3PRDA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
b'MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
total genus 36
structure length 223
sequence length 223
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prdA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prdA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prdA03
3IKDA 3UQBA 2XP3A 3CGMA 4TW7A 4U84A 3RFWA 5HKGA 5B8IC 5HTGA 1EYMA 1QPLA 2MNTA 3LUOA 5J6EA 2XP5A 2XP7A 1FKKA 3IKGA 4JFJA 4IQ2A 1NMWA 2MF9A 4TW8A 2F21A 4JFMA 2F2DA 2JZVA 3PRBA 1FKDA 2M1IA 3JXVA 1M5YA 2KFWA 5HW8A 2XPAA 5HW6A 2LGOA 1A7XA 1ZK6A 1FD9A 3KABA 2OFNA 1D6OA 5DIUA 4DRKA 3NRKA 1Q6IA 2KGJA 2XP4A 3PA7A 1JNTA 4GIVA 1FKTA 3KACA 2RUDA 3O5OA 4ODKA 4DRPA 2MLZA 2KO7A 3O5QA 4IQCA 2XP6A 3O5EA 3TCZA 4TX0A 2RUCA 2ZQVA 3TC5A 1FKRA 1JNSA 3RGCA 1EQ3A 1KT0A 3KAGA 2MLXA 4ODRA 3VAWA 3O5RA 1D7HA 1ROTA 1QPFA 4DRHA 1FAPA 3IK8A 2FAPA 2M08A 3UQIA 4JFIA 1ROUA 4JYSA 1FKLA 2N87A 2PV2A 3EY6A 4LAWA 1T11A 2PPNA 3O5DA 2XP9A 4DIPA 2VN1A 4G50A 4DH0A 2K8IA 1N1AA 4MSPA 5HT1A 4O2TA 4C02B 3UQAA 4DRQA 4TNSA 1F40A 4IPXA 1PINA 2PBCA 3GPKA 4MGVA 1R9HA 1TCOC 1FKIA 2ITKA 3FAPA 4QT3A 3TDBA 1HXVA 4TYOA 5HW7A 2DG4A 1J6YA 1NMVA 3O5IA 4JFKA 2DG9A 2XPBA 3PRDA 2Q5AA 3KAFA 4GGQA 4W9PA 3CGNA 4ODLA 2UZ5A 2LJ4A 2RQSA 4ODOA 4DRMA 4FN2A 4DROA 1F8AB 4ODNA 2PPOA 2XP8A 2ZR5A 3O5GA 4J4NA 4ODQA 5D75A 1FKFA 2F4EA 3JYJA 4BF8A 4TW6A 1FJDA 3UI4A 2D9FA 2ZQTA 1FKJA 1NSGA 2ZR6A 5HUAA 1U79A 2AWGA 3JYMA 5GPGA 4FAPA 2M2AA 4U85A 3O5JA 3UI5A 3KZ7A 3O5KA 4W9QA 2ZR4A 3KAIA 4LAYA 4ODMA 1J4IA 4QT2A 1Y0OA 2ZQSA 4ODPA 4DZ2A 2LKNA 3O5MA 5BXJA 3UI6A 1J4RA 2KE0A 4J4OA 1D7JA 1L1PA 2RSEA 3NTPA 3O5PA 2KR7A 4R0XA 1W26A 3OOBA 1YATA 3B7XA 1BL4A 3I6CA 4JFLA 2IF4A 1P5QA 3ODKA 5HWCA 1B6CA 2PV3A 2ZQUA 4U86A 1FKGA 1FKHA 1PBKA 3H9RB 3KAHA 4DRIA 4DRJA 5HWBA 2PPPA 4ITZA 3UF8A 5DIVA 1J4HA 1JVWA 1YW5A 3KADA 1KT1A 2PV1A 4G2PA 3NI6A 3IHZA 1D7IA 2RURA 3MDYB 4LAVA 2DG3A 4DRNA 1BKFA 1QZ2A 1C9HA 2RUQA 3O5LA 2MPHA 3O5FA 4QIBA 1Q6HA 4NNRA 5DITA 2FKEA 3WH0A 3KCEA 4LAXA 4DT4A 1FKSA 1Q6UA 4DZ3A 5I98A 1Q1CA 2KI3A 2VCDA 2Y78A 4N19A 2L2SA 2LPVA 1FKBA 4W9OA 2MLYA 1ZCNA
chains in the Genus database with same CATH superfamily
2QG9B 3PYEA 5EXLA 4ZPCA 5E2QA 3SJKA 5EJZA 1S97A 2WCXA 3C46A 4CYUB 1QQUA 4NPOA 2FPZA 2KFWA 1E6PA 1XXDA 1JLFB 4DSKA 1C0TA 1Q6IA 4WFBQ 1FN6A 4ER8A 2YX4A 4IH6A 2VGCC 3ZXWA 3SYZA 2E1RA 2OSQA 4FPRA 5C2ZA 2XOKD 2HHVA 3K2UA 4ECVA 2O8LA 3KK3A 3TJNA 3P8BB 4U96A 2H54B 1J16A 3M7TA 4GO5X 4AGJA 1ZMLA 5L8RC 4C6AA 5A0AE 4QWEA 4P2FA 3OY6U 2QA1A 3TP2A 2R3YA 2XQCA 5CD4A 1YIJS 2X1AA 4EYHB 4ILMA 4UONA 2XMJA 1V2LT 2LQBA 2OP9A 1RTLA 2H5DA 1S1WA 1TGTA 5F9NA 4P8VA 1HI1A 3RLWH 4KBIA 3BDEA 2OXSA 5CXTA 1VHFA 3VEQB 1FKHA 2F9UA 3CCLS 2BVXH 1EB0A 3BG8A 2LXFA 1YZ7A 4YR2A 2RQ4A 1ZTTA 4LAVA 1W9VA 2ZUGA 3RXDA 3ARUA 1JLCB 1LW2B 3HVTB 3T1HJ 4W9OA 4W92B 4MKVA 2AWZA 4K4WA 1RI7A 3U1MA 1SGPE 4DV6J 2NS1B 3R6LB 4LQ9A 2CQDA 2YNHB 1EKRA 4IQ2A 2MF9A 4PG8A 3BTTE 1IBCB 3M30A 3CHEA 3AQPA 1Y00A 2V4RA 3BMBA 3Q3XA 2CQPA 1UL3A 3N01A 2Q43A 2QFJA 3J7A1 1HUTH 3GLJA 1TK8A 3FFIB 3M5LA 2FZZA 3KOAA 1HHTP 3AROA 4JV2A 4IG3B 1E38B 1TWXB 1MTWA 2B5TB 2OH2A 1NKEA 4ZKAA 1DTQA 2CPZA 1TUWA 3OV7A 1EQ0A 4GKKF 2DSWA 4OZLA 2Z94A 3FCHA 1U1LA 1F5KU 4WXVA 1O2YA 3CJ3A 4ECUA 3RR7A 1R7IA 1MD7A 2AJ1A 3HZEA 1M90T 2CG8A 4M5KA 4ACAA 1EP4B 1MTUA 4W5UA 3AW0A 4CI0B 4DL7A 1HYLA 3ZVAA 1R8PA 3JZ2B 1MROA 2RUGA 1RWVB 1AXQA 3MR7A 4BOHA 4I6AA 4Y2AA 2P9EA 2JLFA 4PXEA 4R0XA 3K8WA 4HYKA 1UEVA 2VIWA 4E8UA 4ZIVA 2OEMA 1K8AT 1HNIA 3Q2SC 5FX5A 2YKMB 4DUZF 1TMMA 2W25A 4QBUA 3CVKA 1P03A 3L3TA 5LSLA 5CQGA 2K3IA 1QZ2A 3PLBA 2DXFA 1P8GA 1CHOG 4H42U 4LVNP 2G2ZA 1SUQB 5T7LA 1O36A 5GAHU 1YRTA 4U8VA 3TA2A 5G4BA 2RA0A 2BYCA 1M5VC 2XC0A 1B4SA 4E2FB 2EQNA 3STJA 3M8YA 5GAHI 5IQ6A 3K59A 1WEXA 4QU6A 2G2YA 1WU1A 4CRBA 4YEAA 1P01A 2QF0A 5H9EJ 1D6OA 4CHAB 2O9QA 1YHQS 1YPEH 2FOEA 1GBEA 2ZHWH 5FHTA 4BC9A 3PV2A 3QDZB 1IBMJ 3QGIA 2RCEA 2O92A 1G3DA 1O3EA 1R27B 3QO6A 1FNIA 2KX4A 1N36F 5D3GA 1LG2A 3QT7A 5AXKA 2PEHA 3EYZA 4DRQA 2ZE2A 4LREA 4IPXA 4FUDA 1TCOC 3DGPB 1L3TA 3UFAA 1ZA2B 5HXFA 1SHHB 2AH4X 3U98H 4ZMAH 8GCHG 2LJ4A 3ZZ0A 1F5RA 1HBOB 2JZ5A 3RR8A 3E51A 4QT8C 1NC6A 3VHQA 1T7PA 1NSGA 1FJGF 1TA6A 3S01A 1CBWB 2VH0A 4N7TA 1GI3A 3BF6H 1NH8A 4U9RA 1T02A 3PM9A 2H9ZA 1ZOMA 3GP9A 3VB5A 4DX5A 4FXDA 4AL5A 2P6TA 2IRYA 5JBAS 4Y00A 4X6MA 2FTRA 1C5QA 1B7YB 4DZ6A 1HD0A 1AVGH 4YLQH 1XIQA 3IN5A 3V6DB 1S1UA 3O8DA 3ZFVA 4YOEA 1UCYE 1Q7LB 1W7WA 3WWFA 4ILRA 4B6EA 2B4PA 2QE7D 1U26A 5J1EA 4L76A 2BQ7B 3EVWA 2W9BA 1DFDA 4HH1A 1V2ST 2EVZA 4ZVHA 1HPZB 5MAOA 4GKKJ 3M8ZA 2IVFB 3WY8A 3PV4A 1BTUA 3E2EA 1IQTA 4I8KA 1RHUB 3EVMA 1SQTA 1RKIA 4O3OA 1CJTA 1EAIA 1FJSA 4ABJA 2HFUA 5HKKD 1O38A 2IY5B 1RUSA 2CA9A 4C7QA 1V5VA 3NPSA 1C1CA 2R2MB 4PXCA 1VZQH 4MYUA 4DFMA 1EP5A 3BB5A 1CA0C 4B75A 1YZ6A 3NWRA 4C3MA 3SBMA 1ZMJA 1WWHA 1OP2A 2EKYA 2VPZB 1PGZA 2XEXA 2P3FH 1GFWB 2EI6A 5KFSA 4JI7F 4RKOB 3H42A 3RXEA 1P8VC 2CPXA 3TVYA 3GJSB 4CH0S 5IFMA 1XVMA 5SGAE 4DUZJ 3W61A 2Q5AA 1NRSH 4JYUH 3UD4P 3E6PH 4ID8A 2YNFB 1RAIB 3SU2A 3KQBA 2Y1LB 2BANA 3TYTA 4PQUA 1C0UB 4F3OA 4O97A 1O3DA 1C2GA 4MFBB 2EKNA 2WVCA 2GHPA 1J5EF 2ZOMA 3O5JA 4X8UH 3M8QB 1IM4A 3LQVA 1RT2B 1EAXA 2VDHA 4QPTA 2BX3A 3OTBA 1LDTT 2ZUAA 1XKAC 2FESH 1ROFA 3WQPA 2D2DA 2U1AA 2K1QA 3W95A 2WYJA 1P9QC 1RWNB 1K0VA 4I32A 2HWTA 1VQ5S 1GXTA 1P12E 1J14A 2GX4A 5GPRA 1FF2A 2UUBF 5B0AA 4LQ3A 3I78A 1DUEA 1V3ZA 1J9CH 2XO6A 3DHKH 1XBWA 1S0QA 3BGUA 2GQQA 4YDDB 1DPOA 2QA2A 3J81U 2W2MP 2DH9A 3NEKA 1AB8A 3VALA 1RBLA 4OI6A 2E5HA 1QAIA 2CJKA 1FJGJ 3HGNA 4NL5A 1TUGB 2ZWLH 3BSAA 3S0NA 2D26C 3SGQE 5LMNF 1NSQA 3TX0A 1RWXB 1ZM4A 2QLBB 3SO3A 1LVBA 4M5LA 4L74A 1ESBA 2WK4A 1RIWC 1SGIB 1WKLA 3GSIA 2EC2A 5KFDA 2FHOB 3PHEA 4FU8A 2XNDD 5SZTA 3HHLA 1X5TA 4ASUD 4L72B 3ZZ9A 1GTEA 1DXWA 3OXFA 1VIXA 3A89A 1GJ8B 3GY3A 2UV8G 4C8ZA 1S6UA 4IFVB 4QWDA 2ZNYA 1ID5H 1FKFA 2M8DB 3FXYA 1X4AA 1FKJA 3UN5A 4NCGA 2BKOA 4NSVA 2N4DA 4BWJA 2C2NA 1FJCA 2XY6A 1GBLA 2D41A 2VOOA 1S7HA 4DN0A 2R2WU 5F8MA 4ML4A 1HBMB 3O5MA 1F2HA 3MFHA 4NZQA 1WUNH 1WQVH 5HMYA 3H20A 4PCQA 4OJHA 4XOJA 3GTYX 1GDQA 1P5QA 4F4YA 1NM2A 3GDVA 2VODA 1S1VA 1WUUA 2F8MA 5H1SV 4URGA 1RTJA 2W4DA 2ZEBA 5KFLA 2HIYA 4HDGA 1HCGA 3LP1A 3R5BA 1KT1A 4KC5A 4ED3A 3THTA 3J7YU 1DLKB 1XM1A 2BDCA 1HBTH 3ENAA 4ATNA 2FVCA 4ZH8A 3NWUA 2ZFHA 2EFQA 3LGNA 3K17A 3J7YI 3TANA 2DITA 4G6VB 2BY9X 4JI7J 1QZ8A 1FRXA 5KFGA 3MUMP 1OXGA 1ZM9A 1DWEH 4DWSA 3QWCH 5KT5A 3L3CA 2HQFA 2RD5C 2AYMA 2NXJA 3OD2A 2WINI 1PIEA 1RAGB 4JK6A 1T95A 2BD9A 5EIYA 2PTCE 4LT6A 5KGOA 3F2GA 4NLQA 2MQPA 2R2TA 2HGNA 1JLGA 2K7JA 5T3HA 5ETSA 5J2PA 2AQ4A 4Y0ZE 4DS5A 1AT1B 5HBFA 2OMOA 1LFPA 3BTDE 2C3MA 1TNIA 2BA9A 3PW5A 3KNAA 4C9DA 4HGCA 2TPIZ 3A8IA 4DIPA 5AFZH 2Q66A 3L95X 2KB2A 2FIUA 4FU7A 1F3VA 1GBAA 4M5IA 1VISA 4WJBA 3A8KA 1BMAA 4USKA 4EO6A 1FDDA 1U25A 3HHLC 1Y5BT 5ABWA 4AG2A 1FTRA 4FXVA 2KFZA 2V6AA 4HTJA 1KQSR 3B82A 1M5PC 5DF0A 2G0IA 4LAYA 1MN7A 1J8AA 1ZHRA 2PUQH 4HTCH 1K1QA 1O2UA 4AT1B 4GC7A 3LJOA 5C3NA 2IF4A 1LVYA 2GZ9A 4PABA 3OVSA 3RDZA 3BGRA 4A8XA 5D15A 2MYFA 2WZ1A 4O3NA 4FF4A 5LMNJ 5EJ1A 2BKNA 3PDNA 4Q80A 3B8SA 2GGVB 1TLDA 1VBKA 4X2XA 2VB0A 4HHHA 3GR1A 1GBDA 5D77A 3T9ZA 1SGEE 4TQSA 3QIPA 4JI3J 4OGYA 4HL9A 1SJFA 3LGUA 4OS4A 4H4KC 4ED2A 5M2PA 1PYOB 1GXUA 1EQMA 2E9RX 2PWXA 3GMGA 3SUDA 2BJ7A 1RTHB 3ZVCA 5HW6A 3E90B 5DIUA 2OFNA 1UR8A 2D9PA 3CWJA 5KFWA 2LNCA 3BKFA 5GAEU 2RUDA 4I1TA 3O5QA 2B51A 4UFFH 4ED6A 4A8SA 3WX4A 4G65A 3PYFA 4FS1A 4L73A 2QRRA 5GAEI 1TAUA 3MH4A 2C8YB 3M5NA 1B0TA 1WHWA 3LGMA 5HLFB 2VN1A 4M1KA 3HSJA 3N6NA 2K8IA 4NLPA 5F3TA 4DV5F 5KOWA 1MU2B 3G82A 2I2YA 2PMHA 1QURH 3GY5A 4USUA 1VITG 2PD1A 4CBOA 4KFBA 2H1YA 4XBBA 1EIYB 1ESTA 2BDIA 4PYDA 4QIFA 2H9EH 1VQ8S 1V2NT 3PW7A 2BX4A 1EKSA 1T31A 1HJ9A 3ZV9A 4JUZA 3FN8A 2OC8A 4WFYA 1L1JA 4ZP6A 1M1KT 1C4Y2 2BDYA 4IC6A 2RHSB 1EZQA 3AJ1A 2GT8A 2I1RA 2DNKA 4OHZA 1F7ZA 4ZJOA 1HNWF 3LONA 2V8PA 1B6CA 2DPJA 4O9VA 3A86A 3Q86A 3D1QA 1GHBG 1KVJA 5HJXA 5GQBA 1HFEL 2XMKA 3EDXB 1RXOB 4QWBA 4PWUA 2WB4A 3RXMA 2V4JA 4TWWA 2BB4A 4ED7A 2WW8A 1E6ZA 3FP6E 1ETSH 1X7VA 3I32A 3J81Y 3E3XA 5DGJA 2QYGA 4JFJA 4DV7F 1X4FA 4K1SA 1DLOA 2OBOA 2H51B 2XYHB 2OFHX 3AOAA 2YH0A 4IRKA 2GZ7A 4J90A 2V6NA 3LH3A 4ZKSU 1CQNA 3ARYA 2BR0A 3QIDA 5TJXA 1RAFB 3U9AH 2YNIB 3BTQE 1YJ7A 5GNDA 4JYTA 2BY8X 4F4OC 1GXLA 3CCZA 1P2QA 3OU0A 4TNSA 3DRPA 1VJWA 2W2NP 1SKYE 5LOQA 2R7XA 3ITHB 4DWIA 1HYSA 2DEJA 3VB4A 3ARQA 1NNDA 3GR0A 8ATCB 3PIPQ 1U48A 2ALPA 3IG1A 5K14A 3EGVA 4BTTB 1ZTWA 2MHEA 1Y3JA 3DM2A 4ODMA 1ELEE 3T19A 1ZJDA 2QA9E 3DLGA 1HNEE 2MEWA 1SQGA 3KHRA 2FVPA 2UUCF 2DR8A 3GIJA 3KDNA 2J6UA 4J5OA 3N4WA 4X64J 1AB9B 5HK4A 3UDEA 1S1XB 3RU4E 4DRJA 1UK4A 5EQSA 2BZ2A 1U45A 4NA8A 4I8LA 2PKAA 1T9UA 5J4QA 3AFGA 2Q6CA 4H4OA 2FI4E 3FRZA 1W0ZU 3R9LA 1VGYA 2HHWA 4F4ZA 1HA1A 1NHKL 3TAMA 3M05A 4JZIA 4YHHF 1DTTB 1GJ5H 4DV5J 1HJVA 1RLDA 1TPSA 4R8TB 1UKUA 1IJEB 1G7CB 2DHSA 5TCCA 5GJ4B 4I0WA 2IM1A 1WC5A 1HD1A 3KJVA 3MNXA 4FUFA 5ETKA 2OLWA 3H7HB 4UFDH 4DCDA 3ETMA 1R8BA 4FUJA 2GCTC 4ZPAA 2W7UA 1EX3A 2IM2A 3LPYA 3KUHA 4PG6A 1W1PA 2DXDA 3GIMA 3TK6A 4GIVA 3VZHA 2HNTE 1BJVA 5DO4H 3U27A 4OV1A 2JH0D 2XS2A 2C3UA 7LPRA 2ZG0H 1QJ1B 2XP9A 3N9UC 4DH0A 4GVBA 3L7PA 2QF4A 3BH6B 1HNWJ 1IOEA 2OUGA 4QWAA 2J7KA 5T6DA 5E8EH 2VFVA 2EPIA 2UXBF 1HJ8A 1NJWA 4U7UD 4EZ9A 5F8IA 2DEIA 2SGEE 2HVEA 1GVZA 2ZU5A 1MU8B 4Y6IA 1C5NH 2G4TA 4YY3F 4B9TA 3C1KA 1FCAA 1TL1A 1UJ5A 4IGDA 5A2QU 4QT2A 3TGIE 2AW0A 1QVFR 4DV7J 3Q8RB 4IQXA 3M1VA 1OJ4A 4NZ7A 1F0UA 3URDA 4FVDA 2RF2A 1YCPH 1RT3A 4TYDA 4YR3A 2VWMA 1KTSB 2ZU4A 2PV1A 2AYGA 1S85A 4TY9A 1VCPA 1SH2A 3ENVA 3CEDA 3ZZRA 2NSBA 2B9LA 2OPSB 3ZZOA 1F5BA 1CQMA 1AMHA 4ABDA 2AZ1A 1AFQB 4Y79A 3CGMA 1DHMA 2ZHBA 4PWDB 2ZDPA 5HKGA 2BXTH 3H4BA 4HZHA 4NXNF 2W24A 2AGEX 4ZUHA 3K65B 4MVNA 4DUYF 2DGSA 1WTBA 3TLOA 1O5BB 1JLBB 3H90A 4KV8B 1ZK6A 4DCPB 1ZTKA 1FESA 1S0OA 3QT6A 3CIZA 4K1TA 4JI2F 3HP6A 3BSQA 2E7VA 2YWHA 1VQSA 3TH2H 4DPOA 3QTOH 4CRAA 2A3EA 2AJQA 3CCES 1FDBA 2R8GA 1S59A 4M5JA 6CHAB 1PC5A 4AY1A 4ISLA 2PBCA 1N5SA 2BRKA 2WONB 2RS2A 3MD1A 3A82A 1NK9A 1A5IA 1LQDB 5E0HA 5G0RB 3E0NB 3SUGA 3KAFA 2WUBA 1ZA1B 1FUJA 1HJAC 2PPOA 4ODQA 5JUMA 1BTWA 2N3LA 1ZZZA 5F8XA 3KLEB 1GH8A 2QJ3A 2STAE 1F0XA 3EDRB 1QCPA 2HHUA 1C1TA 3MM6A 4YHHJ 2RDDA 2J0SD 3HVWA 5FBIA 2Q6GA 4XD7D 5C5OA 2JETB 3FVFB 1A7GE 2I8EA 1MTSA 3JS9A 3N7EA 2HHTA 2GQCA 4K1EA 2E1AA 1NRPH 1LWCB 1TNLA 4DS4A 1ABIH 3KQDA 3M6UA 4P10A 3CC2S 1C5PA 1SI5H 4IS5A 1F2GA 1U6QA 1B0PA 2CQIA 2QV1A 4ZROA 1AZSB 3TZYA 1NJYA 1C5WB 3MAHA 2CHAB 1F0SA 2HNDA 1BKFA 4XSKU 2FLLA 5K8OA 3ZZYA 3BN7A 1Q1KA 1GHAF 4E06H 2WK2A 1VCWA 1SJ1A 1L3SA 2DD8S 2VKRA 2A6MA 4DV3F 3MTKA 2UXBJ 4K4XA 2BZ6H 1VBXA 5U47A 2HK2A 4A47A 2ZDLA 3ARTA 2QZ8A 2A7JA 1MTVA 1G1XA 2GKVE 4MJKA 6GCHG 4KH0B 1JNTA 4ZKRU 1ZL1A 1B0VA 4YY3J 1WF1A 5LPRA 5F0UA 1C5RA 2PE8A 1BZXE 3M2VB 1FY8E 3KYFA 2XBYA 4CR5A 1EJ7L 2BJEA 2M08A 3AQUA 2HGLA 2WPLS 2V8VA 4TNOA 1D3DB 1WSSH 4R0EA 2Y81A 3BGLA 2IPOB 4OYBA 4C97A 4H54A 2DHGA 3AJDA 1NH7A 4IFYA 6ESTA 3E0PB 1ORFA 2RG3A 2QTWA 4RBUA 4N77A 5HI7A 3IG6B 2GO8A 3OL8A 4NSBA 3TUJC 1ZZFA 2A0FB 3TH3H 4F26A 1B0EA 4IO1A 1RWWB 1TBZH 3KZ7A 1GI2A 4NXNJ 4AG1A 1GMWD 1Z8GA 2KN4A 3DYAB 4CLZA 1KP6A 3P8FA 2FHKA 2J97A 5A0YA 4DUYJ 5BPEA 1FKPB 2IJRA 3PLPA 3W94A 4LSLA 1RGVA 3W1YC 2A2XH 4ZP7A 1Y11A 4Z1MD 2ABYA 2KVIA 4JI2J 1D9FA 1SPJA 3CZ8A 4CLLA 2DRBA 2R8IA 2O8MA 3I82A 2YNGA 3PMJA 3RMEA 4QW9A 5E0GA 3CCQS 4AXIA 2HBRB 2K7KA 3F0OA 1FKBA 3NOCA 2P4VA 1QAJA 2A0QB 3U8RH 1TL7A 3ZVEA 3B4MA 4OL8A 3RU4D 2E7WA 2J5AA 4FP9A 3FP8E 3DKDA 4YB7A 2HFZA 3RMOH 4ZVSB 2MPUA 3W5XA 3QZRA 3GWCA 3TGJE 4O44B 4URIA 4DRPA 1JLFA 1QAXA 3SCIE 3MM5A 1FX0B 1TTHB 3KHVA 1FZZA 3VB7A 2QMWA 3R3TA 2HQIA 2ZC3A 4RU9A 3M6VA 3UUZA 3LDXH 4Y2CA 1X4DA 4KGKA 3HKIB 4O2TA 4OYPA 4AORA 5DSFA 5DQHA 4ERDA 1G37A 1ELBA 1ZYQA 1C4U2 2NUHA 3ARXA 4KGAA 3DNCA 3UNQA 4K69A 3RXTA 2JDID 2Q79A 1XEZA 3HVAA 3K9XB 2ZPQA 2GJIA 1TA2A 1Q82T 3CDAA 8LPRA 3AD7C 5AFYH 4F25A 2ACYA 3EXCX 2HNZB 2U2FA 3FZBA 1FFRA 2BOAA 2CVIA 3RC6A 1Y5AT 1LTOA 2B6AB 2DJWA 4BTUB 4OZ2A 2BRLA 3VAGA 2DY1A 5T41A 1KLTA 4FF2A 4JV1A 4RW6B 5KG7A 5CH7B 2Y5HA 1Q79A 2K2PA 3PTWA 2P9CA 2TBSA 4DBQA 3EGKH 5KG5A 1Q6UA 1C2EA 5I98A 1AHTH 1V2OT 3BG4B 4U8YA 2VIDA 1JLCA 1LW2A 3HVTA 1O2QA 2NQPA 4RLEA 3UCUP 1AKSB 3V7TA 1O37A 1FEHA 5LPFA 1G4CA 3BQ0A 4DHVA 1IKWB 2YNHA 5G4DA 3CNRA 1YTYA 3STIA 5J2QB 3LP2B 4J9LA 1SBWA 4Q43A 3LU9B 3LP0B 2B9YA 4K4VA 1RT5B 2UXDF 1O3BA 2O5DA 3DXSX 4EU0A 4DRHA 2QL9B 2JFDA 5EGMA 4F8RA 4I69A 3FFIA 3TITA 1EETB 1O2SA 4GPGA 4IG3A 2J98B 5THWA 1PILA 3KNGA 4ZVGA 1L1NA 4NIYA 1U2CA 4WWSA 3ARSA 2H5EA 1Z4UA 3TZXA 1FONA 3DHWC 1UVOA 3TPIZ 2LQJA 2XTJP 2AP6A 3BBFA 1FXLA 1NFWA 1OHHD 1TUVA 1YPHC 2VIVA 3NY0A 1JBUH 4QJVA 1LW0B 5A6WA 5M2RA 1LK7A 4E98A 1HWLA 2JEGA 1BQXA 3AOCA 1UVKA 3UQSA 1N34J 3QFWA 4JBCA 2HHHF 1TK0A 3R5CA 4DV4F 1KDQB 1O2ZA 4OX8A 1FNXH 2GV7A 1VKYA 5FPYA 4OX7A 3CSKA 2VPXB 2DNGA 2XCAA 1P11E 2A5AA 3ZNJ1 4ZLNA 3N7DA 3O5LA 2YKMA 1UW7A 3I5BA 1YKWA 1JOUB 1H9HE 1LWEB 3W9HA 1ZBVA 1X4BA 1MCVA 3ARVA 4LXBH 3D65E 4Y0YE 2ALYB 2H65B 5BRRE 1RK8A 2CIMA 5ETNA 1GGDB 3ALGA 3VGSA 1IHTH 1ACMB 4X1SU 2FM2A 3NL0A 5E2OA 3KLVA 2W3KA 3F0PA 3P96A 4KGVB 3Q2TC 2RUSA 4YM9A 4NXMF 4OYAA 1S49A 3FSXA 4MNJA 1B99A 5TCAA 4TX0A 3AVZA 4O0IA 2BJ8A 3BTFE 1AWFH 2MY7A 5F53A 4PKDB 5BYQA 4P7VA 3TJ9A 1ETRH 1R0BG 4MK8A 3GE9A 3EE3A 4BTIB 4UZCA 1U4BA 1PPZA 2CZ4A 4TSFD 3IRWP 3H25A 3SCJE 1GG6C 3CD6S 3AK5A 2UZ5A 3DGPA 4L75A 1FPCH 3N99A 5F8TA 1CS4B 3RC4A 4C8MA 4AQYF 2DT2A 1AQ7A 1B5GH 1HBOA 5GAGU 4OZ3A 5KT2A 3DI6B 2BEFA 1E6VB 3Q76A 1CJUB 4K4ZA 1SGDE 1GI8B 5GAGI 2ZGBH 2PGCA 4RR5A 1V3RA 4JYAJ 3SI4H 2VWNA 1NK7A 2C3OA 1ELCA 3LGWA 1WTFA 1BQMB 3SMZA 5DGAA 4W90B 1C5OH 2ZPSA 4X1PU 2UXDJ 4KO0B 4UQGA 1E0FD 2RKIB 2OO4A 3V6DA 4X84A 1C5UA 2DGVA 4F2RA 1QA7A 4DIHH 4FYXB 4TLQA 1PYSB 2R42A 3KQCA 1TQLA 1SGRE 1LWFB 3VAJA 2L6OA 4F0MA 1V2TT 5JB8S 3VF0B 1HPZA 4PXDA 4FF1A 3RXJA 2GQ2A 1UAWA 2Z56B 2CYYA 1OX1A 2ZGXH 3SQGB 1FFWB 2GCHF 3ITIA 2GHWA 2YNAA 3F41A 1X9SA 3BTHE 2V0NA 1QA0A 3U1NA 3N79A 3O5OA 4E05H 2HRUA 3HVRA 4DF8A 2PMWA 3TEHB 3ZZTA 2BDPA 2I5JA 2MXYA 1KSNA 5ETVA 2ZHAA 2FZKB 1PPCE 4ZAEA 4DV4J 4CHAC 1NKBA 2P93A 3DUXH 1XMNB 1N6YA 2W9AA 4WMFA 1HNXJ 2PKSB 1NSKL 4EEYA 2I0XA 2A4OA 3UD5A 1NPRA 2ADBA 3SOSA 5KFEA 1M1HA 4FPIA 1QSLA 1SKWA 2WVBA 1QTFA 2KG1A 3AA8A 2YNFA 5DG9A 4DQSA 1Z1IA 2QGFB 4U85A 1C0UA 3OL7A 4MFBA 4JP8A 1H8ED 3ET6B 1C1WH 3LPEA 3LPRA 1RT2A 5K20B 2BOPA 3MNSA 2LECA 4O3SA 1W8BH 4NXMJ 2WV5A 2ZQUA 3GJRB 1O2HA 4UY85 1FD2A 4OI0A 3QTVH 1HXFH 4AX9H 3HJFA 2MJUA 4MNXA 1WNOA 1C5YB 1VRUA 2XZWA 1ZH5A 4P2XA 5SUHA 3IR5B 1E1RD 5EXNA 2EW9A 1PJ7A 1S81A 1O2GH 4FUIA 2XB2D 3RFWA 1E35B 1J17T 3DT0H 3FZDA 4PRFA 5CYQB 4P6QA 1LHDH 3MEKA 2LFVA 1KIGH 2JLEA 5KFJA 2ZTXA 1HL6A 2HK3A 1H2VZ 4AQYJ 5EUHA 3MTJA 1OYDA 4Z2GA 3KABA 4TU8A 3MURP 3T3FA 1OMSA 3CJ8A 2ZDMA 4F2SA 1QTMA 1FEEA 1K9OE 4RSPA 5JPMH 2OLHA 5KFXA 1GHVH 1GI9B 1KRPA 2FAPA 2GS8A 1G36A 1BY9A 2FZGB 3LC3A 1E79D 4RKJB 1UA1A 4HHUA 5D78A 1TL3B 1FXRA 1R9HA 3M5OA 4LJMA 3CIMA 3QJLA 4DG4A 2HBZB 2IVYA 1LPZB 3TQEA 1Z6JH 3KN2A 5E5NA 1UW9A 4F0KA 4DLGA 1GMUA 2XC9A 4IFVA 4QIGA 3UNRA 1BMNH 1INCA 1E15A 4W98A 1PC4A 2RU9A 1ZLRA 1RAEB 4DSJA 3VGUA 1RKJA 1P6TA 1HBMA 3G6MA 3EQ0H 2OHDA 1OYTH 1LHFH 3Q0AA 4A8WA 3BQ2A 4NLSA 1IQEA 2VIPA 1XR6A 3ZTSA 3W9JA 3PMBB 4CO3A 3MMBB 1V6HA 4DQPA 3FQLA 1GBKA 2PHBA 3ZTPA 3T26A 1O3JA 3SU5A 2ZOFA 1JLEB 2CJIA 3BIVH 4RN6A 1RJJA 2YOLA 1NWUA 2OPPB 3H2VE 1D3QB 1NM6A 1ZTLA 1GT8A 5IC6B 5HL7Q 2EG1A 1IM6A 1SL0A 3Q8VA 4FVMA 1YM0A 1O5GH 2PA3A 1K73T 1TNKA 3UR0A 5EDWA 1E36B 1OPHB 3VXEH 3GONA 2IMWP 3SEOA 3NS7B 2ZNZA 2ZFPH 2OBQA 4F4XA 5BR8F 5IS2A 3S69A 2IYGA 4TXSA 3VAMA 1S6FA 3G8QA 2FY8A 1H2TZ 2DUCA 2Y6TA 1WOOA 1X31C 1BQNB 4LSNB 1S48A 1UVUH 3VTIA 4JK5A 1KR4A 4UFEH 2WZQA 3K2YA 3CDUA 2VU5A 4ANDA 3CO9A 2WOMB 2GC8A 5E3AA 3KKFA 2WPDD 2YWGA 2ZH4A 1ZBKA 3KLIB 2ZDAH 1W1YA 1LQEA 2F4FA 4QPXA 1W2KH 5F03A 3K6YA 3CCMS 2C8WB 2QE5A 2Z6BD 2RH3A 3KAHA 4THNH 4E0DA 1LFWA 4BLGA 5CA5A 3BTEE 4LF7J 2Q6FA 2HFOA 4ECRA 4X2BA 1QNJA 3URCA 1BMFD 3KG0A 3RW6A 2WBRA 3X1LB 2C28A 2ZCLP 4KHRA 4ZN3A 4XDCA 1SR0A 5EOKA 3VG8A 4X0WU 2B4UA 4OX9F 2FLOA 3KUEA 2V34A 4P8WA 3M35A 2W4CA 3Q89A 4DW2U 5B0BA 2BMGB 3A8CA 2IJFA 2YKPA 3R27A 2JH3A 4U95A 3DC2A 4B2AA 4ZVFA 2AGIX 2A18A 3MEDB 2IC3A 2W4PA 4LGXA 1P2IA 1M5KC 3PA7A 2I9SA 3OVAA 2MLZA 3W4RA 2CPYA 1RTHA 3EMTA 2ERRA 3R1LA 3M32B 3CDBA 2GCFA 4TU9A 1NLKL 1N33F 2V8DA 4EBEA 2ROEA 3G6ES 5ETRA 4A8YA 2ZH6A 1IVZA 2XPBA 4SGBE 1WHYA 4JYVH 1MU2A 5IM0B 4KELA 1SFIA 2OC7A 1SH0A 2FC9A 3GILA 1H7XA 2ZU3A 5JDUB 1RT1B 2UZAA 2AWGA 4ZVOB 4CR9A 3A1YG 4LR7A 2JKHA 4R0JA 1ZYOA 3KUGA 5B7WA 4ZVPB 1I94J 1BRUP 1YX2A 2LQ8A 4KSEB 2JJ2D 2KXHA 4D9QA 2M9KA 3MCNA 3F2HA 1SC8U 2QX0A 3H5YA 2KXNB 2OQ5A 5IT9U 2HPPH 4Q5VA 2ANWA 1LK5A 4K5SA 1RYRA 1RJXB 2O67A 2R7SA 1RGQA 4ZK7M 4DL2A 1PYTA 1RDRA 5BR8J 2ZDNA 4DSFA 2DVIA 1TNHA 1RU1A 2QO3A 4URQU 1Q95G 1KTTB 2B7DH 1RYSA 5C0UA 5EXMA 5L38A 4J9KA 4NIVA 2AKWB 3CCRS 1D3TB 9RUBA 4URSA 2G00A 3C15B 1N5QA 4C3KA 2BD3A 5E7OB 3SQOP 2I6QA 2C2ZB 3SV2H 2LXUA 1GMHF 4DL0C 2XMUA 4GLYA 1JLQB 1FAKH 1LOUA 1U2RA 2KO1A 1VK8A 2YNIA 4FUBA 1NK4A 2JIZD 1S9EB 3D6MB 3M8WA 2ZHFH 4J9MA 2CPIA 2HVYB 1W12U 3ZYDA 3I5CA 3ITHA 3ZZPA 4J9OA 2XYPB 2F3JA 2KZ4A 3C14A 2KRBA 2XMWA 4MQAA 3G2XA 4OX9J 3TNVA 4QR1A 2YMSD 4YOIA 1HR0F 3BTWE 1YLXA 4TY6A 2A45B 3T6JA 3OFFA 2ZGCA 2A3BA 1Q8IA 2LQ9A 1A0OB 2KRRA 2F91A 1W13U 5HGGA 1SJRA 1AROP 5L39A 1U6ZA 3JYTB 1P2OA 4X4PA 2PIIA 1YJRA 4NZ0A 1TB6H 1S72S 2OAUA 2ZJPQ 4F3MA 1QBVH 1S1XA 2ZOGA 5KFQA 1YVFA 3OJSA 3GY2A 1Q78A 2F9NA 1EZSC 1VQ7S 7ESTE 1N33J 3UWJH 2AGPA 2XP3A 1UVIA 3A84A 1PYTC 2CQ3A 3TO8A 4FVCA 3OVBA 1DTTA 4CNYA 4I31A 3ZZUA 3H0PA 1BE4A 4Y7BA 1GJ7B 4I68A 1H0HB 2G81E 2V9KA 2LGOA 1FD9A 3QT5A 2FI5E 1JIRA 1ZSKA 3UN3A 3BEGB 1AI8H 5B6OA 1NK5A 3UY9A 3MM9B 3UCGA 5LL6d 2ZCHP 1GX5A 3D49H 4D7GA 1HAPH 1K1OA 1VR1H 4RJVA 3VXFH 4C0OC 5KFOA 1Q7YT 1VIOA 4YMEA 3CCUS 4NEYA 1TFXA 1ZHMA 3G4SS 1NZQH 1FDPA 2EI7A 1UO6A 2AGGX 1ZAXA 3VB3A 3EGWB 4DX6A 2LU1A 3WD2A 4FAPA 2BW2A 4M9FA 2C2RA 1Y4ZB 4F04B 5DLGA 2A6OA 3ZZ7A 2OPQB 1VYAA 4Q4LA 1I6JA 1CT4E 1HIYA 2KR7A 1LVOA 4DV2F 3A8AA 1PJ5A 1R8CA 3QSYB 1MUEB 2EWHA 2QFIA 5A8KB 3NGKA 2ZBRA 5H9FK 1T7CA 3FC9A 8AT1B 3RMMH 1TFYA 1FHTA 2VBCA 5C42B 3GCOA 3QOKA 5C5NA 4RU2A 2C3SA 2VDIA 2YKAA 3SU0A 2VCDA 4D9RA 1LXNA 4DPYA 4EZ6A 1HKMA 4JV5F 4X4RA 2NXEA 4MIBA 2OPSA 4UOFA 3BJYA 5FDLB 1P09A 4MAVA 4TQRA 4PWDA 3H5UA 1RHKB 4EK2A 3MPVA 1NU9A 4QIWD 2VQFJ 1X4EA 1WKJA 3KFWX 5F41A 1K9MT 1RSCA 3PX6A 5D0EA 2PT0A 1G2MA 2BLOA 1HR0J 2VFUA 3KAGA 1FD8A 2PEBA 4AXJA 3LJJA 3SI8A 4XBDA 4CRDA 4FYWB 3OSPA 2B3TB 3M7VA 4KKOB 4K0KF 2QCYA 3I56S 3MEGA 4ISNA 3SFUA 3E8LA 3VGCC 2JDJA 1VS3A 2WONA 5F8ZA 2G8TA 2VVVA 4ELUA 2F4VF 1HAZB 1PQ7A 4A7IB 5G0RA 5IT0A 1SSXA 1OKXA 5ITHA 1XUIA 2ZU2A 2ZQTA 3CJQA 4PEOA 3ULHA 4K2YA 4V1Ak 3KLEA 1JK9B 4ECTA 1O2XA 1C4CA 2G55A 4GCHG 2JX2A 3OW2R 2P8IA 1L1PA 1DS2E 3BEIB 3MNCA 1IQGA 1V2QT 5DS7A 4P72A 4O4GB 7GCHF 2R7RA 4EBCA 1LWCA 3OJUA 5IT9Y 4ISHH 2XY5A 1VGCB 3PW2A 2IDEA 1TIOA 3DDKA 1FK9B 2AEJA 2TGDA 1W2BR 5C67A 1T05B 2BE2B 1EPTB 4IOAQ 4ED5A 5EQRA 3PNIA 1S9FA 5KFYA 4J37A 1EARA 2V68A 1KHVA 1GI6A 2RQMA 1N54B 4ECXA 4AYYB 4UT4A 4TPYA 4DG1B 1CVWH 1WCZA 4YS2A 5EX0A 1VCQA 2VU8E 1W7GH 1U8WA 1DZ5A 1S83A 1ZPWX 1Y3VA 3ZNUA 5BYSA 1HB0B 1YJTA 3MPYA 4B17A 2QXIA 3QBCA 4ZVEA 2XRCA 1RADB 2RDIA 4EUVA 2ODQA 1WTHD 1ZAVA 1FFSB 4AFQA 1EQ3A 2JC1A 3QATA 2ZBIA 2O8TA 3UNGC 2KJVA 3IXQA 1L5UA 3M2VA 3UWTA 4DV2J 1YK9A 2GCHG 4DSIA 4K2XA 2YTCA 5FLXU 4FYDA 3B9DA 4UY8T 1ZBTA 3OEHD 4AB8A 3IBFB 1U7LA 2VINA 1P0SH 1U1KA 1UTAA 2RA3A 2EBEA 1UTJA 6CHAC 4JI8F 1OS8A 2ATLA 2CQ0A 1RT6A 4S3JA 3BR9A 1W9UA 2VVUA 2XSFA 3NGRA 2AYWA 1X6NA 2QF8A 3SDEB 1REGX 4X4VA 1OYEA 3LGTA 4OJGA 4PWWA 2P6SA 3DYAA 1NB7A 3H40A 3GY7A 4U86A 1FKPA 2MQOA 2JETC 2P5VA 1KBRA 4B3MF 3T6BA 1YW5A 1U49A 4ZXYH 2AEIH 1TMBH 2OGUA 5A8WB 5I42B 2QYIA 2Z0GA 1VC0A 2FLRH 3BTKE 4UW2A 2PP6A 1R43A 2V2QA 4FYVB 3CJKA 5F8LA 1YI2S 4K0KJ 3JB9k 4B71A 2CHAC 1C2MA 1REVB 2FI3E 3G82B 3RXOA 4OS5A 4K4TA 1D8YA 2Z2MA 3AJ2A 2F4VJ 2XPAA 2MZTA 2C22A 1EAYC 3AAUA 3NRKA 5C0TA 2RJZA 4ISIH 1H74A 2V94A 2B9XA 1K28D 4WH8A 4O44A 3CF5Q 2RDEA 2VFRA 5GCHF 4G1IA 3GCTG 2M5TA 3VFEA 1A0HB 4YESB 1NJXA 2W7OA 2ANMH 1FVQA 2DGQA 3Q8PB 3RJMB 4NMLA 3T27A 1Y5NB 4UE7H 2VBXA 1FT8A 5KT7A 1ICEB 4LZ1H 4MTPA 3B8HA 3GYMA 2DNRA 4X4NA 1S0MA 5A8RB 3F9EA 3TJ8A 3SIPB 1WYKA 2WLZA 3I4HX 4ASHA 1E44A 2NCKL 3D3BJ 3A7VA 4DR6F 1TGNA 5E3PA 1GMVA 1S1TB 4K50A 2LKNA 2GA7A 1MN9A 2G4UA 1X0PA 3QZ8A 4DR3F 1RD6A 1DLOB 1N0VC 3W7BA 1FRIA 2C4FH 2FOFA 1VQYA 2PLXA 2NU0E 3IA0A 4WK1A 4XK8C 1GDUA 3AAVA 5IOLA 3KHHA 2Z2ZA 3PLKA 4RW6A 2GMTC 3T29A 5CCLA 5IWAF 1TOMH 5DLFA 2CQ1A 2Z3DA 3UR6A 4IYQA 5LGOA 1NCLA 2HNYA 4DY7B 1BTZA 1GMCF 3BTGE 1TMTH 3NK8A 4A1TA 2XZTB 2VBYA 4BS2A 2ZCKP 3A8EA 2KG0A 4Y8ZA 1HYSB 5HW8A 1L3UA 1AKSA 2DBBA 1ZRKA 4P9SA 4JI8J 5FPTA 4UFGH 1F60B 3CD5A 3WHIA 2QF5A 4USWA 1IKWA 3IG1B 1ELFA 3RG6A 5AE1A 4RNOA 2MGZA 3VQSA 4MNVA 4R0IA 3LP2A 1IWAA 3R7BB 1J5OB 4WFXA 1RT5A 5A09A 3IM8A 4Y11E 1CHGA 1YWXA 2WHXA 4IN2A 2TRMA 1LKAA 3DMJB 4OS1A 4DIIH 4Z2HA 2KTQA 3GPKA 1EETA 2ZJQQ 2J98A 3OE7D 3JSBA 4B3MJ 3N7OA 2QL5B 3TUIC 2F43B 9LPRA 1D9AA 2PKAB 3PO4A 5HIZA 2BQ6B 4YQWA 1C9TA 1Q2WA 4H4OB 2XNRA 3SHCH 3FY1A 3SV9A 3FO8D 1A61H 1UFWA 4LZ4B 3KHGA 3D68A 1VMBA 5D6GA 1LW0A 3J7Z5 1LCYA 1YRXA 1NU7B 1DAXA 4RT1A 4O0NA 4P73A 1VJAU 2PI4A 3N28A 2HS0A 4FU9A 2GDDA 4OZJA 1WHXA 1QJ7B 3C27B 1KDQA 4NLWA 3M3SA 1NJIT 2SGQE 3KYLA 4RUHA 3HPTB 1P1LA 2GIFA 1FY3A 2M52A 3IR7B 4LAXA 2CQGA 4FKXA 1SGFA 4ZP8A 4CWBA 5PTPA 2L3MA 3D6FB 3H8YA 1W0KD 1IHSH 3SZNA 3SQEE 2HRYA 3KQ5A 1LWEA 1JKHB 3V12A 3UNSA 2FODA 4NA1A 4ILLA 2BLWA 3S8SA 4MKBA 4I2QB 2ADCA 4GKJF 3I0SB 2WV4A 3T62A 3R5JB 1CULB 2J5UA 3RGIA 1URRA 5L1LA 2XP4A 2LELA 2FYQA 2E5JA 4OQJA 2HVZA 3CS0A 4G1QB 1QJHA 2BMBA 3R5GA 4UOHA 4DR6J 3QT8A 4ODRA 3QRPA 4KPYA 3MYWA 4NMXA 2DR5A 1JMTA 3W66A 2AS9A 4DR3J 3F9FA 2DE8A 4X65F 1B70B 5D0HA 3AS1A 4FXWA 2WBMA 5FLXY 5B0GA 3GB0A 4A4JA 1KXDA 5JXSA 1O5AB 3HX9A 1U0HB 2UVVA 2FMJA 2DT0A 5IWAJ 3GS9A 2XBWA 3C19A 1P9UA 1CS4A 3PYDA 2VC1A 2B8OH 4TY8B 1DWDH 4ZHAA 2FD2A 2BDHA 5E33A 3LGVA 3P8OA 1N5TA 1OS5A 4E7RG 3DI6A 4KTSA 1PPHE 1E6VA 2QC2A 3OHAA 1CJUA 3ELHA 2NR0A 1RTKA 1GWAA 5C5JA 1V6DA 5KT3A 5DG8A 5DP3A 2GZOA 4MTBA 1XHGA 3I9ZA 1L2EA 1BQMA 3MDYB 3TX8A 4KO0A 4BHQA 4NZCA 3KCEA 2RKIA 4QU7A 5LH8A 1NHUA 2FOHA 2B5UB 3NLCA 4P71A 3IKDA 1OPZA 3HZGA 1VQNS 1LWFA 1U24A 2F9BH 2B0FA 4RW8B 3BO2A 1R6YA 3IKGA 2DHHA 2R4FA 5B08A 1HNZF 1VQ4S 2QYCA 4M95A 4AGKA 4I2PB 5EODA 2A7HA 2AJ4A 3SQGA 4IW4E 4AFSA 1TZ0A 4NFFA 2TGPZ 5LJ5Y 2DGTA 1KT0A 3RAMA 1IR0A 3ZO7A 1FRJA 5EJLA 3DRYA 3KHLA 1YPHE 1Z2ZA 2VGCB 4R5EA 3PCOB 4G50A 3QGPA 1XQIA 1GRJA 3G96A 2XBVA 2SNVA 2JL9A 3TQ1A 1FKIA 2A3AA 2XNQA 3EWGA 2CG4A 4GO7X 1D9IA 1IKVB 3LH2S 4ABBA 1UZDA 3F3BA 4TT3D 1IQHA 5F8GA 2DGXA 4NI2B 4J9QA 1THSH 2YBVA 4ES2A 1P57B 2J92A 1NWSA 2MKIA 3SV7A 2EG2A 2YKNB 1YLCA 2A5IA 4HR2A 4MT1A 3NCLA 2VASA 3A4TA 3ATWA 1BA8B 1WBGB 1O32A 1G30B 1HAOH 4GKJJ 1A0LA 4IR9A 2O9OA 5C25B 2LYVA 2GP9B 3ET6A 4ELTA 2EA3A 1O34A 9ATCB 1FWLA 3AW1A 1DBDA 1SXLA 3F56A 5K9FA 4ED8A 5J1PA 4ABHA 2A5KA 4WE1B 4B2CA 4XPCA 2QF3A 3AAWB 3AXMA 2ZD1B 4MNMA 3GV8B 2OEJA 3AASA 2CGAA 4X65J 4Y76A 4ZLPA 1F9EB 2NYIA 2AYBA 1SPBP 4LFBF 3L4BC 2KFNA 2FJXA 2HQCA 3PJWA 1HHSA 5CYQA 1EDQA 2EI5A 4KB7A 4USJC 2HHPA 1UFKA 1EKBB 4WKFA 4D76A 1JCHB 4DFPA 4YFUA 5MLCV 3UNYA 4P52A 4Z2XA 3C3LA 3F0NA 4K5ZA 3RXAA 2CF9H 3K5MA 2CADA 2AV5A 4KGMA 1LMWB 1JNEA 1XR7A 1NKCA 1NWRA 3PJ9A 2E44A 5ETXA 4X62F 3FBCA 3MOZA 3ILLA 2KCOA 1BBRK 1WACA 2H5JB 2FOMB 4J2YB 2ZTZA 4GVLA 2AX1A 4W4MA 2ZH5A 1RCOB 2J94A 5FL7D 2IA0A 5KFBA 3T25A 1ZB5A 1SIZA 5C20A 1S9GB 1X5PA 2ZGHA 3ISZA 1LNQA 1WAYB 5KFKA 1MH0A 2DYAA 4DF4A 4P8XA 2ZC4A 3LANA 5DDPC 3GY6A 5C1XA 1A46H 4DX8H 1IX5A 5I4MA 2GHVC 4DRIA 4RI0A 1MLAA 2Y7ZA 1UJ1A 3UN2A 1O2MA 1EZZB 1YJ9S 2F4LA 4Y8XA 4X6OA 3DRRB 4N5SA 3RM9A 3MM5B 2IJOB 4JZEH 1KOOA 3P95A 4OS2A 2BUNA 1ABJH 3MMBA 4GMKA 1UTMA 1WC6A 4DR5F 5B8IC 3MHWU 1AFJA 1T9WA 5C94A 1SG8B 2E1CA 2DPEA 2HPQH 2J4IA 1EJNA 2BLQA 1JLEA 1FRKA 2DNYA 4OYZA 1NPPA 2OPPA 3MR2A 1O39A 4ZJLA 1P2NA 2VC0A 5J2MB 4IH5A 2OINA 4LUBA 1C5ZB 3ZZ6A 3H4DA 4OGXA 4R8UB 1WQSA 1S6OA 4Y28C 4MK9A 4B6FA 1D3WA 3FGVA 2V2KA 1SKUB 5GVQA 1H9LB 3W8PA 2LXIA 4C0BA 4WP3A 4M5MA 5J1NA 1UWBB 1P2MA 2X1BA 1JMOH 4C02B 1DITH 3DLKB 1Y5LB 5KOXA 3BR8A 3OR1B 4ZVRB 1L0ZA 4UUXA 1GHWH 2DRDA 2ZZTA 2FVQA 5A8ZA 1NTPA 5K7RA 1BQNA 3TU7H 2ZKTA 3P3DA 4LSNA 2ZH7A 4HI1A 3IITA 1G3BA 5HUAA 4C3LA 2Z3CA 3LGYA 4QCLA 2WOMA 4C48A 4X1RU 4DZ2A 2BJ1A 3UCZP 4ZVTB 2HWIA 1C2IA 3O5PA 2YMSB 2EEYA 3KLIA 2OPRB 4DOZA 2LLZA 5AJ3F 4OFZA 4F4AA 3WZ0A 1JNDA 2HIQA 2AMDA 3MH7A 1PBKA 3ATIA 1TPAE 1YGYA 4ITZA 4MIAA 2UUTA 4OI2A 3HT0A 4IDKB 3MZIA 1U2FA 2WW4A 3FMWA 5EWEA 3SN8A 3HLUA 1TX7A 3BEUA 4ECYA 7GCHG 1YLDA 2XC4A 3MPDA 4KTCA 1SBRA 3KLHB 1AUDA 3FUYA 2EFPA 2H9HA 1FKDA 3KLFB 1FKAF 7FD1A 3MHYA 4FUGA 3NMRA 1EQ9A 1Q3XA 2CDQA 3MEDA 2BJ3A 4CLPA 2NU2E 1S6QA 2ZQVA 3QNWB 3RM2H 1TL4A 3GYLB 3CCSS 1CA0B 3HSZA 2PTNA 3M32A 1D0EA 3HATH 4J9RA 2DGOA 3FMBA 1CT2E 2IM3A 1RT4A 4C0HA 4RBTA 4I86A 3HK3B 1YQHA 2J34A 3DGVA 1JXVA 2VIQA 5J2NB 4BXSA 4XPEA 5HQ8A 2F9JA 2LEBA 4IRDA 2J9DE 2JNJA 3M8SA 2BQUA 1GTHA 4Y2MA 4ZCMA 5A8YA 4U67Q 4CLTA 3SQHE 4Q8EA 1S7IA 1EP6A 1QBOA 2IPHA 1WELA 5DJBA 1MMDA 1SL3A 3N0VA 1W0YH 5IM0A 4MPWA 2ESCA 3W60A 4DR5J 2G9OA 1BITA 2VUGA 1RT1A 4ABGA 3ENQA 2P3UB 4J7CA 1S79A 1HWKA 4BAQB 3LWMA 3ZVDA 3CUNA 1NFUA 2KAIB 6FD1A 2XWAA 5HMZA 1AFEH 1AZZA 3TVKA 2J8SA 3V6JA 3UF8A 2A2QH 2FHJD 1J4HA 1BWVA 2L48A 2NPFA 4TN2A 2QAAA 2KYXA 2VG6B 2NU1E 4OHYA 1C4AA 5DRKA 1R0AA 5C7PA 5DJ7A 4HFPB 1P27B 3S7RA 2QN5T 1T9VA 1ZCNA 1NESE 2FOCA 4K4YA 2KT2A 3CMQA 2QIFA 3K5PA 2QIQA 2UVRA 4N41A 4KQZA 2PSYA 4MNLA 5M2UA 4LR8A 3SCKE 5KAKA 4Y34A 1Q4RA 1DLEA 2XMTA 4QYZK 5DP9A 1NZ8A 2W7PA 1BQYA 1GOIA 1RAOA 1ZSJA 3C15A 3NZIA 4ZA1A 5AT1B 1SGQE 1TOCB 1SI9A 1O33A 4NYOA 2KYZA 3POTB 2Y0SD 2LP6A 1SGYE 1JLQA 5IV3A 4WKYA 3D3CJ 3B9AA 5AJ3J 3BDPA 1XNRF 1MKWH 3CH9A 1RIWB 4NRTA 3CNQP 4PG7A 3Q83A 3D28A 3OL9A 2BHGA 2KHCA 2G0JA 2ZC9H 1V3SA 3MM8B 3ZZZA 1S9EA 4ID5B 1TX6A 4JI5F 4DROA 4AZ2B 2XP8A 3ZZ5A 3EGNA 1TYNA 1F0RA 4IUFA 2M8HA 1XUJA 2CPEA 1V5IB 2P3TB 5ADZA 1APSA 1F5CA 2IYIA 1QRWA 2QGRA 3UW1A 3D66A 4ESTE 2VG5B 3OPKA 2XW9A 1Q8KA 3WKZA 3G8TA 4X4OA 1Y59T 1YC0A 5L9NA 4ANEA 1F6TA 1ARBA 5F8HA 4IQMA 3E91A 4KR0B 1YPMH 2BM0A 3O5TB 3BPDA 3JZ1B 3IHZA 1TALA 4CO0A 3JYTA 4A46A 2DT9A 4GVUA 3EPIA 1GI5A 3ODDA 2I5JB 1TGBA 4JZ1A 3ZZBA 1S99A 4DFKA 3E8OA 1WDDA 1P3EA 4JMYA 2DIVA 1OWDA 1GJ9B 2YKQA 4QOTA 1QL7A 3HULA 2H4YB 4LFAF 3U8TH 3QGJA 3EGZA 3SZ2A 1H73A 5EX3A 3Q8YA 1NRNH 2VWLA 3BSNA 1BT7A 2EEKA 2CQ2A 2D7SA 3LAMA 4KRWA 4Z2IA 3OTJE 4JYSA 5CABA 4A8MP 3EY6A 1O5DH 1RCXB 4AB9A 1WTGH 3PO1C 1P3CA 3BBBA 3J7ZT 1DSUA 3ZZ4A 3UD3P 4X4UA 1YDLA 4DQQA 3MM9A 4Q2LA 3PW4A 1HXVA 2CK3D 1SJQA 2E5IA 2YWWA 2F9VA 3LA0A 1O51A 4GGQA 1EXFA 3RW7A 2XGPA 2ZEJA 3RRGA 2ZHEH 1VRUB 2VIHA 2HAFA 2LMIA 4CRGA 3UI3A 1O2OA 4AYVB 2K8GA 3MEEB 3GIKA 2M2AA 2QT7A 4HH0A 2Y1RI 3HMJG 1Y0OA 1C2PA 3J80U 1TU0B 1N36J 1BD6A 4DOQA 1N0UA 4FNIA 2FTMA 3KXDA 1UR9A 1BTXA 2OPQA 4IOBA 1XTZA 1V2WT 1Q53A 1H2UX 1T3OA 1IJFB 1GMWA 3GISB 4RBVA 2IRXA 2HWLB 3WDOA 1U6FA 4CO5A 3RM0H 5A8KA 1GHZA 3PKYA 3P92A 2QLWA 5FJ4A 5C42A 5CHAB 1RAJA 2Q6BA 1R8AA 4DRNA 2Y80A 2EC9H 2G41A 1NZAA 1DVAH 4KP0A 3HDSA 5CMXH 4LF4F 1GCDA 1BBRH 1TL5A 4JI5J 2F21A 3RXUA 5FDLA 3NXPA 1FTCA 1WI6A 3IWLA 1UVMA 2EI8A 3KIDU 2QA4S 1F9FA 2CPJA 3RXQA 3BZQA 1UPMB 1ELOA 2CKWA 4LFCF 3ESTA 2DNPA 2GVDB 5E2PA 4D7FA 3AODA 3UQIA 3OR2B 3BKTA 3AOBA 3S9BA 4K60A 2NWNA 2ATCB 4HT5A 4ZP9A 1HIAB 3RBDA 3LF0A 4Z6AH 3IBWA 2PFDA 3T5LA 2P8OB 4PQAA 1SGFG 3LTOA 4Z2LA 1NRRH 3E16B 4KKOA 3SYJA 2Y0BB 3CGNA 3SU4A 2CNKB 1TELA 3R7NB 2Y5FA 2CPDA 2M7SA 2UUWA 2BOKA 4FZVA 4WXWA 4ZS6A 1SQOA 1MWYA 4DL4A 2KM8C 5GMEA 1UVTH 4QWCA 4DJBA 3SGBE 2HSEB 3P49B 2HRVA 2GJGA 1WKKA 2LEAA 4LFAJ 3SV8A 1M5SA 3PVXA 2M3DA 2VBWA 2YPYA 4ZXXH 1QQ4A 3O8CA 2RRNA 1O5JA 1PKUA 1DJ0A 2XXLA 1JJ2R 5DPAA 1E37B 4C4WA 3UFCX 3NRLA 1XJWB 4O4GA 1O5CB 1R8HA 4YB5A 3GJQB 1OWEA 1D7IA 2HNTF 2XCNA 2G8ZA 1RTDB 3NUMA 3BYRA 3O8WA 2ZHDA 1FK9A 1QE1B 3TWZA 1J5EJ 4S0MA 4C11B 2FLPA 1CHOF 4WJXA 2MLYA 4WXIA 1K2I1 3W5YA 1T05A 3SNDA 4U84A 4B08A 2BE2A 1EPTA 3PTNA 2XI2A 4O3RA 1HDTH 4LF6F 4IBLH 4PZVA 1HQEB 2JZVA 5FD1A 3JXVA 3UR3C 4DG1A 2EFOA 4DN9A 4ABAA 3C6TA 3BBCA 4F55A 2R7OA 5EQQA 1KTQA 4QW8A 5KG4A 3NKYA 4VGCC 1KFSA 1N5YB 1WNEA 1LL7A 2UUBJ 3R5DA 2FXRA 4JFIA 1F0TA 1S10A 2AT1B 3A81A 3KG1A 1H6KX 3OXGA 2BXJA 3AQOA 3SV3A 1H0GA 1WXRA 1GBHA 2QY0B 2GMLA 2AHOB 2HOBA 1QY7A 4ZKOU 8GCHF 4J4NA 5JJBA 1YYY1 3JYJA 2KU7A 4HBOA 2ZDOA 4BXWA 2BLVA 3A7XA 1T03B 1HARA 4ZCIA 2F9PA 1IKYB 1QB6A 5T1VA 2DSUA 2WB1D 4LF4J 4ODPA 3NGUA 3Q8QB 1C1PA 2J7UA 3SDEA 3RM4A 3CC7S 4U30A 3EZOA 4WH6A 5HN0A 2HS3A 2IC3B 2DNMA 4XFQA 1ZR0A 1SR5C 5IK2D 2G51A 2KVQE 3P6ZB 4LFCJ 1K1IA 2O8UA 1N1LA 3PWCA 1ZU8A 4NLRA 4DWSC 1X0FA 3JQJA 1LHGH 5A8WA 5I42A 2Q3PA 3F44A 2W3IA 4PR6A 4IRCA 3WD4A 5H9EK 4OM9A 1GBJA 1BMMH 3MPUB 3G71S 4DR1F 4LVOP 4M63A 3UR9A 1NK6A 4F4KA 1BMLA 3G86A 5IC4B 4LF5F 2MZ1A 1WV7H 2A31A 1UJ6A 1A7XA 5I25A 1REVA 3QAEA 3C66A 3QZQA 3RB4A 2GCTB 4ALZA 1FKRA 2BW7A 3KK1B 4O3TA 1O3PB 2ILZA 1X4GA 1RHJB 2WSSD 1FPHH 4YDXA 3DN9A 2HLUA 3AD8C 1F40A 2QSWA 3RXPA 3PFOA 3TR5A 4NLGA 1TAWA 2SGDE 3DLHA 4L3KA 2RRAA 1F8AB 1G3CA 3EM1A 2AX0A 4B3RF 2F4EA 3IAS9 2QSFA 2HS4A 2V69A 3RU4T 3QLHB 2HFSA 4DQRA 1TKDA 5A8RA 2W1BA 5C1YA 3TJOA 1Z8RA 2M2BA 4ABIA 3QGGA 4LF6J 4OHVA 2KI2A 3MUTP 4GC6A 1P2KA 4OS6A 3I5AA 2MKHA 1QIXB 2JH6D 4XRNA 3TNTA 4ED0A 2YQ1A 3JTNA 3TIUA 1S1TA 1LJYA 1O3FA 2CXVA 2OCVB 1GUVA 2B8QA 5DP7A 4HTIA 1UVNA 3ILIA 2A3JA 1KYNA 3W3SA 3ARWA 5EU8A 3QRQA 3KF2A 4M5HA 2FJEB 2DISA 4YR0A 3A7YA 1U1QA 2W2PP 1U1NA 1E6YA 4OLPA 1CSOE 1YKTA 3DLLQ 2FC8A 1O2RA 3EDQB 4AFFA 3SI3H 2HVDA 1PBAA 4IG0B 2EY4C 1FLEE 3C14B 2PN0A 3PZPA 1RD3B 1GI4A 2UV8A 1CEZA 1CC7A 3CO0P 3QFHA 2XNIA 1ARCA 3LGHA 4FS2A 4DSEA 1SMFE 1WOPA 3C16B 2D8WA 3PEHA 1J5OA 1N1AA 3EJMA 3SZEA 3P8NA 4F7VA 1L1GA 2ITKA 3TDBA 2AOSA 2VFTA 3DMJA 3HK6B 2FYRA 2W7AA 2ROPA 3QN7A 5AXNA 1DT2A 2IJD1 1O3IA 1GCTB 2O01C 1BMQB 2PC6A 4PAAA 2RMLA 5LMUF 2JEFA 2MKJA 3IGNA 1TE0A 1S6PA 3DLBA 4DR1J 4HKQA 3O3LA 4HHJA 3FEZA 2QXHA 3NAHA 4NGAH 1XUKA 1FRLA 2CQHA 2V5HG 3G01A 1THRH 2GAHC 1K22H 3V6KA 1YRUA 1CJKB 1S84A 3KTQA 4BDPA 1PPEE 1U09A 2G5VA 4ZCNA 3WL1A 1GVLA 2YX7A 3BYPA 3KYGA 3I0RA 2TGAA 2QXJA 3DOMB 1B7XB 1PYTD 1O3KA 5KG3A 1DWCH 4O4RA 3RBZA 2VBZA 1ZMNA 1LL6A 2C2KB 1JKHA 4B3RJ 2XO7A 4ECSA 1GPFA 4ED1A 4I2QA 3NAIA 3I0SA 3NOGA 1CULA 4IT6A 1DANH 2R7VA 4YOJA 3MCMA 2WPHS 1V2PT 2D1CA 4WFAQ 1OY6A 3P8GA 2YKOA 4CDIA 3AT1B 1WHVA 2SGAA 2DNNA 2CJ9A 1QVGR 4G1QA 2HAIA 1WSRA 3HXMA 2DHAA 2YQ0A 3TAQA 1MWZA 1KQKA 2R0KA 4U7CA 1Z71A 1RB0A 4FN2A 4MNWA 1QRXA 1U0HA 2KT3A 4OZ0A 2H4WB 4I64A 1RBAA 3N6LA 1HKIA 4MMOA 2YVSA 2AGOA 4TY8A 1TAQA 2VJ1A 3M3TA 3P17H 2KXFA 3VPKA 2CZ9A 1RA7A 1OSSA 4X4SA 3WC0A 4JI0F 4BNRA 1DY9A 1AZ8A 2VJUA 1SOTA 3D54A 3QQCD 2ZTYA 4EFAC 4BBYA 4GAWA 1C1BB 1D9DA 4DZ3A 1ZPVA 1ANBA 1NDLA 2JRSA 1B3TA 1UVLA 4MNYA 3MWIU 2UP1A 1S5SA 3UOPA 1VBYA 5CZVA 1T4UH 5GMDA 2PSXA 5HTGA 1UHBB 2UUCJ 3MNBA 3MEGB 3RBEA 2IM0A 1EX8A 5L1IA 4RW8A 1O2VA 3U1JB 1V9OA 4DX7A 4LSZB 3K7RA 2XULA 4X4QA 3T9NA 1TBRH 2C90B 4AC9A 3MU4A 1ACBE 3OY5U 4R5PB 1PQ5A 4I2PA 1UWAA 4WZMA 3PR5B 1S4FA 1BHXF 2A2DA 1BOQA 1VITH 5FCKA 2RDJA 1FKLA 2PV2A 4LAWA 1TNJA 4NCYA 4HDHA 2PPNA 4ZJQA 4X8VH 3E3TA 5KFRA 5D4LA 1HWJA 3RYLA 1S0NA 3V4IA 1NO8A 3DA9B 1S6LA 8RUCA 1UTKA 5HQMA 3CD0A 5EHHA 2BE7D 1VITF 3FNNA 1DY3A 2AIRB 4J9NA 1DRZA 4WKRA 4S3KA 1IKVA 4ITSA 1ZOTA 1MTNB 1LV5A 2DNZA 1TRMA 3RXGA 2F65A 3RXVA 3O1LA 1NU4A 1SLWB 1LKZA 2Q6DA 2XMVA 3BQ1A 4UDWH 4NI2A 1C1OA 1DWBH 4I6WA 1MQ5A 2YKNA 1X9MA 4O3PA 1MAYA 3J81j 4JFLA 2AEMA 3U1IB 1BXNA 1MAXA 4F0HA 3FDSA 4KH1B 2DO4A 4KIAA 5L2YH 1H3DA 2HGMA 2FZCB 5C25A 4WK9A 2Z9JA 2ZH9A 2D9OA 1GBIA 1VCTA 1M1GA 1GHBF 1BTYA 3MO6A 3FKBA 2FJVA 4WE1A 2BOHB 2HHXA 4AFZA 3PKMA 1WDTA 2XLIA 4NE9C 1K1JA 4NZ6A 2ZD1A 2WVFA 1A1RA 2ZGJA 3FK4A 1TVRB 2GTBA 5J6EA 5KECA 3QPIA 3RXHA 3T1AA 2MKCA 4GHTA 2CF8H 4BC7A 1NPKA 5DM7Q 5GPIB 3TAPA 2Z2LA 1FERA 4Q7NA 2ZBPA 2HALA 1SV5B 3Q8SB 3AXKA 2MZJA 3RBXA 4MPUA 2EFVA 5BXIA 2YPZA 4KHPF 1FRMA 2Z57B 5HBMB 4LRAA 1RT6B 2XYAA 1QL9A 2J9NA 3KK2B 3OLAA 1DE7H 2BM1A 4JI4F 3OFGA 3ATMA 2FGCA 4JI0J 3DDIA 3D67A 4NASA 1VJ9U 3HHEA 1PG5B 1FVSA 2E9ZA 4B9LA 4CNZA 5CDFE 2PW8H 5HVFA 3GCHC 3J7AN 4FETA 4ZDNA 3BN4A 4Y10E 1ULRA 2P9GA 4I7YH 2J0QD 1MBQA 1OP0A 2RAQA 2AYEA 5D0GA 1T8EA 3TA1A 3GV7B 3WW7A 4LF2A 4EI2A 1RWUA 4WIWA 1NSAA 3S7HB 1S9GA 3CJKB 1UEKA 3LAKA 1GBFA 1FAXA 2ETNA 1P10A 4J4OA 2LVWA 1SKRA 3NCRA 2RVJA 3KLGB 4L3NA 3KQEA 3DXBA 1NXIA 4K8YA 2P59A 3TK5A 2W2OP 2Y1JA 2GJFA 5FX6A 4A5TS 2BVSH 1PBUA 2H5IB 1GI7B 3BXWA 4WFZA 2NU3E 1IBMF 3MFIA 3BF4A 3HFVA 5CD4H 1WDIA 2J9CA 3CENA 3CE8A 3PMAB 3DRRA 5HP1A 2FVSA 1VFJA 3BN9A 1IR2A 2DHXA 1P9YA 3HSDA 3LOXA 1XMBA 3KL6A 1Z1ZA 1IBLF 3IC1A 4I67A 1A7SA 3F6UH 3PFEA 2M70A 1ANEA 1MG7A 1GJ4H 2W9CB 5J2MA 2FDMA 1SVPA 5AE3A 3DOLB 4R8UA 4ABEA 4DEZA 1Q81T 3NP5A 4RX6A 4ZHRA 2ILYA 1NRQH 1H4WA 2D3ZA 1V2KT 1WB0A 4AE5A 2ROGA 5A2QY 3MR6A 3DSPA 3D7SB 4DV3J 2C93B 4A6LA 2A4QA 1VRTB 2P94A 4A1XA 6FDRA 1XMQF 3PTBA 1UWBA 1GJ6A 3DLKA 2AF6A 4JB8B 1KHWA 3IRXB 2Y1IA 2J38A 4RNHA 3KJQB 3OR1A 2OUAA 3VQTA 1HMVB 3C2PA 3UI4A 1GG6B 1WC1A 2JVRA 5HIYA 2ZR6A 1BUXA 4DR4F 4N8OA 4Q45A 1SL1A 4N47A 5FBEA 3OUYB 2HNYB 3M9NB 4OJ3A 3GZ7A 5DP5A 1TFVA 1GEHA 5AVDA 1WI8A 4ZCKA 1VLOA 2RT3A 2ZO3H 1CTNA 1BC6A 4KHPJ 1FQ3A 2OPRA 3RZAA 4PTMA 3NBPB 4G2PA 2RS8A 2FS9A 1P05A 4DV1F 2MGZB 4B9MA 2ZHOA 5HM9A 5KG0A 1FKSA 4IDKA 1TK5A 2FJBB 4JI4J 3ISNC 1EJAA 2L41A 4P00A 4PPZA 1XNQF 4NSYA 4RO0A 1H9IE 1W2IA 4B9VA 1FNOA 2GV1A 3PG9A 4HT7A 4EBDA 4CZCA 2B4VA 1Z1JA 2VD3A 1Y7PA 1EB1H 3PM3A 3KLHA 2V2VA 1D4PB 2FDAA 4FN5A 3KJNB 4OI4A 2ZHQH 1GBMA 2NYHA 4Q2MA 3KLFA 4LBIA 5CYJA 5DGBA 1N4LA 3PMHB 2ZDKA 1R31A 2UXCF 3T5HA 1CQQA 2GAGC 1ZZNA 1D6RA 4OMFG 2AMCB 2N3OA 1C5TA 3CCJS 3DHXA 1DY8A 2E5LF 3CJSA 3M7QA 1SQAA 4Y7AA 1SIWB 1QJ6B 4DFJA 2R3VA 4A92A 2JJ4D 1ZGVA 3MPWA 3QYYA 3PACA 3KDOA 2XMAA 2GNKA 2MZRA 3O5GA 5J2NA 4F36A 4AYBD 2A1BA 2X7IA 3Q22A 2ZBQA 1UA0A 4NYPA 2O3DA 2K0QA 8KME2 4IO9Q 3FOAA 1JRTA 3EZUA 4ZCLA 1EUFA 3UQVA 1O30A 4DU7A 5ETMA 5JYIA 3QLPH 1FXDA 1IBLJ 5ETLA 3PW0A 3M5MA 4JI6F 1PCAA 1OY9A 1J15A 2MQMA 2XBPA 5T6FA 3H9RB 2XWXA 1EATA 5GDSH 4LBHA 2KAIA 4OZ5A 1L3KA 1JNZB 3FBEA 2YMSC 2BQRA 2ZFTA 4MDSA 4BAKB 4XDDA 5BJRA 3ELAH 2VG6A 3LIWA 5C1UA 1QM9A 3T5KA 1RWOB 2CZVC 1NO9H 1AFIA 4U01A 2CQCA 2Z9KA 4LMZA 2FLNA 2MSSA 4ZVUB 1XMQJ 4ZPDA 5L1KA 1UETA 3FANA 4P75A 4TW8A 3T41A 3N5BA 3L7OA 2XLJA 3W62A 4WVPE 1XXFA 4MAKA 5KFPA 1PQAA 4DR4J 6GCHF 2QMUB 2BDAA 1Y5IB 1PQ8A 2FEQH 5CAAA 1EJMA 2ASUB 3TA0A 1MMLA 3AA9A 2XZDB 3DOKB 2LA4A 2N87A 3FAOA 1CGHA 1U0SA 4OYWA 4OHXA 3UOUA 1L4DA 1FN8A 3POTA 1O3HA 1YG0A 1QUVA 5FIIA 5JVGQ 2V9WA 1OIAA 3I55S 1C1VH 3MAQA 5JBTA 4ODLA 2AMQA 3K5NA 3HF5A 4DV1J 2VIOA 1EHWA 4ETXA 1YWUA 3MM8A 2Z9IA 1SLVB 4ID5A 2KKHA 3ETOA 3H7OA 2KDOA 3UREA 4ZIWA 4RNNA 1XNQJ 3UVJB 4PG5A 3GG0A 3OA5A 3OYPA 4UQTA 1M5OC 3NTPA 3MWBA 3I87A 2VG5A 5DM6Q 4DR2F 4A8QA 1FRHA 1QD1A 2A4GA 2ZM6F 3MGJA 2YX1A 4IT4A 5EGYA 1T9YA 4YP3A 4B3SF 2UXCJ 3QAUA 1FE4A 4UEHH 4UTGA 1SKSA 1RTZA 1O6IA 2E5LJ 3LALA 3DRSB 4KE5A 4TW7A 1O2WA 1WG1A 2CFXA 3IM9A 1L4ZA 4KTUA 4F3QA 1W25A 3ONQA 5HJYA 2D3O1 2HHHJ 1YBTA 4M94A 1KVIA 1CU1A 1ZPZA 3MOJB 2D3OR 3QRRA 4EWTA 2AERH 2ACMA 3DU5A 2BVRH 2XP6A 4F49A 4NOHA 1K0HA 1QB9A 2R3UA 2POKA 2CDRB 3IK8A 3LH1A 3QJJA 1U47A 4IKAA 1S77D 3PR9A 3W63A 4I4BA 5AE2A 4JI6J 2VWOA 1XWLA 3GDSA 1CG2A 3OLBA 2W8KA 1YCPK 2DG4A 1PPFE 3I31A 5EW1H 4MKYA 2G1DA 1G2EA 2YWEA 2BVZA 3HHNB 5K8MA 1AUJA 1TKXB 3PEJA 2ANKH 2KZMA 1TRNA 1XUFA 1CBWC 1FWPA 2OSRA 3A87A 1ZTJA 1FMGA 4Q2KA 3UE2A 1N8OB 4I33A 4NA9H 4JI3F 3P70B 1OYQA 2OFGX 4KAIA 2OI2A 1KY9A 3I9V9 1SC4B 3L7UA 3RRHA 3MEEA 3H5CB 2VB6A 2VVCA 3E01B 5EPNA 1U6BA 3THVA 3DLEB 2OC1A 2NPIA 2AIQA 3ODKA 1C2JA 1X8DA 1SL2A 4K3JA 3KMSA 2ZDVH 1MQ6A 2FVRA 1NUEA 2RB7A 1PO6A 2TGTA 2QMXA 2N4CA 1RQ0A 2IIHA 4HLBA 2BXUH 4ENOA 2KZZA 1RHQB 1DDJA 1C2KA 3H2UB 1X9WA 2MPHA 2ZWOA 3M2RB 2C2DA 2AMPA 5DDRC 2PN6A 1N32F 2CXEA 3NGSA 2AGQA 1NBME 1SYTA 1LWXA 3RB6A 1A5GH 1QPLA 5C2GA 1BUIA 3EPGA 1O3NA 2VF3A 3M8PB 2AZ3A 5JVHQ 4NIXA 3TK9A 1KLNA 4C8KA 3SU6A 2XSJB 3JAMU 2R8KA 1LPGB 2PGQB 3HT3A 1YITS 3KJFB 5HATA 3F1SB 2XBXA 3X3UA 3JQKA 3BKUA 1BCUH 4YT6H 3WBZA 4H4KA 4M7GA 4WU2A 4RNMA 2KT5A 1UCNA 1JNSA 1O31A 1T8LA 3UDVA 2G1HA 4NG9H 9ESTA 3O5RA 1QUPA 5GMKa 4H6SB 2GVDA 2GMJA 4DR2J 3OR2A 1PINA 4C98A 1GI0A 2ZM6J 1IQMA 3O5IA 6LPRA 4UD9H 5DN6D 1HIAA 1C5VA 3PRDA 5KFTA 2ZKSA 1XUGA 2ZP0H 5BYRA 2O1PA 4B3SJ 3OT9A 3I6PA 1SJ4P 4USHA 3BS9A 3K0JA 3EAJA 2DE9A 3IS9B 4YTAA 4KT0C 1GDNA 1PPBH 4NA2A 2XM3A 1IBKF 1WC0A 4QQBA 1ETTH 4MPVA 3VV2B 1TBQH 3D6HB 3MU5A 3QK1A 2HQ3A 2CWXA 4ZPVR 5E0OA 1N88A 5KFVA 4C8NA 1SH3A 3CP7A 2MHNA 3P5TL 4M5GA 3OOBA 3MCSA 1IQIA 1T32A 2VICA 1KDNA 4ES1A 3VAHA 5DG7A 1TMUH 4FYYB 1HAGE 3ZVBA 3MXHP 3KADA 1SB1H 2LP4A 2GGPB 5HQLA 2V2ZA 1FIZA 2CPHA 3FZZA 4NNRA 2A10A 3S1TA 2DKOB 3MDFA 1FJ7A 2BD7A 2GD4B 4WKHA 2X51A 1GL1A 1RTDA 1LL4A 2V0BA 2IBKA 3QJPA 1AWHB 3I96A 4B9UA 3MQKC 4JZDH 2ZFFH 1QE1A 4C11A 1OO0B 3CDWA 4DCOB 2C3PA 3BIUH 1YF4A 3NRBA 3VVTA 1HFDA 2A7CA 2OIHA 3O8BA 5CHAC 2MJNA 2E5GA 2W8LA 4Q0BB 4C8OA 1HQEA 2KGJA 3OBIA 2YWKA 1JB0C 3ILJA 3SSSA 4F50A 2ANYA 1EOJA 5J4SA 2E1MC 1TKZB 3IP0A 3ZZAA 3GCXP 3SSRA 2Q1LA 5FCRA 1ROUA 1O3MA 2W6ID 1CLFA 1N5YA 3UQOA 1F5LA 2E29A 3ADAC 2BZAA 3G9CA 2DIUA 4YOGA 3T2NA 1YSJA 4X64F 2MB0B 1YBUA 4LRFA 1RTIB 2RFKC 2ZIQH 2GT7A 4DMZA 4I8JA 2HVXA 2CV3A 1Z8JB 4X2WA 2HWHA 1N32J 4PROA 1WG5A 3M6XA 2WSCC 1UEUA 2P8OC 1XUHA 1NH6A 2F40A 4YN3B 2I6WA 1T03A 2BQWB 1GMDF 2DXEA 3WIJA 2GV6A 3D1OA 3P45B 1OQ6A 1QRZA 1IKYA 1QHRB 1DOJA 1Z8IB 3EVOA 2BE9B 4USTA 2PV3A 2HVIA 3BEFB 1TFWA 5AHGH 1SCJB 2QLFB 4I7FB 4UOCA 3G6VA 1S6QB 4CLSA 1TR0A 5HMXA 4N56A 4I56A 2KJWA 1GHAG 1SQRA 5LT5A 3CHFA 2QLXA 4DL6A 2R2RA 2GVZB 1RT4B 1EYMA 3LUYA 1BIOA 1Q31A 1V2JT 3WQVA 2Z58B 3MTYA 1KVKA 3MMAB 2VQEF 4FBTA 2D69A 2R9LA 5GADU 2OTJS 3QGHA 1FI8A 3CCVS 3EE7A 3FVYA 1F92A 1IBKJ 1J27A 5GADI 1K1SA 1NK0A 3ZTOA 1HAYB 2EXUA 3RXRA 1ROTA 4B02A 1GBCA 3RXBA 3EZ5A 3KK1A 2H3EB 2ODPA 3NXZA 1T4VH 1JWWA 3M61U 1QBNA 3C6UB 4BWMA 1AD8H 1BDAA 5FXLA 3D4JA 3QGNB 3EA8A 1W14U 3WQWA 2K3KA 5JBBS 1A9NB 2Z8QA 1FIWA 3GFYA 2MKKA 4B3TF 2KFYA 1R0AB 3UI5A 4RWXA 4HACB 3K5LA 2IAJA 4AD6A 3QLHA 1DQ9A 4ZPWR 1TP7A 2ZKUA 3NGDA 3IWNC 4LK4A 6AT1B 2G2OA 1W3CA 1ELVA 1HAIH 2FO9A 4ZPTR 4DI6A 1UJ4A 2XGQA 3CJ4A 1BL4A 2JWNA 4WF8A 1OGBA 1MNEA 5K8PA 3OFND 3K8VA 4B76A 4B73A 2Y5GA 2DCUB 4QIVA 1YBWA 4CIOA 2A4RA 2R7TA 3GPAA 1TQ7B 2NZCA 1N5VA 4WMEA 4H6TA 3UDLA 1VQOS 5ESBA 1GJDB 1HBNB 1GHXH 3KGPA 3MM7B 5HVGA 1KXAA 2Z30B 1YJVA 4LBPA 4LIRA 5DETA 1H98A 2K06A 4OYXA 3ZZDA 1RWKB 2P95A 1HW9A 4K8RA 3JAMY 5L46A 4JCNA 3SNAA 4QYRA 1YY3A 1NBEB 1Y0HA 2F9DA 4M5DB 4ZKNU 3RMLH 4P2MA 4DPTA 3LWLA 4CM2A 2WLYA 2WAQD 2B31A 1KONA 3HPOA 4Q8FA 4B3OB 1TPOA 1HAVB 2KO7A 1V3XA 3O5EA 1NBMD 1G3EA 3SU1A 2ALVA 2ZH2A 2GX8A 4U6PA 4IG0A 1F2SE 1TX8A 3TARA 1VQLS 1WOSA 5F9LA 1VQKS 1VF8A 2M0GB 2W01A 3FCVA 1WC3A 2DNQA 3UQAA 3C16A 1UVSH 4X2VA 1NMVA 3V2UC 5KFIA 1IWGA 3VGTA 1NSPA 5L2ZH 2WVDA 2G4BA 1IQLA 1NROH 3CPWR 4FNHA 4PUOB 3VGCB 1UP1A 2KCPA 1OP8A 1SLUB 3R2DJ 5EN1A 1O8BA 4B9NA 1NEEA 3K57A 5DKMA 2SGFE 2W7SA 2A1DB 1RISA 3O5KA 3SGAE 1NHVA 1A5HA 2UVUA 1C2FA 1HV7A 3UI6A 2HPUA 2AD9A 3SU3A 2VQEJ 2F9OA 5KT4A 1BLUA 4O3QA 4CH7A 4F4WA 1NWTA 2V8GA 2EFNA 3MU0A 1F3FA 2LPRA 3F68H 3B9EA 3GFHA 5HWBA 3FCWA 4CREA 3UWIA 1NFYA 2RURA 1KLMB 5CYMB 2ASDA 4DURA 4NIWA 1CJKA 3A7TA 1MSWD 2J0XA 2CQBA 4A8OA 1Q5VA 3Q8UA 1SHYA 5L6NH 3GV5B 1XN9A 3TVJB 2L9NA 1FKOB 2OELA 2F7VA 2RE1A 2JEIA 1E34B 1FKKA 3CW2C 3DOMA 5KFZA 3CJ2A 4JFMA 5DG6A 4TWYA 1IQFA 3MU1A 2B8PA 4B3TJ 3AS2A 2C2OB 3KCGH 4EGLA 5HMAA 5DZ7A 3CHCA 5HM2A 2PSZA 3MMCB 1D6WA 1OGGA 2GW8A 3PY8A 1DFPA 4ECQA 1Y9OA 1MKXK 2VV5A 2CJBA 1Z7KA 5IDKA 4DUTA 1I51B 5AF9H 5LXRA 5C24B 2OD4A 3IFEA 2XC5A 1M0SA 2AEFA 3V5RA 2EBGA 3H5SA 3BO4A 1AVXA 5LSRA 3TVZA 1U1OA 4P7TA 5KFHA 4HG6A 3BSCA 5LJ3Y 5LXYA 2SGPE 1NT1A 4MPXA 3UDCA 3ZC4A 1SOZA 2HBYB 5HMWA 2MMYA 4O23A 2ZQSA 3MMJA 3A13A 2LEPA 1AB9C 1GCTC 1B7FA 4RL1A 5B0EA 2BBEA 4RUAA 3MOCA 5IV4A 4K2JA 2CJXB 4ISOA 2ZFQH 1FKGA 3NS5A 3TRGA 4KYZA 3TUPA 4KPCA 4WY3A 2RILA 3M2UB 2J6TA 1K0TA 4EO8A 3IBCB 5KFFA 3SJ9A 1JLAB 4ECWA 4K7QA 3VVUA 2AU0A 1Q1CA 3JSRA 1C1BA 2STBE 1S57A 3A8JA 1TGCA 1QR3E 3CT9A 4AL7A 2SFAA 2BX6A 3C8YA 2OMLA 4RW9B 1PJPA 2RSQA 1UHBA 5E3RA 1M9UA 1LO6A 1O2IA 5B0DA 1HAHH 2BABA 3LOUA 2FX4A 1MABB 1WORA 4PPDA 3D62A 4F48B 3HKWA 5JH8A 4R5PA 4Q63A 1G9IE 1TRYA 3ARPA 5DQIA 2RQCA 3MFJA 1T94A 2ZZUH 4CQ1A 4J91A 1G3OA 5ESTE 3UIRA