3PRDA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
total genus 36
structure length 223
sequence length 223
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prdA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prdA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prdA03
3IHZA 4JFMA 2LKNA 3KADA 4DROA 1D7JA 3UF8A 5HTGA 3JYJA 4O2TA 1FKIA 1NSGA 1YATA 2RUDA 2RSEA 2ZR4A 3KCEA 1ROUA 4ODMA 2PV3A 1J4RA 3IK8A 5HW8A 2M08A 2XP6A 3TC5A 1KT1A 1FKJA 4LAXA 4LAVA 3H9RB 2KFWA 5I98A 1FKRA 2MNTA 3NI6A 2Y78A 2PPNA 2JZVA 2ZQVA 2DG9A 3UI5A 1Q6IA 3KAIA 3NRKA 1D7HA 3O5MA 4JFIA 4JFLA 2K8IA 3MDYB 5DIVA 1B6CA 4ODOA 1KT0A 3JXVA 1FKDA 4FN2A 4W9OA 1BKFA 2ZQSA 1FKBA 3EY6A 4GIVA 2ITKA 4J4NA 3TCZA 4MGVA 2KE0A 3PRBA 2MLYA 1FKLA 1F8AB 1T11A 1FD9A 2XPBA 1W26A 4QT3A 4QT2A 3RFWA 4TYOA 4DRJA 1YW5A 4IQCA 2ZQUA 4ODRA 4IPXA 5BXJA 4DRNA 4DZ2A 2XP4A 5B8IC 1NMWA 4C02B 1FKGA 2LPVA 2RUQA 5HUAA 1FKHA 5GPGA 1QPFA 2N87A 1FKKA 2UZ5A 4G50A 3UQBA 2IF4A 1A7XA 4N19A 4TW7A 3JYMA 2VCDA 2MPHA 4ITZA 1P5QA 2Q5AA 3O5FA 1C9HA 3I6CA 4R0XA 4DRHA 2ZR5A 3WH0A 2XP7A 2PPOA 3UQIA 4J4OA 2XP9A 1QZ2A 3GPKA 1FKFA 3UQAA 2PV1A 3O5IA 3RGCA 1QPLA 3O5GA 1M5YA 3O5JA 5J6EA 1FJDA 3KAFA 3FAPA 1ZK6A 2MLZA 3O5DA 1BL4A 1J6YA 3PA7A 1HXVA 5HKGA 3CGNA 3O5PA 4W9QA 3TDBA 1R9HA 5DITA 3CGMA 4ODLA 2D9FA 3VAWA 2ZR6A 3B7XA 4LAYA 1FAPA 4ODKA 2MLXA 2AWGA 4TNSA 4IQ2A 3UI4A 3O5EA 1EYMA 5HW7A 2KO7A 3O5LA 1FKTA 2LJ4A 4W9PA 2XP8A 3KACA 3KABA 3LUOA 3IKDA 4TX0A 4FAPA 4TW8A 2MF9A 2KR7A 2RQSA 4DIPA 3KAGA 4MSPA 3ODKA 4ODNA 5DIUA 4ODQA 1F40A 1JVWA 2PPPA 4DRPA 4GGQA 1J4HA 4DRMA 2FAPA 4TW6A 4DRKA 4U84A 2KI3A 1PINA 3PRDA 2OFNA 2XP3A 4G2PA 4NNRA 4U85A 3KAHA 3KZ7A 1N1AA 1PBKA 3OOBA 4DH0A 1JNTA 4BF8A 1Q6HA 1D6OA 1ROTA 3O5QA 1U79A 2VN1A 4U86A 3UI6A 2M2AA 2M1IA 1NMVA 2XP5A 2F2DA 1Y0OA 2ZQTA 4LAWA 2PV2A 1TCOC 2KGJA 2XPAA 1Q6UA 4DRIA 2DG4A 2L2SA 2LGOA 2F4EA 4DRQA 2RUCA 2PBCA 3O5OA 4JYSA 5HWCA 4ODPA 4QIBA 4DZ3A 1EQ3A 1L1PA 4DT4A 2DG3A 2RURA 5HW6A 5HT1A 1JNSA 2FKEA 4JFJA 2F21A 1J4IA 1Q1CA 3IKGA 5D75A 4JFKA 5HWBA 1D7IA 3NTPA 3O5RA 1ZCNA 3O5KA 1FKSA
chains in the Genus database with same CATH superfamily
4P75A 1N8RT 3HKJB 1AY6H 5F0UA 2VPYB 3LH1A 2FJBB 1LXNA 2OCVB 2A5IA 1C1NA 1YC0A 2BHGA 2QY0B 1S1UB 2RNEA 2B0GA 4DFPA 3RXQA 4ZPWR 1NZ8A 1FRXA 2BZ2A 2HWLB 2QMUB 4LJMA 3PZPA 1WHYA 3VB6A 3PNIA 2XC5A 1TGNA 3NCPA 4X4UA 5HVHA 2ETNA 1EPTB 4GLYA 2OO4A 2DNRA 2FTRA 4N5SA 2YNBA 3EGNA 4C02B 3HULA 2AIRB 1ANEA 1PJ6A 1UTJA 2HBYB 1O2KA 2CZ9A 3FRYA 1AGJA 5JJBA 1O6IA 9RUBA 4HACA 1YJ9S 4GMKA 2V67A 3K5MA 4QR2A 2PMZD 4QQBA 3DI6A 3QN7A 2FDAA 5ETTA 5HMAA 1C1TA 4FYDA 1KQSR 1WF2A 4CLYA 4Z37A 3R8YA 2IPHA 1CSJA 1XMQF 1XNQF 1PJ5A 4AD6A 3HVRA 3TA2A 3PM9A 5J1NA 1N56A 2I5JB 4LR9A 1GI4A 1SC6A 4U67Q 4U84A 4DSJA 2F3JA 5FDLB 3LP0A 3SJOA 4DUZJ 2WBRA 3SHAH 1HYLA 3SV6A 3ZXWA 2MKCA 1ZTKA 1VQKS 4LR8A 4DZ3A 2ZVIA 4U8VA 2MZ1A 3FBEA 1Q1CA 3T5HA 1LWFA 1ZCNA 3ATKA 3ZZPA 3TVZA 4LR7A 3PIPQ 2RQCA 3EE7A 3KCEA 5A8ZA 1WTBA 3RG6A 1O5FH 3QIPB 1EB0A 2UVVA 1X7VA 2D8WA 1YRXA 1H2TZ 1V2OT 3ENSB 1JNZB 1GBFA 2R2SA 1LHGH 4KT0C 3O5MA 3K7RA 3ENAA 2PKAA 5GMDA 2YXLA 4AFZA 2G51A 1GX6A 1ZETA 3OTBA 2O66A 2NXCA 1W9PA 1LWEB 3ATMA 1K0VA 4WKAA 2VVUA 4KKOB 2XMTA 2Z3CA 3W94A 1FKHA 1TALA 2C8ZB 3M7UA 2WYGA 4FZVA 4AE5A 2Y5FA 5K8NA 4LVOP 3J7AN 1FKFA 4LRFA 2NU0E 4ECUA 1FRKA 1V3RA 2F9DA 1T8OA 2ZGHA 2F91A 4ASUD 5ETNA 3VB3A 3LPRA 3M6XA 4Y11E 3OTOF 2C1EB 3ZZOA 1SJ4P 4UONA 2BJ9A 4X6NA 4DX6A 4X64J 3F9HA 1T95A 1NROH 1VQ8S 2VASA 2RFKC 3O5EA 2RHSB 3IP0A 4DSEA 2HMIA 2BKNA 4NIYA 4F50A 4PR6A 3T62A 2EFNA 1CG2A 1WOSA 1O2MA 3GSIA 3PLBA 4MTPA 3DRRB 3TJAA 4AG1A 1JNTA 3SI4H 2L6OA 2J0SD 4LF5F 2BY8X 1S9EB 4TPIZ 1BRUP 3O5OA 5F8NA 3RMOH 1HHQA 2ZPSA 1S1VB 1RT4B 3CJ0A 1E15A 2OFGX 3J7A1 1T32A 3T26A 3G6VA 1LK7A 3N5FA 1SKSA 4BWMA 2UXBJ 4NCGB 1EJNA 2VG6B 5I3QA 4RR5A 3OFEA 1ABIH 4JYUH 2BQ3A 2AT1B 2GQCA 2Q66A 1C5XB 1O3NA 3UQOA 1XTZA 3DLHA 1P2IA 2AW0A 5IXUA 1YPLH 1UL3A 5DG6A 3HJFA 2GDDA 4YP3A 1YJTA 1OOKB 3M61U 1FWLA 3EXCX 3CPWR 4ZLLA 4I67A 3W95A 1NB7A 3B78A 4WXVA 3RXBA 3GLJA 2CKWA 2VA2A 2RD5C 3KDNA 1NK7A 2WOMA 2MXYA 5C20A 2XWBI 3DNCA 3P4UB 3KYLA 3VAJA 4H6SB 2FQQB 2FOMB 4KHPJ 3M3SA 4ECTA 2EK6A 2FGCA 2PT0A 5BXIA 4TNSA 1G37A 1IBMJ 4OZ0A 2FJWA 3BM7A 1EZSC 4OZJA 4F04B 1BWVA 3C16B 1INCA 3DCAA 1DITH 3SUDA 3JYTB 1HWIA 4I8LA 1B0TA 4DCJB 1ESTA 2HVXA 2VIDA 3UOPA 4A8QA 3AQPA 3H7HB 3OJUA 2EFQA 3L95X 3HGNA 5MAOA 1U79A 1W1PA 4PPDA 2LYVA 3E91A 3LALA 3EZ5A 1A5HA 3HFVA 3GZ7A 1X4GA 2I2YA 1ACBE 1VF8A 4RN6A 1BY9A 2J34A 3IWNC 4HDGA 2F8EX 2IMOA 2RAQA 3MM9B 3E01A 4URSA 2UZAA 1WKLA 4OZLA 5GPIB 1YZ6A 2GIQA 2TGTA 3K5NA 2VQFJ 1Y5BT 1O3JA 3UF8A 3ENQA 1BMAA 2WCXA 3FMBA 3IK8A 3KNAA 1NT1A 1NH8A 3VQSA 2VU8E 2NWNA 2W9AA 4ODOA 3FCWA 4D7GA 1QY6A 1FWKA 4R25A 2KU7A 4B71A 2MZRA 2FC9A 2RUQA 2J7UA 2NSCA 3DOMA 2FZCB 1BJUA 3ATLA 3SBMA 1Y3UA 2VDIA 2XMMA 3PFEA 1F9FA 2MQ8A 5KFNA 3D68A 4BAQB 1QZ2A 3N6LA 5IT0A 1GGDB 1ZRBA 2O01C 1N36J 4WXWA 2WYJA 4HYKA 3RAMA 3MMCA 3NGRA 1R9HA 1R0AB 1V2VT 3FOAA 1AO5A 1W0YH 3NWGA 2CPDA 1W0KD 4QYZJ 1NPPA 2F83A 4RO0A 5J2MA 4ISIH 4FF1A 1E6ZA 2FTLE 2FJDB 3MECA 4W5UA 2CPEA 1TK5A 2B4UA 1J9CH 2DT0A 2WPJS 3NGSA 4JI7J 2QA9E 4P8UA 1QD1A 1NJXA 3KK3B 3BH7B 4EEYA 2H2ZA 1M0SA 4LSLA 3RXCA 3AFGA 4NLXA 2M5YA 3MFIA 2LGOA 3OE7D 1T3NA 5KFJA 5IS2A 2VJUA 4NZCA 2FZGB 4F3MA 3D6FB 1C2FA 1JKHB 4RW7A 1GHYH 2KN4A 1S6HA 1S6QB 2A7CA 2K3IA 4FYYB 1JIHA 3AOAA 1IKWA 1FKAF 2E5IA 2ZGXH 1VHIA 2BRKA 3M5OA 4KGXB 1K1OA 1O3BA 1C5TA 2FVPA 5FPTA 3MR2A 2ZPQA 2I0XA 1E6YA 1FXYA 1O3GA 4NZ0A 4TSFD 1FPCH 2TPIZ 3M7VA 1Z8JB 3GIRA 1SGTA 4ZVOB 4J2YB 3MURP 2HYIB 3SJIA 4KP0A 4DV4J 5H1SV 1GL0E 2KCPA 2NS1B 2THFB 2H4WB 1IWGA 4ETZA 2OD4A 1RAOA 2TGPZ 5I25A 1GXLA 4F8RA 3CWJA 1A0OB 1OY6A 5E3RA 1BCUH 1QRWA 1WDDA 2BRLA 1IKYA 2ZHFH 1NHVA 3AAWB 3URDA 2VPXB 2ROPA 3QFHA 1U0HA 4EBDA 1YLCA 1CBKA 3R0FA 1O2GH 4UY85 2R7UA 1GBLA 2YPZA 1AUJA 2ZU1A 1S49A 3W1YC 4HTIA 2OK5A 2G1HA 4Q7YA 2ASUB 2PFDA 1DFDA 1RACB 2JH5D 1U47A 1YJ7A 3T5FH 2BXJA 2KH9A 3PW7A 1LWFB 2DSZA 4WP8A 2YKOA 2FVSA 1JLBA 3BTKE 3GOVB 1EB2A 3BYRA 4GCHF 4LRAA 3LC5A 1F2HA 4ELTA 1QSSA 3UQVA 2WTFA 3CCWA 4JZIA 2HGMA 4KGAA 3WHIA 3OW2R 1KXFA 4NE9C 2E7WA 2UWLA 2Y82A 4Z2HA 1G2LA 3MWBA 5J2PA 3TNVA 1OYEA 1CGHA 2ZEJA 2VVCA 3DM2A 1QB1A 1NESE 3K5PA 3CCQS 3PMAB 5EG4A 1LEOA 2KFWA 1MKWK 2W4DA 2OJ3A 1BE4A 1O51A 1C1UH 1N33F 1KWMA 1SV5A 4C4WA 3OLBA 1N1LA 1FDNA 4AFSA 4F0KA 1PPHE 2AZ1A 3JXVA 4I2QB 3AVZA 2E1RA 2R8HA 2XOKD 1RDRA 3O1LA 5CCMA 5KFHA 5EQQA 1YP9A 2IDLA 2BW2A 2LVWA 3W1EA 2B51A 3UD4P 2O1PA 2BD8A 3AJDA 1BTZA 3F0OA 2OINA 1HBMB 1KY9A 5FCRA 2WBMA 4OI3A 3MR5A 3TA0A 1BC6A 2H54B 1A5GH 1FJDA 2VGCB 4J9LA 3MH4A 3NL0A 2MTLA 4P73A 3HKWA 4X4NA 1NWSA 3PCOB 4DV2F 2KG0A 3PHTA 2IMWP 1U1NA 4WU3A 3EVWA 3WX4A 2IDEA 3LUOA 1YKTA 4H4FA 3BGUA 1GK8A 4TY8A 4ED2A 4NXMJ 3MMBA 3W2VA 4NFEA 1GG6C 4OQJA 5KG1A 4Z2LA 1HNVA 3FKBA 1TAUA 5M2RA 1W0ZU 1SJFA 4NYZA 1ZLRA 3WQPA 2MYFA 3CSKA 2W2NP 5KFGA 1GJ4H 1JLQB 3G01A 3V6KA 2VFTA 4J9UE 3ZYEA 3WD2A 1SJ3P 2NYHA 3LPEA 4SGBE 3V4MA 1M5HA 1AFJA 2FHOB 3H9RB 2G13A 4F0MA 4K8BA 4Q5VA 3CHFA 3MZIA 4FUBA 2R2TA 3SZEA 1BUXA 1ZZNA 4R8TB 3BTTE 2AMCB 1B7YB 3KXDA 2DUCA 1TWXB 1VRTB 1TPSA 4W92B 1PGZA 3EUNA 4DN9A 5ETXA 1NSPA 1FDBA 4QOTA 2O67A 1IQTA 3RB4A 2QFIA 2MZTA 4Q44A 3Q76A 3CO9A 2Q5AA 3WH0A 3Q8SB 4J4OA 1SJ1A 1TONA 1QPLA 1WYKA 3FAPA 2G4TA 3CO0P 4F36A 2HQ3A 1VJAU 3CGNA 1CA0B 4YY3F 1V2MT 3SIPB 1C4V2 1H38A 2HQGA 2CNKB 4YHHJ 1TA6A 2KXHA 2XCAA 4W9PA 3IKDA 4KPCA 2HKEA 5KFXA 1EQ0A 1O2RA 4KV8A 2DO0A 1RAAB 1Q7LB 4ZKSU 4E0DA 2OQUA 1F0RA 2DD8S 4K0KF 4K4ZA 1O32A 3AXKA 1RGQA 1ELCA 1YM0A 4F48B 1TBQH 1SGNE 1MN7A 2J6UA 2GD4B 2FOGA 4XBCA 4ABIA 1TE0A 3MEEA 5C2GA 5HQMA 3BIUH 4INHA 3SO3A 4JI4F 1DTTB 2BANA 4K4XA 2LFVA 3FNNA 1F0UA 2BJ3A 4DROA 1WAYB 2Z30B 2BD7A 3T3FA 5ETPA 1QL7A 4MPUA 1ROUA 3L6PA 5CAAA 2A32A 3ET6A 4M9FA 3DOMB 2CQPA 3SFUA 2HQDA 1KTSB 2CYYA 2H5JB 3EDQB 3AXMA 3DMJA 5EPYA 1XMOF 2FVCA 5DIVA 3QT7A 2ZIQH 2HZAA 4X1QU 2HSEB 1DWDH 4OI4A 1NU7B 1SKYE 2D1JA 2MLYA 1A2CH 3MMCB 2SGDE 2YQ0A 1SB1H 4BNRA 3ENWA 2J9EA 2L9DA 5E33A 1J5EF 4K4TA 1PPCE 1IKXB 4CRJA 3KMQA 4Y8ZA 5J2MB 4DR3F 1RAJA 4AXIA 1C9HA 1ARBA 5CQGA 3N5BA 2VHGA 2R9PA 2E1AA 4OHYA 1A0LA 2IM0A 3P92A 4YFUA 2AMPA 1QVGR 4ZVHA 1LK5A 2D2DA 1CBWC 3QTVH 4LF6J 3HXMA 2Y80A 1C5OH 1KXEA 5HATA 1I51B 3T1HF 1CLFA 4AYVB 2GTBA 3MU4A 3BN4A 1URNA 3ZZTA 1HJAB 2FXRA 4F55A 2JH0D 1QSYA 3QX5H 2FAPA 4IG3B 3VGUA 4RW7B 2CGAA 3I4PA 3NMRA 3MD3A 3QQCD 1YBAA 3KUEA 4CNZA 4BBYA 1OPHB 1IKWB 3PWCA 3AD7C 2CQIA 3PRVA 1S1XA 2AWZA 2YY3A 2P6SA 3VAMA 3SQHE 1OS8A 2KFZA 2WPLS 3KLFB 3US5A 2BABA 2AH4X 5HM2A 3LGMA 5EXMA 2OEKA 4KFBA 1DUEA 1VI7A 2GZ8A 2YNFB 3Q23A 4NXNJ 2NR0A 3CNRA 1E6YB 1PYTD 1FY1A 1TNIA 4DX7A 4WKRA 1LWCB 2CPXA 1MH0A 2ZR4A 2ZKSA 2FVRA 1NRQH 1UETA 4KYZA 4IKAA 2BYAX 1DM4B 4Z0KA 4WTYA 2PPNA 3PR4A 2E9TA 3UI5A 1C1PA 4E06H 2DBBA 4DQQA 1MBQA 3BMBA 4P00A 1DBDA 4FN2A 3PO1B 2XW9A 3WWFA 3I9ZA 1MMLA 1HWLA 4USHA 2J0QD 3RRGA 1PYOB 2Z9LA 3OR1A 1CVJA 3F2FA 4Q7XA 3T1YF 4ES3A 1UMJA 1BITA 1T3OA 3FSXA 2H9HA 1ZTWA 1FDDA 3I6CA 1D6RA 2M8HA 1JLEA 3O5GA 1VQ9S 4L75A 4JI8F 3UR6A 4NWBA 1TKDA 1F5CA 3F41A 1HNZF 3BQ0A 4B76A 1JLBB 5A2QY 2DVIA 3E3XA 4E98A 3HX9A 4BANB 4FUHA 3M6WA 1Q16B 4I86A 2ESCA 1EJMA 3QJPA 3EICA 2K1RA 2RU9A 4N56A 1PC4A 3BPSP 3KHLA 2NUHA 2PFEA 1MU8B 2F1FA 1G3EA 1RYRA 1S4FA 3LT3A 1Q78A 3PTBA 4ID5A 1L3UA 1QY7A 2CXEA 1WC3A 3DRPA 2HNYB 3TUIC 2P4VA 2LEAA 1FRMA 3MFHA 2V3MA 2J8AA 1F0SA 3N01A 4IN1A 4CLWA 2OD6A 4ZVTB 3NMAA 2Z3EA 1SL2A 1F1BB 2FKEA 2VG5A 1RYSA 2M3DA 3HD1A 4F4KA 2PUXB 4RLEA 3O5KA 2DYAA 3U1IB 1VBZA 4RT1A 3NAHA 3JYJA 3W9HA 2DNMA 1F0TA 1ZJKA 4LAXA 3FFIA 3PW0A 3WC0A 3VVTA 2GV1A 2YVSA 5SUHA 2B8QA 3DHKH 3QLHA 2RDIA 3EE0B 1VITH 4RW4B 3M35A 1JXEA 1OYQA 4IT6A 1ELFA 1RQ0A 2A6OA 5KFRA 4IO1A 2JJ4D 5DS7A 1NBME 1REGX 2UZ5A 1S99A 2HK3A 1QIXB 1VK8A 4TY8B 2H48B 2W24A 1VRUA 4G65A 1U4BA 2V3OH 5E3AA 2HBRB 1XR6A 1NO8A 1HNVB 1WHXA 2ZR6A 1T9UA 5ETSA 4ZVUB 1WORA 4O23A 1MSWD 2MLXA 2Q43A 5A2MH 4Y28C 2V94A 1S83A 4O3OA 2V8PA 5EJZA 1NPRA 1YX2A 4V1Ak 1ZM4A 4ID8A 3K2YA 2G81E 4DY7B 4HI2A 4TW6A 3KJNB 4UZCA 2QGRA 3SZ2A 2VIQA 3EZUA 3A13A 3FK4A 1WC5A 4ILRA 2UV8G 3KLIB 5DQIA 7AT1B 1U1PA 1P2QA 3H09A 1TK0A 1D9AA 4MK8A 3KQBA 3VALA 5HK4A 1Y3VA 1X31C 2R7RA 2JH6D 3RR8A 1BHNA 3B4DA 4OL8A 1GI0A 3QDZB 2VC0A 2GVFA 1WF0A 4LBIA 6FD1A 3RM9A 4U95A 3FSIA 4WBFA 5J2QA 3BSAA 3NI6A 4P8WA 2XNIA 4B08A 1SH2A 2Q6DA 1DUAA 3RXIA 2GA7A 2F4LA 2D7SA 1FKBA 1UZDA 4EWTA 5HAOA 2BOAA 9LPRA 2W7UA 1O8BA 4QT2A 1DT2A 4DWIA 3C1KA 1RU2A 1H2VZ 3RC6A 5C42A 4Y3CA 1O38A 2TBSA 4GCHG 1OY9A 4K3JA 4MPVA 1IWAA 1NN6A 4NCAA 2ESTE 1WUNH 4F49A 1Y3KA 5DG8A 1JXVA 2VIWA 4HI1A 4UOFA 1H8ED 2RILA 1L3KA 2ZBQA 4P72A 4KV8B 3I9V9 2ZH7A 5L46A 3JB9k 1O5AB 3UAIC 3J7ZT 3HSDA 4NZLA 2HS3A 5ESTE 2V2KA 1NDCA 3D23A 2UUFB 3D1HA 3CZ8A 3NCQA 4LF5J 3UNQA 4ED0A 4VGCB 2AIPA 3QAUA 1LKBA 4O44A 4U9RA 2BANB 2R3VA 5EX0A 2FODA 4Y8XA 1COWD 3MH6A 5D0GA 2HWIA 3GCXP 1XXDA 4DRQA 2L48A 3DMJB 4D3GA 3SNAA 1QA0A 4UE7H 4YLQH 4C8OA 3NTPA 1RWOB 2OI2A 1MTWA 3IHZA 1N6XA 1JQGA 1G2MA 2ASDA 5GAGU 3RM4A 1XR5A 3PXGa 4FU9A 2RUDA 4XO0A 3F0NA 1R8BA 3UWIA 1XNRJ 1SGQE 1MNEA 3SXLA 2V9KA 4JK6A 3QZRA 2B9LA 1C5QA 1XVMA 3CC4S 1HWJA 4C98A 4ECQA 1JB0C 2E29A 3HSGA 3RXJA 4DL4A 3RXOA 4R8UB 2FY8A 4ERDA 5DO4H 2CG8A 2W2MP 1XERA 4C3LA 1D9IA 2PSXA 1LDTT 1DY9A 1KDQA 1P9QC 2QX0A 2JLGA 2Q6CA 4PQAA 3ZTPA 4PYAA 4I6YA 3BTQE 1S1WA 3H5UA 1P02A 2E66A 1YVFA 3ZVAA 4M95A 3O5JA 4OYOA 5IC4B 1F3VA 4O4GA 2DR5A 1KSNA 1E9LA 1UPMB 2ZE2B 1QURH 4INLA 4A1VA 4DLGA 3KK1B 1KLJH 4Y34A 4K2JA 1VCTA 3M30B 2HZVA 3SGBE 1YZ7A 3ESTA 2G52A 2PSYA 4I8JA 3G6MA 2BM0A 1OWXA 2LMIA 3EZOA 4ANEA 2UXCF 3A7TA 1GJ7B 4KFBB 2ZBIA 1WI6A 3BSNA 3KJQB 3QGGA 1ZR0A 1AUTC 3BS9A 3E0PB 5C0TA 1BQMA 1CJUB 2VGCC 1MAYA 3QGHA 3FEXB 4N8OA 3MM8B 1W12U 4OZ5A 2F21A 3CS7A 4X8SH 5C5OA 5HWBA 5A76A 4OS5A 2XSJA 4NI2B 3UN2A 1HCGA 2IJOB 1F9HA 4FPRA 3SORA 1JLCA 2WK2A 3OR1B 5KG5A 1LWXA 1GDUA 3BKTA 3SSSA 4CLZA 3GY2A 2D26C 4Z2XA 3OT9A 1JLEB 4I6WA 1PPFE 1TA2A 1O37A 3ZZUA 1H7XA 1S85A 4MNJA 1FUJA 1FK9A 2Y1RI 7GCHF 4CRCA 3SQOP 4IPXA 3ALGA 2HHWA 1LOUA 3J7YI 2K0QA 2YBTA 3HDSA 3JZ2B 3DLEA 4DVAU 3MPVA 1UMAH 3D6HB 4C8LA 1GVLA 3OSYA 2XO7A 3UDVA 4URGA 1WC6A 5D78A 4ID5B 5EUHA 4ODLA 1QTNB 4TYAA 3H7TA 2R7WA 3M7TA 3HHNB 3B9FH 3KG4A 2OHDA 1OYDA 2EFOA 3NS5A 1Y8TA 2EEKA 2V4JA 2XULA 3FXYA 2ZOGA 2LU2A 2DXDA 5IOLA 3MNXA 1WQSA 2YKPA 4E8UA 1T9VA 3UNGC 2PE8A 2EEYA 3HCXA 5C25A 3V4IA 1RAFB 1SBRA 5A8XA 1B99A 2F2DA 1O3KA 5J2NA 1C2KA 2FVQA 3D3CJ 1WC4A 2AU0A 2F4EA 2CJXB 3F1SB 2YKMA 1WJ9A 1CA0C 3A7VA 2SGQE 3QLHB 4FF4A 1RAGB 5L1IA 4X6PA 1CT2E 2LKNA 4MK7A 4URIA 5GADU 1KHVA 1S0QA 1T02A 5GQBA 2C93B 4BC7A 3GSDA 3PEJA 3WZ0A 1VIXA 3UE2A 1QUPA 5H9FJ 3M32B 4ZVFA 4JFLA 3CULA 2N7YA 2ZQSA 2C28A 4U96A 5GADI 2HVDA 4NPOA 1NRNH 4MNMA 2ZG0H 1X60A 4RBTA 2ZQ2A 1O3HA 3GCNA 1TR0A 2QMXA 4UW2A 4OYXA 3EA8A 2PI4A 2AGOA 3FVFB 2FLBH 3CIMA 5ETVA 1QPFA 1WC0A 5CD4H 4A8MP 4LREA 3MO3A 4KIAA 4LQ9A 3ITIA 1FY8E 5LJ3Y 1H98A 3O5IA 3TUZC 2QEXS 3HVTA 1NH7A 2WLZA 3BBCA 5FIIA 1Q0NA 2SGPE 3SJ9A 1P3CA 2ZZTA 4PG7A 3FFGA 4KGMA 5HI7A 4OI0A 2YQ3A 1LW2A 3ZVDA 1KEKA 4TWYA 3NRBA 2RA0A 5A8RB 3IS9A 4IFYA 1AYEA 2IC3B 4C3KA 1MMDA 3RC4A 1GCTB 5GPRA 1VISA 1GMDF 2W7OA 2HIYA 2M0GB 2ZDLA 1PYTC 5K20B 3EA9A 3LA0A 5EU8A 3PTWA 4LFAJ 4DQRA 2XGPA 4DGJA 5CA5A 4AORA 1HRTH 3ZZ7A 2G5VA 3WIUA 5KOWA 4M5DA 1N33J 2OTLS 1E79D 3OYPA 2EC0A 1QVFR 1LFPA 2QIQA 1GJDB 2BMGB 4QW8A 2FC8A 1HJAC 4H4MB 3TH2H 3LWMA 3RDZA 3D4JA 4DG1B 2LA4A 3W8PA 4H4KC 2K2PA 3V6DA 1T9TA 4M1KA 4X2VA 2FJAB 2FIRH 1G30B 2OMLA 4YDDB 2NYIA 1NJYA 4Y2IA 4F3OA 4QT8C 4H6TA 3RXVA 1E36B 4DL2A 3MMAB 1HYSA 3A8IA 2KDOA 1V6DA 2OPSA 4DV2J 2U1AA 2HNTC 5L6NH 3RU4D 4ZLNA 1XBWA 3FAOA 1TL1A 1HI1A 1GI7B 3BREA 2LXFA 2CQDA 3LQVA 3UDLA 3MU5A 2EC2A 1BHXB 3IC1A 2J8SA 2PLXA 2IYIA 3D49H 4DWSD 3VFEA 2UUCJ 3OBIA 2J98A 3LKWA 4JV5J 1QJ6B 4M5KA 4KSEB 4X4RA 4Q2LA 3D0HE 5KFLA 2FMJA 1FVQA 3ARUA 3WD0A 3LP1B 3NGDA 4G2PA 3IA0A 4FUEA 2GAGC 1TMBH 2WLYA 4ED4A 5DGJA 3NUMA 4RNMA 1P04A 4KRWA 4HH0A 1NRKA 4ZN3A 3LGWA 1LVMA 2AYMA 3HM9A 1DRZA 3IMQJ 2W9CA 1JRTA 3CHDA 1OSSA 2Z94A 1B70B 1EQ9A 3RB3A 1ELEE 5L9XA 2FDMA 1HQ2A 4DZ6A 4WKYA 3OTDA 5F03A 4CO2A 2VKRA 4HFPB 4A8KA 2ZUAA 3SV7A 1V5VA 1O2WA 1KDQB 1DTQA 4P8XA 1GXTA 2XMUA 4ZJQA 2ZQVA 4U7UK 4XDDA 2W6JD 4IQMA 4HLBA 1TQ7B 2IIHA 2BVZA 2A2QH 1DQAA 4ZLPA 1NFUA 2O8UA 3SHCH 3AHPA 3TVKA 4O4GB 2WSSD 3ZZBA 2ZU3A 1PAEX 1FNXH 1RE1B 3OUYA 4JI0F 3TQ1A 1FKKA 3HSZA 1Z8GA 4YY3J 4Q4LA 3SSQA 5F8GA 5KFFA 2PMHA 4HT5A 3TJVA 1RT1B 3WIVA 1M5OC 1YGCH 3AOCA 1K28D 3NGTA 2GV6A 1WI8A 1BL4A 1Q79A 5ETQA 1FLEE 4MKVA 2HFVA 5EHHA 3G6YA 3ZNJ1 1TMTH 3C3LA 2VG7B 2JWNA 1GMHF 2XBWA 1RUSA 1BQMB 3EYZA 3DLBA 1BBRE 3E3TA 3SV3A 1IQLA 2NPIA 5B08A 2W2QP 4ISOA 5EWEA 4K0KJ 3GY5A 1VCWA 2OH2A 4RJVA 5KFBA 1LQ9A 1TUGB 3QWPA 2XSJB 4X1RU 4OI2A 1GL1A 2GVZA 1GJCB 4WFNQ 4JI4J 1ZGIA 3W60A 4J9PA 5DDRC 3RXUA 2KT2A 1ELTA 3STIA 3THPA 5LXYA 4ODPA 4DT4A 2OEJA 3AOBA 5IM0A 1RT3A 1LTOA 5CZVA 1VQ6S 3FUYA 1CE5A 2AGGX 3M2VA 1PQAA 6FDRA 1D7JA 3CCTA 3T19A 1XMOJ 5T7LA 2O3DA 1UVKA 5HW8A 3ATWA 4DZDA 3GDUA 1VOMA 2IOTA 2XYPB 2FPHX 3JTOA 1OWHA 1FNMA 3POTB 1QDUB 3AH6A 4I7FB 5EWFA 3TW0A 1JJCB 2ODYB 1MKXH 1HAVB 3Q8VA 3I31A 1C1OA 4PXCA 4NA3A 4JV1A 4Y2KA 4A6LA 4DR5J 2PMWA 1DURA 4Q7ZA 1ARCA 1JRSA 1SQRA 1CJTB 1NMWA 2DGVA 3GDVA 1KLMB 3T5LA 4NG9H 1Y3JA 1A0JA 2WVFA 1BRBE 3HT0A 1XIQA 1T8MA 2A4OA 4A8YA 1P8VC 4NZ7A 1PG5B 2J2UA 2SGAA 2OMOA 1HNXF 1ELDE 2G1DA 1UFLA 3T1HJ 1P0SH 2VFUA 2ILZA 3AD8C 4X4VA 3URCA 3AJ2A 1ID5H 3V4IB 2JEIA 3KHVA 2QA4S 1GQEA 4N76A 2YMSD 5HM9A 1U6FA 5J2NB 3DLLQ 2WSCC 2J0WA 2I6SA 1S7IA 4ZPDA 4B3OB 1FFGB 3RB0A 3AS0A 2ZWLH 3CHEA 5IWAF 4DR1F 2VFSA 4WH8A 1GBBA 4GGQA 5CYMA 3MR6A 3MU8A 4I2PA 5E2OA 4K50A 4Q7NA 1VIOA 5C0UA 4B9VA 4LSZB 4U6PA 2ZGCA 4A92A 3OVBA 4WIWA 1PAUB 2FLNA 3H2LA 2IJNA 1NJIT 5F9NA 2VC1A 3BR8A 3TGKE 1A6LA 3E1XB 4BAKB 1C9PA 3PX6A 4DR7F 4C8NA 5E2QA 4YUDA 1ZOTA 4ZHMU 4JZ1A 3CJSA 5A2QU 5JB9S 1HWKA 4NIXA 2WVDA 4MH8A 3UDCA 2ZGBH 1JJ2R 2XZDB 3K2UA 3QRQA 4VGCC 1IHTH 3S7KB 2BACA 3T1YJ 3WD3A 4JI1F 1N8OB 2EFVA 3GYNA 1VGCB 5KFYA 3E51A 4M8LA 3ZTQA 2LEPA 4QR0A 1W2IA 5HROA 2PEHA 2JVRA 3H5CB 1C4Y2 2AV5A 1TAQA 3DD2H 2XS2A 1P2MA 2QA2A 4LFCF 3JS9A 1TRYA 2RQ4A 3Q24A 2HLTA 4ZP6A 1NO9H 2R42A 3I56S 1ELAA 3W7BA 1UW7A 1ZSLA 5E5NA 3CD6S 3GMGA 3IS9B 3PDNA 1YIJS 5DQHA 3BH6B 1BMQB 1NM6A 5F6MA 1EAYC 5JDUB 3U9AH 3D7SB 3SJ8A 1RP5A 3QMQA 1ESAA 2FO9A 4ODNA 5L38A 3AT1B 2PFFB 3MM6A 4M5DB 7GCHG 2OFNA 3PRAA 2A1BA 4B3TJ 4LRCA 3IWXA 3PJWA 3RYLA 4LAWA 5L8RC 4JB8B 1UFWA 4N7TA 1W10U 3I0SA 4U01A 5CMXH 4CYUB 4TQSA 3KG0A 3GDSA 3BQ2A 2XY5A 3V6DB 1EB1H 3TK6A 2F9PA 2FWWA 3LGUA 2QRRA 3U98H 1TL3A 2FHKA 2WUBA 3C6TB 1XX9A 3ELAH 3E8LA 4ESTE 2BJ1A 3UN5A 4ZS6A 5ITHA 4ABAA 1W3CA 2BDCA 2DG9A 1ZOMA 1HBUA 1UVMA 3MAAB 1CVWH 3RP2A 1ZMNA 2OPSB 5B0BA 2LQBA 2W7AA 1RB0A 3IRXB 4GSOA 3CH9A 2BLVA 3G6LA 2FS8A 5D4NA 1JLGB 1QM9A 1YK9A 4H42U 2J98B 1ELOA 2NXEA 1D09B 1FX4A 1KONA 1DY8A 1QNJA 1GBHA 1RLCL 4DL5A 2VKZG 4PG5A 3TRGA 3AS2A 2FJEB 3O6QA 1EIBA 5DP3A 3MM7A 1C5UA 2ZBPA 1D3DB 2D1CA 4FKYA 2HBZB 2MQOA 2CPJA 5B6OA 3L7UA 1O33A 3B8SA 4IOCQ 3VQTA 5K9FA 1U8SA 4C6AA 4M5NA 1RHQB 1O34A 5AXMA 2GCTB 1DOJA 4M5GA 2YWHA 4DIPA 1NFYA 3MTYA 2Z4PA 2W9CB 4IC5A 1RWVB 4EK2A 3F9FA 1W13U 4JI2J 2KKHA 3RUBL 2DY1A 5E0OA 1P57B 1QL9A 1FDAA 1XUGA 3V0XA 5DGAA 3VAGA 3RUOA 4YM9A 3ZTRA 4KE5A 2KZMA 1F7ZA 4L3KA 4JI3J 3TO8A 4L76A 4BXWA 3RRKA 3SNCA 3CC7S 3BTGE 1QJ7B 5A0BA 4OHWA 4URQU 1HI8A 3OUYB 4DL6A 4B1TA 2JEJA 3WIJA 4QIEA 3K58A 1V2TT 3RGIA 4C11A 1FRJA 1ZSJA 2Y3YA 1GBTA 4C0HA 1TKXA 3Q3XA 4PZVA 5F9LA 4D7FA 4ZIWA 2RF2B 3DCLA 3WD1A 2DT9A 1ZAXA 1GMDG 3MMJA 3VZHA 2E7XA 4DHVA 5BR8F 2EBGA 3TEGA 5BXJA 2EK1A 1E1QD 3M8PA 1K9OE 2ZHDA 3UY9A 3VAIA 4CTAA 4IFVA 2C2EA 2NCKL 1C1CA 3F73A 5LH8A 1FF2A 3F56A 2FM2A 2XLKA 3BF4A 2BKPA 4PUOA 1H73A 4P10A 4JP8A 3EA7A 3PW4A 4PG6A 2OELA 1ZGVA 2HNTE 3OL6A 1BQNA 2ZH2A 3FZDA 2XEXA 2QL7B 1B64A 2X51A 4P6QA 1N52B 1TZ0A 5A0YA 2I9SA 1RT3B 2XSFA 3W62A 1S77D 3DOLB 4O0NA 1YG0A 3G4SS 2ASYA 2V35A 4UY8T 2H4YB 5CYJA 1PINA 4UT4A 1OPZA 3KAHA 2JX2A 3TJ9A 3NXPA 5T7LB 2DGWA 2ZDVH 1P01A 4ZJOA 1MWYA 1EZXC 4KPYA 5GNDA 3IWLA 4TY9A 3KJVA 3HZEA 3FCVA 4KJIA 1AN1E 1EQ3A 2NU3E 2ZEBA 4A8SA 2FLPA 2D3OR 5DM7Q 1O3DA 1YBUA 2DK2A 1O3AA 3I32A 4K5RA 2C3YA 2VF3A 4O2TA 1BQXA 1ZM2A 1HQUA 3BSCA 2FYRA 2J95A 2B5JA 4ZHRA 1WF1A 4HG6A 3JSMB 2W3KA 3ARPA 1WDIA 3DHXA 4PWUA 2CPZA 3GJSB 3ELHA 1CULB 1S4EA 3A83A 4YLUA 1SJRA 3SU2A 4MLFB 2KCYA 2HNZB 2PO4A 1TGBA 1KFWA 2DCUB 4FXGH 1EATA 1GI2A 3MO9A 1EZZB 4MPXA 1K0HA 3H20A 1VQLS 2ZR5A 3GG1A 2RQKA 2DXFA 2FI3E 2BM2A 2EW9A 1OQ6A 1AU8A 2HNDA 5CYMB 1UA1A 3PKYA 5HP1A 2PR3A 2UXCJ 3QTOH 2CDQA 1ZYOA 4CH8B 1NLKL 3KACA 4YT7H 1RHJB 3CJ2A 4F4XA 2HHHJ 4YQWA 2KHCA 4DV7F 1A61H 3K17A 5KFUA 3MTJA 4ATNA 4R5EA 3M4XA 2HALA 4DWSA 1BBRH 2M2AA 4FDFA 1MBMA 3X1LB 2J4IA 2L2SA 1BDAA 2L9WA 1THPB 4Q80A 3SU0A 2ZKUA 3EQ0H 2DKOB 4WU2A 3VGTA 5IZHA 4Y7BA 3CCSS 1E6NA 1O2OA 5KT2A 2D69A 1A4WH 5AVDA 4OYAA 1YJUA 3HF5A 1T05B 1NSGA 1GMHG 5H9FK 2CHAB 5GJ4B 5HROB 1U09A 1LO6A 2YOLA 3Q00A 2CPFA 4PPZA 4WKHA 3SV8A 3DGPA 2E1CA 1O0DH 1BKFA 4A1XA 3SYJA 2UVRA 3TX8A 2JH3A 3Q83A 1H2UX 4ICLB 2BDBA 5G0RA 2A7HA 2KM8B 4N19A 1KP6A 1AFQB 3VB7A 1BQYA 1BT7A 4HHHA 5FL7D 5CZXA 3MM6B 3RXTA 3UN3A 4J9KA 5LM7E 3CJ4A 3D6TB 4DV1F 5D6GA 1ZHMA 3B8JA 5KT6A 3M5LA 4FAPA 3FSYA 5HN0A 1FFSB 1K1SA 3I5CA 4HGCA 3S7RA 1UVJA 4FUGA 1YJNS 2W2PP 4QIVA 2NXUA 2DRBA 1MTNC 1LQ0A 2KI3A 2KB2A 4X6MA 4ES1A 1LVYA 2BYCA 2HHTA 1TL3B 3E8OA 1QAXA 1TCOC 1FI8A 2Q1JA 2KGJA 1X4HA 2DG4A 1OYTH 4NLRA 1FESA 3ARXA 2YBVA 4WK1A 2B0FA 2FZKB 3TARA 5HIZA 3V81A 1Q8KA 3LONA 3MEGA 2LQ5A 3W2WA 3PVXA 1JX4A 3C15A 1C5MD 2HWTA 1HV7A 5J4QA 2A7JA 2PGQB 2WV5A 4FP9A 3HHLC 1DLOB 1FRHA 3OHBA 2NU2E 3GJTB 2VL1A 2A2CA 5KFEA 1SUQA 3TCZA 5HLFA 1FJGF 2AYWA 3BEIB 4CLLA 4FS1A 1EAXA 1WC1A 2UUYA 2CVIA 1VCPA 1I5OB 4M5JA 5AE2A 1P1LA 2DHXA 3JQMA 3R7BB 1E1RD 2ZOMA 1E6PA 3NWRA 1KMHB 4TLQA 4G50A 3LUYA 2OBOA 1CJKB 1JK9B 3KNXA 3U8TH 2ZNYA 3TZZA 3BGRA 4OFZA 5I3PA 3IR6B 1U1OA 4RKUC 2H65B 5IQ6A 4YOGA 2OP9A 1TAWA 5BYRA 4FVCA 4OX9F 2RS8A 5M2UA 4MSPA 2MMYA 1RSCA 4HH1A 3A85A 1YLXA 3O5TB 4ZKRU 3M8ZA 4DR6F 1MROA 2BVXH 4A46A 4I8GA 2MQMA 2AS9A 1AI8H 2F63A 2XP5A 1BTWA 2D3ZA 4L73A 3WL1A 5GDSH 1O3IA 2B9WA 3PW2A 1VQOS 4C11B 2H51B 1VFJA 4PCQA 3M1VA 1IQJA 2FTMA 4BC9A 3HD2A 2B31A 1HIAA 1XUHA 1CC7A 4DQPA 4DV3F 2J9CA 4G1PA 4YN3B 4J9QA 4XE4A 1D3WA 1Q8IA 2ZBCA 4I0WA 5B0EA 1HJWA 5DDQC 2DGQA 1A7GE 2BQRA 2EXUA 3CF5Q 2GV7A 4DG4A 4C8YA 2W9BA 1RTJB 2H1YA 3EPGA 2E5LJ 5GWZA 1L4DA 3D5MA 2L74A 2C3PA 1B7FA 1REVB 2F9UA 2DGUA 4PUOB 5C24A 3BEGB 3FN8A 1JNEA 3SV2H 1TX6A 4WWYA 2M5TA 4ZVRB 5E0GA 4BLGA 4B02A 3RJMB 5J1PA 1BQNB 1GMCF 4HL9A 1IR1A 1IOEA 6CHAB 2V8GA 2YWWA 1LHDH 3AB4B 1KLTA 2DISA 1VQMS 1AWHB 1BTUA 1Z71A 1TNJA 4CO5A 2MKHA 2PI6A 2NLWA 4OI6A 2KCAA 4ZHAA 2EULA 4DV5J 1EYMA 1V2KT 2FOCA 3AS1A 4YB7A 3A7XA 4Q0BB 1VGCC 1MTSA 2Z56B 4A7IB 1LPKB 4XDEA 7ESTE 2BY5X 1HJVA 1AA1B 5ETKA 1M5VC 2HLUA 1FDPA 1HW9A 2C2KB 1KQFB 2QTWA 2ZCLP 3HVWA 4PRFA 1H3DA 1PBUA 3L4BC 2WSEC 2C2OB 2HPPH 5ABWA 2RURA 1RBLA 1P09A 4S0MA 2ZC9H 2A4QA 4KHRA 3HHKA 2W4PA 5SZTA 4IR1A 5KT4A 3UDEA 1TVRA 3KFWX 4DPYA 3M8QA 4PWWA 1FCAA 2YWEA 4X4PA 4Z2KA 4JZDH 2Z2YB 4UUXA 5KFWA 3T6JA 3JZ1B 3TH4H 2BQ6B 4Y6DA 3D1OA 1HNEE 1N6QA 1A9NB 1BXNA 4XRNA 4JI6F 2XC0A 1YPJH 2ZNKH 3P3DA 3L33A 1LW0A 1YITS 2FLRH 2QG9B 4MGVA 1YWXA 3Q2TC 2HNDB 4MYUA 1CSOE 1UEKA 2ZDNA 3BV9B 1KTQA 3PFOA 1RJXB 1DWCH 1GT8A 3S01A 4C48A 4IG0A 2A3BA 1FKGA 2KL8A 1EZQA 4IH6A 2QJ3A 3OR2A 1RADB 3HHDA 1JIRA 3KK2A 4R0JA 1N34F 1S9GB 2XP7A 2XP9A 3VZIA 2R3UA 1TX7A 4RNOA 1UTLM 2VNTA 4RBVA 5DDOC 2XS5A 1R89A 3M6VA 3HMJG 3BZQA 5DKMA 3V13A 1M1KT 4ODKA 3UPFA 1TK8A 3M5MA 2YKNB 3SCKE 5GMEA 4NRTA 2HS0A 1HGTH 2IRXA 4DBQA 3S9AA 4WJBA 2MY7A 5F8ZA 4O3QA 3FY1A 4TXSA 1NK0A 4DUYF 1SC8U 1T7PA 4FF3A 1ETTH 2YTCA 3CD0A 2ALPA 2BQ7B 1DAXA 2ZU5A 5GVQA 3GR1A 1WXRA 3R97A 3LJOA 2BD4A 1PCAA 3ZZ4A 4NLYA 3H40A 3GR0A 2G8TA 1GBJA 1T03A 1ZL1A 1HNIA 2QF4A 1AZSB 1P27B 4CLPA 1SXLA 8ESTE 1DHMA 1RTDA 1C1SA 1PSDA 3LTOA 3DGPB 4YZUA 2VH7A 4WFZA 2J9DE 3LAKA 2H5CA 3C6UB 1K8AT 1PFXC 1RCOB 3QUMP 1RT7A 4MG3A 3M7QA 2MNTA 2JC0A 3FANA 4ZVQB 5D4LA 5ETRA 4QYRA 5K14A 2SNWA 2EKNA 3H2UB 1RTIA 2HFSA 4O3RA 4USVA 4O0IA 1JOUB 2FIUA 3HO1A 1D4PB 1JIMA 5HQ8A 4WFBQ 1UTKA 4YT6H 1NNDA 2CJKA 3SI3H 4NEYA 1UZHA 5DP7A 3FRZA 3QK1A 4D9RA 2EI7A 2Y81A 2BD9A 1Y9OA 4USKA 1FKPA 2AYBA 5C5JA 4PWDA 5JUMA 5BYSA 4NYPA 4TU7A 5FBIA 2KYZA 5IWAJ 4DR1J 2AWGA 2V8VA 4YOJA 2WONB 2IYGA 3Q86A 2LQ9A 1NUEA 1L1GA 2KR7A 2XO6A 1YHQS 2IFXA 2F9OA 1W8BH 4DX8H 3CENA 3I55S 2XC4A 3MEGB 5DP8A 2IA0A 1BGXT 1W7WA 2VN1A 4UEHH 3SU3A 2JLEA 3PACA 4CLSA 3W61A 1P2JA 1SGRE 4KH1B 2UUJB 1P9SA 5B0CA 4Q63A 4DR7J 4ABEA 3R5AA 4LMZA 7FDRA 3MM5A 2WPKS 2Z6BD 3KKFA 1TQLA 1ZZFA 2DEJA 2UXDF 1DWBH 1IBKF 1HDTH 1XXFA 4Q8EA 1LG1A 2AIQA 1J27A 4NLWA 4USTA 2FOAA 1AROP 4ZVGA 1RAIB 4JI1J 2HFOA 3SN8A 3J80U 3SW2B 2RRNA 5LOQA 2SGFE 3V6HA 4DI6A 2DGOA 3MWIU 5AXKA 2ALVA 5HJYA 2F7VA 5LSLA 4LFCJ 3V2UC 3OY5U 1ZBCA 3BGRB 1J5OB 2LP4A 1GJAB 3D2WA 3P8BB 1G6BA 2N4DA 4A8XA 4DJZB 1UEVA 3D9BA 1CQQA 3BEFB 1R6YA 1O2SA 3PYEA 2G41A 2HHUA 4L3NA 3OPKA 2A5AA 3DDKA 1RBOB 2Q6FA 1UTPA 3QGJA 2C3UA 1C4AA 1K9TA 1HJ9A 1RWUA 4M63A 4DQSA 3U28C 2FY1A 3PA7A 3O5PA 4F4OC 3KHHA 1F5RA 1L1NA 1MROB 2OUGA 1C1WH 2N82B 4P2FA 3R7NB 1FVSA 4LRDA 3GY4A 1CGJE 3SDEA 2W25A 3ARQA 3O5LA 4X2WA 4HT7A 1E44A 3GYXB 5KG2A 1TKTA 1RA6A 2GHVC 3LPYA 3BF6H 1TGCA 4JI5J 1JMOH 3MHYA 4GAWA 2DH7A 2P9EA 2E44A 2CJBA 3CDEA 5KTQA 4DV0F 3DXBA 5A6PA 1UVPA 4CIOA 3TP2A 1EQMA 1GEHA 2HHSA 2Z8QA 1SCJB 4QW9A 1EIYB 2ASJA 3VPKA 4BDPA 2W9BB 2BDGA 5DK1A 1UAWA 4DURA 4OYBA 2B9YA 4D9QA 4X1SU 4CH0S 4Y8YA 2GMTB 3G8TA 1HFDA 5DF0A 1JLAA 4FBTA 4M94A 3A8BA 2TGDA 1VMBA 3IXQA 1SLXB 1GVKB 4B74A 1U6ZA 1QJHA 5I98A 3NBPB 4CQ1A 2AEMA 1MCTA 3QNWB 2P2CB 4J9SA 5D8HB 3HHEA 3MF5A 2GX4A 2H9EH 1ZMJA 3ZZCA 4IQCA 2GZOA 5F53A 2A45B 3GPAA 1A7SA 3TUPA 4MTBA 4ZPBA 4CI0B 5LT5A 1N5SA 3V12A 4ZITA 2DT2A 2W01A 1P5QA 3NRLA 2B4VA 3MCOA 5E8EH 4PYDA 1G32B 1S5SA 1RIWC 2NUUG 4A1TA 4B3RF 4DR4F 2MJUA 3CCES 1RKIA 2V4RA 1MQ5A 1ELVA 4IMZA 1ZU8A 1UVUH 1AB8A 1PPBH 1NSKL 1RXOB 4IRKA 4H4OA 3J81j 3OOBA 2QLJB 3DFJA 3G2XA 1WEZA 1Y0OA 4QR1A 3I78A 1MKXK 2PKSC 3RXFA 4AZ2B 1H7WA 3EX7B 2GIRA 4CRGA 1K21H 2ZU2A 3MD1A 3BTEE 2RUGA 2DE8A 2GHPA 3TYTA 1N6QB 1P2OA 2DG3A 4Q7AA 5D0HA 4E2FB 5GAEU 3SQEE 1LW0B 2OD3B 4LRBA 2HG4A 2HRVA 3RLWH 2F40A 1H8HD 3Q8RB 2HGLA 2XMJA 4ZHLU 2MZQA 1FNIA 1QAJA 3NNAA 4DIIH 2H1UA 1QGFA 2LECA 4IYQA 1IBLJ 2OC7A 4CZCA 5BR8J 4EBCA 3TH3H 3MCNA 4Q2KA 3KNGA 3ITHA 1SPBP 3I6PA 4DL7A 2QN5T 5F3TA 4X2XA 1OO0B 3NS6A 2AMDA 4MJKA 5CHAB 1UHBB 3A12A 2M52A 1K73T 1NSQA 1PILA 5DQGA 1G4CA 2VU5A 3EJMA 2ZFPH 1UK2A 1QRZA 3DGVA 5HBMA 1WTHD 5AFZH 2PGCA 3IRWP 2W7PA 3THVA 3P6YC 1X7AC 2R7SA 2P6TA 1X4EA 2ZVSA 1GMVA 1VJ9U 5KFCA 2C2RA 1EHNA 3GICB 1T03B 3TGJE 4DCOB 4X62F 3ZZDA 4TWWA 5DM6Q 1TRMA 2HAIA 4LBPA 3IITA 1W1VA 1O5DH 2Y9HA 2FP7B 4WMDA 1EHWA 1NS3A 2XI2A 2YNHA 1X5SA 1TMJA 5LSRA 1N1AA 1M5KC 4JK5A 2CDRB 2FX6A 1T9XA 3ZO7A 3BG4B 3UNSA 3K89A 1RT7B 1GMCG 3MUVP 3A81A 2FYXA 2ABYA 5IFMA 4JYAF 3GY3A 1OP0A 1FKOB 3QPIA 4RW8B 4IOBA 4RW6A 1ZAVA 2BX6A 3CJ3A 3TNTA 2OPPB 2AJ1A 2MQLA 4FYXB 1RT5A 3ENVA 3RXEA 3Q8QB 2RSEA 4LZ4B 2B3TB 2HW3A 1QSLA 1F0XA 3HPOA 2JEGA 1THSH 2RRAA 3KG1A 2G9OA 2ADBA 3BGFA 3TX0A 3CJQA 2QXJA 1AKSB 1L2EA 4W90B 1FJCA 1IUJA 3H90A 1C5NH 3G82A 5DPAA 4TY6A 4A8WA 3EE3A 1BTPA 1FKPB 1FKLA 1AXQA 1KFSA 3DXSX 3P5BP 1XHGA 3PR5B 2XY6A 1NJWA 4DRNA 1MTUA 3K65B 3BO3A 1FN8A 1HBOA 1EETA 2AHOB 4ZOSA 4NFFA 3ZYDA 1SIWB 2GCFA 2XYAA 2C4FH 2YNIA 3EGKH 1RWPB 4ZXYH 2PTCE 4JMYA 2M7SA 1AUDA 2CZVC 5LSOA 4X66J 1Z6JH 1DXWA 3SFGA 5C94A 2R7OA 1ZHPA 3P17H 3CCMS 3LIWA 4TT3D 1THRH 3LP2B 4MKYA 1C2LA 2XP8A 3H5SA 1HKJA 4MNKA 3VWSA 1HMVA 3BSOA 4Y65A 4CH7A 2POKA 3W9JA 1GTEA 1WDTA 4IRDA 3RM8A 1Q5YA 3A8DA 1Y10A 4WZMA 1GWAA 5DJ7A 2XNRA 3S7HB 1RWNB 3UD5A 3GP9A 3JSRA 6CHAC 2C3OA 1O3OA 1ZPVA 1KDNA 1O3CA 2KYXA 2ZH3A 2BD2A 1UFKA 4LSNA 8LPRA 2CQGA 4P7VA 3H98A 1HAIH 1UP1A 2IHR1 2SXLA 4R5PA 4CR5A 1QE1A 4PQUB 1S59A 2V7QD 3RMMH 2OP5A 2A3AA 1ORFA 1TABE 1SB6A 1VBKA 5AXNA 1GNKA 5C2ZA 2ANYA 3MPYA 6ESTA 4C7QA 4B2BA 2B5UB 5CD4A 4NL5A 2DB1A 2ZC4A 3FBBA 2P93A 4X1PU 3RFWA 2DGXA 1RZMA 2MGZA 2HGTH 5FHTA 1UK4A 3UVJA 5ADZA 5GXPA 1R3NA 4JYTA 4A4JA 4OS7A 3FBCA 1FY3A 3D6MB 1SYTA 2EQNA 3KLHA 2UUBF 3J81Y 1UVLA 4DV1J 4OJ3A 4WFAQ 2PV1A 4IQXA 1FV9A 3FKSD 3BB5A 1IR2A 3OA5A 3MH7A 1TGTA 1ZMLA 1SI5H 2GQ2A 4PABA 3DLKA 2M4MA 2WINI 1VR6A 1EAUA 1FN6A 4MTVA 4J9VA 2R7VA 1IQFA 4MYTA 3RU4T 4YB6A 1CTNA 3N0VA 4Z6AH 1MKWH 1GXUA 3U1MA 4TY7A 3TNSA 1XUKA 1HBNA 1VITF 5C1YA 4I6AA 1O0PA 1V6HA 4GVBA 3I87A 3U8RH 3N79A 3PR9A 4KHPF 4P9SA 4DJBA 4DFKA 4HACB 2GVDA 3SOSA 1J4IA 4J9MA 2B5TB 3ILOA 3DI6B 4LIWA 1RI7A 1IBMF 5H4IB 2XWAA 2LDYA 2RSQA 2ZDPA 4N47A 1CT0E 2W4CA 1RLDA 1KYNA 2HFNA 1NDLA 1FKRA 2WPIS 5F0WA 1FTRA 1RT6A 2IBOA 4OS1A 1J14A 2CMYA 2ZZUH 2V2ZA 4P02A 1DSTA 1TL7A 3B6BA 2ZJPQ 1Y5UT 4QIWD 3VB5A 2ZD1A 4RWXA 2W26A 3GCWP 4OIXA 4X8VH 3EPIA 3LP0B 5TJXA 2XXLA 2CNLB 3HJVA 2JKHA 1H9IE 1IJEB 3OFGA 1SR0A 2VWMA 2F8MA 2KJVA 1KN6A 3LH3A 3D67A 1A7XA 3PYDA 3RXDA 2J97A 5HMZA 3CJKA 3M8SA 1AE8H 2ODQA 3JAMY 3PTNA 5JBTA 1UW4A 2QN6B 4H4OB 4PTMA 1CO7E 4USMA 4OX9J 1S82A 1YTYA 1OX1A 2ATLA 4KELA 2GMHA 1SGFG 2XGQA 3DFLA 2LQJA 1SOZA 1HL6A 1HHTP 1K1LA 1TRNA 1FA0A 3FMWA 1G3OA 5IQQA 1V9OA 4DR6J 4QZVB 4LF8F 2V0NA 4ZJLA 2Z0GA 4OV1A 5KFSA 5FLXY 2PKAB 1NKCA 3CCUS 5AFYH 2WSFC 2FLLA 2ZFTA 1SLVB 4ZH8A 1X4FA 2Y1JA 1HPZA 4KHMA 1TIOA 4ABBA 2AX1A 3IBWA 3TANA 2HLCA 1XM1A 4DV3J 5U47A 2YX7A 3QAEA 3MPDA 1HQEA 3LGVA 2AF6A 3MTKA 3CD5A 3ZZZA 2OSRA 4THNH 3TZWA 1EP4A 5EXLA 3ITHB 5F8LA 1D2KA 3PMBB 2BX3A 3WX8A 5D77A 3EIPA 2YNGA 1C1BA 1NWRA 1GDNA 2ZFFH 2OTVA 2WW4A 2HEKA 1Z8IB 1KXDA 2W1BA 2HMIB 1FJ7A 1FERA 3K5LA 2BDHA 1Y5LB 2FI4E 1WHWA 2HHXA 1FD9A 3SU6A 2HURA 2MB0B 4UUWA 2QLFB 5EW1H 4NX9A 2ASLA 5HUAA 1XQIA 2H9ZA 3DLGA 3UWTA 2Z9JA 2F4VF 1OWIA 3N7EA 2G8ZA 5KG4A 1G7CB 4ZVEA 2XRCA 1BBRK 5KEDA 2XM3A 2E5GA 3UQAA 2JEFA 4I32A 2ZECA 5EODA 3M6UA 1O2QA 2RDEA 4BAMB 4UTGA 3MPWA 3EM1A 5EJLA 2ZDAH 1TFWA 4FUCA 2D3UA 1KVIA 2UUAF 2CJ9A 3L09A 2DY9A 2BE7D 2UWPA 2HFZA 5HVFA 4ED6A 1PIEA 1TFYA 4WJXA 4LF9J 2AP6A 4RW6B 1KVJA 5DP4A 3A8AA 4DV6J 4OYPA 1OSCA 4TYBA 1FXRA 2P95A 4RL1A 4U85A 4DV4F 3KEEA 4CBOA 2DT1A 2GKVE 3ADAC 3DRXA 1LVOA 4DSLA 4IR9A 4LGXA 5CYQA 3QIDA 2MQQA 4EFAC 4CLFA 1KXAA 2BZAA 2PBCA 5EN1A 5HWCA 1XMBA 5HQLA 3ZV9A 5DN6D 3M2UA 5CHCB 1UKUA 2KFNA 2WOMB 5I3UA 5AF9H 3AQUA 1YRTA 1H72C 4JI6J 2BE2A 2BY6X 1SC3B 2CXVA 2R8GA 3ZZ8A 1WG1A 4HKQA 4NCYA 1P6TA 1XUFA 3KIDU 1HBOB 2QF5A 3R1HA 2A3EA 1C1QA 3MEDA 1MD8A 2QLWA 1HPGA 3PKMA 1UTNA 3ARYA 3LJJA 4KGKA 2E9ZA 5E0HA 2A3CA 5G4DA 2XBVA 4F2RA 1EJAA 2DTJA 4MPKA 4KKDA 2PTNA 3UR3C 3P8FA 1UK3A 2DNZA 2GMTC 3PMHB 2KI2A 4MKBA 3IG1A 1XUJA 1EPTC 2RDJA 3E01B 1HMVB 2OC1A 4DPOA 2BE9B 4ITSA 2ZH6A 4FVDA 3NCRA 4P2SA 4M5LA 3ZZ5A 3UCZP 3V7TA 4KO0A 5I46H 2KX4A 4DUYJ 4DL3A 2VZ9A 5L1JA 3C8YA 3DU6A 5KT3A 4KTUA 2FLOA 4CH2B 1ZPCA 2F65A 1RBAA 1C1RA 2MQPA 3UNRA 1PQ8A 2IJRA 3RM2H 5B0FA 1RCXB 5KFKA 5DRKA 1L3VA 1H1BA 3DC2A 4JZEH 4OV6A 1MUEB 5RUBA 4MAKA 4LT6A 3RLYH 1HAZB 2BQWB 2LDIA 4LF2A 1Q6HA 3CGIA 4ZPCA 4CRBA 3ZZ3A 4WXIA 4Q8FA 4DS5A 4ZVSB 5GIBA 3A7WA 4UZBA 1OY8A 2MHNA 2QF0A 5JBAS 5LMNJ 2DR6A 1TELA 3N6NA 1ZB5A 1D6WA 1XEZA 2MGZB 1GBDA 3F0PA 1TL4A 3UVJB 3KLGA 2XBXA 1DS2E 4NLPA 2ANMH 2DH8A 4FXVA 1NC6A 1PJPA 4IGDA 2QYCA 1FEHA 2CPIA 3MECB 2ZQ1A 1K1JA 2Y5HA 2PA8D 4WP9A 2WRMA 3PO5A 3OX7U 4YR3A 2V68A 3AW1A 2I5JA 3MQKC 3DDNA 2NXNA 3UFAA 2BW7A 2D9OA 1E38B 3MOCA 4OS2A 1NAQA 2R2WU 4LSLB 2WVEA 1C2IA 3JYMA 1PPGE 4C0OC 4J9OA 4DPTA 2MJNA 2WPHS 5LPRA 3ODFA 2GZ9A 1UJ1A 3RBDA 1Z1IA 4I7YH 1EZUC 1Z2ZA 4EI2A 1FZZA 3I29A 2FS9A 2AOSA 3FZ2A 3SV4A 3QIPA 3S1TA 3MAHA 3VAHA 1PYSB 1BMLA 5IK2D 2HK2A 4GVBB 4ECYA 2AEJA 2DNKA 1LPGB 2JOQA 2K8GA 1V2QT 1JVWA 2X7IA 1W9VA 1DQ8A 1VQNS 1IM6A 2WVBA 3RXSA 1AB9B 1LWEA 4LZ1H 1KTTB 3ZZAA 4KC5A 2F9NA 2DPEA 3KWMA 1KVKA 3NWUA 2UXDJ 4KKOA 1IBKJ 1RTLA 1SSXA 2BDPA 1YWUA 2BZ6H 1W25A 1RT6B 1OMSA 1TPPA 1YLDA 3CJRA 3PYGA 4JFJA 4JFKA 1IKYB 1HLTH 1T9YA 1OGBA 2RE1A 1WQVH 3D65E 1U0HB 1TOCB 5HKKD 1QA7A 4OZ3A 2KT3A 3GU0A 3VV2B 4AQYF 4Z7CA 4XPCA 3SBKA 3NPSA 4Z2GA 3S0NA 2HRUA 2K8IA 1KLNA 1T7CA 1YPKH 3LGTA 2NREA 3BG4C 2AJ0A 3AW0A 1ZM3A 3DRRA 3GYGA 4QT3A 1IBCB 1RTHA 2ZJRQ 1V2JT 2FEQH 1UCNA 5DG9A 1S9EA 1FPHH 3QT5A 5KT7A 1KRPA 3SV9A 2UVUA 2G2ZA 3VG8A 1RWXB 4RNNA 2FJVA 1U6QA 1S1VA 4AY1A 4NWLA 2CQHA 5JPMH 2C8YB 1RT4A 1T8LA 4MNXA 1ZK6A 3SUGA 5J2PB 4RWWA 4X4SA 2DT3A 3DM2B 2GZ7A 1ZPBA 5L30H 1NU4A 2XZTB 4NCGA 2VG6A 3CDBA 4DV0J 1FTCA 4HARA 1HQEB 4N41A 1SV5B 3W63A 2J76E 1LJYA 5M2PA 4Z2IA 3MR3A 1EP4B 3H0PA 1Q31A 4O97A 4QU6A 2KZ4A 4FS2A 3O8RA 5B0DA 4X4TA 2YNGB 4WFYA 5FX5A 2PV2A 5AT1B 1GHBF 4ZMAH 3GIMA 2C2ZB 3O3LA 1KNZA 5AHGH 4GHTA 2Q6BA 1C2HA 4R0IA 4IRCA 3R9LA 1SL3A 3CCZA 1VRQC 2RU3A 3RMNH 2RKIA 4UOCA 1U2FA 2XB2D 3TAMA 4YR2A 4GUXA 3DLGB 1DJ0A 2OKQA 3TVYA 3FVYA 3GIKA 3PV4A 4JFIA 4QIGA 3Q8YA 1SVDA 1MWZA 1NRRH 1V3ZA 3C16A 3CMES 4RZRA 4W9OA 3JYTA 3MMBB 1XMQJ 3W2VB 3SMZA 1XNQJ 3RXRA 4EU0A 2XPBA 4J5OA 4TYOA 1FY5A 1VITG 4WY3A 1LQEA 1OWDA 5BPEA 1Q81T 1UR8A 3T9NA 3UQBA 3DFEA 4P2MA 3N4WA 2MPHA 4ZA1A 4XSKU 3MM9A 4IH7A 4B3RJ 4DR4J 2V0BA 2JLFA 4USWA 2GQQA 3AJ1A 1TUVA 5HMXA 2J9NA 2ZOFA 2ANWA 4LF7F 4DPXA 4QWAA 4ECVA 2BJDA 3BQ1A 1DXPA 1GGDC 5CYQB 3EDXB 3PYFA 4X4OA 3D1QA 2PN6A 4DU7A 1BMFD 4TW8A 2VBYA 1CHGA 3W65A 1W9UA 1C4U2 3ODKA 3QZ8A 3V3MA 1D8ZA 1A3BH 2BE2B 4ASHA 1DPOA 3ULHA 2ZQTA 2H5EA 2H3EB 1JXPA 4ZDNA 2EG2A 1GBAA 1HAHH 5FPSA 2DIVA 3MEDB 3UQSA 2XY7A 1NB2A 1YDLA 1KSPA 1RGVA 2XMKA 4SGAE 5HW6A 3FP6E 2HWHA 4NIVA 1DDJA 2HGNA 3NEKA 1FIZA 4UFDH 5CE1A 4G6VB 2QSFA 1V2RT 2A2XH 2XG8A 4DN0A 4OMFG 1J2VA 3QO6A 2FGOA 3OTOJ 3IG1B 3MDYB 1L0ZA 2ZTZA 4INKA 3BYPA 4AG2A 2MSSA 3A3NB 1EDQA 4KB7A 1AIXH 2ILYA 1C2DA 2AGIX 5A09A 3GFXA 2PA3A 2Z2ZA 1ITXA 4OS4A 5A8YA 3MYWA 3KK3A 2XYGB 1EP5A 1SH3A 2QXHA 2UP1A 2XWXA 4D8NA 3BN9A 5C1UA 1ANBA 1VGYA 3EGVA 4MIAA 1NBEB 4TU9A 4AL6A 3M37A 3MEEB 4XIUA 1JWWA 2ZZNA 4ISHH 4X62J 3F6UH 1GJ6A 1JKHA 4K1EA 2VIPA 1S6QA 2J94A 1ZM9A 1GBIA 5JMNA 1NM2A 4U32A 5C67A 3BBFA 3ET6B 3W4RA 4F4YA 2DHSA 3UI4A 4JZFH 2RCEA 4RKOB 4ECXA 2VODA 4L74A 2KVIA 2IAJA 5F8XA 4ODQA 4UQGA 1WOOA 1XK8A 4JYAJ 2ZH1A 5KFAA 4NZ6A 4WMFA 3QWUA 1YCPH 3O5QA 1ROTA 1SLUB 1TL5A 4W4MA 5D4PA 1GPFA 3PEHA 2XTJP 3KLGB 1WOPA 4HHJA 1H0IA 1AD8H 3LH2S 2EI5A 3ZZYA 1QBOA 3TZXA 3VXFH 1NWUA 1KTVA 2ROGA 1JNSA 2YNAA 2CV3A 1MG7A 1WELA 4ZKNU 3A4TA 5CDFE 1D7IA 1Z7KA 5GAGI 3CEDA 2RA3A 4DOZA 3ARTA 2GIFA 3STJA 1EP6A 4GVUA 3FQKA 4EO6A 1MW7A 3HLUA 2Y78A 3IBCB 2BQUA 2Y7XA 3NCLA 4AXJA 3K6YA 4XBBA 1OWJA 1RA7A 2JJ2D 2A18A 2XHWA 4J4NA 2B6AA 4I68A 1H4WA 2A10A 3OVAA 2HQFA 4B9NA 3BSQA 1KXCA 3DDIA 2WV9A 3B9DA 2A31A 1CA8B 2EPIA 2J5UA 4ECWA 1S1XB 5H9EJ 1N48A 2D41A 4FOUC 2L9NA 1CBWB 2H6MA 3H59A 4TQRA 1HAXB 4GC6A 2GT8A 3RW6A 4K2XA 3I5BA 1V3SA 1H74A 1UJ6A 3TR5A 1WB0A 4UOGA 4JBCA 4QPXA 2BVRH 3LGNA 3G8QA 2OQ5A 3K0JA 4KY3A 4QBUA 1FKTA 2LJ4A 4UF4A 2BA9A 1YKWA 3OL7A 4OZ2A 4FYWB 2C2DA 2Y1LB 2LEBA 4HBEA 3DUXH 4BAOB 3B8HA 1C5RA 5DIUA 4TLRA 1FONA 2PPPA 4I2QA 2MKKA 1O3EA 3K5OA 3PW5A 4LOYH 3ILLA 5I4MA 1ZTJA 2X1AA 1C2PA 3JTPA 4O3NA 1C5ZB 3A80A 2R8JA 3RB6A 1ZA2B 1K2I1 4BHQA 3IR5B 1HBMA 3CCVS 3A3PB 2ROEA 4F4WA 4O3UA 3J81U 3BBBA 2I6QA 2XCNA 3CDAA 4YMEA 2WPMS 2ZWPA 1RTHB 2AQ4A 2YH1A 4IC6A 3IR7B 1BTYA 2DNQA 2GX8A 3H4BA 4AUKA 4JUZA 3KF2A 1VJQA 1O2XA 2QXIA 2K1RB 1EX8A 1WKJA 1T8NA 2WB4A 2BD3A 4USUA 5C3NA 1QUVA 4EGLA 2VBWA 2B8PA 2RDLA 4PG8A 1IN0A 4P74A 3DRPB 4B3MF 4DRJA 1IX5A 4PXBA 2J7KA 2B4OA 2UUBJ 2CF8H 2AGPA 4NOHA 2VIVA 2HPUA 1WV7H 2FD2A 4TU8A 2OLHA 4CLTA 1Y4ZB 1JLQA 4DU8A 2EWHA 3CCRS 4ALZA 3A86A 2ZU4A 1WTFA 1OWQA 2VG5B 3RW7A 1HAPH 3HFKA 1XNRF 1L3TA 2AMQA 3DRYA 2WZQA 1G2EA 5AJ3F 1D8YA 3W5YA 2LU1A 1ZPZA 1RWKB 2BXUH 1NHUA 4FN5A 4X65F 2NZ4A 2FHJD 3FEZA 1DANH 2EVZA 3FFIB 5AE3A 1T4UH 2XWYA 4YO9A 4DIHH 5JXSA 1MAXA 1OPIA 2FHMA 9ATCB 2W8KA 1JWTA 2HVIA 4ZPAA 2PHBA 4NNRA 3RU0A 1VRTA 1X4BA 1AWFH 1QAIA 4NLGA 4IOAQ 2RKIB 6LPRA 1Y3XA 1BTXA 4MFBA 3QSYB 3QRPA 1NMVA 3TAMB 2VVVA 3BO4A 2VIHA 4I4BA 1LCYA 4NSBA 4JYSA 3OEED 3SUFA 1ETSH 2JL9A 4AL5A 1AZ8A 4QCLA 1VRUB 2HS4A 2DNOA 1LXJA 2ODPA 3ZVCA 3TA1A 5LGOA 3GCHB 1J8AA 2HRYA 3JAMU 4I1TA 1VLOA 2CPYA 4K8YA 4K4SA 4NASA 2XP6A 1TFVA 1ZA1B 2CNOB 2C22A 2F9VA 4X84A 1N5TA 1CPZA 3NRKA 1K22H 3TGIE 1IR0A 5FLXU 3T5JA 1CHOF 3GQCA 1UA0A 1S6LA 1ULRA 2DJWA 5D3GA 1P3EA 1W2KH 2BMBA 3R6LB 1H9LB 5L2YH 1N5QA 4ZN1A 4ZP7A 5ETLA 3N7DA 4QU7A 2YWGA 3P45B 1U49A 3OL9A 2VWOA 1F5KU 1SQOA 3RBXA 4NLUA 2YKAA 4R0XA 5DDPC 2VBZA 4ZP9A 4RUHA 2M8DB 1Z1JA 2AEIH 1DTTA 1U2CA 2IA6A 2G0JA 4LF8J 4J91A 1ABJH 1AVXA 2BD5A 2AZ3A 3CB4A 4ISNA 1WU1A 2A3JA 4MIWA 2ZHEH 1X6LA 5KG6A 3PHEA 3GFZA 3SGAE 1P1TA 2DNYA 1QZ8A 5J2QB 3FBFA 1PQ5A 1G1XA 3K6ZA 4TX0A 5C1XA 3RXMA 4RI0A 2ZHOA 4NLTA 4TNOA 2O8MA 1O3LA 3U8OH 1X4DA 2KHDA 3UO0A 4K4WA 1A5IA 1C5YB 1AFIA 1EX3A 3LAMA 5C42B 1HA1A 4EBEA 3M3TA 3FDSA 1CU1A 2I1RA 4F2SA 3QBCA 1NEEA 1P2NA 1IKXA 2V5HG 2A0FB 1FAXA 4B2CA 3S6EA 2N7CA 4DT7B 3Q3KA 3CCLS 1QBVH 2BDYA 1GRJA 1RT2A 4ED3A 1NXIA 1PYTA 2MPUA 3TK5A 2GJFA 3CP7A 2M2BA 3OL8A 3LOXA 1O2PA 4UFEH 1ZRKA 1FKIA 2QC2A 4B9TA 4ODMA 2DCLA 2HFUA 1YBTA 2WAQD 4CLUA 3WKZA 1BD6A 3T2NA 1WOFA 3QSIA 1L4ZA 1AB9C 1HD0A 2OLGA 1V2PT 2ITKA 2F4VJ 4O44B 4AT1B 1SJQA 4IG3A 1G3BA 3R5BA 3GFYA 3EGWB 5T3HA 4H4KA 1MU2A 1GHBG 5B8IC 2CF9H 4K4YA 4CCHA 5DP5A 2N87A 2F9JA 3PO1C 1P11E 4NCBA 3KLFA 1E35B 4D3HA 2QIFA 2UUAJ 4MAVA 2Y0BB 5FPYA 3CMQA 1AVGH 2GJIA 2IAJB 2WB1D 1FX0B 2YNFA 1Z4UA 4I8KA 2GNKA 4N8NA 3MPUB 4Y2AA 2DNPA 3ARWA 1HB0B 1LWCA 4IUFA 3B7XA 1Y3WA 4AGJA 2ACYA 3Q3YA 3OFFA 2Z9KA 1S57A 4OYMA 3PV2A 4DR2F 2G5NA 1B0VA 5FBEA 4CLKA 1YLNA 3TAPA 2LP6A 4EMDA 4UFGH 3RXKA 3OJSA 3FP7E 2GMJA 6AT1B 3O44A 4K5SA 3RXGA 1N0VC 1FXLA 5KFQA 1O5BB 3K9XB 3KHGA 7FD1A 1GTHA 1M5SA 3FQLA 3QGIA 4J9RA 1ZYQA 2JC1A 4U8YA 1S1WB 3PYHA 2PC6A 2RT3A 2IM1A 4MPWA 1K44A 2B6AB 1WWHA 1ZJDA 1X5TA 1S0OA 1TNLA 3UTUH 1HXVA 4AFUA 3MAQA 1NJZA 5DG7A 3GV7B 2AJFE 4F4AA 1SQEA 8AT1B 4BTTB 1S0NA 1O6XA 3UIRA 3CNQP 5EGMA 1TQ0B 5ETOA 2A0QB 1FKDA 2BEFA 1HKKA 1M1HA 1T11A 1VYAA 3TJUA 2LXUA 4RUCA 2HNYA 3H7OA 3TVJB 2R3YA 3T5KA 4LFAF 3VXEH 2X1FA 2MZJA 1TNGA 1ZBKA 1KHWA 3R6GB 2CQCA 5TCCA 3OTPA 2J5AA 1U1MA 1Q82T 1LVBA 1O31A 1X9SA 4B9LA 1Y0HA 1JLCB 4W9QA 4GO5X 3V5RA 1SH0A 4AL7A 5EJ1A 1U8WA 2KO7A 1FNOA 3K8VA 1T4VH 4X0WU 2AJ2A 1C2GA 1SFQB 1HFEL 2DNGA 3UB0A 1E6VA 3AY0A 4OLPA 2KT5A 2F9BH 4RW4A 1R43A 4WFXA 5IT9U 1P12E 1FK9B 5D4OA 5KFOA 1FQ3A 1GDQA 2K3KA 4AX9H 1SGYE 3ZVFA 2HBQB 4QWDA 3DLEB 1ROFA 2FJXA 3NG8A 1J5EJ 1SLWB 4WPAA 4Y0YE 3PJXA 4DR3J 2GDEH 2UUCF 1UCYE 3HHLD 1TOMH 4OHXA 4DL0C 1P05A 3AD9C 2V6AA 4JV5F 2L08A 3Q8PB 2Y8YA 3SUEA 1HAYB 1S81A 1C2EA 4C97A 3FGVA 1KFDA 3ISNC 2J6TA 3WD4A 2WPDD 1X8DA 3KL6A 1W7GH 2B7CB 1T0TV 1EFRD 2V4JB 4YB5A 2UWOA 2WVCA 5T6GA 1N88A 2KE0A 2G2OA 2JIZD 1RJJA 3V6JA 1NMEB 1BJVA 5C25B 4I33A 3KLIA 5D0RA 1SFIA 4P7TA 3TPIZ 4FU8A 4TPYA 4ZCKA 3TJNA 4X2BA 2YKMB 3O5FA 3S9BA 3DYAA 1O36A 1IJFB 1XC9A 5EQSA 3R5DA 2V3HH 4MNWA 1MWQA 1WACA 1N0UA 2AX0A 3TDBA 1HNWF 3QRRA 4MFBB 2KXNB 1JNRB 3T28A 1AZZA 4LF4F 1HAGE 3FP8E 1O2ZA 3TAQA 4WK3A 3MOZA 2JHEA 1SPJA 5B0GA 4FUDA 1FXDA 2STBE 4DRMA 1EOJA 4QWBA 3U27A 3L7PA 3D66A 4MDSA 3DSGA 1O5CB 4U86A 1SQGA 3B9AA 1R8CA 2XPAA 2IPOB 2W6ID 2B43A 3LOUA 3GISB 1Q86T 1LPZB 4XD7D 1XKBC 1X0PA 4USJC 5HT1A 1NY22 2OSQA 4AQYJ 1DICA 2Z3DA 3HVTB 1LHCH 1I94F 4WE1A 1TUWA 5JVGQ 3RBZA 4PAAA 5D3GB 3Q22A 4U30A 5HTGA 1O2YA 4K5ZA 2PV3A 1J4RA 1XUIA 4JI8J 1HXFH 2CQ2A 4FUIA 2IM3A 5B6LA 1S5ZA 1HNZJ 3PM3A 1FX2A 1LW2B 2IPQX 1Q6IA 1O30A 4XFQA 3U02A 4YOEA 3ARSA 3MNCA 3EVMA 3ZZ0A 3BGOP 2RUSA 4IFYB 3DN9A 1RXPA 1YPMH 2DIUA 3VGSA 3J80Y 1Q53A 2FI5E 2ZQUA 1RTZA 4A5TS 4DF8A 2R2MB 3D0IE 4ACBA 4B3SF 4ZPTR 1CS4A 4C0BA 4PKDB 1N6YA 2DR8A 2ZFQH 1V2UT 4USIA 4YDXA 1UVSH 2V4QA 1FMGA 4NMLA 1C1MA 5KFDA 1NRSH 3CDWA 4RNFA 4ABGA 2GGPA 1WSVA 3HVAA 3EAJA 2P94A 1JNDA 2L41A 2ZFHA 2IBKA 3QZQA 1WSSH 2ZH5A 4FNIA 1UTQA 2A4RA 1PBAA 5HW7A 2FUG9 3A1YG 3MUTP 1Q1KA 4J9NA 2ZNZA 3LO3A 4DR5F 1IQIA 1RT2B 4J7CA 4DQIA 4R8UA 1RKJA 1WNOA 1ZZZA 4DW2U 1MU6B 2P5VA 4FUFA 3UI6A 1IQEA 3ISZA 1HYSB 2VWLA 2QAAA 3BO2A 1UVNA 1AMHA 5IC6B 3RR7A 2VQEF 4HTCH 5KG3A 3CE8A 5B0AA 3OSNA 2VFRA 1UPPA 1TL1B 3PV5A 1W7XH 1C9TA 2ZE2A 1T31A 3KK1A 1RU1A 1MU2B 3CUNA 3MH5A 4B75A 1Q2WA 4WXOA 1I6JA 4ETXA 3M30A 2XLIA 2XNDD 2OAUA 2QLBB 5DP6A 3LGHA 4FVMA 2ZHBA 2KAIA 3KCGH 4OGYA 3IAM9 3GYLB 3WQWA 1SMFE 1BZXE 5A0AE 3TEHB 2DNNA 1NK5A 3BTWE 3ONQA 4C8ZA 4F02A 1I3OB 4DSKA 3D62A 4LK4A 4EZ9A 5KG0A 2VFVA 2BM1A 1X4AA 2CQ0A 1CJUA 1RWMB 1GI1A 2ADCA 4LF7J 1NDPA 2QMWA 3MM8A 2MKJA 3EXYA 2WHXA 4CRFA 4NI2A 1GHWH 1YF4A 2QA1A 3VAWA 1UVIA 3E0NB 2QXGA 1BB0B 1DTQB 5IYTA 2DNHA 4ILMA 3CVKA 2QGFB 5KFTA 3DT0H 1AUSL 3HFZB 4RNHA 4O3TA 1CHOG 2QF8A 2KTQA 1ESBA 3UWJH 3U1NA 3IAS9 3BG8A 2BY9X 4AOQA 2GT7A 1C5WB 4YR0A 5KECA 1B0PA 2MZSA 2FHJA 1X9MA 2E5JA 2FDNA 4RUBA 1NFXA 4OI1A 3E90B 4Y71A 2RVJA 1Y3YA 2KZZA 4OYWA 5EW2H 5E3PA 2DEIA 2B7DH 1VK3A 3TU7H 8KME2 1U02A 1KOOA 3I5AA 5LPEA 1RFNA 1O5GH 4QPTA 4FU7A 1FE4A 2P16A 2OC8A 1DX5M 5LMUF 2Z9IA 2PW8H 5B7WA 3FEYB 4C8MA 3A8EA 3R27A 2O8LA 4F25A 4CO1A 1B6CA 4B3TF 1DLEA 3G6XA 3LGIA 3F2HA 4PEOA 1SKRA 4CRAA 1YPGH 5EQRA 3MGJA 2ZUGA 5H9EK 3A8JA 2DPJA 2GVZB 1WCZA 4AFFA 2HNTF 1R27B 3VAKA 4CM0A 3BPDA 1Q5VA 4GVLA 3GCHC 5FAHA 5IM0B 4KAIA 1IQGA 1BUIA 1SGPE 2FX4A 1E6VB 4EYHB 3M2VB 1X0FA 1G3CA 1J6YA 2WM0A 3C27B 4RW9A 1CQNA 1LMWB 2CJQA 2VUGA 4WP3A 2O8TA 3KQ5A 1GBKA 1TGSZ 1NDKA 5F8JA 4OJHA 4HTJA 3AA8A 1EKBB 5LPFA 5T6DA 2HVEA 1MD7A 3M32A 2HQIA 1F5BA 5F8TA 3SYZA 2CNNB 3B54A 3SU5A 3AQOA 4DRPA 3K8WA 4MK9A 3KHRA 3IWMA 4EZ6A 4LUBA 2QO3A 2GO8A 1N4LA 2ZKTA 1H0GA 2BDAA 4K7QA 3TITA 1IVZA 3VCDA 3LDXH 2WHOA 1GCDA 1GCTC 1FI4A 5HGGA 5L2ZH 1FAKH 2VD3A 2J9DA 4DSIA 2G00A 1EASA 3ZIAD 1WD6A 2XCFA 2I6WA 3CXCR 1QTMA 4C9DA 2J38A 5K5MA 3NZIA 2RIJA 4B9SA 2Z58B 1TU0B 1YPHC 2ATCB 2VBCA 3CTRA 1HARA 4X8UH 2M70A 2ZTYA 5FCKA 4JI2F 1SBWA 2V8HA 1S7HA 4ANCA 3DYAB 5A8RA 2VIOA 1B3TA 1YPEH 1MTVA 2GP9B 4BXSA 2LELA 2IC3A 5CXTA 1F2GA 4I2PB 3A7YA 2RG3A 3KUHA 2UUKB 2XP4A 2ZCHP 4NZQA 4ZAEA 1S6UA 3JXOA 1L3SA 4CT9A 4W98A 2VDHA 2J92A 1Q8LA 5DJBA 3B23B 4XPEA 2DR7A 4JI3F 1IHSH 1S6OA 4ITZA 2MHEA 1NKBA 3BEUA 2PPOA 2MSTA 1GJ9B 3CDUA 1FJSA 1LHFH 1IQZA 3G71S 3P8OA 2ZTXA 4CH1A 1BOQA 2JDJA 2VV5A 3PX0A 2QL9B 2RQMA 1V2LT 2XYHB 3TOQA 3IN5A 1SC1B 5LXRA 4GC7A 4H4MA 2P3UB 4Q45A 1M9UA 3PWBA 3MNSA 3PG9A 4JV0A 4DG1A 1GAOA 1M1GA 2CG4A 3ZNUA 4WE1B 4L6V3 3KZ7A 2AKWB 3I0RA 3R1LA 2G0CA 2QA4G 1BMNH 1SGDE 1QL8A 2CZ4A 3MMAA 3VGCB 1HKIA 4LBHA 4CO0A 4ABDA 1YJVA 2EFGA 3O8DA 5EIYA 8ATCB 2G2YA 1HW8A 3WC2A 1VQPS 2E1MC 1FKSA 3PB1E 1F5AA