3PRDA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 36
structure length 223
sequence length 223
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prdA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prdA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prdA03
4ODNA 2PV1A 1NSGA 2M1IA 4ODOA 3O5DA 4NNRA 3UI5A 3FAPA 4DRQA 2MLZA 1PBKA 1QPFA 2ZQVA 3IKGA 3JYJA 1EQ3A 2DG4A 3O5IA 4FN2A 4IQ2A 4BF8A 5HTGA 1JNTA 3O5OA 4DRNA 4DIPA 2PV2A 3KZ7A 3KCEA 4GGQA 1P5QA 1D7JA 3PA7A 3O5RA 3PRBA 5HT1A 1FKTA 4TX0A 1FD9A 1FKDA 4W9QA 4ODLA 3NTPA 2DG3A 2FAPA 2ZR6A 3CGNA 5HKGA 4R0XA 1Q6HA 2XP5A 2F4EA 4MGVA 2ZR4A 2XPAA 1QPLA 3KAFA 4ODKA 1J6YA 2ZR5A 2RUCA 1FAPA 4G2PA 4U86A 3UI4A 2N87A 4J4OA 2XP8A 4JFLA 4DZ3A 1FJDA 2PBCA 1FKSA 3B7XA 4ITZA 4W9PA 2MNTA 2MLYA 3O5LA 3GPKA 4TW8A 2ZQSA 4QT3A 2RURA 1JNSA 4QIBA 1Q1CA 4DRPA 5HUAA 2VN1A 5HW7A 1D6OA 2KO7A 5HW8A 1YW5A 4GIVA 3UQIA 4DRMA 2RSEA 1M5YA 2PPOA 1F8AB 3KAHA 3IKDA 4DRKA 1ZCNA 3KABA 4U85A 3UI6A 2KR7A 1BKFA 2JZVA 3ODKA 2RUDA 4ODPA 4DH0A 1FKFA 3O5QA 5B8IC 5HW6A 1R9HA 1NMWA 2RUQA 2VCDA 3KADA 3O5JA 4JFJA 2XP9A 4ODRA 2ZQUA 3TC5A 3UF8A 3JYMA 4IQCA 1L1PA 2MLXA 1T11A 5HWBA 1KT1A 1J4RA 1W26A 1QZ2A 2LGOA 4U84A 2XP4A 2OFNA 2XP7A 3JXVA 3KAIA 4FAPA 4W9OA 3H9RB 3RFWA 1A7XA 5GPGA 2FKEA 1BL4A 1PINA 5D75A 1ROUA 1HXVA 3TDBA 1U79A 4TNSA 2KFWA 5BXJA 1FKIA 2F21A 1TCOC 2KE0A 4JYSA 3KAGA 1FKGA 5DIUA 5DITA 1FKHA 1N1AA 4G50A 4DZ2A 2L2SA 3I6CA 4IPXA 4DRIA 5HWCA 4J4NA 1D7HA 1ROTA 1YATA 2LJ4A 2XPBA 4LAYA 2KI3A 4N19A 1F40A 4O2TA 2F2DA 4TYOA 2AWGA 2MF9A 3IHZA 3O5FA 2PPPA 3TCZA 4QT2A 4TW7A 3LUOA 3RGCA 3OOBA 4LAWA 2ZQTA 3O5GA 2KGJA 3NI6A 3PRDA 4LAXA 1C9HA 2IF4A 2LKNA 3MDYB 1Q6IA 1J4IA 4MSPA 5I98A 1FKRA 2XP3A 4DRHA 3VAWA 1EYMA 1FKKA 2PV3A 2UZ5A 2MPHA 4ODQA 4DRJA 2PPNA 2Y78A 2RQSA 4TW6A 3UQBA 2M2AA 1KT0A 2DG9A 1B6CA 3KACA 3O5MA 2XP6A 3UQAA 1FKBA 3O5PA 5J6EA 2K8IA 4C02B 1NMVA 4DROA 1Q6UA 1FKJA 1D7IA 3O5EA 4ODMA 3O5KA 3WH0A 3NRKA 2D9FA 1ZK6A 4LAVA 2M08A 4JFMA 1FKLA 2Q5AA 1J4HA 3IK8A 4JFIA 5DIVA 2ITKA 3EY6A 4JFKA 1JVWA 3CGMA 2LPVA 1Y0OA 4DT4A
chains in the Genus database with same CATH superfamily
2WSFC 4WKRA 4UY85 2ZQ1A 4BWMA 3LJOA 4MT1A 8LPRA 2H5CA 1K0TA 3POTA 1YI2S 3WY8A 1O5BB 2ALVA 3BTFE 1QVFR 5F9NA 3KAFA 1MSWD 2B9YA 1N6YA 4LSLA 3MXHP 4O3TA 1NCLA 2ALYB 4WU2A 1MLAA 2VA2A 4X1RU 3DMJA 2E5HA 4X6NA 2JLFA 4YUDA 3KAHA 3UN3A 1C2LA 4RN6A 3MEKA 1H2TZ 3EDXB 4ODPA 4P7VA 4B08A 4A48A 1FJ7A 1JXVA 1PJPA 1GTHA 2OD4A 1FD8A 1DUAA 1L0ZA 4YMEA 4DJBA 5EGYA 2BR0A 1C2HA 4NMLA 2PGCA 2ZNKH 2C3SA 4D8NA 2V6NA 2IDEA 3LONA 1X4CA 2AYGA 2V35A 3ATWA 5DF0A 3M36A 3O8CA 4I4BA 3H98A 2L2SA 3JTPA 2LQ8A 3B4MA 2A2XH 1NWUA 4AY1A 2HPQH 1RYSA 2I0XA 3KLHA 2BVSH 4OZNA 2I2YA 2QYCA 4WKHA 3BKTA 3DM2B 3IRWP 1Q7YT 1SBWA 4X8TH 3RBDA 3OY5U 4WXOA 3E2EA 4M5GA 5E2PA 2HQCA 3UR3C 5HMZA 3J7A1 2BOAA 2F43B 1CVJA 2DRBA 2FPZA 3GCNA 1G1XA 3CD0A 4A46A 1P2MA 2KN4A 5BYSA 2UVUA 4MDSA 1Y00A 3NY0A 4G1IA 1ZK6A 1GJAB 1IKXB 3ULHA 3T3FA 2VH6A 3DKDA 2YKNB 2QXGA 3MAAA 4K59A 2ZUAA 3CMES 1F7ZA 1JNTA 1B0VA 2JNJA 1C9TA 1HWUA 3QIPA 1YBUA 5D77A 2PV9B 2TGAA 1FY5A 1ZA1B 4R25A 4PQUA 2MNTA 3O5LA 3OFND 4AB9A 1RAAB 4MK7A 1D8YA 2W01A 4F3MA 4ZXYH 1Y5UT 1S6UA 3B9DA 3JAMY 2QGRA 4NLYA 2I5JA 4KTUA 2GQCA 2ZFHA 1TKXB 3B8SA 3NRBA 4X66F 3AAVA 1RISA 3Q83A 1H74A 4OZ2A 5IT9Y 1X4FA 1G9IE 1BJUA 3M5NA 5JDUB 3DRYA 2YWKA 5I3UA 4GSOA 1VJAU 1HBOA 3VAMA 3QN7A 3D6TB 2Z3DA 4TPYA 2L9NA 4F67A 3H2UB 4HACB 5HJYA 4AZ2B 2YQ1A 3CD7A 4NRUA 4Q2LA 3QRQA 3W2WB 2CIMA 1ZAWA 2FLOA 3KUHA 2Y8WA 1LO6A 4CLSA 1QAYA 4K0KJ 4WMDA 4NWKA 4B1TA 2QF5A 2J95A 5KFOA 4LK4A 3MEGA 4URGA 2C1EB 2VVCA 1NHVA 4F3QA 4MPVA 3DRXA 1C2MA 2FI3E 4RJVA 1RWUA 1HNZJ 1AGJA 4AD6A 3DN9A 4KBIA 3KUGA 2QF0A 2Q6BA 1MMJN 1V2UT 4V19J 2H51B 2GMTB 4A8KA 3AOBA 5L1JA 4GCHF 3MH7A 4LF8J 1GOIA 3H5XA 1RZMA 2YWWA 2MZJA 3E90B 3CENA 4BTIB 4DOQA 1X4AA 2EULA 3C14B 3UI5A 3ZXWA 2LQBA 3NGUA 1PPCE 2VIWA 1JOUB 3ZZPA 4TLRA 2R2WU 3OVAA 1KQKA 4K1SA 2QLWA 3KG1A 3CMQA 1WHWA 1VQSA 2HG4A 1LQDB 4PZVA 2KJVA 4C9DA 4H42U 3B6BA 2OTVA 2N87A 4A47A 2L6OA 2APOA 2PBCA 1GMCF 3T25A 5F8IA 2A18A 4N47A 6FD1A 4AYBD 2ZE2A 4LRBA 2IYGA 1BMMH 3UQIA 2V0BA 3GONA 3KLEA 4ZHRA 1S0QA 1V6DA 2A2QH 4IFVB 3LGNA 2ZA5A 2W1BA 3VAKA 2VU8E 4KJIA 4M5IA 1D8ZA 3G96A 1URRA 3SSQA 2B5JB 2VPZB 4LSNA 1SG8B 4F4WA 1B5GH 4DL2A 2EEKA 1LWEA 3ITHB 4NA3A 2ZZUH 3BSCA 2I9SA 2GVFA 1GBDA 1GBIA 4OYPA 5DZ6A 2ZU3A 4Y2MA 1KVJA 3Q8YA 2V67A 1NS3A 1VITG 4I2QA 1P2QA 1KXCA 2ZCHP 2DNMA 1GMHG 4ER8A 1SC4B 3NKKA 3OL7A 4LAXA 1VQ9S 3GS9A 2WONA 4KFBB 1KONA 2RF2A 2AEJA 1NK9A 3SU1A 4USHA 4PUOA 1M5PC 1FV9A 4ZVPB 3L9ZA 2RDIA 1N8OC 3NS7B 2KG0A 1F0XA 1S6HA 4B74A 4KGAA 2Z6BD 2B51A 2THFB 4RNNA 2OHDA 4Z2KA 1Y4ZB 4PWUA 1AZZA 1LG2A 2ZFPH 3F0NA 1KLNA 2VB0A 1GTEA 4ANDA 3RP2A 3ZTOA 2IDLA 2EVZA 5A8YA 3Q86A 2Y82A 1LL7A 5ADZA 1YLNA 4Y8YA 1P09A 1WG5A 3KJFB 1QE1A 4NA2A 3AXMA 1B0PA 1BUIA 2F65A 2UXDF 2GVZA 1CGHA 4EYHB 2V4QA 1HNZF 1NWRA 5B08A 1IBKF 4NEYA 3HSZA 2OTLS 3R7SB 2O9QA 1ELVA 1O3OA 1F5AA 1XMNB 4OJGA 3CIZA 5B7WA 1T7PA 1N36F 1YF4A 3E0PB 4PROA 4ZXXH 1SI5H 3FRZA 5J1EA 3DU5A 3UVJB 1GMUA 4MTBA 4IN1A 2E7WA 3LOXA 1U79A 5F3TA 2J8SA 1HAPH 2G41A 2LXIA 2HVZA 2UP1A 2V4RA 3NWRA 1NB2A 2W7SA 2R8HA 2HQFA 5J2MA 3M2RA 3TUIC 1DY3A 1RSCA 1IKWB 3A89A 4ALZA 3M5MA 2QEXS 1HHTP 2XGPA 4OHVA 1LTOA 3NUMA 3Q2SC 3J7YI 4DG1A 3D67A 3RRKA 5BR8F 3WX4A 1HYSB 2P8OB 2ZGCA 1K1QA 4LFCJ 1F0TA 2FWWA 5FX6A 2BKNA 1Y0OA 3C6UA 1T4UH 2OGUA 3A4TA 3MH6A 5CYJA 1APSA 3OXGA 4RNMA 2XMKA 1EKBB 2W9CB 4DWIA 4MMOA 5C25A 3KK3B 1KNZA 3IGNA 3CC2S 1GI0A 2EXUA 4WFBQ 5L1LA 4ECXA 1H2VZ 4YN3B 1T03B 1O3NA 3A8IA 2J7WA 3IG1B 1DLOB 3R8YA 2WRMA 2WV9A 3PZPA 4W9PA 3M8ZA 1O2GH 4XBDA 4B9LA 5L6NH 3VZHA 1TKDA 4ZPVR 3S9BA 1W7WA 4CIOA 1V3SA 1T9VA 5HI7A 5A0CA 4NZQA 3QJJA 2OC1A 4RW9A 3VALA 4JMYA 1I94J 5B09A 5B0EA 3IG1A 1EZUC 4WY3A 3RXSA 2DY9A 2BDAA 3JYMA 1AUSL 2VIVA 3NWUA 4ISIH 1Y3YA 1ZPCA 1T03A 1R6VA 4CT9A 1NK5A 1HBUB 2W2MP 3L4BC 3EXCX 1AKSB 4TNOA 1UFKA 3ALGA 1N1AA 3TA1A 3RMOH 2YX4A 2DGTA 5CD4H 2BUNA 2GP9B 1XMQF 1VBZA 1YWUA 5DN6D 1S82A 2ZQTA 3SEOA 1WG4A 4CRCA 4MSPA 1RWKB 4Z2XA 3HLUA 1NY22 1UCYK 2IM1A 1Y5NB 2HK2A 4HHUA 2QG9B 5CYQA 4JV0A 2NPFA 2ZU4A 5DP8A 3AD8C 3LP1B 2BA9A 3HK3B 2MSSA 1NDKA 3U8RH 2FJDB 3OU0A 2ADCA 3L6PA 5D15A 3CTRA 3RXTA 2EFNA 4ERDA 1F9FA 3OEHD 5FX5A 4K4XA 3HCXA 2UUYA 2KRBA 1UKUA 1MTNB 1TIOA 5F6MA 5GCHF 2CPHA 1H0GA 1UL3A 1AN1E 1S79A 4ELVA 3CDUA 4O3QA 1YJRA 1U1PA 1W8BH 4AYVB 3DRPB 1HLTH 2G8ZA 1RT6B 3EVMA 3G2XA 3PEJA 1ZMJA 5DP5A 3DOMA 1LW0A 1O32A 3OFGA 4IH7A 1ZPBA 2BTCE 3PV2A 4I7FB 1S1VB 5EODA 3CS0A 1SUQB 1YJ7A 2NLWA 2A3CA 2DNKA 1S4EA 1RBLA 5KFCA 1ROUA 3PYFA 2FODA 4X4VA 5D4LA 5DJ7A 1R7IA 2Q79A 1TKZA 4JI8F 1SQFA 4YM9A 2CZVC 4MPKA 1LPZB 2UZAA 1WELA 5K9FA 3O3LA 2HHPA 2G1DA 3A81A 4LRAA 1AVGH 1N6XA 2PFDA 2AMPA 2VJUA 3FP8E 1O3DA 1NU9A 2WPJS 1YPLH 3DHWC 3TEGA 4TXSA 4INHA 2VBCA 3BTHE 1SIZA 4RUCA 4FF1A 2OCVB 3K57A 2G1HA 5KOWA 3MEEA 2DE9A 1XMOF 3JZ1B 1DFPA 4HI3A 1NSQA 4CWBA 2DNRA 3G8TA 3RM2H 1EQ3A 3BSAA 4NLGA 5DS7A 1R0AB 4GGQA 2HGLA 3PVXA 2BX6A 4FUJA 3NWGA 4TU7A 3CGNA 2G00A 1OY9A 4FU9A 4LFCF 1GVKB 1F6TA 1K21H 3BM7A 4ED1A 5KG0A 2DGSA 1Y5AT 4YHHF 2VWMA 9ATCB 2U1AA 1AFJA 4IQMA 3ZZZA 3I0SA 2Y8YA 3CMAS 4UZCA 4QIFA 3QRPA 3KWMA 1Q53A 1S1WA 2QTWA 4KT0C 3AW1A 1PAUB 3S9AA 2GW8A 3BGLA 3GPAA 1EAIA 1VHIA 5HGGA 2HZCA 1PO6A 4CP5A 4DUZJ 1NWTA 5IOLA 1QJ6B 2MQQA 5A8KA 3N7DA 1VI7A 4YHHJ 2J7KA 1V2WT 2QYGA 3K58A 3UWJH 3UQVA 2A4GA 2BJ7A 3GY8A 2XSFA 3F73A 1EOJA 2W2OP 1W9PA 3A7XA 2J9DA 4X2VA 2QRRA 2ROGA 4B9TA 4ZHAA 3RXAA 2LKNA 2A3JA 2LQ5A 1NT1A 4G6VB 1GMDG 2R7SA 1TX8A 1TABE 1GHBF 2KB2A 2X1FA 4AG2A 3V6KA 3LU9B 2F5GA 3CJRA 3W5ZA 7LPRA 2TBSA 2CJQA 3QYYA 5J6EA 3EGVA 4I1TA 4EO6A 1XMOJ 3OPKA 3S69A 3HPTB 4AFSA 4R8UB 2ODYB 4FUIA 4JFMA 2Q5AA 1GXTA 4LQ9A 5K20B 3R5GA 2CQ2A 3UNSA 3EA7A 4TQRA 3D23A 3QRRA 1OKXA 4LF6F 1DM4B 4ODLA 5I4MA 1QZ8A 4URQU 4FU8A 4L76A 3GILA 3SV6A 1E35B 2ZIQH 1GJCB 2FOBA 3LJJA 4WYLA 4I8GA 4C6AA 1FT8A 2ALZA 3AXKA 2BJDA 1ANBA 1EOLA 5C5NA 4QIBA 1UW9A 2HNDA 1VRTA 2LMIA 2YXLA 3K65B 2WSCC 1ZPVA 2C2RA 1EHNA 3UB0A 1NKEA 3GV8B 3TZXA 5KG5A 1A0OB 4OYBA 4DR2F 3KADA 2Y1LB 1AXQA 3S7KB 3KTQA 1IQKA 3FCHA 4ZVTB 4DV6F 3AVZA 3EMTA 4QR2A 2FZZA 5DG8A 3NCLA 3UTUH 2GV6A 2KT3A 3R5JB 2ZHWH 2KYZA 2CJYB 3AY0A 2KI3A 4F4OC 4DRHA 3O8BA 1AB9C 5J4QA 3VGVA 5LOQA 2Z56B 4ZPBA 3MAQA 1RE1B 1GL1A 2ZZMA 3ZNJ1 2BACA 4CRAA 4FS2A 4S0MA 2KM8B 1LKBA 3ALFA 1ITXA 4RT1A 1SYTA 3TH3H 1UZDA 1RT4B 5E3PA 4ODOA 1RJXB 2HNTF 3HSDA 2AOSA 3TK9A 5J2QA 1D9IA 4E98A 5SGAE 1AT1B 4N7TA 2RDLA 3EGNA 3X1LB 1NPRA 2XYPB 4NLRA 2G0CA 3BB5A 4LBIA 3RJMB 1L3SA 1GMHF 3U1JB 4X4OA 2TGDA 3M2UB 4RT0A 1W11U 3U1LA 5CYMA 2O3DA 1ZJDA 2ZU1A 2BD4A 1SIWB 2HVDA 3BYRA 2X1AA 1O3KA 2ZU5A 5D0HA 1SPBP 3SN8A 1SH3A 5F0WA 3TVKA 4BC9A 3W1EA 3FDSA 4CDIA 1MD7A 2NU3E 3TOQA 2XS7A 1XX9A 4OQJA 3MOJB 1T31A 1ELOA 1GI7B 3KAGA 4A8FA 1RQ0A 2HZVA 3OV7A 2W4DA 3R3TA 1PPFE 1N32F 3NCQA 2AJ2A 2MZSA 4Y8ZA 3KLFB 1J4IA 1FFWB 5THWA 3PACA 3C16A 1FDBA 1UPMB 2HPUA 1S1TB 3W5YA 2K8IA 1GMCG 4E06H 1RIWB 4ACAA 3CJ2A 1SB1H 4HG6A 1NJXA 2GCHF 5J2PA 4DX5A 2RG3A 5KFXA 5DIVA 4L72B 4FUCA 1GG6B 2CJIA 1PAEX 2CPXA 3M3VA 4P74A 2HHTA 2MLZA 4DL7A 4WPAA 4C8KA 2FC8A 3CHCA 2ZPRA 4Z1MD 4K4WA 5EOKA 2EI5A 3R7BB 1SGTA 4OHZA 4ZN1A 3CHEA 1REVA 4WVPE 4J9NA 2BB4A 3M8WA 3CC4S 3SBKA 5J1PA 1SQRA 1MW7A 3HD2A 3J81j 4DV3J 4P2SA 5HIYA 4LT6A 3BGRA 1CJUB 3HF5A 3LO3A 4ZVUB 4DF8A 3O2IA 5ETQA 3B54A 3UN5A 3TC5A 4ZVSB 3D68A 1OPIA 1TPAE 5HWBA 1N88A 1DANH 1Z71A 2BQ7B 3P8NA 4JI1F 1ZTLA 1MUEB 2GZOA 1BY9A 3LP2B 1BL4A 4HL9A 2KCPA 3I0RA 1O0DH 2POKA 3SCIE 4GVLA 5C1UA 3TNSA 5EJ1A 1H73A 1A2CH 3TQ1A 1EZSC 2U2FA 1HFEL 1P9YA 1CBKA 3KMSA 2BZAA 3QO9A 4B2CA 2W5EA 1JNEA 1NK8A 3OUYB 3CCMS 2ZWOA 3BTTE 3R2CJ 4ASHA 2QC3A 1TFWA 1SJ4P 3ARSA 5HSPA 2Z9LA 2JX2A 2Z3CA 2VJVA 5EQQA 3DGVA 2PN6A 2A7HA 4P2FA 4KQZA 2PGQB 1E79D 5J1EB 5AVDA 3U27A 1MKWH 3VGTA 1TNGA 3M1VA 2LP4A 2ZH2A 4NSYA 1HKKA 1ETRH 1DS2E 4DR3J 4OHXA 4M5DB 1QB1A 3OUYA 4FS1A 5H9FK 5FDLA 3FOAA 4AFQA 2XP5A 4BOHA 1KSNA 1RTJB 3PLPA 3GIJA 2DK2A 2XNRA 5B0GA 3DA9B 4MH8A 4DFPA 1UJ6A 4DR1J 1D0EA 2FI5E 1PPHE 1IR0A 3H4DA 4OI2A 3W63A 1SQOA 2PPOA 3FSYA 1O3JA 3ZVBA 3FANA 3WW7A 1TRNA 1ZAXA 3I55S 4DR5J 2J5AA 5B8IC 3LF0A 3WIJA 1YGCH 3RMNH 1D9FA 2XGQA 1GPFA 4M5DA 4FKYA 4FXVA 3V6DA 3B8HA 4DXLA 2J7UA 3ATIA 2DR5A 3G9CA 1QD1A 5GADI 2DVIA 2LGOA 4X4RA 1BQYA 1O2QA 4XE4A 4DOZA 3KHVA 1ZHPA 2GGPA 2R2RA 1L5UA 5C24A 1DJ0A 3LGYA 3P8OA 2ZFTA 2FJBB 4Y10E 1RLCL 2M0GB 5CH7B 4X4SA 5AE2A 1ETTH 2LU1A 4TY8A 4Q2MA 5KT5A 5F03A 5KFSA 4PG6A 3TVYA 4NSBA 1NNDA 4O9VA 4FYYB 2FLNA 1O2NA 4KGZB 1CPZA 2AF6A 2VIOA 3UR6A 5KFNA 3S7HB 3BTWE 3MTYA 2ZOMA 2CQ3A 3CZ8A 1I6JA 1PGZA 2PMWA 2CQCA 2V69A 4OFZA 4Q7AA 3N4WA 1DX5M 3QK1A 4IKAA 4C2MA 2YNIB 2FB0A 4DV4J 2HQGA 5ETXA 2DYAA 3MMBA 1RT7A 4J7CA 2F4VF 3MM6B 1GI1A 4SGBE 3IKGA 1Q31A 2BDCA 2JEIA 3C15B 3ICLA 5ETLA 1J5OB 2AGGX 1XMQJ 2B9EA 3KCGH 4HACA 3OFHA 1BWVA 3RW7A 4ED4A 3RXVA 1SBRA 3IRXA 1E6RA 3TJVA 1OWXA 3BBCA 5BYQA 3MMBB 3UNGC 1NFUA 1RTZA 4RU2A 3PR4A 3UY9A 1MTSA 1O3BA 3EE3A 2FI4E 2J38A 2NU4E 1W0JD 1W13U 4HDHA 4NCBA 2H65B 3KABA 5HP1A 2BE2B 1K28D 2VKZG 3OQ2A 2WPKS 1GMVA 2AEMA 5KG7A 2B5UB 1WAYB 5T14A 4GKKF 2D26C 3VXEH 3HM9A 3RM4A 1YC0A 5FXLA 2H5JB 2IJFA 2ZZTA 4CH7A 1E34B 1GT8A 4DV0F 3ZO7A 2QA4G 1N8RT 1CLFA 4HBEA 2KFWA 1DQ8A 2QXHA 4TYAA 3R2DJ 2A0QB 1JLEB 3GCXP 4Q4LA 2NXEA 1TQ7B 3A8CA 3BEFB 1GBFA 2ZFQH 2CQHA 4CLWA 5M2UA 1CVWH 1H6KX 3PW5A 2RRBA 2CXEA 2Q6CA 4J9KA 3SZEA 2RMLA 1WEXA 4EFAC 5LMUF 4FVMA 2A4RA 1S81A 1RCOB 2XYHB 2MGZA 4QWCA 3ZZBA 1T9XA 1E44A 1DWEH 2JH3A 1RWXB 3O5DA 1O2HA 4ESTE 3IBFB 1JNDA 4LBPA 3BMBA 1QJ7B 3S1TA 3JSRA 2RSQA 1LHFH 4WKAA 4QWDA 1SLWB 1TMUH 1NFYA 3PA7A 1DWCH 2Q66A 4QBUA 1F5KU 2OKQA 1OOKB 1RTHA 4ABGA 2VIDA 2BDHA 1L4DA 5KFJA 1A3EH 3UFAA 2D9PA 4GC6A 2FY1A 2I38A 1C4U2 5ABWA 3BBBA 5TJXA 2WONB 2HNDB 1N0UA 5ESTE 3LPYA 4JZ1A 3BH6B 7GCHG 2CPYA 4M5HA 4YB6A 3OYPA 3L7OA 3EXYA 4DPXA 1NZQH 1SLXB 4RI0A 5KG1A 4YT6H 1WKLA 1HDTH 2YNFA 1L4ZA 1T3NA 2BX4A 4K69A 1FKFA 4ABDA 4L3NA 4OZLA 1AQ7A 3HT0A 4CQ1A 2HLCA 4HBOA 5D6GA 1F0UA 1TWXB 2ZKTA 1K1LA 1NO9H 1KT1A 2CQ4A 1SL2A 1S7HA 1NJWA 3ZIAD 3M2UA 4X64J 1S5ZA 3VFEA 3H9RB 3PFEA 1SFIA 5U47A 1VYAA 4QIGA 4LREA 3T1HF 3TYTA 1SV5A 1LDTT 4ILMA 5T6FA 1MQ5A 1CT0E 2ZM6J 2DNGA 2W7OA 2FVRA 5IZHA 4JBCA 2C2ZB 3W95A 4WF9Q 4IO1A 1HIYA 1VIOA 4KGVB 5HMYA 2D1JA 3KACA 3PJ9A 3R5CA 2NR0A 1FKJA 2R2TA 5D4NA 5B6LA 1EAYC 2ATLA 3RAMA 1C5PA 3U8OH 1MROA 1AFIA 3IBWA 3L3TA 2YNGB 1HRTH 4CNYA 2AX0A 4RW8B 3UPFA 3MURP 2XBPA 2UUCF 3RU4D 3NZIA 2AZ1A 5HT1A 3OSYA 1QQUA 2G4UA 4JZFH 4MFBB 1V2TT 4P71A 3BV8A 2BD3A 1TPOA 4H6SB 4CO2A 4IOAQ 3MFHA 4DZ3A 2ZH3A 2R3UA 3T1YF 3BTQE 4DY7B 4DIHH 3IM8A 1D3TB 1ZBWA 3FXYA 1MROB 2KT5A 1LKZA 2P6SA 3SZNA 2OEJA 2R8IA 2YNGA 2Z58B 2D69A 3UE2A 3P95A 1Q78A 2YNHA 3CVKA 1N32J 4CR9A 4GVBA 1WUUA 2SNWA 2ZH4A 1F5LA 2FGCA 1Q82T 3DNCA 3F44A 4ZIWA 4ECQA 1P27B 3FK4A 2GZ7A 2QF8A 2XSJB 1VJQA 2CGAA 3LH1A 1PSDA 1FKPB 2LECA 3DGPB 5E8EH 1HXVA 3UDLA 4O97A 3RXDA 1HNVA 1FZZA 1QL7A 1FDNA 1C5YB 3H7TA 1TK5A 1RBAA 4FXDA 1HNXJ 3PCOB 2XNQA 3MF5A 3BBFA 4IR9A 1H1BA 1TL4A 4JI5F 2P59A 5C3NA 1W2KH 2LFVA 1BUXA 1H0HB 2D9OA 2ZGBH 2PFEA 4K8RA 4B9SA 2ZPSA 2P3TB 1EB0A 4TU9A 2YKMB 2ZQ2A 3H09A 2RKIB 2BV3A 1A5GH 2J94A 1C1RA 5CHBA 4Y2AA 3PJXA 2BY8X 1UVLA 3UQOA 3Q24A 1YJ9S 1DFDA 5LSRA 3VGCB 1UWBB 1Y0HA 2B0FA 1HWKA 5ETKA 1VISA 5SUHA 4R0IA 1U8SA 1B0EA 4EU0A 3T1YJ 2QX0A 4HH0A 2ZR4A 2JEFA 4PKDB 1TP7A 4X8UH 2RS2A 2F8EX 4J9LA 4XDCA 4CO0A 4QJVA 4YT7H 4FF3A 2IN2A 2RILA 2WV5A 3MD1A 3KEEA 3HGNA 2H6MA 2XMAA 2ZD1B 4DWSA 1MTVA 2N82B 4IG3B 2VWLA 3TWZA 2WOMB 1JXPA 4HDGA 2HFSA 2ZQUA 1ACMB 4FVCA 1VR6A 1JIRA 3MI7X 3SBMA 4DFMA 1S0VA 4O44B 1VBKA 4KTSA 3BSNA 4ISHH 1S12A 5C1XA 1RAOA 1MWQA 1C5TA 3MM8B 4DSLA 5FPYA 3RXJA 4G50A 4NCGA 3HK2A 1FY8E 5TCAA 1R6YA 2ZECA 3ZZYA 4TY7A 4OI3A 3QATA 3PG9A 3KLHB 3NL0A 2BY6X 3FCVA 3P92A 3SNAA 5IM0A 3HVWA 5HLFA 4HARA 2A10A 4B3OA 1Y11A 1FF2A 5KG2A 1D9DA 3SUDA 5KT7A 3CCES 2DHHA 2VF3A 4FXWA 3IC1A 2JIZD 3J81Y 1MBQA 1FDAA 2EC9H 2P5VA 2PA3A 4FKXA 2XCPA 4U9RA 3SHCH 3MO6A 1BTZA 2ZH1A 3T62A 5DGAA 2BVRH 2W4CA 2M3DA 4L74A 5F8TA 1S6PB 4BTUB 2Z9GA 3G6VA 1TALA 3D1HA 4JI3J 5AJ3F 4ZK7M 4LRFA 5KT4A 1O2ZA 6CHAB 1RT7B 3GV7B 4Q7YA 2WPLS 2O92A 3FBEA 1RAFB 5M2PA 2GV7A 1JLCB 3TNVA 4B2BA 1MCTA 1GBCA 4CI0B 3H40A 1SHYA 2HFZA 4NZ6A 1RS0A 2JDID 1M5KC 2EFPA 2PN0A 1ZMNA 1O2YA 2CHAB 4YY3F 2KRRA 3PTWA 3RDZA 5JVHQ 2BZ6H 4Y3CA 3G86A 1WKJA 3PW0A 1HD0A 2FLBH 1VCTA 1JQGA 1LMWB 5G0RB 1VJ9U 1DLKB 3RUOA 1YJVA 1K1MA 3E51A 2KGJA 1O3LA 4FF2A 1KHVA 3SQGA 2DSVA 4ABEA 3MM6A 3RM9A 1P3CA 1OGBA 1TMJA 1KTQA 3OL8A 3ESTA 2PKSB 1LWFA 2ATCB 3LALA 3SU3A 4B3TF 2RIJA 4ANEA 3TJUA 3A83A 2NZCA 2RQCA 1ZGIA 2SGFE 3WKZA 3LP2A 1MKXH 2OSRA 1J5OA 1VR1H 3LP1A 4X65F 4FNHA 3I9ZA 5ETRA 1MTNC 1RTIB 4MKVA 1Z8JB 3G6XA 3TZZA 2BRKA 2EK6A 3CCRS 4UE7H 1QIXB 3HHKA 3OX7U 2FDMA 4AORA 2ZJPQ 1AVWA 1S9FA 3QT5A 1VKYA 1P06A 1UA1A 3EAJA 3FQKA 3PJWA 3MM7B 4ZMMA 4J90A 4I8LA 1EXFA 5C7PA 2VFVA 5HW7A 4YOIA 1YW5A 1F9HA 1CEZA 2MSTA 2C42A 1TOMH 1UCNA 3ODDA 2IBOA 4OZ0A 1L3UA 4MKBA 1NBME 1O3FA 4AL7A 1YCPK 4ID8A 2ODQA 1ELEE 2UUCJ 2AEIH 3DOMB 2F3CE 2WVFA 2A5KA 5EW1H 4DSFA 5FJ4A 4CH8B 1G3OA 1QZ2A 2JL9A 3WWBA 1IM4A 3DCLA 1SC1B 4MPUA 4L6V3 1V9OA 3AJ1A 1IKVB 1Q3XA 5LXRA 1G37A 1RT2A 2OUGA 3AASA 4LAYA 1U6BA 2DISA 4WE1A 1KXDA 4C11A 4NWBA 1LHDH 1SQGA 3OXFA 2XZWA 1I1GA 4RNFA 1IHTH 2KYXA 1TPPA 4HLBA 2C2MB 2MMYA 1GHXH 2A4QA 1FK9B 3O44A 1A1RA 9ESTA 1O2IA 2H5EA 2A6MA 2JJ1D 2XMJA 4UW2A 5FD1A 2J9NA 2A0FB 2C8YB 1RTDB 1P6TA 4I8KA 4WP8A 1FNOA 4UFGH 3GCHB 2F63A 1HLWA 4CLFA 2E7XA 1Q86T 4WP9A 1GJBB 3GIKA 4ZP8A 3NGSA 3M61U 1O2MA 1UMAH 1SGRE 2JH0D 2R7UA 2EI7A 4RLEA 4ITZA 2FHMA 3DFEA 3TAMA 1X4EA 4U01A 3BN4A 4LZ1H 3KLIA 5ETNA 1XQIA 2OC7A 3S7RA 4XO0A 2WCXA 2HQ3A 1UP1A 2GHWA 2MJUA 3F56A 1P02A 4CRDA 1JLAB 5B0AA 1F60B 3MNXA 1O2OA 3MEGB 3ZZDA 4U8VA 2XCAA 4O4RA 3SIPB 1DARA 4IT4A 1VIXA 4CH1A 1JRTA 4CBNA 4HI2A 3M30B 2W25A 1ARBA 3VEQB 4PQUB 2PW8H 1LPKB 5J2QB 3RGIA 1YZ7A 3DDKA 5IT0A 2QA1A 2SGAA 3E6PH 2NYHA 2PT0A 2FOCA 2WBMA 2QIQA 1ELCA 2ROEA 5GMEA 4GVBB 2B9XA 2E5LJ 1XUFA 4HHHA 1ZZZA 2RU3A 2GX4A 2HS0A 8RUCA 2ZGXH 5J2MB 1CQQA 3K2YA 3V81A 2AGOA 4ZMAH 1JJ2R 2QA4S 1HQEA 4EI2A 3LGWA 2M2AA 1RT1A 1GI5A 4GHQA 2MQPA 4JK5A 5A0BA 4C8OA 1Q6UA 3T2NA 2G9OA 5EWGA 3U1NA 3DLJA 3W8GA 3PFOA 4CO1A 1V2NT 4NLQA 1SR0A 1TVRB 3H25A 4NA8A 4OYIA 1C2KA 3CCUS 2OBQA 2ZDVH 2DCUB 2VPWB 3BO3A 3CDBA 3A8DA 1O3IA 4WIQA 1U2RA 2BLVA 1EIYB 3MOZA 1FTCA 1KLMB 2HFUA 1IAUA 3R7NB 3SI8A 4O3OA 3CJ8A 1Z7KA 4YOGA 3KK3A 2E5IA 4X6OA 4NYPA 4OS4A 3HVTA 1WG1A 3C14A 4C3LA 4TW8A 2J0WA 2J0QD 4CZCA 1V5VA 2B5TB 2JVOA 5KEDA 1SL3A 5GXPA 2P2CB 3PV5A 2OD3B 3UNRA 3OVSA 3EYDA 4KR0B 4O23A 3CC7S 4PPZA 3EDQB 3QZRA 2XXLA 5H9EK 4Z2LA 1IKWA 1NROH 3QLPH 3WC2A 1TL1B 3PMBB 1BCUH 1ARCA 1ZHMA 5FPTA 1T9YA 2BQ3A 1SKRA 2BJ3A 3WZ0A 3ARQA 1CULA 5AJ3J 2XW9A 1H38A 2ANYA 4C0HA 2UV8G 3BGUA 1TCOC 1R8BA 4ISOA 3BIUH 2AJ4A 4B71A 4CCHA 1C4AA 4DV0J 1Q5YA 4O4GA 4Q0BA 2K8GA 1QBNA 3H20A 2W9BB 3LQVA 3ARTA 2UUAJ 4DL5A 5C5OA 4TSFD 2RKIA 1AHTH 1OSSA 2IVMA 2WAQD 2GAGC 3PIOQ 1ELGA 1XXFA 1FX0B 2ZITA 1DUEA 3K8VA 5L30H 1K8AT 5JH8A 4U2WA 1VRUA 3J80Y 1YPHE 4QWEA 1YKWA 3V5RA 2KZMA 1C0TB 1E6ZA 1A0LA 1RT4A 1S1XB 3NNHA 2FVCA 3SORA 3VQTA 4C4WA 2HNTC 1NTPA 1KD1T 3M6XA 4Y6IA 4W9QA 1NDPA 2ILYA 2Y6TA 2QA2A 2FOAA 1F2GA 3URCA 4ZA1A 3QWCH 4A1VA 3Q0AA 4BS2A 4F7VA 2XQCA 2CWKA 2KXHA 1DVAH 4I0WA 4CLPA 3HT3A 1URNA 4AN7A 4O03A 2CJ9A 3GFYA 1VQ8S 1E6YB 1VC6A 3OD2A 3JB9k 4IO9Q 2XOKD 1EPTB 1NESE 4ENOA 1OSDA 4X2YA 1RTKA 4NIVA 2AERH 2DSZA 4LF8F 3BQ1A 2P4VA 3A7YA 1TX7A 4KV8B 4ZCNA 1JMTA 3MM5B 2V7QD 2FJAB 3O8WA 2QV6A 1YPMH 4JI8J 3ATMA 3ADAC 1LW0B 1YY3A 2ZH8A 4JV5F 2I6WA 1FKGA 1UA0A 4J4NA 2V2KA 2EFQA 1O3EA 5F9LA 1C2GA 4B9UA 1ZZNA 1SJ3P 1C1SA 2G0IA 1GHAG 3RRHA 4ODQA 3M8YA 4I67A 3E8LA 1WDIA 5FBEA 2CG4A 5ETSA 2ILNA 4B3SJ 2DHAA 4JB8B 1SGPE 1B70B 1B0FA 4ICLB 3D0GE 4PPDA 3PM9A 2CQPA 3M9MB 5F8NA 4IR1A 4ASUD 4INLA 1JIMA 1GDQA 2LEAA 1RUSA 4JZEH 1N5YB 5FCKA 1IBMJ 3GJQB 2G0JA 4DRNA 1K22H 1TFVA 3LAKA 4ITSA 2YKOA 2IM3A 1C5VA 2VG6A 2YWHA 2BRLA 1GWAA 1KXBA 2BMGB 2PC6A 4R0XA 4P75A 2LU2A 4LGXA 5CE1A 2K3KA 4RWWA 1FLEE 3WQPA 5C5JA 3GY5A 2O5DA 2D3ZA 4DHVA 4DI6A 2DT9A 2VDIA 3VAFA 5GWZA 2DSWA 1M5SA 4YB7A 1P01A 1RHQB 4LFAJ 4E2FB 1ZCNA 1QFKH 4OI1A 1AZSA 4DPTA 3N5BA 1LW2A 2MTLA 3I0SB 4DL3A 1R0CB 4LSLB 5GAGU 4XBBA 1R3NA 5K8PA 1C5NH 2BXUH 2V8DA 2YNIA 3TR5A 1E36B 1X6LA 4LZ4B 3MPDA 5HATA 2EI6A 4X65J 3JQKA 2SNVA 2W3IA 3FP7E 4B02A 1GBLA 3GZ7A 3K5PA 3PV8A 3D9BA 1O5DH 2H9ZA 1MMDA 3G4SS 4LF7J 1GDNA 1GK8A 2OPPB 4Y7BA 1AWHB 3LGVA 4BC7A 3O8RA 1TX6A 4Q80A 4Y79A 3HHLD 3IMQJ 4JYVH 4CHAC 2UZ5A 1RHJB 1LWXA 2XBXA 2RQSA 2Z7FE 2KXFA 4ZP9A 2HGNA 2FOMB 1ZS6A 5K5MA 3THPA 3GFHA 1K9TA 3CD5A 1RWNB 4ECRA 3RUBL 2EA3A 1NRRH 2O8LA 4LF6J 4W5UA 2FJWA 2OAUA 5DLFA 4DX8H 2ZC9H 1J14A 1NM2A 2MHNA 1ZGVA 1UMJA 3T5JA 1JLEA 4DCPB 1TMMA 4J4OA 3MO3A 1YVFA 2HHWA 2BKOA 1X0PA 2CRLA 1EQ9A 2HW3A 3EVWA 2CYYA 1CG2A 2PHBA 4ABBA 3T6JA 4LIRA 5HW8A 2UV8A 2OFHX 1I3OB 2H9HA 1TELA 4G1QB 3AROA 4U85A 4X2BA 4WFXA 4TN2A 1KLTA 5F0UA 3ZZ7A 2ZU2A 1MZAA 2RFKC 2YY3A 1FNMA 1FY3A 5A8WB 2C90B 1QSSA 3SNDA 1XUGA 3SGQE 4WE1B 5KFAA 4OMFG 2BE9B 2AEFA 4JYAJ 1AE8H 2VBYA 3D4JA 1KFWA 3A7WA 2R7WA 5HVHA 3GYGA 1Q6IA 2MKYA 1H8HD 2KG1A 3WD3A 4Q5VA 5KG3A 4DWSD 2MDAA 4X1NU 3Q8RB 1O2XA 3GDSA 2VQEJ 4WZQA 1X4HA 3H59A 2XCFA 3SHAH 2YKAA 1HD1A 3LGMA 3M37A 1HUTH 3ET6A 4DUYJ 1UTOA 1NRSH 2ZHFH 2AD9A 4IRKA 5T1VA 3UIRA 2KI2A 3LH3A 3LGUA 1TA2A 5KFHA 2RS8A 1ZYOA 4ZKOU 1BTWA 2XRCA 4K7QA 1JK9B 2VICA 5D8HB 2OINA 2DG4A 4G65A 1VQNS 3PR5B 3DU6A 3AS1A 3KYGA 1Q7LB 4C8MA 4DCJB 2Z9IA 4FUFA 2X3GA 3C6TB 1QBOA 2V8GA 2KFNA 1HBTH 3M4XA 4QIVA 3KJNB 1UVJA 1NFXA 4F4ZA 2A6OA 1F92A 2DGXA 3A87A 3KKFA 3T1AA 5GAGI 2ZH5A 2UVWA 3T19A 3VTIA 3ZZ6A 2PFFB 1AROP 2V8VA 1D2KA 2FJVA 1S84A 1KOHA 3RMMH 3WWFA 3SO3A 3J81U 4ECVA 1WC5A 1XTZA 4USKA 2JETB 1MU2A 1V2PT 1GJ8B 1P2JA 2QA9E 1EASA 1GJ9B 1YCPH 4OX6A 3U98H 1C1BA 1KYNA 3ARWA 1BJVA 2ZDAH 3JXVA 3LWMA 1V2MT 1M5OC 2FD2A 3DDNA 3C27B 1BQMA 5DITA 4MYTA 1M5HA 1O3HA 5C20A 1EKRA 1Q95G 4IBLH 3CCTA 5T41A 2GJ2A 3E16B 4XK8C 4OS7A 3B9FH 5T7LB 2DNPA 1PQ5A 4XFQA 1A3BH 4J1YA 4IRCA 5HM9A 1O2RA 3SDEA 4F55A 1FRHA 1VC0A 1BBRE 3HULA 1RI7A 1KBRA 2KCOA 4FVDA 2A3EA 1HPGA 2BQRA 2CPDA 4P73A 1FIZA 2OEKA 2ITKA 4GAWA 1YCPM 3UVJA 2Y1RI 4JV5J 4ZDNA 2RA3A 5EJLA 3UDCA 1DWBH 2B4VA 4ED0A 4ED8A 5HTGA 2VVUA 4X4PA 2ZZNA 4N77A 1VQOS 3K6YA 4TQSA 5EX0A 5C1YA 4KE5A 1GBHA 3SCJE 3H2LA 3KHRA 1KS2A 1JLGB 3NTPA 3V4IB 1W14U 2G2ZA 3E01B 3G6LA 2HIQA 3KLEB 3MU8A 3HVTB 3ZVFA 4HHJA 1V2ST 3JTNA 1GMWD 5IT4A 1SKWA 1AE5A 1SC3B 1B3TA 4KTQA 2A5AA 3ILIA 3OR1A 5ITHA 1TL1A 4HZHA 3U02A 1U45A 3H8YA 2BDBA 4BNRA 2DO0A 2IRUA 1VS3A 1EZZB 3UAIC 1QTMA 5FIIA 3SV8A 1VQKS 4JFJA 1VGYA 3E3XA 4HFPB 4IQCA 1RT3A 3V4IA 2ZTZA 4NOHA 3D28A 3BGOP 4IS5A 2HBQB 5KG6A 3FUYA 4LR7A 1SL0A 2DUCA 2HQIA 2UUBF 4A7IB 4RUAA 4NXMJ 4DPUA 1HXFH 1GBAA 2KJWA 3FBBA 2K1RB 3PYGA 2VBWA 2H5IB 1O2KA 5DPAA 2VA3A 1G2MA 2PGBB 2G5VA 1PJ5A 3CCWA 4DPYA 5D0GA 3MWIU 3TIUA 2Y78A 3SI4H 1KOOA 1B7XB 3HI9A 1GGDC 2K0QA 3U7JA 2WOMA 2R8KA 1S9EA 1ZA2B 5IV3A 1AKSA 4JYUH 5F8LA 3PRVA 3T1HJ 1K9OE 3KNGA 2VOPA 1SB6A 4CR5A 3LUOA 2B8OH 1W3CA 1GX6A 3JSYA 5BPEA 1JKHA 1QRWA 1U7LA 3R0FA 3O5IA 4ZROA 4DIPA 2M52A 4DQQA 5DO4H 4O44A 1FEHA 4OX9F 2Z30B 2DBBA 2JEJA 1MMNA 2BW7A 3PO4A 1OWHA 3ZTSA 2KVIA 2R7TA 2PWXA 1HQ2A 4WBFA 2H2ZA 2R7XA 1N33J 1XHGA 5CZVA 3SSSA 1TGBA 3C6UB 2B4OA 1LQEA 1BQNA 1RWOB 4NZCA 1F5BA 1D6OA 4YFUA 3GOVB 2R8GA 1WOFA 4Q22A 3K5OA 3RLWH 2W6JD 4ZOSA 4KKOA 1CQMA 1YRUA 4Y11E 1IQEA 2VCDA 3FBCA 1W9UA 4RW6A 3UCGA 3ODFA 5DDPC 4DS5A 2ZJQQ 1GDUA 3TJ8A 2V63A 1NEEA 3B8JA 2YOLA 5EGMA 4FBTA 3S01A 1SVPA 1RA6A 1XNQF 2ZBQA 2BX3A 4MNMA 1F40A 1S6PA 4UY8T 1O0PA 2WVEA 1U6ZA 3PRDA 3MUMP 1GVLA 2XI3A 1SJQA 3E1XB 3VAWA 3LANA 1ZTKA 4DRJA 1U26A 3GQCA 2XLIA 1C5UA 2MZRA 5EG4A 2QN5T 1GI3A 4M7GA 4ZHMU 3D0IE 1XXDA 2D7SA 1DTQB 3M8PA 3FVYA 3WH0A 1LEOA 3W94A 4X62F 4H4OB 2DH9A 4WZMA 2KFZA 1SOZA 4D9RA 3SV4A 2GAHC 3RGCA 4RW4B 2BYAX 5DG6A 1FCAA 1QUPA 3IA0A 5F8GA 4HYKA 2RUSA 3ATKA 4DGJA 5HKGA 1QB6A 1ZJKA 2CPFA 1N5VA 4Z2GA 4WWYA 2YBUA 2RU9A 3FGVA 1WKKA 3TH2H 1H72C 1Y5IB 1CQNA 1VJWA 3GG1A 3QZ8A 2YX1A 5JPMH 1OWQA 2DITA 5D0EA 4U67Q 1AW0A 3PDNA 2HVEA 3IXQA 4DWSB 4ED6A 2K1QA 1BWEA 3CWJA 4IGDA 1PPZA 2J9CA 1PPBH 1CC8A 2OPRA 2R0KA 1T05B 1NO8A 4ZKNU 2Z2LA 2JJ4D 5D75A 1C5OH 3TEHB 1IN0A 4KPCA 1TGCA 1CBWB 1PFXC 3Q8SB 5KFDA 4OL8A 4EK2A 3VB5A 2Z3EA 1C1MA 1IR2A 3MDYB 2ERRA 2STBE 3ZZTA 1T8EA 4BTTB 1L3KA 2Q6FA 1F3VA 2F9PA 4ZP7A 2AIQA 3AOAA 3KJVB 1V5IB 1N48A 3T5KA 2SGQE 1A46H 3V3MA 4BHQA 1N54B 5EUHA 3QGIA 3DSPA 3SUEA 4MJKA 2NYIA 2N7YA 5IM0B 1JIHA 4OIXA 1ROFA 1Y3VA 1DT2A 1TRYA 2TIOA 1SR5C 2GJGA 3FZZA 4O3UA 4GC7A 2J0SD 4OX7A 2OXSA 2MQLA 1N6QA 1MNEA 4FYWB 5DQGA 1EIBA 1LL6A 2I8EA 1QRZA 3FSIA 2FXRA 2UWLA 4P8WA 4ETXA 3A13A 4WFZA 3L3CA 2RJZA 4KHMA 4X8SH 1Z2LA 4GVUA 3ZZRA 2DE8A 4J91A 5AE1A 1ZM4A 2IFXA 2FEQH 2JWNA 4K4SA 1VITH 3S8SA 3PO1B 1T9WA 2B31A 2D41A 1NPKA 3N9UC 1HW8A 1X9MA 4AE5A 3JSMA 2ZUGA 1FAKH 4AG1A 1C4V2 5DJBA 4F49A 1FKAF 1D6RA 1RTDA 3R1HA 2V34A 5E0GA 2XNIA 1YX2A 4IH6A 5A6PA 3MR6A 2AW0A 3H4BA 5JBTA 1R31A 4LF5J 3TDBA 3JSMB 4X6PA 4ILRA 4DV2F 2XMTA 1ZZFA 4GKJF 5E3AA 1WACA 3V6DB 3HKJB 1PCAA 3EGWB 5G4DA 1XN9A 1FHTA 3A8BA 1C5XB 5IC6B 1O33A 4F2SA 3ZYDA 3D0HE 3SCKE 5F8ZA 3ARPA 4M8LA 5HBMB 1S85A 2AJQA 3NOCA 2BJ9A 3AH6A 3Q8PB 5L1IA 1NPPA 4JYAF 3G87A 2GX8A 4D3HA 3QZQA 3PLBA 1DQAA 3MEDA 1K0VA 4B3SF 2FHKA 2LP6A 2PV1A 2JJ2D 4NNRA 2C3OA 1GVZA 4A1XA 4F0HA 3PB1E 3P6YC 5HROA 1FKDA 2VASA 4DG4A 1RAHB 2Y1IA 2DPIA 1COWD 3M9NB 1MH0A 1BDAA 4FF4A 5L1KA 1QSYA 4CLZA 1OP8A 4Y00A 1LWCB 2DHSA 2FPHX 4DUZF 1AZ8A 1HR0F 2XO6A 1PBUA 3GPKA 1TGTA 4NLOA 1PPEE 2O66A 1C1PA 5LMNF 4B9MA 3V81B 1LJYA 1YJUA 2FS9A 2BLQA 3I5CA 1A4WH 3CJ4A 4M5NA 1HQEB 5DM6Q 1NU4A 1K9MT 2Y81A 1Q8LA 1GRJA 2BXJA 1SKSA 1PILA 4CT8A 4A8QA 2BY9X 2RQ4A 1C2EA 1EPTC 3BF6H 2ANKH 1KTTB 1GNKA 4ABHA 4IOCQ 5H4IB 2QLXA 1QTNB 2K2PA 1HI8A 3CIMA 4U8YA 5FAHA 1KFSA 1ZL1A 1O5GH 1MAYA 2CV3A 4NX9A 1YATA 5JMNA 3URDA 1HJWA 3ONQA 2G13A 1N56A 1SCJB 5C2ZA 3GCTF 4B3RF 3K9XB 1FESA 1WF2A 4NE9C 1QQ4A 3CCQS 5A8XA 2QL7B 4QW9A 3F0PA 4DLGA 2RDJA 4NXNF 2WW8A 3SCLE 3G8QA 4JI2F 3IWNC 4UDMA 2MKSA 2E1AA 3BTGE 1QPFA 1VCPA 1R8PA 3DXSX 2AKWB 3MNSA 1Y7PA 3NNAA 5ETTA 1S6QA 3H2VE 3RRGA 2HLTA 1ELBA 5C42A 5LH8A 3OR1B 5LGOA 3P5TL 5JBBS 1WORA 5HBFA 1VQ6S 3DUXH 2FIUA 4IFYA 3PLKA 3BTEE 4DU7A 2DNNA 1MN7A 5E33A 4Y0FA 4O0NA 3QJLA 4U7CA 4OV1A 3BN7A 2BQ6B 3IWMA 1ACBE 2RF2B 2HHHF 2XS5A 2PSYA 1CJTA 2A31A 1GH8A 4A1TA 1GJ6A 4ZKSU 1NH7A 4CYUB 3NKYA 3GU0A 3TJNA 4ES1A 3KQDA 1CC7A 1ZAVA 4INKA 2KR7A 2E5LF 3QLHA 4V1Ak 1NBMD 3QX5H 2UUFB 2VG7A 1TYNA 2PA8D 1HKMA 3QMQA 1HBUA 3T9NA 1BBRH 1OXGA 4FAPA 2WLYA 2L9WA 4CRBA 4W9OA 1DURA 1EP6A 1FKIA 3DCAA 1H9IE 4IN2A 4UTGA 4U95A 5KFPA 3AODA 1Y59T 2DR8A 4I6WA 4DMZA 4NA7A 2OQ5A 4CRJA 2CQBA 1HAZB 5F41A 3OVBA 2M7SA 5AXNA 1P57B 1NH6A 2D3O1 1HWJA 4M1KA 1O3GA 1EPTA 1GI8B 3MPVA 4ZPAA 4AXIA 1WOPA 1K0HA 1QTFA 4ES3A 3MNCA 1MU6B 5LPFA 3DXBA 2QXJA 4MNXA 1VMBA 4WWSA 1F0SA 2H1YA 3Q22A 3MR2A 9LPRA 1KY9A 3WD1A 2MKHA 1E1QD 4X4UA 4KB7A 3MMAB 4IQ2A 4DR7F 3OL6A 3SV3A 1ZTJA 4KGMA 5JVGQ 1THPB 3OAAD 4UOHA 2FYRA 3AS0A 1HNWF 1FJSA 2VG5A 4WKFA 2IPOB 2AGPA 2VB6A 1WU1A 3MFJA 1YJNS 1U02A 4OYXA 3OHBA 3CULA 4FUDA 4AQYJ 1XMBA 5F8HA 3HJVA 2STAE 1M5YA 2NCKL 1WTHD 2G55A 3TVJB 3KIDU 4ATNA 3CO0P 1WB0A 4QQBA 5HW6A 1RWWB 3UI3A 1ZOMA 2D3OR 3CHFA 1FO1A 5KGOA 4XIUA 1RU1A 2XMUA 3TX8A 1D3PB 3OFEA 2QGFB 1YJWS 4OI6A 2LQJA 4MYUA 4WFNQ 4UFDH 1PBAA 3R9LA 1J5EF 3LGTA 2AP6A 3A8AA 2DIVA 1VQLS 2MKIA 3I31A 4GRSA 5HN0A 2NZ4A 2VHGA 2Y5HA 3MUTP 3B78A 5A0YA 4RNHA 1QAIA 1Q4RA 3QOKA 2EC0A 3ZC4A 1Y3XA 4ID5B 1B6CA 3MUVP 1C2JA 3VWSA 4HVZA 3I0RB 2BANB 3CW2C 2ZC3A 1ZBTA 2V2QA 3GIRA 1AMHA 1X9SA 4U96A 2L41A 2CZ9A 1HJ8A 1N5TA 3P70B 3CGMA 4DZDA 4DPOA 1HAXB 2B8PA 1OYDA 4ID5A 1ELTA 3W66A 4NLPA 2HVIA 2OP9A 3SJ9A 1MMLA 4ES2A 4JI4F 2AS9A 1ZMLA 4AFUA 2KCYA 3GFXA 3TVZA 2ZH7A 3DT0H 4JI1J 1BQXA 5E0OA 1QSLA 3Q8VA 2NPIA 4HH1A 4WTOB 3VGSA 4NASA 2FO9A 1K73T 3M3SA 2WB1D 2EEYA 5KFWA 4X2WA 1XWLA 2WLZA 4FDFA 2OH2A 1FD2A 1XR6A 1N5SA 3MU1A 2E5GA 1MD8A 1TOCB 2OO4A 3I5AA 3P8FA 3S6EA 2XWXA 5E0JA 1VHFA 1ZH5A 3VAIA 1TL7B 2HYIB 4NG9H 2AIRB 1CT2E 2ZKSA 2CF8H 3F1SB 3KQEA 4EGLA 2A3BA 2WK4A 3JXOA 3OLAA 1RAGB 3D54A 4F4YA 3MHYA 3HGPA 2W7UA 5CQGA 3DRRA 1V2QT 2GDDA 1HKIA 5EWFA 1HKAA 1EB2A 3T5HA 2O8UA 2JFKA 3L7PA 1HIAA 2V3MA 3UFCX 3T9ZA 1EETB 3UD5A 3CJSA 5EN1A 4FP9A 3UWIA 2E66A 1HI0P 3VCDA 4DW2U 2J6TA 3IS9A 1UEVA 5IFMA 2O01C 4TW6A 1KTSB 4AUKA 3O5PA 1W10U 4N8NA 1WC3A 1JLQB 4DV4F 1SHHB 4NIWA 2XHWA 5EXNA 3EX7B 2V8HA 4RL1A 1FK9A 1KDQB 2CA9A 3OSPA 2QXIA 5E0HA 5ETMA 5AE3A 1CA0C 2OD6A 3T26A 1XR7A 3QFWA 1Q8KA 2QFIA 2VOOA 3SI3H 2IOTA 4CLKA 4ZLPA 3GICB 4KGXB 3M35A 3TAQA 3LP0B 2YNFB 5RUBA 2X1BA 2FTMA 1Z6EA 1ORFA 4ZAEA 2QFJA 4KTCA 1ZSLA 5AXLA 5EPNA 3OR2B 3M8QB 4DV1J 1SH0A 2CNNB 5K7RA 4N5SA 1BTYA 3ILOA 1A9NB 3HKIB 1O38A 2KL8A 1GBBA 2Y7ZA 2GQQA 4E0DA 1IBLF 4DR4F 3G6ES 4Y28C 4MKYA 1YSJA 1A6LA 3SV9A 4F26A 3ARZA 4F0MA 2DGOA 5AXMA 2XP9A 4WFAQ 1LFWA 4NZ0A 4K1EA 3QO6A 3LW5C 3FMBA 1THRH 1VK8A 5LJ5Y 4UZBA 4A8WA 3PHEA 4HT7A 1TGSZ 3V13A 2DNZA 3VAGA 1O37A 5C0TA 3F0OA 1OYEA 4FOUC 1R8AA 2CK3D 2PSZA 2GIRA 1UW4A 2J9DE 3DOKA 3IITA 3TNTA 5KFKA 3RU4E 4YXWD 1O5EH 2BY7X 3P8GA 3ZVCA 2P95A 1HAVA 1T95A 1C1WH 3SNBA 3QT8A 4I69A 4KRWA 5AFYH 4YP3A 2O9OA 3Q2TC 4Y76A 1F1BB 3MM7A 5EJZA 5BR8J 1Z8RA 4LR9A 4DBQA 3OTCA 1EAUA 2PUXB 2GDEH 4BAOB 2EPIA 3JYJA 4RKUC 2IVFB 1TK0A 3GDUA 1EP5A 5PTPA 4RW7A 2I5JB 2M8DB 2B3TB 1W9VA 5A8KB 4DR6J 1CS4B 2ZR6A 3MECB 3DLHA 1GI4A 1FJDA 2G4TA 1IQTA 2OLWA 3FO8D 5C2GA 3HHLC 4K8BA 1B4SA 1QR3E 4NLSA 1FRIA 3UOUA 2J0XA 3B23B 5HUAA 1F5RA 3V12A 3RB3A 4J9MA 1XK8A 1ID5H 5DSFA 2HAFA 3R5DA 2ASJA 5KFLA 3SUFA 4F02A 1HBMB 3CJ0A 2J76E 1GI9B 1RT5B 4B3RJ 2AT1B 3MECA 3RW6A 1ZETA 4X1PU 2ZWLH 4U84A 2M2BA 4QYRA 5K14A 1C1TA 3KF2A 1PQ8A 3BKUA 2G51A 4Q43A 2EFVA 1N34F 4KY3A 3B9EA 2ZNZA 2R2SA 4JI3F 1AY6H 2F2DA 4DDFA 2DKOB 4YDDB 3JTOA 3NI6A 3PYEA 2ZDNA 1JLFA 1N8OB 3DI6B 1CO7E 1KXEA 2MKKA 2HLUA 3W9JA 1B7YB 3SQHE 4C0OC 3O5KA 1MKWK 2BQUA 3SZ2A 2F7VA 2CPZA 2CXVA 4X4NA 1ZM3A 1TUGB 3AQUA 3HX9A 3F9FA 2CVEA 3CT9A 1JWTA 1GCTC 4R5PB 2ZH9A 4GMKA 3DLKA 1D7JA 4AYYB 2QMXA 3UCZP 4K2YA 1NK0A 4YOJA 2YKQA 1VFJA 4OI0A 1JMOH 2CJBA 1AVXA 1FMGA 3N7EA 2VWNA 2G4BA 4ZVRB 1S6OA 2WVDA 3GE9A 1E6PA 4YR3A 3CDEA 1RU2A 1WSVA 2CMYA 4GCHG 3HHLB 3SV2H 2DXEA 2KHCA 3POTB 2GA7A 1LOUA 4RKOB 1TKTA 1V2RT 5HL7Q 1VBXA 4FYVB 5L8RC 3KDOA 3M2VB 1JJHA 4J2YB 3TAMB 4YR2A 1L1PA 4J5OA 4NEZA 2WV4A 2D1CA 1Z8GA 1GFWB 2V3OH 1S0MA 5GNDA 2QLJB 1NPMA 2KAIB 3RR8A 5E7OB 4DV7J 3SUGA 1TONA 1UVUH 4ISLA 1XUIA 2FX6A 3MMCA 1ROTA 4Y6DA 2VL1A 3T27A 1PYSB 3ZVGA 2R7OA 2ZDOA 3DYAA 4J9RA 4KP0A 2Z2MA 2XP3A 3KYLA 3PKYA 2RA0A 3A80A 4CLLA 3FZBA 2PIIA 1C2DA 4M95A 4Y71A 3DGPA 1S0OA 2BM2A 4AX9H 4R0EA 3HKWA 4MIAA 4RO0A 2D9FA 4LVOP 1ZM2A 2HVHA 2ZDMA 3WBZA 1UAWA 5JJBA 3EY6A 4MK9A 3PO1C 1HYSA 3R6GB 3MTJA 1IM6A 4YEAA 3I82A 2PMHA 1NKCA 1S1VA 2LDYA 1RT1B 1BT7A 4WU3A 5C17A 3FEXB 4Y2KA 1WNEA 4XBCA 1SGNE 2VDHA 3QDZB 5I3PA 2XC5A 1DDJA 4ZLNA 6AT1B 4ECWA 1UR8A 2DO4A 5HVGA 2GIQA 2P8OC 3RB0A 4DVAU 2IJNA 2IBKA 5B6OA 4DJZB 3IWLA 3AS2A 3G01A 3EUNA 4Q8EA 4UQGA 5D3GA 1K1NA 3A12A 3EA8A 1DLOA 5ETOA 3BTKE 4F2RA 7FDRA 2BBEA 4F25A 2BLWA 1UVOA 2XTJP 2IC3B 1BKFA 1YPHC 2OEMA 3OSNA 1T4VH 3D65E 4MLFB 3OTEA 2DNOA 4X0WU 1ZSKA 3QNWB 2FHJD 1FPCH 2YMSC 4PCQA 4YB5A 1TFXA 1Y3KA 3PW4A 4H4MB 4JI6F 1FRJA 5DDRC 4RZRA 1NSAA 1W1YA 5KFUA 1OWDA 1ABIH 2FVPA 1FIWA 1IKYB 1OY6A 4Q7XA 3KQBA 2GCTB 5A0YB 5BXJA 4P72A 3SNCA 4XPEA 5FLXU 5HQLA 3E3TA 3AHPA 3SU5A 1JLBB 1NK7A 3EQ0H 2A4OA 4RBTA 2TGPZ 3KK2A 4QYZK 5KFQA 2CQIA 3GCOA 5IC4B 1O5JA 3FBFA 2HKEA 5IYTA 2Z8QA 2VBZA 3SMZA 3GY7A 1HMVB 1VCWA 3N01A 1UW7A 1Y3UA 7ESTE 2W9AA 3TUJC 2XB2D 4Z6AH 1RBOB 3MDFA 1YIJS 3NRKA 2BD8A 3X3UA 2HS4A 2KXNB 1HJVA 5C0UA 1IQHA 2C8WB 2E9RX 4YTAA 3VAJA 2DTJA 3I4HX 2EG1A 1WI8A 2RRAA 3OHAA 3PW7A 3IG6B 2UUJB 3O5OA 2HK3A 3EIPA 2JDJA 4MNYA 3ITIA 1FTRA 3QFHA 3VXFH 4DIIH 1EDQA 4CM2A 4WJXA 4MGVA 1KN6A 2YWGA 5DP3A 3EPGA 4TLQA 1LWFB 4FUBA 1I51B 1PC4A 1UETA 1G6BA 1NK4A 4A8OA 3F2HA 1GXLA 1WD6A 5C94A 1WHYA 4NCAA 4P8VA 5KT3A 2C3YA 1U49A 4Z7YA 3P17H 4M94A 2W7AA 2E29A 3GYNA 1QB9A 3OBIA 4K4YA 3ODKA 2ASDA 2LVWA 4C11B 1TL5A 2AQ4A 4OS2A 4MIBA 2B43A 1J4RA 3CDWA 1OY8A 3MHWU 1KXFA 2M5TA 1KTVA 5DRKA 5HQMA 4G1PA 1BXNA 1HIAB 2Z9JA 2GJFA 5HMXA 4IMQA 4AL6A 2GGVB 3BJYA 3N0VA 1X4DA 2IA0A 1C0UA 1UCYH 2J6UA 3ARRA 3V6HA 4GKJJ 3CUNA 3G82A 3CPWR 1H3DA 3WHIA 3H90A 3HFZB 1FE4A 2PPPA 4Y0YE 1K1JA 2N3LA 5IS2A 1ELDE 4Y2IA 4JYTA 5DZ7A 4RNOA 1MU8B 3FCWA 4ZVFA 2FOEA 1LVYA 3A8EA 2IMOA 3C66A 1CE5A 1J9CH 1QVGR 3W65A 3RBXA 4B3TJ 3MMGA 2HVXA 3PEHA 4FXGH 2QIFA 3GLJA 4HTIA 3KLGB 4WH8A 4OJHA 1O31A 4YQWA 1C5SA 4UT4A 1XNQJ 2XO7A 1GAOA 2V50A 2XC4A 5CHAB 1IKVA 2PDAA 2KX4A 2IRYA 1TE0A 3MCMA 3J7YU 1JLAA 1NN6A 1CA0B 4TY8B 1SJFA 4PUOB 1TA6A 1FXRA 1HJAB 1JLCA 2EY4C 3Q89A 2F4EA 4LF5F 3IAS9 1DXPA 1BD6A 4W92B 1QCPA 5HVFA 2XYAA 2ESTE 6GCHG 2GV1A 3KLGA 2EBEA 1C1QA 2OSQA 2P9CA 1K2I1 3I77A 2R2MB 1G2EA 3HO1A 4LF7F 2BD7A 2N3OA 4OV6A 4K4TA 1TK8A 2R0LA 4NIYA 1V3ZA 4JOUA 1QRXA 2OFGX 2B8QA 3R5BA 3UF8A 3CCLS 2FIRH 1NXIA 2BE7D 2HHHJ 3UD4P 2L08A 3W61A 4TNSA 4K5ZA 5DGJA 3KLIB 2GT7A 1RRKA 1VQ5S 3KHHA 2AV5A 2NXJA 2CADA 2DNLA 3PMJA 3PYHA 1FFQA 3PM3A 3EZOA 4LR8A 4QT2A 1ANDA 2J97A 4U7UD 1WTBA 1CJKA 1LL4A 4ZKAA 2UU9J 2DEIA 3DSGA 3IGVA 5I42A 2R8JA 4IUFA 5GADU 2YWEA 1TUWA 1MG7A 3RXHA 1SQEA 2VFRA 3KLVA 4TKTA 3M2RB 1BBRK 2VINA 4RKJB 3TITA 4D76A 1S77D 3AB2B 2Y5GA 3IM9A 3FC9A 1OWJA 4L73A 4BAHB 3H42A 2ZP0H 1HBNB 5A2MH 3GJTB 1N6QB 3IP0A 3AJDA 5HK4A 3MU4A 1TTHB 3C19A 4ZHRB 4TX0A 4PG7A 1HA1A 3HHDA 2E5JA 3RZAA 2NQPA 3OA5A 4K5RA 2A7JA 4B3MF 2VPXB 2LCWA 2GVDB 3ARUA 1XJWB 2O8WA 3QJPA 1AO5A 4HR2A 1LCYA 2E1CA 4H4KC 4GIVA 2HWHA 2YTCA 5C25B 3GV5B 1AFQB 1KR4A 1H2UX 3FFIB 2YNHB 2RUDA 1FNIA 2YPZA 3TGJE 1BMQB 2IVYA 2R42A 3K5MA 5E5NA 5HO4A 4TYDA 1RLDA 3FAOA 2XSJA 4Z2HA 2DGWA 4LRDA 2WHXA 1HAGE 2G52A 1FKPA 1Q2WA 2PEBA 3PX0A 1NK6A 5DIUA 1T3OA 4B6EA 1BE4A 1S6LA 3L95X 1P3EA 2XPBA 5C42B 1S6QB 2VQFF 3RM0H 1W0ZU 3BEUA 5JXSA 4EUVA 2LELA 2ZFFH 2QAAA 2XM3A 2KKHA 2K1RA 1AD8H 3CD6S 1IUJA 3MPWA 2DNQA 3RXFA 1EYMA 2QE7D 1OGGA 4IFVA 5A8WA 2Q6GA 2RQMA 2XCNA 1N0VC 1VOMA 4DR7J 3RYLA 1VQMS 4VGCB 4OLOA 2Q6DA 1TNJA 4FPIA 4C8LA 4WJBA 2FOFA 2RDDA 2Q1JA 3BGRB 2AGEX 2XBWA 4BF8A 3SGBE 2DT0A 1EKSA 2ZWPA 3IR7B 3MU0A 1NWSA 2G2YA 1FXYA 2PI4A 2FAPA 3DOKB 1JXEA 4ZPCA 2DPJA 4BBYA 1X60A 3MD3A 1LK7A 2C2DA 2E1RA 4P8UA 1LWCA 4ILLA 2MLYA 1UJ1A 2Q3PA 2P3FH 3ENQA 3R5AA 4WJG2 4I2PB 3D6FB 2W7PA 2HAIA 1T7CA 1UVIA 4QPXA 4F4AA 4MNLA 2AYBA 3RXIA 2NUHA 4LF1A 4LFAF 4DQIA 3K6ZA 1TAWA 3HD1A 4XD7D 3CJ3A 1XVOA 4S3JA 3WQVA 3SOSA 3MH4A 3MMCB 4OX9J 2FLLA 1SFQB 1UK2A 2LJ4A 2H54B 1D1UA 2W2PP 3BEGB 3F41A 1WHXA 5DP4A 2K7KA 1TVRA 1U6QA 4R5EA 1IXKA 4UDWH 1O8BA 2ZNYA 3MFIA 1WDDA 3KQ5A 1O3AA 1Q8IA 2KM0A 3W64A 1GEHA 2KVQE 2FDAA 4JI4J 3ZVAA 3VGCC 3SV7A 4WYWA 4F04B 1X5SA 3O1LA 1OP0A 3UNQA 6CHAC 1TR0A 2BDIA 3I87A 4W98A 2EWHA 3G6YA 2CWXA 1WWHA 1WQVH 1K1IA 1O6XA 1QURH 3D6MB 3CCSS 2PI6A 4TYBA 3TUPA 3PTNA 5EW2H 3F68H 1RGQA 3OLBA 1EQMA 1XUKA 3PWCA 5AT1B 4CO3A 4ICLA 4GUXA 2H4YB 2GHVC 1L1GA 2PUQH 1IQLA 2O1PA 4BWJA 1G36A 2BXTH 1GHBG 2Y9HA 2DHXA 1NMWA 6LPRA 2M4MA 2OC0A 2DPEA 2PKAB 1QHRB 5K0HA 4RPFA 1MTUA 4LRCA 4C3MA 2AYWA 3A82A 1G2LA 4CLUA 1QL9A 3VG8A 5LL6d 1UHBB 2ZHQH 4JYSA 3QGPA 4ZVEA 2KO1A 3W3SA 4ZVHA 1UEUA 2JC0A 2GKVE 1O30A 1T05A 3LT3A 4JI0J 1S5SA 4OZJA 4H4OA 3KNAA 2AMQA 4O2TA 2ZBRA 3BH7B 3C15A 1C1CA 1H8DH 3L09A 1C9HA 1D3DB 5I98A 1U0SA 4PYDA 1J16A 3UR9A 1WI6A 3U69H 3O5MA 1E9LA 1O5FH 3SQOP 1S9GA 1E0FD 3KN2A 3PV4A 4N76A 1RCXB 3GJRB 1RFNA 4OGXA 4IC6A 3IK8A 4DUTA 5HKKD 3NCRA 4HGCA 3A7VA 1N4LA 2OUAA 1FFSB 3ZZUA 4K1TA 1V2OT 3PMHB 3LDXH 2CNLB 4IQXA 2YNAA 4QR0A 1C1NA 4IDKB 3U8TH 1GBKA 2G5NA 3DYAB 1KKHA 1K1SA 3LUYA 2JHEA 1BMNH 1EAWA 5AXKA 3MCOA 1SGFA 2VC0A 1HAYB 3G8SA 3I96A 4USIA 2QY0B 4P9SA 2C28A 2RVJA 4TWWA 5GAHU 1Q1CA 3QGHA 2M88A 2EC2A 1HPZB 1G7CB 1TQLA 3HP6A 2HSEB 1NKBA 2DGVA 3U28C 2GZ9A 1BRUP 2B7DH 4KV8A 1O35A 3UI6A 1FWLA 1YKTA 3BG4C 4BAMB 1PJ7A 2QZ8A 1KFDA 1IX5A 4DV5J 1O2VA 2UWPA 2XP4A 1NU7B 2ZDKA 2HZAA 5KFFA 3KAIA 2IJOB 3F3BA 4I86A 1HCGA 2LXUA 2KE0A 3QGJA 3V6JA 5IK2D 1J2VA 3LP0A 3PX6A 1Z4UA 1UCYE 3EJMA 4K3JA 2PD1A 2I1RA 3M1VB 3M7VA 1B0TA 1GGDB 1BHNA 1RTLA 2UU9F 2HGMA 1AWFH 4JI7J 1SSXA 4NA1A 1IQFA 3K17A 2HHVA 4EO8A 1Q81T 1OS8A 1P9QC 1QY7A 3GJSB 1HI1A 3A3PB 5GMDA 3THTA 3GY3A 2JRSA 4C3KA 5GAEU 3AJ2A 4EWTA 5LPEA 4OYOA 2FTRA 3W1YC 3KK1A 4IG0A 3JZ2B 1CJVB 3GIIA 4DQSA 3STJA 3Q3YA 3TJ9A 5AHGH 4CRGA 3QTOH 4YB1P 2BD5A 3LGHA 4ZPDA 3M05A 3CNQP 1S48A 2P93A 5GAEI 2JLGA 1HNIA 2AJ1A 4PXBA 4EZ9A 3UPEA 2DG3A 2OPRB 3AFGA 3MCNA 3GSDA 3FN8A 5CDFE 3GCHC 4DZ6A 1V3XA 3WIVA 3SFGA 2XP8A 3ZYEA 5J2NA 3NOGA 3IWXA 2Y1JA 1VDHA 1BB0B 3ET6B 2BEFA 2KHDA 4A8MP 1ZB5A 2FLPA 2KO7A 4PXEA 2GGPB 4GO7X 1S97A 4X4QA 1S6FA 2F1FA 4FPRA 1AA1B 4BCAA 2E7VA 3M5LA 4CTAA 3IRXB 3N6NA 3DFJA 3SFUA 1ESTA 2Y80A 2W2NP 3OJUA 2WSSD 3NMRA 4B73A 3IR6B 4XOJA 4F4KA 5A8RA 1M1KT 2A45B 1Q1KA 2QMWA 4ZP6A 5HM2A 3TLOA 1HWLA 4USVA 2ZI2H 1R89A 1C4Y2 3S9CA 2V0NA 3QQCD 1ZU8A 4EBCA 2BOHB 4LFBF 3C3LA 5L38A 4RSPA 2BM0A 3DRRB 1L3TA 4B75A 4FUGA 5K8MA 4DV3F 2MJNA 2R9PA 1E6NA 1UTKA 2B7CB 4BLGA 1FFRA 4M63A 2WUBA 1S1WB 2ZH6A 2IIHA 2XEXA 1WSRA 1DSTA 1L2EA 4KKDA 2ULLA 1C1BB 2BJEA 3SW2B 5LPRA 1MU2B 2GT8A 3BXWA 3EGKH 2WW4A 5BRRE 1HBNA 2BDPA 4LFBJ 4JFKA 1FY1A 5DP6A 5CXTA 1NSPA 1YPKH 1O6IA 1NM6A 4C7QA 4QCLA 2A5IA 3CJKA 2XTTB 2Y0SD 1P2IA 3WQWA 3MZIA 2AFQB 5DKMA 2JZ5A 4A5TS 5J1NA 4NZ7A 1QPLA 4I68A 1J6YA 1NZ8A 1FKSA 4FNIA 3TQEA 5CA5A 3OL9A 1QM9A 1Z1IA 1O39A 4PABA 3AA9A 4ZJLA 2ZG0H 1ESBA 2D74B 5T3HA 1D6WA 1Q16B 1VRQC 4A8YA 1PYTC 4NFEA 1W1PA 4IFYB 2VIHA 2WVBA 4XAKA 3F6UH 5DETA 2PI5A 2J9EA 2HWTA 2V68A 1F9EB 3FJ2A 5IWAJ 3NXPA 1BTXA 3O5JA 3WDOA 2ZHBA 3ITHA 1LWEB 3CE8A 5JB9S 2MQNA 4H54A 5DO2A 2B5JA 4ZLJA 2EK1A 2D2DA 5LM7E 3WD0A 4ZH8A 3KNXA 2OP5A 1KQFB 3Q8UA 2HALA 2F8HA 2CQ1A 3DOLB 1FN6A 4CRFA 1D7HA 4C98A 1BGXT 4USUA 2J8AA 3NCPA 4K0KF 2PMZD 4I31A 2RD5C 4K50A 1BHXF 4Y65A 4ECTA 4SGAE 2YMSB 3UQBA 1KT0A 2PTCE 2JOQA 1BQMB 1NMVA 2UUKB 3MCSA 3GB0A 2N4DA 4NWLA 2A2CA 1FJEB 2L74A 4NSVA 4Y0ZE 1FKLA 4F0KA 1FRLA 2ZO3H 4ED3A 1SMFE 1DTTB 1Y5LB 2ZDLA 4VGCC 3MR5A 2AHOB 3KUEA 3PRBA 5CHAC 4IH5A 4WP3A 3BN9A 5GPIB 1FD9A 1WEYA 2KAIA 3MMAA 4ED7A 1QY6A 1H9LB 1LHCH 1BITA 4WIWA 1SOTA 3QT6A 1RAIB 5GIBA 1P2KA 2P6TA 2C2KB 1FI4A 2GVZB 4LSZB 3OTBA 1QE1B 3SJKA 4NYOA 5IQQA 3R1LA 1O2WA 3MQKC 4I6AA 4ZCKA 1LHEH 3VR1A 1RKIA 2LXFA 4X8VH 2VG5B 1KDNA 4O3SA 1YLXA 3QWUA 4MNJA 1TBRH 3QZ7A 2X51A 3LTOA 4J9UE 4YS2A 3E01A 4Q44A 2RDEA 2P16A 2OPQA 5LMUJ 2Q1LA 2GCTC 5FHTA 1GJDB 4I8JA 1YHQS 2GJIA 3C16B 1MWYA 3IAM9 4OZ3A 1UFLA 2BOKA 1QNJA 1ESAA 4DFJA 1X5TA 3TI0A 1Y9OA 4KH0B 3FY1A 1YDLA 2ODPA 2QL9B 2RE1A 2XG8A 7GCHF 4X4TA 5DGBA 2PR3A 1LV5A 3SDEB 2CDQA 4DURA 1ZSJA 1C2FA 3GWCA 2X7IA 3KL6A 4CHAB 4ZJOA 4MFBA 1OQ6A 5FCRA 1AFEH 1LKAA 4DG1B 4F48B 3DRSB 5EQRA 3SYZA 5HQ8A 3AK5A 2QMUB 2W8KA 2BANA 3FAPA 1PBKA 2ROPA 1W7XH 8KME2 5FDLB 1R8HA 1IKXA 3MAAB 1YZ6A 4L75A 1HNEE 3PIPQ 2DGUA 3JAMU 4B3OB 1HAOH 1LPGB 2SFAA 1Y10A 2UWOA 4TU8A 5ESBA 1S1TA 4ODKA 2FJEB 3F9EA 1VQ4S 2CJAA 4DV6J 1YPJH 2L48A 1NB7A 2F40A 2VBXA 1Y5BT 2HWIA 4K60A 2GTBA 3H5UA 3R27A 1HAHH 2FMJA 5D78A 3A8JA 4RX6A 5GJ4B 1DICA 5A2QY 4OJ3A 1P0SH 1RT3B 4DUYF 3QIPB 3GFZA 4ZPTR 2HHQA 4DN9A 2BVXH 2QLFB 3SQGB 1G3DA 1TL3B 3M7QA 3DLEB 1FX4A 3ISNC 3ZZCA 2YBVA 1A0HB 3O5QA 1UJ5A 3LPRA 1R9HA 5HXFA 3K59A 1PPGE 5LJ3Y 4WCEQ 3AD9C 5MLCV 1THSH 5K8OA 4DV5F 1K44A 2HNTE 4THNH 2WHOA 4Z2IA 1Q5VA 3PR9A 3VB3A 3Q00A 2C8XB 1C0TA 1MAXA 2MZQA 3RFWA 1NUEA 1U47A 4ZCIA 1T9UA 2RH3A 2ZFSA 1C9PA 1FKHA 5DEZA 4UFEH 3BSOA 1QAJA 1GMWA 1CGIE 3DSOA 1DY8A 2FQQB 3GTYX 2HURA 2C4FH 1NDCA 4OS6A 1U8WA 3T29A 1V6HA 4NCGB 1HKJA 4NMXA 2RT3A 1CTNA 1WC0A 4MPWA 5G0RA 1V2VT 4ODMA 1IBKJ 1B64A 2ZGHA 2UUTA 3MH5A 2ANMH 3SU0A 1WAWA 3UDVA 3MR7A 1A0JA 2ABYA 3PRAA 3EWGA 2KZZA 2C2NA 5HLFB 1SJ1A 4PR6A 3F2GA 2YVSA 4XSKU 1FKTA 2SGDE 1CHOG 4EYIB 1GBTA 1TZ0A 5L9XA 2ZR5A 5DQIA 4JFLA 3KJVA 1IVZA 3KK1B 3LC5A 2ZQSA 1P1TA 2DR9A 1C2PA 1W12U 2XC0A 1O3CA 2PP6A 2FZKB 1QA0A 1T32A 3D1QA 3EZUA 3FRYA 4DRMA 2YKPA 3D62A 3KHGA 3TW0A 2BJ1A 1XUHA 4TVAB 1I5OB 2JZVA 1WF0A 5KOXA 4DLEA 1FDDA 1CHGA 2A32A 1H8IH 1N5YA 4YESB 4P02A 4NXMF 1ZTWA 3RBEA 3TU7H 3K7RA 1NJYA 4WK1A 1BRAA 2AH4X 4KGKA 1S7IA 3Q23A 2DNYA 4KHPJ 4GKKJ 4D3GA 4QIWD 2B9WA 2YMSD 1ZLRA 2HRTA 3M8SA 4W90B 1Q79A 2UXCF 2WK2A 5HYOA 1E6VA 2HFVA 2WPDD 4MQAA 3IR5B 2PKSC 1HJXA 4TW7A 1FVSA 3O5GA 1U1NA 2TRMA 2IF4A 1N52B 2JLEA 4LF4F 3A1YG 1D09B 3K5LA 1RYRA 1NJIT 1D3WA 4PXCA 5BXIA 1TAUA 3NAIA 3KQCA 1QL8A 4DN0A 4WMEA 3ARVA 1IJEB 3CCJS 7AT1B 1XNRF 1BTHH 5JBCS 5B0BA 1ANCA 3ZZ9A 5TCCA 3AD7C 3QAUA 4XPCA 2V4JA 2MQOA 1IJFB 1SLUB 1VQYA 4ECUA 1SGDE 1X6NA 2DIUA 2PV2A 2DRDA 3BS9A 2FESH 3RBZA 2NUUG 2QL5B 4HKQA 1TL7A 1R43A 1T9TA 1C1CB 4K5SA 5IT9U 3NPSA 4GLYA 4KC5A 1IBMF 2J92A 1CS4A 7FD1A 1MWZA 4UUWA 3H5SA 1IOEA 2BJ8A 4IW4E 2GC8A 1JNSA 3BEIB 1TNIA 1Z1JA 1KXAA 1MQ6A 3IKDA 1SLVB 3M6UA 2MEWA 3M32B 4DH0A 1K1OA 1AUJA 1QAXA 4I6YA 4IRDA 4AB8A 1ZPWX 4OZ5A 4YOEA 2GIFA 1SV5B 1FWKA 4UOGA 1XERA 2QSWA 2HNZB 4Y2CA 3DLBA 3PW2A 2BABA 3CNRA 1O2LA 1LXJA 2CHAC 4OYZA 2G2OA 1F3FA 2IUZA 3I6CA 3NRLA 4IPXA 3M6VA 1KVKA 1RABB 2VD3A 3ZZ0A 5IDKA 1PYTA 2FHJA 4DSIA 3LPEA 4ABFA 3HZEA 1ITPA 5T7LA 1ZOTA 3JYTB 3B82A 4A8SA 1SC6A 3WD2A 2RQKA 1KVIA 5F8JA 1YPEH 3CEDA 5H9FJ 4Z37A 2HBZB 1V2LT 3KDNA 1PQAA 3OTOJ 5DLGA 2HLDD 5A6WA 1MKXK 4JZDH 2HNYB 1C1UH 4ZS6A 1T02A 3FFIA 1IQZA 4K4VA 4ZKRU 1HB0B 2WINI 5KFTA 4EZ6A 1EX8A 1FONA 2B56A 3PNIA 1TU0B 3FQLA 3NGKA 2JH5D 2D3UA 1GQEA 1S0RA 1RACB 1D9AA 1KQGB 4NLWA 3IS9B 1FJCA 4J9QA 4CYUA 3BKFA 4TPIZ 2KZ4A 1TB6H 2LYVA 1T94A 3HK6B 2ZDPA 1HJ9A 3QAEA 1T8NA 3UR0A 1VZQH 4WXIA 4LF2A 1ANEA 4GHTA 3DHXA 4MTPA 3ZTRA 1KLMA 3TJOA 1OYQA 4QYZJ 2DH7A 2CPEA 1YG0A 1AB9B 2AMCB 3MO9A 4CM0A 2F9BH 2GCFA 1GHWH 5F8MA 3VAHA 3MR3A 1V3RA 1X0FA 1RXOB 3M8QA 4DX6A 4NLTA 3WD4A 4RW9B 5D4OA 4UD9H 2BMBA 4AQYF 1SJRA 3DOLA 2FHOB 3B9AA 2W24A 3N28A 2DB1A 3RB6A 3W2VA 1VK3A 1S1XA 2JKHA 1WBGB 3CCVS 1FRKA 1P03A 1JXLA 2WYJA 4MG3A 2DGQA 1S59A 3J80U 1NMEB 3K5NA 1GL0E 3BQ0A 1KLIH 3TCZA 1PYOB 3TA0A 2OMLA 4LAWA 4Z7CA 4ZPWR 3PXGa 2NXUA 6FDRA 5BJRA 1RD6A 1QJ1B 3AQOA 4LUBA 2KU7A 5LSLA 2XI2A 2GCHG 2K06A 4B9NA 5EX3A 1CJKB 5F3ZA 3BPDA 2NWNA 1P11E 3OE7D 1INCA 2VU5A 2QN6B 4ZCMA 4O4GB 4WIIA 3W2VB 1K47A 3QSYB 1WC4A 4CLTA 3BYPA 2DY1A 3AAWB 3TJAA 3BR8A 2EW9A 1U4BA 1XVMA 2O67A 3HJFA 1VLYA 3BDPA 3EYZA 2Z2YB 2EI8A 1FFGB 5DP7A 3JSBA 2ACYA 2CQGA 2V6AA