EULA 2O92A 4JYSA 2G41A
chains in the Genus database with same CATH topology
1W9UA 2OLHA 3RM4A 2DG3A 1EHNA 2ZQSA 4QT3A 4LAWA 4ZPTR 3VAWA 3O5GA 1NWSA 2IF4A 1LL4A 2RQSA 2ZR4A 2DSUA 4G2PA 1NH6A 1YW5A 2LKNA 1ZB5A 3UQAA 2WLYA 2M08A 3WL1A 2PPNA 4P8VA 4JFKA 3QOKA 1WAWA 1ZL1A 2D9FA 4WIWA 4ODQA 1GUVA 1UR8A 2RUDA 1QPLA 1ZBVA 2F4EA 4MNJA 1J4RA 1EDQA 1Q6UA 4LGXA 2VN1A 4DIPA 1W9VA 1FKKA 1W26A 4JFIA 2XPBA 1XRVA 4ODLA 2ZR5A 2PI6A 2RUCA 3O5EA 1E15A 4MNMA 2M2AA 4WK9A 2A3AA 3O5DA 3O5IA 1W1VA 3O5JA 2WK2A 2YBUA 2MPHA 2YBTA 1IX5A 3OOBA 1E6NA 1HJVA 4ODRA 3WKZA 2XP7A 1FKIA 4DRMA 2LGOA 5HW7A 4DWSB 3ARQA 1FFRA 3FY1A 1H0IA 2DT1A 1FAPA 3ARVA 4HBEA 1GOIA 1QZ2A 4QZVB 2DG4A 1NWUA 4L72B 1FKGA 2A3BA 3G6LA 4NNRA 2MLXA 3CHFA 4MTVA 1H0GA 2WLZA 1BL4A 1FKTA 5HWBA 1E9LA 2F2DA 1HJWA 3FXYA 5DIUA 4U86A 2AWGA 5JH8A 4IQCA 3ODKA 4L3NA 3WD1A 4DRIA 2DT0A 3AROA 3UI4A 3JXVA 1FKBA 1X6LA 2RURA 3KCEA 2XP8A 3ARRA 3FAPA 3IK8A 2KI3A 3CHEA 4DRNA 2FKEA 2MNTA 4JFJA 3NRKA 2XP5A 1L1PA 3ARXA 3UQBA 4Z2KA 1D7IA 2PPOA 1OGBA 1E6RA 1HKKA 3ARWA 5BXJA 1LQ0A 1F40A 2KO7A 3WD3A 3ALFA 5HKGA 1JNEA 3I6CA 4W9OA 2RSEA 3RM9A 2XPAA 1EIBA 4QIBA 4DRJA 3CHDA 3ARPA 4MSPA 3AS0A 2FAPA 1YATA 1VF8A 1E6ZA 1NMVA 2ZQTA 4IT6A 3KAIA 2DG9A 3B9EA 3IKGA 4ZS6A 1HKIA 4LAYA 2AOSA 2K8IA 4W5UA 4JFLA 3TCZA 4Z2GA 4S3JA 3KABA 3WD0A 4DRHA 5HTGA 1CTNA 4U85A 1D7HA 3OA5A 1ZCNA 2F21A 4URIA 1D2KA 2XP4A 4ODKA 4DWSC 4JFMA 3W4RA 4DT4A 3JYMA 1LG2A 3B8SA 4WKAA 1M5YA 2PV1A 2ZR6A 1SR0A 3AS1A 3O5FA 1B6CA 2KE0A 3O5MA 2ZQUA 4FN2A 2PPPA 1NWRA 3WQVA 3O5RA 3ARZA 4Z2LA 4DRQA 1PBKA 4TX0A 4TW6A 2QF8A 1JNDA 1W9PA 2L2SA 2A3EA 2WM0A 2PV2A 1T11A 1U79A 3WD2A 4HBOA 4S3KA 2DSWA 1FKDA 3O5PA 1EYMA 2O9OA 1J4HA 5DEZA 2G8ZA 4XAKA 3PRAA 3WIJA 3ARYA 4NZCA 2ITKA 3B7XA 3B9DA 3UF8A 1FKRA 3ARSA 3CHCA 5DIVA 3TDBA 3UI6A 2MLYA 2N87A 4GGQA 4MAVA 2MF9A 1Q6HA 3AQUA 1ZK6A 4P8XA 2XP9A 4WKHA 5I98A 2LJ4A 4TW8A 1ZU8A 1Q1CA 3PRBA 4TYOA 3WQWA 2XP6A 3WH0A 1Q6IA 2OFNA 2PBCA 4N19A 4TW7A 2KGJA 1D6OA 3BXWA 5HUAA 4ODMA 1ZBWA 2ZQVA 5GPGA 1HJXA 3AS3A 1R9HA 3TC5A 1W1YA 4IQ2A 1A7XA 2KR7A 1K9TA 4R5EA 5DF0A 1FKSA 4U84A 3G6MA 3AS2A 1J4IA 1FJDA 4DRKA 3IHZA 4ITZA 5J6EA 5HW8A 4R0XA 3CGMA 4IPXA 5GQBA 3NTPA 2FDMA 4GIVA 1KFWA 4KR0B 3RMEA 3CGNA 1LL7A 1WB0A 2JZVA 3KZ7A 4ML4A 3JYJA 1QPFA 2ESCA 1XHGA 1J6YA 3KAHA 1ZBKA 3KACA 4DH0A 2XP3A 1JNTA 1KT0A 4ODNA 1X6NA 3KAFA 4DRPA 5HWCA 5HT1A 3WD4A 3IKDA 1E6PA 1NMWA 4Q22A 3KAGA 1FKLA 4DWSD 3ARUA 3KADA 1WNOA 2IUZA 3CH9A 3RM8A 1TFVA 3O5OA 1D7JA 1FKHA 4J4NA 1BKFA 2DSVA 2DT3A 2Q5AA 1LL6A 1OGGA 4O2TA 3RGCA 2DSZA 3O5LA 1KT1A 4WJXA 3H9RB 4W9PA 4ODPA 4Z2HA 4Q7NA 1ROUA 1OWQA 4MGVA 1JVWA 3ALGA 1NWTA 4LAXA 3PA7A 4LAVA 1N1AA 3UI5A 1W1PA 3B9AA 5B8IC 4WKFA 4BF8A 3GPKA 5DITA 1EQ3A 4W9QA 1LJYA 1LG1A 4HARA 3RFWA 4ZPWR 2B31A 2VCDA 3CZ8A 3PRDA 4P8WA 4QT2A 1FD9A 4DZ3A 2UZ5A 3ARTA 4Z2IA 4NSBA 1TCOC 2KFWA 1ITXA 1F8AB 2DPEA 1ROTA 2PV3A 1SYTA 5HW6A 2M1IA 1W1TA 3MDYB 2A3CA 2Y78A 3EY6A 3UQIA 5GPRA 4ODOA 4PTMA 4MPKA 4DROA 4G50A 2MLZA 4DWSA 1Y0OA 1HKMA 4AY1A 4P8UA 3NI6A 2LPVA 3WL0A 4C02B 3O5KA 4TNSA 1ZBCA 2DT2A 3O5QA 3LUOA 1JNSA 4Z2JA 4KQZA 5HBFA 4MNLA 1HXVA 4MNKA 1GPFA 4IT4A 4DZ2A 4FAPA 1FKFA 1HKJA 5DO2A 1P5QA 5D75A 1UR9A 1RD6A 1FKJA 3PR9A 2RUQA 1O6IA 1PINA 4ZPVR 1FFQA 4J4OA 1NSGA 1C9HA 2O92A 4JYSA 2G41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  3KAD A;  1T11 A;  1U79 A;  3UI4 A;  3JXV A;  2DG3 A;  2ZQS A;  1FKB A;  2RUR A;  4QT3 A;  1FKD A;  1D7J A;  2XP8 A;  1FKH A;  3KCE A;  3O5O A;  3O5P A;  1EYM A;  1BKF A;  4J4N A;  3FAP A;  2Q5A A;  3IK8 A;  1J4H A;  3O5G A;  4LAW A;  2KI3 A;  4O2T A;  3RGC A;  2IF4 A;  3O5L A;  1KT1 A;  4DRN A;  2FKE A;  2MNT A;  3H9R B;  4JFJ A;  4W9P A;  2RQS A;  2ITK A;  3B7X A;  4ODP A;  2ZR4 A;  3UF8 A;  1FKR A;  3NRK A;  2XP5 A;  4G2P A;  1ROU A;  1YW5 A;  2LKN A;  1L1P A;  5DIV A;  4MGV A;  3UQB A;  1JVW A;  4DRI A;  3UQA A;  1D7I A;  2PPO A;  2M08 A;  3TDB A;  3UI6 A;  2PPN A;  2MLY A;  2N87 A;  4LAX A;  4JFK A;  3PA7 A;  4GGQ A;  1N1A A;  4LAV A;  2MF9 A;  5BXJ A;  1F40 A;  3UI5 A;  2KO7 A;  1Q6H A;  5HKG A;  3I6C A;  2D9F A;  5B8I C;  4ODQ A;  4BF8 A;  1ZK6 A;  3GPK A;  5DIT A;  1EQ3 A;  4W9Q A;  4W9O A;  2RSE A;  2XPA A;  2XP9 A;  5I98 A;  4QIB A;  2LJ4 A;  4TW8 A;  4TYO A;  1Q1C A;  2RUD A;  3PRB A;  3RFW A;  4DRJ A;  2VCD A;  2XP6 A;  3WH0 A;  1QPL A;  2F4E A;  4MSP A;  1Q6I A;  2FAP A;  1YAT A;  2OFN A;  2PBC A;  3PRD A;  4N19 A;  1J4R A;  4TW7 A;  2KGJ A;  1NMV A;  4QT2 A;  1Q6U A;  2ZQT A;  1FD9 A;  4DZ3 A;  2UZ5 A;  5HUA A;  2VN1 A;  4ODM A;  4DIP A;  2ZQV A;  3KAI A;  5GPG A;  1R9H A;  1FKK A;  1TCO C;  1W26 A;  2DG9 A;  1F8A B;  2KFW A;  4JFI A;  2XPB A;  3IKG A;  3TC5 A;  4ODL A;  4IQ2 A;  1A7X A;  4LAY A;  2ZR5 A;  1ROT A;  2PV3 A;  2KR7 A;  2K8I A;  5HW6 A;  2M1I A;  3VAW A;  2RUC A;  1FKS A;  4U84 A;  3MDY B;  3O5E A;  4JFL A;  2Y78 A;  1J4I A;  3EY6 A;  3TCZ A;  3UQI A;  1FJD A;  4ODO A;  2M2A A;  3KAB A;  4DRK A;  4DRO A;  4G50 A;  3IHZ A;  4DRH A;  4ITZ A;  2MLZ A;  3O5D A;  3O5I A;  5HTG A;  1Y0O A;  5J6E A;  5HW8 A;  4R0X A;  3O5J A;  1D7H A;  4U85 A;  3NI6 A;  2MPH A;  2LPV A;  1ZCN A;  3OOB A;  3O5K A;  3CGM A;  4C02 B;  2F21 A;  4IPX A;  3NTP A;  4TNS A;  4ODR A;  2XP4 A;  3O5Q A;  4GIV A;  4ODK A;  2XP7 A;  1FKI A;  4DRM A;  2LGO A;  3LUO A;  4JFM A;  5HW7 A;  1JNS A;  3CGN A;  4DT4 A;  3JYM A;  2JZV A;  1HXV A;  3KZ7 A;  1FAP A;  1M5Y A;  2PV1 A;  1QPF A;  1QZ2 A;  2ZR6 A;  3JYJ A;  4DZ2 A;  1J6Y A;  3KAH A;  4FAP A;  3O5F A;  1B6C A;  1FKF A;  2KE0 A;  2DG4 A;  3KAC A;  3O5M A;  4DH0 A;  1FKG A;  2XP3 A;  2ZQU A;  4FN2 A;  2PPP A;  4NNR A;  1JNT A;  1KT0 A;  2MLX A;  3O5R A;  4ODN A;  1P5Q A;  5D75 A;  1BL4 A;  1FKT A;  1FKJ A;  1PBK A;  3KAF A;  4TX0 A;  4DRQ A;  4DRP A;  2RUQ A;  5HWB A;  5HWC A;  5HT1 A;  2F2D A;  1PIN A;  4TW6 A;  5DIU A;  3IKD A;  4U86 A;  4J4O A;  2AWG A;  3ODK A;  2L2S A;  1NSG A;  1C9H A;  1NMW A;  4JYS A;  3KAG A;  4IQC A;  1D6O A;  1FKL A; 
#chains in the Genus database with same CATH topology
 1W9U A;  2OLH A;  3RM4 A;  2DG3 A;  1EHN A;  2ZQS A;  4QT3 A;  4LAW A;  4ZPT R;  3VAW A;  3O5G A;  1NWS A;  2IF4 A;  1LL4 A;  2RQS A;  2ZR4 A;  2DSU A;  4G2P A;  1NH6 A;  1YW5 A;  2LKN A;  1ZB5 A;  3UQA A;  2WLY A;  2M08 A;  3WL1 A;  2PPN A;  4P8V A;  4JFK A;  3QOK A;  1WAW A;  1ZL1 A;  2D9F A;  4WIW A;  4ODQ A;  1GUV A;  1UR8 A;  3GTY X;  2RUD A;  1QPL A;  1ZBV A;  2F4E A;  4MNJ A;  1J4R A;  1EDQ A;  1Q6U A;  4LGX A;  2VN1 A;  4DIP A;  1W9V A;  1FKK A;  1W26 A;  4JFI A;  2XPB A;  1XRV A;  4ODL A;  2ZR5 A;  2PI6 A;  2RUC A;  3O5E A;  3GU0 A;  1E15 A;  4MNM A;  2M2A A;  4WK9 A;  2A3A A;  3O5D A;  3O5I A;  1W1V A;  3O5J A;  2WK2 A;  2YBU A;  2MPH A;  2YBT A;  1IX5 A;  3OOB A;  1E6N A;  1HJV A;  4ODR A;  3WKZ A;  2XP7 A;  1FKI A;  4DRM A;  2LGO A;  5HW7 A;  4DWS B;  3ARQ A;  1FFR A;  3FY1 A;  1H0I A;  2DT1 A;  1FAP A;  3ARV A;  4HBE A;  1GOI A;  1QZ2 A;  4QZV B;  2DG4 A;  1NWU A;  4L72 B;  1FKG A;  2A3B A;  3G6L A;  4NNR A;  2MLX A;  3CHF A;  4MTV A;  1H0G A;  2WLZ A;  1BL4 A;  1FKT A;  5HWB A;  1E9L A;  2F2D A;  1HJW A;  3FXY A;  5DIU A;  4U86 A;  2AWG A;  5JH8 A;  4IQC A;  3ODK A;  4L3N A;  3WD1 A;  4DRI A;  2DT0 A;  3ARO A;  3UI4 A;  3JXV A;  1FKB A;  1X6L A;  2RUR A;  3KCE A;  2XP8 A;  3ARR A;  3FAP A;  3IK8 A;  2KI3 A;  3CHE A;  4DRN A;  2FKE A;  2MNT A;  4JFJ A;  3NRK A;  2XP5 A;  1L1P A;  2P4V A;  3ARX A;  3UQB A;  4Z2K A;  1D7I A;  2PPO A;  1OGB A;  1E6R A;  1HKK A;  3ARW A;  5BXJ A;  1LQ0 A;  1F40 A;  2KO7 A;  3WD3 A;  3ALF A;  5HKG A;  1JNE A;  3I6C A;  4W9O A;  2RSE A;  3RM9 A;  2PN0 A;  1EIB A;  2XPA A;  4QIB A;  4DRJ A;  3CHD A;  3ARP A;  4MSP A;  3AS0 A;  2FAP A;  1YAT A;  1VF8 A;  1E6Z A;  1NMV A;  2ZQT A;  4IT6 A;  3KAI A;  2DG9 A;  3B9E A;  3IKG A;  4ZS6 A;  1HKI A;  4LAY A;  2AOS A;  2K8I A;  4W5U A;  4JFL A;  3TCZ A;  4Z2G A;  4S3J A;  3KAB A;  3WD0 A;  4DRH A;  1JCH B;  5HTG A;  1CTN A;  2ETN A;  4U85 A;  1D7H A;  3OA5 A;  1ZCN A;  2F21 A;  4URI A;  1D2K A;  2XP4 A;  4ODK A;  4DWS C;  4JFM A;  3W4R A;  4DT4 A;  3JYM A;  1LG2 A;  3B8S A;  4WKA A;  1M5Y A;  2PV1 A;  2ZR6 A;  1SR0 A;  3AS1 A;  3O5F A;  1B6C A;  2KE0 A;  3O5M A;  2ZQU A;  4FN2 A;  2PPP A;  1NWR A;  3WQV A;  3O5R A;  3ARZ A;  4Z2L A;  4DRQ A;  1PBK A;  4TX0 A;  4TW6 A;  2QF8 A;  1JND A;  1W9P A;  2L2S A;  2A3E A;  2WM0 A;  2PV2 A;  1T11 A;  1U79 A;  3WD2 A;  4HBO A;  4S3K A;  2DSW A;  1FKD A;  3O5P A;  1EYM A;  2O9O A;  1J4H A;  5DEZ A;  2G8Z A;  4XAK A;  3PRA A;  3WIJ A;  3ARY A;  4NZC A;  2ITK A;  3B7X A;  1E44 A;  3B9D A;  3UF8 A;  1FKR A;  3ARS A;  3CHC A;  5DIV A;  3EIP A;  3TDB A;  3UI6 A;  2MLY A;  2N87 A;  4GGQ A;  4MAV A;  2MF9 A;  1Q6H A;  3AQU A;  1ZK6 A;  4P8X A;  2XP9 A;  4WKH A;  5I98 A;  2LJ4 A;  4TW8 A;  1ZU8 A;  1Q1C A;  3PRB A;  4TYO A;  3WQW A;  2XP6 A;  3WH0 A;  1Q6I A;  2OFN A;  2PBC A;  4N19 A;  4TW7 A;  2KGJ A;  1D6O A;  3BXW A;  5HUA A;  4ODM A;  1ZBW A;  2ZQV A;  5GPG A;  1HJX A;  3AS3 A;  1R9H A;  3TC5 A;  1W1Y A;  4IQ2 A;  1A7X A;  2KR7 A;  1K9T A;  4R5E A;  5DF0 A;  1FKS A;  4U84 A;  3G6M A;  3AS2 A;  1J4I A;  1FJD A;  4DRK A;  3IHZ A;  4ITZ A;  5J6E A;  5HW8 A;  4R0X A;  3CGM A;  4IPX A;  5GQB A;  3BMB A;  3NTP A;  2FDM A;  4GIV A;  1KFW A;  4KR0 B;  3RME A;  3CGN A;  1LL7 A;  1WB0 A;  2JZV A;  3KZ7 A;  4ML4 A;  3JYJ A;  1QPF A;  2ESC A;  1XHG A;  1J6Y A;  3KAH A;  1ZBK A;  3KAC A;  4DH0 A;  2XP3 A;  1JNT A;  1KT0 A;  4ODN A;  1X6N A;  3KAF A;  4DRP A;  5HWC A;  5HT1 A;  3WD4 A;  3IKD A;  4UDM A;  1GRJ A;  1E6P A;  1NMW A;  4Q22 A;  3KAG A;  1FKL A;  4DWS D;  3ARU A;  3KAD A;  1WNO A;  2IUZ A;  3CH9 A;  3RM8 A;  1TFV A;  3O5O A;  1D7J A;  1FKH A;  2B5U B;  1BKF A;  2DSV A;  2DT3 A;  2Q5A A;  1LL6 A;  1OGG A;  4J4N A;  4O2T A;  3RGC A;  2DSZ A;  3O5L A;  1KT1 A;  4WJX A;  3H9R B;  4W9P A;  4ODP A;  4Z2H A;  4Q7N A;  1ROU A;  1OWQ A;  4MGV A;  1JVW A;  3ALG A;  1NWT A;  4LAX A;  3PA7 A;  4LAV A;  1N1A A;  3UI5 A;  1W1P A;  3B9A A;  5B8I C;  4WKF A;  4BF8 A;  3GPK A;  5DIT A;  1EQ3 A;  4W9Q A;  1LJY A;  1LG1 A;  4HAR A;  3RFW A;  4ZPW R;  2B31 A;  2VCD A;  3CZ8 A;  3PRD A;  4P8W A;  4QT2 A;  1FD9 A;  4DZ3 A;  2UZ5 A;  2F23 A;  3ART A;  4Z2I A;  4NSB A;  1TCO C;  2KFW A;  1ITX A;  1F8A B;  2DPE A;  1ROT A;  2PV3 A;  1SYT A;  5HW6 A;  2M1I A;  1W1T A;  3MDY B;  2A3C A;  2Y78 A;  3EY6 A;  3UQI A;  5GPR A;  4ODO A;  4PTM A;  4MPK A;  4DRO A;  4G50 A;  2MLZ A;  4DWS A;  1Y0O A;  1HKM A;  4AY1 A;  4P8U A;  3NI6 A;  2LPV A;  3WL0 A;  4C02 B;  3O5K A;  4TNS A;  1ZBC A;  2DT2 A;  3O5Q A;  3LUO A;  1JNS A;  4Z2J A;  4KQZ A;  5HBF A;  4MNL A;  1HXV A;  4MNK A;  1GPF A;  4IT4 A;  4DZ2 A;  4FAP A;  1FKF A;  1HKJ A;  5DO2 A;  1P5Q A;  5D75 A;  1UR9 A;  1RD6 A;  1FKJ A;  3PR9 A;  2RUQ A;  1O6I A;  1PIN A;  4ZPV R;  1FFQ A;  4J4O A;  1NSG A;  1C9H A;  2EUL A;  2O92 A;  4JYS A;  2G41 A; 
#chains in the Genus database with same CATH homology
 1W9U A;  2OLH A;  3RM4 A;  2DG3 A;  1EHN A;  2ZQS A;  4QT3 A;  4LAW A;  4ZPT R;  3VAW A;  3O5G A;  1NWS A;  2IF4 A;  1LL4 A;  2RQS A;  2ZR4 A;  2DSU A;  4G2P A;  1NH6 A;  1YW5 A;  2LKN A;  1ZB5 A;  3UQA A;  2WLY A;  2M08 A;  3WL1 A;  2PPN A;  4P8V A;  4JFK A;  3QOK A;  1WAW A;  1ZL1 A;  2D9F A;  4WIW A;  4ODQ A;  1GUV A;  1UR8 A;  2RUD A;  1QPL A;  1ZBV A;  2F4E A;  4MNJ A;  1J4R A;  1EDQ A;  1Q6U A;  4LGX A;  2VN1 A;  4DIP A;  1W9V A;  1FKK A;  1W26 A;  4JFI A;  2XPB A;  1XRV A;  4ODL A;  2ZR5 A;  2PI6 A;  2RUC A;  3O5E A;  1E15 A;  4MNM A;  2M2A A;  4WK9 A;  2A3A A;  3O5D A;  3O5I A;  1W1V A;  3O5J A;  2WK2 A;  2YBU A;  2MPH A;  2YBT A;  1IX5 A;  3OOB A;  1E6N A;  1HJV A;  4ODR A;  3WKZ A;  2XP7 A;  1FKI A;  4DRM A;  2LGO A;  5HW7 A;  4DWS B;  3ARQ A;  1FFR A;  3FY1 A;  1H0I A;  2DT1 A;  1FAP A;  3ARV A;  4HBE A;  1GOI A;  1QZ2 A;  4QZV B;  2DG4 A;  1NWU A;  4L72 B;  1FKG A;  2A3B A;  3G6L A;  4NNR A;  2MLX A;  3CHF A;  4MTV A;  1H0G A;  2WLZ A;  1BL4 A;  1FKT A;  5HWB A;  1E9L A;  2F2D A;  1HJW A;  3FXY A;  5DIU A;  4U86 A;  2AWG A;  5JH8 A;  4IQC A;  3ODK A;  4L3N A;  3WD1 A;  4DRI A;  2DT0 A;  3ARO A;  3UI4 A;  3JXV A;  1FKB A;  1X6L A;  2RUR A;  3KCE A;  2XP8 A;  3ARR A;  3FAP A;  3IK8 A;  2KI3 A;  3CHE A;  4DRN A;  2FKE A;  2MNT A;  4JFJ A;  3NRK A;  2XP5 A;  1L1P A;  3ARX A;  3UQB A;  4Z2K A;  1D7I A;  2PPO A;  1OGB A;  1E6R A;  1HKK A;  3ARW A;  5BXJ A;  1LQ0 A;  1F40 A;  2KO7 A;  3WD3 A;  3ALF A;  5HKG A;  1JNE A;  3I6C A;  4W9O A;  2RSE A;  3RM9 A;  2XPA A;  1EIB A;  4QIB A;  4DRJ A;  3CHD A;  3ARP A;  4MSP A;  3AS0 A;  2FAP A;  1YAT A;  1VF8 A;  1E6Z A;  1NMV A;  2ZQT A;  4IT6 A;  3KAI A;  2DG9 A;  3B9E A;  3IKG A;  4ZS6 A;  1HKI A;  4LAY A;  2AOS A;  2K8I A;  4W5U A;  4JFL A;  3TCZ A;  4Z2G A;  4S3J A;  3KAB A;  3WD0 A;  4DRH A;  5HTG A;  1CTN A;  4U85 A;  1D7H A;  3OA5 A;  1ZCN A;  2F21 A;  4URI A;  1D2K A;  2XP4 A;  4ODK A;  4DWS C;  4JFM A;  3W4R A;  4DT4 A;  3JYM A;  1LG2 A;  3B8S A;  4WKA A;  1M5Y A;  2PV1 A;  2ZR6 A;  1SR0 A;  3AS1 A;  3O5F A;  1B6C A;  2KE0 A;  3O5M A;  2ZQU A;  4FN2 A;  2PPP A;  1NWR A;  3WQV A;  3O5R A;  3ARZ A;  4Z2L A;  4DRQ A;  1PBK A;  4TX0 A;  4TW6 A;  2QF8 A;  1JND A;  1W9P A;  2L2S A;  2A3E A;  2WM0 A;  2PV2 A;  1T11 A;  1U79 A;  3WD2 A;  4HBO A;  4S3K A;  2DSW A;  1FKD A;  3O5P A;  1EYM A;  2O9O A;  1J4H A;  5DEZ A;  2G8Z A;  4XAK A;  3PRA A;  3WIJ A;  3ARY A;  4NZC A;  2ITK A;  3B7X A;  3B9D A;  3UF8 A;  1FKR A;  3ARS A;  3CHC A;  5DIV A;  3TDB A;  3UI6 A;  2MLY A;  2N87 A;  4GGQ A;  4MAV A;  2MF9 A;  1Q6H A;  3AQU A;  1ZK6 A;  4P8X A;  2XP9 A;  4WKH A;  5I98 A;  2LJ4 A;  4TW8 A;  1ZU8 A;  1Q1C A;  3PRB A;  4TYO A;  3WQW A;  2XP6 A;  3WH0 A;  1Q6I A;  2OFN A;  2PBC A;  4N19 A;  4TW7 A;  2KGJ A;  1D6O A;  3BXW A;  5HUA A;  4ODM A;  1ZBW A;  2ZQV A;  5GPG A;  1HJX A;  3AS3 A;  1R9H A;  3TC5 A;  1W1Y A;  4IQ2 A;  1A7X A;  2KR7 A;  1K9T A;  4R5E A;  5DF0 A;  1FKS A;  4U84 A;  3G6M A;  3AS2 A;  1J4I A;  1FJD A;  4DRK A;  3IHZ A;  4ITZ A;  5J6E A;  5HW8 A;  4R0X A;  3CGM A;  4IPX A;  5GQB A;  3NTP A;  2FDM A;  4GIV A;  1KFW A;  4KR0 B;  3RME A;  3CGN A;  1LL7 A;  1WB0 A;  2JZV A;  3KZ7 A;  4ML4 A;  3JYJ A;  1QPF A;  2ESC A;  1XHG A;  1J6Y A;  3KAH A;  1ZBK A;  3KAC A;  4DH0 A;  2XP3 A;  1JNT A;  1KT0 A;  4ODN A;  1X6N A;  3KAF A;  4DRP A;  5HWC A;  5HT1 A;  3WD4 A;  3IKD A;  1E6P A;  1NMW A;  4Q22 A;  3KAG A;  1FKL A;  4DWS D;  3ARU A;  3KAD A;  1WNO A;  2IUZ A;  3CH9 A;  3RM8 A;  1TFV A;  3O5O A;  1D7J A;  1FKH A;  4J4N A;  1BKF A;  2DSV A;  2DT3 A;  2Q5A A;  1LL6 A;  1OGG A;  4O2T A;  3RGC A;  2DSZ A;  3O5L A;  1KT1 A;  4WJX A;  3H9R B;  4W9P A;  4ODP A;  4Z2H A;  4Q7N A;  1ROU A;  1OWQ A;  4MGV A;  1JVW A;  3ALG A;  1NWT A;  4LAX A;  3PA7 A;  4LAV A;  1N1A A;  3UI5 A;  1W1P A;  3B9A A;  5B8I C;  4WKF A;  4BF8 A;  3GPK A;  5DIT A;  1EQ3 A;  4W9Q A;  1LJY A;  1LG1 A;  4HAR A;  3RFW A;  4ZPW R;  2B31 A;  2VCD A;  3CZ8 A;  3PRD A;  4P8W A;  4QT2 A;  1FD9 A;  4DZ3 A;  2UZ5 A;  3ART A;  4Z2I A;  4NSB A;  1TCO C;  2KFW A;  1ITX A;  1F8A B;  2DPE A;  1ROT A;  2PV3 A;  1SYT A;  5HW6 A;  2M1I A;  1W1T A;  3MDY B;  2A3C A;  2Y78 A;  3EY6 A;  3UQI A;  5GPR A;  4ODO A;  4PTM A;  4MPK A;  4DRO A;  4G50 A;  2MLZ A;  4DWS A;  1Y0O A;  1HKM A;  4AY1 A;  4P8U A;  3NI6 A;  2LPV A;  3WL0 A;  4C02 B;  3O5K A;  4TNS A;  1ZBC A;  2DT2 A;  3O5Q A;  3LUO A;  1JNS A;  4Z2J A;  4KQZ A;  5HBF A;  4MNL A;  1HXV A;  4MNK A;  1GPF A;  4IT4 A;  4DZ2 A;  4FAP A;  1FKF A;  1HKJ A;  5DO2 A;  1P5Q A;  5D75 A;  1UR9 A;  1RD6 A;  1FKJ A;  3PR9 A;  2RUQ A;  1O6I A;  1PIN A;  4ZPV R;  1FFQ A;  4J4O A;  1NSG A;  1C9H A;  2O92 A;  4JYS A;  2G41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...