3O5QA

Fk1 domain mutant a19t of fkbp51, crystal form iv, in presence of dmso
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5qA00
3O5IA 2ZQVA 1KT0A 2LKNA 2PV1A 1Q1CA 4GGQA 2DG4A 5HW8A 3IK8A 4QT2A 1ROUA 1FKHA 2PBCA 3O5LA 1EQ3A 2KO7A 3KAFA 3O5DA 1Y0OA 2MLYA 2RUQA 5HKGA 1J4HA 4DIPA 2KE0A 3UI4A 3KAHA 2RQSA 1R9HA 3O5RA 2D9FA 4MSPA 4J4OA 4JYSA 5D75A 3RGCA 1F40A 4BF8A 4JFKA 4IQ2A 5HW7A 4LAYA 3NTPA 4C02B 1QZ2A 2LPVA 2ZQSA 2XP9A 3JYMA 3O5JA 1FAPA 3CGNA 4J4NA 2F4EA 4ODNA 5J6EA 2MLXA 1J4IA 1QPLA 1ROTA 2DG3A 3O5KA 4U86A 2RURA 1FKFA 4JFMA 4ODOA 4TW8A 4JFLA 4DZ3A 1T11A 1D7IA 1D7JA 1W26A 1D6OA 1FKLA 2MPHA 3GPKA 3IKDA 1A7XA 3O5GA 1KT1A 4ODPA 5DIVA 3O5PA 1FKIA 2Y78A 4LAWA 1D7HA 3UQIA 4N19A 1J4RA 4ODLA 4TW6A 1BKFA 1M5YA 1YW5A 2KR7A 3IHZA 2K8IA 4W9OA 2ZQTA 3IKGA 2N87A 5DITA 3UF8A 1QPFA 2PPPA 2XP5A 2XP7A 4TW7A 2FAPA 2OFNA 1TCOC 2PPNA 2UZ5A 4R0XA 4DRNA 5HT1A 3UQAA 4JFIA 4NNRA 5GPGA 1L1PA 2MF9A 4W9PA 2XPAA 1C9HA 1ZK6A 3KADA 2RUCA 5I98A 2PPOA 2M2AA 5DIUA 5BXJA 1FD9A 4G2PA 1J6YA 2Q5AA 3UI6A 4DH0A 2ZQUA 1FKKA 2VN1A 2LGOA 2XPBA 4GIVA 1NMWA 4DRPA 4W9QA 3PA7A 3NI6A 4TYOA 3O5QA 3TCZA 2ZR6A 2MLZA 1FKDA 2LJ4A 3KAGA 4U85A 5B8IC 3PRBA 1FKBA 1FKJA 2F21A 4TNSA 4TX0A 3O5FA 3PRDA 2RSEA 3FAPA 4G50A 4JFJA 1P5QA 3UQBA 2XP8A 4ODRA 2L2SA 3RFWA 5HTGA 1PBKA 1Q6IA 3LUOA 4QT3A 3O5OA 1EYMA 3EY6A 4DRMA 4FAPA 1BL4A 3H9RB 4DRIA 3KCEA 4DZ2A 4DT4A 1F8AB 3O5MA 1N1AA 2XP3A 2VCDA 4IPXA 4FN2A 1U79A 2FKEA 4DRQA 1NMVA 4ODQA 4ODMA 4ODKA 4LAVA 3ODKA 1JNSA 1JNTA 3I6CA 3MDYB 2PV2A 4DRKA 1NSGA 2IF4A 4LAXA 3OOBA 3JYJA 4DROA 3O5EA 4QIBA 2ITKA 4U84A 2AWGA 4DRJA 4ITZA 3TDBA 3WH0A 5HWBA 2RUDA 1FKGA 4IQCA 1Q6HA 5HW6A 1HXVA 5HUAA 2DG9A 2ZR4A 2M08A 2MNTA 5HWCA 1PINA 2KFWA 2KGJA 1FKSA 2XP6A 3NRKA 2XP4A 3B7XA 2KI3A 1Q6UA 1B6CA 2F2DA 2M1IA 1FKTA 3TC5A 1FJDA 2JZVA 2PV3A 3KZ7A 2ZR5A 3JXVA 1JVWA 4O2TA 1YATA 3KABA 1FKRA 3VAWA 3UI5A 3KAIA 3CGMA 1ZCNA 4DRHA 3KACA 4MGVA
chains in the Genus database with same CATH superfamily
2DT1A 2ETNA 3ARPA 3PRAA 3WQWA 2LKNA 1HKIA 5HBFA 1ZL1A 1EHNA 2PN0A 4WK9A 2PBCA 4ZPVR 4WJXA 2RUQA 1J4HA 3WD0A 1NH6A 2YBTA 4J4OA 4JYSA 3WL0A 1LQ0A 1QZ2A 2DT3A 5GPRA 1FAPA 2F23A 3CGNA 5J6EA 1J4IA 1ROTA 2DG3A 3B9DA 4DZ3A 2RURA 4LGXA 3ARVA 1T11A 1D7IA 1D7JA 1W26A 3IKDA 4ODPA 2DPEA 1GPFA 2Y78A 3UQIA 4N19A 2DSZA 1BKFA 1LL7A 1M5YA 1YW5A 2K8IA 3IKGA 1NWUA 4R0XA 1XHGA 4W9PA 1E6NA 2WLYA 1W1YA 1SR0A 2RUCA 2PPOA 3EIPA 1EDQA 2LGOA 4P8XA 4GIVA 3AS3A 2ZR6A 2MLZA 5B8IC 2YBUA 1FKJA 3BXWA 3PRDA 2RSEA 3UQBA 1ITXA 1UR9A 2XP8A 2DT2A 1HKMA 1NWTA 4QT3A 5DF0A 4FAPA 3ARUA 3CHCA 4WKFA 3FXYA 4MNLA 1N1AA 2XP3A 2VCDA 4IPXA 1U79A 1NMVA 4ODQA 1HJXA 2PV2A 4P8UA 4DRKA 2IF4A 4LAXA 4DRJA 3ARTA 4HARA 3WH0A 1WNOA 5DEZA 5HUAA 2DG9A 3RM4A 3CHFA 3ARQA 3NRKA 2WLZA 2F2DA 2M1IA 3TC5A 1JCHB 3JXVA 4O2TA 1FKRA 2AOSA 3CGMA 4DRHA 4S3KA 3O5IA 2ZQVA 1KT0A 3B9AA 5JH8A 2OLHA 3IK8A 1EQ3A 2G8ZA 3O5DA 3WL1A 1IX5A 2KE0A 2RQSA 1W9PA 1R9HA 4MSPA 4Z2JA 5HW7A 4C02B 2XP9A 3AROA 3O5JA 4J4NA 3UI4A 4P8WA 4TW8A 4ZPTR 1D6OA 2MPHA 3GPKA 5DIVA 3O5GA 1KT1A 1W9VA 3GU0A 3O5PA 1E9LA 2B31A 1KFWA 1D7HA 3AQUA 2KR7A 2P4VA 3IHZA 5DITA 2ZQTA 1SYTA 2O9OA 2FAPA 1TCOC 4Z2GA 3UQAA 1L1PA 2B5UB 1UR8A 2WK2A 5I98A 4ZS6A 1FD9A 4G2PA 1J6YA 1FKKA 1GUVA 2XPBA 1NMWA 1HJVA 1W9UA 3O5QA 1O6IA 1FKDA 1ZBCA 2FDMA 3KAGA 4U85A 3PRBA 1FKBA 2F21A 4TNSA 1OGGA 4P8VA 1E6PA 4HBEA 3WIJA 2L2SA 3G6MA 2A3AA 5HTGA 4NZCA 4MNMA 3O5OA 4MNKA 1H0IA 4Z2IA 1LL4A 4S3JA 4R5EA 1ZU8A 4FN2A 2FKEA 2O92A 4DRQA 4ODMA 4ODKA 1JNTA 3I6CA 3MDYB 3G6LA 3OOBA 1K9TA 5HWBA 5HW6A 1ZBVA 3ALFA 2PI6A 3ARYA 2G41A 1Q6UA 1B6CA 3WKZA 1W1VA 4ML4A 1JNEA 3UI5A 1ZCNA 3RFWA 1NWRA 4ZPWR 4GGQA 1Q1CA 2DG4A 5DO2A 2DSWA 1ROUA 1FKHA 4MTVA 3KAFA 1Y0OA 5HKGA 4DIPA 1HJWA 3KAHA 2D9FA 1F40A 4URIA 4BF8A 4JFKA 1TFVA 4IQ2A 4UDMA 1H0GA 3NTPA 2LPVA 4PTMA 3AS0A 2ZQSA 5GQBA 2MLXA 3O5KA 1A7XA 2EULA 1FKIA 1W1TA 4LAWA 1J4RA 4ODLA 4TW6A 3UF8A 1QPFA 1FFRA 2XP5A 2XP7A 4TW7A 2UZ5A 2PPNA 1RD6A 4KR0B 4MAVA 4DRNA 1W1PA 4Z2HA 4JFIA 3FY1A 4DWSA 3KADA 1ZB5A 3RMEA 3ARZA 4Q22A 2M2AA 5BXJA 3RM9A 1JNDA 3WD1A 2Q5AA 1E15A 3UI6A 4DWSD 4DH0A 2ZQUA 4WIWA 4W9QA 2LJ4A 1LG1A 4TX0A 3FAPA 4JFJA 1PBKA 4WKHA 1BL4A 1E44A 4DZ2A 4DT4A 3O5MA 1ZBWA 3W4RA 4LAVA 3B9EA 3GTYX 3ODKA 1X6NA 1GRJA 3JYJA 4U84A 2AWGA 2A3EA 4KQZA 4IQCA 1Q6HA 2WM0A 4DWSB 2ZR4A 2MNTA 5HWCA 1FFQA 2KFWA 1FKSA 2XP6A 2XP4A 2KI3A 3BMBA 4NSBA 3ARWA 1EIBA 1FKTA 1FJDA 2JZVA 3KZ7A 3CZ8A 1LJYA 1WAWA 1GOIA 3ARXA 1YATA 3KABA 3VAWA 3KAIA 1XRVA 3B8SA 2PV1A 2DT0A 3CH9A 4MNJA 5HW8A 4QT2A 4IT6A 3O5LA 4Z2LA 2KO7A 2MLYA 3PR9A 1ZBKA 1LL6A 3O5RA 3RGCA 5D75A 4LAYA 4Q7NA 4WKAA 4HBOA 3JYMA 3WD4A 2F4EA 4ODNA 5HT1A 1QPLA 1VF8A 1E6RA 1OGBA 2A3CA 1FKFA 4JFMA 4ODOA 4U86A 4JFLA 3OA5A 1FKLA 3QOKA 3AS2A 1NWSA 3CHDA 4W9OA 2N87A 3ARSA 2IUZA 2PPPA 3RM8A 1WB0A 2DSVA 2OFNA 4NNRA 5GPGA 2MF9A 1OWQA 2XPAA 1C9HA 1ZK6A 3WD2A 2A3BA 5DIUA 1CTNA 4QZVB 4MPKA 2VN1A 2DSUA 4DRPA 3PA7A 4AY1A 3NI6A 4TYOA 1HKJA 4IT4A 3TCZA 4Z2KA 3O5FA 4G50A 1P5QA 4XAKA 4ODRA 3LUOA 1Q6IA 4W5UA 1EYMA 1E6ZA 3EY6A 4L3NA 4DRMA 1X6LA 3H9RB 4DRIA 3KCEA 1F8AB 1D2KA 3ARRA 2ESCA 1JNSA 1NSGA 4DROA 3O5EA 4QIBA 2ITKA 4ITZA 3TDBA 1LG2A 2RUDA 1FKGA 1HKKA 3ALGA 1HXVA 2M08A 3WQVA 1PINA 3AS1A 2KGJA 3B7XA 2PV3A 2ZR5A 3WD3A 1JVWA 3CHEA 4DWSC 4L72B 3KACA 2QF8A 4MGVA
chains in the Genus database with same CATH topology
2DT1A 3WQWA 3ARPA 3PRAA 2LKNA 1HKIA 5HBFA 1ZL1A 1EHNA 4WK9A 4ZPVR 2PBCA 4WJXA 2RUQA 1J4HA 3WD0A 1NH6A 2YBTA 4J4OA 4JYSA 3WL0A 1LQ0A 1QZ2A 2DT3A 5GPRA 1FAPA 3CGNA 5J6EA 1J4IA 1ROTA 2DG3A 3B9DA 4DZ3A 2RURA 4LGXA 3ARVA 1T11A 1D7IA 1D7JA 1W26A 3IKDA 4ODPA 2DPEA 1GPFA 2Y78A 3UQIA 4N19A 2DSZA 1BKFA 1LL7A 1M5YA 1YW5A 2K8IA 3IKGA 1NWUA 4R0XA 1XHGA 4W9PA 1E6NA 2WLYA 1W1YA 1SR0A 2RUCA 2PPOA 1EDQA 2LGOA 4P8XA 4GIVA 3AS3A 2ZR6A 2MLZA 5B8IC 2YBUA 1FKJA 3BXWA 3PRDA 2RSEA 3UQBA 1ITXA 1UR9A 2XP8A 2DT2A 1HKMA 1NWTA 4QT3A 5DF0A 4FAPA 3ARUA 3CHCA 4WKFA 3FXYA 4MNLA 1N1AA 2XP3A 2VCDA 4IPXA 1U79A 1NMVA 4ODQA 1HJXA 2PV2A 4P8UA 4DRKA 2IF4A 4LAXA 4DRJA 3ARTA 4HARA 3WH0A 1WNOA 5DEZA 5HUAA 2DG9A 3RM4A 3CHFA 3ARQA 3NRKA 2WLZA 2F2DA 2M1IA 3TC5A 3JXVA 4O2TA 1FKRA 2AOSA 3CGMA 4DRHA 4S3KA 3O5IA 2ZQVA 1KT0A 3B9AA 5JH8A 2OLHA 3IK8A 1EQ3A 2G8ZA 3O5DA 3WL1A 1IX5A 2KE0A 2RQSA 1W9PA 1R9HA 4MSPA 4Z2JA 5HW7A 4C02B 2XP9A 3AROA 3O5JA 4J4NA 3UI4A 4P8WA 4TW8A 4ZPTR 1D6OA 2MPHA 3GPKA 5DIVA 3O5GA 1KT1A 1W9VA 3O5PA 1E9LA 2B31A 1KFWA 1D7HA 3AQUA 2KR7A 5DITA 3IHZA 2ZQTA 1SYTA 2O9OA 2FAPA 1TCOC 4Z2GA 3UQAA 1L1PA 1UR8A 2WK2A 5I98A 4ZS6A 1FD9A 4G2PA 1J6YA 1FKKA 1GUVA 2XPBA 1NMWA 1HJVA 1W9UA 3O5QA 1O6IA 1FKDA 1ZBCA 2FDMA 3KAGA 4U85A 3PRBA 1FKBA 2F21A 4TNSA 1OGGA 4P8VA 1E6PA 4HBEA 3WIJA 2L2SA 3G6MA 2A3AA 5HTGA 4NZCA 4MNMA 3O5OA 4MNKA 1H0IA 4Z2IA 1LL4A 4S3JA 4R5EA 1ZU8A 4FN2A 2FKEA 2O92A 4DRQA 4ODMA 4ODKA 1JNTA 3I6CA 3MDYB 3G6LA 3OOBA 1K9TA 5HWBA 5HW6A 1ZBVA 3ALFA 2PI6A 3ARYA 2G41A 1Q6UA 1B6CA 3WKZA 1W1VA 4ML4A 1JNEA 3UI5A 1ZCNA 3RFWA 1NWRA 4ZPWR 4GGQA 1Q1CA 2DG4A 5DO2A 2DSWA 1ROUA 1FKHA 4MTVA 3KAFA 1Y0OA 5HKGA 4DIPA 1HJWA 3KAHA 2D9FA 1F40A 4URIA 4BF8A 4JFKA 1TFVA 4IQ2A 1H0GA 3NTPA 2LPVA 4PTMA 3AS0A 2ZQSA 5GQBA 2MLXA 3O5KA 1A7XA 1FKIA 1W1TA 4LAWA 1J4RA 4ODLA 4TW6A 3UF8A 1QPFA 1FFRA 2XP5A 2XP7A 4TW7A 2UZ5A 2PPNA 1RD6A 4KR0B 4MAVA 4DRNA 1W1PA 4Z2HA 4JFIA 3FY1A 4DWSA 3KADA 1ZB5A 3RMEA 3ARZA 4Q22A 2M2AA 5BXJA 3RM9A 1JNDA 3WD1A 2Q5AA 1E15A 3UI6A 4DWSD 4DH0A 2ZQUA 4WIWA 4W9QA 2LJ4A 1LG1A 4TX0A 3FAPA 4JFJA 1PBKA 4WKHA 1BL4A 4DZ2A 4DT4A 3O5MA 1ZBWA 3W4RA 4LAVA 3B9EA 3ODKA 1X6NA 3JYJA 4U84A 2AWGA 2A3EA 4KQZA 4IQCA 1Q6HA 2WM0A 4DWSB 2ZR4A 2MNTA 5HWCA 1FFQA 2KFWA 1FKSA 2XP6A 2XP4A 2KI3A 4NSBA 3ARWA 1EIBA 1FKTA 1FJDA 2JZVA 3KZ7A 3CZ8A 1LJYA 1WAWA 1GOIA 3ARXA 1YATA 3KABA 3VAWA 3KAIA 1XRVA 3B8SA 2PV1A 2DT0A 3CH9A 4MNJA 5HW8A 4QT2A 4IT6A 3O5LA 4Z2LA 2KO7A 2MLYA 3PR9A 1ZBKA 1LL6A 3O5RA 3RGCA 5D75A 4LAYA 4Q7NA 4WKAA 4HBOA 3JYMA 3WD4A 2F4EA 4ODNA 5HT1A 1QPLA 1VF8A 1E6RA 1OGBA 2A3CA 1FKFA 4JFMA 4ODOA 4U86A 4JFLA 3OA5A 1FKLA 3QOKA 3AS2A 1NWSA 3CHDA 4W9OA 2N87A 3ARSA 2IUZA 2PPPA 3RM8A 1WB0A 2DSVA 2OFNA 4NNRA 5GPGA 2MF9A 1OWQA 2XPAA 1C9HA 1ZK6A 3WD2A 2A3BA 5DIUA 1CTNA 4QZVB 4MPKA 2VN1A 2DSUA 4DRPA 3PA7A 4AY1A 3NI6A 4TYOA 1HKJA 4IT4A 3TCZA 4Z2KA 3O5FA 4G50A 1P5QA 4XAKA 4ODRA 3LUOA 1Q6IA 4W5UA 1EYMA 1E6ZA 3EY6A 4L3NA 4DRMA 1X6LA 3H9RB 4DRIA 3KCEA 1F8AB 1D2KA 3ARRA 2ESCA 1JNSA 1NSGA 4DROA 3O5EA 4QIBA 2ITKA 4ITZA 3TDBA 1LG2A 2RUDA 1FKGA 1HKKA 3ALGA 1HXVA 2M08A 3WQVA 1PINA 3AS1A 2KGJA 3B7XA 2PV3A 2ZR5A 3WD3A 1JVWA 3CHEA 4DWSC 4L72B 3KACA 2QF8A 4MGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5I A;  2ZQV A;  1KT0 A;  2LKN A;  2PV1 A;  1Q1C A;  4GGQ A;  2DG4 A;  5HW8 A;  3IK8 A;  4QT2 A;  1ROU A;  1FKH A;  2PBC A;  3O5L A;  1EQ3 A;  2KO7 A;  3KAF A;  3O5D A;  1Y0O A;  2MLY A;  2RUQ A;  5HKG A;  1J4H A;  4DIP A;  2KE0 A;  3UI4 A;  3KAH A;  2RQS A;  1R9H A;  3O5R A;  2D9F A;  4MSP A;  4J4O A;  4JYS A;  5D75 A;  3RGC A;  1F40 A;  4BF8 A;  4JFK A;  4IQ2 A;  5HW7 A;  4LAY A;  3NTP A;  4C02 B;  1QZ2 A;  2LPV A;  2ZQS A;  2XP9 A;  3JYM A;  3O5J A;  1FAP A;  3CGN A;  4J4N A;  2F4E A;  4ODN A;  5J6E A;  2MLX A;  1J4I A;  1QPL A;  1ROT A;  2DG3 A;  3O5K A;  4U86 A;  2RUR A;  1FKF A;  4JFM A;  4ODO A;  4TW8 A;  4JFL A;  4DZ3 A;  1T11 A;  1D7I A;  1D7J A;  1W26 A;  1D6O A;  1FKL A;  2MPH A;  3GPK A;  3IKD A;  1A7X A;  3O5G A;  1KT1 A;  4ODP A;  5DIV A;  3O5P A;  1FKI A;  2Y78 A;  4LAW A;  1D7H A;  3UQI A;  4N19 A;  1J4R A;  4ODL A;  4TW6 A;  1BKF A;  1M5Y A;  1YW5 A;  2KR7 A;  3IHZ A;  2K8I A;  4W9O A;  2ZQT A;  3IKG A;  2N87 A;  5DIT A;  3UF8 A;  1QPF A;  2PPP A;  2XP5 A;  2XP7 A;  4TW7 A;  2FAP A;  2OFN A;  1TCO C;  2PPN A;  2UZ5 A;  4R0X A;  4DRN A;  5HT1 A;  3UQA A;  4JFI A;  4NNR A;  5GPG A;  1L1P A;  2MF9 A;  4W9P A;  2XPA A;  1C9H A;  1ZK6 A;  3KAD A;  2RUC A;  5I98 A;  2PPO A;  2M2A A;  5DIU A;  5BXJ A;  1FD9 A;  4G2P A;  1J6Y A;  2Q5A A;  3UI6 A;  4DH0 A;  2ZQU A;  1FKK A;  2VN1 A;  2LGO A;  2XPB A;  4GIV A;  1NMW A;  4DRP A;  4W9Q A;  3PA7 A;  3NI6 A;  4TYO A;  3O5Q A;  3TCZ A;  2ZR6 A;  2MLZ A;  1FKD A;  2LJ4 A;  3KAG A;  4U85 A;  5B8I C;  3PRB A;  1FKB A;  1FKJ A;  2F21 A;  4TNS A;  4TX0 A;  3O5F A;  3PRD A;  2RSE A;  3FAP A;  4G50 A;  4JFJ A;  1P5Q A;  3UQB A;  2XP8 A;  4ODR A;  2L2S A;  3RFW A;  5HTG A;  1PBK A;  1Q6I A;  3LUO A;  4QT3 A;  3O5O A;  1EYM A;  3EY6 A;  4DRM A;  4FAP A;  1BL4 A;  3H9R B;  4DRI A;  3KCE A;  4DZ2 A;  4DT4 A;  1F8A B;  3O5M A;  1N1A A;  2XP3 A;  2VCD A;  4IPX A;  4FN2 A;  1U79 A;  2FKE A;  4DRQ A;  1NMV A;  4ODQ A;  4ODM A;  4ODK A;  4LAV A;  3ODK A;  1JNS A;  1JNT A;  3I6C A;  3MDY B;  2PV2 A;  4DRK A;  1NSG A;  2IF4 A;  4LAX A;  3OOB A;  3JYJ A;  4DRO A;  3O5E A;  4QIB A;  2ITK A;  4U84 A;  2AWG A;  4DRJ A;  4ITZ A;  3TDB A;  3WH0 A;  5HWB A;  2RUD A;  1FKG A;  4IQC A;  1Q6H A;  5HW6 A;  1HXV A;  5HUA A;  2DG9 A;  2ZR4 A;  2M08 A;  2MNT A;  5HWC A;  1PIN A;  2KFW A;  2KGJ A;  1FKS A;  2XP6 A;  3NRK A;  2XP4 A;  3B7X A;  2KI3 A;  1Q6U A;  1B6C A;  2F2D A;  2M1I A;  1FKT A;  3TC5 A;  1FJD A;  2JZV A;  2PV3 A;  3KZ7 A;  2ZR5 A;  3JXV A;  1JVW A;  4O2T A;  1YAT A;  3KAB A;  1FKR A;  3VAW A;  3UI5 A;  3KAI A;  3CGM A;  1ZCN A;  4DRH A;  3KAC A;  4MGV A; 
#chains in the Genus database with same CATH topology
 2DT1 A;  2ETN A;  3ARP A;  3PRA A;  3WQW A;  2LKN A;  1HKI A;  5HBF A;  1ZL1 A;  1EHN A;  2PN0 A;  4WK9 A;  2PBC A;  4ZPV R;  4WJX A;  2RUQ A;  1J4H A;  3WD0 A;  1NH6 A;  2YBT A;  4J4O A;  4JYS A;  3WL0 A;  1LQ0 A;  1QZ2 A;  2DT3 A;  5GPR A;  1FAP A;  2F23 A;  3CGN A;  5J6E A;  1J4I A;  1ROT A;  2DG3 A;  3B9D A;  4DZ3 A;  2RUR A;  4LGX A;  3ARV A;  1T11 A;  1D7I A;  1D7J A;  1W26 A;  3IKD A;  4ODP A;  2DPE A;  1GPF A;  2Y78 A;  3UQI A;  4N19 A;  2DSZ A;  1BKF A;  1LL7 A;  1M5Y A;  1YW5 A;  2K8I A;  3IKG A;  1NWU A;  4R0X A;  1XHG A;  4W9P A;  1E6N A;  2WLY A;  1W1Y A;  1SR0 A;  2RUC A;  2PPO A;  3EIP A;  1EDQ A;  2LGO A;  4P8X A;  4GIV A;  3AS3 A;  2ZR6 A;  2MLZ A;  5B8I C;  2YBU A;  1FKJ A;  3BXW A;  3PRD A;  2RSE A;  3UQB A;  1ITX A;  1UR9 A;  2XP8 A;  2DT2 A;  1HKM A;  1NWT A;  4QT3 A;  5DF0 A;  4FAP A;  3ARU A;  3CHC A;  4WKF A;  3FXY A;  4MNL A;  1N1A A;  2XP3 A;  2VCD A;  4IPX A;  1U79 A;  1NMV A;  4ODQ A;  1HJX A;  2PV2 A;  4P8U A;  4DRK A;  2IF4 A;  4LAX A;  4DRJ A;  3ART A;  4HAR A;  3WH0 A;  1WNO A;  5DEZ A;  5HUA A;  2DG9 A;  3RM4 A;  3CHF A;  3ARQ A;  3NRK A;  2WLZ A;  2F2D A;  2M1I A;  3TC5 A;  1JCH B;  3JXV A;  4O2T A;  1FKR A;  2AOS A;  3CGM A;  4DRH A;  4S3K A;  3O5I A;  2ZQV A;  1KT0 A;  3B9A A;  5JH8 A;  2OLH A;  3IK8 A;  1EQ3 A;  2G8Z A;  3O5D A;  3WL1 A;  1IX5 A;  2KE0 A;  2RQS A;  1W9P A;  1R9H A;  4MSP A;  4Z2J A;  5HW7 A;  4C02 B;  2XP9 A;  3ARO A;  3O5J A;  4J4N A;  3UI4 A;  4P8W A;  4TW8 A;  4ZPT R;  1D6O A;  2MPH A;  3GPK A;  5DIV A;  3O5G A;  1KT1 A;  1W9V A;  3GU0 A;  3O5P A;  1E9L A;  2B31 A;  1KFW A;  1D7H A;  3AQU A;  2KR7 A;  2P4V A;  3IHZ A;  5DIT A;  2ZQT A;  1SYT A;  2O9O A;  2FAP A;  1TCO C;  4Z2G A;  3UQA A;  1L1P A;  2B5U B;  1UR8 A;  2WK2 A;  5I98 A;  4ZS6 A;  1FD9 A;  4G2P A;  1J6Y A;  1FKK A;  1GUV A;  2XPB A;  1NMW A;  1HJV A;  1W9U A;  3O5Q A;  1O6I A;  1FKD A;  1ZBC A;  2FDM A;  3KAG A;  4U85 A;  3PRB A;  1FKB A;  2F21 A;  4TNS A;  1OGG A;  4P8V A;  1E6P A;  4HBE A;  3WIJ A;  2L2S A;  3G6M A;  2A3A A;  5HTG A;  4NZC A;  4MNM A;  3O5O A;  4MNK A;  1H0I A;  4Z2I A;  1LL4 A;  4S3J A;  4R5E A;  1ZU8 A;  4FN2 A;  2FKE A;  2O92 A;  4DRQ A;  4ODM A;  4ODK A;  1JNT A;  3I6C A;  3MDY B;  3G6L A;  3OOB A;  1K9T A;  5HWB A;  5HW6 A;  1ZBV A;  3ALF A;  2PI6 A;  3ARY A;  2G41 A;  1Q6U A;  1B6C A;  3WKZ A;  1W1V A;  4ML4 A;  1JNE A;  3UI5 A;  1ZCN A;  3RFW A;  1NWR A;  4ZPW R;  4GGQ A;  1Q1C A;  2DG4 A;  5DO2 A;  2DSW A;  1ROU A;  1FKH A;  4MTV A;  3KAF A;  1Y0O A;  5HKG A;  4DIP A;  1HJW A;  3KAH A;  2D9F A;  1F40 A;  4URI A;  4BF8 A;  4JFK A;  1TFV A;  4IQ2 A;  4UDM A;  1H0G A;  3NTP A;  2LPV A;  4PTM A;  3AS0 A;  2ZQS A;  5GQB A;  2MLX A;  3O5K A;  1A7X A;  2EUL A;  1FKI A;  1W1T A;  4LAW A;  1J4R A;  4ODL A;  4TW6 A;  3UF8 A;  1QPF A;  1FFR A;  2XP5 A;  2XP7 A;  4TW7 A;  2UZ5 A;  2PPN A;  1RD6 A;  4KR0 B;  4MAV A;  4DRN A;  1W1P A;  4Z2H A;  4JFI A;  3FY1 A;  4DWS A;  3KAD A;  1ZB5 A;  3RME A;  3ARZ A;  4Q22 A;  2M2A A;  5BXJ A;  3RM9 A;  1JND A;  3WD1 A;  2Q5A A;  1E15 A;  3UI6 A;  4DWS D;  4DH0 A;  2ZQU A;  4WIW A;  4W9Q A;  2LJ4 A;  1LG1 A;  4TX0 A;  3FAP A;  4JFJ A;  1PBK A;  4WKH A;  1BL4 A;  1E44 A;  4DZ2 A;  4DT4 A;  3O5M A;  1ZBW A;  3W4R A;  4LAV A;  3B9E A;  3GTY X;  3ODK A;  1X6N A;  1GRJ A;  3JYJ A;  4U84 A;  2AWG A;  2A3E A;  4KQZ A;  4IQC A;  1Q6H A;  2WM0 A;  4DWS B;  2ZR4 A;  2MNT A;  5HWC A;  1FFQ A;  2KFW A;  1FKS A;  2XP6 A;  2XP4 A;  2KI3 A;  3BMB A;  4NSB A;  3ARW A;  1EIB A;  1FKT A;  1FJD A;  2JZV A;  3KZ7 A;  3CZ8 A;  1LJY A;  1WAW A;  1GOI A;  3ARX A;  1YAT A;  3KAB A;  3VAW A;  3KAI A;  1XRV A;  3B8S A;  2PV1 A;  2DT0 A;  3CH9 A;  4MNJ A;  5HW8 A;  4QT2 A;  4IT6 A;  3O5L A;  4Z2L A;  2KO7 A;  2MLY A;  3PR9 A;  1ZBK A;  1LL6 A;  3O5R A;  3RGC A;  5D75 A;  4LAY A;  4Q7N A;  4WKA A;  4HBO A;  3JYM A;  3WD4 A;  2F4E A;  4ODN A;  5HT1 A;  1QPL A;  1VF8 A;  1E6R A;  1OGB A;  2A3C A;  1FKF A;  4JFM A;  4ODO A;  4U86 A;  4JFL A;  3OA5 A;  1FKL A;  3QOK A;  3AS2 A;  1NWS A;  3CHD A;  4W9O A;  2N87 A;  3ARS A;  2IUZ A;  2PPP A;  3RM8 A;  1WB0 A;  2DSV A;  2OFN A;  4NNR A;  5GPG A;  2MF9 A;  1OWQ A;  2XPA A;  1C9H A;  1ZK6 A;  3WD2 A;  2A3B A;  5DIU A;  1CTN A;  4QZV B;  4MPK A;  2VN1 A;  2DSU A;  4DRP A;  3PA7 A;  4AY1 A;  3NI6 A;  4TYO A;  1HKJ A;  4IT4 A;  3TCZ A;  4Z2K A;  3O5F A;  4G50 A;  1P5Q A;  4XAK A;  4ODR A;  3LUO A;  1Q6I A;  4W5U A;  1EYM A;  1E6Z A;  3EY6 A;  4L3N A;  4DRM A;  1X6L A;  3H9R B;  4DRI A;  3KCE A;  1F8A B;  1D2K A;  3ARR A;  2ESC A;  1JNS A;  1NSG A;  4DRO A;  3O5E A;  4QIB A;  2ITK A;  4ITZ A;  3TDB A;  1LG2 A;  2RUD A;  1FKG A;  1HKK A;  3ALG A;  1HXV A;  2M08 A;  3WQV A;  1PIN A;  3AS1 A;  2KGJ A;  3B7X A;  2PV3 A;  2ZR5 A;  3WD3 A;  1JVW A;  3CHE A;  4DWS C;  4L72 B;  3KAC A;  2QF8 A;  4MGV A; 
#chains in the Genus database with same CATH homology
 2DT1 A;  3WQW A;  3ARP A;  3PRA A;  2LKN A;  1HKI A;  5HBF A;  1ZL1 A;  1EHN A;  4WK9 A;  4ZPV R;  2PBC A;  4WJX A;  2RUQ A;  1J4H A;  3WD0 A;  1NH6 A;  2YBT A;  4J4O A;  4JYS A;  3WL0 A;  1LQ0 A;  1QZ2 A;  2DT3 A;  5GPR A;  1FAP A;  3CGN A;  5J6E A;  1J4I A;  1ROT A;  2DG3 A;  3B9D A;  4DZ3 A;  2RUR A;  4LGX A;  3ARV A;  1T11 A;  1D7I A;  1D7J A;  1W26 A;  3IKD A;  4ODP A;  2DPE A;  1GPF A;  2Y78 A;  3UQI A;  4N19 A;  2DSZ A;  1BKF A;  1LL7 A;  1M5Y A;  1YW5 A;  2K8I A;  3IKG A;  1NWU A;  4R0X A;  1XHG A;  4W9P A;  1E6N A;  2WLY A;  1W1Y A;  1SR0 A;  2RUC A;  2PPO A;  1EDQ A;  2LGO A;  4P8X A;  4GIV A;  3AS3 A;  2ZR6 A;  2MLZ A;  5B8I C;  2YBU A;  1FKJ A;  3BXW A;  3PRD A;  2RSE A;  3UQB A;  1ITX A;  1UR9 A;  2XP8 A;  2DT2 A;  1HKM A;  1NWT A;  4QT3 A;  5DF0 A;  4FAP A;  3ARU A;  3CHC A;  4WKF A;  3FXY A;  4MNL A;  1N1A A;  2XP3 A;  2VCD A;  4IPX A;  1U79 A;  1NMV A;  4ODQ A;  1HJX A;  2PV2 A;  4P8U A;  4DRK A;  2IF4 A;  4LAX A;  4DRJ A;  3ART A;  4HAR A;  3WH0 A;  1WNO A;  5DEZ A;  5HUA A;  2DG9 A;  3RM4 A;  3CHF A;  3ARQ A;  3NRK A;  2WLZ A;  2F2D A;  2M1I A;  3TC5 A;  3JXV A;  4O2T A;  1FKR A;  2AOS A;  3CGM A;  4DRH A;  4S3K A;  3O5I A;  2ZQV A;  1KT0 A;  3B9A A;  5JH8 A;  2OLH A;  3IK8 A;  1EQ3 A;  2G8Z A;  3O5D A;  3WL1 A;  1IX5 A;  2KE0 A;  2RQS A;  1W9P A;  1R9H A;  4MSP A;  4Z2J A;  5HW7 A;  4C02 B;  2XP9 A;  3ARO A;  3O5J A;  4J4N A;  3UI4 A;  4P8W A;  4TW8 A;  4ZPT R;  1D6O A;  2MPH A;  3GPK A;  5DIV A;  3O5G A;  1KT1 A;  1W9V A;  3O5P A;  1E9L A;  2B31 A;  1KFW A;  1D7H A;  3AQU A;  2KR7 A;  5DIT A;  3IHZ A;  2ZQT A;  1SYT A;  2O9O A;  2FAP A;  1TCO C;  4Z2G A;  3UQA A;  1L1P A;  1UR8 A;  2WK2 A;  5I98 A;  4ZS6 A;  1FD9 A;  4G2P A;  1J6Y A;  1FKK A;  1GUV A;  2XPB A;  1NMW A;  1HJV A;  1W9U A;  3O5Q A;  1O6I A;  1FKD A;  1ZBC A;  2FDM A;  3KAG A;  4U85 A;  3PRB A;  1FKB A;  2F21 A;  4TNS A;  1OGG A;  4P8V A;  1E6P A;  4HBE A;  3WIJ A;  2L2S A;  3G6M A;  2A3A A;  5HTG A;  4NZC A;  4MNM A;  3O5O A;  4MNK A;  1H0I A;  4Z2I A;  1LL4 A;  4S3J A;  4R5E A;  1ZU8 A;  4FN2 A;  2FKE A;  2O92 A;  4DRQ A;  4ODM A;  4ODK A;  1JNT A;  3I6C A;  3MDY B;  3G6L A;  3OOB A;  1K9T A;  5HWB A;  5HW6 A;  1ZBV A;  3ALF A;  2PI6 A;  3ARY A;  2G41 A;  1Q6U A;  1B6C A;  3WKZ A;  1W1V A;  4ML4 A;  1JNE A;  3UI5 A;  1ZCN A;  3RFW A;  1NWR A;  4ZPW R;  4GGQ A;  1Q1C A;  2DG4 A;  5DO2 A;  2DSW A;  1ROU A;  1FKH A;  4MTV A;  3KAF A;  1Y0O A;  5HKG A;  4DIP A;  1HJW A;  3KAH A;  2D9F A;  1F40 A;  4URI A;  4BF8 A;  4JFK A;  1TFV A;  4IQ2 A;  1H0G A;  3NTP A;  2LPV A;  4PTM A;  3AS0 A;  2ZQS A;  5GQB A;  2MLX A;  3O5K A;  1A7X A;  1FKI A;  1W1T A;  4LAW A;  1J4R A;  4ODL A;  4TW6 A;  3UF8 A;  1QPF A;  1FFR A;  2XP5 A;  2XP7 A;  4TW7 A;  2UZ5 A;  2PPN A;  1RD6 A;  4KR0 B;  4MAV A;  4DRN A;  1W1P A;  4Z2H A;  4JFI A;  3FY1 A;  4DWS A;  3KAD A;  1ZB5 A;  3RME A;  3ARZ A;  4Q22 A;  2M2A A;  5BXJ A;  3RM9 A;  1JND A;  3WD1 A;  2Q5A A;  1E15 A;  3UI6 A;  4DWS D;  4DH0 A;  2ZQU A;  4WIW A;  4W9Q A;  2LJ4 A;  1LG1 A;  4TX0 A;  3FAP A;  4JFJ A;  1PBK A;  4WKH A;  1BL4 A;  4DZ2 A;  4DT4 A;  3O5M A;  1ZBW A;  3W4R A;  4LAV A;  3B9E A;  3ODK A;  1X6N A;  3JYJ A;  4U84 A;  2AWG A;  2A3E A;  4KQZ A;  4IQC A;  1Q6H A;  2WM0 A;  4DWS B;  2ZR4 A;  2MNT A;  5HWC A;  1FFQ A;  2KFW A;  1FKS A;  2XP6 A;  2XP4 A;  2KI3 A;  4NSB A;  3ARW A;  1EIB A;  1FKT A;  1FJD A;  2JZV A;  3KZ7 A;  3CZ8 A;  1LJY A;  1WAW A;  1GOI A;  3ARX A;  1YAT A;  3KAB A;  3VAW A;  3KAI A;  1XRV A;  3B8S A;  2PV1 A;  2DT0 A;  3CH9 A;  4MNJ A;  5HW8 A;  4QT2 A;  4IT6 A;  3O5L A;  4Z2L A;  2KO7 A;  2MLY A;  3PR9 A;  1ZBK A;  1LL6 A;  3O5R A;  3RGC A;  5D75 A;  4LAY A;  4Q7N A;  4WKA A;  4HBO A;  3JYM A;  3WD4 A;  2F4E A;  4ODN A;  5HT1 A;  1QPL A;  1VF8 A;  1E6R A;  1OGB A;  2A3C A;  1FKF A;  4JFM A;  4ODO A;  4U86 A;  4JFL A;  3OA5 A;  1FKL A;  3QOK A;  3AS2 A;  1NWS A;  3CHD A;  4W9O A;  2N87 A;  3ARS A;  2IUZ A;  2PPP A;  3RM8 A;  1WB0 A;  2DSV A;  2OFN A;  4NNR A;  5GPG A;  2MF9 A;  1OWQ A;  2XPA A;  1C9H A;  1ZK6 A;  3WD2 A;  2A3B A;  5DIU A;  1CTN A;  4QZV B;  4MPK A;  2VN1 A;  2DSU A;  4DRP A;  3PA7 A;  4AY1 A;  3NI6 A;  4TYO A;  1HKJ A;  4IT4 A;  3TCZ A;  4Z2K A;  3O5F A;  4G50 A;  1P5Q A;  4XAK A;  4ODR A;  3LUO A;  1Q6I A;  4W5U A;  1EYM A;  1E6Z A;  3EY6 A;  4L3N A;  4DRM A;  1X6L A;  3H9R B;  4DRI A;  3KCE A;  1F8A B;  1D2K A;  3ARR A;  2ESC A;  1JNS A;  1NSG A;  4DRO A;  3O5E A;  4QIB A;  2ITK A;  4ITZ A;  3TDB A;  1LG2 A;  2RUD A;  1FKG A;  1HKK A;  3ALG A;  1HXV A;  2M08 A;  3WQV A;  1PIN A;  3AS1 A;  2KGJ A;  3B7X A;  2PV3 A;  2ZR5 A;  3WD3 A;  1JVW A;  3CHE A;  4DWS C;  4L72 B;  3KAC A;  2QF8 A;  4MGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...