3PRDA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 36
structure length 223
sequence length 223
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prdA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prdA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prdA03
1EYMA 2L2SA 3O5GA 3RGCA 5HTGA 1Y0OA 1YW5A 4JFLA 2PV2A 3NRKA 2XP8A 3FAPA 3UQBA 4R0XA 2IF4A 3KAGA 4JFIA 4DRNA 3OOBA 3NTPA 4QT3A 5DITA 2ZQUA 4FN2A 4N19A 5HUAA 1KT1A 1L1PA 4JFMA 2F2DA 4G50A 1A7XA 2DG4A 1FJDA 2LJ4A 1NMWA 2M1IA 2VN1A 4O2TA 1JVWA 4J4NA 1U79A 2K8IA 2KO7A 2ZR5A 2Y78A 3TC5A 4ODQA 1D6OA 4MGVA 2LGOA 1F40A 4G2PA 2LPVA 2MF9A 2PPPA 5HKGA 4DZ3A 2MLYA 2DG9A 2KGJA 2MNTA 4DRMA 1J4IA 4ODKA 4QT2A 5HW6A 1FKJA 2XP7A 3WH0A 5HWCA 5J6EA 3O5EA 3O5KA 1R9HA 2XP6A 1D7JA 3IK8A 2RUDA 1FKLA 4LAVA 4W9OA 4GGQA 4W9QA 4DROA 1J6YA 4TNSA 4DRHA 2PV1A 2M2AA 1C9HA 2N87A 1FD9A 2PV3A 2KFWA 3O5RA 1N1AA 1YATA 1PBKA 2ZQVA 3IKDA 3KADA 3H9RB 1ZCNA 2VCDA 4IPXA 4IQCA 1JNTA 2XPAA 3O5QA 1EQ3A 1W26A 5B8IC 2XP4A 1J4HA 4GIVA 2KI3A 2ZR6A 1JNSA 3EY6A 1FKRA 1QPFA 1BL4A 4U85A 2PPOA 3LUOA 1TCOC 1Q6IA 2DG3A 3RFWA 2Q5AA 4TW6A 3B7XA 2ZQSA 3UI5A 2RQSA 4ODRA 2FKEA 1T11A 5I98A 5HWBA 3PA7A 1ZK6A 5GPGA 4ODNA 2RUQA 4DH0A 2PBCA 1FAPA 1F8AB 2XP3A 4IQ2A 4ITZA 4LAWA 3UQIA 4DZ2A 3JYMA 3GPKA 3UI6A 1BKFA 1NMVA 5D75A 2XP5A 3UQAA 1FKKA 3O5MA 3TDBA 1KT0A 2RSEA 3KABA 4C02B 5HW8A 2F21A 1Q6UA 1B6CA 3JYJA 4DRKA 1FKFA 1D7IA 3IHZA 2MLZA 3PRDA 1FKIA 2ZQTA 2ZR4A 3MDYB 3NI6A 3O5OA 1NSGA 2KR7A 3KAIA 2KE0A 2UZ5A 5DIUA 4J4OA 5HT1A 1PINA 3IKGA 4ODPA 1M5YA 5BXJA 2M08A 4LAYA 4DIPA 2JZVA 4FAPA 2RUCA 1FKBA 4BF8A 3O5JA 4DRIA 1FKGA 1J4RA 2D9FA 3UI4A 5HW7A 2MPHA 4DRJA 1FKDA 3O5DA 3TCZA 3CGMA 3KACA 3KAFA 3KCEA 4TX0A 5DIVA 1P5QA 4MSPA 1FKTA 1D7HA 4DT4A 2ITKA 2LKNA 1ROTA 1FKSA 3O5PA 3I6CA 1Q6HA 3UF8A 3KAHA 1FKHA 3PRBA 1Q1CA 4DRQA 3VAWA 1QPLA 2RURA 4TW7A 4TW8A 4ODMA 4DRPA 4JYSA 2PPNA 3O5FA 2OFNA 4JFKA 2XP9A 1ROUA 3ODKA 4ODLA 3O5IA 4LAXA 1QZ2A 3JXVA 2XPBA 4TYOA 3O5LA 3KZ7A 2AWGA 2F4EA 4U86A 2FAPA 4W9PA 1HXVA 4QIBA 4U84A 4ODOA 4NNRA 3CGNA 4JFJA 2MLXA
chains in the Genus database with same CATH superfamily
1AFIA 1S76D 1N1LA 1RT7B 3VCDA 3ATKA 2YKQA 2JRSA 3BSCA 2OKQA 1LWEA 3PJWA 2DT1A 1YK9A 3SGAE 3PYDA 5DM6Q 1RT7A 3ENVA 5K8MA 2RD5C 2MGZB 1GGDC 1H9HE 2YBVA 1UPMB 4KPYA 2VIVA 3AODA 4FNIA 2LXUA 1O2WA 2WBMA 2M9KA 1FKJA 3DRYA 3DLLQ 1EB2A 2XS7A 2EG2A 5HVFA 1ZSJA 1FUJA 5F41A 1SXLA 1RD6A 5A0CA 3W94A 4NLWA 5HROB 2R7WA 2P9GA 5MLCV 3RGIA 4PQAA 3TNSA 4DPYA 1NNDA 3AAVA 1EHWA 5EN1A 3QO9B 2VC1A 1H7WA 1AI8H 2FP7B 3ZZ5A 5KT4A 3V81A 3L6PA 4YMEA 5IZHA 1HRTH 5EJ1A 2FLNA 1SI5H 1RTLA 2KKHA 3NK8A 3PVXA 1ARCA 1OIAA 3NS7B 3RBZA 2GAHC 3T27A 2Y8WA 2VVCA 2GIQA 2UUBJ 4ASHA 4MTVA 2HFOA 1VOMA 1IQMA 2R7VA 2AJ4A 2FVQA 2PMHA 1RTHA 4ZLLA 1EOJA 4JYTA 1PQ5A 4F50A 1U1QA 4RU9A 3ITHA 2R3YA 3BGFA 1WWHA 3L3CA 2MHEA 2QO3A 3CJ0A 2VF3A 3OW2R 4Z37A 1RWUA 3PACA 1S0OA 1U6QA 2WSFC 2XSJA 2EPIA 5A8KB 1KVJA 2PGBB 3RDZA 1UZHA 4K4ZA 1OKXA 2KN4A 1FDDA 1O2GH 2KO7A 4FXGH 3DCAA 3SHAH 5L46A 3P92A 5HMZA 4O4GA 1UVPA 4P8UA 3P8NA 5ETSA 1GQEA 4U9RA 4G1QA 3T1YJ 4GC7A 1R3NA 2OEJA 1Z71A 1ZTJA 3J81U 1CJTA 5LPRA 1QL9A 5GVQA 2BJ1A 1EQ9A 2CHAB 1E6ZA 3MNCA 2QL9B 2ZBIA 3OXLA 5F3ZA 5EWGA 4F04B 3MM5A 2FYQA 3SCKE 2Q5AA 2HWTA 4OZLA 1DLOA 1O2MA 2J94A 1HUTH 2RUQA 3F0PA 3A83A 4OHWA 4F2RA 5KFSA 2PKAA 4JK6A 1DWEH 1V5IB 2FDAA 2DH7A 2DE9A 4HI3A 3E2EA 1FEHA 3ZZCA 3PR9A 1JWTA 4AORA 1FRMA 3ETOA 1J4RA 2FOHA 4LK4A 2GX8A 2IMWP 1SB1H 3M2RB 1KLNA 1Z1ZA 1P9SA 2B8QA 2O8LA 4DX5A 1P01A 1TMTH 3AOCA 1HNZF 2ZI2H 1ESBA 2FIRH 1KHVA 2RILA 4MAVA 2FO9A 5K7RA 2QN5T 1FY1A 3SDEA 1HB0B 4NYOA 4DPUA 5KG7A 2CJYB 1C9TA 4X2VA 3KN2A 1X0PA 2YMSB 3NRKA 2AMCB 2LKZA 1BUIA 1M5HA 2XNIA 5CMXH 2M0GB 1RUSA 3BN9A 1JVWA 5EXNA 1SGNE 1E1QD 1ELCA 4KPCA 2A2QH 5LGOA 5EJLA 2HNTE 1RKIA 4GPGA 3NY0A 2Y5FA 2MMYA 2H48B 1C5TA 5IC6B 4X6PA 4CLUA 3MURP 3Q2SC 2UXDF 2IRYA 4RO0A 4FVBA 1UP1A 1HNIB 2EC0A 2R2UA 3O8CA 3CD6S 1P8VC 3SU2A 1S1UB 5KFXA 3R97A 4OI6A 4LRAA 2VKZG 1X5OA 1GMWD 5EGYA 4IS5A 5E2OA 4ECZA 4ABDA 1F8AB 1HDTH 5EW2H 3HXMA 4AY1A 2HQFA 3HK6B 2K7KA 1T31A 4DUYF 1S0RA 2UUAJ 3KLEB 2OLHA 3A8BA 5FD1A 2L08A 2XI2A 2ZCHP 1AUTC 2HS3A 4BAOB 3CCRS 1FD8A 3DRPB 2VH7A 1GBKA 4GHTA 4I2QA 2ZUAA 1CLFA 1DQAA 1MABB 3VB3A 2KB2A 1FY8E 4FU8A 4ZPAA 3CMQA 4EEYA 1ZM9A 1AUJA 1EPTB 4PYAA 5DP6A 3U8TH 2H51B 1AE8H 3GONA 1I3OB 1JLCA 2XPBA 1MKXK 1SFIA 2RDLA 3T5LA 2XYAA 1IBCB 4B2BA 5HJXA 1ELTA 4B17A 3VB6A 3K65B 1BHXF 1DAXA 4NRUA 1K0TA 2DK2A 1FJDA 3A3PB 2FESH 1A1RA 4LBPA 5HBMA 1HIAA 1Z4UA 2QGFB 3SSQA 1K1IA 1SB6A 1TUGB 1THSH 1XR5A 1OOKB 4DCJB 1VC6A 4YOJA 1GL1A 4DV1J 3MM7A 3SNEA 1TP7A 2LA6A 1NJYA 1O5GH 1CT0E 2NU1E 4ZVRB 3TAQA 4PWWA 4BAHB 1SGDE 2Y1JA 1BHXB 2ZWPA 3HVAA 1ZM3A 3M2UA 3OAAD 1RP5A 3I0RB 4GUXA 4ZPBA 2JH5D 1X4DA 1JKHB 3FSIA 2ALVA 2MZSA 2PD1A 4YFUA 1W1VA 2MHNA 5ITHA 3EMTA 2CJIA 4DQQA 4PRFA 1BWEA 5IT4A 5M2UA 4AQYF 1T03A 4DWSD 3LP0B 3HK3B 2DSUA 1MMNA 4NZ7A 2POKA 4RLEA 4D3HA 1MTSA 1OSDA 2YNAA 1FIWA 1NEEA 4PQUB 2DH8A 2FJVA 2OTJS 3J7ZT 3BS9A 2KFZA 2Q6FA 4MSPA 3L4BC 3RXLA 3TIUA 1NH7A 1FKPB 4DV5F 2PN0A 2P16A 2ZFRH 2UUAF 2U1AA 2KAIB 3FEXB 4JFKA 4J9SA 3FVYA 4DR1J 5J2MB 2W9CB 2FJDB 3K57A 4INLA 3ZTRA 3DKDA 2JC0A 2ZOMA 5GAEU 4AG2A 5KFWA 1JLQA 4I33A 3K58A 2OP9A 4FZVA 3GIRA 4NMXA 3C14A 1JLQB 1T9TA 3ZVFA 4ZP6A 4E2FB 1GBFA 4RW9B 4ISLA 1O3OA 1NJZA 1GHBG 1DY3A 6FD1A 1QR3E 2XMVA 4GGQA 1XMQJ 4Y71A 3C66A 2KVIA 2H5IB 4P7VA 2DNLA 1LKBA 1C2KA 1HJ8A 1EQ3A 1QTNB 4IYQA 5BJRA 2AP6A 4ZVOB 3JB9k 1SUQA 1QFKH 4KQZA 2FGOA 1GI1A 3N7EA 2QRRA 4A8OA 5EW1H 4ZH8A 3TGIE 1TX6A 4DV6J 2GV7A 2KYZA 4KSEB 4X65J 3OR1A 5B0GA 5IFMA 3W5ZA 4W5UA 3ETMA 2BLWA 5EX3A 1QSLA 2RUGA 3H42A 2AKWB 4F26A 3ILOA 4EK2A 5HT1A 1PPGE 1C1OA 1WC1A 1QB1A 3BGLA 4KFBA 4CR9A 4ZVEA 1DICA 2FTMA 1K1LA 1FRXA 4MT1A 2BB4A 1FVQA 2XMJA 2B9WA 1Y5UT 3CCJS 4NASA 2BVXH 1SCJB 1EZZB 3U69H 3GJQB 2A1BA 3SUGA 2FI5E 4X1PU 4ML4A 5LL6d 3AS3A 5HLFA 2EULA 3CMAS 2STBE 2FZKB 3N01A 3TJUA 2KVQE 5DDPC 2B51A 2MQPA 2YX1A 2SGPE 1AYEA 2ZDAH 3KAGA 4ISIH 2F2DA 3OXFA 3TK5A 5B09A 3SYZA 4IMQA 3MEEB 4WFXA 1UWBB 1H2TZ 4EMDA 2BDAA 5KFAA 3A7YA 3J81j 1GJ8B 1LFPA 4IH7A 2A7JA 1IQTA 4ZPTR 1GMHG 2BM2A 3OY5U 1UA0A 2E5IA 1EQMA 3M2UB 1QBVH 3K7RA 4Y2KA 3AY0A 2Y1IA 2UWPA 2Y3YA 4I8GA 4LF8F 1TGNA 3HVTA 1XMOF 3KJVB 5IC4B 1E6VB 3A1YG 3O8DA 4J91A 1A7GE 4QWEA 3Q8SB 2BZ2A 2ODQA 1RADB 1UTQA 3FZBA 1UWAA 3Q77A 5KECA 4J5OA 2D3OR 5DRKA 3SI4H 2CRLA 3MZIA 3F2HA 2RF2B 2KXNB 5B6OA 2CG4A 2B4OA 3ILJA 3F44A 4BC7A 5HSPA 1SH2A 3KWMA 4X4QA 2XLKA 2FI4E 2HVZA 1SJQA 2F43B 4C8ZA 4RW4A 1B0FA 2AJQA 2Z30B 2QF4A 1L4DA 2V2KA 1P2KA 2Z9GA 1ZMJA 3EWGA 1GCDA 1TKDA 1E79D 4L72B 3GFZA 3PB1E 4LIRA 1EIBA 4Q8FA 3QGIA 4PKDB 4DG4A 2BABA 3SU1A 3BTEE 1FKOB 1HPZA 2W9CA 1HBTH 2ZQ2A 2ZJPQ 3VTIA 2E5HA 2ALZA 1KONA 2G81E 2XOKD 2CVEA 2AHOB 4Z1MD 1YBUA 2Y78A 3FNNA 2IM2A 4KHRA 4A4JA 2XCFA 1F5BA 1W9VA 3UDEA 3FZZA 3ZZ9A 3GY5A 1FE4A 2ZOFA 1GDQA 4C3MA 3IR6B 3HJFA 4CRDA 2VJ1A 1ID5H 1E9LA 2GCTC 3KADA 4LQ9A 2BYCA 1N4LA 2IJFA 1VQ4S 3ALFA 4M1KA 2X7IA 4QWCA 1P3CA 3ALGA 2DNGA 2BD8A 3E51A 3MMJA 3BZQA 1TNLA 1AZZA 3L3TA 1O32A 2JH0D 3PFEA 1T11A 4A1VA 3JAMU 4PG8A 1QTMA 2Y82A 3P5BP 1PJ7A 1QBOA 4RUCA 3DOLA 1V2UT 2ZD1B 3D2WA 4Y7BA 4USHA 2F9DA 2W2OP 3US5A 1R0BG 3BH6B 2P5VA 3M2VA 4ABIA 1XIQA 3R8YA 3BGUA 2OEKA 2JC1A 2UWOA 4JI1J 1FK9B 2VG6A 5FDLA 2LELA 4CH2B 1W7GH 5KFMA 3PYGA 4FBTA 2PHBA 1HAOH 1Z8JB 1IKVA 1VGCC 1IUJA 3GJRB 1EJMA 1ZZFA 4ZVFA 3M6UA 3LU9B 1TA2A 2ZECA 3VVTA 1VRUB 2GS8A 3W61A 4HR2A 4FUGA 3K89A 1NDKA 3I96A 2C93B 2EXUA 2VQEF 3HVTB 1E36B 1Z1IA 1V5VA 3TJOA 4ODQA 2HFUA 3V13A 2LPVA 1TUVA 4FUJA 1UA1A 3GYNA 3BO4A 2K1RB 1H8ED 4KR0B 2IHR1 1NU9A 2JHEA 1QAYA 5HIYA 3LGVA 3NRBA 1UCYE 1CBKA 4CCHA 1YZ6A 2DIVA 4UEHH 1UMJA 3MEGA 4ZDNA 1S5SA 3T1YF 4DL3A 4Z6AH 2V63A 3FOAA 4F4KA 1EAWA 4AB9A 3OUYB 1GK8A 4NZ6A 2V7QD 4YR0A 2WM0A 2Y5HA 1Q7YT 3BIUH 1GVKB 5AXLA 2FLBH 3ZZTA 3I77A 4M5DA 2VL1A 2E66A 3K9XB 1YX2A 1OWKA 3GICB 1RHUB 1N5SA 1QSSA 4LT6A 2BE2B 1FKIA 1U0HB 1NSQA 2PMZD 4F0MA 4X8VH 3CZ8A 3ZTPA 4ECXA 4I8LA 1YBWA 1J8AA 2P2CB 3DDKA 5AXMA 3TQ1A 2N3LA 2ZC3A 3SEOA 3FVFB 4NXNF 2M88A 3WC0A 1KXDA 2OBQA 3EPGA 3DXBA 3V5RA 4ZVPB 3KHVA 3Q8VA 3NAIA 2WPJS 2ULLA 3SU3A 4OX6A 2U2FA 3HFKA 1Q4RA 2XO6A 3EYZA 3U8OH 3CJRA 1Y59T 1H38A 1GCTB 3PMHB 2IF4A 3KEEA 1FJGJ 4DR6J 4DR4J 3CDUA 1LG2A 4NLQA 1F0XA 1DTTB 3FFGA 2UUKB 4B2AA 4ISNA 1T32A 4WTYA 1L1NA 2X1GA 3G86A 1RWWB 2EFQA 1U1RA 2ZKSA 1PC5A 2W7OA 3FAOA 3QYYA 3UOUA 1U24A 2W3IA 2EKNA 2EA3A 5JYIA 1NM6A 1HMVB 3MECB 4LBIA 2FHKA 5CYMA 2JEFA 5B0BA 4MTPA 4O0NA 3V2UC 1YKTA 1OQ3A 1FE0A 2R0LA 2ZWLH 4NLUA 1RIWC 3M05A 3LWMA 2YKPA 1LXNA 3TEGA 4Q2MA 2VV5A 2XCPA 3IBCB 1U26A 3HSGA 4UD9H 3KYLA 3KDOA 2BUNA 2CQGA 4TVAB 1RQ0A 3F56A 3CCQS 3QMQA 2J95A 1HR0F 4N47A 4NI2A 1IHSH 1GHVH 1SGIB 2ZM6F 2ZDPA 1C1TA 4OYPA 2D74B 1QIXB 4OLOA 3OU0A 1R89A 3V6DB 3PKMA 2AEFA 1VMBA 1SKYE 1YWXA 2R2SA 3JYJA 4X2XA 3QX5H 2YNHA 2ZQTA 3MWIU 2WV9A 1TOMH 4GCHG 1R8BA 2PEHA 1X60A 4GSOA 4DRIA 1RBLA 4LREA 2ZU5A 4JV5F 4DRJA 1OWXA 3KACA 9ATCB 1WKLA 5KFFA 3OV7A 4FNHA 2CF9H 2GQQA 2NU0E 2W01A 4YOEA 2QLWA 4TY8A 1OQ6A 3KOAA 4F8RA 3DI6A 4CM0A 1O51A 2F83A 4M9FA 4B9SA 2VWOA 1EZUC 1HI0P 4MPKA 3LAKA 2MLXA 3LDXH 2QIFA 1C1UH 3UNSA 4ECRA 2FZGB 4DSJA 2R7TA 1M5OC 4GKJJ 1HAHH 5CYQA 2BX3A 4MPWA 1HAVA 4R5PA 5KT5A 3TU7H 3CDEA 1P2NA 4QIEA 5A0YA 1BCUH 2FPHX 2SXLA 1VBXA 2VFVA 3GR1A 4NLOA 2G13A 1BBRK 2AJ1A 3TUIC 4VGCB 1CJVA 1HNZJ 2EKYA 1UTNA 3UNGC 2L9NA 2XXLA 1C1CB 1WD6A 2EFGA 1FN8A 3BTDE 2W4CA 2WONA 2QIQA 3RTVA 2W6JD 4ELUA 1GRJA 1QAXA 1HXFH 2COLA 3TWZA 3NAHA 1S1WA 4X65F 4ED2A 2FZZA 5ETNA 2I2YA 3MU8A 1BTHH 2VIOA 3ARUA 2P94A 1FWLA 3SI8A 4YESB 3H7TA 3ZXWA 5HROA 2DR6A 1D3TB 1HHTP 1H98A 1GI4A 4MLFB 2KTQA 3CMES 1MU6B 1ZL1A 1NAQA 2DO0A 3GV8B 2OUAA 5B08A 4J9MA 4ECVA 2HQIA 3J7Z5 3BTQE 2WSSD 1T0TV 3ARPA 4F02A 3KGPA 4DN9A 1YZ7A 3SZEA 5HMYA 2WHXA 4L74A 2CQ3A 2H4YB 1ESAA 2W8LA 4WK3A 1YI2S 1YLCA 4OX9F 4RT1A 3AVZA 1JLEB 2OFGX 3OL6A 3N9UC 1FI8A 4PUOA 1B64A 1WJ9A 5J2NB 1YW5A 1KC8T 3O1LA 4CLPA 2QXHA 4J9KA 3BYPA 4RW6B 4ABJA 1RKJA 4J4NA 1U8SA 3U1JB 2MQLA 2J98B 1F40A 3KNXA 2OINA 1ZSLA 4BTTB 4HTCH 2HQGA 1VR1H 2TBSA 2AQ4A 4OS1A 4H4KC 4X8UH 1UAWA 1YIJS 2AT1B 4UQTA 5IOLA 1ITXA 1RD3B 1H2VZ 4ZHMU 2W9AA 2VBXA 2HGLA 3AB4B 1FJGF 1S82A 1BBRE 5GDSH 5CE1A 1LO6A 4IOBA 4BAKB 2ZZTA 3T29A 1VCWA 4NZQA 3OFND 4B3OA 2DXDA 4HH1A 5GNDA 2ROPA 4X6OA 1O5JA 1HARA 1TLDA 5HO4A 2BR0A 1Z1JA 3M9NB 1WSSH 1VQYA 1FKBA 3LP1B 1FKGA 3TA2A 1IWAA 3UI4A 3NOCA 2Q3PA 4WF8A 2HRVA 3KAFA 1GL0E 1C5NH 3C16A 6FDRA 5C1YA 4DL0C 1DWBH 1Z6JH 2OEMA 2XGPA 2OC8A 2G2OA 4KV8B 3V81B 4TW8A 2VINA 2QXGA 2F7VA 2H3EB 1BITA 4L76A 1DJ0A 4B9VA 1MW7A 1UTOA 2BY5X 4UFDH 4X4PA 2XYHB 3SXLA 4DEZA 4EGLA 3LPRA 1EHNA 3PNIA 2CNOB 2GQCA 3I9V9 1WKKA 3E6PH 3NBPB 2DGVA 1GJBB 4YLQH 4JFMA 4RR5A 4BAQB 2WOMB 4NXMF 2NXJA 4WH6A 1PKUA 1D0EA 4MGVA 3FFIB 1LQDB 2KT3A 3T6BA 1EQ0A 3KHHA 1PIEA 2MQNA 4RKOB 1SGYE 3HULA 4SGAE 4JV5J 1IQJA 1NBEB 2A3BA 4H4KA 2XHWA 4TNSA 2W7SA 3G6XA 3OSPA 4C0OC 3I78A 2EW9A 3KMSA 2BX6A 1ZS6A 2W7PA 4U6PA 1AVGH 3MDFA 3BSNA 1EOLA 1NLKL 2KM8B 3SU6A 2H2ZA 1BTXA 1HAVB 3R0FA 1SKWA 3HKJB 4ALZA 3M61U 1XNQF 3KF2A 1BQMB 5DEZA 2Y1LB 1O5FH 5ETQA 1KR4A 4R8TB 3VQSA 1XMOJ 2IA0A 2F4LA 2V69A 4LRDA 5DJ7A 3JSYA 4M5NA 2KZMA 1LWXA 2B9EA 3HKIB 1JLBB 2LA4A 2CQIA 1RT3A 1T9VA 3RXFA 1HKIA 2JETC 3CHEA 1JNEA 4NZ0A 5DM7Q 1FKSA 1KD1T 3H7OA 2DGTA 3M32B 5GPIB 2MTLA 1J9CH 3E8LA 2WOMA 1JRSA 2FEQH 2O9OA 4U67Q 1V3RA 2IC3B 3U28C 3UNRA 3IC1A 2J0SD 4Y3CA 3RB6A 4ID8A 2GMJA 4ECYA 4U96A 3OSNA 2HLTA 1BJVA 2YNHB 1AZ8A 4MPVA 3NMRA 5HKKD 1TRMA 1C1RA 1LKZA 1HBMB 4C8YA 4XIUA 1FWKA 4YT6H 3K5OA 1OWJA 1QTFA 4RW4B 4P8VA 2DRAA 1TA6A 2C8XB 4JCNA 3PV4A 3GCNA 4OYIA 1C2FA 1TRNA 1JWWA 1Y8TA 1EKSA 3SGBE 1TPPA 1SV5A 4P75A 2RRAA 4QW9A 2VPWB 1LKAA 1P9UA 5FJ4A 4Z7CA 5IV3A 4CRFA 3O2IA 3QIPB 4J9OA 1ELDE 2G41A 2AIQA 3M7QA 1P1LA 1HMVA 1TNJA 1VK8A 5B8IC 1ZHMA 3IITA 1YJUA 3VAKA 1UL3A 1BMQB 4DOQA 5L2YH 5F0WA 3SFGA 2CF8H 1WHWA 1LWEB 1FAKH 1QURH 3OL8A 4R0EA 1WU1A 3MR6A 8GCHG 4YB1P 2RQKA 1IAUA 2ZHDA 5A8RA 1BQXA 1U1KA 2DBBA 1GVZA 1TZ0A 1WDIA 1RTDA 1IHTH 1BQNA 1KOHA 2RU3A 3U8RH 4MKAA 1H9LB 3B82A 1D3QB 3JSMA 3MHYA 3HVWA 2J98A 3R3TA 3ZZ8A 1IKWA 2BJ3A 1MKXH 4D76A 3CCTA 2LP4A 1TKTA 3HT0A 4AFZA 1FEEA 1G37A 3TLOA 3SW2B 1QNJA 3RRGA 4E8UA 1KXAA 2IOTA 1FNOA 3MM9B 3RU4T 2QGRA 1K0HA 2MGZA 4JFLA 3LOUA 4DFJA 1WB0A 3HMJG 3QTOH 4PXDA 2CPIA 4HT7A 3T62A 1MQ6A 1GJ6A 1JX4A 1YBTA 2G4BA 4MIBA 2FODA 5AFZH 4DQPA 3WC2A 4URIA 3PW4A 2PV9B 3KQEA 4NFFA 5K20B 2G1HA 2VB6A 3ZYDA 3KUGA 1F5LA 2XP7A 2NS1B 2FQQB 2ZA5A 3D9BA 1JNDA 1BTZA 3TITA 4R5PB 5DGAA 4DS5A 1P05A 1IWGA 1LVYA 3GCWP 2C42A 2NZCA 5LM7E 2YTCA 3MOZA 2JLGA 1SGFG 2ZPSA 1BXNA 1WUUA 3DLJA 5KT3A 4HHJA 1JMOH 3W62A 1SQGA 2ZKUA 2PPOA 4URSA 1FMGA 2FB0A 5KT7A 4AN7A 4IRKA 1DXWA 4K59A 1WQSA 2E1RA 1GOIA 4X1SU 2LEBA 2ZDVH 3PV5A 1HNXJ 2J0XA 5FCRA 3K2YA 2VA2A 4MYTA 2DUCA 2ODPA 3ZVDA 2DVIA 2EG1A 3BKUA 3VGTA 2BOPA 3Q22A 1HAZB 5A6WA 1RAGB 3FANA 2MKIA 4WMFA 4MKYA 2VIHA 1YP9A 5GJ4B 1HAPH 1P2QA 1UFKA 1IKYB 1J5EJ 1H7XA 4H4MA 4MPXA 3GIMA 3GYLB 2C3MA 3JQMA 2CJXB 3GZ7A 3WY8A 2XM3A 2RHQB 1ZR0A 5I46H 1NHKL 1QRZA 1YLXA 4RNFA 2W26A 3MH5A 1W8BH 3L7PA 2BY6X 2UXCF 1ELGA 3ZV9A 2QSWA 1AXQA 5D4PA 1UCYK 3WD4A 3AA9A 4F49A 3MUTP 4MK7A 3B23B 3CDWA 2GMLA 5HBFA 5EHHA 4OFZA 2B9LA 1P1TA 1D8YA 2ILZA 5KT6A 3NEKA 4HKQA 2BD5A 3DI6B 5J2QB 1KS2A 3DFEA 1E15A 1LW0B 2WYJA 4FDFA 3ATMA 1RAFB 5KFCA 5DDRC 2YY3A 2C90B 5D4OA 2H5EA 1CT4E 1FY3A 5TCAA 1VBKA 1BHNA 1YJTA 5HQLA 1B0VA 4B9MA 1O0DH 5KFVA 1TKXB 2ZDOA 4ES2A 3RXKA 2C3PA 5HI7A 2HHVA 2RT3A 2OTVA 3BH7B 1PAUB 1S72S 4ELVA 1HFEL 1N32J 1NH8A 4BBYA 4WJBA 3JAMY 2ASJA 1FK9A 4TY7A 1SMFE 4GLYA 5HVGA 2LDYA 1WV7H 1CJKB 2V8GA 4NA2A 4CIOA 5I3UA 2D41A 2A6MA 4PXEA 4DUZF 2HRYA 4QCLA 2FY1A 3I5BA 1E6RA 2F9VA 3TNVA 1FWPA 5JH8A 3ISZA 3EE7A 4DFMA 3GPKA 2XP5A 3MH4A 4ZS6A 5HW8A 1PO6A 4E05H 2FOGA 2MEWA 2UVVA 2WLZA 3UNQA 1Q8BA 3F0NA 5EOKA 4K69A 2DO4A 3O5JA 1LL7A 6LPRA 2XTTB 3MECA 5KFTA 2I8EA 1JXPA 1SL3A 3M3VA 4YZUA 4ZKAA 5GAEI 1THPB 2M70A 1S9FA 4ZN1A 3H90A 4C8MA 4UQGA 2DSWA 3UD3P 3OY6U 1N8OB 4ODLA 4HARA 5AVDA 1ZM2A 4OI3A 3ISNC 1UJ1A 1RLCL 1Y4ZB 5KEDA 1YDLA 1Q78A 1RK8A 1WF0A 1D09B 2YKAA 3H20A 2RQCA 1HWIA 4H4OA 5DGJA 3GYGA 1MZAA 2HHXA 2VONA 4QYZJ 2R8HA 3GCHC 3VGCB 3Q89A 3AOBA 2GJFA 1DT2A 3TA1A 2CPFA 5KFGA 1C5WB 1TNIA 3DDIA 4HT5A 2MQOA 1V2NT 6ESTA 4H54A 3AS1A 3D3BJ 4W9QA 4ED1A 1VQ8S 3ZIAD 1THRH 2M2AA 1TGSZ 4LF6J 2ZVIA 4AFUA 2L6OA 2G1DA 2ZH2A 2VWLA 3M3SA 3BF4A 3IBFB 3NKYA 2BJDA 2VZ9A 1L3SA 2OSRA 4C0BA 4F3OA 1F92A 1URNA 4F4WA 3A82A 3F73A 5GMEA 1S6HA 1NMVA 1RSCA 1YYY1 5C0UA 1UVIA 2AYMA 1UVTH 1YCPM 3KLFA 1C5YB 3CJ4A 3MEGB 2AMDA 3SUEA 5DIUA 1D4PB 4VGCC 2V3MA 3RRKA 5GCHF 1VITF 4MVNA 2V0NA 2Z58B 3WBZA 4IRDA 3J7YI 1ZTWA 4WKFA 3BO3A 4YLUA 4WE1A 2GTBA 3CCMS 4F67A 2HHHJ 3M8PA 3EA7A 3W3SA 3DLEA 1C0UA 2FMJA 5KFOA 5HJYA 3MMAB 2Y7XA 5HM2A 1P0SH 3MEKA 4TYDA 1RT2A 8AT1B 3P4UB 2YWHA 3KZ7A 2F4EA 2OXSA 3OHBA 2IJNA 5CCLA 4NNRA 3UD4P 1EJAA 1Y3XA 4X4TA 4PPZA 3V4IB 1GDUA 2LLZA 2Y81A 3ZZUA 3R5AA 1SQOA 1YPHC 3NCLA 3RXTA 1G3CA 3JXOA 5D0RA 3MCMA 2XWAA 2BM1A 3CF5Q 2KG1A 2W2PP 4C48A 1W1YA 3RC5A 3MEDA 3WIUA 1DLEA 4A8MP 2LYVA 5GMKa 3NNHA 2GC8A 3TR5A 5ETKA 1DUEA 3PLKA 5A8XA 1AUDA 1S6QB 3A13A 3RU4D 5C1XA 4B9TA 1S7HA 2ASUB 3D0GE 3C27B 1OWDA 1FX2A 2R3UA 2QXJA 1Q5VA 2IDEA 3H8YA 2ZGJA 2HWLB 3AS0A 2OJ3A 1S83A 3RXMA 4IFVA 4F25A 2A4GA 2BMBA 3GFXA 1OPHB 2QXIA 3UCUP 3MEDB 4WXWA 2K8GA 5FBIA 4FS2A 2NYHA 4DPOA 2MZ1A 1QB6A 1SFQB 4MNXA 1S1VB 3A88A 5CD4H 3KLHB 4GVBA 1MN7A 1QSYA 1P6TA 1NSKL 4KKOB 2DIUA 1ZB5A 6GCHF 2F9BH 2F3JA 1E37B 1Q1CA 4AD6A 3BG4B 4OJHA 2V8VA 1RAIB 2GDDA 2RDEA 1X5PA 1UK3A 4ZAEA 1W10U 1D3PB 8ATCB 4I67A 3UUZA 3RBXA 4U8YA 3HI9A 3EE0B 4PXBA 2HFNA 2C4FH 1O3FA 2ZZNA 1KLTA 1MLAA 3QNWB 1RJXB 4XTTA 2OCVB 1JJHA 2ZH4A 3A3OB 3Q76A 4UW2A 4O2TA 2HFVA 2IYGA 4NA9H 5T6FA 4ISOA 2XBPA 3CNRA 5L1IA 1S1TA 4F4XA 4I8JA 1MAXA 3B9EA 2QMWA 3BGRB 3WKZA 3KLFB 1H73A 2ZHBA 4DRMA 1O2TA 1RTHB 3FZDA 4NXMJ 4NYZA 3B4MA 2H5JB 1S0VA 1PBKA 2FI3E 1O5EH 3H0PA 4X8TH 4ZN3A 2BANA 1SR0A 4TY9A 1K1PA 2FJBB 2HS4A 2PGQB 3D1HA 2EFNA 1NC6A 3IAM9 3UN5A 3T5KA 4HEA9 1UVNA 3W1EA 3WZ0A 3B7XA 2J0QD 1S0QA 3UR9A 5DP4A 4PABA 1Q7LB 1NO8A 3PWCA 1AN1E 3DU5A 2AGGX 2DHHA 1P12E 4NA8A 1F60B 2QN6B 1GXTA 1T03B 1B6CA 2DXEA 1FONA 1CHGA 3L7OA 4YR2A 3PFOA 2WW8A 1HD0A 1QJHA 1JKHA 3PDNA 4BWJA 1Q81T 1F0RA 5D4LA 2IBOA 3KHRA 1XKBC 1V3SA 1CJKA 3JYTA 2C2DA 5DLGA 2ZH9A 4A48A 2O5DA 4THNH 4Y2CA 5H9EK 5ETTA 4F36A 1QQ4A 2YPYA 2ZU1A 3DMJB 2VNTA 1VI7A 1HQEB 2IAJA 2GA7A 2B43A 1SGCA 1JK9B 4DR4F 1CQMA 1V2RT 2CAJA 1XUFA 2KT5A 1U09A 4MNYA 4DIHH 1DBDA 1U1NA 2UUTA 5CHCB 3QTVH 3G8TA 1SIWB 1G6BA 4KYZA 3LW5C 1ZM4A 3PR5B 5DLFA 4DU8A 2Q6CA 4ISHH 4TYBA 1XXDA 2LXIA 3RG6A 3FSYA 3ATLA 2P6SA 3THTA 2RUDA 4C6AA 2B8OH 4I6YA 4DF4A 4KGMA 7LPRA 1FD9A 3BR9A 3KXDA 3CP7A 5I3UB 3ZZYA 3IS9A 4WKYA 1Y3VA 1W26A 1ICEB 3KL6A 3K5PA 2ATCB 1FO1A 2OELA 2Q66A 3D6MB 3IAS9 3LPYA 3AOAA 3T26A 3UDLA 1UR8A 2Z94A 9RUBA 2BRLA 2M52A 4ZROA 1ZK6A 2V50A 3D1OA 1UCYH 5DZ7A 2IVFB 3N28A 2FYRA 1D7IA 4C2MA 4GVBB 5LMUJ 1B99A 1HHSA 3CO9A 1DQ9A 3H98A 1RAJA 4ZLJA 2IM1A 2YOLA 5KFHA 1VCTA 1Z8IB 3AQUA 3B9FH 3BMBA 4Z2GA 3J7YU 3D0HE 4XRNA 5AE2A 1L0ZA 2UUCJ 3M2RA 3S7HB 1OP2A 3U1NA 3VAWA 2FD2A 3MMGA 2D3O1 3ZVGA 2ZE2B 4DJBA 4D7FA 4LRFA 2ZH8A 3P17H 1E1RD 1YRTA 2ACMA 5K8NA 2W1BA 2HPUA 4Z2KA 1UKUA 3FBCA 3RGCA 1FESA 1AKSA 3C8YA 3CE8A 2B7DH 4QT3A 4O3QA 1RTFB 3SMZA 2CZVC 4JYVH 1GMCF 2YBUA 4CLKA 3B8JA 3CD5A 2E1MC 4LQ3A 1N6QA 3ZNUA 4WK1A 2CMYA 3FSXA 2FXRA 3GR0A 1ZAVA 1VITG 2VPYB 1QA0A 1SHYA 2GCFA 3QZ8A 1TKTB 4OV6A 4ZKOU 3FMWA 1IR0A 2QLBB 4O23A 4Q43A 3ZZBA 4ERDA 2P4VA 1S4FA 1ANCA 4C11A 1HPGA 3NWUA 4K5RA 4JYAJ 1DXPA 5I98A 2EFPA 3ZTOA 2B6AA 1D9FA 1C1QA 1QLNA 1EPTA 1FQ3A 1GXUA 2MZJA 2AERH 1ZETA 3O5MA 2QA4S 1VLOA 3IHZA 5GQBA 3S9CA 3LP1A 4B3RJ 4PYDA 5CHAB 1RI7A 3LA0A 5CZXA 2ZU2A 3GCOA 1WYKA 3CENA 3UOPA 1ROTA 3OFGA 2M8HA 3MO6A 1RWPB 3C3LA 3E90B 2NLWA 4RL1A 4IN2A 2GVFA 1CJTB 5F9LA 1UW7A 3EA8A 4A6LA 2B31A 4ZHLU 1EDQA 2QC2A 5HMXA 2XO7A 3H2VE 3L7UA 5G4DA 4LFCJ 2L2SA 1EETB 2STAE 2QF5A 5E0HA 9LPRA 4MNWA 4O3SA 1HQUA 1XUJA 3OOBA 4ZK7M 1T05B 1QAIA 1IN0A 3D4JA 1RXPA 2ZPQA 3HHKA 3QAEA 1UR9A 3Q8PB 4GKKF 2YKNB 1AY6H 1DWDH 1W13U 1U1LA 2HNYB 4DCPB 2HNDA 1YC0A 3P49B 4M5GA 1D2KA 4MNMA 2F8MA 4IG3B 4UOHA 4DDFA 4A5TS 2ZH1A 1SKSA 1L1JA 1YTYA 3MR5A 2DNNA 3IKDA 4ZLNA 5F8ZA 3GB0A 1W2KH 2VKRA 2IVYA 1T94A 4K2XA 4PUOB 3RLWH 2BDGA 3VPKA 3N6LA 4J9VA 1VISA 2RVJA 1YPEH 2HS0A 2VODA 1REVB 3LGMA 1RTJB 1HJWA 1IQKA 5C2ZA 1QVFR 2DRDA 3VGUA 2F4FA 2PFFB 3ZZ6A 3W2VB 1M5YA 1QJ1B 1L4ZA 3K5NA 3A8CA 2DNOA 2JLEA 1C2HA 2KJVA 1QM9A 1SC4B 1EP4A 4Q7XA 2K1QA 4OL8A 3URCA 1O2QA 1YG0A 4Q22A 1IQIA 2J5AA 1RTIA 1DANH 2GHWA 4FPRA 1G2EA 3LH2S 5K8OA 4FXVA 5FBEA 2AWGA 4CLSA 1Y11A 3K5MA 4X1RU 2CQ1A 5T41A 3GP9A 4ZA1A 2FPZA 4YS2A 3UW1A 4ZKRU 2XTJP 1Q16B 2R8JA 2YWFA 1O2NA 2VN1A 1CJVB 2UV8G 2DNMA 3RXDA 1TAWA 1Z8GA 2FJWA 1HNEE 2ANMH 2WV4A 5A0AE 1H8IH 3OTDA 5AT1B 1TNHA 1M5VC 4UZBA 2ZJRQ 3IK8A 5KG3A 3GIKA 5DG6A 4MIAA 4M5LA 2ROGA 1NK9A 4XDEA 1YRUA 1P9QC 4J9QA 4Y6IA 4YQWA 2WSCC 2AF6A 2ZGBH 4ECTA 4C3KA 2PT0A 1O37A 1JBUH 4B6FA 3OPKA 3QATA 5J4QA 3OTJE 3M6WA 4FYYB 3L95X 5E3RA 1F9FA 2JLFA 3JTNA 1FXDA 5IWAJ 3T9ZA 3DC2A 3OTBA 2PWXA 1KLMB 4RWXA 3EDXB 3RW6A 2KE0A 1VIOA 4IC6A 3IRXB 2HGMA 3CB4A 1O8BA 1D3WA 4ZITA 1HJAC 1PILA 1S9EB 1BC6A 4OI4A 1HNWF 1KLMA 5PTPA 3B54A 4N8NA 4J9UE 3MH7A 4OGXA 5B7WA 5IV4A 3CH9A 2OFNA 3TJVA 3CS0A 2HGTH 2R8GA 1GHXH 1P11E 4EBDA 2DJWA 1FIZA 2NXCA 3V6KA 3D7SB 3NGTA 1LWFA 1WF1A 5DP8A 1N0UA 5DG9A 4UT4A 1WC3A 1OJ4A 4ZCIA 3HD1A 2DEIA 3ITHB 1JOUB 1SJFA 1FVSA 1K73T 4ANCA 1SJ4P 5DP3A 1X5TA 3MUMP 1KLIH 3ENQA 2Z9LA 1B4SA 3HHDA 4OI2A 3SCJE 1IBMJ 1JB0C 4IUFA 2CNKB 3BEUA 1VQMS 3J7AN 1KY9A 1V2QT 2VASA 2OC7A 1HQEA 2IAJB 2ZQVA 2LPRA 3H5CB 1X9WA 4ED0A 3R27A 3RLYH 1L3KA 1ESTA 2AWZA 1HCGA 1K9MT 2V6AA 3POTB 5A09A 1OYEA 1QE1B 4Y0YE 1S4EA 5EWEA 4K0KF 3ARZA 2GD4B 4NI2B 4ELTA 1QCPA 1BWVA 4JI7J 3QO9A 4DBQA 2V94A 3UDCA 1DM4B 5D75A 2Y0SD 2DSVA 1GTHA 1Z2LA 4C02B 4U7CA 2F8HA 4WBFA 1FLEE 1LHEH 2VVUA 1KTTB 2RCEA 3LH3A 4CT8A 2CJ9A 2I6SA 1Z2ZA 1KTVA 5DG7A 1GBEA 3LALA 3BG8A 1GHYH 4WKRA 2XQCA 2NWNA 5J2NA 1EIYB 5IWAF 1RT1A 1SLXB 3BEFB 1C4U2 3M6VA 3AAWB 2BW2A 1KMHB 4R5EA 1TE0A 2AGOA 3K8VA 2HBYB 2BDHA 2A1DB 1AHTH 3JXVA 5L1JA 2GVZA 2AJFE 4EUVA 5E7OB 5EGMA 1HNWJ 1U1OA 1W11U 2FOAA 2VU5A 3JYTB 4UFGH 3BGRA 1W14U 4DRNA 1HLTH 2G2YA 5C5OA 3FO8D 1UHBA 2V3OH 4DV7J 2HNTC 1NY22 1FN6A 2KO1A 4ETXA 2ANYA 3QGGA 1GNKA 4OS6A 6CHAB 3VHQA 1FY5A 2KJWA 3IA0A 2VICA 4FYWB 3W9HA 2C8WB 5HWCA 3HKZD 1T7PA 2FDMA 2GJGA 3PROA 1U1PA 4X4NA 1NJXA 2MZTA 3B4DA 3GG0A 1NHUA 2ZHFH 3RXVA 3N99A 1TPOA 4CLYA 3W2WA 3G6VA 2KM8C 4P00A 2QTWA 4RUBA 1HNXF 3LH1A 3EY6A 1J16A 1WTBA 5ETMA 2AH4X 4OMFG 1RWVB 1J15A 4K7QA 4OS5A 3SJOA 5F8GA 3W8PA 2NREA 1RU2A 3IG1B 5E33A 3RM0H 3NNAA 4Y76A 3KG0A 3LJOA 2XBYA 1EFRD 4A8XA 1JMTA 1LVMA 1WHYA 4F2SA 4I7YH 4ICLA 3T6JA 3SZ2A 1A5HA 1BMMH 1SGQE 4WFNQ 4JZIA 3JSBA 3O5TB 5IM0A 1CSOE 2B7CB 2A3EA 1V2VT 1LJYA 4ZKSU 3O5DA 3M5NA 2PN6A 4O3NA 4DT4A 2Z2LA 4ABEA 4C97A 1KTQA 4F3MA 1QBNA 3GU0A 3K0JA 1QPLA 1ZGVA 3DU6A 4NLPA 3W60A 1ZOMA 1GTEA 3UI3A 2DPIA 1K22H 3OFHA 2H1YA 3GLJA 1S49A 2QF3A 4DLGA 1VQSA 3BTME 1ZBVA 1L3TA 3UQBA 1D9AA 1CQQA 2ZG0H 3CEDA 5IYTA 4DL4A 3FQKA 4ZHRB 3MR7A 5GPRA 3UR3C 2BJ9A 1R7IA 2GMHA 2AGIX 4KTSA 4RUHA 2YWEA 1FXLA 3C46A 1E6NA 3MPYA 2XC4A 4KGVB 3W64A 4AYVB 1O5BB 4CYUA 4JI4J 5B6LA 3IR7B 4DG1A 5D8HB 2W2MP 4RW8A 2F3CE 2ZGHA 1FNMA 2CFXA 2H4WB 1NUEA 3BXWA 3UN2A 1HPZB 1NHVA 1ZCNA 2DHGA 5FCKA 3O5QA 1WCZA 4ZJLA 1TVRB 2RNEA 1FTCA 2UVWA 2Z4PA 3Q3KA 1TCOC 2ABYA 1HXEH 1W12U 4UFFH 4ED8A 4BANB 3UI5A 2J7UA 3CVKA 1EAXA 5H9EJ 3LWLA 1A6LA 4AQYJ 2GAGC 2RHSB 4K4WA 2CWKA 2P9EA 5JVHQ 4DMZA 3RYLA 3OTPA 1ACBE 1L3VA 3M30A 4USKA 5E3QA 2A18A 1Y3KA 2KFYA 2KM0A 4KO0A 1HJVA 1YCPH 1KVKA 1RT5B 2AHME 4DLEA 4PAAA 3PX6A 4DUYJ 3KLVA 2H9EH 2D3ZA 1C9PA 1TL1B 1KKHA 3MPWA 4B3TJ 1FDPA 2IJD1 3UF8A 2V68A 2DGSA 5IXUA 3LKWA 2CN0H 4WFBQ 4IKAA 1SLVB 3T28A 1T8LA 4IG3A 4JI3J 1TNKA 1X4HA 2EI8A 3R2DJ 2QA2A 2OPPB 3ARXA 2HIYA 1CC7A 1NK6A 1ZHPA 4L75A 1SGTA 3UFAA 1U25A 2DY9A 1NMWA 2CQ4A 4FUCA 4N56A 2XMTA 3CJKA 1AZSB 1A3BH 1HWJA 2JDID 4HZHA 2LGOA 7KMEH 4RWWA 2ZTZA 1RWKB 4D9QA 5I4MA 2Z0GA 3PKYA 1PQ8A 4DF8A 4O4RA 2MNTA 2Z7FE 2M5YA 4ZMAH 3WH0A 3GY2A 3MEEA 3C6UB 2XGQA 2EQNA 1GX6A 5HYOA 1ZRKA 4R25A 1UMAH 2ZC9H 3ILLA 2Z3CA 5KTQA 4LF2A 3VAJA 3ZNJ1 1G3BA 3OTOJ 3GYMA 3M30B 1PQ7A 4J2YB 1JLAB 2RMLA 1N32F 3FQLA 3OJUA 4B3MJ 3IWMA 4OI1A 5HVHA 3G6ES 3DMJA 2JL9A 3F3BA 2P93A 2K1RA 1FI4A 2XC5A 1C2LA 2FHJD 3EDRB 1PBUA 3PYEA 4FUBA 2E9ZA 1GMHF 1K1NA 2W5EA 1TVRA 1NU7B 3A8JA 3ZV8A 4B08A 5C5NA 4MG3A 3N5FA 3DSGA 4ZXXH 1YVFA 3MO9A 4GHQA 2QX0A 5JBTA 3GCHB 2G00A 4B3RF 4S3JA 3SQGA 8GCHF 2V3HH 1KNZA 1H8HD 4L73A 2PO4A 5K14B 4FU7A 4H6TA 2R9LA 4U84A 2GQ2A 1GHWH 2J6SA 2XNDD 4UF4A 2UU9J 1SGEE 5L2ZH 4F4ZA 3BF6H 4FUHA 4RKJB 3TC5A 4K0KJ 5HP1A 1LWCA 3ARRA 2SFAA 3SV3A 4HH0A 1C0UB 3GSDA 3M8PB 2IBKA 1NRPH 1QHRB 3HSDA 3PEHA 5J6EA 4FYVB 4J1YA 4WE1B 4YY3F 3BDEA 2J9NA 2AJ2A 1BRCE 1VRTB 1HNVA 1FFRA 3DLKB 5D6GA 1BA8B 1R8AA 2DG3A 4X64F 3KTQA 4DWSB 3W66A 1TV6A 4G65A 4ODNA 4WP3A 2PBCA 4LZ1H 3X3UA 3PTWA 2QMXA 4I7FA 5G0RA 1H2UX 4KT0C 3WD1A 4UOGA 4LF9F 1MSWD 4CBNA 3HPTB 4H6SB 1SQAA 2UUWA 3P5TL 1TV6B 5C0TA 3G6MA 2VIWA 2SGEE 3MMCA 2IPOB 3DLBA 1DURA 4D3GA 2JDJA 4ED4A 2LQ8A 1U02A 1XMNB 2BA9A 3DLKA 4HGCA 2O67A 2DNQA 2P6TA 1RAEB 2K0QA 1P3EA 4KIAA 5KFRA 1I6JA 1B0EA 4LSZB 1SL0A 2XNQA 1IQFA 3MPUB 4JYUH 1YRXA 5EU8A 1KXFA 3CGNA 2TGAA 3SNDA 3CO0P 4X8SH 1ZPVA 1I5OB 4XO0A 1UVMA 1U0SA 1P04A 2H9HA 3VFEA 5A2QU 4Q8EA 2BLOA 2LJ4A 1UEUA 2F63A 1D3DB 1E34B 1C1VH 2WPLS 1N5YB 2QA1A 4WU2A 3EICA 2FYXA 5TCCA 2VG7B 3I4PA 2RQMA 3OR2A 4OX7A 4QYRA 1NCLA 2XY6A 2XWYA 1DUAA 2CQBA 3KFWX 3UWJH 3QFHA 1E44A 1JLGB 2KG0A 4JI2F 2F4VJ 2AEJA 2ZEJA 1N1AA 1S10A 2ZBCA 3DXSX 1WORA 3ILIA 2XS2A 3RFWA 4NCBA 1AZSA 2BBEA 1RT2B 1T8OA 2VPXB 2BD3A 2BDIA 2KXHA 1FFSB 2QSFA 4CH7A 4WK9A 4IQ2A 5LMNJ 3PO4A 2VDIA 3TUJC 2EI6A 2SGQE 4MAKA 2OMOA 5KFLA 5IQQA 3TAMA 3R6LB 3Q0AA 2F21A 1U47A 3M5LA 1S1XA 4S3KA 3SSRA 4NZLA 1FY4A 2ZPRA 3DSPA 3O3LA 2LP6A 4EYHB 3ZC4A 1ZYOA 4OZ0A 3OVBA 2ZWOA 4B75A 2NSBA 3E91A 2B5JA 4B76A 1OY8A 4CLZA 1LL4A 1G1XA 1ZU8A 2DR8A 4EZ9A 3TZZA 1GJCB 1UFWA 1SUQB 1SBWA 1ZAWA 4I7FB 1VBZA 1X7AC 4LGXA 4XE4A 2HSEB 1SC6A 2XY7A 5J2QA 4DV6F 2JJ4D 4X4UA 1VFJA 5K5MA 1Q53A 1R31A 2LNCA 3AHPA 4ZP9A 3ARYA 3BV8A 1KVIA 1WG4A 1EATA 4P7TA 1JLCB 3K59A 4HDHA 1Y3WA 4ZUHA 3OXGA 2WCXA 2ZFQH 3BB5A 4DV2J 6AT1B 2PP6A 4UONA 3V12A 1IQHA 5HKGA 2H9ZA 3BTWE 5KFNA 1IBKF 3MU0A 5F8XA 1DQ8A 3UVJB 1MQ5A 1N8OC 4W9OA 3OR1B 1WSRA 1B7FA 2XWXA 2I1RA 3U9AH 1WKJA 5K9FA 1C5OH 1V6HA 1TOCB 1TMBH 1FKPA 3DHWC 1Q31A 2Y6TA 2CVIA 5C5JA 5G0RB 5IDKA 1WELA 1N36F 1SSXA 5JUMA 4A8YA 2MKYA 2SNWA 4YXWD 4J90A 3QIPA 4CNZA 4FVMA 3GY3A 4JZEH 1J5EF 3ZVCA 1ZGIA 2QL5B 1WUNH 3R5CA 5KG0A 1VCQA 3A7VA 4HACB 2A2XH 4NLVA 1BE4A 3CWJA 1GJ4H 3QLHB 4ABAA 1NSGA 3CD7A 2GP9B 3FRZA 2B7BB 1O3LA 3M1VB 3KIDU 3MMAA 1OP8A 3M8YA 3AFGA 3BQ1A 3TCZA 3M8QB 2V2VA 3AH6A 2CXVA 4PWDA 2CPDA 2OQ5A 1DS2E 2JETB 4IRCA 3PO1B 2PKAB 1AVWA 2GO8A 1KTSB 1U2FA 3FBEA 1GHZA 1B70B 1FFGB 1PYSB 1YPKH 2G2ZA 3PIPQ 2ETNA 4DGJA 3CCUS 1KDQA 1LPZB 2P59A 3V4MA 2CKWA 3OYPA 3AASA 4NE9C 1XN9A 1FCAA 3SNAA 2QF0A 3FFIA 5AE3A 3R7BB 2F23A 1VR6A 1WEXA 3N79A 1HBOB 1YJNS 3UCZP 5KOXA 3NUMA 5DITA 2PI5A 4I8KA 2RG3A 4WMEA 2M1IA 1U79A 2VBWA 3UY9A 4RNNA 1RTKA 4ECSA 4FUFA 5FX5A 4G2PA 1W0KD 2JVOA 3PV8A 1IBLJ 4GO7X 3NGUA 4DQRA 3OTEA 1EASA 1NPPA 1PPFE 3W2WB 4EO8A 3CJKB 4KJIA 1N8RT 4ED5A 2PI6A 1WI8A 4IH5A 1S85A 2FVPA 5GAGU 1MG7A 2HHHF 3CJ8A 3FZ2A 3U1IB 2UXDJ 1ELOA 3AXMA 2F5GA 2JWNA 1Q82T 2V2QA 3GTYX 4WYWA 2BY7X 1TTHB 3C16B 4QPXA 1V2PT 4TWYA 2HHSA 5EXMA 1U7LA 5HAOA 1XJWB 3VB4A 2CJBA 4FU9A 2YNIA 4NIXA 5EUHA 2YNGA 1XBWA 1A46H 1L3UA 5L6NH 1J17T 4AUKA 3DD2H 1A0LA 3SBKA 5GAGI 1NZQH 1ZPWX 3ARSA 4AXIA 4LOYH 2NSCA 1BZXE 2N82B 5HW7A 3EIPA 1RAAB 4NRTA 3HD2A 3RW7A 5DK1A 1ZAXA 3AXKA 4GC6A 4FYDA 2ZGXH 2B9XA 2HQCA 2UUCF 2FZCB 1O31A 3DYAA 3I5CA 2FOFA 4LF4F 5A8KA 1W1PA 2HZCA 4W4MA 3BREA 1PQAA 4LF4J 2HHTA 3MI4A 3BSOA 4BXSA 4I2QB 2PC6A 1IQLA 4DS4A 1SIZA 4USUA 3LGHA 3RBDA 4YHHF 1A7XA 2ZDLA 1WHXA 2IC3A 2D8WA 2BQ3A 4Y0ZE 5E3AA 5T14A 3PEJA 6GCHG 2QG9B 1NO9H 3QT5A 4IFYA 1WOOA 1J4IA 4QT2A 2G9OA 1KIGH 5D15A 3A8AA 2VJVA 1K1OA 1C5XB 1JLEA 2CJAA 3IWXA 4B73A 2MQQA 2IRXA 1R27B 4UUWA 2YMSD 5J1EA 1VQLS 1F9EB 1T7CA 1X4GA 2GO9A 3AK5A 3TZWA 4U85A 4LVOP 4DFPA 3O8BA 3RXSA 1O2HA 2ZU4A 5B0FA 1Q2WA 1T8EA 1AVXA 4ECUA 2Z57B 1O3DA 3ONQA 3ULHA 1NPMA 4I56A 3MPVA 4KP0A 2WVBA 4XSKU 2AZ3A 4Y28C 2BTCE 3MD1A 3KK2B 4RN6A 2RH3A 2XYGB 1O3AA 3O44A 4FBUA 3MM6A 3O6QA 2E5LJ 3VF0B 1IBKJ 2E5JA 2KR7A 3VZHA 1KQSR 1Y5LB 3HFVA 4DR7F 1P27B 2YH1A 2OSQA 1Z7KA 3POTA 4HYKA 4FYXB 1ORFA 2XS5A 3O5PA 4ABGA 2DHXA 1UVUH 1DOJA 1FKHA 2YBTA 1FRJA 3SOSA 2CDRB 1TAUA 1CG2A 1R0AB 4QWDA 1FKAF 2XP9A 1F9HA 4LAXA 4B3TF 1XTZA 3GJSB 5C20A 1FHTA 4CRGA 1N6XA 1A0JA 2FVSA 4KAIA 1DTQB 1LW0A 2CG8A 1TL7B 3AA8A 4WU3A 3GCTG 1OY9A 2XNRA 3PZPA 3A89A 4K2JA 4WIWA 4YOIA 2RDJA 2XYPB 3NGDA 2X3GA 3UQVA 2RB7A 2I5JB 2XLIA 3RM4A 3OFFA 2WRMA 3OFEA 3KK1B 2FM2A 1HBMA 2HKEA 5IM0B 4KRWA 3S0NA 1BTYA 1RA6A 5C2GA 2P3TB 1KRPA 1CGIE 1YJ7A 3D6FB 5C25B 1MCTA 4K50A 4USMA 2ZR6A 1BL4A 1XMBA 1C2MA 1SG8B 3KJFB 2LU2A 1V2WT 2PFEA 3IG1A 3TJ8A 1RCXB 1NROH 3PX4A 1C1WH 4A46A 1YPMH 7FD1A 2D9OA 4LF9J 3THVA 1MBMA 5F3TA 1IKXA 5D0EA 3ODFA 2D1JA 1QA7A 1QUPA 4KHMA 5GMDA 1HAXB 1RT6B 3WD3A 1FV9A 3GYXB 4NCYA 1RU1A 4ETZA 3D68A 3FEYB 5ETVA 3SHCH 1LOUA 3KUHA 3KK1A 3HO1A 1X4AA 3P6YC 3KK3A 3E3TA 1C1PA 2XMUA 3QJJA 3CCES 5F8JA 4OHVA 2PSYA 2O3DA 2R4FA 1MZDA 2ESTE 2HMIB 5KFKA 1O3MA 4DRPA 1S9GA 4EI2A 3H4BA 1BRUP 4HTJA 4LUBA 2A0QB 1X9SA 2F40A 2A4QA 2YPZA 3T19A 2DHSA 3CC7S 3SU5A 1LW2B 4Y2AA 3VGSA 3EA9A 2ZKTA 2LCWA 2E1AA 1GMUA 1EAUA 2R0KA 3LUYA 2RFKC 2VBYA 1NRNH 2LU1A 4KY3A 2RIJA 3RXAA 1LHGH 3GV7B 1HFDA 2JJ1D 1FFQA 2MF9A 3MM9A 3VGCC 2DCLA 3PMAB 4WY3A 3GWCA 1ABJH 1W25A 2BM0A 2AU0A 1R9HA 1FKLA 3OEHD 4FP9A 1FPHH 2WPKS 5LPEA 2CK3D 3FKSD 1YATA 1FFWB 3EJMA 3TANA 2BVSH 1SV5B 5BXIA 2D9PA 1O3KA 3JQKA 1GJ5H 2XP4A 4WIQA 1LWFB 5DP9A 4JK5A 2WK4A 4WXIA 5LMNF 3VR1A 3AQOA 3B78A 2Q43A 4AGJA 3UQIA 3DYAB 1N34F 1J27A 3NGKA 3A85A 4XBDA 1U0HA 1A0OB 1F2SE 1RT6A 2M3DA 1E35B 3OT9A 3ZZRA 3FN8A 2ZH6A 5A76A 3IKGA 2WSEC 3H59A 1FRIA 2HW3A 3JZ2B 2JZVA 4TQSA 3Q3XA 2D9FA 3CXCR 4UY85 1M1HA 2FLRH 2CQPA 2R7RA 4ZOSA 3EXCX 3WIVA 5DP5A 4JZFH 4X4RA 2VC0A 1V2KT 2L9WA 1F0TA 2DE8A 1GBCA 3G71S 1NFXA 2BY9X 4HI1A 4CLFA 5SGAE 4U86A 2HNDB 1TAQA 3H25A 3I55S 2CJQA 3U1LA 2RU9A 4NWBA 5DQIA 1SVDA 1B3TA 4NG9H 2NR0A 3OA5A 2W2QP 1K8AT 1QJ7B 5L9XA 1ANEA 4O9VA 1YQHA 2ZO3H 2Z2ZA 2OD6A 2OLGA 1H6KX 5LJ3Y 1NK4A 3KJQB 2DR7A 4Y8ZA 3DHXA 1VJ9U 2NZ4A 3BPSP 2HHPA 1UPPA 1IR2A 3HHEA 2VOPA 1C5VA 1IKXB 1YPHE 4P73A 4KKOA 1DY8A 1XUIA 3CCWA 2RQ4A 5D4NA 1YPGH 5C2CA 5BYRA 1C9HA 3EUNA 3KCGH 3JSRA 1AGJA 2EI5A 4WXVA 2E7VA 1BMFD 5A8WA 8ESTE 1S7IA 1N6QB 5KFPA 4IT4A 1BGXT 3SO3A 4YDXA 2GJIA 4RT0A 2JEJA 4X4SA 4NEYA 1COWD 3CHFA 4JZDH 1ZTTA 1TYNA 3HSJA 2B8PA 1YLNA 2EC9H 3TGJE 2V4JA 3CJ2A 3OX7U 1HLWA 4CT9A 4Z2JA 2KCYA 2EWHA 1SJRA 2FLOA 4OS2A 1Y5NB 3SUFA 3M5OA 2GMTC 4DVAU 3IM9A 2ZTXA 3R5JB 2DITA 3VAHA 1UVJA 1TQ7B 4I6WA 3B8HA 1APSA 4ER8A 5CHBA 3A87A 2AYWA 2NYIA 4ZVGA 1OO0B 1XX9A 2IPQX 3IWLA 4DZDA 1DSUA 1O3PB 3AJ2A 1DITH 1GPFA 4MQAA 1N5QA 2OMLA 1J5OA 4Q2LA 4IBLH 4N76A 1LQ9A 4NFEA 3C6TA 4K5SA 3CD0A 4CO1A 1I94F 1NB2A 2ALYB 3I6PA 3FEZA 3V3MA 2XG8A 4QU7A 2G0JA 1LG1A 1KOOA 3ADAC 2I0XA 1TALA 4ZCNA 4M95A 3NKKA 3CIMA 3LQVA 1QD1A 1TR0A 4DQSA 4B3OB 1C5ZB 5BYQA 4FVCA 4LSNB 4Q0BA 1N33F 2KZZA 2V8DA 1WSVA 4YO9A 3GDSA 2HVIA 1Y5AT 5ETXA 3NBPA 1GI6A 4OHXA 2I6WA 3C15B 1AKSB 4M5JA 1GHBF 4DUZJ 4ENOA 3ZVAA 2EFOA 3W5XA 4DUTA 3RM2H 1OPZA 5CYQB 2ZFSA 3DGPA 3ZTSA 4QT8C 4WTOB 3B9AA 2H9TH 3VG8A 3V0XA 2DPEA 4XBCA 3QAUA 4KGZB 4HACA 1ELBA 5KFBA 2UV8A 1WDDA 4I2PA 3LPEA 3CGIA 4NWKA 4MH8A 2DY1A 2ZQ1A 2AFQB 2J38A 3HVRA 4OS7A 3AS2A 1DLKB 3TUZC 2BD2A 1SYTA 3BV9B 1YM0A 3H40A 2ZJQQ 4E06H 1X6NA 1N52B 4EBEA 1HBUA 2HQDA 3PRDA 2BKNA 2BDCA 4C8NA 2M08A 2APOA 1K21H 2F4VF 2QFJA 3CCZA 3UVJA 4LMZA 4KBIA 1WC0A 4CP5A 3W5YA 4P71A 1N54B 2XZDB 1XNRJ 1FF2A 3RMLH 4KH1B 1S99A 2BOAA 5FHTA 4ATNA 3LANA 3IS9B 1QQUA 3M7VA 2ADCA 1LQ0A 4BLGA 2W4DA 4WF9Q 1GWAA 2LVWA 2FGCA 1NKCA 5T3HA 2N7CA 4JOUA 3RAQA 3M36A 2AEIH 2WVCA 1HQUB 1DVAH 4PTMA 1YCPK 1PJ6A 2QLFB 5ABWA 1EETA 3HSZA 3LGIA 2FHOB 1VZQH 1XRVA 2RA3A 3FCVA 4GVUA 1P2OA 1WC4A 4NA7A 3EQ0H 1ZH5A 2UXBJ 4QZVB 3MR3A 3GIJA 2D2DA 2WW4A 4WVPE 4JMYA 1TB6H 1SOZA 4WIIA 3GY8A 4RKUC 1CA0B 2BE7D 5A2QY 2NPIA 1AB9C 4Q80A 2B4UA 5T6DA 4V19X 2YNGB 4J37A 3B8SA 3I29A 3RR7A 3PLPA 2L74A 4DROA 4JI8F 1TL3B 1TL4A 2FWWA 2FLPA 1GJDB 3M2VB 1MCVA 2K06A 4QIWD 1KWMA 4UOFA 3J80U 1W0YH 3GFHA 2WPMS 4ZIWA 2DYAA 1O2LA 1FRHA 2CQ0A 3QGNB 3G4SS 3FGVA 3DA9B 1S0NA 2GMTB 3VAFA 1BY9A 3TUPA 3SV8A 1Q8IA 3KLGB 3I32A 2CDQA 3D3CJ 1HAGE 1NRQH 4DZ2A 1W1TA 3GPAA 4KKDA 2CUYA 1A0HB 2AEMA 4GO5X 4MIWA 1N48A 1VQ7S 2WZQA 1IM4A 2MDAA 4JI0F 1Q6UA 3KK3B 2ZP0H 5HQ8A 5LOQA 1A3EH 3NOGA 2ZVSA 3LC5A 2VB0A 1UK2A 1H0HB 3CNQP 2M2BA 1F0UA 1V2LT 3GQCA 2PMWA 4YR3A 2V4RA 3P6ZB 3NLCA 2LKNA 1RISA 1SC3B 3QBCA 5DJBA 2PSXA 1G7CB 1ZA1B 4QW8A 2R2TA 2XW9A 2VG7A 3BKTA 4U01A 5HLFB 2OTLS 1KDQB 2PUQH 1X4FA 2A6OA 1NM2A 4Y2IA 1Q79A 3SJ9A 2G4UA 2BJEA 2O66A 5L39A 2Y80A 4DFKA 4M63A 2DPJA 2UXCJ 5EPYA 3RXUA 3ZVEA 2ADBA 2L41A 1VKYA 3TJ9A 1CULB 2GIRA 2O8UA 4TQRA 4FUEA 3MR2A 3UPFA 2MXYA 1RGQA 5HP1B 2JNJA 3WX4A 1OMSA 1OP0A 2ZFFH 1I94J 4RSPA 5J2MA 4K2YA 1SR5C 4PG5A 4PG7A 1VQOS 1O2VA 4X64J 1S6QA 4FF1A 3H9RB 2J34A 2BE9B 5BYSA 1BRBE 1XERA 4WMDA 3R3GB 2DSZA 2OO4A 5KFYA 2GT8A 3TQEA 4DSIA 5JPMH 1RDRA 2I6QA 1Y0HA 4NL5A 1RHQB 4X62F 1GBTA 1WDTA 1U48A 1SOTA 2P3FH 1OWHA 3SQGB 2O1PA 2MJNA 1I51B 1M90T 2XMMA 4A7IB 3TRGA 1ETRH 3F2FA 1VJWA 3NWGA 5JMNA 5BXJA 3S9AA 5GAHI 1O2RA 2DKOB 3DOKA 2Q79A 4DURA 1G3EA 4BWMA 1G30B 3CIZA 4IDKB 2R9PA 4DRQA 1WACA 4YOGA 2AYBA 4TN2A 4FUIA 2R7XA 4WWSA 4A8QA 2DGQA 4ZVHA 1VF8A 2V8PA 3NP5A 5F8MA 1S6FA 2KX4A 1BLUA 1NS3A 3MOJB 1C2JA 1A7SA 3ZZ4A 3MMBA 3W63A 4DV4J 5LMUF 3UAIC 1PGZA 1P2JA 4JFIA 2A32A 2ZQUA 4IO1A 8KME2 3SUDA 1ZBTA 2ZHEH 2YQ3A 3WX8A 5HN0A 4IFYB 2YX4A 5B0DA 3MYWA 1GJ7B 2JZ5A 2OPQB 2PEBA 4IDKA 1X9MA 1FZZA 1TL5A 5T1VA 4JZ1A 3O5KA 4LAVA 5CA5A 3A80A 5DO2A 1FKOA 1BQNB 1UVKA 1TPAE 1NPKA 1ZZZA 4CH0S 1JNRB 4N77A 3P96A 2GZ9A 1HW8A 4IN1A 1O39A 1UJ6A 1WC6A 2DTJA 1IQGA 4JV0A 1NK8A 3LC3A 3NS6A 5JBAS 1HL6A 2BJ7A 1D6RA 4LF5F 4A8KA 1O36A 4X66J 2DB1A 2XEXA 1VRUA 2YVSA 2Y0BB 3PW5A 1ZZNA 3CCLS 1V6DA 2VA3A 2RRBA 1UTMA 1C4CA 1F0SA 7ESTE 1GI8B 2G8ZA 1LQEA 4X62J 4BHQA 1BTWA 4B74A 2NXUA 3I0SA 3OUYA 5GWZA 5C24A 3PM9A 3P8OA 2A4OA 3CJ5A 1IBLF 2VG6B 5FDLB 1C2DA 3J81Y 2QY0B 1V2JT 3TGKE 4P52A 1SH0A 3KJVA 3MCOA 4DV7F 2KHDA 2BQ6B 2FY8A 4PG6A 4O44A 2RE1A 1KXBA 3EPIA 3A8DA 2VVVA 1A9NB 5B0EA 1OY6A 2SGFE 1OYQA 1H74A 1TWXB 4X84A 1GMWA 1GBDA 4OYWA 3QGHA 2MQMA 4UDWH 2BHGA 3SV7A 1T8NA 2DCUB 4MDSA 3D49H 1RZMA 1GDNA 4DV0F 1HYSA 3NG8A 5LT5A 2H5DA 4JI5J 2PGCA 5JJBA 3OLAA 3OL9A 3O5RA 1X31C 4DR1F 2YWWA 3CC2S 2ZH7A 4D9RA 2QA9E 4FS1A 4KTQA 2BX4A 4ZP7A 2ZCLP 3LP0A 1N88A 4M94A 4X0WU 3KG4A 3UB0A 2QYCA 2FKEA 3RXPA 3GJTB 4Y8XA 4TPIZ 4JI7F 3Q8RB 4J9PA 2K3IA 3DM2A 4ZVQB 5H9FK 2KZ4A 2XP3A 3TEHB 1ELVA 4K4VA 5KFIA 3AT1B 4NIYA 3SSSA 3I0RA 4RUAA 4ZVSB 1S48A 4LXBH 4WXOA 3FY1A 2BV3A 3UFCX 1P2IA 4CBOA 1NPRA 3DM2B 5AJ3F 3BQ2A 2CA9A 3EXYA 1MROB 1IJFB 2DGUA 4JI1F 4ZCMA 4QIGA 3DNCA 4XDCA 4LFBF 1D7HA 3F41A 2ZDNA 4I8HA 3PRVA 2R8KA 4XPCA 3D5MA 1EKBB 2H54B 3OTOF 3AAUA 4BAMB 2HHUA 2IY5B 8LPRA 2SNVA 3SJ8A 2J8AA 2GT7A 2XWBI 2VBCA 2UUFB 3MCNA 3VAGA 4MKVA 1RFNA 1HKKA 3QOKA 3RAXA 1T9XA 4ABFA 2ZH3A 3NCRA 2GCHG 4PPDA 2KT2A 1RHRB 1M5PC 2JH6D 5HQMA 3IGVA 1NSPA 2DG9A 3F9HA 1UW4A 1BMLA 2XZWA 4F55A 1JNZB 1VQ6S 3KNAA 4QR0A 1XWLA 2Y1RI 4P6QA 4Q5VA 3MNBA 4IR9A 4OYAA 4NYPA 3BO2A 3KMQA 4QU6A 3ZZ7A 1FXYA 4AX9H 1A61H 5DKMA 3RR8A 3W9JA 1C5MD 1WQVH 1RLDA 1UWBA 1Q6IA 1X4BA 2V9KA 4IT6A 4TW6A 2GVZB 4EFAC 2A0FB 2WB4A 2DR5A 2ZC4A 4WPAA 3X1LB 2MKHA 2PLXA 4PZVA 4I1TA 3KQBA 1MMDA 1CJUA 4U2WA 1WHVA 3MFHA 2ZIQH 2PR3A 4NIWA 4PQUA 2M4MA 3W4RA 1G9IE 4CO0A 1DFPA 1BD6A 3MO3A 1VK3A 4CLWA 1XK8A 4PROA 2CQCA 5C17A 1EP6A 3WW7A 4IH6A 4QJVA 3MUVP 4BF8A 1GEHA 3TO8A 4YY3J 1NFYA 1FKDA 1S1XB 5E3CA 4TX0A 1O33A 4UUXA 1EB0A 1QDUB 1O3EA 3NPSA 3KUEA 3LF0A 4X2BA 3I9ZA 1W0JD 2RJZA 3ZZ0A 4TWWA 1RTDB 4LF7F 2GZOA 2A7CA 1IVZA 1HI8A 1CO7E 2AZ1A 1ABIH 3JS9A 3E1XB 2BVZA 7GCHG 3RU0A 1ZTKA 4K8YA 1BOQA 1VQKS 4G50A 3B9DA 2OP5A 4IGDA 4Y34A 2JH3A 2YXLA 1QAJA 3M3TA 3M8ZA 2LQ5A 2A10A 2HVHA 2V2ZA 4LSLB 2C22A 3G9CA 2OAUA 2MKKA 4OHZA 2JSXA 3F2GA 5J1NA 1GCTC 3DLHA 2CPYA 5SZTA 3E8OA 2LEPA 3VAIA 2JFKA 2WB1D 3URDA 5C3NA 1BDAA 5DF0A 2CIMA 2DNPA 7AT1B 4Z0KA 1C0TA 1K0VA 1RWXB 2CGAA 4NIVA 2E1PA 1Q5YA 4NLYA 3DRXA 2FTLE 1WOSA 3K17A 2ZEBA 3WIJA 1UTLM 4WYLA 1RJJA 2DNHA 2FOCA 1NWSA 3TZYA 1H0GA 2FOBA 1S1WB 1KSPA 2FJEB 2OUGA 4C0HA 2KDOA 4CQ1A 1H8DH 3O5OA 4FPIA 4KH0B 3MAHA 3DRRA 1ELAA 4BCAA 2BDBA 2GV6A 4NZCA 3S7RA 2JKHA 5JBCS 4KHPF 1SHHB 3PY8A 3D6TB 1YPLH 3HK2A 3I6CA 1LVBA 3WQPA 1Q3XA 3RP2A 1RYSA 4TW7A 3D28A 2BKOA 1IXKA 3O8WA 4Y7AA 2VBZA 1DWCH 1FERA 2I5JA 4CZCA 2CQDA 1Y7PA 4TSFD 5AJ3J 3MGJA 2ZNKH 5FPSA 1UK4A 2BRKA 1OYTH 4OZJA 5EPNA 5HMAA 2HZAA 1D6OA 2ZF0H 2PUXB 2XBWA 1FDNA 3IG6B 1NFWA 3PMJA 3UE2A 3LP2A 1BQYA 3AW0A 2KAIA 1TGCA 5HGGA 4QIFA 5ETRA 2CV3A 2BVRH 2XPAA 4URQU 3MTKA 2QYGA 4LF1A 1SLWB 2HAFA 2QE5A 4CHAB 1JNSA 2MB0B 4XFQA 1RT4B 2GGPB 4IW4E 3CJQA 4P2XA 4C3LA 5J2PA 3LO3A 2WVFA 7GCHF 2DT0A 1PBAA 3H2UB 2MZQA 3FCHA 4ECWA 1RTIB 1SC8U 2KU7A 3KLIB 4DL2A 2ESCA 3PV2A 1KT0A 4X4OA 1MKWH 4H42U 1MKWK 1ZA2B 4CLLA 2UZ5A 2MSSA 4J4OA 2BJ8A 3HHLC 2HBRB 3NXZA 4U7UD 3QT7A 1T95A 2DXFA 4ES1A 3CGMA 2HVDA 3OJSA 4JI6J 3NMAA 4ZCKA 1NWUA 3EM1A 3AJDA 4P2FA 3BQ0A 1M1KT 1FDAA 4R8UA 4OJ3A 2UUYA 1RTJA 4TLQA 5I3QA 1N6YA 1K1QA 5D3GA 3SQEE 1WNOA 1GX5A 2GGVB 4GAWA 3ZFVA 3QZ7A 2G51A 2EI7A 4Z2LA 3H5XA 1ZSKA 5HBMB 1FX0B 1UJ4A 1YJRA 2Z3EA 2C2MB 1R8HA 1W9UA 1HJ9A 4RI0A 1ELFA 1GT8A 3QSIA 4Z2HA 3FKBA 2C1EB 5JB9S 4I4BA 1AMHA 4CWBA 1D6WA 3RC6A 3MM6B 4EU0A 2EY4C 3OD2A 1EXFA 1LPGB 1HBNA 1YBAA 1CHOF 3T5HA 2YX7A 4USWA 2WINI 4DRHA 3DGPB 2ZU3A 4JYSA 3E16B 3RMOH 1T05A 3U27A 2X51A 1O35A 2XSJB 1HAIH 2BE2A 1YJ9S 1JXLA 1C4V2 4USJC 2C8YB 4Y10E 5K0HA 3DSOA 3SV9A 1S9EA 1Q8LA 5HWBA 1OWIA 3TARA 1ZLRA 4O0IA 3F9FA 1GI0A 1BB0B 3IRXA 3PHEA 4AL7A 1HBUB 3U7JA 4OZ2A 4KC5A 5DDOC 2AJ0A 3S6EA 3MAQA 3OBIA 1HIYA 1H72C 2XHCA 4GRSA 1JLBA 2AIRB 5DGBA 3LGYA 4I2PB 2Q1JA 1G4CA 2QAAA 4QR2A 4G1IA 3PWBA 1GFWB 3NRLA 2WPHS 2OBOA 2OHDA 4KGKA 1WOFA 3TAPA 4Q4LA 1FRKA 3DT0H 1CVJA 3J7A1 3OHAA 5CABA 3MNXA 4X6NA 3W1YC 2WUBA 1CGHA 2XP8A 3FAPA 2ZH5A 4R0XA 2I9SA 1W0ZU 4DWSC 2R7SA 3QRPA 2CWXA 2BD9A 5KG2A 2CZ4A 4JI2J 3TVYA 4ODKA 4USIA 1V2ST 3F6UH 2PV1A 1CT2E 4DJZB 4BS2A 4RU2A 2KFWA 5E3PA 1BUXA 1MROA 2FIUA 2H5CA 2Z2MA 3CC4S 4Y8YA 1LVOA 1HQ2A 1C5LH 2IPHA 4M8LA 5F8HA 2N4CA 2W6ID 4TT3D 1TIOA 4Q2KA 2QA4G 1F3VA 2IDLA 1EP4B 1VGYA 4OYXA 5AHGH 3LGTA 2HLDD 2WVDA 4GKJF 2F9NA 1PYTA 3J80Y 4K4TA 5GPGA 1R6VA 1HWKA 3BKFA 2AIPA 4G1PA 2KFNA 3WWBA 1PAEX 3A3NB 4DRKA 4DL6A 1LEOA 2V4JB 3MD3A 1SPBP 5IQ6A 4RBTA 1DDJA 2BKPA 1UO6A 2MYFA 3SNCA 3KKFA 3P3DA 4LFBJ 1AROP 1E6YA 4TY8B 1HBOA 2W25A 2DT3A 2CPXA 3EE3A 2M8DB 1WF2A 1MTNC 3U98H 3BN4A 4AFFA 5KG1A 4DSFA 5EJZA 3ARWA 3QWCH 1XC9A 1XUGA 5H4IB 2HOBA 2FHJA 3GILA 4DY7B 3G6LA 3GMGA 1QZ2A 3PW0A 3GS9A 3C19A 2FAPA 2R42A 2VPZB 2O8MA 1LV5A 5IK2D 2EEYA 2EVZA 5C25A 3V6DA 4IOAQ 3OTCA 2EC2A 4U30A 2HEKA 1UTJA 3SQOP 5HUAA 3HP6A 3H4DA 1JQGA 3TW0A 3UR6A 2ZHWH 1X4CA 2J4IA 4O3OA 4V1Ak 5DSFA 1K1JA 4AE5A 2IRUA 3FP6E 1AWFH 4ANDA 4ZJOA 3GCXP 1Q0NA 1KXEA 5LXYA 2XBXA 4WJG2 1W2IA 1O2XA 2MKCA 1SQEA 4K1TA 3P95A 1IBMF 1FA0A 2QE7D 2TGDA 4DV5J 5F0UA 4JP8A 4URGA 3M5MA 3BTHE 2HLUA 4G6VB 2FVCA 2GZ8A 1O6XA 3JYMA 3VGVA 3ESTA 2ZBRA 1SGPE 4XBBA 3H5UA 4KB7A 5M2PA 3TDBA 1MAYA 2HAIA 2Q1LA 2HNZA 4OZNA 4FUDA 1HYLA 2F91A 3E01B 2W7UA 4DN0A 3DHKH 2FJXA 4ID5B 4D8NA 1Y9OA 3VV2B 1V2OT 3ZZ3A 2FVRA 4I64A 2B4PA 4O3UA 1XR6A 3RRHA 4BTIB 4FOUC 2HMIA 5F8NA 4USTA 3IWNC 5DQHA 1T02A 1C0TB 3KAHA 3CJTA 4F4OC 4N5SA 3KLIA 2GVDB 1GMVA 1ROUA 4Q7NA 5I42B 1ITPA 4LF8J 3FK4A 3M4XA 3PYFA 4AG1A 1W3CA 4ZMMA 3T9NA 5J2PB 9ESTA 4X66F 2IYIA 1W7XH 2H1UA 3A12A 3G01A 3MMBB 1UEKA 4JBCA 4M5DB 3Q8UA 5L1KA 3MAAA 3ZTQA 1HW9A 4WFYA 2O9QA 2CQ2A 3VB5A 4JI8J 5E0OA 3ZZOA 4NWLA 3SV4A 3QT6A 4ACBA 1HD1A 2BD7A 3P45B 3VEQB 5KAKA 2BACA 1Y3JA 3ATIA 2F65A 4J9LA 1LK5A 3ARVA 2VG5A 4J9RA 3ZYEA 2J6UA 2N87A 5DDQC 4ABHA 2PV3A 2VUGA 4D7GA 1C5QA 2R2RA 2G5VA 2PA3A 1YPJH 4AXJA 3QGJA 4Z7YA 4SGBE 1ANBA 3STJA 1NTPA 3DUXH 2GHVC 3M9MB 2ZM6J 1ETSH 2N4DA 1NH6A 3PIOQ 5FLXU 2XCAA 1INCA 2KCOA 4LFAF 3QLPH 3NI6A 1Y00A 1O2JA 3ITIA 3LAMA 1MD8A 5KGOA 1T9WA 2UVUA 1IKVB 5I3PA 3D6HB 4JI5F 3M6XA 4R0JA 3LP2B 1F5AA 3QPIA 3RXIA 3JZ1B 5KFEA 5DIVA 3MOCA 2CNLB 1S77D 2AD9A 3CSKA 2GZ7A 2C3OA 2Q6GA 4DSLA 4ODMA 1NJWA 5M2RA 4FF2A 3D54A 2ZFTA 3ODKA 1KBRA 3ENWA 2DNYA 2IA6A 1XNQJ 1PPCE 2GCTB 3SGQE 1E38B 2FS9A 4IC5A 2JFDA 1TGTA 3A7ZA 1OS5A 3FJ2A 1WG1A 4LF6F 1VCPA 2DG4A 2HVXA 1EP5A 4C8KA 2HHWA 5ETPA 5T7LA 2C2RA 1X0FA 2JOQA 3Q86A 4PG4A 3IP0A 4Q7AA 2BW7A 2EK1A 4QWBA 2HPQH 2ACYA 2QFIA 2UUBF 3FUYA 4DZ3A 4M5MA 3CDAA 2MJUA 4NGAH 1LNQA 4CDIA 4IG0A 4LRCA 3OEED 4E0DA 4DR3F 3AD7C 4WFZA 2WTFA 4I0WA 4RBVA 3T41A 3FBFA 3QO6A 3TA0A 2A5KA 2DR9A 4KELA 1V3XA 2HVYB 1UTKA 2J7KA 3EZOA 4ZVUB 5L30H 4WWYA 2VIQA 1SJ1A 3R5BA 2ILNA 1CBWC 1EJNA 3AB2B 1RWMB 3BTKE 2B9YA 1Y5BT 3KABA 1QY7A 4F0HA 1M5SA 1FJ7A 3RXRA 2MLZA 1KFDA 1GH8A 4DI6A 1NDCA 1U6FA 4O3PA 3M1VA 5C67A 2ZUGA 1Y3UA 3P70B 2XB2D 2VGCB 4B9UA 2QV6A 4NX9A 3SU0A 1ZTLA 3KG1A 1QL8A 4DPTA 2DISA 4LIWA 1JLAA 2BOHB 5J1EB 4KTCA 1QVGR 4B02A 2Y9HA 2OH2A 3CUNA 1D9DA 2RKIB 3E0NB 4K8RA 3O5IA 1LK7A 4P2SA 3O5LA 2J9DE 3RXJA 4A8FA 1ZHRA 4DL5A 1WAWA 1DFDA 1HGTH 3RXEA 3CPWR 1RBOB 2FJAB 2HRTA 1GI3A 2XRCA 2DNRA 1RXOB 2HNYA 1HJXA 1CEZA 2KCAA 2J9EA 3PTNA 1EKRA 3T2NA 5H9FJ 2RUSA 5DQGA 2V35A 1AT1B 3L09A 3QSYB 2GCHF 3PXGa 5IT9Y 1RHMB 2E9TA 4X1QU 3BJYA 1AIXH 4QWAA 1LCYA 2BDYA 1NDLA 4NSVA 3KQDA 1RA7A 1QPFA 4UTGA 1TL1A 5EDWA 2JX2A 1SBRA 5LPFA 1T3NA 3A8EA 3QRRA 3UR0A 3PG9A 3GV5B 5DETA 1GI9B 5GADU 4ILLA 1WOPA 4KO0B 1YKWA 4CTAB 1DRZA 4NLGA 3H09A 4DR3J 1GMDF 2KXFA 1XR7A 5ETOA 1AD8H 1RTZA 2DHAA 2TIOA 5KFZA 4ACAA 2YMSC 1QL7A 1QRXA 2B56A 1NFUA 2N3OA 1IR1A 1URRA 3A8KA 1DZ5A 1G32B 4NCAA 2IMOA 2CNNB 1RHJB 4DT7B 3QDZB 4INHA 4CNYA 2MZRA 4C7QA 4FF3A 4MNJA 1RAHB 5ESBA 2W8KA 1HI1A 3K5LA 1X6LA 3PX0A 4YB5A 3G82B 1PJPA 2R2MB 1S79A 1ETTH 4HVZA 1ZBKA 1H4WA 4IMZA 2V8HA 5EX0A 1NRSH 2TGPZ 5A0BA 4LBHA 1FAXA 1GBBA