3O5QA

Fk1 domain mutant a19t of fkbp51, crystal form iv, in presence of dmso
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5qA00
4W9QA 4LAXA 2FKEA 4U84A 1L1PA 3PRBA 2XP7A 4DZ2A 3NTPA 2FAPA 2RSEA 4DROA 2N87A 2KO7A 3UI6A 1FAPA 3O5RA 1NMVA 2RUCA 3ODKA 2ITKA 5BXJA 3IKDA 3O5OA 4DZ3A 3JYMA 5HT1A 4MGVA 2LGOA 3WH0A 1QPFA 2LJ4A 2PV3A 1T11A 1YATA 2M2AA 1EQ3A 1JNTA 3UQAA 2XP4A 1J6YA 3KZ7A 2MF9A 1FKDA 5HKGA 1D7HA 2D9FA 2XPAA 5HUAA 3O5LA 1Q6HA 4ITZA 4ODNA 4TW6A 1B6CA 5HW6A 2ZR4A 2ZQVA 2RURA 1BL4A 4MSPA 2MNTA 2KI3A 3UF8A 4JYSA 1P5QA 4ODOA 4QT3A 3OOBA 4NNRA 2RQSA 3I6CA 2JZVA 4N19A 1FKHA 5HWCA 2UZ5A 4LAWA 1J4RA 2DG3A 4DH0A 3O5DA 4JFJA 3UI4A 4QIBA 1F8AB 2KR7A 1JNSA 5DIVA 4DIPA 4DT4A 1FKLA 5B8IC 3O5GA 5I98A 3EY6A 1ZK6A 3O5JA 4FN2A 1FKJA 3KAHA 4TX0A 5D75A 4QT2A 2K8IA 1QZ2A 3KADA 3NRKA 2MPHA 4ODLA 1NMWA 1PBKA 3RFWA 1BKFA 2F21A 1D6OA 2Y78A 4U86A 4W9PA 4W9OA 4C02B 1NSGA 2AWGA 3O5QA 3KCEA 4DRNA 4DRHA 5HWBA 4DRKA 4ODPA 2ZR5A 4R0XA 1Y0OA 4DRPA 4GIVA 5HW8A 3O5IA 2KE0A 2KFWA 4IQ2A 3JXVA 1YW5A 4G2PA 4IPXA 2OFNA 3GPKA 1KT1A 3KABA 2LKNA 4J4OA 2PV2A 4LAVA 2LPVA 2F2DA 2XP6A 1Q1CA 2KGJA 2XPBA 1HXVA 4ODKA 4TYOA 4JFKA 3CGNA 3UI5A 4GGQA 3PA7A 2MLZA 3KAFA 1FKKA 1D7IA 4DRIA 1W26A 3B7XA 2PV1A 2ZQTA 1FKIA 2PPOA 5DIUA 1F40A 3IK8A 3IKGA 3TDBA 2M08A 2XP5A 4FAPA 1ZCNA 2PPNA 4O2TA 1Q6IA 4J4NA 1EYMA 4JFLA 1JVWA 3O5PA 4ODMA 4IQCA 3O5FA 4U85A 4DRQA 2L2SA 1FKSA 2ZQSA 4LAYA 2IF4A 3KAIA 3VAWA 1N1AA 1FKTA 1KT0A 3TC5A 3PRDA 5GPGA 4JFMA 4ODRA 1FKGA 5DITA 1FJDA 2PPPA 1J4IA 2XP8A 2PBCA 4BF8A 1U79A 4DRMA 3JYJA 3LUOA 2VN1A 2Q5AA 4JFIA 2MLXA 1PINA 1FKBA 4ODQA 3O5EA 2ZR6A 1Q6UA 1ROTA 3KAGA 3UQBA 4G50A 4DRJA 2RUDA 3O5KA 1R9HA 1J4HA 2DG4A 1TCOC 2F4EA 3H9RB 3KACA 3MDYB 3O5MA 2VCDA 1C9HA 1FKFA 3RGCA 2XP9A 3UQIA 5HW7A 4TW8A 3CGMA 1A7XA 3TCZA 1QPLA 5HTGA 1FKRA 2RUQA 1FD9A 1M5YA 2DG9A 3FAPA 5J6EA 2M1IA 2MLYA 2ZQUA 4TW7A 2XP3A 3NI6A 1ROUA 3IHZA 1D7JA 4TNSA
chains in the Genus database with same CATH superfamily
4NZCA 4LAXA 2FKEA 2XP7A 4MNLA 4DROA 4DZ2A 2N87A 3UI6A 3WIJA 3O5RA 4XAKA 3ODKA 2ITKA 4WK9A 4ZPWR 3WH0A 1GRJA 1W1VA 1JNTA 2F23A 3KZ7A 2MF9A 4TW6A 4MSPA 2MNTA 3OOBA 2RQSA 5DF0A 2DT3A 1J4RA 2EULA 4ZPVR 3O5DA 1ZU8A 1F8AB 1K9TA 4FN2A 4TX0A 4QT2A 2K8IA 1HKJA 1NWTA 4ODLA 3B9EA 1BKFA 2Y78A 1D6OA 4W9PA 2O92A 1NSGA 1HKIA 1EDQA 3FXYA 4R0XA 2YBTA 4IPXA 3JXVA 4LAVA 2OFNA 3GPKA 2LKNA 1XHGA 2PV2A 4WKFA 4Q7NA 4HARA 1W9UA 4JFKA 3RMEA 2G8ZA 3UI5A 4ML4A 4URIA 1ZBWA 2A3AA 2ZQTA 1FKIA 4FAPA 1LQ0A 2A3BA 2DT0A 1Q6IA 3WQVA 1EYMA 1XRVA 4WIWA 4JFLA 1JVWA 3O5PA 4IQCA 2A3EA 4LAYA 2IF4A 1IX5A 5DITA 1H0GA 2QF8A 2PBCA 3LUOA 2O9OA 3W4RA 4JFIA 3WD1A 2B5UB 3PR9A 1NWRA 4QZVB 3O5EA 4Z2LA 2WM0A 4DRJA 1R9HA 2DG4A 1ZBCA 3UQIA 4TW8A 1LL6A 1EIBA 1A7XA 4KR0B 1FKRA 5HTGA 4WKHA 1FD9A 2DG9A 3FAPA 4MAVA 2MLYA 4TW7A 5HW6A 4W9QA 4MNJA 3NTPA 2G41A 4P8UA 2DSWA 3B9AA 3BMBA 1HJVA 3IKDA 3JYMA 5HT1A 1EQ3A 2M2AA 3UQAA 1J6YA 1CTNA 2D9FA 3QOKA 3O5LA 5DEZA 2ZR4A 2ZQVA 1BL4A 1E6NA 2B31A 1P5QA 4QT3A 4NNRA 4Q22A 3I6CA 3ARWA 4PTMA 1TFVA 4L72B 4LAWA 3UI4A 4JFJA 4QIBA 1NH6A 2KR7A 3CHFA 5DIVA 3WL1A 4DIPA 2P4VA 1FKLA 5I98A 3O5GA 5D75A 1QZ2A 3KADA 1W1PA 2F21A 4C02B 3O5QA 4DRNA 1WNOA 4DRKA 4Z2GA 1Y0OA 5HW8A 2PI6A 4IQ2A 2KE0A 1YW5A 4G2PA 4NSBA 1NWSA 2LPVA 4W5UA 2F2DA 2XP6A 1Q1CA 2KGJA 1HXVA 1GUVA 3CGNA 3GU0A 1RD6A 4GGQA 3ARRA 4MNMA 3CH9A 2DSUA 1D7IA 1W26A 2AOSA 3ARZA 5DIUA 3BXWA 1F40A 3IK8A 3IKGA 3TDBA 1ZCNA 3O5FA 1FKSA 4Z2HA 3AQUA 5DO2A 2PPPA 1E6ZA 4ODQA 2ZR6A 1Q6UA 3CHEA 3KAGA 1W1YA 3O5KA 1J4HA 1TCOC 3MDYB 4L3NA 4MNKA 4BF8A 4DH0A 2DSVA 1C9HA 1FKFA 3WKZA 2XP9A 4DWSD 1JNDA 2FDMA 1D7JA 2ESCA 3RM4A 5J6EA 2DT1A 2M1IA 2XP3A 2DPEA 1E6RA 1HKKA 1LJYA 4U84A 2RSEA 1OGBA 3AS1A 4LGXA 2KO7A 3CHCA 1NMVA 2RUCA 5BXJA 3O5OA 1JCHB 1QPFA 2LJ4A 2PV3A 1E6PA 1T11A 2XP4A 1FKDA 1FFQA 1B6CA 1ZL1A 3UF8A 4JYSA 1OGGA 1UR9A 4N19A 2JZVA 1FKHA 2UZ5A 3ARXA 1WB0A 1JNSA 4DT4A 5B8IC 3ARUA 4KQZA 3WQWA 1O6IA 3G6MA 2MPHA 1PBKA 2IUZA 3RFWA 3ARPA 1EHNA 3AS0A 4DRHA 5HWBA 2ETNA 1VF8A 2ZR5A 3ARYA 3PRAA 2DSZA 4ODPA 3O5IA 3KABA 1KT1A 1GOIA 4J4OA 1E9LA 2XPBA 4ODKA 4S3JA 4P8WA 5GQBA 1LG2A 1UR8A 5JH8A 3ARQA 4Z2JA 4ZPTR 3PA7A 2MLZA 3KAFA 1FKKA 3B7XA 4R5EA 2PPOA 1HJXA 2PPNA 1FFRA 3ARSA 4J4NA 1E44A 2ZQSA 1H0IA 1LL4A 3TC5A 1KT0A 3ARTA 2WLZA 3B9DA 3PRDA 5GPGA 4JFMA 1FJDA 2XP8A 1U79A 3JYJA 1ITXA 1JNEA 3RM9A 1PINA 5HBFA 2F4EA 4W9OA 3O5MA 3H9RB 3RGCA 3AS3A 2WLYA 1WAWA 4S3KA 3CGMA 1QPLA 3FY1A 2RUQA 4P8VA 1M5YA 2ZQUA 1SR0A 1ROUA 3CZ8A 3PRBA 4Z2IA 2FAPA 4MTVA 1ZB5A 1FAPA 3ARVA 4DZ3A 1X6LA 4MGVA 2LGOA 4HBEA 1KFWA 3GTYX 1YATA 1X6NA 3AROA 3EIPA 2YBUA 3WD4A 5HKGA 1D7HA 2XPAA 4IT4A 5HUAA 1Q6HA 4ITZA 4ODNA 4Z2KA 3G6LA 4ZS6A 2KI3A 4WJXA 1ZBKA 4ODOA 1W9PA 5HWCA 2DG3A 3B8SA 2WK2A 3EY6A 1ZK6A 3O5JA 4HBOA 1FKJA 3KAHA 3WD3A 3WL0A 5GPRA 1SYTA 4WKAA 3NRKA 1NMWA 3CHDA 4U86A 2AWGA 3KCEA 1W9VA 3OA5A 3ALFA 3ALGA 4DRPA 4DWSB 4GIVA 1HJWA 2KFWA 1L1PA 1NWUA 4TYOA 4IT6A 3AS2A 1OWQA 4MPKA 4DRIA 1D2KA 3WD0A 2PV1A 2M08A 2XP5A 4O2TA 4ODMA 4U85A 4DRQA 2L2SA 1LG1A 3RM8A 4DWSA 3KAIA 3VAWA 1N1AA 1FKTA 3WD2A 4DWSC 4ODRA 1GPFA 1FKGA 1J4IA 4DRMA 2VN1A 2Q5AA 4AY1A 1ZBVA 2MLXA 1FKBA 4P8XA 1ROTA 3UQBA 2A3CA 4G50A 1LL7A 2OLHA 2RUDA 3KACA 5HW7A 2VCDA 2DT2A 1W1TA 3TCZA 1E15A 2PN0A 1HKMA 4UDMA 3NI6A 3IHZA 2RURA 4TNSA
chains in the Genus database with same CATH topology
4NZCA 4LAXA 2FKEA 2XP7A 4MNLA 4DROA 4DZ2A 2N87A 3UI6A 3WIJA 3O5RA 4XAKA 3ODKA 2ITKA 4WK9A 4ZPWR 3WH0A 1W1VA 1JNTA 3KZ7A 2MF9A 4TW6A 4MSPA 2MNTA 3OOBA 2RQSA 5DF0A 2DT3A 1J4RA 4ZPVR 3O5DA 1ZU8A 1F8AB 1K9TA 4FN2A 4TX0A 4QT2A 2K8IA 1HKJA 1NWTA 4ODLA 3B9EA 1BKFA 2Y78A 1D6OA 4W9PA 2O92A 1NSGA 1HKIA 1EDQA 3FXYA 4R0XA 2YBTA 4IPXA 3JXVA 4LAVA 2OFNA 3GPKA 2LKNA 1XHGA 2PV2A 4WKFA 4Q7NA 4HARA 1W9UA 4JFKA 3RMEA 2G8ZA 3UI5A 4ML4A 4URIA 1ZBWA 2A3AA 2ZQTA 1FKIA 4FAPA 1LQ0A 2A3BA 2DT0A 1Q6IA 3WQVA 1EYMA 1XRVA 4WIWA 4JFLA 1JVWA 3O5PA 4IQCA 2A3EA 4LAYA 2IF4A 1IX5A 5DITA 1H0GA 2QF8A 2PBCA 3LUOA 2O9OA 3W4RA 4JFIA 3WD1A 3PR9A 1NWRA 4QZVB 3O5EA 4Z2LA 2WM0A 4DRJA 1R9HA 2DG4A 1ZBCA 3UQIA 4TW8A 1LL6A 1EIBA 1A7XA 4KR0B 1FKRA 5HTGA 4WKHA 1FD9A 2DG9A 3FAPA 4MAVA 2MLYA 4TW7A 5HW6A 4W9QA 4MNJA 3NTPA 2G41A 4P8UA 2DSWA 3B9AA 3IKDA 1HJVA 3JYMA 5HT1A 1EQ3A 2M2AA 3UQAA 1J6YA 1CTNA 2D9FA 3QOKA 3O5LA 5DEZA 2ZR4A 2ZQVA 1BL4A 1E6NA 2B31A 1P5QA 4QT3A 4NNRA 4Q22A 3I6CA 3ARWA 4PTMA 1TFVA 4L72B 4LAWA 3UI4A 4JFJA 4QIBA 1NH6A 2KR7A 3CHFA 5DIVA 3WL1A 4DIPA 1FKLA 5I98A 3O5GA 5D75A 1QZ2A 3KADA 1W1PA 2F21A 4C02B 3O5QA 4DRNA 1WNOA 4DRKA 4Z2GA 1Y0OA 5HW8A 2PI6A 4IQ2A 2KE0A 1YW5A 4G2PA 4NSBA 1NWSA 2LPVA 4W5UA 2F2DA 2XP6A 1Q1CA 2KGJA 1HXVA 1GUVA 3CGNA 1RD6A 4GGQA 3ARRA 4MNMA 3CH9A 2DSUA 1D7IA 1W26A 2AOSA 3ARZA 5DIUA 3BXWA 1F40A 3IK8A 3IKGA 3TDBA 1ZCNA 3O5FA 1FKSA 4Z2HA 3AQUA 5DO2A 2PPPA 1E6ZA 4ODQA 2ZR6A 1Q6UA 3CHEA 3KAGA 1W1YA 3O5KA 1J4HA 1TCOC 3MDYB 4L3NA 4MNKA 4BF8A 4DH0A 2DSVA 1C9HA 1FKFA 3WKZA 2XP9A 4DWSD 1JNDA 2FDMA 1D7JA 2ESCA 3RM4A 5J6EA 2DT1A 2M1IA 2XP3A 2DPEA 1E6RA 1HKKA 1LJYA 4U84A 2RSEA 1OGBA 3AS1A 4LGXA 2KO7A 3CHCA 1NMVA 2RUCA 5BXJA 3O5OA 1QPFA 2LJ4A 2PV3A 1E6PA 1T11A 2XP4A 1FKDA 1FFQA 1B6CA 1ZL1A 3UF8A 4JYSA 1OGGA 1UR9A 4N19A 2JZVA 1FKHA 2UZ5A 3ARXA 1WB0A 1JNSA 4DT4A 5B8IC 3ARUA 4KQZA 3WQWA 1O6IA 3G6MA 2MPHA 1PBKA 2IUZA 3RFWA 3ARPA 1EHNA 3AS0A 4DRHA 5HWBA 4ODPA 1VF8A 2ZR5A 3ARYA 3PRAA 2DSZA 3O5IA 3KABA 1KT1A 1GOIA 4J4OA 1E9LA 2XPBA 4ODKA 4S3JA 4P8WA 5GQBA 1LG2A 1UR8A 5JH8A 3ARQA 4Z2JA 4ZPTR 3PA7A 2MLZA 3KAFA 1FKKA 3B7XA 4R5EA 2PPOA 1HJXA 2PPNA 1FFRA 3ARSA 4J4NA 2ZQSA 1H0IA 1LL4A 3TC5A 1KT0A 3ARTA 2WLZA 3B9DA 3PRDA 5GPGA 4JFMA 1FJDA 2XP8A 1U79A 3JYJA 1ITXA 1JNEA 3RM9A 1PINA 5HBFA 2F4EA 4W9OA 3O5MA 3H9RB 3RGCA 3AS3A 2WLYA 1WAWA 4S3KA 3CGMA 1QPLA 3FY1A 2RUQA 4P8VA 1M5YA 2ZQUA 1SR0A 1ROUA 3CZ8A 3PRBA 4Z2IA 2FAPA 4MTVA 1ZB5A 1FAPA 3ARVA 4DZ3A 1X6LA 4MGVA 2LGOA 4HBEA 1KFWA 1YATA 1X6NA 3AROA 2YBUA 3WD4A 5HKGA 1D7HA 2XPAA 4IT4A 5HUAA 1Q6HA 4ITZA 4ODNA 4Z2KA 3G6LA 4ZS6A 2KI3A 4WJXA 1ZBKA 4ODOA 1W9PA 5HWCA 2DG3A 3B8SA 2WK2A 3EY6A 1ZK6A 3O5JA 4HBOA 1FKJA 3KAHA 3WD3A 3WL0A 5GPRA 1SYTA 4WKAA 3NRKA 1NMWA 3CHDA 4U86A 2AWGA 3KCEA 1W9VA 3OA5A 3ALFA 3ALGA 4DRPA 4DWSB 4GIVA 1HJWA 2KFWA 1L1PA 1NWUA 4TYOA 4IT6A 3AS2A 1OWQA 4MPKA 4DRIA 1D2KA 3WD0A 2PV1A 2M08A 2XP5A 4O2TA 4ODMA 4U85A 4DRQA 2L2SA 1LG1A 3RM8A 4DWSA 3KAIA 3VAWA 1N1AA 1FKTA 3WD2A 4DWSC 4ODRA 1GPFA 1FKGA 1J4IA 4DRMA 2VN1A 2Q5AA 4AY1A 1ZBVA 2MLXA 1FKBA 4P8XA 1ROTA 3UQBA 2A3CA 4G50A 1LL7A 2OLHA 2RUDA 3KACA 5HW7A 2VCDA 2DT2A 1W1TA 3TCZA 1E15A 1HKMA 3NI6A 3IHZA 2RURA 4TNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  4LAX A;  2FKE A;  4U84 A;  1L1P A;  3PRB A;  2XP7 A;  4DZ2 A;  3NTP A;  2FAP A;  2RSE A;  4DRO A;  2N87 A;  2KO7 A;  3UI6 A;  1FAP A;  3O5R A;  1NMV A;  2RUC A;  3ODK A;  2ITK A;  5BXJ A;  3IKD A;  3O5O A;  4DZ3 A;  3JYM A;  5HT1 A;  4MGV A;  2LGO A;  3WH0 A;  1QPF A;  2LJ4 A;  2PV3 A;  1T11 A;  1YAT A;  2M2A A;  1EQ3 A;  1JNT A;  3UQA A;  2XP4 A;  1J6Y A;  3KZ7 A;  2MF9 A;  1FKD A;  5HKG A;  1D7H A;  2D9F A;  2XPA A;  5HUA A;  3O5L A;  1Q6H A;  4ITZ A;  4ODN A;  4TW6 A;  1B6C A;  5HW6 A;  2ZR4 A;  2ZQV A;  2RUR A;  1BL4 A;  4MSP A;  2MNT A;  2KI3 A;  3UF8 A;  4JYS A;  1P5Q A;  4ODO A;  4QT3 A;  3OOB A;  4NNR A;  2RQS A;  3I6C A;  2JZV A;  4N19 A;  1FKH A;  5HWC A;  2UZ5 A;  4LAW A;  1J4R A;  2DG3 A;  4DH0 A;  3O5D A;  4JFJ A;  3UI4 A;  4QIB A;  1F8A B;  2KR7 A;  1JNS A;  5DIV A;  4DIP A;  4DT4 A;  1FKL A;  5B8I C;  3O5G A;  5I98 A;  3EY6 A;  1ZK6 A;  3O5J A;  4FN2 A;  1FKJ A;  3KAH A;  4TX0 A;  5D75 A;  4QT2 A;  2K8I A;  1QZ2 A;  3KAD A;  3NRK A;  2MPH A;  4ODL A;  1NMW A;  1PBK A;  3RFW A;  1BKF A;  2F21 A;  1D6O A;  2Y78 A;  4U86 A;  4W9P A;  4W9O A;  4C02 B;  1NSG A;  2AWG A;  3O5Q A;  3KCE A;  4DRN A;  4DRH A;  5HWB A;  4DRK A;  4ODP A;  2ZR5 A;  4R0X A;  1Y0O A;  4DRP A;  4GIV A;  5HW8 A;  3O5I A;  2KE0 A;  2KFW A;  4IQ2 A;  3JXV A;  1YW5 A;  4G2P A;  4IPX A;  2OFN A;  3GPK A;  1KT1 A;  3KAB A;  2LKN A;  4J4O A;  2PV2 A;  4LAV A;  2LPV A;  2F2D A;  2XP6 A;  1Q1C A;  2KGJ A;  2XPB A;  1HXV A;  4ODK A;  4TYO A;  4JFK A;  3CGN A;  3UI5 A;  4GGQ A;  3PA7 A;  2MLZ A;  3KAF A;  1FKK A;  1D7I A;  4DRI A;  1W26 A;  3B7X A;  2PV1 A;  2ZQT A;  1FKI A;  2PPO A;  5DIU A;  1F40 A;  3IK8 A;  3IKG A;  3TDB A;  2M08 A;  2XP5 A;  4FAP A;  1ZCN A;  2PPN A;  4O2T A;  1Q6I A;  4J4N A;  1EYM A;  4JFL A;  1JVW A;  3O5P A;  4ODM A;  4IQC A;  3O5F A;  4U85 A;  4DRQ A;  2L2S A;  1FKS A;  2ZQS A;  4LAY A;  2IF4 A;  3KAI A;  3VAW A;  1N1A A;  1FKT A;  1KT0 A;  3TC5 A;  3PRD A;  5GPG A;  4JFM A;  4ODR A;  1FKG A;  5DIT A;  1FJD A;  2PPP A;  1J4I A;  2XP8 A;  2PBC A;  4BF8 A;  1U79 A;  4DRM A;  3JYJ A;  3LUO A;  2VN1 A;  2Q5A A;  4JFI A;  2MLX A;  1PIN A;  1FKB A;  4ODQ A;  3O5E A;  2ZR6 A;  1Q6U A;  1ROT A;  3KAG A;  3UQB A;  4G50 A;  4DRJ A;  2RUD A;  3O5K A;  1R9H A;  1J4H A;  2DG4 A;  1TCO C;  2F4E A;  3H9R B;  3KAC A;  3MDY B;  3O5M A;  2VCD A;  1C9H A;  1FKF A;  3RGC A;  2XP9 A;  3UQI A;  5HW7 A;  4TW8 A;  3CGM A;  1A7X A;  3TCZ A;  1QPL A;  5HTG A;  1FKR A;  2RUQ A;  1FD9 A;  1M5Y A;  2DG9 A;  3FAP A;  5J6E A;  2M1I A;  2MLY A;  2ZQU A;  4TW7 A;  2XP3 A;  3NI6 A;  1ROU A;  3IHZ A;  1D7J A;  4TNS A; 
#chains in the Genus database with same CATH topology
 4NZC A;  4LAX A;  2FKE A;  2XP7 A;  4MNL A;  4DRO A;  4DZ2 A;  2N87 A;  3UI6 A;  3WIJ A;  3O5R A;  4XAK A;  3ODK A;  2ITK A;  4WK9 A;  4ZPW R;  3WH0 A;  1GRJ A;  1W1V A;  1JNT A;  2F23 A;  3KZ7 A;  2MF9 A;  4TW6 A;  4MSP A;  2MNT A;  3OOB A;  2RQS A;  5DF0 A;  2DT3 A;  1J4R A;  2EUL A;  4ZPV R;  3O5D A;  1ZU8 A;  1F8A B;  1K9T A;  4FN2 A;  4TX0 A;  4QT2 A;  2K8I A;  1HKJ A;  1NWT A;  4ODL A;  3B9E A;  1BKF A;  2Y78 A;  1D6O A;  4W9P A;  2O92 A;  1NSG A;  1HKI A;  1EDQ A;  3FXY A;  4R0X A;  2YBT A;  4IPX A;  3JXV A;  4LAV A;  2OFN A;  3GPK A;  2LKN A;  1XHG A;  2PV2 A;  4WKF A;  4Q7N A;  4HAR A;  1W9U A;  4JFK A;  3RME A;  2G8Z A;  3UI5 A;  4ML4 A;  4URI A;  1ZBW A;  2A3A A;  2ZQT A;  1FKI A;  4FAP A;  1LQ0 A;  2A3B A;  2DT0 A;  1Q6I A;  3WQV A;  1EYM A;  1XRV A;  4WIW A;  4JFL A;  1JVW A;  3O5P A;  4IQC A;  2A3E A;  4LAY A;  2IF4 A;  1IX5 A;  5DIT A;  1H0G A;  2QF8 A;  2PBC A;  3LUO A;  2O9O A;  3W4R A;  4JFI A;  3WD1 A;  2B5U B;  3PR9 A;  1NWR A;  4QZV B;  3O5E A;  4Z2L A;  2WM0 A;  4DRJ A;  1R9H A;  2DG4 A;  1ZBC A;  3UQI A;  4TW8 A;  1LL6 A;  1EIB A;  1A7X A;  4KR0 B;  1FKR A;  5HTG A;  4WKH A;  1FD9 A;  2DG9 A;  3FAP A;  4MAV A;  2MLY A;  4TW7 A;  5HW6 A;  4W9Q A;  4MNJ A;  3NTP A;  2G41 A;  4P8U A;  2DSW A;  3B9A A;  3BMB A;  1HJV A;  3IKD A;  3JYM A;  5HT1 A;  1EQ3 A;  2M2A A;  3UQA A;  1J6Y A;  1CTN A;  2D9F A;  3QOK A;  3O5L A;  5DEZ A;  2ZR4 A;  2ZQV A;  1BL4 A;  1E6N A;  2B31 A;  1P5Q A;  4QT3 A;  4NNR A;  4Q22 A;  3I6C A;  3ARW A;  4PTM A;  1TFV A;  4L72 B;  4LAW A;  3UI4 A;  4JFJ A;  4QIB A;  1NH6 A;  2KR7 A;  3CHF A;  5DIV A;  3WL1 A;  4DIP A;  2P4V A;  1FKL A;  5I98 A;  3O5G A;  5D75 A;  1QZ2 A;  3KAD A;  1W1P A;  2F21 A;  4C02 B;  3O5Q A;  4DRN A;  1WNO A;  4DRK A;  4Z2G A;  1Y0O A;  5HW8 A;  2PI6 A;  4IQ2 A;  2KE0 A;  1YW5 A;  4G2P A;  4NSB A;  1NWS A;  2LPV A;  4W5U A;  2F2D A;  2XP6 A;  1Q1C A;  2KGJ A;  1HXV A;  1GUV A;  3CGN A;  3GU0 A;  1RD6 A;  4GGQ A;  3ARR A;  4MNM A;  3CH9 A;  2DSU A;  1D7I A;  1W26 A;  2AOS A;  3ARZ A;  5DIU A;  3BXW A;  1F40 A;  3IK8 A;  3IKG A;  3TDB A;  1ZCN A;  3O5F A;  1FKS A;  4Z2H A;  3AQU A;  5DO2 A;  2PPP A;  1E6Z A;  4ODQ A;  2ZR6 A;  1Q6U A;  3CHE A;  3KAG A;  1W1Y A;  3O5K A;  1J4H A;  1TCO C;  3MDY B;  4L3N A;  4MNK A;  4BF8 A;  4DH0 A;  2DSV A;  1C9H A;  1FKF A;  3WKZ A;  2XP9 A;  4DWS D;  1JND A;  2FDM A;  1D7J A;  2ESC A;  3RM4 A;  5J6E A;  2DT1 A;  2M1I A;  2XP3 A;  2DPE A;  1E6R A;  1HKK A;  1LJY A;  4U84 A;  2RSE A;  1OGB A;  3AS1 A;  4LGX A;  2KO7 A;  3CHC A;  1NMV A;  2RUC A;  5BXJ A;  3O5O A;  1JCH B;  1QPF A;  2LJ4 A;  2PV3 A;  1E6P A;  1T11 A;  2XP4 A;  1FKD A;  1FFQ A;  1B6C A;  1ZL1 A;  3UF8 A;  4JYS A;  1OGG A;  1UR9 A;  4N19 A;  2JZV A;  1FKH A;  2UZ5 A;  3ARX A;  1WB0 A;  1JNS A;  4DT4 A;  5B8I C;  3ARU A;  4KQZ A;  3WQW A;  1O6I A;  3G6M A;  2MPH A;  1PBK A;  2IUZ A;  3RFW A;  3ARP A;  1EHN A;  3AS0 A;  4DRH A;  5HWB A;  2ETN A;  1VF8 A;  2ZR5 A;  3ARY A;  3PRA A;  2DSZ A;  4ODP A;  3O5I A;  3KAB A;  1KT1 A;  1GOI A;  4J4O A;  1E9L A;  2XPB A;  4ODK A;  4S3J A;  4P8W A;  5GQB A;  1LG2 A;  1UR8 A;  5JH8 A;  3ARQ A;  4Z2J A;  4ZPT R;  3PA7 A;  2MLZ A;  3KAF A;  1FKK A;  3B7X A;  4R5E A;  2PPO A;  1HJX A;  2PPN A;  1FFR A;  3ARS A;  4J4N A;  1E44 A;  2ZQS A;  1H0I A;  1LL4 A;  3TC5 A;  1KT0 A;  3ART A;  2WLZ A;  3B9D A;  3PRD A;  5GPG A;  4JFM A;  1FJD A;  2XP8 A;  1U79 A;  3JYJ A;  1ITX A;  1JNE A;  3RM9 A;  1PIN A;  5HBF A;  2F4E A;  4W9O A;  3O5M A;  3H9R B;  3RGC A;  3AS3 A;  2WLY A;  1WAW A;  4S3K A;  3CGM A;  1QPL A;  3FY1 A;  2RUQ A;  4P8V A;  1M5Y A;  2ZQU A;  1SR0 A;  1ROU A;  3CZ8 A;  3PRB A;  4Z2I A;  2FAP A;  4MTV A;  1ZB5 A;  1FAP A;  3ARV A;  4DZ3 A;  1X6L A;  4MGV A;  2LGO A;  4HBE A;  1KFW A;  3GTY X;  1YAT A;  1X6N A;  3ARO A;  3EIP A;  2YBU A;  3WD4 A;  5HKG A;  1D7H A;  2XPA A;  4IT4 A;  5HUA A;  1Q6H A;  4ITZ A;  4ODN A;  4Z2K A;  3G6L A;  4ZS6 A;  2KI3 A;  4WJX A;  1ZBK A;  4ODO A;  1W9P A;  5HWC A;  2DG3 A;  3B8S A;  2WK2 A;  3EY6 A;  1ZK6 A;  3O5J A;  4HBO A;  1FKJ A;  3KAH A;  3WD3 A;  3WL0 A;  5GPR A;  1SYT A;  4WKA A;  3NRK A;  1NMW A;  3CHD A;  4U86 A;  2AWG A;  3KCE A;  1W9V A;  3OA5 A;  3ALF A;  3ALG A;  4DRP A;  4DWS B;  4GIV A;  1HJW A;  2KFW A;  1L1P A;  1NWU A;  4TYO A;  4IT6 A;  3AS2 A;  1OWQ A;  4MPK A;  4DRI A;  1D2K A;  3WD0 A;  2PV1 A;  2M08 A;  2XP5 A;  4O2T A;  4ODM A;  4U85 A;  4DRQ A;  2L2S A;  1LG1 A;  3RM8 A;  4DWS A;  3KAI A;  3VAW A;  1N1A A;  1FKT A;  3WD2 A;  4DWS C;  4ODR A;  1GPF A;  1FKG A;  1J4I A;  4DRM A;  2VN1 A;  2Q5A A;  4AY1 A;  1ZBV A;  2MLX A;  1FKB A;  4P8X A;  1ROT A;  3UQB A;  2A3C A;  4G50 A;  1LL7 A;  2OLH A;  2RUD A;  3KAC A;  5HW7 A;  2VCD A;  2DT2 A;  1W1T A;  3TCZ A;  1E15 A;  2PN0 A;  1HKM A;  4UDM A;  3NI6 A;  3IHZ A;  2RUR A;  4TNS A; 
#chains in the Genus database with same CATH homology
 4NZC A;  4LAX A;  2FKE A;  2XP7 A;  4MNL A;  4DRO A;  4DZ2 A;  2N87 A;  3UI6 A;  3WIJ A;  3O5R A;  4XAK A;  3ODK A;  2ITK A;  4WK9 A;  4ZPW R;  3WH0 A;  1W1V A;  1JNT A;  3KZ7 A;  2MF9 A;  4TW6 A;  4MSP A;  2MNT A;  3OOB A;  2RQS A;  5DF0 A;  2DT3 A;  1J4R A;  4ZPV R;  3O5D A;  1ZU8 A;  1F8A B;  1K9T A;  4FN2 A;  4TX0 A;  4QT2 A;  2K8I A;  1HKJ A;  1NWT A;  4ODL A;  3B9E A;  1BKF A;  2Y78 A;  1D6O A;  4W9P A;  2O92 A;  1NSG A;  1HKI A;  1EDQ A;  3FXY A;  4R0X A;  2YBT A;  4IPX A;  3JXV A;  4LAV A;  2OFN A;  3GPK A;  2LKN A;  1XHG A;  2PV2 A;  4WKF A;  4Q7N A;  4HAR A;  1W9U A;  4JFK A;  3RME A;  2G8Z A;  3UI5 A;  4ML4 A;  4URI A;  1ZBW A;  2A3A A;  2ZQT A;  1FKI A;  4FAP A;  1LQ0 A;  2A3B A;  2DT0 A;  1Q6I A;  3WQV A;  1EYM A;  1XRV A;  4WIW A;  4JFL A;  1JVW A;  3O5P A;  4IQC A;  2A3E A;  4LAY A;  2IF4 A;  1IX5 A;  5DIT A;  1H0G A;  2QF8 A;  2PBC A;  3LUO A;  2O9O A;  3W4R A;  4JFI A;  3WD1 A;  3PR9 A;  1NWR A;  4QZV B;  3O5E A;  4Z2L A;  2WM0 A;  4DRJ A;  1R9H A;  2DG4 A;  1ZBC A;  3UQI A;  4TW8 A;  1LL6 A;  1EIB A;  1A7X A;  4KR0 B;  1FKR A;  5HTG A;  4WKH A;  1FD9 A;  2DG9 A;  3FAP A;  4MAV A;  2MLY A;  4TW7 A;  5HW6 A;  4W9Q A;  4MNJ A;  3NTP A;  2G41 A;  4P8U A;  2DSW A;  3B9A A;  3IKD A;  1HJV A;  3JYM A;  5HT1 A;  1EQ3 A;  2M2A A;  3UQA A;  1J6Y A;  1CTN A;  2D9F A;  3QOK A;  3O5L A;  5DEZ A;  2ZR4 A;  2ZQV A;  1BL4 A;  1E6N A;  2B31 A;  1P5Q A;  4QT3 A;  4NNR A;  4Q22 A;  3I6C A;  3ARW A;  4PTM A;  1TFV A;  4L72 B;  4LAW A;  3UI4 A;  4JFJ A;  4QIB A;  1NH6 A;  2KR7 A;  3CHF A;  5DIV A;  3WL1 A;  4DIP A;  1FKL A;  5I98 A;  3O5G A;  5D75 A;  1QZ2 A;  3KAD A;  1W1P A;  2F21 A;  4C02 B;  3O5Q A;  4DRN A;  1WNO A;  4DRK A;  4Z2G A;  1Y0O A;  5HW8 A;  2PI6 A;  4IQ2 A;  2KE0 A;  1YW5 A;  4G2P A;  4NSB A;  1NWS A;  2LPV A;  4W5U A;  2F2D A;  2XP6 A;  1Q1C A;  2KGJ A;  1HXV A;  1GUV A;  3CGN A;  1RD6 A;  4GGQ A;  3ARR A;  4MNM A;  3CH9 A;  2DSU A;  1D7I A;  1W26 A;  2AOS A;  3ARZ A;  5DIU A;  3BXW A;  1F40 A;  3IK8 A;  3IKG A;  3TDB A;  1ZCN A;  3O5F A;  1FKS A;  4Z2H A;  3AQU A;  5DO2 A;  2PPP A;  1E6Z A;  4ODQ A;  2ZR6 A;  1Q6U A;  3CHE A;  3KAG A;  1W1Y A;  3O5K A;  1J4H A;  1TCO C;  3MDY B;  4L3N A;  4MNK A;  4BF8 A;  4DH0 A;  2DSV A;  1C9H A;  1FKF A;  3WKZ A;  2XP9 A;  4DWS D;  1JND A;  2FDM A;  1D7J A;  2ESC A;  3RM4 A;  5J6E A;  2DT1 A;  2M1I A;  2XP3 A;  2DPE A;  1E6R A;  1HKK A;  1LJY A;  4U84 A;  2RSE A;  1OGB A;  3AS1 A;  4LGX A;  2KO7 A;  3CHC A;  1NMV A;  2RUC A;  5BXJ A;  3O5O A;  1QPF A;  2LJ4 A;  2PV3 A;  1E6P A;  1T11 A;  2XP4 A;  1FKD A;  1FFQ A;  1B6C A;  1ZL1 A;  3UF8 A;  4JYS A;  1OGG A;  1UR9 A;  4N19 A;  2JZV A;  1FKH A;  2UZ5 A;  3ARX A;  1WB0 A;  1JNS A;  4DT4 A;  5B8I C;  3ARU A;  4KQZ A;  3WQW A;  1O6I A;  3G6M A;  2MPH A;  1PBK A;  2IUZ A;  3RFW A;  3ARP A;  1EHN A;  3AS0 A;  4DRH A;  5HWB A;  4ODP A;  1VF8 A;  2ZR5 A;  3ARY A;  3PRA A;  2DSZ A;  3O5I A;  3KAB A;  1KT1 A;  1GOI A;  4J4O A;  1E9L A;  2XPB A;  4ODK A;  4S3J A;  4P8W A;  5GQB A;  1LG2 A;  1UR8 A;  5JH8 A;  3ARQ A;  4Z2J A;  4ZPT R;  3PA7 A;  2MLZ A;  3KAF A;  1FKK A;  3B7X A;  4R5E A;  2PPO A;  1HJX A;  2PPN A;  1FFR A;  3ARS A;  4J4N A;  2ZQS A;  1H0I A;  1LL4 A;  3TC5 A;  1KT0 A;  3ART A;  2WLZ A;  3B9D A;  3PRD A;  5GPG A;  4JFM A;  1FJD A;  2XP8 A;  1U79 A;  3JYJ A;  1ITX A;  1JNE A;  3RM9 A;  1PIN A;  5HBF A;  2F4E A;  4W9O A;  3O5M A;  3H9R B;  3RGC A;  3AS3 A;  2WLY A;  1WAW A;  4S3K A;  3CGM A;  1QPL A;  3FY1 A;  2RUQ A;  4P8V A;  1M5Y A;  2ZQU A;  1SR0 A;  1ROU A;  3CZ8 A;  3PRB A;  4Z2I A;  2FAP A;  4MTV A;  1ZB5 A;  1FAP A;  3ARV A;  4DZ3 A;  1X6L A;  4MGV A;  2LGO A;  4HBE A;  1KFW A;  1YAT A;  1X6N A;  3ARO A;  2YBU A;  3WD4 A;  5HKG A;  1D7H A;  2XPA A;  4IT4 A;  5HUA A;  1Q6H A;  4ITZ A;  4ODN A;  4Z2K A;  3G6L A;  4ZS6 A;  2KI3 A;  4WJX A;  1ZBK A;  4ODO A;  1W9P A;  5HWC A;  2DG3 A;  3B8S A;  2WK2 A;  3EY6 A;  1ZK6 A;  3O5J A;  4HBO A;  1FKJ A;  3KAH A;  3WD3 A;  3WL0 A;  5GPR A;  1SYT A;  4WKA A;  3NRK A;  1NMW A;  3CHD A;  4U86 A;  2AWG A;  3KCE A;  1W9V A;  3OA5 A;  3ALF A;  3ALG A;  4DRP A;  4DWS B;  4GIV A;  1HJW A;  2KFW A;  1L1P A;  1NWU A;  4TYO A;  4IT6 A;  3AS2 A;  1OWQ A;  4MPK A;  4DRI A;  1D2K A;  3WD0 A;  2PV1 A;  2M08 A;  2XP5 A;  4O2T A;  4ODM A;  4U85 A;  4DRQ A;  2L2S A;  1LG1 A;  3RM8 A;  4DWS A;  3KAI A;  3VAW A;  1N1A A;  1FKT A;  3WD2 A;  4DWS C;  4ODR A;  1GPF A;  1FKG A;  1J4I A;  4DRM A;  2VN1 A;  2Q5A A;  4AY1 A;  1ZBV A;  2MLX A;  1FKB A;  4P8X A;  1ROT A;  3UQB A;  2A3C A;  4G50 A;  1LL7 A;  2OLH A;  2RUD A;  3KAC A;  5HW7 A;  2VCD A;  2DT2 A;  1W1T A;  3TCZ A;  1E15 A;  1HKM A;  3NI6 A;  3IHZ A;  2RUR A;  4TNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...