3PRDA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Chaperone, isomerase
total genus 36
structure length 223
sequence length 223
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prdA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prdA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prdA03
1JVWA 2DG9A 4DRQA 3IK8A 2MF9A 3GPKA 3O5QA 5DIVA 4DZ2A 3O5GA 1NMVA 2M1IA 1Q6IA 2ZQTA 3TDBA 1FKLA 1P5QA 3KADA 1ZK6A 2ZQUA 4U84A 4DRJA 1J4HA 1YATA 2M2AA 2AWGA 1C9HA 4JFLA 3JYMA 4QT3A 3WH0A 4DRMA 2MLXA 2XP5A 4MSPA 1D6OA 2PPNA 1ROUA 1FKIA 1NSGA 3B7XA 4W9QA 1D7IA 1FKBA 3PRBA 3O5PA 4N19A 1FKGA 3KCEA 3I6CA 4FN2A 2F21A 3KAHA 2XP3A 2XPBA 2ZQSA 1ROTA 1HXVA 1J4RA 3ODKA 3O5LA 2ITKA 5HW6A 4DIPA 1FAPA 2XPAA 3TCZA 4DRIA 1PINA 1Y0OA 3NI6A 1B6CA 5HUAA 1JNSA 5HW7A 2IF4A 3O5EA 3O5OA 2F4EA 1D7JA 3CGMA 4C02B 1EQ3A 3IKDA 2FAPA 2XP7A 3MDYB 5BXJA 1FJDA 1YW5A 2PV2A 3KZ7A 1BKFA 4IQ2A 5HT1A 5HW8A 2M08A 3UQBA 2KGJA 4LAXA 1PBKA 2JZVA 2N87A 3KAGA 4QIBA 1Q6UA 4TW8A 3UF8A 3CGNA 1J6YA 4ODMA 4IQCA 4TX0A 3LUOA 4U85A 2VN1A 1FKRA 4O2TA 4LAVA 4DRPA 4ODNA 5GPGA 4MGVA 1Q6HA 2RUCA 5HTGA 3NRKA 5I98A 4ODKA 5D75A 1TCOC 2RURA 3O5KA 2KFWA 2KI3A 2VCDA 1T11A 3JYJA 3PA7A 4ITZA 4J4OA 1A7XA 2RSEA 4ODOA 4JYSA 4TYOA 2MNTA 2Q5AA 4G2PA 5J6EA 4TW6A 2D9FA 4DRNA 2LJ4A 1KT0A 2XP6A 1W26A 2XP4A 2LPVA 2PPOA 2ZR4A 3H9RB 4ODPA 4ODLA 5HWCA 2RQSA 3IHZA 2OFNA 4LAWA 2K8IA 1NMWA 3TC5A 3O5DA 1F8AB 5DITA 1QZ2A 2ZR5A 4ODQA 3UI6A 2RUQA 3KABA 3OOBA 1KT1A 4W9PA 4DROA 3UI4A 3RFWA 4DT4A 2DG3A 2PV1A 3IKGA 3O5RA 4GGQA 1FKJA 3UQIA 4TNSA 3UQAA 4DZ3A 2MPHA 4U86A 1JNTA 1Q1CA 4JFIA 1ZCNA 1D7HA 4ODRA 4W9OA 4NNRA 3FAPA 4DH0A 4J4NA 2L2SA 4DRKA 2LKNA 2RUDA 4LAYA 1F40A 2XP9A 3EY6A 3UI5A 3O5MA 4IPXA 4JFMA 3VAWA 1FD9A 4JFKA 2XP8A 2Y78A 2FKEA 1N1AA 2PV3A 2DG4A 4GIVA 4TW7A 2PPPA 4FAPA 1R9HA 4BF8A 3O5JA 3O5IA 4JFJA 5B8IC 4QT2A 1EYMA 1QPLA 5DIUA 1M5YA 3KAIA 1U79A 5HWBA 1FKDA 4R0XA 3KAFA 3O5FA 2LGOA 2MLYA 1FKSA 3RGCA 1BL4A 1FKHA 2MLZA 3NTPA 2KE0A 1L1PA 2KO7A 3JXVA 3PRDA 2F2DA 4DRHA 5HKGA 1FKTA 1FKKA 2ZR6A 2ZQVA 3KACA 1QPFA 1J4IA 4G50A 2PBCA 1FKFA 2KR7A 2UZ5A
chains in the Genus database with same CATH superfamily
3DC2A 5CAAA 5LMUF 3MU4A 3DOMA 3WBZA 2BQRA 2AYBA 1HDTH 5KFBA 2JX2A 2ZIQH 4JV1A 2ZHAA 3LGUA 4QIGA 3KGPA 4ZJLA 2EC9H 1RD6A 4S0MA 2QE5A 4OJ3A 2FO9A 1KS2A 3C19A 4DV0F 1SQRA 3HMJG 4ECXA 4WFNQ 1FAPA 4X1SU 4GKJJ 4XRNA 1ZMNA 4Y2MA 1W0JD 1SGIB 4DG4A 2I6SA 4P2MA 1BRUP 4NA1A 1TNLA 2GZ8A 1ZOMA 2KGJA 2MXYA 2DR8A 2FVQA 1MMLA 4J1YA 1N8RT 2HBZB 1XBWA 1B70B 1R8HA 1TA6A 2HNZB 5J6EA 2VBXA 4KGKA 4NWKA 1WF0A 2HWLB 4R8UA 1RD3B 2RCEA 4RBVA 4AT1B 4C8MA 3OHBA 2UXBF 5KFAA 2UU9J 1R27B 3KYFA 2OPRA 4MG3A 1C2FA 5CA5A 4TNSA 3CJKB 2BOPA 2HS0A 3F2HA 1VBXA 1LW0B 1UVNA 2VKZG 3EE3A 2XM3A 3GY7A 2QG9B 3DDKA 3H5UA 4MPUA 9LPRA 1T02A 1P01A 3KLGB 1C0TA 4JBCA 1ELOA 3DMJA 2ASLA 2FUG9 5J2PA 4MPWA 1RT7B 4O3RA 5DETA 5FAHA 1G37A 2G00A 1FJSA 4DW2U 2MZJA 3NOGA 3W63A 1TR0A 2OD3B 1TPAE 1O3CA 1JXEA 2BDGA 4U9RA 1Q5YA 2F23A 3UNSA 2DBBA 4WZQA 4D76A 4Y0FA 4Y11E 1NJYA 1SV5A 2VV5A 5EJZA 2F8EX 1TK8A 4NI2A 2PPNA 3V5RA 4N19A 4FN2A 4ERDA 4LF7F 5G0RB 1C2DA 4DIPA 4DFKA 4OHXA 2PGCA 3UW1A 4BNRA 3CCTA 4WK9A 1NU9A 1O2LA 4DWSD 3D68A 3V13A 4Y28C 3N7OA 1RFNA 2DR6A 3DSPA 3P4UB 3WQWA 1W12U 6CHAB 3EXYA 4ED2A 4LAVA 4C3KA 2HBRB 3Q8SB 3RXJA 1RWMB 1OWDA 2RKIA 5J2MA 4NXMF 4IRKA 2ZBCA 1MBMA 2GP9B 5HBMA 1UVJA 1IKWA 1S0OA 5ETPA 2WM0A 2WPHS 1RGQA 5ETKA 3I9ZA 2UXCF 2BV3A 1PILA 3SI4H 3G71S 1GPZA 1M5PC 1H9LB 3GQCA 3W66A 3IKGA 5F8ZA 3OSPA 2DNQA 4GC7A 4UZCA 2KN4A 1MTWA 3TU7H 1YPEH 3P8NA 1ZCNA 1WI8A 3VVUA 1HNWJ 4B3TJ 1PQ7A 5K8NA 2DGSA 2PSYA 3VAHA 4DCDA 1OWEA 2V8HA 5E7OB 4QU7A 4BCAA 2LFVA 5A8RB 4Q0BB 5B8IC 1S85A 3FMWA 2R7WA 3FOAA 1W7WA 3W5YA 1E36B 1FFQA 1C5NH 1Z8JB 1IVZA 2W26A 1AB9C 3FCVA 1KP6A 3SSSA 2LP6A 2FJXA 4K4UA 2VC0A 1UWAA 4KH0B 1N5TA 1AUDA 1CA0B 2DT0A 4F0HA 1V2TT 1P1LA 2ZH4A 4X2BA 1EUFA 2UUAJ 2R42A 4CO5A 4Y8ZA 4BAHB 3FMBA 1GK8A 5LMNJ 5EUHA 5JB8S 3FSXA 2RH3A 3POTB 2R8HA 1KFDA 2PEHA 5A8KB 2ODQA 1ZBVA 1RAOA 3RB0A 4TU9A 2ZM6F 4P8WA 4BTTB 1RYSA 2BQWB 1Q6UA 2BLOA 2CN0H 1CPZA 2BY6X 2VJVA 2BVSH 2Z56B 2HMIA 2VF3A 3UPFA 1QCPA 1K22H 1X9WA 2JOQA 3GV8B 1FRJA 2B6AA 4MJKA 1KVKA 2BJ3A 2XSJB 5KFWA 3SJ8A 3K5MA 2LJ4A 1MMNA 3C3LA 1HFDA 1QAXA 1QUPA 3HDSA 3IP0A 3SU3A 1ZTKA 2WUBA 3HPOA 4GC6A 5MLCV 4AC9A 4DGJA 4UF4A 1NUEA 1RTHA 2RQ4A 2XS2A 1C5VA 2WOMB 1F0SA 1CEZA 1GRJA 1JCHB 4ABJA 4CM0A 1PPBH 5BXIA 1DTTA 1QJHA 3PXGa 1EIYB 2P8OC 4XPEA 4YHHF 5E3CA 1RABB 4IPXA 2CQ4A 3NAHA 1VQ8S 3MUMP 3MPWA 4RUHA 4MDSA 2MKKA 2O01C 3G01A 3FP6E 1X31C 1QLNA 1PYOB 2QA4G 1IR2A 1F60B 4KB7A 1N6XA 4LK4A 1NK4A 1SJ3P 2QGRA 3DOLA 4JZIA 1TKXA 1VJQA 3EGNA 1N5QA 1YPJH 2V69A 3HJVA 2SNVA 4Q7NA 4M7GA 1HA1A 2VIOA 3QIPA 2A4OA 2YQ1A 1U2RA 3ZZ3A 5ITHA 5HLFA 2QF4A 4TQSA 2IM3A 2FJEB 2FLNA 2ZO3H 3D62A 3A7WA 1TWXB 3QAEA 3F2FA 1EJNA 3RXVA 3AH6A 4ZITA 3GJQB 3F68H 3UREA 5HN0A 3HVAA 4AB9A 1SQAA 4KRWA 1T7PA 1MU2A 4A1VA 3QDZB 3RM8A 2XBYA 2RHQB 3QT7A 4Q7XA 2JLFA 3MTKA 4I4BA 2MQOA 2M52A 2XMVA 2Q6CA 1RRKA 2HFZA 1R8PA 2ZA5A 1F5CA 3D0HE 4DRNA 4ES2A 2ZR4A 3SEOA 2C3SA 3N28A 5HMYA 1S82A 3SXLA 4I2PA 4U86A 1GI5A 4ZROA 2A5KA 2ZDKA 5EODA 4A1TA 1S4FA 2W7OA 4DH0A 2RU9A 4DWSC 1IKVB 3SJ9A 5KG4A 2C3OA 4K2YA 2RQMA 3CCSS 5CYQA 1T03B 1D9FA 3JS9A 2NU1E 4ZMAH 2NYHA 2J9EA 2XB2D 1UK4A 5L6NH 1ZLRA 1NH6A 4C8ZA 1K9TA 5BR8J 2YTCA 3KYGA 1FKFA 1YPKH 4IDKA 4LFBJ 1ELVA 1H0IA 3U02A 2WAQD 3IK8A 9ESTA 2VG7B 2N4DA 4G1QB 1R6YA 4JYAF 3QZQA 2RDDA 4PZVA 4O9VA 2IYIA 2AWGA 1GPFA 4LQ3A 3W65A 1D6OA 2ZFPH 3LGYA 1D7IA 5F3TA 2QL5B 2XBPA 3DRRB 1Y3YA 4BAMB 1EZQA 3KLEB 1GHBG 3ITHB 2GGVB 1IQEA 1FDPA 3CGMA 2E5IA 5KFJA 2B7DH 4LRCA 4ISHH 1OSDA 2WONB 2GJFA 2KJVA 4AYBD 4B9NA 1ZS6A 1D9DA 4CO2A 1UJ6A 4M5JA 2YMSB 5EXMA 3EIPA 4WKHA 4Y6IA 4RZRA 1Q2WA 1WSSH 2HBQB 4R5PA 3BDEA 2V2VA 2R2UA 1VLYA 2B8OH 2OTJS 1W1TA 1GMHG 1RBLA 3GFHA 2GMLA 2E1RA 2O3DA 1VITG 5IWAJ 3ZZDA 5E2OA 3IG1B 1O3IA 1K1OA 4O4GB 2RVJA 3QRRA 3RXDA 2ZNKH 2F83A 1RKIA 1L3SA 3V6HA 4RPFA 4YZUA 1T8LA 2PTNA 3E91A 1ID5H 2IC3A 3CNQP 2PMHA 4WY3A 1J8AA 3OTJE 2R8KA 4LF4F 1PPCE 3T62A 2V6NA 1FKHA 3NBPB 4HHUA 3ZVGA 3KQBA 4TNOA 1S0MA 4ELTA 2ZUAA 1NHVA 4NSVA 2J98A 3EM1A 4NZCA 4LXBH 4DMZA 3BBCA 5EWFA 5B0GA 2RNEA 4K8BA 5FCKA 4J7CA 5D8HB 3PG9A 3Q86A 5I3QA 1M5VC 4USWA 2ESCA 3QGIA 3AXKA 4DQQA 3D67A 1NNDA 2IF4A 1I1GA 4NGAH 2Z2YB 2FDAA 3KUGA 3CCVS 3SCLE 3T5KA 4S3JA 2ZH1A 3RW6A 1KLMA 4I31A 2GVZB 3DLKB 1LVOA 1RTJB 3MO9A 3UD4P 3PROA 3HD1A 2RSEA 1GL0E 3UCGA 1GVZA 1UVKA 5D4LA 4MKAA 4ICLB 4M1KA 1RS0A 4X8SH 1X9SA 3HLUA 1N6QA 3JYTB 2Z9KA 3N6NA 5IQQA 1DE7H 1MUEB 1HAOH 2J9CA 3HXMA 1IXKA 4DEZA 1TRYA 2JVRA 1BJVA 3H5CB 3TA1A 2F40A 5AFZH 2OGUA 1GJDB 2ROPA 2CXEA 2AYWA 3GFZA 1I94J 4CLFA 5B0CA 1VHIA 1WKLA 3RUOA 1Q95G 2JZ5A 2PFEA 3J81j 5B6OA 4W92B 3E01B 3IRXA 2ZH6A 1NDKA 4G3IA 5T6GA 3KUHA 1TIOA 3MOCA 3EDRB 3MU0A 4ASUD 4RNMA 7LPRA 4FF2A 4PWDA 1LHFH 1YRXA 3HI9A 2JEJA 5DDRC 2HIQA 1EZZB 5KG2A 1G2MA 4FUBA 4AFZA 4TKTA 5HM2A 3ARXA 4JI0F 4C11A 1S4EA 1IQIA 3M2UB 2XCAA 2IIHA 4PXCA 3MEDB 1OWIA 2BY7X 1N36J 3TGKE 4FOUC 3TGIE 2ANKH 3RW7A 1WQSA 1FI8A 3IC1A 4KTCA 1BB0B 3W1EA 2OC7A 2D3UA 4RW9A 3V7TA 1M9UA 3NRKA 3U1NA 4DV5F 3VPKA 4C2MA 4LF9F 4LMZA 2MPUA 3PLPA 4OI3A 3TVJB 3UN3A 2RDJA 1F0RA 3T6JA 1FKAF 1BUIA 2YX4A 2AJ4A 4CLPA 2HNYB 4ED3A 2QGFB 2FJAB 5JPMH 3KK3A 4JK6A 1IKYB 2ZZTA 2AJ1A 2UV8A 2WRMA 1INCA 1L3KA 1S5SA 3MMBA 4I2QA 3O5MA 4QIWD 3W64A 1A46H 3BSOA 5GMKa 2NS1B 2GIRA 1J5OA 5HK4A 3DRPA 1W9PA 2D8WA 4UT4A 3CPWR 2MY7A 1U47A 5IT9U 2AGOA 2ZPQA 2IM2A 2HHQA 1Q86T 1SPJA 3Q76A 4DRHA 1MABB 1A7GE 4K4YA 2FM2A 1SGTA 2LLZA 1RHQB 2XGPA 1UL3A 2CZ4A 4YDDB 3JSMB 2DG9A 1LWEA 3EZOA 1XR6A 2QC2A 3RYLA 4X2XA 4IO9Q 2KCAA 6FDRA 1FPHH 4ZVQB 2G4UA 1BQYA 4JI1J 3BBFA 3M7UA 4YUDA 4RBUA 3BB5A 1O2ZA 1AVXA 4CLTA 2P2CB 1ZM3A 3M1VA 4ZIWA 1RCOB 1GJ4H 2QL9B 4DN9A 1HBTH 1ANDA 2HWTA 2W9AA 5FHTA 1IN0A 3BSNA 3QZRA 5IK2D 1SC1B 4WF9Q 4ECRA 4FDFA 2H9HA 2XI3A 5TJXA 2UV8G 3MM5A 3SDEA 5DJ7A 4WXIA 3L4BC 5AVDA 1X6NA 5HQLA 4A7IB 1OGBA 2QF8A 2BDBA 1CQNA 3CJQA 1GEHA 3J7AN 2IRUA 1TGBA 5DP8A 2YPZA 2Z30B 2G8ZA 2OPQB 2V94A 2AOSA 2RHSB 1EHWA 1T31A 4JZDH 2K1RB 3A3OB 2FLLA 1H4WA 4USKA 2UVWA 2Y80A 3RXSA 3W2WB 1N0UA 3OTDA 2OPPB 3C1KA 3SCIE 3TJ8A 3B8HA 3GR0A 1SC4B 1Y3UA 3NNHA 2DNYA 1TX8A 1XEZA 1RIWC 1KXBA 4JFKA 4YOEA 4NZ0A 1QAJA 5KG5A 4B74A 2YKAA 4LVNP 2C2KB 1O2MA 1LV5A 4JI7F 4K4WA 1UTQA 3OY5U 2ZZMA 1UJ5A 4ZVEA 4LF6F 1LWCB 1VC0A 1NBME 3CE8A 8ESTE 2QT7A 3R5DA 1FY3A 2PGQB 3K8VA 2KJWA 2IM0A 1XNRF 2AYGA 3PIPQ 1ZK6A 2VQEJ 4KTUA 1T9TA 2FJBB 1O36A 3DDNA 2LDIA 1P12E 1HD1A 3H25A 3B7XA 2DD8S 5KFFA 4ZVSB 3TW0A 1RHKB 5DM7Q 2BVRH 3H5XA 2GTBA 1MG7A 4X6OA 1DRZA 1HWUA 2BZ2A 1KXEA 2H6MA 3WQPA 3LAMA 1TRMA 1KRPA 4URSA 2GT8A 2PSZA 2F7VA 5EOKA 4CHAC 2XY6A 3SIPB 2QF3A 2FPHX 1GGDB 1MTNC 5KFGA 3TVKA 1Y9OA 2B43A 3CENA 4OZ5A 2BYCA 1TUGB 3D9BA 1HJWA 1L4DA 2XNRA 5KOXA 5DQHA 1GNKA 1U45A 1Q7LB 1VRUB 4ELVA 4K4SA 2AZ3A 4DSEA 4LIRA 1P3CA 1GFWB 2XP4A 1C2EA 3T25A 5KFEA 3PYDA 5L39A 5L30H 2QN6B 1S6HA 3CJSA 3J81Y 1G3BA 2BJ8A 4U32A 2FS9A 2YVSA 4IC6A 2W7SA 1FA0A 3TK9A 3FBBA 2V4JB 2CPIA 1YGYA 2BKNA 1JJ2R 1U8SA 5B0EA 4CLSA 2OLWA 2R2SA 3NS5A 4AFQA 2C93B 1GBCA 2IBKA 2FVCA 1N48A 4MNWA 1RHMB 1U1OA 1S9FA 1Q8BA 1HNIA 1EOJA 4QIEA 1O5BB 3L33A 2XP9A 3EY6A 1W0KD 4Z2HA 3B82A 2QY0B 4A8XA 2WPIS 3HZGA 2JFDA 2V2QA 2GQCA 1SLWB 2AHOB 2MKCA 3OLBA 1DTQB 2DCLA 2DT9A 3KJVA 1HIAA 3AODA 1HHTP 4LFCF 2IN2A 3DLGB 2ZNZA 2BD3A 1CGJE 2ZC9H 1NO8A 3C6UA 5J1EB 3KDNA 4ABBA 4WU2A 1HNXJ 5D0RA 2R8JA 4ABFA 2FJVA 4DUYJ 3QIDA 4WK1A 3BF6H 4AXJA 2DGXA 3GY2A 1U6ZA 2ZQSA 3PHEA 3T5FH 3CVKA 4N47A 3MR7A 3RMEA 4ZPCA 3KLIA 5C2ZA 4NLGA 4C4WA 3LTOA 1C0UB 3W1YC 2ZBPA 4LJMA 2DGTA 3LP1A 3ARUA 1MQ6A 3B8SA 5L1IA 1J6YA 1BBRH 4F02A 4BTUB 3TZZA 1YBAA 2Z58B 4H4KC 2ZH9A 1BQNB 4DL2A 3MR6A 4TYOA 1QVGR 2QN5T 2UWPA 4B2CA 4M5KA 4Z37A 5FDLB 1VDHA 2A2XH 4R0IA 3QK1A 1KKHA 4DS5A 3NNCA 2ZH8A 3Q2TC 4IR1A 2DXDA 4FNHA 3TUIC 4WH8A 4F25A 4ZLPA 1IQMA 1LCYA 4B71A 2OCVB 5KFCA 1BY9A 3ZC4A 4UOHA 3H5SA 3BBBA 1TNGA 2DGWA 2WINI 3UI5A 5H9EJ 1CBWC 2BANB 2I5JA 2V8GA 2ZDAH 4TPIZ 5L2ZH 1Y5LB 1YJNS 3HVTB 1FX0B 5HKGA 2Q6FA 2DIVA 2ZQVA 3RBDA 1IM6A 3OFEA 3ALFA 3RXLA 3JXOA 1V2KT 1D3DB 2OINA 2WPKS 4X6PA 1SJRA 5H9FK 4F3OA 3ZTQA 4NXNF 4KQZA 2E5JA 2BR0A 2LQJA 3U98H 1GXLA 1JWWA 2Q79A 3ILOA 1SBRA 3W2VB 4LF8F 1UK2A 2ZP0H 5DGBA 3F44A 2EFNA 1QBNA 2WSCC 2Z3DA 2R3VA 1TELA 4XK8C 2VB6A 3BN4A 3PWBA 3A86A 3SJIA 2EC0A 2QJ3A 4O97A 3H59A 4X4UA 4M5NA 4OGXA 4WZMA 2H9ZA 1VR6A 2JKHA 4DZ6A 4X84A 1IQLA 2BDIA 2BACA 4NLQA 4RO0A 3IS9B 2FHOB 5U47A 3ZNUA 5E41A 2E1CA 1XUHA 2BM1A 3GYGA 3AQUA 1XTZA 1W26A 2Y1RI 3K9XB 2NPFA 4PAAA 3TAMA 3IHZA 2D9OA 3M5LA 2YNGB 4KV8A 2ZR5A 3K2YA 3EGWB 4QWEA 2VFTA 5E0GA 4W9PA 4OYMA 2FHMA 5C1UA 3UIRA 4F0KA 2Z3CA 1HAXB 2XNQA 1GI7B 2XQCA 1JNEA 3DI6A 1GHBF 3HFKA 4NEZA 1GMVA 1FIWA 4JK5A 1SQFA 2OSRA 3BGFA 3MWBA 2AEMA 1WDIA 2DNHA 1D2KA 2YNFA 2B31A 2GX4A 5EQSA 2P3FH 5C42B 3V6KA 3CJ5A 1VFJA 4B3OB 4H6SB 2E7WA 3A8AA 1Z7KA 2ATCB 1TNJA 3RGCA 2VH6A 3D28A 5B08A 1C2GA 1SPBP 1SGPE 1FY4A 2ZFTA 2OMLA 4QWBA 4G50A 2OPSB 1IJEB 3OE7D 1ELDE 1E6NA 1TNKA 4URQU 2HVXA 1FDNA 4HI1A 4LF5J 3OL7A 2M1IA 1FXYA 1GMHF 2G4TA 2JIZD 2M8DB 5EU8A 4W98A 3LGMA 4KTSA 4BTIB 5D4NA 5HVFA 5I42B 3VAGA 2ERRA 4PWUA 2R8GA 1FRHA 4HARA 2MQMA 1SLVB 1LQ9A 4NLRA 2XPAA 3SJOA 3HCXA 2RS2A 2E9TA 1RAJA 4NCGB 3QBCA 2HGNA 1DWCH 2MGZB 4ODMA 4U85A 1KHVA 3KCGH 1OP8A 3IR6B 1DXPA 1HBMB 1HW8A 4Q7YA 4Y71A 3PR4A 1JRSA 5A0AE 4J4OA 2AGGX 5LH8A 4MNKA 3VB4A 4CLYA 2LXUA 3AW0A 1OYEA 3R1HA 2XSFA 2ZOGA 4KKOA 4AY1A 3AA9A 1W3CA 1GUVA 2CF8H 2PIIA 3B4DA 1RT1A 2QMWA 1GJ9B 1FK9A 4GVLA 2MQ8A 2FOGA 2QA9E 3NNAA 4X1NU 4Q22A 2BX3A 3QO9A 4DV1F 1X7AC 4JI2J 3OY6U 4DOQA 4HG6A 4ECSA 3T1YF 4FBTA 1U1RA 4ILRA 4F48B 4QWDA 4BF8A 1GX5A 4QT2A 3UQSA 2FOAA 3MTYA 1P0SH 2KDOA 1G7CB 4FN5A 1ZU8A 4ZPDA 3M7QA 1HAZB 2XW9A 2HGTH 1QL9A 3RXHA 1VF8A 3IITA 2GMTB 1LDTT 1UCYK 1OX1A 2CNKB 5H1SV 2Y9HA 1EB0A 3RXCA 4DF4A 4CO0A 2D26C 4DR5J 1X60A 2F4VF 2CGAA 1I6JA 5B6LA 1X4AA 3WD3A 4DRMA 3K5OA 3I55S 1FPCH 3CZ8A 4ED8A 1YZ7A 4I68A 2F5GA 1UHBB 3CD6S 1W0ZU 1YF4A 1PYTA 3D1HA 1A1RA 1FWPA 4WTOB 2BXJA 4AB8A 4DL7A 2B8QA 3JTNA 4QR1A 1ZHMA 2LPRA 2V67A 1GMWA 1T3OA 1JLQB 3GY6A 4K8RA 3VR1A 1TL7B 1CC8A 3MMAB 4WCEQ 2CQBA 2MQNA 2DEJA 4GKKF 1ZTLA 1C1VH 2JC1A 5HJYA 5K9FA 4HH0A 1FFSB 4MLFB 5HVHA 4JYSA 1JJHA 3LGTA 2C28A 3DD2H 1MTSA 2OFNA 1L0ZA 1O3MA 2NXNA 2JH6D 4I32A 3P96A 1ZSJA 3UVJB 3KNAA 2CJ9A 3RXUA 4GGQA 2BQ3A 3GPAA 4X65J 5GQBA 3O8CA 3H2UB 5EGYA 2EK6A 3EVOA 4X4OA 3GYLB 1ZBCA 4B9LA 4UTGA 2SGPE 2FOBA 1WOSA 3AS2A 1PBUA 4OS1A 4FU9A 2H5EA 5C5NA 1PSDA 4R0XA 1VCQA 4Z2GA 1D6RA 2CADA 1JLGB 4UUWA 2X3DA 3OTOF 4GO7X 1VQ9S 2W2QP 1QSYA 1JK9B 1UO6A 5D6GA 1DY9A 4H4FA 4FXVA 3NPSA 4WIQA 3CCMS 4OHWA 3CS0A 4DT7B 3DFEA 4QWAA 3BGRA 1TQLA 3NP5A 3L7UA 4FUEA 1AUTC 3DGPA 5GCHG 4USJC 1AW0A 5C25A 3RM9A 4O3TA 1NRRH 3CJTA 3VALA 4DPOA 1F7ZA 3BPSP 1CJTB 4MFBA 3OU0A 2KXFA 1AU8A 4ZHMU 3UWIA 3MD1A 3CMAS 4D3GA 4X0WU 2PV2A 4G1PA 4OJHA 4FBUA 4K5SA 1Z4UA 3GCOA 1NDCA 2IAJB 3GWCA 4B17A 4CH8B 3JAMU 1RE1B 5LMUJ 2JH5D 3I5AA 3DM2A 3KKFA 2G2YA 3ODFA 1SJ1A 1TP7A 2GZOA 4EO8A 4UOGA 4LRAA 1GWAA 3L3TA 1TOMH 1NSAA 2D7SA 2MJUA 1NU4A 1QJ6B 3RG6A 1O0PA 2DKOB 4X2VA 2KU7A 3M30B 4O0NA 5HP1B 1GI3A 2NCKL 4Q7AA 2ZOMA 3AQOA 3LJOA 2PT0A 3V2UC 4L76A 2VVVA 4OS6A 1NPKA 4ODRA 2L2SA 1S12A 2PA3A 4IG3B 1HPGA 3TO8A 1U0HB 2XMTA 2JC0A 4TW7A 1GG6C 2EEKA 3PTWA 1GBTA 3VGUA 3ZTOA 1KLTA 3LGWA 1P3EA 3HKJB 1NESE 4QIVA 3RM2H 2ZKUA 5DG7A 1VGCC 1YPHC 3P5BP 1ZZNA 1LK7A 2IA6A 1QSLA 4THNH 1ELGA 1P09A 1FQ3A 1DZ5A 1S97A 3DFJA 5JVHQ 4FKYA 1TGNA 3MUVP 1QL8A 4HBEA 3OR2A 1EARA 1P9QC 2BX4A 2J97A 1EDQA 3AAVA 1ROUA 3F0NA 4TY9A 1A0JA 1RA7A 4K59A 3TIUA 1SFIA 2DHHA 1YLNA 1IBMJ 1Z1JA 3HHLB 4B3SF 5K14B 1WV7H 4ZLJA 1ANCA 1Q4RA 3ARVA 2C2MB 4M5MA 1S49A 1Z6EA 2M4MA 3KJNB 1IHSH 2IMWP 1EQMA 4I64A 5I3UB 4LR8A 1KSPA 2VBWA 3CHEA 3CDUA 1V2RT 5FIIA 3C8YA 2N82B 2H4YB 5HMZA 2G41A 4PUOA 4F2RA 3MECA 3JYJA 4CRCA 3PA7A 4OS7A 3GB0A 3EVMA 3GFXA 2JHEA 2WYJA 3LIWA 1FDAA 1F6TA 2B4PA 4J5OA 2V4QA 3R5CA 3W8PA 4NIVA 4XD7D 2VPYB 1KBRA 3TPIZ 4NLPA 3BYPA 3VXFH 4F4ZA 1VQKS 4LF7J 2FYQA 3J7ZT 4P8UA 1Y5IB 1VHFA 1DAXA 2CVEA 2ZTZA 1RTDB 1NRNH 4Z1MD 2C2ZB 3QUMP 1PCAA 1TL1A 4BBYA 1C5RA 3Q3XA 2B5TB 5E8EH 4JFMA 2AH4X 3PDNA 1YQHA 2M3DA 4ETZA 1BUXA 1XMOJ 2M0GB 3SBKA 2B8PA 4WIWA 1ZAWA 3GONA 1TV6A 2GFFA 4LSLB 2E66A 3TUPA 5C1YA 2O8UA 2PHBA 3TI0A 4CM2A 3I82A 3IWLA 2OXSA 1JVWA 4HR2A 4ED4A 4DIIH 1NWUA 4JI6J 2Q3PA 1YJRA 1YJVA 3AD7C 1PO6A 1HNWF 2QFIA 1NWTA 2KRRA 1VQ7S 1S1UA 3SQEE 4QYZJ 2ZJRQ 3K8WA 2UUWA 1H73A 3TH2H 2H65B 2P59A 1NHKL 2YQ0A 3T28A 1ROFA 1EPTB 1P05A 4N41A 4NRTA 1FY5A 2N87A 4TW8A 1PIEA 4QT8C 2FJDB 4IH5A 3KLHA 1Q6HA 2ETNA 2ODPA 3FFIB 4N56A 2UUAF 2HHVA 5KFIA 2YWFA 5FLXY 2W8KA 1WF2A 3WX8A 2DH9A 3NY0A 2QLXA 4KPCA 4KHPJ 1S83A 1TKTA 4DCJB 2GV1A 2KM0A 4C0HA 5JH8A 2BQ6B 2MKIA 3AFGA 2Y0SD 5IQ6A 3HT3A 5TCAA 1G3CA 3J7YU 5A09A 4OM9A 2ZM6J 4ZCIA 1UETA 4QBUA 1YJUA 2JLEA 2VODA 2BOHB 1SSXA 4TPYA 3MH5A 2FZGB 1BRBE 2HPPH 3MH6A 2ZKTA 5HWBA 1AB9B 2DHSA 3GCWP 2ZQ2A 3GYNA 1TKZB 2A4GA 2R3UA 1E6VB 3EYDA 1Q8IA 3Q2SC 4Z7YA 4E2FB 5IFMA 4QR2A 2XMAA 2B7BB 3OR1B 3TWZA 3AJ1A 3Q8VA 3MI7X 2D9PA 4FUIA 1GOIA 3NS6A 2HSEB 2N7CA 1P10A 2JH3A 2YWHA 1A6LA 2JDJA 3LP0B 3LC5A 3KUEA 3TA0A 3PY8A 1PINA 5KFYA 1G2LA 5KFHA 4HI2A 1FJ7A 3BEGB 4F49A 5LSOA 1CJUA 1JLAA 4ABHA 5HW7A 3LC3A 3UF8A 4P6QA 4CTAA 1V2WT 3E1XB 1PYTD 1DDJA 1RWVB 2W2MP 1BTXA 4N8OA 5E2QA 4B3MF 2HFOA 3A7TA 1GMWD 5CQGA 3SNCA 1NWSA 2ZZUH 2H48B 3AVZA 5EWEA 3MR5A 3WKZA 2YWKA 1HQEA 2B0FA 5FL7D 3KABA 2BW2A 2HQGA 1NZAA 3D0GE 2CHAC 2LECA 2GDDA 1RKJA 1J27A 3M8ZA 4A8SA 1FD2A 3MNBA 2E7VA 5D0EA 4U6PA 5A2QY 1GBMA 2AHME 2A2CA 2ZU4A 3PB1E 5GAGU 2NREA 3I29A 4P73A 1P9YA 1P9SA 4YY3J 1DBDA 2LA6A 2AV5A 2Q66A 2MDAA 1S77D 2FYXA 3US5A 4QCLA 3WD4A 1TK0A 1OHHD 1UPPA 3M7VA 3MOZA 3NOCA 2WB4A 3ARTA 4ID5A 4FVDA 3ENSB 2FHKA 2DSUA 3K65B 4AQYF 1AFIA 4B3OA 5D0HA 1F2GA 3KMQA 3QSIA 1ELTA 4E7NA 1RU2A 1MCTA 3V6JA 1P8VC 5GVQA 2K3IA 1TL3A 4QIFA 1S0VA 4LSNB 2KTQA 1C2MA 3R7NB 1HBUA 1NB7A 5KFLA 1QSSA 1KOOA 2VGCC 1ELEE 5EX3A 1BQMA 3VZHA 3W62A 4DS4A 4LOYH 3F73A 2RAQA 1KQKA 3QOKA 4MK9A 2QXIA 1ICEB 2RMLA 2DT3A 2GW8A 1P2OA 1O3AA 2FLRH 4B1TA 2UZAA 1V5VA 2B4VA 3OFHA 2STAE 3FY1A 4JYAJ 4DL6A 4ZHRA 2KG0A 1ZAVA 3SORA 4N8NA 1DWDH 4YDXA 1S6FA 3SUDA 3ZVFA 3OVAA 1HIYA 1FRXA 1V9OA 4A92A 5D0GA 1V2LT 3S7HB 2RQKA 2ZOFA 4DWSB 2BE9B 2Z4PA 1BLUA 3ZV8A 1P06A 4JZFH 1X4EA 5AE1A 3I31A 4IO1A 2H5JB 1FXDA 3FBCA 1VRTA 3O44A 4V1Ak 2GHWA 4P10A 2MZSA 4H4MA 4X8TH 1CULA 2J5UA 2ZU3A 5FD1A 3PVXA 3TLOA 5C2GA 1A5IA 1NPMA 4USTA 3UUZA 1O30A 2R7SA 4AORA 5A8ZA 3B8JA 1PQ5A 3HKIB 3ARSA 2FPZA 3GPKA 4RW7B 1FDBA 1H9IE 1CJVA 3N01A 1ABJH 1B0VA 2GGPA 5C20A 1ITXA 2SNWA 1SYTA 1EZXC 2EC2A 1DITH 2CJYB 3SI8A 2QXGA 2BVXH 3BR8A 4TXSA 5LM7E 3HVRA 4WP9A 1XKBC 5AXKA 3UE2A 5ETSA 2ILZA 2HQCA 5LL6d 5CYMB 2QSFA 3BGUA 3EQ0H 1O0DH 3K5NA 3NI6A 4LF4J 3U8OH 1Q0NA 2DJWA 4IRCA 1FJDA 1ZTWA 2M8HA 4HZHA 3PCOB 2BZ6H 2M08A 3C15B 2I6QA 3TJVA 4NMXA 4ZPAA 4MAVA 3T19A 1GTHA 4PG7A 3M9MB 2F3JA 2HFUA 5L46A 3CHDA 5E3AA 3TVYA 4OI1A 4RKJB 2V8DA 1ZGVA 1GI9B 5KT6A 2C2OB 4ZH8A 4IS5A 4Y6DA 1WAYB 3ARYA 4YFUA 1NFUA 3SFUA 1MKWH 1TBQH 1E35B 1HBNB 4JYUH 1YRUA 2DG3A 2Y8WA 4DWIA 3B9FH 4KHRA 1KNZA 4P2SA 3C14A 4RR5A 4NNRA 3LO3A 3IR7B 1LW2B 2IPOB 3PR9A 3G9CA 1OSSA 5C3NA 3GJTB 1FKPB 1PYTC 1AZSA 2A7CA 4A8QA 5I4MA 1SR5C 1SGYE 1BOQA 1W2KH 2QXJA 4ZA1A 3OSNA 2R0LA 3V81B 3M2RA 5GIBA 2F2DA 2W4CA 3IBWA 3BG8A 1N8OC 2FS8A 1XVMA 3BREA 2UZ5A 4NWLA 2KL8A 2CWXA 3EX7B 3WW7A 2HHTA 3KK1B 3BSQA 2JVOA 4JI8F 2Z2ZA 4TYBA 1EQ9A 1F9EB 2HRVA 1YATA 1I94F 4JFLA 3ATLA 1EAWA 3JYMA 1HPZA 2RQCA 1PQAA 3I87A 1WKKA 1AQ7A 4ER8A 3RXGA 3HK3B 4EK2A 1K0HA 1ZPVA 3RMMH 2DO0A 5K7RA 1HYSB 1X5TA 4NZQA 1ZHRA 3JTOA 4LREA 1G3DA 3ET6A 3DHXA 1ZA2B 2AFQB 5JUMA 1S1TA 4YM9A 1ZM2A 4WMEA 2IDLA 4OI4A 3CD7A 3BTKE 5GCHF 3OUYB 2PI5A 4QPXA 4QOTA 1HWIA 3KHVA 4ZVRB 4YEAA 2W24A 1M1HA 1VCPA 2W01A 3ARQA 1M5OC 2HNTE 2AJQA 3MMCA 1GHZA 1O5FH 3KIDU 2QO3A 4ANCA 3KYLA 4JI5F 2BXUH 3PFEA 4DV5J 1COWD 1HNZJ 3S8SA 4LF9J 1OS5A 2PUQH 3AY0A 2VUGA 3FVFB 8GCHG 4D3HA 3MURP 2HFSA 3B78A 2NR0A 1L5UA 1NPRA 4IMZA 4IT6A 3P6YC 3U27A 2ZF0H 3VTIA 3M5OA 2J2UA 9ATCB 3IBFB 2GCTC 4K1SA 4J9VA 3VGVA 5BJRA 4H4OB 4RW6B 1Y59T 1X4GA 1JLCA 4DR3F 1XN9A 1EJMA 4ALZA 1AWHB 2XP3A 3WQVA 2A1DB 1S1XB 3Q89A 1YTYA 1T8NA 1O3FA 1RAHB 2BD8A 3G6LA 4OQJA 3EDQB 1O51A 2ESTE 2NXJA 2KCPA 2BJ7A 3I0SA 3A82A 4LRDA 4GCHG 1TMBH 4X1QU 1BJUA 2BOAA 3NS7B 4J9UE 3WY8A 3VHQA 1KDNA 2OBOA 3M32B 3VAMA 3PV8A 2RUGA 5DDPC 4DSLA 2I6WA 1U2FA 4JI3J 4O3PA 2MMYA 4FUGA 2ZVIA 5AE2A 3DOMB 4RW4A 3BR9A 3T1HJ 1BMFD 1X6LA 2E1MC 5AE3A 2DRBA 3TNSA 4YP3A 4KGXB 1FKOA 5FPSA 2OUAA 4WXWA 1K1LA 1HARA 4FUCA 2FX6A 2VH0A 2ALVA 1U1KA 4WJG2 1TMUH 3T26A 4GHTA 1MD7A 2FESH 2YOLA 2VVCA 2DNRA 2XYGB 3EA9A 3HJFA 1EFRD 2WV9A 1YGCH 4FYDA 2ZDOA 3IBCB 1BA8B 3J7Z5 4IYQA 3TUZC 3SGBE 1S6QA 1Z6JH 3QMQA 3S69A 3ARZA 2YBTA 1V3ZA 3QLHA 5DG8A 3CGIA 3PLKA 2V3MA 1YK9A 2RF2A 2VNTA 2RRBA 4B75A 2C42A 1GBJA 1A4WH 1C4U2 1C5SA 1F5AA 2J9DA 3K5LA 1SC6A 5JVGQ 1ZPWX 1QB1A 1AGJA 3PYEA 4KE5A 1A61H 4DRJA 4X6NA 4A8MP 4R8UB 4Q7ZA 2G1HA 3HKWA 4RT0A 1WHVA 3CJ0A 3OL9A 2OPRB 3RRHA 3ODDA 1GBHA 2JJ1D 1RJXB 4AFUA 1C1TA 4OYOA 4JI7J 5HUAA 2HK3A 3GG1A 1GCTC 2FGCA 2LQ5A 2DR5A 1O3OA 5BXJA 4AYVB 3QSYB 5HANA 5C5JA 4FU7A 1TVRA 4QIBA 4LF6J 4HKQA 1C0TB 3QJJA 2ZD1A 2A5IA 1RI7A 3DMJB 1GI6A 1C5ZB 2VQEF 3HT0A 4WFZA 5J2PB 2V35A 3A8KA 1XNRJ 3A8EA 1AFQC 1F0UA 3BTTE 1P6TA 1WUNH 5B0AA 2G5NA 1NWRA 3BO4A 4Z7CA 5FX5A 4B2AA 2RQSA 4HLBA 3ZIAD 2B4OA 1HWJA 1NRSH 2PW8H 1PJ6A 3O3LA 5B0DA 1DUAA 3QGJA 3LOUA 1FWKA 2V9WA 1SV5B 3MHWU 3NWGA 4NI2B 5C0UA 1AB8A 1YKWA 4WFAQ 4USUA 2XRCA 4F8RA 4YO9A 2H51B 1Q31A 3RP2A 2VPXB 1MTVA 2J6TA 4G1IA 3K5PA 2HQIA 1H2VZ 1N32F 1YCPK 1OQ3A 1LPGB 1C1UH 1T8EA 2E9ZA 2RSQA 4G6VB 3N4WA 1GXUA 1NCLA 2LXFA 2RKIB 5J2MB 3RBXA 4I8LA 1K1NA 3HX9A 5CHAB 3KEEA 3T6BA 5HBMB 2PFDA 2AMDA 1IKWB 3D4JA 2ZQTA 1TMMA 2KKHA 2J0XA 1URNA 2WLYA 1J4HA 3F0OA 5CDFE 2I8EA 4TQRA 3RMOH 3ZZ6A 1N5VA 5DDQC 4K5ZA 1ROTA 2FI3E 1QBOA 4X8UH 3N5FA 1JNZB 3DHKH 4FUDA 4CO3A 4CHAB 4DL3A 1KXAA 1MTNB 3LQVA 1FNIA 2M5YA 3OW2R 1HB0B 3B9AA 1WNEA 4LFCJ 2HVZA 4ELUA 5IT0A 4DL0C 4MGVA 1HNXF 1O2JA 2XTTB 1W9VA 4HACA 3O5KA 1WHXA 3NXZA 2AWZA 1TK5A 1T11A 2QAAA 4ABGA 1BZXE 3NCLA 4G2PA 3NL0A 2WPJS 2WLZA 1RTLA 7FD1A 2BM2A 2BDYA 1R3NA 2KX4A 2RUQA 3W9IA 1P2JA 3IA0A 3NCPA 3QTVH 2P94A 3W9HA 3K59A 4A1XA 3G6VA 1K1QA 1O2PA 3KQ5A 3X3UA 2FGOA 3PYHA 2HZCA 3ZZPA 3ZZRA 1N54B 2KVQE 5F8XA 5D77A 3EGZA 1S9GA 1J15A 2GCHG 4G65A 3TK5A 2GJ2A 4FUFA 1RUSA 3A8JA 3GILA 1O6IA 4DL4A 1FKKA 4OZ1A 4YB1P 2PBCA 2HMIB 1VGYA 2XZWA 5ETXA 2GVDA 2B6AB 1X4CA 3OQ2A 5CZVA 1GTEA 3TZXA 4FXGH 4X2YA 5K0HA 3RLWH 2AGPA 1SG8B 3LW5C 3UD5A 2UP1A 3KCEA 1RTHB 2D1JA 2ZE2A 3GSDA 4K4XA 1HNVA 3Q00A 5EXLA 4IUFA 2OAUA 3CDBA 1L1GA 1DTTB 3L7PA 5SUHA 1AMHA 3RU0A 1EQ3A 3VB5A 4PEOA 5KFZA 4IQ2A 2ZWPA 3ISNC 2Y5FA 3V4IA 2JETC 3SBMA 1RT6A 4DRPA 4TVAB 5GNDA 2B9XA 2QRRA 2VPZB 5CHCB 5L1JA 2KI3A 3OEHD 3DOLB 4NIYA 1TKXB 2O67A 2GC8A 2GMJA 4YR0A 4ZPWR 1EKSA 2UUJB 1O3GA 1CG2A 4NXNJ 1GXTA 5B7WA 3OBIA 1Z2ZA 2PE8A 2OD6A 4ZP9A 1J5EF 4LF8J 3QX5H 1OWJA 2PKAA 2G1DA 3QIPB 2VC1A 1EZUC 1WD6A 5HLFB 2HVDA 1E6RA 4IH6A 2JJ2D 5T7LA 1GJ5H 1DPOA 2V50A 1ELCA 2IVYA 2L41A 3OTPA 1VJ9U 1CBWB 2O8LA 1N33F 4QPTA 1F40A 1SL2A 1PG5B 1EASA 1SJQA 3BSCA 4CQ1A 2AMQA 2A10A 3KAIA 3L7OA 4X8VH 1MU2B 4RLEA 1WEZA 4UQGA 4F4YA 2ZHWH 1FKTA 1VQ6S 4ZPTR 4HBOA 2PN6A 3A12A 1RHRB 2WBMA 1XUJA 1LFWA 4SGAE 5AFYH 3O5QA 5DZ6A 2DUCA 3HGPA 1D3WA 3AT1B 1PAEX 3TNTA 3UCUP 1EAUA 3RBZA 2LDYA 3GCNA 5RUBA 4RSPA 3UI3A 3UWJH 3L9ZA 2HNDA 3D1QA 2BD5A 4I8HA 4OMFG 1O33A 4I2PB 2MZTA 2HNTF 8RUCA 1RT2A 2RRNA 1Y0OA 4I6AA 2FDNA 2WUCA 4UUXA 2O9QA 1TFXA 1QTMA 1YPLH 3RU4D 3RC5A 3NGUA 5T14A 3PMBB 4MPXA 3UQBA 2V2ZA 2ZI2H 2JEFA 5CYQB 3LUOA 2BVZA 1SGNE 1WXRA 3PO5A 2A31A 3QLPH 2CKWA 2VZ9A 2FI4E 3S0NA 3RJMB 4X4TA 4I8JA 1O2UA 3VF0B 1OWKA 3M6WA 2YPYA 1A0OB 3CJ4A 2PPOA 4ODPA 4IDKB 2P4VA 2GZ7A 3LOXA 2KZMA 3F3BA 2HRYA 1VR1H 3DRSA 4FXDA 3WHIA 2XNIA 2RDEA 3A7ZA 4ABIA 5DP6A 5BYRA 2HHXA 2XULA 1O2VA 4XOJA 2J6SA 2HHHF 2OK5A 3ZZYA 4EU0A 1BBRE 4Q45A 1VBKA 3NAIA 1A2CH 3EAJA 2OFHX 3I4PA 2HEKA 1FRLA 1BD6A 2PD1A 2YKNA 3U7JA 2GQQA 3FEZA 4H6TA 3ELHA 3QAUA 5DP9A 4ZCNA 3LT3A 1ZOTA 3UY9A 2Y3YA 3BTDE 2R7XA 1O35A 2PV9B 2A4RA 4DX6A 4Y65A 2HFNA 4A4JA 2NU3E 3SOSA 2LEPA 1D9AA 3CCUS 4JI2F 2WB1D 2WVEA 3TJOA 3RXOA 1VC6A 1TX7A 2Y5HA 5IDKA 2Y7XA 4DV1J 4R5PB 1SGCA 2X1BA 4GMKA 4M95A 3T1YJ 1TAUA 4OJGA 3SCKE 2ZFFH 3FEXB 5K8PA 2L08A 4F7VA 3ODKA 4RJVA 4KAIA 3ALGA 1MZAA 5A2MH 4B3RF 2H5IB 2RFKC 2F4EA 3H7HB 2FAPA 8ATCB 2HVEA 1HV7A 2IC3B 3J80Y 1YSJA 2QTWA 5D3GA 1KTTB 2XY5A 2KG1A 4IH7A 4KGVB 1YBTA 1CA0C 3DLJA 3UWTA 5HTGA 1AROP 3ADAC 2PLXA 2RURA 4KY3A 4RI0A 3NGKA 4BAQB 3DLLQ 2F4VJ 4CNZA 5ETRA 1P2IA 1W7GH 2EBGA 2ZZNA 1FX2A 4M5DA 3KTQA 2QLJB 2G51A 2VIQA 5GWZA 2YQ3A 4L73A 2J98B 2A2DA 4K5RA 1BTYA 5T6FA 1UWBA 1N56A 1U02A 1BMAA 2DT2A 1JMTA 2ALZA 3IR5B 2JFKA 4ECZA 4TN2A 5KT7A 3SYJA 1D7HA 1B99A 3ZFVA 2ZHBA 3DXSX 1NJZA 1GBAA 3S01A 4NLWA 1IR1A 1BMNH 1V6HA 3PJ9A 4RBTA 2ULLA 3O5IA 4GKKJ 2V34A 5A76A 3LP2A 3N7EA 4ZVTB 2BLQA 1KLMB 3I0RA 5K5MA 5HBFA 1NM6A 1DM4B 5B0BA 4X65F 5HJXA 3FZ2A 3MEGA 1HLTH 3KQEA 2QE7D 1OY8A 3HZEA 1KC8T 4KGMA 1ORFA 1XUFA 1AE5A 4QYRA 3GSIA 3BM7A 3MUTP 2DE8A 1N6QB 3FSIA 3K2UA 4IW4E 1TFYA 1WG1A 4RN6A 1O2KA 1R0CB 4I8KA 3BXWA 1DX5M 1ESAA 4DDFA 3OTOJ 1S6UA 2WPLS 4CH7A 1JNDA 4KP0A 4CYUA 4J9QA 1QIXB 8GCHF 1HKAA 3EICA 3M6VA 2I1RA 1S6PA 4Q43A 5DF0A 1FNOA 3VQTA 2QXHA 3IRXB 3K7RA 3MFIA 1SIZA 1J2VA 1ANEA 1BWEA 1NKCA 3I56S 1NMWA 6GCHG 3TX8A 4PWDB 3CWJA 1U6BA 3NEKA 2A6MA 3UQOA 3UI4A 2AIRB 4XDEA 2W5EA 1E15A 2BD2A 3PX4A 3EVWA 2FY8A 4DQIA 4L3NA 1PFXC 1DWEH 4C11B 1GVLA 4DSJA 1HBOA 1EP5A 1NO9H 4DY7B 4MYTA 3DT0H 1X4HA 2BDPA 4YR3A 4MKVA 2H9EH 4GCHF 3M4XA 2O66A 4C97A 3GDVA 4IFVA 1WSRA 3AS1A 8LPRA 3PMAB 4Y2AA 3M9NB 4X4VA 1ELBA 2BDAA 3E3XA 2WZ1A 5C94A 1AY6H 3NCQA 3Q77A 2ZG0H 1LK5A 4AL6A 4RW9B 3T27A 1SMFE 2A7JA 1AI8H 1VMBA 2DGQA 1K9MT 3GY8A 1MAYA 2XBXA 1F9HA 3MEEA 2XI2A 2W4DA 3TDBA 3VV2B 4AXIA 1P5QA 1U2CA 2Z9JA 4F4OC 2GMHA 5D15A 4ZPVR 4ETXA 5HIYA 2FTMA 2DPJA 1K21H 3BZQA 3MM8A 2NUHA 2GVFA 3P70B 5GAEI 3CJ8A 2XC0A 3KK3B 1KMHB 2QIQA 1Y10A 4WBFA 1ELFA 4C6AA 3LGVA 4C02B 3LALA 4ZKAA 3MMBB 4I2QB 1N1LA 3KAGA 3A84A 3BGLA 2MKJA 1J5OB 2CV3A 3DRPB 4ZAEA 1FKRA 2XYHB 2FI5E 1VQYA 5DKMA 2PR3A 1TZ0A 3R3TA 2NZ4A 4K4TA 1IBMF 5HWCA 2CA9A 1QAIA 1QJ7B 1LWEB 1T4VH 2BMGB 3HFZB 1O2IA 4B3SJ 4DSIA 1PC5A 3RRGA 3BJYA 5L9NA 5A6PA 3O8RA 5E0OA 1Q7YT 3MR3A 1GG6B 3I78A 3M1VB 2YMSC 4X64F 1UVSH 2R2MB 4ZN1A 4CLUA 4UDWH 4PG4A 5MAOA 1VGCB 4QW8A 5DIUA 1SOZA 1W14U 2Q6BA 1SVPA 3SV2H 3SV7A 4QR0A 1BTZA 4UE7H 1IR0A 3MM5B 1MTUA 3AS0A 5KG0A 4X1RU 3SDEB 1O31A 3GISB 3CC7S 1S0NA 4UDMA 1EP4A 1X7VA 1S0RA 5KT3A 1TAQA 1AZZA 2HAIA 4ZKOU 2V6AA 4OLPA 2Q6DA 3Q8UA 2OIHA 2MEWA 5DG9A 2AERH 3WWFA 2ANWA 1XRVA 2UUKB 5JBTA 1HWLA 1XMOF 1OWXA 3HHEA 3QFHA 3VGTA 1TL4A 3F41A 5F8GA 2V0BA 2FOFA 2DNMA 2EG1A 1TB6H 2FLPA 1H8IH 4INHA 3FJ2A 4R0JA 2KVIA 3FGVA 1XMBA 1G36A 3A89A 2HAFA 4YB7A 4JI6F 3QO6A 3ONQA 1GBDA 3CJ2A 5DPAA 2NSCA 2NZCA 2FVRA 4PROA 3D0IE 2GJIA 5A0YA 1W13U 4A46A 4Z0KA 3M36A 3HSZA 4MTBA 2HS4A 3QGGA 4FF4A 3F9EA 2WW8A 8KME2 4PTMA 4DR4F 1FJEB 1F2HA 3ETOA 3ZZCA 2HQFA 2XLIA 3J81U 1ZTTA 5AXLA 1QFKH 2DHAA 3BPDA 2VICA 2DY1A 3HF5A 5L2YH 4ED0A 2C3YA 3L09A 2EFPA 4YR2A 1JIHA 1U6FA 2M7SA 3A85A 3O6QA 5C7PA 4OX7A 4DU8A 1LQDB 1QPLA 2AF6A 1QA7A 2Q43A 1XX9A 1FKDA 2AGEX 4KHPF 2LA4A 4X4RA 2EULA 2HPQH 3MFJA 3OFGA 4K3JA 2G8TA 1GVKB 1V2PT 2Y1LB 2EI5A 4J9SA 2VOOA 5L8RC 5L38A 1SGDE 2F9DA 1KN6A 2ILYA 4DHVA 3QRPA 3A8BA 4OZ0A 3UN2A 1ZSLA 4PQAA 1BIOA 1E6YA 3GZ7A 4W9QA 3CJ3A 3CHFA 3PV2A 1OGGA 1RT3A 2G4BA 2WK2A 3M35A 5CXTA 2XEXA 4MAKA 3EGKH 3JB9k 1T8OA 2P6TA 3WD1A 3R5BA 5H9FJ 1GJ8B 4I86A 1HNIB 3CCES 3KNGA 3ARWA 3AAWB 1VLOA 2EXUA 5DGAA 2GCHF 2X1FA 3CCRS 4URIA 1WTHD 2TGAA 2BXTH 5FPYA 3G8SA 2LQ8A 2D3O1 3E3TA 3KJVB 1HIAB 3WC0A 1ZAXA 1W11U 2VIVA 1URRA 1DLKB 4C8YA 4UFGH 4LAWA 2J9NA 2CPXA 4DG1A 1RP5A 4JYTA 2XZDB 4H4KA 4D7FA 2GO9A 3C6UB 3SU1A 2BJ9A 1HAIH 4NLOA 2B9YA 4NG9H 1YDLA 2A0FB 3OTBA 3EE7A 1DANH 1NH7A 2O8WA 1C2LA 1C1NA 2DSWA 3WIJA 1RZMA 1VCWA 3A13A 4BHQA 1UVOA 3SU0A 3SNBA 2FOEA 1ETTH 4NA7A 1NSKL 3UAIC 4CLZA 4KH1B 3KLIB 4JFJA 4B3MJ 3M8QA 4ZLLA 3LP1B 1UTPA 4YN3B 2UUYA 2YNHA 4YT6H 4ZJOA 4D9QA 4DFMA 2DSVA 3L3CA 1ZM4A 4ZCKA 3DYAA 5J2QA 1MMJN 2R2RA 1U1PA 3M6XA 1HAYB 1N5YA 1Y00A 2Y82A 2TIOA 1DLOB 1SHHB 2CRLA 4TY8A 1V2MT 4VGCC 3MMJA 4I69A 5LOQA 4YY3F 4OX6A 1LG1A 3CMES 4MIBA 3RUBL 2STBE 3DOKA 3PM9A 2FB0A 4NYZA 1GJ7B 4HL9A 1UJ4A 3KLVA 1GCDA 3EA7A 1ZB5A 2MQLA 1D7JA 2L3MA 2ZDLA 4ZKSU 3DUXH 1CGIE 1G6BA 3P49B 4TX0A 4IQCA 2G52A 4AFSA 4HDGA 2I5JB 4AQYJ 2IDEA 3QRQA 1SI5H 1WAWA 3OVBA 4ZP7A 3ZZ5A 1C2JA 3QWCH 1CT4E 4BWMA 2CHAB 3O5DA 1ZMLA 1HD0A 4Z2XA 4ZP8A 6LPRA 2VFSA 4NLYA 2AQ4A 1DQ8A 1JX4A 1GJ6A 3SN8A 4MQAA 3PMJA 1RCXB 4DV2J 2QMXA 2ADBA 1WF1A 2VD3A 4K0KJ 3KLFA 3EXCX 4NZ7A 3S9BA 2DH7A 1IJFB 1YHQS 3RGIA 2AIPA 1XIQA 2YH0A 3DLEA 2C22A 2JDID 5KT2A 3W8GA 1HKKA 3JQMA 5M2UA 1ZTJA 1TOCB 3L6PA 2VWNA 1VYAA 1X0FA 1O32A 2LU2A 2NXEA 3FRYA 3TAMB 4KFBA 1N88A 3OT9A 4INKA 4KV8B 3QZ7A 1D6WA 3PYGA 1O2SA 2ASYA 2MQPA 1I5OB 3H4BA 2PMWA 2ZVSA 1QAYA 3DI6B 1KSNA 2SGQE 4NLVA 5EG4A 1NLKL 2B9EA 1E37B 2K06A 2P6SA 2Z9GA 2YNFB 2CMYA 9RUBA 2ZGHA 4LAXA 4MT1A 3PX6A 2YKOA 4WKFA 3LH2S 1OY6A 4O2TA 2E7XA 3UOPA 2VA2A 4A8OA 1F5LA 5CE1A 3AHPA 1SC3B 3G6MA 1PGZA 2FDMA 3OAAD 2D9FA 1NS3A 3VCDA 1DSUA 1JQGA 2CAJA 4NX9A 2ZTXA 4OZNA 2CPFA 2UUTA 4Q63A 2EI6A 2WTFA 3FZZA 2WK4A 1WC6A 6AT1B 3UD3P 1KTVA 2R9PA 4ISLA 3UQVA 2IFXA 1O2YA 3MDFA 3IN5A 3HSDA 1QE1A 2CXVA 3TZYA 2AGIX 1FMGA 1UVTH 4PCQA 1NH8A 1CT0E 2VA3A 1M5YA 2QSWA 2K7KA 4F4XA 2ZDMA 4FYVB 1NJWA 5GJ4B 3BN9A 3Q83A 5IM0A 3MNSA 1CJKA 2AGQA 2FJWA 5F9NA 4O0IA 1GDUA 1BC6A 1BCUH 1VQ4S 1EKBB 2LQBA 3H40A 2BUNA 3PKMA 4KKOB 1LOUA 2TRMA 3QN7A 2F8MA 1ZRKA 1AD8H 1WTBA 4NA8A 3RXAA 3ZVCA 1RT1B 2F21A 4EZ9A 1FK9B 4WK3A 3CULA 3MGJA 2GD4B 2XZTB 3TAPA 1LFPA 3QO9B 1X0PA 1D8YA 4LQ9A 3G87A 2GJGA 2C2RA 3AJDA 1EETA 4ZVPB 1XVOA 5DG6A 2ZC3A 2CJIA 4CRDA 1FERA 1CGHA 2A7HA 5HI7A 1O37A 3M61U 3H09A 5KOWA 2ACYA 2MZRA 4ZUHA 4CO4A 2HHPA 2YKMA 2NWNA 3B9DA 2ZGXH 4JI8J 1B7FA 1X5OA 1T7CA 3W3SA 1O5DH 2W2OP 1SQTA 1GI1A 4UQTA 3PO1C 2KXNB 5M2RA 3K57A 2ADCA 1VQLS 1PPGE 2F9JA 4BANB 1HAGE 2CQPA 3IFEA 4EYHB 1UTNA 4UY85 2QF0A 4Y10E 3RFWA 4OYAA 2XO6A 4DV7F 1MKWK 3CC4S 1MCVA 3WD2A 2HLCA 4Q44A 1BHNA 1D3PB 3MO6A 5EW1H 3UNYA 3NZIA 5JYIA 1WB0A 2IPHA 1O3PB 3NRBA 2NLWA 4OV1A 1REGX 2Y5GA 3GIIA 1C1QA 2XMUA 4NSBA 1RQ0A 2JSXA 5DSFA 1C2IA 2F4FA 2KE0A 2B5JA 1K44A 3QNWB 4NRUA 4OIXA 4DPTA 1T8MA 1RLCL 2CPZA 2V3OH 2G5VA 1MH0A 1NRQH 1EXFA 1KOHA 4CRJA 3QJPA 1Y5AT 6GCHF 4J9NA 3O5GA 2VBZA 2DNPA 2M5TA 1RK8A 2W9BA 4S3KA 1FCAA 3AASA 3CCLS 2XMJA 1Y5NB 5DN6D 3PACA 1XMNB 4PQUA 1HNZF 3KAHA 4EGLA 2SGFE 2P3UB 4JI5J 3FQLA 1SL0A 4ANDA 2AJ0A 3RXTA 3Q22A 1XHGA 1LO6A 2BJDA 2FHJA 4F2SA 2RJZA 1MU8B 5F8NA 3RXBA 3RC4A 4FETA 3CUNA 2OJ3A 1S76D 1GBBA 4BXSA 3CCWA 4RWXA 3FBFA 1ZR0A 3RMLH 4LR9A 5KEDA 1W10U 1HW9A 2KT3A 1RAIB 1NRKA 1G32B 4IG0A 3SZNA 1WI6A 1DQ9A 1FE0A 1TPOA 2XWXA 2FX4A 2YKPA 2ZU5A 3MAAA 4DR3J 1C5QA 2GX8A 4WKRA 2SXLA 3W60A 2QV1A 3BGRB 1DY8A 1E6ZA 3W94A 2CK3D 4M9FA 1S1VA 1IUJA 1HAVA 4UD9H 1HWKA 4K2XA 1S5ZA 5A8YA 3DGPB 5D4OA 3QT5A 1EX8A 4Y76A 2RU3A 5C25B 1VCTA 4BDPA 3PX0A 2MY8A 1O5JA 3P8FA 3P6ZB 3ENVA 4ZDNA 2Y78A 4MFBB 1XERA 5EW2H 1NN6A 4JMYA 4JI3F 1EYMA 1MW7A 5C24A 4C8KA 2W7AA 3H8YA 3BEFB 3MO3A 4NCAA 1ELAA 4C8LA 2G9OA 3U28C 3T1HF 4P02A 3LA0A 5K8MA 2KR7A 1IKXA 3MYWA 2GCTB 1IWAA 1D3QB 4DRQA 3G6YA 3DM2B 3OJSA 1C5YB 4NLDA 3MM9B 3OA5A 4YXWD 3ICLA 5F9LA 1A3BH 2M2AA 4JP8A 4DR2J 2XP5A 2LMIA 1NRPH 3LAKA 2ANYA 1QNJA 1T32A 1O3BA 3OPKA 2ITKA 3PMHB 1QUVA 5B09A 3TCZA 4CNYA 5KFOA 1FRKA 4GVBB 1ZYOA 3FFGA 1ZPZA 3C66A 1L3TA 2KFYA 2J7WA 3W9JA 1FEEA 2L9WA 2JZVA 1NSPA 3ATWA 3RXRA 2OD4A 3SU2A 2F9OA 4OYZA 2J95A 2GAGC 3M6UA 1IBCB 4XDDA 5EQQA 3ZZ0A 4LIWA 1E1RD 3HD2A 1EB2A 3GP9A 5IYTA 3ENWA 4FVMA 3M8PA 4BS2A 1YCPH 2CPEA 2B9LA 2DHXA 2B5UB 1D1UA 4F36A 3FAOA 1FXLA 3WWBA 2R3YA 1PJ7A 4OZLA 3OR2B 1Y3JA 1BTHH 5ETLA 4YOIA 3TUJC 1SGRE 1TAWA 2XWYA 3CDWA 3AROA 1OQ6A 1REVA 3RTVA 1IAUA 3ZZUA 1B7XB 1KVIA 2A5AA 4YS2A 2G0IA 4PG8A 1CHGA 5I25A 2FOHA 2MLZA 1L1PA 2XC9A 2CG4A 4M63A 4J9PA 5KFTA 2Z0GA 1SKUB 2RE1A 1C1MA 5DDOC 1R0AA 1CS4A 4PUOB 2XHWA 4DN0A 3MECB 1HRTH 3ETMA 3FKSD 2RD5C 2W9CA 2O8MA 4NSYA 1UJ1A 2AEJA 4C7QA 4RKOB 1JLEA 1YLXA 3FNNA 3MH4A 5BYQA 3N5BA 4P9SA 1DOJA 4U30A 2W2PP 2XTJP 5CABA 1GCTB 4ES3A 3A88A 4M5IA 1XXFA 3UTUH 3GYXB 1Y7PA 2VU5A 2QA4S 2L9NA 3VAKA 1TL1B 2VG5A 1N32J 4Q5VA 1OO0B 1R0BG 2DRDA 3D54A 2FC9A 4RW8A 3F0PA 5HT1A 4CIOA 3PW4A 5EIYA 1HJ9A 4AOQA 1U09A 1FRMA 1AFQB 1F92A 2R2WU 1PPEE 3EE0B 2ZFSA 3D66A 2AEFA 3S1TA 1TV6B 2GQ2A 3QJLA 1HJAC 3T41A 2EG2A 4IFYA 1FAXA 5FLXU 1LWXA 2XNDD 2Q6GA 3LU9B 3KK2A 2KM8C 4DQRA 3UCZP 1HI0P 1MKXK 2ASJA 1OY9A 3SYZA 1KLIH 1S1UB 2OQ5A 1RACB 2Y81A 4NA3A 1DICA 2LELA 3B23B 1FHTA 3UOUA 3W7BA 1D3TB 1MN9A 3G4SS 3Q8QB 2VWMA 1YVFA 5C17A 2OBQA 2A18A 4Y00A 3GS9A 3I6PA 4CH0S 4HTIA 3A4TA 1FJGF 3A87A 2ZR6A 4CZCA 3KLHB 1RWUA 2Z9IA 5DJBA 1C4CA 2GA7A 3ENQA 1MLAA 2ZFRH 3MM6A 1WC3A 1NAQA 4O4RA 2PTCE 1NMVA 4DV4J 4B9TA 2SGAA 1VK3A 2CPYA 2YNIA 4FYXB 4OLOA 4OX8A 4W90B 2BY5X 5SGAE 2KAIA 3EPGA 1TKTB 1CVJA 4OYBA 3BQ1A 3MH7A 3TH3H 1FLEE 2BEFA 2CWKA 2CQ3A 3PIOQ 2RA3A 4ZJQA 2L48A 4RNOA 4J9KA 2AJ2A 3PKYA 3DN9A 1DLOA 3V0XA 4WKAA 1LVYA 2BKOA 3P92A 4E05H 3PW5A 1P03A 4KGZB 1O5EH 2BA9A 2F9VA 3TJAA 2L6OA 3CGNA 1LWFB 4GSOA 3MPVA 1GQEA 4YTAA 1O3KA 3GY5A 2F9PA 4V19J 5DRKA 4RNNA 1O2NA 1TE0A 1T05A 3KHHA 5ETMA 3RB6A 1KTQA 5JXSA 4TU8A 1MMDA 1CSOE 4DX8H 1SH3A 5KFMA 1GJAB 3CCQS 1MWQA 3KQCA 4DZ3A 5FX6A 4KYZA 5E3RA 1K0VA 4WIIA 2ZU2A 1JIRA 1FEHA 2HBYB 2SGEE 4DV3J 1O2TA 4DZDA 5A2QU 3BTGE 1SOTA 2ZHDA 3RMNH 4GIVA 1RDRA 2DPIA 3E0PB 3ZZ9A 1J17T 1CJUB 1JLAB 3WL0A 4YB5A 4CTAB 1M0SA 2J6UA 2OO4A 2ZHEH 1AVWA 2HRTA 1SUQA 2G0JA 4ED5A 4C48A 1J5EJ 4TLQA 5IC4B 4DL5A 2OELA 5CH7B 3G6XA 1C1PA 1JKHA 1TGCA 1UKUA 2GHVC 2OFGX 3D1OA 1FKLA 1I51B 1HQEB 4WP8A 4MPKA 2VHGA 3P5TL 5IT4A 4Y0ZE 2G2OA 4B08A 1BTPA 3GY4A 2RB7A 4E8UA 1N33J 2M88A 2VDIA 4HT7A 3IGNA 4U67Q 2P3TB 1WC4A 5EJLA 1O2GH 1WJ9A 1B6CA 3GFYA 4DOZA 1UFKA 2JETB 3NUMA 3DU5A 2B4UA 5KFUA 3T5LA 2FTLE 4ZXYH 3AOAA 2FHJD 4WPAA 3UFCX 3PHTA 2F4LA 2ZCLP 1EQ0A 2ZJQQ 4ID5B 3I5BA 1YBUA 3HHLC 1BWVA 3R2CJ 1K1SA 1OJ4A 5DITA 1QBVH 4DXLA 2W1BA 4MPVA 2MKYA 1MROA 3LPEA 4DR7F 3SSRA 1TL3B 2CNOB 1HBUB 1ZBWA 1NK0A 1RWPB 4BC7A 2KHCA 4KR0B 1IOEA 1BQMB 1AE8H 4O44A 1P02A 4NOHA 3CCJS 1VITF 5F3ZA 3BMBA 4R5EA 4DSKA 3KAFA 3M5NA 1NZ8A 3EWGA 2DEIA 3T9NA 8AT1B 3RBEA 1BGXT 5I3PA 4KT0C 2FYRA 3KACA 2FIUA 5GPIB 5EDWA 5KGOA 1THPB 4DLEA 2F9NA 2CJXB 3BS9A 1HAPH 1PAUB 3BV9B 1RADB 4ZHRB 1RHJB 1Q6IA 1C1CA 3ELAH 1O3LA 1RTIA 4ECYA 2HHHJ 2HHSA 4K50A 1FVQA 4MKBA 4XAKA 2VIWA 3SV3A 3MPYA 1W9UA 5CCMA 1VC5A 3PYFA 1R6VA 4LVOP 2ZDNA 2R9LA 1R43A 1K0TA 2VL1A 4ZIVA 2ZNYA 2V3HH 4XO0A 3M8SA 1Z8RA 1UCNA 4TY7A 3AB4B 3RB4A 1RSCA 3R6LB 1RT4A 1VRTB 1LKBA 4ECTA 1G2EA 2DXEA 4Y8XA 1HJ8A 4ODKA 1U8WA 4H4MB 1CULB 1TUWA 2JL9A 2QFJA 3ZVAA 1FN6A 3AS3A 2VPWB 4H42U 4EMDA 3LANA 3GJSB 5BYSA 1E79D 1Y5BT 2VG6A 4LF1A 2WV5A 2AMPA 4ESTE 3RXQA 2B51A 1BT7A 1NTPA 1CJVB 2GGPB 1EPTC 5KTQA 2ZFQH 3HHKA 4B3RJ 1WDTA 1A7SA 2MKHA 1B5GH 4P00A 1NEEA 1V3SA 1YZ6A 1GI0A 1ESTA 1RT5A 3M05A 3PLBA 3VB3A 3RB3A 3VAWA 2FKEA 3P95A 2PV3A 2BQUA 3H90A 4ZKRU 3C46A 3C6TA 1DFDA 4UFEH 2EA3A 3H7TA 2NUUG 3OD2A 3RXEA 4I7FA 4NZ6A 2JJ4D 2B9WA 3G82A 2A45B 2H1YA 4DPUA 1FDDA 4A48A 3BKUA 1XNQF 3CD0A 1Q82T 3URCA 3KADA 4U84A 1JLFA 1KD1T 1QVFR 4GHQA 1LHCH 3P3DA 2G2ZA 5FBEA 3FSYA 3OTCA 3K17A 1XR5A 3RDZA 4KKDA 3E6PH 1GDNA 3NGSA 1FF2A 2CDRB 1KEKA 1YWUA 1KHWA 3C16A 1S59A 1HYLA 4Q80A 1JNSA 3TR5A 2ZUGA 1LKZA 3C14B 1Z2LA 1IBLJ 1MN7A 2VBCA 2EFQA 4JV2A 2HS3A 2XBWA 2VWOA 1X4BA 4WXVA 3HO1A 1RISA 4AFFA 5A8WA 4GPGA 1UAWA 2WV4A 1QQUA 1Y3XA 1AZSB 3ARRA 3R5AA 4ZVUB 3QWUA 2EQNA 3M2RB 3EZ5A 3MI4A 3LWMA 2D1CA 3CMQA 5C0TA 5JB9S 1APSA 1IQZA 3D5MA 1D0EA 5AJ3F 4OV6A 5HROA 3HULA 3DSOA 3V6DA 3OHAA 5HSPA 1C2HA 3TX0A 4P75A 2WBRA 3M7TA 3UQAA 4AL5A 1AZ8A 3ZZTA 5HKKD 3CIZA 1HPZB 2IA0A 2H9TH 2GKVE 3O8BA 1GBFA 2C2DA 3FAPA 1K8AT 1QA0A 3QPIA 3KMSA 2V4RA 2QYCA 1TRNA 1FD9A 1GHYH 2XP8A 1N1AA 4ACAA 3D6MB 3BH6B 4I6YA 4O3QA 1PPZA 3P45B 3TANA 1BL4A 5HATA 4FF1A 1F9FA 4WJBA 1C5XB 1YLCA 1O3DA 1E9LA 1AA1B 3ET6B 3WDOA 1DHMA 5L9XA 4ECQA 3JTPA 1S1TB 1T9WA 3PRAA 1F3FA 3OFFA 2MQQA 1WC0A 1Q53A 1XQIA 1UCYE 3ZNJ1 1S7HA 4OHVA 2XXLA 5I46H 2I9SA 4F26A 1K1IA 2ZH2A 1TONA 4J2YB 2XCFA 4JZEH 1Z71A 1B4SA 5JMNA 4O3OA 1UA1A 3SZ2A 3MM9A 3FK4A 5FJ4A 4F04B 3LH1A 3UDLA 2VWLA 3A1YG 3MMCB 4ILMA 5KT4A 1XKAC 2CG8A 2KZZA 3PJWA 2OH2A 2HHWA 2VH7A 1TU0B 2DXFA 2VIPA 1XUGA 2ZBRA 4ITZA 2KFWA 1WC1A 4GVBA 1QM9A 4ANEA 3ZZ8A 1BHXB 1O8BA 5IOLA 1LPZB 3CSKA 3RU4T 1SGFA 1EAYC 3GV5B 3CJRA 2XYAA 2DYAA 1C2PA 1OKXA 3P8GA 2DK2A 5ETNA 1JLCB 3KFWX 1FX4A 1BRCE 1B0PA 2J76E 4B02A 3ESTA 2HG4A 4M94A 1P2NA 2VVUA 4DUZF 3RRKA 2UUBF 1GMCG 5C2CA 1TGSZ 4U95A 5L1LA 1DT2A 3ZTRA 1QJ1B 1QR3E 3I0SB 1HQUA 2X1AA 1P1TA 4K2JA 2CJKA 3A7XA 4N5SA 1S1WA 2HQ3A 1X8DA 2COLA 3B4MA 2E9RX 2J4IA 3KHGA 1ZBKA 2GAHC 1LQ0A 7FDRA 2ZC4A 5DK1A 4W5UA 4YLUA 4QT3A 2XMMA 3UNRA 4RW4B 2VFUA 2FLBH 4X64J 2FC8A 3AD9C 1FKOB 2CJBA 2ZGBH 1SGFG 1NJIT 2UWLA 1EX3A 4DRIA 1LMWB 1ARBA 3I9V9 3GLJA 7ESTE 1V2NT 5AT1B 2IMOA 1BDAA 4WE1A 3CEDA 4NCBA 4ZXXH 3A81A 2OI2A 2DR9A 3FEYB 1A5GH 1SB6A 4RNFA 2PI6A 1KWMA 2ZHOA 5IV4A 2W7UA 3R3GB 1S6QB 3BGOP 3QLHB 4IRDA 3BKTA 4LUBA 2B7CB 2W3KA 2RF2B 1L3VA 1A0LA 1YITS 3PV4A 5KG6A 2IM1A 1RXOB 2BLVA 4F4WA 2DGUA 4B9VA 3G86A 2GV7A 3LWLA 1UVIA 1OYDA 3IAS9 3JZ2B 2YWGA 4DPXA 4YQWA 1SKWA 1Y0HA 1G4CA 1CLFA 1H9HE 3FN8A 4C0OC 4U01A 2XYPB 3Q8YA 2K8GA 3SO3A 4W4MA 2VKRA 2SFAA 2M70A 2ROEA 3I5CA 1C1BA 3MAQA 1Y4ZB 3T2NA 4U8YA 5IS2A 5T3HA 2K1QA 2EPIA 1TVRB 3M8RA 2J7UA 1K2I1 1C4V2 2ZD1B 4DR4J 1ESBA 2ZGJA 3LDXH 4D8NA 2OQUA 1BRAA 1C2KA 3MEKA 2FOMB 4UOCA 2E44A 4O03A 3FANA 2XOKD 1OP2A 5HYOA 4NCYA 3EDXB 4UW2A 2RUSA 1JJCB 2CNNB 3SQGA 5GADI 4PYDA 3MM7A 3VEQB 2VB0A 2UVUA 2DNZA 1NBEB 4OI0A 1WACA 2HW3A 1LL7A 2OC1A 3Q3KA 2D41A 2CF9H 1Q8LA 4RUAA 4IOCQ 5AXNA 3TZWA 3O8WA 4FKXA 1Q8KA 1L4ZA 3VQSA 3VFEA 5L1KA 2TGDA 2XMWA 1PC4A 2DNNA 1AVGH 5JBAS 2LP4A 2CJAA 2QA1A 1IX5A 1R8CA 1OOKB 1SCJB 2B56A 2J7KA 4EZ6A 2RG3A 1LWFA 4LFAF 4TWYA 4Y79A 2G0CA 2WZQA 4I56A 3QZ8A 1C5LH 3DU6A 4OJ1A 3BTWE 1JNTA 2ASUB 1P2KA 1E44A 2JRSA 4LSZB 2ABYA 4CT9A 3QATA 2XS7A 1FNMA 1TQ7B 1T9UA 3LPRA 1A9NB 4KO0A 1UVMA 1RWOB 1S9EA 4ZHLU 1H0GA 3FBEA 1LVBA 3M2VA 1RTFB 3KDOA 2DNLA 1KDQB 3RXIA 2JNJA 3CIMA 5J2NA 1UW4A 1JLBA 3F2GA 3NTPA 4XBCA 4Q2LA 2E29A 1EJ7L 3DLHA 1X5PA 4E06H 1F1BB 1O3EA 4HACB 3ATIA 1RBOB 2B3TB 1NC6A 2W4PA 3B9EA 3BG4C 2P8IA 5D4PA 1AKSA 4ZP6A 4A8WA 3ATMA 1V3RA 4FS1A 1B0TA 2DTJA 1U6QA 1QL7A 5FXLA 1Q78A 5FCRA 1O2HA 1W2IA 4ABDA 3MNCA 1FFGB 2QV6A 5LPRA 4TSFD 4FUJA 2I38A 2BE2A 4WYWA 1OIAA 1R7IA 1UEVA 3QFWA 2X7IA 1S9GB 4WF8A 2P8OB 1U0SA 3U1MA 1YP9A 5EGMA 3UQIA 1C1OA 1UZDA 3ATKA 3MWIU 4V19X 3A8IA 2GCFA 2GVDB 3C2PA 2FZZA 2WSSD 2PV1A 3WX4A 2C8YB 2VQFF 2OTLS 1O2WA 3MU5A 1HGTH 3HK6B 2CZ9A 5AF9H 2BW7A 1U48A 2ZE2B 3A80A 1SXLA 1VK8A 4Z2JA 3UNGC 3KL6A 1HNVB 1YWXA 3TGJE 1F0XA 3SHAH 1IBKF 2QYGA 2HYIB 2CFXA 2MHEA 3SV8A 1D09B 1X5SA 4BXWA 4DPYA 4JV0A 3RLYH 5KG3A 1EKRA 2BRKA 4CH1A 3V4IB 2J0WA 3LONA 2HNZA 1RT6B 4FF3A 1YJWS 3M8WA 1DS2E 5ETOA 2ZGCA 4MIAA 1VQSA 5E2PA 4VGCB 2FVPA 1UMJA 4OYXA 4FUHA 1VQOS 1CA8B 4DV2F 3S9AA 3R7BB 1Y5UT 3CJKA 4FZVA 4K0KF 3THPA 3TOQA 1LW0A 4X62J 4ZVOB 2PKAB 1SQEA 4OHZA 1AWFH 2PP6A 3DCAA 1GHVH 5JJBA 3SUEA 2V8VA 1ETSH 4MKYA 4JV5J 2W6JD 3KLGA 5T7LB 3MR2A 2MSTA 3HP6A 3IKDA 4WXOA 2BDCA 4X4SA 3KZ7A 1RT7A 3BIVH 2DGOA 4X66F 4NA9H 2FEQH 2KCYA 1Z8IB 2E5GA 3VGCC 1HKIA 3RZAA 1C5MD 3P8OA 3EYZA 4U7UK 2BY8X 5GAHU 3O5TB 1VBZA 3D23A 5DLFA 2A3EA 1UR8A 1JNRB 1PJ5A 1FO1A 2EVZA 5G0RA 4MNJA 4CO1A 3OL6A 2TBSA 5J1NA 4GVUA 2HNDB 4I1TA 4FXWA 2J0SD 2HALA 4DRKA 4UFDH 2ZCHP 3CC2S 1RT2B 2F91A 3FUYA 2APOA 5CD4H 3A7VA 3E8LA 2Y6TA 3CNRA 1T9YA 3N7DA 1H98A 5ADZA 2UUCJ 4IBLH 1TABE 1CT2E 2AEIH 1ZM9A 1DFPA 2ZKSA 1QB6A 2UXDJ 5F8TA 2A0QB 2NU2E 4HGCA 4USHA 5F0WA 2DHGA 1SLXB 1DUEA 2DO4A 1P57B 5HVGA 2KB2A 2FIRH 3MFHA 1K1JA 2OEJA 2RT3A 2KYXA 2MSSA 4AE5A 2IOTA 1NK7A 2LXIA 2QA2A 1SVDA 3GG0A 3DRSB 3ZTSA 2JLGA 1NB2A 1GMDG 3QT6A 4IKAA 4PWWA 2XPBA 2G55A 1HXVA 2OLGA 1FESA 3IGVA 3SU5A 4ZPBA 4F0MA 5A8RA 2V63A 1W0YH 6ESTA 4Q0BA 3KJQB 2FOCA 5EPYA 1BKFA 2QCYA 3MXHP 2YKNB 1UTLM 5CHAC 1S72S 3GCTG 1ZRBA 4KJIA 3J80U 1OPIA 3U1JB 4MMOA 2RRAA 5EPNA 1TNHA 4AGKA 1FTCA 4CR9A 2H54B 1GMUA 3R5GA 4MTVA 5HAOA 3I77A 3HGNA 1TUVA 4IN2A 5AXMA 2H2ZA 2KFNA 2IPQX 2PEBA 3POTA 5A8KA 3GCHC 1ZSKA 1WHWA 1RGVA 4B73A 3H2VE 4DR6F 2D3OR 1W1VA 1O2QA 5KFSA 2O5DA 1PPHE 4LAYA 4YOJA 4EFAC 1RAGB 3RAXA 1KLJH 4ISNA 3KN2A 2Z57B 1SBWA 2QX0A 2C4FH 3SV9A 2R8IA 4Z2IA 1FKSA 2JEGA 2YNAA 5D3GB 1IQGA 2XSJA 2CQ0A 4F50A 4URGA 1WORA 1QPFA 2MZQA 2XLJA 3A7YA 3PWCA 4TT3D 1DY3A 1QB9A 1KQSR 1N34J 1BTWA 3D3BJ 4DV7J 2V5HG 4PRFA 1NFWA 2CPDA 5CYJA 2WOMA 2OLHA 1S6OA 4M5DB 2W7PA 4Y8YA 3PM3A 1FKIA 3H5YA 1V6DA 3V12A 2R7RA 4P7TA 2V0NA 4CRAA 2MKSA 1YRTA 1UWBB 1O34A 1K28D 3BV8A 4I7YH 1LVMA 4WU3A 3VG8A 2FVSA 1H7XA 1WOFA 4LBHA 2IYGA 4EO6A 2ZHFH 1HMVB 4DUTA 4AD6A 3RXFA 4MIWA 1JRTA 4NFFA 3LP2B 2DRAA 5KG1A 2QYIA 4LGXA 4XBDA 2DISA 3I0RB 1ZBTA 3OXFA 3PO1B 4TU7A 5KFXA 1RWWB 1C9TA 4I0WA 5KFRA 3MAHA 2E5HA 1F8AB 3MEGB 4HDHA 4ZVHA 1C1WH 3CCZA 2DIUA 2HVYB 1V3XA 1EZSC 4FNIA 2A32A 4DURA 1W1PA 4DV6J 3Q24A 2A4QA 1NK6A 3A8CA 2AD9A 2Z2LA 3G8QA 1FY8E 1RAFB 2G81E 4JFIA 4CRGA 1T95A 1NBMD 2LKNA 3OL8A 2MJNA 2DNKA 2ZBQA 2VIHA 1XMQJ 2I2YA 5LSRA 4HVZA 5F41A 1UPMB 1GAOA 3SV6A 3TRGA 4AGJA 4H54A 5LXRA 2HLDD 4U8VA 3R0FA 3FDSA 1WBGB 4OYIA 5KAKA 1KXCA 4CYUB 4AL7A 2WCXA 1YYY1 3EZUA 1S6PB 4UONA 4WJXA 1QTNB 1HJXA 5CHBA 2ZJPQ 1BTUA 1LXJA 1C9PA 2FMJA 2DT1A 1F5RA 2QZ8A 2A3CA 1RYRA 3N79A 2DITA 4RNHA 4C9DA 1SKYE 2Y7ZA 1IHTH 5HW6A 4NL5A 4L3KA 2BJEA 3I6CA 2YKQA 4PG6A 5DP5A 2IJOB 5GAEU 2HQDA 1RTZA 1IKVA 3UDVA 2QMUB 1O38A 1HBOB 2VFRA 1T03A 4JI4F 3O5OA 4ACBA 3AAUA 2CQ2A 1GMCF 4HH1A 4NMLA 3H0PA 4U7UD 4MNXA 1EJAA 2VBYA 1QD1A 5GPGA 4IFVB 1M90T 4BAKB 3CD5A 5HXFA 2BY9X 1TCOC 4DR1J 4DR2F 4GAWA 3P8BB 2VG7A 4P2FA 1O5AB 4G1QA 2Q5AA 4TW6A 3BF4A 3PNIA 2W6ID 3E2EA 3C27B 1O5GH 1HCGA 3TC5A 1S7IA 1NDLA 3IWXA 4EUVA 3PEJA 3MEEB 4CRBA 3ISND 3DRRA 2W3IA 2XC4A 1E6PA 5F8MA 5DQGA 3KLEA 1WEYA 4M8LA 4TLRA 2HLUA 4WWYA 3ITHA 1UEKA 3MM8B 4OX9J 3W61A 3D49H 2ZEBA 2WONA 2MYFA 2XG8A 1FV9A 4CT8A 1UVPA 3W95A 4HHHA 3THVA 1C1SA 2XO7A 4P74A 1OSCA 1ZJKA 1SR0A 2LU1A 1YJ7A 5KT5A 4P2XA 3PRVA 3ILLA 4ED1A 1QDUB