3PRDA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
total genus 36
structure length 223
sequence length 223
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prdA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prdA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prdA03
1J6YA 2AWGA 4R0XA 4ODOA 1FAPA 1QPLA 3H9RB 3O5DA 4TNSA 5J6EA 2KGJA 3KAFA 4DRNA 4FAPA 4G50A 3WH0A 3IKGA 4TW6A 2PPPA 4IPXA 2RUQA 3FAPA 4BF8A 2ZQUA 3O5GA 4ODKA 2F4EA 3O5IA 1BKFA 4JFMA 1D6OA 2RURA 4DRMA 2LPVA 4DZ3A 2XP9A 3PA7A 1D7HA 1J4IA 2KE0A 2LGOA 2XPBA 4J4OA 5BXJA 1J4RA 1NMWA 1Q1CA 2RQSA 3NRKA 2UZ5A 4DRIA 1F40A 2OFNA 3LUOA 1Q6HA 4NNRA 2ZQTA 3TCZA 4TYOA 2MLXA 3KADA 5I98A 3KAIA 3KCEA 4LAYA 1Q6UA 1FKRA 2PV3A 1Q6IA 3CGMA 1L1PA 3NI6A 1JVWA 3O5EA 1N1AA 3PRDA 5DIVA 4DH0A 1NMVA 1B6CA 2ZQVA 4DROA 1ZCNA 4FN2A 4QT3A 3I6CA 1EQ3A 1D7JA 2XP5A 4W9PA 3UQAA 5HUAA 1FKHA 2LKNA 3PRBA 1D7IA 2F21A 1FKTA 2ZR5A 4GIVA 4QT2A 1FKIA 3O5JA 3UF8A 1PBKA 1FD9A 2M1IA 2PV1A 4JFKA 4DRHA 1FKBA 1FKLA 2PBCA 2PPOA 5HW7A 3UQIA 3KABA 2IF4A 2ZQSA 4ODPA 2M2AA 4U85A 4W9QA 3IKDA 1FKKA 2K8IA 4ODRA 4G2PA 4DRKA 1J4HA 2MNTA 4QIBA 1T11A 2PPNA 3NTPA 4O2TA 4ODMA 1F8AB 5HTGA 4DRJA 2XP4A 4ODLA 2FAPA 1QPFA 3OOBA 1FKGA 1YATA 1YW5A 4DT4A 3KAGA 3UQBA 3RFWA 1W26A 2VCDA 4IQ2A 2M08A 2D9FA 2F2DA 2XP8A 2Y78A 4DZ2A 5DITA 3RGCA 3JYJA 4MSPA 4U84A 4N19A 1TCOC 4TW8A 2KR7A 1Y0OA 1C9HA 3MDYB 4TX0A 4U86A 4J4NA 1EYMA 4W9OA 4DIPA 2XP3A 3O5KA 2MLZA 1R9HA 2FKEA 2N87A 3TDBA 3VAWA 4JFLA 3O5OA 4IQCA 3UI5A 3IK8A 3O5FA 4JFIA 1KT0A 2RUDA 2DG9A 5HKGA 1FKJA 2ZR6A 3KACA 2RSEA 4C02B 1FKSA 2L2SA 5HW8A 2ITKA 1KT1A 4ODQA 1FKDA 1FJDA 1PINA 2XPAA 4JFJA 2RUCA 5DIUA 5HW6A 2PV2A 2VN1A 2KI3A 5HWCA 1FKFA 3O5LA 2XP6A 1P5QA 2JZVA 5HWBA 1HXVA 4LAXA 1M5YA 2XP7A 2DG4A 1JNTA 4DRPA 3JXVA 1U79A 2ZR4A 3O5PA 4ITZA 1ZK6A 4GGQA 5D75A 5HT1A 3O5QA 4LAVA 3KZ7A 4LAWA 4MGVA 3ODKA 3KAHA 2Q5AA 4DRQA 3GPKA 3O5MA 4JYSA 2KFWA 5GPGA 4ODNA 2KO7A 1A7XA 1ROUA 2MPHA 5B8IC 1ROTA 3B7XA 4TW7A 3UI4A 3O5RA 1QZ2A 2MF9A 3CGNA 3EY6A 3JYMA 1NSGA 3TC5A 3UI6A 1JNSA 2LJ4A 2MLYA 1BL4A 2DG3A 3IHZA
chains in the Genus database with same CATH superfamily
1MU6B 1HKMA 3Q3KA 1HL6A 4BS2A 4BC7A 1WEYA 3P92A 2WCXA 3P45B 3DLEA 5F9LA 1E6VA 4RU9A 1TMJA 3MEDB 1XUFA 4LBHA 3TR5A 1SVPA 4M5KA 1SL2A 1HIYA 1HPZB 2FGOA 1D1UA 1KSPA 1QA7A 4OYPA 4LF4J 2EY4C 2HQIA 5KFPA 3LA0A 1KFSA 4LZ4B 2HHHF 1N1AA 3DT0H 3P8NA 4GVUA 2IPOB 1X5TA 2BDGA 4LF9J 1KYNA 1PYTD 2A3CA 5E0GA 2WBRA 1T05A 1FA0A 1SI5H 4I8LA 4ZJQA 5E0HA 4MNXA 1GDQA 3ALFA 4I31A 4Q2MA 3QO6A 2QXGA 1IM4A 4E8UA 3NGKA 1VBYA 2FZZA 4RNOA 2L9WA 3R8YA 1U6QA 3ITHB 3O8RA 4MYTA 1C9HA 3MOCA 1TAQA 2E5LJ 4OFZA 4ED6A 1QJHA 3K0JA 4YR3A 3PO1C 2W9BB 1SV5A 3IK8A 1MABB 3DLJA 2BXTH 3OXLA 3BM7A 2W9AA 4YB1P 2CVIA 2LQ5A 1O2VA 5A8KB 2LEBA 2CXVA 2ZNZA 3A13A 1ZBCA 3RXJA 4TN2A 2XZWA 3WQWA 5KFCA 1XUIA 1W9PA 3OW2R 4ODNA 1X7AC 2GFFA 1RHMB 4KT0C 1SB1H 2ASJA 1NWUA 2VVUA 2H54B 5DP3A 3S8SA 1NJZA 4WJXA 4HI2A 3DOKB 1FFGB 3TARA 4ZHRA 3RXMA 3U1NA 4JI5J 5AF9H 2WPIS 3A81A 2IPHA 2XBPA 1GHYH 3DLHA 1KLTA 2W24A 2HLCA 3U8TH 4D76A 1RAHB 1ITPA 2LPRA 2BKOA 1M90T 5I98A 5HAOA 4ZA1A 3CP7A 2AYWA 3K57A 5A0AE 5D0GA 1EB2A 3M3SA 1JMTA 3NS7B 5C42B 4J5OA 2IJD1 1LW0B 2PSXA 2UXBJ 3QGHA 1CGHA 3MH6A 3LH2S 3WDOA 4U01A 1GVKB 3SU6A 2M3DA 1FKKA 2GHVC 4LK4A 2ANKH 3F68H 3NTPA 2A4RA 1TBQH 2YY3A 4UUXA 2WUBA 3H98A 3TAPA 2ATLA 2K1RB 1BMAA 1HNXJ 1FNMA 2F65A 4MSPA 2R8IA 1HD0A 3VZIA 1ZZZA 1WELA 2C2OB 2NU0E 3CMAS 2ZC4A 4K0KF 1LVYA 3BTFE 3MPVA 2CQCA 2Q66A 2VBWA 2VDIA 2OPPA 4X2XA 2CQ0A 4EI2A 2CYYA 1RBAA 4LSZB 3K9XB 3GTYX 3MUMP 3ULHA 1P03A 1HKAA 1NWRA 1P09A 1EHWA 2VN1A 3OHAA 1F5KU 1X4FA 3SQGB 2A3JA 1ZPBA 3A1YG 2MZQA 3HVTA 3QGPA 1J17T 1RT3B 3MH7A 3TJOA 1C1WH 4B17A 4QWEA 3PWCA 1N8OC 1RWNB 3ZVCA 4RKUC 3CC2S 4B3MF 3CB4A 3WWFA 4DN9A 4YP3A 3SYZA 1MSWD 2FOBA 2IFXA 2FOFA 1C4AA 2CRLA 5HLFB 2P5VA 4FNIA 3D3BJ 2ZJRQ 2BJ3A 4ZP7A 4E7RG 8GCHG 1YJVA 2F3JA 3EGZA 3GSDA 1GTHA 2R7VA 1QAIA 1G2LA 4VGCB 4OZ2A 2UUTA 1WV7H 3SZNA 1WC1A 5B6LA 2LU1A 1HAVB 2MY7A 5KG4A 5KFJA 1Q31A 2CQGA 1NK8A 2B43A 1NRKA 2YXLA 2D41A 1HR0J 2DSUA 3SI4H 3HO1A 3POTA 2PA3A 1GI3A 2ZH6A 2GZOA 2EK6A 1UVTH 2MQ8A 2FOGA 2MKJA 2O92A 3SFUA 1O2LA 5DETA 1G4CA 3HSDA 4V19J 2DGWA 2P6SA 4CLWA 2A2XH 2Q6GA 1DAXA 2R7WA 3EWGA 2J95A 2BTCE 5HM9A 4KO0B 4PXDA 2A3AA 4WXIA 5SGAE 2AYMA 4RZRA 3RAXA 1OGBA 1JKHA 3EYDA 1DM4B 2CWKA 5A0CA 2CPZA 1HWJA 4JK5A 4LF1A 2G4TA 1KLMA 4CR9A 1HNWJ 1PPBH 4X2WA 1NKBA 2UVWA 2UUJB 1T8OA 1HXEH 1WNOA 4AORA 1NN6A 2WONB 4Q43A 1TNIA 2XTTB 2XGQA 1JNSA 5HANA 3L7OA 1BQMB 3ATMA 1E6PA 1UMJA 3BGLA 2R8GA 1S9EA 2J9EA 1N32F 1DICA 4Y65A 3OL9A 1HQEA 1LHFH 2RKIB 2RUQA 1BE4A 5KG6A 3WC0A 4NLRA 3EDXB 5PTPA 4I2PA 2ZH7A 3CCSS 5CAAA 1EKRA 4MH8A 2LMIA 4RW7A 3FK4A 2XP9A 1Y5IB 2BUNA 2KJVA 1Q0NA 5DG7A 1ZPVA 2HHPA 3AD9C 3BF4A 1A0LA 4MNMA 2OCVB 3KCEA 1HFEL 1H74A 1H3DA 1BJVA 2O9QA 2NSCA 1FVSA 1ETTH 3J80U 3HFKA 4NCAA 2FDAA 1C5PA 2N7YA 3TNTA 1CS4B 2FODA 3GMGA 2BW7A 1FDDA 1T8EA 3ARZA 1SH0A 5FDLB 1Y3YA 1YITS 1BZXE 1OXGA 1UCYH 1TUGB 3BKTA 5JYIA 4AXJA 1JRSA 3SN8A 2DHXA 3D4JA 2VCDA 1FT8A 5KFQA 4IW4E 3HHNB 1VQLS 4RUAA 1VQSA 3H5XA 3WQPA 3PVXA 3OFFA 4W9OA 3DRPB 2RA3A 1HKIA 3R97A 5F6MA 4K1EA 4OI1A 1GJ7B 4LF5F 1VMBA 2QE7D 1Q95G 2MZ1A 2HWLB 1AROP 1S72S 3U98H 3ZTQA 4B9TA 2UXDJ 3CHCA 3MHWU 1BHXB 3GONA 2VINA 3CHFA 2CHAC 3QUMP 1RTHA 1M5YA 1KOHA 4NA3A 2F4FA 2A5AA 4Z2HA 1ZTKA 4MG3A 1E44A 1FE4A 4URSA 2BVXH 4BC9A 3H7HB 1NK4A 4N76A 1AY6H 2C2EA 3FAOA 1TNHA 4ISNA 2Z30B 3HFVA 2W1BA 5E3CA 4HACB 4F4YA 3EAJA 4DR3F 4XAKA 1GPZA 2DR5A 3U1MA 2RVJA 4BOHA 4CH1A 2EWHA 2ASYA 4L3KA 1OYEA 4Q44A 2A45B 3T5FH 2F4EA 4ED4A 1BTZA 2BDPA 5IZHA 2PEHA 1MTWA 1DTTB 4LAYA 1SC4B 3HGPA 1DX5M 3DM2B 1BRUP 3BPDA 1UR8A 4MKAA 1NU4A 1QM9A 3DDKA 2VWMA 5F53A 4KBIA 5E3AA 3STIA 2V63A 2VQFJ 5GCHG 2DD8S 1XUJA 4ZHMU 5H9FK 3G4SS 4NA2A 2ZVIA 2DT1A 1DUAA 2ZEJA 3ZVDA 3AA8A 4QYZJ 4OYZA 3CCES 5A2MH 4KGMA 1RAGB 2WOMB 4I8GA 4QIEA 1C5XB 4JBCA 1FN8A 3TAMB 2P6TA 1EJAA 3MFJA 4TQRA 1SIZA 2LYVA 3AW0A 3UCGA 2HLTA 3V6KA 1BTYA 2FD2A 2J94A 5DPAA 5L39A 2N3OA 2NXCA 3E01B 2Y8WA 3ET6B 1RGVA 1KLIH 3EE7A 3ZVAA 1F0XA 2OEMA 2YTCA 2ZGJA 1GHXH 3R5BA 4F49A 4DRPA 1RHQB 1K47A 1DPOA 2XXLA 2R2MB 3QT8A 5D15A 1N8RT 4CQ1A 3E0PB 5T14A 3TITA 2GV6A 3RBDA 2OD3B 2BR0A 2EI5A 3TLOA 1VRUA 1U02A 1YCPK 3NBPA 1E1RD 4FUDA 4PYDA 1S12A 1IBMF 4DWSD 2XCNA 4J9KA 3TQ1A 2OBOA 3C27B 2KT3A 1QRXA 1U6FA 2F23A 2ZNKH 1W1YA 2GX8A 1S5ZA 1AUTC 3VEQB 1CC8A 4NFFA 4USWA 1TA2A 1YYY1 2NPFA 2MHEA 3V6DA 4WU2A 4X66J 2OIHA 4WXVA 4JZFH 2HRYA 3FC9A 1YCPH 1WBGB 2HQFA 2RT3A 1FN6A 1IKYB 3F2HA 1RXPA 1SC6A 1TL1A 4K50A 2L48A 1NHUA 3OE7D 2PBCA 1BQYA 1U2CA 3RW7A 3QLHA 2AWZA 1NKEA 2ZU5A 2DGSA 1RFNA 5G0RB 1YATA 2WM0A 2DNKA 1FKPA 5HATA 3RFWA 3RXRA 3KJFB 3RGCA 4HI3A 1TZ0A 5CYQB 1W12U 4HZHA 4KPCA 4DIPA 4RI0A 2NU2E 2BANB 2X1FA 2H9HA 1N6QB 4K59A 1AWFH 2FTLE 3ZZDA 2ZOMA 3NNAA 2XSJB 2XM3A 3AAUA 5T7LB 2W9CB 2TGPZ 1EKSA 4XSKU 2WTFA 2HEKA 1QA0A 4OHXA 1P2IA 1LW2A 3FNNA 2YWFA 2JZVA 5E3QA 1BTPA 2Q6DA 2EFPA 3TOQA 1C1SA 3SMZA 4B1TA 4MKBA 4B73A 2HZCA 2W5EA 2ZJPQ 2YKOA 4Q0BB 2E7WA 1GFWB 3Q89A 5JH8A 2F9BH 5EQSA 1TMMA 1QZ2A 1QB9A 2RHQB 2HFZA 1S77D 1S83A 3WQVA 1GHAF 3UOPA 3SSQA 1HMVB 3IKGA 1BBRK 1RTFB 3FO8D 1GMWA 2AU0A 3ISZA 4ESTE 3TX0A 4TQSA 3QSIA 3IWXA 4JFMA 1PYSB 2VA2A 3ZZYA 3M5NA 5A09A 2QYGA 4J4OA 1Q8LA 3FANA 5EWEA 4DR6J 1N0UA 1RB0A 5LMNJ 1UKUA 1SJFA 2PV3A 4FYVB 1NZ8A 1M5KC 5DIVA 3CNRA 9ATCB 1KDQA 1XIQA 3C14A 1AZSB 1TGBA 2CGAA 4HGCA 1YWXA 3J7YU 3AJ2A 2VKRA 1HBTH 1ID5H 2VWOA 2A0QB 2EG1A 1R0AA 2M70A 2HNZA 5B0AA 2QGFB 2HHXA 2ZQ1A 5I25A 2BRKA 1CBWB 1N5SA 3CC4S 3QPIA 4DMZA 2LP6A 3HATH 4A8XA 5CHAB 1SI9A 1SQOA 4L74A 1K8AT 2C2KB 3FMWA 3KK1A 3FOAA 3IGVA 2VFRA 9RUBA 1VITH 5J1PA 4WMDA 4M5LA 4JK6A 2DRAA 3LAMA 3HD1A 1YIJS 1YPKH 3TDBA 5HP1B 3OD2A 2O5DA 4AYBD 1S1UA 3RUOA 5BRRE 4ILRA 2OI2A 3DFJA 5F8TA 3RAQA 3JQMA 3P96A 2PV2A 1EHNA 4R0JA 4N41A 1W7XH 2OQ5A 5JBBS 4JV5J 4JI8J 2B51A 1Q5VA 4O3SA 3KYLA 4RW9A 2HPQH 2H51B 3I87A 3MEEA 4YR2A 4Y6DA 1RISA 5DM6Q 1OWHA 2OC1A 2R8JA 4TPIZ 2XNDD 1AIXH 3HSJA 1MAXA 2GGVB 2BJ7A 2FLBH 1FRLA 4X2YA 6LPRA 4WFZA 3RU4D 5J2QA 2OC7A 3AXMA 2EBEA 5D3GA 1J6YA 2CN0H 1V2WT 1VI7A 2BJEA 3ZYEA 2O9OA 2JJ2D 2H4YB 2BQ6B 3TGJE 4CWBA 4IO1A 2SGPE 3CUNA 5GMKa 4FUCA 2LPVA 2W01A 4PG6A 3BGRB 3B78A 1IR2A 3IWNC 1U0HB 1V2RT 4DFMA 1GXLA 2P8OC 1FPHH 4FPIA 2ZH9A 4F26A 2O1PA 4VGCC 4J37A 1V2OT 2AIQA 3V6HA 1VC5A 2YNGA 2Z8QA 1ZMLA 2B7BB 3R5DA 1H7WA 3HHKA 4I7FB 4NMLA 2ZQSA 4QR0A 2ZZMA 5JUMA 4HKQA 1AQ7A 3OLBA 4IFVA 5E3RA 3A8AA 2AD9A 4YY3F 2BVSH 3TEHB 1N33J 3K7RA 1ETSH 2LQ8A 1FKOB 3BTME 1IQEA 4QZVB 2WSCC 1EX8A 2F43B 2JOQA 3RW6A 5GPRA 3LP1B 1WHYA 3I5CA 3QNWB 1CA0B 4JFIA 2SFAA 2CJAA 2PA8D 4J90A 1ICEB 3Q8PB 1FKDA 1RE1B 3VWSA 1DOJA 4FUIA 1UVSH 1X31C 4JOUA 5HWBA 3A3NB 4QIVA 2D8WA 2YKMB 1VCPA 1O5CB 1W9VA 2B56A 2YNFA 1H0HB 1VITF 2V4JA 4LR7A 3VAKA 2YKNA 4TVAB 2W2QP 3M8QB 1SR0A 4OI2A 1PBAA 1M5SA 2IY5B 3OY6U 3H2VE 1UCYE 1ABJH 4ZLNA 1GBMA 5CD4A 4J9QA 2FYQA 3BSCA 2VFVA 4P75A 1FFRA 1NPPA 1M0SA 3BDPA 4GLYA 2ZUGA 2A7JA 4ZVPB 5F8IA 2CJQA 3LGTA 1OKXA 1LHCH 3ZV9A 1GJ5H 3SOSA 4OI0A 1OHHD 1EQ9A 1O5BB 3V81A 3CHDA 4OZNA 3TUJC 5HUAA 5IXUA 1IHTH 4MQAA 4CBOA 1W1TA 1WF0A 1C2IA 1TVRB 2XO7A 4A92A 5B0GA 2MKIA 1FCAA 3KK3A 1FWKA 5HGGA 3GISB 3RXGA 3BZQA 3M6WA 4K0KJ 4EK2A 3EZOA 5KG0A 3GPAA 5T1VA 2QCYA 2XQCA 1SKWA 1TFVA 2GC8A 2H3EB 4ZPDA 1SGIB 2Y1JA 2YOLA 1LVBA 1BQNB 1CQQA 1R9HA 5EPNA 1W3CA 3O5FA 1FJGF 3SQGA 3KHRA 3FEZA 4DV0J 5C17A 4FYXB 4XIUA 2UU9J 5DLGA 3I0SA 3DGVA 1MW7A 2AF6A 4YB5A 1G3CA 3R5GA 4QU7A 4DFJA 2AMQA 2ZKUA 1T7PA 2KFWA 4W4MA 5FLXU 4OZ3A 2R0KA 1WEZA 1VRTA 1ACBE 5HLFA 3P4UB 2FDNA 3KLEA 4ECRA 5IV4A 2FEQH 2CDRB 2W25A 2C3PA 9LPRA 1Q5YA 2D3ZA 3W65A 3NCQA 3T25A 4S3JA 3GJTB 3PMBB 4TU7A 4TKTA 2Z7FE 1DHMA 4J9SA 4BAKB 1T9VA 4YN3B 1NB2A 1C1VH 2J97A 2JVOA 1WU1A 4DR5F 2VB6A 2VUGA 3A3OB 4CCHA 3M3VA 1Y3WA 4MKYA 1OWXA 3TH4H 5F8NA 2G8TA 3RXHA 4ZVFA 2XMTA 3SCLE 1ELOA 1N0VC 3TZZA 3F3BA 2HWTA 1KVIA 5DSFA 2MNTA 2AYBA 3F0PA 3OA5A 2G81E 3DLKB 2XLIA 4JV1A 2HK2A 2MQQA 1WC3A 3FBEA 2R2SA 1K1LA 1XM1A 3E3TA 3FFIB 3SV4A 3A7TA 1YBAA 2GO8A 4DWSA 2XBWA 3I4PA 3MMCA 4DR7F 2KXNB 2GZ8A 3BTEE 1SL0A 5HMWA 3ATIA 2VOOA 2V8DA 4J9MA 2G51A 2RCEA 2PMWA 5CE1A 4I7YH 1GI9B 1QL9A 1VCQA 4RKOB 3UO0A 2KDOA 2PGCA 1IOEA 4DV7F 3AD8C 5L1JA 1PC4A 1FX0B 3S7HB 2QFIA 4DV1F 2VGCB 1OPIA 1VC0A 3AB4B 3OR1B 2EG2A 4K8BA 2IJRA 5FPSA 2ZDKA 4PXEA 5A8RA 1LEOA 3TA0A 1AO5A 1Q53A 5K14B 1JJHA 1MZDA 4ODOA 2BX6A 1V6DA 2VOPA 1ZL1A 3P3DA 1BIOA 3EZ5A 4N47A 3TNVA 4ECQA 3KG1A 5GAHU 2ZZNA 2G13A 2N4CA 4NL5A 2XPBA 1C1TA 4KJIA 4TYOA 2GZ7A 2OPQB 3BQ1A 5M2PA 2GS8A 1QJ1B 1EQ3A 4DPOA 5E2QA 4MPXA 4WTOB 3K6ZA 2ZBQA 3DN9A 4P74A 2WPLS 4ZK7M 2C1EB 1ZAVA 3QQCD 1DE7H 5GNDA 1GGDC 3AOBA 4MNYA 4AZ2B 4B3TF 2DNOA 5HTGA 2HW3A 3G8QA 3J80Y 3PRVA 4P6QA 5ITHA 1I94F 2XWYA 2KN4A 2QA2A 5FPTA 4YUDA 3E8LA 2Z3DA 5EDWA 1AD8H 4ZN3A 4JZEH 1JX4A 1W14U 2VH6A 2AGQA 3N0VA 3MM6B 1A2CH 1B7YB 1HQ2A 4Q2LA 1ZSKA 1JCHB 4WP8A 1PPGE 3QJPA 2ILZA 5F8XA 3M32A 3FVYA 1W13U 4GHQA 3SIPB 4ZCMA 3GQCA 2E1MC 3W2WA 2Y5HA 4O03A 2ZD1A 2KB2A 5C2ZA 2KM8C 4OZLA 5J2MB 4DOQA 3KUEA 3GIKA 3E2EA 6FDRA 3RB4A 1P3EA 1YM0A 2ASLA 1TGNA 3KAFA 3HF5A 3EGKH 3PJXA 1SGCA 1C5RA 3BF6H 4NWKA 1FONA 3AA9A 4N8NA 4KP0A 3DM2A 1ZETA 2FS9A 3ZZ0A 3NRKA 2XHCA 2HNDA 2FESH 2Z6BD 3DOMB 1VGCB 3BEUA 2FZGB 2ANWA 1O2XA 3M8PB 3UNSA 2L9NA 2VJ1A 5IDKA 5B0CA 4OM9A 5I3UB 4NASA 2SNWA 3O44A 5I3PA 2AQ4A 4OX8A 4RU2A 1DLOB 1TKZB 4BAOB 5ABWA 2OFHX 3O6QA 1T11A 2ZGBH 2WOMA 1UHBB 3A89A 4C8MA 1XMOJ 5F9NA 2CJKA 2LVWA 2JEJA 2M08A 1W1PA 4KGXB 1B99A 2YNIA 2D1JA 2V67A 2XWXA 1MWZA 3H5SA 1VJAU 3MDYB 1BUXA 2J38A 6GCHF 3NWGA 2NS1B 2OGUA 3R27A 5JPMH 4I32A 2HS4A 2YX1A 7GCHF 2ZITA 3MU8A 4KTSA 2RUCA 4PAAA 4O23A 5FL7D 4OGXA 2ZPQA 3GYMA 1JLEA 3UY9A 1L3UA 2EI8A 1NH6A 1IQNA 5HT1A 4AN7A 1VF8A 2X1AA 2KH9A 2O8TA 4FKXA 1M1GA 2OKQA 4P02A 4WJG2 1EP6A 3PV4A 1EDQA 3WD3A 4PPZA 2IHR1 1UVKA 3MM5A 1UJ5A 1IKXB 1QGFA 2OMOA 3GCNA 1QPLA 3Q77A 1P1LA 4C3KA 2RA0A 3GOVB 4FUBA 3VZHA 2QA4S 1KY9A 4IR1A 5JJBA 2OXSA 3A4TA 1YWUA 2RQSA 5ETLA 2Y1RI 4KAIA 1YHQS 2F9PA 5BR8J 3M5OA 2PSYA 3A7ZA 3K8WA 3PEJA 4ABJA 2ZTYA 1TFXA 2FLOA 3BG4B 3WWBA 1SH2A 4USKA 1WC5A 1Z4UA 1FRIA 2WPKS 1R3NA 5HVHA 1WCZA 5CYQA 1WQSA 4B6EA 1QPFA 4PG7A 4USIA 4FETA 5L2ZH 2R7XA 2GTBA 5LMNF 4D7FA 4OX9F 3THTA 5JXSA 3LWMA 2CVEA 1HD1A 2RS8A 2WAQD 2AP6A 3R9LA 2HAFA 2W9CA 8GCHF 2UV8A 3EZUA 2N87A 4WTYA 2X1GA 1QNJA 1V2NT 1NPKA 1TA6A 3ZZ7A 1Z1JA 1PINA 2R8KA 3BH7B 2V6NA 1P5QA 2F8EX 4DG1B 2P8OB 3B9FH 1THRH 4NSVA 4KY3A 4YEAA 1MCTA 4PCQA 5HK4A 2VQEJ 4IC6A 5DDOC 4LRCA 3KAHA 1ZR0A 1UZDA 3GPKA 2H1UA 4OS7A 1WG5A 2GA7A 1MTNC 2R7RA 4GRSA 4PUOA 1C5MD 2GIQA 3TC5A 5BJRA 1JLQB 5ETRA 1URRA 1K0VA 3KJQB 3OFND 2QF0A 4F2RA 3LANA 3IAS9 1JXEA 3PYGA 2SGFE 3TZXA 4DDFA 4ENOA 4PROA 2RJZA 1C4CA 1RWOB 3CJSA 2MGZA 3GS9A 1KP6A 4A8MP 3M5MA 5E2OA 3T9NA 2GMHA 4QPTA 4JZDH 1O51A 3CGMA 2BKPA 1SIWB 1B6CA 1R0AB 3I6CA 1Y8TA 2BX4A 1GVZA 2AFQB 2PLXA 1IBKJ 2CQIA 1K1OA 2NZ4A 1F2GA 1E34B 2DSZA 2C2NA 1EB1H 4K4YA 1TQ7B 1NHKL 3M8WA 1WDTA 1K9TA 5C1UA 5AFZH 1M9UA 1N8OB 4U7CA 1BLUA 4ZVEA 3LF0A 5HP1A 4Q8FA 3KG0A 5KG1A 2ZOFA 3KN2A 1O3IA 2E9TA 1AFJA 1N88A 1UW9A 4CH7A 1AZ8A 1BOQA 3KQBA 3MMAA 4J4NA 1HW9A 2BJDA 1NRPH 2XC0A 4SGAE 1IBMJ 2XG8A 2CV3A 3KACA 5DP8A 3MQKC 3BTDE 3MEEB 4JYUH 3NEKA 4OZ5A 1D3QB 2L9DA 1HI0P 1DITH 1VFJA 2IYGA 2FY8A 1GMDF 3LKWA 2XP6A 4AXIA 1SFIA 3G6ES 2PFEA 5H9FJ 3FVFB 3W5XA 3ATWA 3P95A 4NEZA 1HAXB 3QT5A 1UWBB 4PABA 4FF2A 3OTOF 3TEGA 2B6AA 2EKYA 1RTJA 1KD1T 3B9AA 1YLXA 1DZ5A 3BSNA 4WKHA 1DQAA 2WPMS 4I2QB 4X4OA 4CLKA 3SUDA 2FLRH 4A8SA 2G2OA 1F92A 4FAPA 3UWIA 3NMRA 2PHBA 1KQKA 2LXIA 1ABIH 2HFOA 3M37A 2KE0A 1K22H 1VIXA 1ELBA 1R8PA 1GJ6A 4CLTA 2V50A 2YNGB 2D9PA 4LF9F 2O8WA 4QOTA 2BY5X 4ZLLA 4WE1A 2UUKB 5HQLA 3PRBA 1LK5A 2BD5A 1X5PA 4PXBA 3SBKA 3VG8A 3PYEA 4X6NA 2G2ZA 2BXJA 4F50A 4ZMMA 1O6IA 3S6EA 3L3TA 3CCJS 1CJUA 5DJBA 1GI7B 2ZJQQ 2JETB 2XHWA 2XP8A 1TL7B 4DV6F 1K1PA 1JLCB 5CYJA 4FPRA 2ZH5A 2C22A 4USJC 2Y6TA 4I69A 2F9OA 5EOKA 1ZPCA 2IUZA 4LF2A 5DN6D 2B3TB 1UK2A 4FF1A 2F40A 4Y79A 2CZ9A 3W2VA 2FC9A 1SC8U 1KT0A 2RUDA 5HL7Q 5HKGA 2YKMA 2ACYA 1XERA 4Y34A 4IRCA 1MWYA 1A61H 4LF6J 5D6GA 1WKKA 3CENA 4ABAA 5LSOA 1HBUB 1MTVA 1WEXA 1E1QD 2DGUA 2G0CA 3KLFA 2HMIB 1OO0B 4X4RA 3L09A 4WPAA 3UW1A 5DKMA 3Q23A 4CH8B 1Q2WA 2BE2A 2LQJA 2CA9A 1Q8IA 1SGYE 1O34A 1Z71A 2JETC 4HI1A 3O5GA 1YGCH 4RW6A 4UE7H 3SQOP 4K4WA 4NA1A 2LGOA 3EA9A 3GCTF 4A1VA 4RW4A 4AX9H 4Y76A 4GO5X 2QMUB 1SFQB 1IR0A 3BTWE 3UNQA 2L6OA 3KK3B 3OTJE 2CQ2A 2YQ0A 1E6RA 4JYVH 3UDVA 3O5JA 3F41A 3HKIB 1PJPA 4MPWA 3C6TB 3P5BP 2IF4A 3R5AA 1WORA 1XR5A 3E6PH 3QIPA 1S6HA 3PG9A 3WL1A 3LC5A 1BQNA 1RT4A 3Q8RB 2DK2A 7AT1B 4NLUA 1C1BA 2J6TA 3RXAA 2RMLA 2W8LA 3B6BA 3VAJA 1OQ6A 1MAYA 1O0DH 3F73A 1NPMA 3F6UH 1B0PA 2YNHB 4CO1A 4E0DA 1J15A 2NCKL 3OFEA 3SBMA 2JJ1D 3O5LA 2QTWA 3VAGA 3T5HA 1LG2A 2WPJS 4ZVTB 3NUMA 2NYHA 2PDAA 2LNCA 2DHAA 2WYJA 2WPHS 1HFDA 1YLNA 2Q43A 2J76E 1PC5A 3TK9A 1EIYB 4DR5J 4MIAA 1GJCB 2AMDA 4RSPA 2UUAF 1JLBA 3HI9A 4R0XA 4P2SA 2YMSB 5AJ3F 3QMQA 2BD8A 2XNRA 4DL3A 1C2JA 1HB0B 1TNLA 2PKSB 1BKFA 4E2FB 3MO9A 2P3TB 1RT2B 3U02A 3HKJB 4EYHB 2PI6A 2KI2A 3BR8A 3T2NA 1G30B 1HIAA 4WKRA 1C2FA 3RC5A 2N7CA 3PTBA 2BQUA 2FM2A 3ARSA 2ALYB 1MKXK 1XX9A 2PKAA 3PJWA 1SKRA 4BLGA 4ZPCA 2PSZA 1RTZA 4N77A 1L3SA 1E36B 2PN6A 1S9FA 2ZBRA 5TJXA 2R3UA 1O3MA 2V8GA 2J0WA 3CJTA 4MMOA 3FFIA 3TJ8A 3KLGA 1MROA 1TP7A 4ZXYH 4HHUA 3AQPA 5HQMA 3RB6A 2LKZA 2Z9JA 5GWZA 4WZQA 2EULA 1T05B 4ZAEA 3FFGA 2ZDOA 4XTTA 2H5IB 3CS7A 3D6HB 2BDIA 1VJ9U 2HGMA 1PQ5A 2HIQA 1D0EA 4QT8C 2JJ4D 4UEHH 3ILIA 4ECVA 2Y1IA 2M88A 4F3OA 4U67Q 2DPIA 2UUCF 1Q16B 3UAIC 4FS1A 4DQSA 3F0NA 4MLFB 4AYVB 1QUPA 3C16A 5JVGQ 1FKFA 4EEYA 1VR6A 1G36A 3OL6A 1BBRH 3UTUH 3FBBA 3FJ2A 3CJ0A 1P9QC 2X51A 2ZOGA 5B8IC 3QT6A 4LFCF 4A5TS 3MAHA 3DSOA 3UR9A 3ZTOA 1F0RA 2QEXS 2G0IA 1U1OA 3AK5A 3UQVA 3PMHB 2LDYA 2DXEA 1O35A 3TX8A 2EW9A 2ZWPA 4HEA9 1VBXA 1NZQH 1GBKA 1D9AA 4HTIA 4TYDA 1VQ6S 1D7HA 1HUTH 1QHRB 3WKZA 1T03B 2UZ5A 1UW7A 3Q2SC 3M7VA 5CYMB 2M5TA 3MWIU 3IR5B 2IC3B 5GMEA 1KHVA 3ARQA 3A8BA 3C1KA 7ESTE 1F5CA 1B7FA 1Q82T 5C0UA 3CDAA 3DU6A 4QT2A 2VC1A 3QZ8A 1J16A 3TANA 4X62J 1FVQA 1SH3A 2AZ1A 5D4LA 3OBIA 1C4Y2 1LQEA 2ZNYA 3SSSA 3CDWA 1S84A 2ROGA 3H25A 2H5EA 2BW2A 2ZH2A 2AYGA 2OJ3A 1V2KT 2YNBA 1WQVH 1ZU8A 3G82B 2C3OA 4ZXXH 8ATCB 2C8WB 3MR2A 2CDQA 4NI2A 4UF4A 3DRRA 1SLXB 2FS8A 5K8MA 2QLXA 4MFBB 4X4VA 3H2UB 4ANCA 1FRXA 4CRCA 4DURA 3U9AH 3ZZ4A 2IYIA 2OPPB 2QL7B 3A3PB 4R8TB 1AYEA 5FXLA 2KKHA 1FK9B 1A46H 4DV0F 5IT9Y 1FI4A 2LECA 3LT3A 2ANMH 1S6PB 3U8OH 2ZF0H 1VQKS 3KMSA 1Q86T 2EC9H 4MTVA 4J9LA 1BMLA 3GCHB 2PGBB 1O36A 2FOMB 2YX7A 2F83A 4F4ZA 3UUZA 3HHLD 3RU4E 4MJKA 4UTGA 3R7SB 3T28A 3IR6B 4ZCNA 1AGJA 1BA8B 1H9LB 3EPIA 3CSKA 2JZ5A 5A8ZA 1FI8A 3LALA 3M8RA 5KEDA 2VIHA 3HVRA 4X6MA 4YTAA 3GFHA 5C25A 4DRIA 4P10A 2CG8A 2QF5A 5E8EH 2CADA 5F8LA 3I56S 2W7AA 1MG7A 2EI6A 4LRBA 1QJ7B 2PIIA 4DSIA 1L4DA 2GVZB 3N7EA 2FOAA 1W7WA 1HAYB 1RS0A 1AZZA 1V5IB 1JLFA 1N34F 1ARCA 3GV7B 1GI6A 2DBBA 3POTB 4IDKB 3KHVA 4NRTA 4Y71A 1LWEB 1IKWA 1HLWA 3VPKA 1VS3A 1FX2A 3BJYA 4CTAB 4DQRA 1P57B 5RUBA 4NIXA 3MU4A 4Q7AA 1AFQC 4DGJA 4BXWA 2WK4A 2Z9IA 3MMBB 1FLEE 1AMHA 1B0FA 1W8BH 1NDCA 2HHUA 4KO0A 2RS2A 5IM0B 3H42A 3BPSP 1PPFE 1FKSA 2MEWA 4F8RA 3EA7A 3SU5A 2BLQA 1GK8A 2KFNA 3RRHA 1XMQF 1SC1B 1QL7A 3SNCA 5LM7E 1ELVA 4JYSA 1HXFH 1NAQA 3JTNA 1T9WA 1SVDA 2GV1A 3SGAE 1F60B 1G32B 5J2NB 1VQ4S 4C0HA 2R0LA 2PPPA 2DNQA 4LBPA 5K5MA 1N33F 3TUIC 3W1YC 1T3OA 3TVYA 1WHVA 2XCFA 3N4WA 4JB8B 4N7TA 4OIXA 3JZ2B 3DLGA 1YKTA 4B3SF 1L1JA 2J5AA 3ILOA 1OWKA 5DRKA 1F2SE 3MI4A 2IAJA 3I77A 3R3TA 2BLOA 2W2MP 3BV9B 1C1PA 5EW1H 1MTNB 4DR4F 1OWEA 1FD9A 4HLBA 4CLLA 4UFFH 1X6LA 1WHXA 4RR5A 1EPTA 3CCQS 2R9PA 2D9OA 3CF5Q 2VIOA 4J9VA 4RUCA 2W26A 4Q7XA 1UPPA 1N52B 3IM8A 4DQPA 5FDLA 1ZHMA 1C1NA 2CJ9A 2E44A 1J2VA 4HTJA 2QFJA 1HBMB 1LQ9A 2OAUA 3IG6B 4NMXA 3NOCA 2KU7A 1UTMA 3AD7C 3HLUA 3UN2A 2POKA 4HL9A 5ESBA 1E6YB 4M7GA 3DRPA 3DRSB 4ZP9A 5HWCA 4AYYB 1UWAA 1BWEA 4CO2A 3D5MA 4WFXA 4Q63A 1XUGA 3UREA 3OTDA 1KTTB 1NROH 2B8PA 4ZH8A 2H5CA 2X1BA 2E5GA 2RDJA 5ADZA 1YPHE 1QTMA 4ZCKA 3CCMS 1HAGE 3GR0A 3GCOA 3EA8A 1RD6A 5I42A 2QIFA 3AAVA 2LJ4A 1D2KA 2KCPA 1NSKL 4A1XA 2CKWA 3RMOH 4TNOA 4Y8ZA 1B0VA 2CZ4A 3NAHA 3MNCA 2QXJA 3CT9A 4ELUA 3OY5U 5G4BA 1C9TA 1ZB5A 1X4CA 2A6OA 1D6OA 1IWAA 1J5EF 1QE1A 1FO1A 3JSBA 2M8DB 1O37A 4INKA 3HKWA 1RT1A 1X6NA 3NRBA 3IBFB 3B8HA 3FXYA 2LP4A 4WFNQ 1WDDA 1SGFA 2B4OA 1K2I1 3A8CA 3MCSA 4NOHA 1GBAA 1PPCE 3E1XB 3PO5A 3T1YF 5GAEU 3BQ2A 2BD3A 3IKDA 5DQGA 1P9UA 4F02A 1NO8A 2UUYA 4DQQA 1YX2A 4CNZA 3F9FA 4ODLA 2IPQX 1BXNA 2KO1A 4DSLA 4DCPB 4UOFA 3RR7A 2OPRA 3GIIA 3WD4A 2VA3A 2ZHQH 3K65B 4LF8F 1FEEA 1Q3XA 3GFZA 1S0QA 4K3JA 3EGWB 2ZBIA 3IA0A 5C24A 2RQ4A 2OHDA 3MUVP 2FLPA 1VJQA 4JZIA 2VONA 2A7CA 4IBLH 1CG2A 1S1VA 1YBWA 1PPZA 5L1LA 1KHWA 1PSDA 3CO0P 3H0PA 2V8HA 3AS2A 2B6AB 4O4GA 1YKWA 2FHOB 2G55A 1U79A 1Y5UT 3IWLA 4YT6H 1FMGA 2LEAA 3PB1E 4BXSA 4H42U 2FI3E 4M1KA 5KFSA 1T9XA 4I8HA 2CUYA 1W10U 3CD6S 4IC5A 1RWPB 2OELA 3OFGA 4TNSA 4FN5A 2M9KA 4ZPTR 1UR9A 1HNZF 1TKXA 7FDRA 5EQQA 5A2QU 2DT2A 4HH1A 1HJ8A 4X65F 2ZHFH 2MLXA 1HW8A 4K8YA 1NDKA 2B31A 5JVHQ 4ES1A 1B0EA 5T6DA 4DH0A 1FNIA 2APOA 3AQOA 3PLKA 1O2PA 4C0BA 1ESTA 3KQEA 1FKIA 2C2RA 4ECTA 3AJ1A 1OSDA 4G1QB 2IM3A 1TL7A 1Y5NB 1S99A 3M36A 4WP3A 3NWRA 2HZVA 4DG4A 3I82A 4A8QA 3J7AN 3T19A 1K0HA 3IRXB 2HOBA 1XXFA 2AGGX 3PFEA 4J91A 5GMDA 4CRDA 4P00A 4PKDB 1CGIE 3DRXA 5G0RA 3CJ8A 1FXYA 2YWWA 4NZCA 1EP5A 1RTKA 1GHWH 3SNBA 2GKVE 1R89A 2JH0D 1VLYA 2I5JA 3MR3A 3BSOA 3KLFB 2HMIA 1O3CA 3RXPA 2LFVA 2Z9KA 3PW5A 2WONA 3K5NA 2QJ3A 4TY8A 2DIVA 1LFPA 4YLUA 1FJCA 2ZHEH 4O97A 1G37A 2AGIX 1F9EB 1HBOA 2MZRA 4X4UA 2MYFA 1JQGA 2O8UA 1HQEB 3TP2A 4IN2A 2Z2ZA 3CD0A 1XR6A 2B9LA 4FS2A 4M5DB 1RIWC 4I2PB 3RXBA 3PKMA 3DD2H 1PQ7A 4K4XA 3ZVEA 2Z2YB 2CPYA 3TZWA 2HBZB 3LP2A 3MZIA 3K2YA 4ICLB 1S9GB 3JB9k 3MD1A 3BEFB 3BXWA 1IBCB 2ZQTA 3MTKA 1ANBA 1J8AA 4DPUA 1Y3XA 4XFQA 4NLDA 4BWJA 3UQSA 3FRZA 1AUJA 3MH4A 3RXOA 4H4OA 3PJ9A 2OH2A 4J1YA 3SDEA 2VQFF 2PV1A 3X3UA 3RB0A 1V2JT 1AZSA 2KXFA 1TQLA 1DWEH 1GI0A 4OYOA 4DV5F 1MNEA 4FBUA 2L3MA 5C3NA 1GDNA 3A8IA 1XKAC 1RZMA 2A3EA 1U09A 1MWQA 4SGBE 3LOXA 2UV8G 4V1Ak 3MEKA 4IG0B 1F5AA 1Y3JA 1MKXH 1V3RA 3CPWR 1W1VA 1AA1B 3LO3A 1KLJH 1YJUA 2YH1A 2ALVA 2DRBA 2BD4A 1TGSZ 1LWFB 1SJ4P 2BD7A 3BTGE 2BOAA 1ZSJA 3QTVH 2AOSA 3J7YI 4DV1J 4ODQA 2UUAJ 3R2CJ 2FOEA 5FPYA 3MI7X 3KQDA 3M5LA 1GXTA 2RDLA 2W2PP 1RBLA 3RXTA 1LV5A 2RNEA 1RSCA 1H8HD 2QF3A 1RT6A 1E15A 1C0UA 2QV1A 4ASUD 3A7VA 4RN6A 5ETOA 5D8HB 1MU2B 1MU8B 2F63A 4C6AA 2B4VA 1SQRA 1SUQA 4CP5A 1MMJN 2BYAX 3HK3B 2RDEA 1FDAA 1OOKB 3IRWP 3OUYB 4EYIB 1F0UA 1M1HA 2V94A 2ZUAA 2FGCA 1L5UA 2KM0A 4F4WA 4G65A 3GV5B 2Q1JA 4UFGH 1U1RA 1PKUA 1HIAB 2CMYA 2VBXA 1NJWA 1G7CB 1LHEH 3CZ8A 4UONA 1DLKB 1HAIH 2FP7B 5HQ8A 1Q8KA 1YJRA 4Q7ZA 1JXPA 1H2VZ 3BGRA 1EETA 3TVZA 1GBTA 4KV8A 2JLFA 1HCGA 4X64J 4DI6A 1MROB 1FKHA 3PMJA 1D7IA 3VHQA 4YFUA 1PBUA 4DL6A 3TJAA 3MM8B 1TTHB 5HBMB 4P8WA 1F7ZA 4O2TA 1S0RA 2HQCA 5A76A 1F8AB 3WD1A 3TAMA 4I7FA 3TVKA 2KX4A 4LGXA 1PJ7A 2AW0A 3Q2TC 2ZDLA 1RI7A 1JLGB 1BCUH 3FRYA 4DV3J 2XBXA 2P3FH 1NC6A 1P2MA 4EO6A 4ZPVR 4AT1B 2J7UA 2FDMA 2JNJA 3AS3A 3BG4C 3M6UA 2BB4A 1TL3A 1D9FA 2J5UA 1TRNA 4DS4A 2MKYA 4RO0A 1XHGA 1VRUB 2TIOA 1PJ5A 8AT1B 2K2PA 1ITXA 2F9NA 2KO7A 5HBFA 4DSKA 1T31A 1WF1A 4HG6A 1MKWH 2YNFB 4EBCA 2J9CA 1BD6A 2MDAA 2F4VF 2BHGA 2J9NA 3HHLC 2F4LA 3PW2A 2FC8A 2EFNA 2CIMA 5GJ4B 3CO9A 3SGQE 4EFAC 3OV7A 1B70B 1NK6A 1TOCB 1U25A 3GV8B 2YWGA 1LKAA 4XE4A 2GHPA 4AUKA 2UVVA 2A0FB 3FSYA 1OY9A 1LXJA 1D9IA 5G4DA 5ETXA 1LNQA 4RNFA 2C2ZB 3GDVA 5M2RA 3RXIA 3CCRS 1Z1IA 2KG0A 2YBVA 4CLPA 4YLQH 2QYCA 1ELAA 1FKBA 3UR6A 3MNSA 2NR0A 3G01A 3PYHA 1LPKB 4LF6F 3H7OA 4DWIA 4LF5J 1T8NA 3BTQE 4CIOA 3G82A 2BDCA 2FLNA 3JTOA 5LSRA 3OR2A 2VDHA 3DHWC 1W26A 4X0WU 4NI2B 3D28A 1C1QA 1F9HA 2A5IA 4N19A 1UEUA 2YBUA 2JLEA 1SJ1A 2I38A 2WVDA 3M8SA 5T7LA 1EYMA 1HPGA 1MD8A 3UDLA 2A18A 2BD2A 3W95A 4U6PA 1ZLRA 1HAOH 2HHSA 4AGKA 1A1RA 3BYPA 1U8WA 3NGTA 3PKYA 1IBLJ 5HJYA 5L1KA 3HK6B 4URIA 4K5SA 3ZZ5A 4BCAA 3LP0B 4P9SA 3R6LB 3T62A 3DI6A 1Y3VA 2NYIA 1TKTB 4JI7F 3CMQA 2XMUA 4EO8A 1ZPWX 3ZIAD 3UI4A 1TIOA 2MF9A 5BR8F 2A32A 1AI8H 1GMCF 2H6MA 4IKAA 2ZTXA 4PPDA 1S49A 1VKYA 5C25B 1RKIA 3DC2A 1G1XA 2LCWA 3OSNA 3KLVA 3FQKA 3B4MA 3OX7U 2FHMA 3V4IA 3GY4A 4ETXA 1KQSR 1NMWA 2IN2A 2HRVA 3PR5B 1X9MA 1Y59T 1TPOA 4WU3A 1RA6A 4RW8A 1SL3A 4XBCA 2GVZA 1ROFA 3RMLH 2PP6A 2HNZB 2MHNA 1XRVA 5ETTA 1ZH5A 1PIEA 2PI5A 5J2PB 2JH5D 1IBKF 2UXBF 1HAZB 1U48A 1C4V2 3UWTA 4EU0A 4MPVA 2TBSA 4CTAA 2J4IA 1HQUB 1OWDA 1SMFE 2PD1A 3ZXWA 3UPEA 4ZKOU 4I33A 5K7RA 4DF4A 1HNZJ 5LH8A 2V5HG 2VJUA 2DGOA 2RUSA 3MMBA 2FOHA 3G9CA 3D0GE 3AXKA 5IM0A 4RNMA 5B0FA 3DLKA 3G6LA 2V4QA 3A88A 3KLHB 2FJWA 3UD5A 4JFLA 4B74A 4Z2JA 4ID5B 2VC0A 2M4MA 1GI2A 1FFSB 2J6UA 1XMOF 5LL6d 3U27A 3US5A 3MMCB 3A7YA 5H4IB 4Z2KA 1RXOB 2J8AA 3VTIA 2HFUA 1UCNA 3UOUA 4PR6A 5K8NA 5C20A 2JX2A 1FFWB 5HM2A 1ZAWA 1CU1A 1O3EA 1LVOA 2IJFA 3ETOA 2UUBF 3GLJA 2V4RA 1JNZB 7LPRA 1K44A 4QWDA 5J2NA 3N7DA 2VG5A 5IC4B 3UI6A 1UL3A 4CRJA 2GDEH 2PTNA 3OR1A 4OYAA 3W7BA 1RWXB 3OTPA 4DRNA 4QQBA 1AFEH 2ZHOA 3DLGB 1C5LH 1T32A 2C3SA 2XMMA 2UWLA 2HGLA 4YO9A 5HIYA 4DX6A 1VQOS 1SOZA 3MHYA 4Y7BA 1VGCC 1AE8H 1S6LA 4I64A 1KXCA 4OZJA 1O2NA 1O3LA 3FSXA 3OJSA 1JVWA 1COWD 1HGTH 1NNDA 3EXCX 1T02A 1PYOB 3N5FA 2ZU2A 4G3IA 4UZCA 2CPIA 5AE1A 3EM1A 3VB7A 4AL5A 2V7QD 3W60A 4B3RF 3DXBA 1TQ0B 2XY6A 1S6QB 2Y8YA 5IC6B 1P11E 1JBUH 4DW2U 1YRXA 2C3MA 4IG3A 4AC9A 4U96A 1Y7PA 4U95A 4DCDA 1V5VA 2WVCA 3ZYDA 2MSTA 4LFBF 1OYQA 3Q00A 4PEOA 1BHNA 4ABHA 4YOEA 4ETZA 4WFYA 2M2BA 1A3BH 2DR6A 3LU9B 3O5KA 3G6YA 4DSEA 3B8JA 1GBCA 4QIWD 3SFGA 2QX0A 2OK5A 2CJXB 1VBKA 2Y5FA 2AMPA 4NLYA 5U47A 5EWFA 2VIWA 2BJ1A 4O3RA 5TCAA 4XDDA 2YKNB 4O9VA 1HJVA 2F3CE 5C67A 5THWA 2YKAA 3U28C 4LXBH 1CJTA 1MN7A 2P9EA 4UD9H 3KDOA 2R2TA 4OJHA 2FOCA 1HXVA 3IHZA 2FVRA 1VQ8S 2GVFA 1QUVA 4ALZA 2D3UA 4UFEH 4OLPA 1BMFD 1W7GH 2KFYA 1XNQF 1SYTA 4OJ1A 1LQDB 4CDIA 1GEHA 3M2UB 4G6VB 3GY3A 1AKSB 1DWCH 1V2UT 2V3MA 1ANDA 5KG3A 5CD4H 3RRGA 1AB8A 1S59A 3IBWA 3VVUA 1IHSH 4A48A 2F91A 1TVRA 1T0TV 1IQZA 2YVSA 1GI4A 2WW8A 3TUZC 2H5DA 1CHGA 1TX8A 3G71S 5KECA 5C0TA 3OSYA 3SQEE 2XMAA 1AB9C 4DR4J 3PW7A 3W3SA 2WLYA 5I3UA 2FVSA 5DQIA 3FBCA 2QC3A 1FIZA 1FDPA 2FI5E 2OPRB 1YBTA 4NEYA 2DNGA 4I0WA 1PGZA 1HLTH 1QZ8A 3CJ5A 5K20B 1S1TB 2DISA 3D54A 4TXSA 4ABEA 2FYRA 4WYLA 5D0RA 3HSGA 1O3AA 3SHAH 1D9DA 2RF2B 2BVZA 5DGAA 1HWLA 1XQIA 2JEFA 4KFBA 2ZGXH 5GAGI 4ES2A 3GJSB 3KGPA 3S69A 4DUYF 3UDCA 3ZNUA 5CZVA 2JC1A 5KGOA 2SNVA 3A82A 1L2EA 4TU9A 3PRAA 3FMBA 2DHSA 3CJKB 4HBEA 4RBTA 2AX0A 5DDQC 1PO6A 2HALA 3GYNA 3EUNA 5IV3A 1C1OA 4B9NA 1P2JA 2HHTA 2STAE 2W4PA 1W11U 2LU2A 1Z6JH 3NCLA 4IN1A 2MTLA 4IH5A 1YPGH 4OX9J 1NO9H 2C42A 3ENQA 3I9V9 3QZ7A 1YJNS 1P2NA 1TMUH 4X8SH 3GCXP 5EW2H 1KVKA 2CNLB 2GVDB 3VAFA 4IS5A 4USMA 3MEDA 1C2KA 2F9JA 3VALA 4GHTA 2CG4A 1YPJH 2VD3A 3BBFA 1GT8A 2DHHA 3LGIA 4DQIA 4JV0A 1XXDA 2QL5B 3F44A 4DXLA 4MNLA 3IRXA 3E90B 4U85A 2FPZA 1OSCA 1N6YA 3GE9A 3VGCC 3LPEA 2CXEA 3MPYA 4NYPA 5AXNA 4KE5A 1FD2A 2Q3PA 4DWSB 3GIMA 1Q78A 1HYLA 5KT6A 4KKDA 2Z58B 1BMMH 1AXQA 2MQNA 4QU6A 3AFGA 2VB0A 4CYUB 3TK5A 4U86A 2R7UA 3MM9B 5L46A 3QX5H 4DR1F 1Z2ZA 3ITHA 3SORA 4KKOB 2ZIQH 2NREA 1WTGH 3BTKE 4PQUB 3BG8A 4H4MB 2Y81A 1DFPA 4X1QU 5C2GA 2JIZD 3ODFA 3HKZD 4CHAC 1ZM3A 1EB0A 1HR0F 4YS2A 5A8KA 2Y0BB 5L9XA 1LG1A 1FUJA 4C4WA 2QSWA 2QA1A 3ENVA 2VODA 1TB6H 3NGRA 4FU9A 3LIWA 3LP2B 2A5KA 1VQMS 3T5LA 2FJVA 1JLQA 4ABIA 3FAPA 4OX6A 2ASDA 2NXUA 1KXBA 3BO2A 1FY5A 1S1WB 1KTVA 2I2YA 4IUFA 5FX5A 1SGNE 4PWUA 1HWIA 4BHQA 4B3MJ 3SO3A 1NFXA 2E7VA 2FQQB 3SDEB 3NI6A 1JNDA 3QGJA 3TJ9A 2JWNA 1PJ6A 2QMWA 4RWWA 3IWMA 1FAXA 1RAJA 3DSPA 1DY3A 2VASA 3ELHA 1CO7E 1TU0B 2IJNA 4IG0A 1O3FA 5IS2A 4CO3A 3LUYA 4TYBA 4DFPA 4ISIH 1U4BA 5LPRA 3VR1A 3OEHD 4AOQA 2HNTC 2Y78A 2RRBA 1SLVB 2AHME 4RLEA 2Z4PA 3MM6A 2JC0A 4WWYA 1X0PA 3Q86A 4OMFG 2ALPA 4DL0C 1UFWA 1KONA 3ZV8A 2MY8A 2VPXB 4FUFA 1P01A 1ZSLA 4UOCA 1RAOA 2ZFPH 2ZE2A 2VPWB 1QSSA 4LAXA 1A3EH 4KHRA 2CAJA 1S0MA 2Q6FA 2C93B 4LR9A 2YX4A 2XS2A 1NUEA 2GQ2A 4Z0KA 5DP4A 4MNWA 1TYNA 1Y5LB 1YRUA 1B5GH 3OUYA 3VXFH 3HVTB 3AW1A 5ESTE 2CJYB 1RT3A 1Z7KA 3AT1B 1J27A 1VIOA 4RKJB 1LTOA 3IR7B 2ROPA 3EE0B 2E9RX 2CQPA 4CO5A 5KFWA 1TX7A 4KV8B 4MT1A 4L72B 4X8UH 1SKUB 3DGPA 4Y0YE 3ENSB 1X9WA 3P8BB 5DP5A 3FP7E 3S9CA 4I1TA 3THVA 4ZS6A 1VRQC 2XP5A 3B54A 2H1YA 2XLKA 2ESTE 5C7PA 1GBBA 2XBVA 3FBFA 1K1MA 3OTCA 4BNRA 1PBKA 4JV5F 4JFKA 1A4WH 3QIDA 2XZTB 4TT3D 4ISOA 2BMBA 4J9NA 4ES3A 1I6JA 4DRKA 2C8XB 1XVMA 4DZ6A 2QSFA 3T5JA 3FEXB 5KFXA 1EOLA 1FY3A 4NXMF 4NYZA 1HNEE 4I56A 4C7QA 4FBTA 3UQOA 2B5JB 1K1IA 2THFB 3KCGH 2BDBA 1TL3B 3RUBL 1S0OA 2JL9A 3ISNC 1GUVA 2I6QA 1JLEB 1HJ9A 2NXJA 4QWCA 2ZDAH 2FUG9 2OTJS 3K58A 2ZDVH 5E0JA 1DSTA 3W2VB 1Y3KA 5B0DA 4I6AA 3J7Z5 1IQFA 5JBCS 4LAVA 3UR3C 4FU7A 2HLDD 6CHAB 4WKYA 2VH7A 3KMQA 2WB4A 1SQTA 3LC3A 5EODA 1M5PC 4EZ9A 4QR2A 2MPHA 3CGNA 4AL6A 4F0KA 2KAIB 2QN5T 3MCOA 2GGPB 2G5VA 3HT0A 2WW4A 3TK6A 1N5TA 1GNKA 2VG7B 5EXMA 5EX3A 1P2KA 1T8MA 4LIRA 1JXLA 2CPHA 5IK2D 5JDUB 1UJ4A 1V3ZA 2ZPSA 1S9EB 1UCYK 1FPCH 1G6BA 2JEGA 1VISA 1DFDA 1G3OA 2OFNA 2JH6D 1XBWA 4Z37A 2M0GB 4I6YA 2ZC9H 5L2YH 2VV5A 5KFMA 4ED7A 3MWBA 1QAJA 2HURA 3PO1B 4MK7A 3CXCR 5DK1A 5DDPC 1QBVH 1HV7A 1UK3A 1APSA 1MBQA 4ML4A 5E33A 3CE8A 1IQLA 3D9BA 2K8GA 3AJDA 4I6WA 4V19X 4C9DA 2NU1E 1N1LA 1JIMA 3RGIA 4Q45A 4DPYA 4NLWA 2FMJA 1TV6B 1UTQA 4UUWA 4M5JA 2VFUA 1WUNH 3QRRA 4WKAA 5A0BA 2HFSA 3GYGA 4Y2KA 4R0IA 2E7XA 3QIPB 5KOXA 4DV2F 2BE7D 1A7SA 2JH3A 3X1LB 1GHZA 2BD9A 3SI3H 5C2CA 3V2UC 4LZ1H 4HARA 1ZZFA 2B4PA 2ATCB 3TYTA 4DU8A 4YOGA 4LFAF 1QTNB 1XVOA 1P6TA 1LWCA 3EE3A 6CHAC 2WPDD 4PZVA 2TGDA 1RJXB 4Y11E 3DI6B 2VIPA 1IQHA 1SB6A 5FCKA 1ZK6A 5EJ1A 1XK8A 2W3KA 2Q5AA 2HVYB 3RP2A 3RBEA 3ILJA 2VIVA 4FYWB 3B7XA 3G6MA 1SOTA 2VIQA 3N6NA 1O2JA 1IBLF 4E06H 3LW5C 5F8HA 3PZPA 3N7OA 4Y2IA 3FP8E 3OQ2A 4K69A 3M30B 2ZTZA 1NRSH 3QTOH 5AJ3J 2OUAA 3LGVA 4X1SU 2AT1B 4QR1A 1ESAA 1FKAF 4DFKA 2PKSC 4K2JA 2ZA5A 3SZ2A 1E35B 3QLPH 1KS2A 3GCTG 4FZVA 4C8KA 1EQ0A 1YSJA 4ANDA 4Y0FA 4L73A 2ZZTA 3IFEA 2Q6CA 1DS2E 2ZGHA 4QCLA 3PX6A 3VVTA 2R2WU 1UPMB 1KXAA 1EZUC 5LPEA 1WKLA 4ODMA 2HIYA 2ZM6J 4B08A 3PFOA 1S7IA 1RABB 3MMAB 4KSEB 4DR2J 4FUGA 5DITA 2Y82A 1BITA 2D74B 3THPA 1WJ9A 2SGDE 2IM2A 5E3PA 4FF4A 4DR2F 1RTDA 4B2CA 4IQCA 5F8ZA 1R8HA 2QLJB 4B9SA 2ZR6A 5HROA 1JJ4A 2BY7X 4ECSA 4Z2XA 4B3TJ 3WZ0A 1ZTWA 1C5TA 1H0IA 1Y10A 1EOJA 1YP9A 4IH6A 5IOLA 3UR0A 3EPGA 2FI4E 1DY8A 5ETQA 4C0OC 3ET6A 2EBGA 4P8VA 4K60A 2MSSA 3M8ZA 4LRFA 2HZAA 4ZITA 3NK8A 3V6JA 5KT4A 3PM3A 3F9HA 3TWZA 3K59A 1M1KT 1LXNA 1RD3B 4YESB 2KGJA 2NU4E 3EXYA 4I67A 2H65B 4NLSA 2GCTC 4WF9Q 1YDLA 2TRMA 2W4CA 3KYFA 1P12E 1V2PT 1Z8IB 2F4VJ 4WIWA 1OJ4A 1F40A 1RHRB 2XCAA 2HQ3A 3SUGA 3KAIA 1Q6UA 2ZHDA 2MQOA 2ACMA 4NIYA 1FNOA 1RAAB 3WX8A 3TI0A 4QYRA 5KFZA 3I29A 4B9LA 1CJUB 1QCPA 2J6SA 1PFXC 1U2RA 4F55A 1R8AA 1U6BA 2R3YA 2BE9B 2AERH 1NDPA 4DT4A 1IXKA 2F2DA 1S79A 2KTQA 2WHXA 2A6MA 1HI8A 5D78A 3P5TL 3RM9A 1U1LA 1X5OA 1WXRA 3C8YA 1TWXB 2ZDMA 2Z0GA 4DV2J 3BN4A 4Z2GA 4ZVRB 2M8HA 3AH6A 3PLBA 2D3O1 2ZC3A 3OXGA 4BANB 3AQUA 4C02B 3K5MA 1HBNB 3PV2A 2CPJA 3T29A 1O2UA 3N9UC 2IMWP 4G1PA 2OD6A 3KF2A 4GC6A 4CI0B 4MNKA 2RQKA 4BTIB 2HPPH 5DP9A 1RKJA 3BMBA 4ZJLA 3LDXH 3V12A 1L1NA 1WUUA 1NK7A 4X4PA 2WSSD 1W9UA 1SQAA 3S1TA 1FK9A 2XNIA 1VCTA 2HK3A 3W61A 3RM8A 1S6PA 3LGYA 1MMLA 3KXDA 4RW6B 1G9IE 4XBDA 5DO4H 2ZDNA 1B7XB 4G50A 2ABYA 1AKSA 2YWKA 2DGTA 5DM7Q 1L4ZA 4RW4B 2OPSB 2F5GA 4O0NA 3UFAA 4OHYA 2SXLA 1NBMD 2JSXA 1U8SA 3R5CA 1S6UA 4A7IB 3KADA 3HJVA 2VIDA 3NNCA 4L6V3 4JI1J 1CT0E 3RC6A 1IJEB 2FXRA 4CRFA 2MPUA 4KTCA 1C2MA 5H9EK 2L74A 2ZKSA 2WLZA 1C5UA 1ZHPA 2ZFHA 1KDQB 3HD2A 1QIXB 1RT4B 1S1TA 4X8TH 1N5YA 4ZPBA 3JSMA 1VK8A 1XKBC 3TJVA 4USVA 2DHGA 5JBTA 2RF2A 3OTEA 1JLFB 2YMSD 1ELTA 3TH2H 2YNHA 4YM9A 1R0CB 1OPHB 2OQUA 2FVPA 5AXKA 1LWEA 3N28A 4FYDA 4KHPJ 1BMNH 3UI5A 2R7SA 3A87A 4CO0A 3EIPA 2DG9A 2Q6BA 4F4XA 3MGJA 2RSEA 4RX6A 4DV5J 2XPAA 1KLNA 1ZA2B 2E1AA 3C15B 4ECYA 3MMGA 1V6HA 3C66A 3ETMA 4BAHB 1YI2S 3ZZRA 4B9VA 1FD8A 1ZRKA 1HDTH 2IDLA 4YR0A 1MMDA 1P05A 2V2VA 3DYAB 2KZ4A 4CRGA 5TCCA 3SJ9A 2MQPA 1CULB 3BDEA 1CQNA 2W7OA 3K2UA 4H6SB 4RW9B 4PWWA 4O0IA 1CSOE 3D2WA 3M3TA 5LMUJ 3ARTA 1P9SA 2QG9B 1TLDA 1NFWA 3QGNB 3ZFVA 4CBNA 4NIVA 3RAMA 5J2QB 5D3GB 2J0SD 2UUFB 1FF2A 3GY8A 4FXWA 4NLPA 3GJQB 1GAOA 2QZ8A 2BM0A 1PILA 1XNRJ 2V8PA 2B9YA 4NG9H 4WCEQ 2WV5A 3NXPA 2GIFA 4OI3A 4NCGB 3NWUA 4KIAA 4NXNJ 3KLGB 1H4WA 3C6UA 4M94A 3FSIA 1C9PA 3L4BC 3QGIA 5DG9A 5KFYA 2V68A 4FUHA 2XC4A 3A8JA 2F8HA 4MPKA 2K8IA 2SGEE 3ATKA 4M9FA 2ODYB 5FX6A 2EK1A 3MM9A 1VQ9S 1ZOMA 1T7CA 3GY2A 4CRAA 4NFEA 1RHJB 4IQMA 1J5OA 2OD4A 1SKSA 5EQRA 1WACA 1FIWA 3CCLS 3U69H 1UVJA 2QIQA 1KT1A 4KB7A 1FJDA 4AD6A 4JFJA 5DLFA 1EZXC 2KHDA 3BGFA 4Y2MA 1Q8BA 2I8EA 3ADAC 1T8LA 1I1GA 2EVZA 4C8YA 2Z56B 2VPYB 4OS4A 4ATNA 2MMYA 3DRSA 3SI8A 5B0BA 1KDNA 4IMZA 3SNAA 1ELCA 3RM0H 1OY6A 1TGTA 3G86A 3ITIA 3BGOP 3D6MB 1PQAA 1TAUA 2UU9F 2IVYA 5EU8A 1O3DA 1HPZA 5J6EA 1S1WA 3SCKE 3M8QA 3WH0A 3BB5A 2PTCE 2F8MA 3GG0A 1UMAH 3SJIA 1OP0A 4L75A 2BABA 1A7GE 5CYMA 4QJVA 3KG4A 1AHTH 3FKSD 4CLFA 2GQCA 1DDJA 2ZCKP 2I1RA 4I8KA 3F9EA 5FBEA 5EN1A 5KFNA 2GCHG 4AGJA 3URCA 1QSLA 1GG6B 1YC0A 1GH8A 1YBUA 4MVNA 5KFRA 2E66A 3JXOA 4WWSA 3VAHA 2WYGA 5EGMA 1OS8A 4GC7A 2HYIB 1RCXB 4UT4A 4WXOA 4XPCA 1ZGVA 3V0XA 4J9UE 4YQWA 2U2FA 1Y9OA 4X2BA 3D1QA 1HNIB 3DRRB 4DZ2A 2QXIA 1C2EA 1SV5B 1KFDA 1HKKA 1RDRA 1YPLH 4RL1A 3KK2B 4MIBA 4THNH 5A8YA 1NSAA 4B76A 1Z8GA 1K1SA 2CFXA 2ZE2B 4FF3A 1L3TA 4QBUA 3VF0B 1MBMA 3BBBA 3PO4A 1IQJA 3T1HF 1NZAA 3UNRA 1RTIA 1RRKA 1PPHE 2PMZD 5I3QA 4JP8A 3HDSA 2BZ6H 2AMCB 1RT7B 1S1VB 2HAIA 3QRPA 2RDIA 3KL6A 2RILA 3ARUA 3TW0A 3EY6A 2QV6A 3Q0AA 4O4RA 3WY8A 1YLDA 4LSLB 3RXCA 1NH8A 1UP1A 1JIRA 2GMJA 4XO0A 2E5JA 1VRTB 4Q2KA 3AAWB 2XY5A 4JYTA 1GJ4H 1M5HA 1S0NA 4ITSA 1D8ZA 2OTVA 1S10A 4OQJA 1C5VA 3EDRB 3M7QA 4TSFD 3S9AA 4PXCA 3ZTRA 1CSJA 2VVCA 2G00A 3SHCH 3QJLA 2ZDPA 3GCWP 1O2MA 3J7ZT 2LKNA 2FVQA 1NEEA 1R43A 1SKYE 2M1IA 4C8NA 1FKLA 1UVMA 5F8MA 1DVAH 2PO4A 2AGEX 1FJGJ 5CMXH 1KC8T 1RBOB 2UUCJ 3JAMY 2E9ZA 1VJWA 4ABGA 3IM9A 5A0YA 1FTRA 1AFIA 1SJ3P 1FTCA 2B5JA 4LRAA 4C11A 1ZGIA 4ELVA 1W2BR 1T3NA 1GCDA 4PRFA 3BREA 3ZVGA 1UZHA 4ZKSU 3O3LA 2DY1A 1KOOA 2CPFA 2KVQE 1SHHB 2P4VA 4JI0J 2L2SA 2O67A 1U7LA 4H4FA 4Q5VA 2ANYA 1VR1H 1NRRH 4KRWA 3ZZBA 2XLJA 2VPZB 3W4RA 4CNYA 5IQ6A 2GMTC 1FWLA 1EZZB 3H5CB 2KAIA 4KGKA 3LAKA 1NJIT 4QPXA 3SU1A 2XYPB 3SCJE 4ANEA 2CHAB 1TELA 3W94A 3IO1A 3N99A 1E37B 3WD0A 8RUCA 2FB0A 4ZP6A 3ZZOA 1UA1A 1CT4E 5KFIA 1SHYA 1SLWB 1S4EA 3Q8QB 1ZM9A 4AG2A 1BTUA 2ZGCA 4M5DA 2E5LF 1CPZA 2CK3D 3PYFA 4DZ3A 2OMLA 4INHA 2ODPA 1N48A 5BXJA 4NLGA 1V2LT 2RB7A 1NKCA 1DT2A 3KNAA 1IUJA 1S9GA 4JI7J 3M1VA 1HRTH 5D4NA 1ZCNA 3DFEA 2R4FA 4ZMAH 2ZI2H 4JI6J 5MAOA 1EPTB 1TV6A 2FJXA 1BBRE 1X0FA 2B4UA 1AW0A 3UNGC 2GDDA 4DUZF 3UF8A 1UVLA 3LONA 3J7A1 1P0SH 4H4OB 5ETSA 1U1NA 1TRYA 3UN5A 3TJNA 2K7JA 1CJVA 3W5ZA 2HFVA 1GMWD 5J1EB 2OC0A 2EI7A 2DB1A 3LWLA 1GBFA 2JEIA 3C19A 3TQEA 4B75A 4B2BA 4HBOA 1FJEB 4GCHF 3UN3A 4NLXA 5KFOA 2BKNA 4LIWA 3DFLA 2O01C 1KLMB 4GKJF 2DNPA 4ZDNA 2OFGX 1RA7A 4ED8A 3RXDA 1H1BA 2UUBJ 1QBOA 2PUXB 1UVIA 4X8VH 2OC8A 1LWFA 2IJOB 3SV2H 4NXNF 4ABDA 4ZP8A 3ZZ6A 4J9OA 3EGNA 5HN0A 5I42B 3HGNA 3I96A 3R6GB 4ZLPA 1Q7LB 4YT7H 1H72C 1KNZA 1SJRA 3K8VA 3HXMA 3W1EA 4AL7A 3OVAA 2VWLA 2YBTA 2MB0B 2RKIA 3TUPA 4GVBA 1RT6B 2CNNB 1V3SA 2WVFA 5KFGA 5J2MA 2NUHA 5A8WA 4ZPAA 1GI1A 4TW6A 2RE1A 2VBZA 1C1RA 4GKKJ 1K9MT 5EWGA 1SUQB 2PUQH 1LHGH 2DY9A 3BN9A 1ZMNA 2AH4X 2LQ9A 4Y28C 1K1JA 3RXEA 4ISHH 1ZTTA 1RWKB 3IG1B 3Q83A 4QWAA 1C1UH 8ESTE 3ZZPA 4DV4F 1WYKA 3VFEA 3IXQA 3V13A 1OWJA 1KEKA 4K4UA 4YDDB 1G3EA 1QB1A 1QFKH 2G1HA 1HARA 1EETB 2ZFFH 1O2GH 1O5JA 4P8UA 4NGAH 3RR8A 4CRBA 3QGGA 4KHPF 2Z3EA 1NY22 1C5OH 3EYZA 1YW5A 1TKZA 3PHEA 1T9YA 4B3SJ 3IITA 5HBMA 2ASUB 1GHVH 1GXUA 4DV6J 1WC4A 2OEJA 3R7BB 4LJMA 1RU1A 2PT0A 4D3GA 4L3NA 1VQ7S 5EGYA 4NCYA 4GKKF 4KELA 3O5OA 2YNIB 1F0SA 2BOHB 1F6TA 3ZZ9A 4RUHA 2HSEB 1TALA 3GILA 1LKBA 3CVKA 1CQMA 2A2CA 4JI8F 1L0ZA 4M5NA 5C5OA 1CEZA 1D6RA 1WB0A 3P6YC 4NWBA 3O5MA 3CWJA 1RHUB 5E7OB 4O3PA 2YWHA 2AJ2A 2JKHA 3DOLA 3I0RA 2ZU3A 1YJTA 3AY0A 1FJ7A 1O0PA 1S48A 4F4AA 4NZ0A 2KG1A 4QWBA 4Y8XA 4C8LA 4Z7CA 4GUXA 1O3OA 3VQSA 1DTTA 1RAEB 3RZAA 2CNOB 5KFHA 4DX8H 4FYYB 1H8IH 5BYQA 3RXQA 3PA7A 3LH1A 1QR3E 2EFGA 1QDUB 3TNSA 3BO4A 3KDNA 1T9TA 3Q76A 4P8XA 3MAAA 2TGAA 2IVFB 5GQBA 3CJ4A 2QL9B 4G1QA 4WK1A 1CVJA 3Q8YA 2LA6A 2MKSA 4B3OB 5SZTA 1O5EH 1BRAA 4C3LA 5AE3A 3NGDA 2KFZA 3TVJB 3GY5A 2OEKA 3NP5A 2BLWA 2WUCA 3D65E 4UW2A 1UVUH 4ZVOB 1VGYA 1EARA 1ULRA 1V9OA 1HBNA 2I5JB 4ER8A 1NTPA 1OWIA 1UW4A 5KG5A 1C2LA 5HSPA 1FKJA 2K06A 4TY8B 2KVIA 1DARA 1JB0C 3JZ1B 4O3NA 4OHZA 4RBUA 4GAWA 3AASA 4DJBA 3NXZA 3NL0A 2MKHA 3TGIE 4U7UD 4M95A 4MGVA 3Q3YA 3BYRA 3JYTB 3Q8UA 3PX4A 3KQCA 1O2KA 2E29A 1LKZA 3L95X 1TMTH 2VNTA 2HBQB 1F0TA 2VVVA 1X4HA 1AB9B 3FP6E 2HWHA 1LVMA 2IIHA 2G9OA 3W62A 4ICLA 5KFFA 4JI5F 2XS5A 4Z2IA 3HHLA 1P04A 2DR7A 1ARBA 2BQ3A 2UP1A 3KNGA 1JRTA 2ZPRA 1ZJDA 1A0HB 2JDID 3RLWH 1OMSA 2DH7A 4OS1A 2WK2A 2GX4A 1J4IA 1C0TA 1UAWA 1H9IE 3B23B 5D0EA 2DNZA 3OXFA 4OI4A 1TL1B 3BTTE 2ALZA 3SW2B 4HVZA 1F3FA 4DHVA 3URDA 1W2IA 4LUBA 2QA4G 1PAUB 4F3MA 3SNEA 1CC7A 1TK5A 2RUGA 2NZCA 1QB6A 3QN7A 2H4WB 3FCWA 4JCNA 2R2RA 3GDSA 2V2ZA 3CS0A 5DZ6A 3J81U 4NA8A 1VK3A 1VHFA 4DBQA 1KVJA 1WSSH 2Q79A 2R7TA 3KUGA 3H7TA 2KCYA 2CPEA 1TRMA 1DBDA 5HMYA 1XNRF 2JRSA 1RAFB 3H5UA 3NOGA 4NZQA 1N6QA 1NWSA 3LGHA 1FWPA 1C1CB 5L8RC 1S6FA 1RU2A 4A8YA 3TA2A 2ZCLP 3BTHE 1YPHC 4DVAU 5GIBA 2CF9H 2FKEA 2QT7A 2E1RA 1GMVA 2XW9A 5AT1B 3Q24A 3KYGA 3PDNA 4P52A 3D49H 1H8ED 1RWWB 1SCJB 5CZXA 3DYAA 2FZCB 3LH3A 2BY9X 4ZVSB 4NX9A 2D7SA 1LFWA 1D3WA 4H4KA 4JI6F 1W25A 1XEZA 4DLGA 2J2UA 4GGQA 4MDSA 4ED3A 4CLYA 1INCA 2NXNA 2XMKA 2WZ1A 2SGAA 5GPGA 1KR4A 4NRUA 3RJMB 2ADCA 3K5PA 2DEIA 3D67A 4DR6F 2W8KA 4KGAA 2VG6A 2D26C 4X65J 1SGEE 1RUSA 1X7VA 2OBQA 3EDQB 3SGBE 1AFQB 4U9RA 1ZAXA 2VG5B 2W7SA 1HNVA 2KCOA 3HFZB 2QYIA 2IDEA 3WX4A 1BC6A 3BBCA 3SSRA 3QO9B 2DGQA 3NRLA 1AN1E 4P71A 3PW0A 1TONA 4LOYH 1MKWK 5F03A 3F2FA 4ILMA 5I4MA 2LQBA 4DV7J 1UFKA 2BA9A 2F21A 3D6TB 2A3BA 3JSRA 2ZR5A 3KTQA 4IFYB 3T41A 1Y5BT 4AB8A 1QQ4A 4OYXA 3UQIA 2UXDF 1S4FA 1D09B 1DJ0A 1QQUA 4PG4A 1D8YA 2Y9HA 3FUYA 2FLLA 2HNYA 2CJIA 2HQDA 1LJYA 1GQEA 5CHCB 1VC6A 1SGTA 2VICA 2EKNA 1E6ZA 3RMEA 2GJFA 3ENAA 4OI6A 2O8LA 2C90B 4LVOP 5BYSA 3OJUA 1EASA 3ENWA 4MTPA 2J98B 5EHHA 2G1DA 3DMJA 2G5NA 1EKBB 2K7KA 4X64F 1JNTA 2HKEA 4ASHA 3RM2H 2DNNA 4HR2A 4WZMA 2AV5A 1KXFA 1SR5C 1T95A 2HHWA 1HBUA 3ALGA 5KT3A 1HHTP 4TY6A 5EX0A 1SXLA 1YGYA 4RNNA 4RT0A 1ELGA 1JNEA 4DCOB 3JSYA 6AT1B 3CCZA 1OS5A 1GHBF 2FVCA 1IQGA 3S9BA 1JJ2R 2GT8A 3RU4T 3UPFA 3FZDA 2IRXA 2KT5A 4ZVUB 1K73T 4PQAA 3CJ3A 5ETVA 2B8QA 1NWTA 5KG7A 2ZHWH 1EP4B 4F25A 5J1NA 4DY7B 5JB8S 4USTA 1TNJA 4X6PA 5DZ7A 1EJ7L 1KIGH 2QY0B 3DHKH 2G2YA 3MM7B 3VB5A 1HHSA 4H4KC 2FTMA 3MNBA 3QFHA 1GI5A 1ZMJA 2A4OA 2HVXA 1QTFA 4LMZA 4GIVA 2XRCA 4DOZA 5HJXA 1RK8A 3KABA 2PGQB 4ZCIA 5CABA 3F1SB 1TE0A 1FKOA 2GAHC 3V4MA 3RXFA 4IO9Q 3G2XA 1EIBA 3KK2A 4LSNA 3R0FA 5IT0A 2Y7ZA 2YPZA 4HDHA 5HVGA 2AJ0A 3HMJG 1FRHA 4PWDB 1MTUA 4GO7X 1FEHA 4X1RU 2QGRA 2BM1A 1A5HA 5K0HA 3T1AA 1C1BB 1ZS6A 2KZMA 3RXSA 2C3YA 6FD1A 4WBFA 4O3OA 1RGQA 2VKZG 3KIDU 3ZTPA 1URNA 3CJRA 4LF7J 1O3HA 1NK9A 1K1NA 2AHOB 2MZJA 3I32A 4KFBB 1BMQB 3OHBA 2I9SA 4ZHLU 1BTXA 2QC2A 3O5QA 1ACMB 2DE8A 1TOMH 1IM6A 3ODKA 4RUBA 3ARRA 1O31A 4LSLA 4C98A 2WHOA 3L3CA 1WG4A 3T5KA 3K17A 1GG6C 3HSZA 3LGUA 1Z8JB 3O5RA 1TNGA 2BDAA 4ZN1A 1ZYQA 5BPEA 2Y5GA 4NA7A 1K28D 4AFZA 3V4IB 1BJUA 4OS6A 1QY6A 1O30A 3VGUA 1R31A 5IT4A 5DJ7A 4YHHJ 1NM2A 1P8GA 2EEKA 2XMJA 2P9CA 2RURA 3AB2B 3UD3P 4S3KA 1KTQA 3S0NA 2V8VA 4KR0B 1LL4A 2V3OH 3N6MA 4FUJA 3EQ0H 2PFDA 3LPYA 6ESTA 3T9ZA 4P73A 1HKJA 4W9PA 3Q3XA 1A6LA 2WBMA 3KHLA 4DL4A 2FTRA 1HQUA 1N5QA 5JBAS 2ZHAA 1BUIA 3VB6A 3UVJA 3ODDA 5A0YB 1LPGB 2BYCA 3MPDA 3P49B 4WVPE 5F8JA 4UOHA 1REVA 3RC4A 2XCPA 1R7IA 2Z3CA 3C2PA 4U8VA 4YB7A 1RWMB 4DX5A 2ZHBA 4IQXA 3CDEA 3JQJA 1FZZA 1MH0A 3LOUA 4ID5A 3ISND 5C1XA 1TAWA 3W9IA 4GPGA 3B8SA 2V2KA 3LQVA 2PMHA 3MR5A 3B9EA 3A8EA 4J9PA 3MPWA 4FVBA 4CYUA 5HMAA 3MFHA 2GZ9A 2Z2MA 1V2ST 4JV2A 3WHIA 3PV5A 4MAVA 1HWKA 4Y2CA 1TABE 5HYOA 1O3BA 3M8YA 2QXHA 3KLEB 3M61U 4H4MA 1DTQA 3HZEA 1YPEH 3ZTSA 3D0IE 1RAIB 1VZQH 4OYMA 1HYSA 4WF8A 3SYJA 2R7OA 1A9NB 1O3JA 1BRCE 2V34A 4LFAJ 2RAQA 4DL7A 4ECZA 2Z57B 2AJQA 3KUHA 1C5YB 2FX6A 3PW4A 1UFLA 3I31A 3M1VB 4YOJA 1FY8E 3MMJA 4S0MA 2A31A 3O5EA 1DWDH 2OTLS 3FDSA 3N5BA 3M7UA 3A83A 2Y7XA 3HM9A 2A10A 1NS3A 3OL7A 4K4VA 1GBLA 1PAEX 1CJVB 1ANEA 1TL5A 5HW7A 2R3VA 4ODRA 3OVBA 2C28A 3DNCA 4J7CA 1C5WB 1DQ9A 2DKOB 2C3UA 4LF8J 1NBEB 3KAGA 3DRYA 2WSEC 4IH7A 3DLLQ 3Q8VA 3VGCB 4DIIH 1CJKB 4U8YA 2YMSC 1UO6A 3QFWA 2XYGB 1ELDE 3OEED 3D0HE 4TX0A 5EXLA 5H1SV 2NU3E 5CCLA 4JI3F 1GCTC 4TY9A 1OY8A 2I0XA 1NFUA 1BQXA 4F48B 2DNRA 3MR6A 3GYXB 2J9DA 3HK2A 1RYSA 4FU8A 1CJTB 3W9HA 1O2YA 2Y80A 3A7XA 1GMUA 3DKDA 5C1YA 3EMTA 3ONQA 2RQMA 4ACAA 1GL0E 5K14A 2XO6A 4K8RA 1U1MA 1N36F 3W64A 2QN6B 3W5YA 1S57A 3GY7A 5A8WB 1TMBH 3ARYA 1S1XB 1C5NH 1NB7A 1X4GA 2DGVA 2LEPA 1UVOA 3R1HA 3M9NB 1EJNA 1P10A 3MYWA 1I3OB 1X8DA 2RRNA 3MEGB 3A80A 3IG1A 2W7UA 4ED1A 1SG8B 2OPQA 2L41A 2BDHA 4DRMA 2YKQA 3FZBA 3CC7S 3ZZUA 5KFTA 1KXEA 4ZHRB 1SSXA 4NNRA 3ILLA 2FJEB 3M9OB 3GY6A 8LPRA 1NM6A 1VQYA 3RB3A 2H48B 2GCHF 3OPKA 4HFPB 4WH8A 3DGPB 3BIVH 2NUUG 4DL2A 5HVFA 5F8GA 1I5OB 4IYQA 4NLTA 2D2DA 3GSIA 5C42A 3QAEA 1SPBP 4NCBA 3PYDA 4CT9A 2HGTH 2J34A 2R7QA 3GCHC 4JI4J 2UVUA 2D9FA 1D3TB 1O2OA 1T94A 1GTEA 2BEFA 2MZSA 2A2DA 3PTWA 4HT7A 2MZTA 2FZKB 1HNXF 4IDKA 2OSQA 3DSGA 1NXIA 2EFOA 4ERDA 3L9ZA 4XRNA 3M05A 1W2KH 2V2QA 2QE5A 1AE5A 2V9WA 5HW8A 2R8HA 4KH1B 2OO4A 4D8NA 3A12A 2B9XA 3CJKA 1R27B 2KM8B 4ELTA 4LF7F 3JXVA 4ED0A 2XSFA 3DOLB 4ITZA 2DH9A 3I0RB 2V35A 3SV7A 3KZ7A 1H0GA 1FY4A 1O3NA 2ZO3H 3P6ZB 3K89A 2NLWA 1JLAB 1CBWC 5H9EJ 3ARWA 1ZRBA 1GHBG 1R8BA 2ILYA 1UTPA 2HVEA 2QF4A 2WV4A 2Z94A 1SQFA 5F3TA 1H73A 3JAMU 2QMXA 1GPFA 1NCLA 3RM4A 3MURP 2H9EH 4MTBA 2FPHX 3HHEA 3I4HX 2HNDB 4DF8A 3SV9A 3DOMA 5DG8A 2XOKD 3QWUA 3D23A 4DWSC 3MAAB 3CULA 4GCHG 2DCLA 2KT2A 1OQ3A 1N54B 1GBIA 1Q6HA 2RRAA 4DCJB 2UZAA 2OSRA 2GMTB 1VLOA 1DXWA 4OHWA 4BTUB 3G87A 1DLOA 1QSYA 1GMHG 4Z6AH 2ERRA 1UHBA 2SGQE 1DSUA 3EVWA 3MDFA 1TPSA 4ZKRU 4Q4LA 4X84A 2WINI 1X4AA 2IAJB 4F4OC 2FHKA 3CD7A 3KJNB 4NWLA 4ZROA 4K4SA 2QLBB 1GBHA 4KGVB 4ZUHA 2GAGC 2VZ9A 3TZYA 4KHMA 3RTVA 1EZQA 4O3UA 3CCTA 1YLCA 4KKOA 3C3LA 4OV1A 3JTPA 4IR9A 1Y11A 1UJ1A 3MTYA