3PRDA

Structural analysis of protein folding by the methanococcus jannaschii chaperone fkbp26
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
223
structure length
223
Chain Sequence
MVEKGKMVKISYDGYVDGKLFDTTNEELAKKEGIYNPAMIYGPVAIFAGEGQVLPGLDEAILEMDVGEEREVVLPPEKAFGKRDPSKIKLIPLSEFTKRGIKPIKGLTITIDGIPGKIVSINSGRVLVDFNHELAGKEVKYRIKIEEVVDDKKNIVKEIVKMYVPRLSDVKVTIRNGTVKIELPEFAPFIPNIQTAKMAIANEILKRLEDAEKVSFVETFERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone, isomerase
molecule keywords FKBP-type peptidyl-prolyl cis-trans isomerase
publication title Structural Analysis of Protein Folding by the Long-Chain Archaeal Chaperone FKBP26.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 36
structure length 223
sequence length 223
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18046 FKBP26_C FKBP26_C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.330 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3prdA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3prdA01
3.30.70.2210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3prdA03
4DRJA 5DITA 1FD9A 4IQCA 3NTPA 1YW5A 3KACA 4DRHA 5B8IC 1D7JA 2LGOA 3O5QA 2D9FA 5HKGA 4IQ2A 1F8AB 3UQBA 4U84A 4W9QA 1FKIA 2PPOA 4BF8A 2LJ4A 4W9PA 1W26A 2LPVA 2ZQTA 4R0XA 2XPBA 2OFNA 2Q5AA 2PBCA 4LAWA 1ZK6A 4GGQA 3KZ7A 1Q6HA 3O5MA 4JYSA 3KAFA 4MGVA 1FKKA 3PRBA 2XP6A 3LUOA 4G2PA 4NNRA 3TCZA 3UF8A 4DRNA 2M2AA 4QIBA 3WH0A 4ODKA 5J6EA 2ZQVA 3TC5A 1JNSA 3ODKA 4DRIA 1Q6IA 2F21A 2K8IA 4JFIA 2UZ5A 2XP7A 4ODNA 1KT1A 2RURA 3MDYB 4JFMA 5HWBA 1Y0OA 3KAGA 3O5EA 3KCEA 3O5KA 3O5JA 3OOBA 4W9OA 4DT4A 4ODMA 5HTGA 3H9RB 4DZ3A 4DRQA 3RFWA 1NMWA 4TW6A 1NMVA 1Q1CA 2PV1A 3UI6A 2KO7A 3I6CA 4LAVA 4DRKA 5GPGA 2PV3A 4IPXA 1QPLA 2Y78A 1FKRA 1U79A 2MLXA 1PBKA 4TW8A 1FKGA 2ZR4A 3IK8A 4U85A 3NI6A 2PPNA 2LKNA 4ITZA 5HUAA 2VCDA 1L1PA 4J4OA 2ZR6A 2KGJA 2DG9A 4U86A 4C02B 2MLYA 3JXVA 4G50A 4LAXA 4O2TA 3KAIA 5HWCA 2FAPA 1A7XA 1D7HA 3FAPA 2MF9A 2PPPA 4JFLA 2F2DA 2MNTA 2MPHA 2ZQSA 1QPFA 1J4IA 3O5OA 5HW8A 1ROUA 1R9HA 2RUDA 1M5YA 3O5DA 5HW7A 2JZVA 3KAHA 4MSPA 4DROA 3B7XA 3CGMA 4TYOA 1JNTA 1T11A 2XP4A 4ODLA 4DZ2A 3PRDA 5DIUA 4FAPA 3O5IA 2KFWA 2ITKA 1JVWA 3KABA 3PA7A 4LAYA 1BL4A 1P5QA 4JFJA 2ZQUA 3UI5A 4ODQA 3IHZA 1TCOC 1FAPA 3JYJA 2M1IA 4TW7A 1HXVA 1FKDA 2N87A 4ODPA 1EQ3A 4TNSA 2M08A 1F40A 3GPKA 2AWGA 2MLZA 2F4EA 1FKFA 2DG4A 3NRKA 4DRPA 5HT1A 2RUQA 1FKBA 2KI3A 1B6CA 1C9HA 3JYMA 3O5GA 4J4NA 4N19A 1NSGA 2RQSA 3KADA 1D7IA 3IKDA 1YATA 1FKLA 4QT2A 5HW6A 1J6YA 2XPAA 4FN2A 5DIVA 3UI4A 1ROTA 2XP9A 3EY6A 1J4RA 1ZCNA 2XP8A 2FKEA 3O5FA 1FKJA 1N1AA 4DRMA 2KE0A 1FKSA 2PV2A 1PINA 2IF4A 2ZR5A 4QT3A 4JFKA 4DIPA 1FJDA 5I98A 1KT0A 2DG3A 5BXJA 1Q6UA 3O5LA 2VN1A 3O5PA 4TX0A 1D6OA 1J4HA 2RSEA 4ODOA 3UQAA 3VAWA 4GIVA 3IKGA 4DH0A 1EYMA 2RUCA 2KR7A 3UQIA 1FKHA 2XP5A 3CGNA 1BKFA 2XP3A 4ODRA 3O5RA 5D75A 2L2SA 3TDBA 3RGCA 1FKTA 1QZ2A
chains in the Genus database with same CATH superfamily
3D5MA 3WBZA 2FPZA 1O35A 4UY8T 1FE0A 1QQ4A 3MPUB 4QBUA 2BOPA 4ZVSB 3IRWP 1K0HA 1IX5A 3SFGA 1FI8A 3M32A 4A8YA 3I5AA 3LIWA 3D0GE 1RHQB 4THNH 4GO5X 4AYYB 4FUHA 4QYRA 4USKA 4YP3A 9ATCB 4JOUA 3B9DA 4DJZB 2RB7A 2C8ZB 4CHAB 3DRSA 2VIPA 4R5EA 1KDQA 5CMXH 3R5CA 2DXEA 4MLFB 1DUEA 1HWIA 2F7VA 2A6MA 1TZ0A 5KFYA 1SGDE 1FIZA 1FEEA 4JI0J 2VB0A 2DGQA 2E5IA 1V6HA 1CT2E 1SUQB 3LKWA 2DNOA 2FZKB 1GI6A 1P1LA 3W66A 3LOUA 3BO3A 3QLHA 3ARWA 5IC6B 2HWLB 1EAXA 2DGWA 1UVTH 3BTGE 3H42A 2BM2A 2QFIA 2UUCJ 3TLOA 3EGZA 2ANMH 2V63A 1TGTA 5F3ZA 4CLFA 1W9VA 2JHEA 3SQHE 3R27A 2FGOA 5J2MA 3SCLE 1B70B 4A7IB 3NGUA 4KJIA 5IDKA 4AN7A 1BL4A 1Q86T 4DL6A 1U1LA 2C2NA 4USHA 2VVCA 1J15A 4Q43A 2VF3A 5BYQA 3SCJE 3TUJC 5KFIA 5EUHA 3RAMA 2NUHA 3LJJA 3BTME 2R3YA 3KCGH 3T26A 2VQFJ 1F5AA 1BTPA 4FN2A 3AOBA 3Q24A 3SHCH 4LIWA 2EI5A 3TVKA 4J9NA 1SSXA 3GDVA 3ILJA 2BX3A 1R0BG 3CWJA 3U1LA 3RM0H 4DN9A 2IAJA 1L3TA 2HHSA 1FRIA 4ASUD 2AV5A 3GYMA 3OTBA 3A7TA 4XPCA 1IBKF 3H25A 5JB8S 3JQKA 3SBKA 3MPYA 1RACB 2Y1IA 1NK7A 1SC1B 3Q22A 4JCNA 2MY8A 2DE8A 4FYWB 1KTQA 1RWWB 2QCYA 1MKWK 2XLKA 3HKIB 4FNHA 3G01A 2OQ5A 1SLWB 4WKAA 4UONA 3MHYA 3A89A 3PFEA 1NDPA 3VVTA 1NWRA 5CA5A 2QF5A 3KL6A 1KTTB 4ACBA 1O2QA 2ZQVA 4DSKA 1E36B 1AE5A 1AE8H 1K22H 1O3IA 4JFMA 1D1UA 1NZQH 3DYAB 2OBQA 3CCMS 2ZGHA 4IFVB 2BTCE 3LWLA 1F5CA 2BV3A 3BBBA 4DRKA 5HGGA 2XSJA 4NWKA 4FUBA 1ZM4A 2LKNA 2XBYA 3MDFA 5BYRA 3DT0H 2Q43A 3AOAA 1UETA 1IBLF 3DMJA 3GJTB 1C1CA 2ZQSA 2RQ4A 1BQNA 1NEEA 4ZPDA 2R8JA 3AT1B 3F0PA 2A18A 1HHSA 3LP2B 2V4RA 2HNZB 4ALZA 1I6JA 3ZTSA 3THVA 4K2YA 1HKAA 3S01A 4S0MA 3AFGA 5F8JA 3OTOJ 3KF2A 4Q80A 2DR5A 3D65E 1O3BA 2Z3DA 3O5GA 1SJQA 1IKVB 3P95A 1WC1A 1THSH 3ZZ7A 2M4MA 1IVZA 1UA1A 3ODDA 1FKJA 1YWXA 2JRSA 5LMNF 1NZAA 1V2NT 2QC3A 1CT0E 3FANA 1X4EA 1CC7A 2JLEA 2V2VA 2A3CA 5M2PA 1LG1A 3KLFA 1FKOA 5D75A 3AW1A 4J37A 2ABYA 2OD3B 1QRXA 3HFVA 1D7JA 2O92A 2PO4A 3GFHA 3P5TL 2VD3A 4C8KA 1LHDH 2OELA 4ID8A 1T8LA 1N32J 2D3OR 2EK6A 5HK4A 3DLEB 5D4PA 2HBYB 2D9PA 1BHXF 2VIVA 3A7WA 5U47A 4ISHH 2BZ2A 2G2OA 3O5MA 2CWKA 4YB7A 2ALZA 3E0NB 2RHSB 2RDDA 1QSLA 1O2LA 1V9OA 4OGXA 2E1MC 4L72B 2HHPA 2XP7A 4MNJA 2G00A 3LW5C 1CBWB 5DDRC 4X1SU 4D7FA 3QZ7A 1Z8JB 3F56A 4F0KA 1WOSA 4FF2A 1MD7A 4Q2KA 1YRXA 2AIPA 3AAVA 3MH5A 1T8EA 4Y76A 4C0OC 3FSXA 2IJNA 5HUAA 1ORFA 5I4MA 3KQ5A 1DM4B 3D6TB 5KFEA 4DSIA 4FOUC 3TEGA 1KLJH 3B9EA 4B3RJ 1WC5A 1P8GA 2VIWA 1TOCB 4DROA 3ZZ3A 5GMDA 3M32B 1WQVH 1MKWH 3FO8D 1GAOA 4R8TB 4WWYA 1KTVA 4WFYA 2BLOA 1T03A 2QYIA 2XMTA 1FKDA 1S6QA 3T9NA 3DRSB 1MWZA 1GJDB 1DUAA 1SC4B 2G9OA 1X4CA 4ZKAA 2X7IA 4FDFA 1O3DA 4TSFD 4TU9A 1H3DA 4NLPA 3CCLS 3M9NB 1MAXA 3QLHB 4ZXYH 2E7WA 5CYMB 2UUYA 2L2SA 1GMHG 3BKTA 3UI3A 3BSAA 3JSRA 3KACA 1X4HA 3FSIA 2D3O1 3JZ2B 5F8HA 4U6PA 2QIFA 1Y0HA 2E1PA 4ED7A 4X1NU 2V8GA 3BN7A 1ZTTA 3OXGA 1FY4A 1VQ4S 2F83A 1O39A 5J2MB 1JXVA 2I38A 4EO6A 5EWGA 3LGYA 2RQKA 1J5OA 4AE5A 1VRTB 1LV5A 5J1NA 2H5JB 1BIOA 4DL3A 5AFYH 2BDCA 5C5NA 1RIWB 4B3SF 4DX6A 3BGRB 5E0JA 2FUG9 2B5JB 2I8EA 2OMLA 4Q7ZA 5I25A 2WAQD 2FDMA 1S79A 4TY7A 1Y0OA 2QF8A 4TY9A 1KQFB 4JI1F 4WKFA 2CFXA 4C8NA 4GKJJ 4NCBA 3WY8A 1DANH 2KVQE 3SUEA 5LSOA 1FDNA 4VGCB 3T6BA 2UVUA 1NZ8A 2HPPH 2JH5D 2DG9A 2JLFA 4G50A 3NWRA 3FCWA 2DPIA 2HBZB 5GCHF 1VFJA 3UO0A 1OWDA 4DHVA 2QY0B 4LBHA 4EO8A 1Q3XA 3PMAB 1UPPA 2NUUG 1SXLA 4N41A 4K59A 1JWTA 4DV2F 4DV3J 1E6RA 1RABB 4JFJA 4C2MA 3FZ2A 2TIOA 5DGAA 2LECA 4O3UA 3G71S 4CIOA 2HS4A 1S85A 1BJUA 2X3DA 4CDIA 3I56S 2KRBA 2AIQA 1RWMB 2RAQA 3OQ2A 1D9AA 1ZPWX 2OPPA 3WX4A 4ILLA 1KFDA 5C0TA 2GV6A 3VV2B 2VFRA 2XWYA 1PINA 3PW4A 5AE1A 3R8YA 2R8GA 2XSJB 1TRNA 1X4BA 4E7RG 1ZTKA 4ZHLU 1N0VC 2WSCC 3D9BA 3MUTP 2VA3A 4ODRA 2M0GB 3M8RA 1FRXA 1ZOTA 3EM1A 3U8OH 3DSOA 1EIYB 2F43B 2FTMA 1BQNB 2FI5E 1HPGA 1NY22 3IBCB 4F0HA 3D62A 1RA7A 1GTEA 1TMBH 3NS5A 3M05A 3B23B 4URQU 1LPZB 3PRBA 3LUOA 2PKSB 5HIZA 1O2NA 2ZJRQ 1M1GA 1GFWB 1JNZB 1D2KA 1RGQA 4X1RU 3IN5A 4LBIA 2W4CA 1W2BR 1WCZA 1EX3A 4P73A 1QY6A 2YMSC 4YOEA 3Q8RB 3R5DA 3PWBA 3U1JB 3GWCA 1VGYA 5DG6A 3HP6A 2P94A 1GDUA 2MQLA 1NDCA 1FKOB 3DGVA 2Z7FE 4WJXA 3E8LA 2R2SA 2ZKUA 1F5BA 1AUSL 1A7XA 1OIAA 1X6NA 2KB2A 3DDKA 1TA6A 2GKVE 3GJSB 5B7WA 2V6AA 2ZBPA 3MM5A 1Y3JA 5CHAB 3VXEH 2AIRB 2FI4E 1P9YA 4NIWA 5L1IA 1N34F 3NWUA 3ZVBA 1HCGA 4Y6DA 3GCHC 4ETZA 3SV2H 2V3OH 1KLMA 4ED4A 4OX9J 3H4DA 1ZCNA 5LJ3Y 1QJ7B 3S9AA 4G1PA 1IQKA 4CLTA 3J7YU 2GZ8A 5I98A 1W0YH 2XO6A 2KG1A 4J9LA 3PIOQ 1JNDA 2H2ZA 1LO6A 3EGKH 2CZ4A 3BTFE 4IT6A 4CWBA 1WAWA 2VIQA 1T7PA 3PEHA 1UEUA 3SI3H 3ZVEA 3QSIA 4WE1A 1NRSH 2PP6A 3PFOA 1UVIA 3GYGA 1BGXT 4A92A 3HFZB 2ZM6J 3E6PH 4CRBA 2ODPA 1O2RA 4LF7J 2FO9A 4WH6A 2GIRA 4ZITA 3SI8A 1T03B 3HKJB 1DS2E 4NCAA 2AGOA 5FAHA 2J7UA 2KZZA 1S0VA 1NWSA 1Q6IA 4BXSA 5GXPA 5B6LA 1KT1A 1VCQA 5JBTA 5D0GA 1CVWH 4URIA 3BTWE 1X0FA 3M5MA 3HHLD 2WHOA 5FIIA 4RUAA 4IRKA 3E91A 4IC5A 3RU0A 1JJ4A 1KSPA 5C67A 1UTOA 2P3UB 4QWEA 1VBYA 1LWEA 5KG6A 3A4TA 2ZWOA 4NLOA 2FVRA 2AH4X 3UR9A 1J5OB 1KOHA 4WKYA 2PSXA 2EWHA 3BTKE 1XMQJ 3CJRA 3LO3A 1TX6A 1XVMA 5DQHA 1YPGH 2DJWA 4DF4A 1HJWA 5T14A 2Z8QA 1G30B 5K8PA 1DWCH 1H9LB 2W5EA 4QZVB 2QXHA 1K73T 2DXDA 1ZYQA 3RRGA 5DGJA 1VS3A 2FJAB 4ED8A 1ANBA 2GGPA 1VQYA 1VQOS 1F2HA 1O2HA 1C5SA 1W0ZU 4X2VA 3M6XA 1UTAA 3UIRA 1YJ9S 2N3LA 2I2YA 4D8NA 1DTQA 5KFJA 1RKJA 2Y7XA 3T9ZA 5A0AE 5HQ8A 1X5SA 2WPLS 2QN5T 4OHYA 2JC0A 2DSZA 1E37B 2VIHA 1HAZB 1URRA 1OWQA 3ATWA 3WH0A 1RCOB 2YQ1A 4QIEA 4BAOB 2C2RA 4GKKJ 1OPZA 1JRTA 1TGBA 4WYWA 3M9MB 2HOBA 2IPQX 4B6FA 4BS2A 3EJMA 4Z1MD 1ZPZA 4K50A 4NCGA 2IBOA 5LL6d 1OKXA 3EZOA 2MLXA 2L3MA 2RE1A 2FYRA 4FUDA 5EGMA 3BIVH 4E05H 4MTPA 4NZQA 1YKWA 2VCDA 3PACA 9LPRA 4M5DA 1TV6B 3AXKA 1AZZA 3ZZAA 5J1PA 3UREA 5JMNA 4I1TA 4I8HA 3ZZ0A 2BE2A 3SYZA 3ESTA 1N54B 1U8SA 4ABEA 1MMDA 4URGA 4QWCA 2QL9B 2BDHA 1YF4A 4O3PA 3UI5A 2HVIA 2JL9A 2ZF0H 4A4JA 2NXCA 4MG3A 3DOKA 5EX0A 2RF2B 1C9HA 3UVJB 4CRJA 1ELTA 4XDEA 1YI2S 1WDIA 5HW6A 5DPAA 1NS3A 4DCOB 1JJHA 1QTNB 3MH4A 1ZETA 1JRSA 2DCUB 3DLJA 3KNGA 3U27A 1S6PB 4I86A 1EOJA 1IQLA 3WIVA 1SPBP 3CGNA 3K5LA 1TRYA 3F6UH 2AJFE 4ZKRU 2IYIA 1C4U2 2VBXA 3MM5B 1HMVB 1QL8A 3MNBA 3W94A 5AXNA 3W65A 1VQ6S 1NO8A 4RL1A 1G1XA 1DWBH 1YLNA 3MM8A 3N5FA 3SDEA 5H9FJ 1GBMA 1WORA 5FPTA 1KLMB 5EPYA 1EKBB 3H5YA 4DWIA 4RW9A 2HHXA 3G86A 1ZZNA 5E41A 4LK4A 1ESAA 3FC9A 1FVQA 2RQMA 2ZZNA 4ZHMU 2B9YA 3ITIA 4JB8B 1B99A 1O3JA 2YKMA 3QLPH 4P8UA 1BXNA 2BDBA 4MPXA 3DCAA 1C5WB 2YKPA 2ROGA 3PM3A 1KLNA 1WUUA 1LEOA 3QQCD 4QPXA 1OXGA 3P70B 4QR0A 9RUBA 4WE1B 3TJNA 1UWBA 3FXYA 5A8RA 2GMHA 3WL1A 1SGTA 2BX4A 3RGIA 2ITKA 1EASA 3RU4T 3KFWX 2J94A 4TNSA 4IG3A 2GQCA 4O44A 1GCTB 2KI3A 4BC9A 2HGNA 1F2GA 5F8MA 4NXMF 3O8RA 3CHCA 4LFAJ 4ZH8A 1BMAA 3D6FB 1VC0A 1ROTA 1RT7A 5ETLA 3RXVA 1K1QA 2R8IA 3GFZA 1WAYB 1ELGA 2VH0A 1GJAB 5J4SA 3EZ5A 2DRBA 1F5LA 2ZC9H 1P8VC 2CPXA 1HR0J 1DT2A 3GJQB 1T32A 2ZFHA 2I6QA 3SXLA 4N76A 3N01A 1YLDA 3ENAA 1GUVA 1GBDA 2P16A 2QG9B 3TH3H 3L3TA 3TVJB 3BQ2A 3V4IA 3P45B 4ECZA 3TNTA 3G6MA 2GT8A 4HHJA 2GCFA 4OI0A 4Y0YE 2GIQA 1VGCB 2XHCA 1HI0P 3D68A 2KKHA 2YPZA 1I3OB 1ZSJA 4OJ1A 3T1YJ 3J81Y 4YEAA 4NFEA 3B9AA 5F0UA 4ODNA 4BHQA 2YQ0A 2UU9F 4TW6A 4MK9A 2P8OB 1RTHB 4CO1A 4B3MF 1N8RT 3BSCA 1SL3A 1DITH 3GB0A 3H4BA 1WSSH 3H2LA 3AS2A 2BVZA 3TZWA 3KUHA 1QAJA 3ITHA 4AC9A 2FAPA 1VQ5S 4Y6IA 4KPYA 2O9QA 3CIZA 2CA9A 2E1AA 5D4NA 2U2FA 1DTQB 5ESBA 4TYBA 4KSEB 5AVDA 4OI4A 2IYGA 2BJ8A 2FIUA 4OS2A 2BW7A 4ZA1A 2HQGA 4LGXA 1Y00A 2A10A 3RAQA 4LF4J 4KGKA 3MCOA 3GISB 3BB5A 3ZNUA 5KFLA 1RUSA 2NCKL 5BR8F 1V2LT 4K1SA 4CH1A 2BM0A 2H54B 4BAHB 4FU7A 1KSNA 1YPHE 2H9ZA 1C1OA 1YIJS 4A1TA 1C5OH 2G2YA 2G5VA 4Y65A 2W7UA 2YWFA 3S6EA 3KWMA 4DQSA 4WXWA 1U1NA 2A5KA 1UR9A 3QTOH 4M5DB 3PX6A 1GI9B 3PX0A 5CHCB 2NPFA 3BTEE 4U8YA 5C42A 3MEEB 1HB0B 5A76A 3OLAA 1HJVA 1SVDA 2BANA 3AB4B 3E01B 1GMCG 3VB6A 4W9QA 3DM2A 3TUZC 3HHKA 2BQWB 4AFSA 1GBHA 3FMWA 4NLVA 2J5AA 4R0XA 3PV2A 2XPBA 1VR6A 1B4SA 1RIWC 5LGOA 3KAFA 1GHWH 4O03A 4NNRA 4HG6A 2IPOB 1S0OA 2AF6A 1YITS 3FP8E 4BCAA 7AT1B 3HVRA 2C2DA 2OLWA 2ZTZA 4NA9H 2RURA 3WKZA 1O5FH 2UUTA 3LPYA 3VAJA 1G37A 4DQPA 1PJPA 4U8VA 3JSMB 3PO5A 3G82A 4K5SA 3RMOH 3C1KA 2UV8A 1N0UA 3L4BC 2B9LA 1NPKA 3SV8A 1VDHA 2XMKA 1O5BB 4UDMA 1GBIA 3K6ZA 1R8BA 3EE3A 1IHTH 1NFUA 4DPTA 4WIWA 4DIIH 4LF9J 2KJVA 1EJNA 1MKXK 2XCAA 2QEXS 3KADA 3MM8B 3GCWP 3SDEB 5JBAS 1JQGA 3MO9A 4B76A 2UXBJ 1S57A 3MNXA 2ZCKP 1VRQC 1MROA 2F4FA 2RDIA 1RADB 1Y5LB 2HQ3A 2XP3A 2CNNB 3BEUA 1LPGB 4X8SH 3AJ1A 1PPEE 1MTNC 1BY9A 3SU6A 4ER8A 1S9GA 4NZ7A 4O3TA 2F91A 1U24A 1THRH 4KH1B 3EVWA 3BSNA 1UWBB 3UNYA 1JX4A 2HRVA 4HBOA 4PQUA 4AYVB 1WHYA 2ZCHP 4PCQA 3KYGA 1DAXA 2XNIA 4IOCQ 3AB2B 2JH3A 2EI8A 4IG3B 1DWDH 3M6WA 1CHOF 2HHHF 2E7VA 4ZCIA 2ULLA 2BMGB 1IM4A 3ZZBA 1CVJA 3NY0A 3R0FA 5HMZA 1UK4A 5KFNA 3M8WA 4TVAB 3HGPA 1CG2A 4J9UE 3KK1B 5CZXA 1FKRA 2MJUA 4U7UK 1H98A 5L2YH 1CJVA 2FB0A 4EK2A 4ZLLA 1M5OC 1GHAG 4KBIA 2J7KA 4C8LA 3O2IA 4NSBA 3FBBA 3B7XA 1OYTH 2P3FH 5JJBA 1Y5BT 1HWUA 2FOCA 1REVA 4O4RA 1FAPA 3NG8A 4TW7A 1HXVA 3CCSS 2KZMA 2H9TH 2IUZA 1RE1B 2AHOB 1F40A 3DN9A 3KHGA 2YVSA 2QA2A 2RS2A 1K1LA 3FDSA 4DPYA 4ZHRB 4FF3A 3T1HJ 4OX8A 1WTGH 1NXIA 4OHWA 2YX1A 4NLYA 1S1WA 1UVLA 2OHDA 3LGVA 5A2QU 2M7SA 3EDQB 1OWIA 2Y1LB 1LHCH 1G3EA 1AFQB 1P0SH 1OO0B 2YNFA 2XP5A 2FOAA 2ZGJA 1OYDA 4JI5F 4P2XA 4HTJA 2WVDA 1F3FA 1F9FA 2E44A 1S76D 1UKUA 1FKIA 3UPEA 3F0OA 1RDRA 1JJ2R 3IG6B 2KDOA 2FOGA 1BMNH 1FXRA 3IR5B 1A5HA 3QAUA 4C8ZA 3IAM9 2OMOA 1MKXH 4QW9A 3DLGB 3ALFA 2OJ3A 1SC3B 4X4VA 1YCPK 3WDOA 2CNKB 4E2FB 2Q79A 3HK6B 3UDEA 3O5JA 4JI6J 3EE0B 4XBDA 3RTVA 3BM7A 2VQEF 5HMYA 1U6FA 2PV1A 4KV8A 2C42A 1W12U 4TPYA 3E16B 2DHAA 3P96A 5L1KA 2ZZMA 3NNCA 2R8KA 1H9IE 1MUEB 2AHME 4NCYA 4DQQA 1N33F 4C02B 1WF1A 3J7YI 3BTTE 5EW2H 2XWAA 4ML4A 4ATNA 1D6RA 1R9HA 2B4UA 1HYSA 2BANB 1B7XB 1KVJA 1BTXA 2PI5A 1T11A 4GC7A 3WC0A 3D6HB 2ZVIA 3LWMA 1GDQA 3R97A 1FDBA 2F9DA 3LPRA 2OFGX 2W2OP 3LF0A 3HX9A 1O2SA 4YT7H 4NL5A 1GHBF 1VJ9U 5FBIA 1UJ5A 3BTDE 3Q00A 3BF4A 4RBVA 2XMAA 3ALGA 2W7SA 2ZDAH 1HJAB 4KGAA 4JFKA 5SGAE 4J9SA 4X8TH 1NPMA 3MM9A 3BS9A 1NJXA 4MAKA 1N5VA 2V8PA 4DURA 4ES2A 4PPDA 4Y11E 5HSPA 1QVFR 2JOQA 4ISNA 3MCNA 4TQSA 1UCYE 2JETC 4WF8A 3QZRA 2R4FA 4W9PA 3PKMA 1O5CB 2K1QA 2QF4A 2ANWA 4F67A 4HH1A 2WBMA 2IVMA 2OO4A 3TITA 1SJ1A 3M8PA 1EUFA 1JBUH 5HMWA 1WBGB 3V4MA 2OC8A 4W98A 3VZIA 2F9UA 4F4XA 3WZ0A 1TKXA 1DSUA 1K1OA 2HNTE 3D54A 2VVVA 4B73A 3BN4A 3IS9A 3JZ1B 4X62J 2G0JA 3P8OA 2GX8A 1RYSA 3JB9k 2FHOB 4FVDA 1MROB 2CIMA 2DNPA 1S6OA 2M88A 1U79A 1AB8A 3GJRB 1YGCH 3CCQS 2R7XA 1IQTA 1NSPA 1YVFA 2OD4A 1Y3WA 2O8MA 4KGZB 3TIUA 5I3PA 3PLPA 4X64J 2VODA 3AD8C 1XK8A 1FHTA 1S9GB 2QC2A 2FZZA 3HSDA 2WVFA 2V9KA 3MM7A 4DV1F 3LPEA 3OE7D 2Q6DA 2UUKB 3TZYA 1GI1A 1SB1H 2GCTC 1JLEB 5HBMA 4PQUB 4W5UA 1GGDC 3KEEA 4ODQA 1CJUA 3FZBA 2CK3D 4ZVQB 2VKZG 4JUZA 5IT0A 2BABA 4ID5A 1YCPH 1GBEA 2C1EB 2PEBA 3HJFA 1ELFA 5E2PA 4QT2A 3LP1A 2ZHQH 3SU4A 3D28A 2VBZA 1RT1A 1T8NA 1FKSA 1YJ7A 3CNQP 1FJDA 4P2SA 4X4SA 2YNHA 4CBOA 1NT1A 1TPSA 1FPCH 1CJVB 2R7VA 1AYEA 3KLHA 1UZHA 1B3TA 1AD8H 4Y8YA 5D4OA 1T05B 1S1XA 4UW2A 1M5VC 3PYGA 3ILOA 1SH3A 4P8WA 5G4BA 4D76A 1TL3B 3PTNA 2W01A 1RK8A 4OHZA 3TA2A 5K8MA 1Q53A 3HKWA 3VCDA 2CV3A 2QMXA 4F3QA 1PC5A 1UEKA 3RJMB 4LFBJ 1EPTA 1SQOA 1VZQH 1FK9A 1SHHB 3OSNA 3FGVA 2MSTA 4I4BA 1REVB 4DWSD 1SIWB 1SFIA 1XUHA 3D1HA 3I78A 3HSJA 3M8QA 3PX4A 3TAPA 1FLEE 4XD7D 2Y3YA 3W64A 2DEIA 3G6YA 5FPYA 1RWKB 2BR0A 2HLDD 1KWMA 1S1WB 4WK9A 1V2VT 4X8UH 5DDOC 2B8OH 2ZH2A 2QX0A 3VGCB 2XY7A 3DHWC 4RWXA 1QIXB 3AVZA 3SNBA 5E5NA 1EKSA 3CNRA 1VIOA 1VCWA 2XBWA 3GY7A 1IR1A 2AJ0A 1OJ4A 4KFBA 1XUIA 2NXUA 1YK9A 1HNIA 2CDQA 3SCKE 1TNLA 2P6SA 3BZQA 3HULA 3GIRA 5F03A 3T62A 2K3KA 1GHYH 4QIGA 1FRMA 2KFWA 3SV4A 3MEDB 1KP6A 5KFSA 1W7WA 2XBVA 3WD2A 3IGVA 1L1JA 4E7NA 2RQSA 2XO7A 3ZZPA 3UWJH 4M5MA 1BTHH 1HNXF 2W9CB 3ENWA 4CREA 3E8OA 2RSQA 4OHVA 1S5ZA 1TPPA 2W26A 2WOMA 4TN2A 5ETMA 3K9XB 2OH2A 1UFWA 1E6VB 4CTAA 2PV9B 2FC9A 3TGKE 4X0WU 1IKYB 5L9XA 2ANYA 2K0QA 1ZHRA 3NOGA 4OIXA 3F2GA 3QSYB 2NREA 4DWSA 5FL7D 3WL0A 1EP5A 4ZVFA 3BO2A 3PR4A 2FDNA 2NQPA 2FZCB 2ZH9A 4TXSA 1FDPA 2JX2A 3LANA 2GHVC 2W7AA 3KQCA 4NX9A 1C1BA 3SGBE 3IBWA 3UE2A 4X4PA 2ZH5A 3LTOA 1BRUP 2B0FA 4MTBA 5HWBA 2VINA 1TPOA 4DUZJ 1RYRA 2P8OC 1FN8A 3KQEA 1TUWA 1SKUB 2N82B 4DVAU 1KXEA 2IIHA 3OV7A 1PILA 3RG6A 1TL5A 6FD1A 3MM9B 1NC6A 1LW2A 4INKA 4RW8B 2QV1A 3EQ0H 3SNCA 1DARA 2J6TA 4MIAA 2LMIA 4RW7B 2RILA 1JLCB 1IN0A 2B56A 2GTBA 3TARA 3MU0A 4JK6A 1U6ZA 2DIVA 1ZGVA 3PCOB 3GILA 4YB5A 1OS5A 2F1FA 2VL1A 3NOCA 2ZH1A 4OGYA 1HBNA 1H4WA 2N87A 1XNRJ 3A81A 2VQFF 5EDWA 1K8AT 3M8PB 4UZBA 1VR1H 1GMUA 4HTCH 2ZOGA 2V0BA 1LKZA 1UVSH 5A6PA 1GXUA 4UY85 1RHUB 2ZFTA 5HQMA 3LP0B 1JLBA 2AX0A 1WD6A 3ATLA 1FT8A 2UZAA 1O3PB 4FF4A 1FWKA 3SCIE 2RA0A 3D7SB 1SHYA 2CJAA 1ZMJA 1ABIH 2P6TA 2ZTYA 2AJ4A 5J2PB 4O0IA 1OS8A 4K5ZA 1VMBA 3MM7B 4TYDA 7FD1A 1CA0B 3G4SS 1NK4A 5HBMB 1FY3A 1QDUB 2KT3A 1VBXA 2VJVA 2AU0A 2MQMA 2PI6A 3A12A 2BRKA 3RAXA 5C1YA 1VI7A 4ID5B 2D1JA 3A8CA 3SNAA 1SGYE 4B9TA 4CRDA 5EU8A 2B3TB 3LP1B 1RT1B 2D26C 1RWXB 2ZNKH 2GHPA 1IQHA 1T95A 4F36A 4CLZA 1UTPA 2YNHB 3SJ9A 2UP1A 1W7GH 5HN0A 1GVLA 4AQYJ 2KGJA 2HSEB 3KLHB 2VWMA 2QE5A 1XRVA 4LBPA 1S1XB 3MFJA 4KE5A 2GCHF 3M2RA 4U30A 2HQFA 3AASA 2DE9A 2BXJA 1FY8E 5K20B 3OTOF 1AIXH 1EPTB 4YN3B 4DR2J 1FK9B 1C1MA 3JYJA 2XTJP 4PG5A 1DXPA 5GAEU 2AYGA 3M8QB 1OWEA 4J4NA 1NSGA 4EBCA 4U32A 5G0RA 2XCFA 4B3TJ 1Q0NA 3VALA 1QZ8A 1Y3UA 1MTSA 4Y7BA 4DDFA 4ABBA 2XULA 3SOSA 2VWOA 4YY3J 3GICB 3SZEA 2Z3CA 1S12A 1J4HA 4I56A 4B3OA 3EZUA 2A3EA 1QBVH 1GJ9B 4Y71A 4HH0A 1XR5A 2RKIB 4I2PA 2XBXA 1QUVA 2W9BA 2FXRA 3ZVAA 1RSCA 1U6QA 4UUXA 2X1GA 1N32F 4ABFA 3HKZD 1OWHA 2DGVA 1V5IB 3ATMA 4RN6A 4ELVA 3UCGA 2VPZB 4NASA 4Q22A 2PFFB 4LF8J 1SLXB 2Z6BD 1RISA 4CNZA 1AU8A 1HNEE 3M6VA 4ZMMA 4Z7CA 1YJUA 2WZQA 1YKTA 1K28D 3KIDU 2IPHA 5ETVA 1ANCA 4DZDA 1YYY1 1GPZA 2H3EB 3HF5A 4OZNA 1VITF 2UUAJ 4CTAB 3Q3KA 2QMWA 4DG1A 1C2IA 1AUDA 3KUEA 1C5NH 4B3RF 1RTIB 1NKBA 3T28A 2ZR6A 1PG5B 3DLLQ 3PZPA 2R2WU 4AXJA 3KUGA 4P52A 3D49H 3NL0A 2J5UA 2HIQA 2HGMA 4ZUHA 3EYDA 3EIPA 2ZU3A 3K57A 1IWGA 3LH1A 4OS7A 4BAKB 2KCAA 2WK2A 1GJ5H 1IWAA 2N3OA 2C4FH 3P6YC 1H8HD 2BJ9A 3ZZ9A 1C1BB 1FXDA 4XBCA 5C17A 5HVFA 4H4MB 1YC0A 2IM2A 4OLPA 4YXWD 2PN6A 4MIBA 1GMWA 2JNJA 2OTJS 3QWPA 1DQ8A 4L3KA 4OLOA 1URNA 1DX5M 2GGVB 1AFQC 5FLXU 2MKYA 1FKPA 3X3UA 1HIYA 3AAWB 2P95A 4E0DA 2CQ0A 2LQ8A 4F4KA 1LW2B 1NU4A 4Z7YA 2R2RA 3HHEA 4OI2A 1WEZA 2C8XB 4UE7H 1M5PC 1PPFE 1ZH5A 4WJBA 1QJ1B 2OBOA 3DOLA 2BBEA 2YKAA 4X65F 1QE1A 4H6SB 4KYZA 2MZTA 4NZ0A 2CAJA 2BB4A 4CT8A 3GIKA 1EZSC 2WUBA 2Y82A 3V7TA 3OPKA 3KK2A 2R0LA 4IH7A 3ZZUA 3SEOA 1WNEA 1PJ6A 1YLCA 3GSDA 3X1LB 4GKJF 2ZDOA 1U1QA 2J0QD 4LSLB 3RB6A 1PQ5A 2HFZA 1LXJA 1M9UA 4AT1B 3M5LA 3U98H 2YWHA 1ELEE 2ZQ1A 2A3JA 3MPWA 4WVPE 2ILYA 2AEFA 1GX6A 4NEZA 3JS9A 1P3CA 2XZTB 1TPAE 2F8MA 4CLLA 3GY4A 4DV3F 1ROUA 5LSLA 3RXLA 4G65A 4C4WA 1PYTA 3QDZB 4X6MA 2JVOA 2BY9X 2SGAA 1H72C 1LWCA 1E6NA 1P5QA 5LH8A 1OY8A 1E6YA 4DV7J 4I64A 4RBUA 1Y5AT 2WK4A 2J6SA 1SOTA 3ARYA 1RJJA 2HS0A 2ZPRA 2F3JA 2HPUA 2F4VJ 1JLAB 3VAIA 4Z2HA 3J7Z5 2QA4G 4MPUA 4JI2J 4J9KA 3CCZA 3SUDA 4IQCA 1TIOA 3LT3A 5T7LA 4DL7A 2YOLA 2QN6B 3EXCX 3M2RB 3D2WA 2PSYA 2ESCA 1MNEA 1MW7A 4Q7YA 3QGIA 2IM1A 1C0TA 1JIRA 3D0IE 1IOEA 2FJWA 1O32A 4C8OA 1K44A 4MNLA 5B0AA 3LAKA 1N6QA 1HARA 4RNFA 5G0RB 2IVFB 4PWDA 2FX4A 5DKMA 5DP5A 3S7KB 2QLXA 4ODMA 2ALYB 2VKRA 2KTQA 1NMWA 3RYLA 3CXCR 3TK5A 3W2VB 4U85A 4B3OB 2PMHA 3UOUA 1WJ9A 2V35A 3F41A 5DS7A 3AH6A 2DNMA 2GO9A 1ZOMA 3FBFA 4I2PB 4MNKA 1YDLA 2LLZA 2F2DA 3TJ8A 2W9BB 5GCHG 2M8HA 2M8DB 4MKAA 2BD5A 3RXIA 4C7QA 3OW2R 1P2IA 4AORA 1JLQA 2ZDKA 2J8SA 4ASHA 1RT4A 3PV5A 2H5CA 1H38A 4FVBA 5ABWA 2M08A 5KFXA 2CJXB 4OX9F 2V3HH 3RB3A 4AFZA 4LF5J 2IDEA 2GJ2A 2XC9A 4GAWA 1CEZA 2CWXA 5B08A 2BOAA 4IQMA 1V2RT 4DR7J 1HKMA 1HHQA 1B0PA 4QT3A 1ESBA 3G2XA 4OV1A 2XLIA 1EZXC 5GMEA 1PBUA 3I9ZA 1E15A 1FRJA 1DE7H 3HXMA 2F8HA 1NPPA 1CS4A 1P9UA 3EE7A 5KG1A 3UR3C 2GZ9A 5ETNA 2ZM6F 5CE1A 1W13U 2HHTA 2QYGA 2J4IA 3OTEA 4LF7F 5MAOA 1Y7PA 3JXOA 1D9FA 2AT1B 4WIQA 1SPJA 4GO7X 4MYTA 2FLRH 2OFNA 1CGIE 1RHRB 5CCMA 4WMEA 6LPRA 1FKKA 1KS2A 3PIPQ 1Z7KA 3SO3A 2ZH4A 5A0CA 5IOLA 3ZZ4A 3QRPA 4FYDA 1RT6B 1DLEA 2BD7A 3OTJE 2ZD1A 1KHWA 3G8SA 2W7PA 3LALA 2BJ7A 3WWBA 2ZHEH 4X8VH 2VH7A 3VGCC 2C3PA 1FKPB 2NR0A 3IAS9 1YGYA 2AMCB 1C9TA 2BKNA 4GUXA 4AL5A 1AXQA 4JV0A 1YJVA 2C3YA 3CTRA 3C14A 5F8NA 3IG1B 3ZXWA 4SGAE 1HBTH 3O5IA 1HAXB 1XMQF 5J2QA 1LK7A 2YNIA 1TKTA 3HZGA 3L9ZA 1AUJA 2FC8A 2B5UB 3MTJA 3KK2B 4ZVOB 1W7XH 5DETA 2N4CA 3BTQE 2G2ZA 1UVNA 4ABIA 2KYZA 2HW3A 4HVZA 4A5TS 2MZRA 1O2ZA 2H9EH 1JLGA 1O33A 5B0BA 5FHTA 3PKYA 2C2EA 1TFXA 2VASA 3K65B 2QO3A 1W8BH 4PROA 4IS5A 1TVRA 1NJWA 2YY3A 4WFXA 1OWXA 2J8AA 5F8LA 1TMMA 1QB1A 3FJ2A 2KHDA 2NU4E 5HKGA 2GT7A 5KG0A 3IWNC 3UWIA 4QU7A 3DSPA 4NOHA 4YDXA 4BOHA 1S81A 8GCHF 1LWCB 5HVHA 2VZ9A 1NTPA 1ZBWA 1QA0A 5GNDA 3M8YA 2SNVA 3RBEA 1ANEA 4Y2CA 3NKKA 3MU8A 1KONA 4B08A 1U8WA 1SL0A 1QQUA 1RXOB 1SJ3P 2FLNA 4B2AA 2CUYA 3ZYEA 4C6AA 3BGOP 3QGNB 1EQ0A 1BBRE 5T6GA 3M2VA 2KG0A 5GPIB 3E2EA 1GBLA 2IC3B 4CNYA 1UVJA 1Q7LB 2GA7A 1JKHB 3GONA 3M8SA 1J17T 1S9FA 1EARA 4OM9A 1EJ7L 4KGXB 1O3OA 2DHHA 2HKEA 3ZVCA 3CO9A 1S77D 1FRLA 2QYCA 3L33A 2CQHA 4Z2IA 2JIZD 4WU3A 2ZFRH 5FX6A 3PB1E 3S7HB 4PG8A 3DUXH 3O3LA 4X4OA 4DRPA 1JNRB 1Y3KA 2ZDVH 3IXQA 4YLUA 3TEHB 2KXHA 1WOFA 5C5OA 4PWDB 3GIIA 3I0SB 2RA3A 2IRXA 3IBFB 5F53A 5IQ6A 3MU5A 5DDPC 2OEKA 3A86A 4X2WA 1TKZA 1X4DA 2BDAA 2Y0BB 4QW8A 2ZWLH 2GV1A 2J6UA 3N0VA 1KFWA 5A8KB 3RXFA 1KXCA 1CA0C 3LDXH 4CH8B 3RR8A 4KELA 3FKBA 3Q2SC 1JJCB 3FZZA 3U8RH 5ETOA 4IFYA 1JLQB 3FVYA 1B0TA 1S9EA 1YBWA 5LPEA 2GJFA 5D15A 1C1NA 4H4KA 2G51A 4ANDA 3R3TA 1P2QA 3CMQA 4A8WA 1EZQA 2PGCA 4JFIA 2JEFA 1EOLA 3TPIZ 2D1CA 2PTNA 1BT7A 1NDKA 5DN6D 2MZQA 4DEZA 2R42A 1GBKA 1A2CH 2VFSA 4PG6A 3K7RA 4WTYA 1V6DA 1O2MA 4XAKA 3O44A 1QURH 3CDAA 2PW8H 4IG0B 1CS4B 4GMKA 1IKXA 1FFRA 3DDNA 4Q8FA 5DZ7A 4HL9A 3VAMA 2WRMA 3UD4P 4CR5A 1ICEB 3MEGA 3UD5A 4BDPA 1EPTC 4OYOA 2ATLA 4BWMA 2YWEA 2ZHOA 3RM9A 4LFAF 2R9PA 1H8IH 1PQAA 1TALA 2W2MP 3HVTA 2KH9A 3QRRA 3MQKC 3VHQA 1X8DA 2ZD1B 1U1OA 2Y6TA 1X5TA 3N7DA 1VQ8S 2V8DA 2PV2A 3EPIA 3N6MA 4ZLPA 4RKOB 2J9NA 1HR0F 5A8ZA 1VLYA 3VAWA 1N56A 1EYMA 1H8DH 3TVZA 1QJHA 1EETB 2YPYA 1U26A 2GVDA 2R3VA 3N5BA 1R7IA 3C14B 4A8KA 3Q3YA 3MPDA 4K4SA 2LJ4A 3DFJA 5DG9A 4MKBA 3T1YF 1K2I1 3BR9A 3SZNA 1TKTB 1WC0A 1HIAA 1MMNA 2STAE 3G6VA 1LWXA 1YRUA 2PEHA 3QO6A 2AWZA 2UVRA 5KFTA 3R9LA 1C4CA 2B7DH 5GAEI 1WTHD 4GC6A 4ZN3A 4IMZA 3URDA 1O8BA 3SI4H 2XYAA 2PPNA 3C8YA 4RNOA 3B4MA 4LMZA 1HBOA 2EEKA 2DT1A 4F8RA 1SI5H 5DJ7A 3UB0A 2JEJA 1BDAA 1NNDA 2QA1A 4CP5A 1TBZH 3EVOA 1TBRH 2MPHA 4DWSC 4ELUA 1RWNB 1U0SA 1BJVA 2HVEA 4LF4F 4RW6A 4HBEA 4OZ5A 1CSJA 1MTVA 2EFGA 3NPSA 3JAMU 1AB9B 5KFCA 2O9OA 1B6CA 2PD1A 4CH0S 4PEOA 4UFGH 4PQAA 1SJFA 2FVQA 3QOKA 1WEXA 3C19A 4ABDA 1VBKA 2DO4A 5KT6A 5J2NB 4JBCA 1LVYA 4RUHA 5B0CA 1GMDF 1MU6B 2ZGXH 3GMGA 3M2VB 5KFZA 2CJBA 4W92B 1RT3A 3TGIE 1R8HA 1E44A 1PFXC 3FZDA 2IM0A 4WY3A 1C5PA 4LFCJ 4B17A 4E8UA 3RXMA 3DOMA 3GPKA 5C94A 2DR7A 3BDEA 1H74A 2DK2A 2J98A 1V3ZA 3VQSA 1O5GH 1HDTH 2FY1A 2GIFA 4HT7A 1Z1ZA 1QB6A 1RWPB 1H0GA 2K3IA 2ESTE 1X7VA 4DR6J 4YS2A 2WPJS 2I5JA 3SBMA 2CQDA 4ZLNA 4MVNA 3H7HB 2V68A 4NG9H 2HVHA 2KHCA 4ZKNU 5I3QA 1LG2A 1ZR0A 3OOBA 3SUGA 1SGEE 2BD4A 1Z1IA 1T31A 3RXTA 4B75A 2HNYA 2FGCA 3NGRA 1VHFA 3HCXA 4Y8XA 1A0OB 2BDGA 1DBDA 2AEMA 5FCKA 1WTFA 1RT2A 3CB4A 1V2QT 2VH6A 5KFUA 1V2TT 1NRKA 3IR6B 2DTJA 4RWWA 1ZBKA 4MYUA 5JXSA 3FAPA 3MR2A 4ZMAH 4XTTA 5LM7E 4IO9Q 2QL5B 5JVHQ 3KQDA 1JMTA 3BBFA 2QSFA 2WPHS 5CYQB 3VEQB 4CLYA 3CJ4A 3TK6A 2EC9H 1S9EB 4ODPA 1ZYOA 5IT9U 3BF6H 9ESTA 2UXCJ 4KKDA 2CXVA 4X6PA 3NGKA 2UXBF 1TTHB 4WIIA 1OMSA 1FVSA 1NRNH 4A8XA 3PW7A 1AKSB 3D0HE 1VCPA 2CG4A 4DY7B 4XSKU 3F9HA 2CHAB 1QTMA 2P9CA 1NJIT 1A7SA 1R6VA 3UQAA 4MPVA 1FFGB 4U9RA 3TAQA 2BJDA 3OY6U 5HANA 3W1EA 1MZAA 5HQLA 4F4ZA 3GCXP 1G9IE 3NXZA 2G0IA 3CGIA 2KT5A 1UJ6A 1YW5A 5F6MA 1IKXB 2FVPA 3O1LA 1AI8H 2F23A 3O5QA 2CQ1A 4YM9A 2OI2A 4OS6A 4DV0J 4OHXA 1MBMA 2IOTA 4C3KA 1CT4E 4XDDA 2FODA 3T3FA 4ZJOA 3FVFB 5IS2A 2BY6X 3T5HA 5IXUA 1Y10A 3BH7B 3DXSX 3NAHA 1FN6A 4NRUA 4U95A 1SKRA 1K9MT 1ITPA 2C2KB 1EP4A 2ZFPH 2MQ8A 4A8SA 1ELCA 4IR9A 1UVUH 4IPXA 4AFUA 3L3CA 3RB4A 2P2CB 2SGDE 3I0RA 3ARQA 3CCES 1EP6A 2BQ3A 4ITZA 2CPIA 1KXFA 4RX6A 2C3UA 3OSPA 2D41A 1DOJA 1IQEA 1IQIA 1S7HA 2G0CA 5KT4A 3KOAA 4F49A 2EFQA 3HSZA 2HFVA 4JP8A 3SU0A 4I31A 1FJ7A 3IRXB 4ZLJA 2M52A 2ZUGA 3AS0A 3PRAA 4E98A 1U4BA 1VHIA 3F9GA 3LGMA 4ETXA 1C1SA 3A7YA 1XR6A 1FPHH 1K1NA 4PZVA 1HIAB 3QNWB 4P6QA 3T1HF 3RXBA 2FS8A 3M7TA 2IHR1 4JMYA 1O2WA 2CJQA 5DZ6A 2QLBB 4NXNJ 1Q2WA 2WCXA 4B9MA 3PR5B 1LFPA 1TNHA 2BE7D 4Q63A 3F2HA 3W1YC 1O30A 2LU2A 2DCLA 2ZC4A 2V5HG 2QIQA 3A1YG 2ZVSA 4WMFA 1AHTH 2DEJA 1IQJA 2MHNA 5F8TA 1IXKA 3LQVA 1MBQA 5B0DA 3BKUA 1TMJA 1D3PB 2QXGA 2BVRH 1C1RA 2DT0A 1WQSA 2ZQTA 2QA4S 4BWJA 4AB9A 1ZK6A 1QJ6B 1XKAC 3UF8A 4PYAA 3JQJA 1R3NA 5M2UA 5JBBS 2MZJA 1M5HA 4UTGA 4JI6F 4J91A 3A87A 1CHOG 1RLCL 1H6KX 4MPKA 1FWLA 2RH3A 3PLBA 1CGJE 3PR9A 3NK8A 1TBQH 1OYEA 1P03A 2EFPA 2JSXA 1HW9A 1ZM9A 5GPGA 1RBLA 3PO1B 3ARUA 3KLEB 1SKYE 3QJPA 5LXYA 3GFXA 4OS1A 3HMJG 1QSSA 4KO0A 3Q2TC 1ETSH 5EXLA 3QGJA 1C0UA 3CH9A 2RU9A 1C2HA 3A13A 1SL1A 3DOMB 3RMEA 2KRRA 2LXUA 3DHXA 2AZ1A 3EX7B 2Y7ZA 3DYAA 5HW7A 2R0KA 2J98B 3PWCA 4K0KJ 2E5LJ 3BIUH 2CKWA 5HP1A 4ODLA 1ZTWA 2SGPE 2B43A 5JVGQ 5C5JA 3PMBB 4RU2A 1DLKB 4HGCA 1RBAA 1XX9A 2E1CA 2G8ZA 2B8QA 3UFAA 1DLOB 3M7VA 4F2RA 1KC8T 1TGCA 2FKEA 2AYMA 2HNZA 2VU5A 3PYFA 1DWEH 1N88A 3PW2A 2MZSA 2CJKA 2HWHA 1WC3A 3UR0A 2XB2D 1S1UB 4K4VA 2FLOA 1RT2B 3J80U 1IKVA 1BRBE 4MFBB 2OAUA 2ZH6A 2B9WA 2DY1A 2VOPA 2B31A 4DU7A 1F8AB 1PYTC 1XJWB 1HV7A 2RRAA 1GVKB 2BXUH 2CZ9A 4X2YA 5IK2D 1J5EJ 4M63A 4OMFG 1GQEA 2MDAA 3TCZA 1R31A 3P4UB 4MQAA 4X62F 4NLSA 3NRBA 3A8BA 3B6BA 1W14U 3FOAA 4LUBA 2DITA 4CZCA 2C3OA 4BLGA 3MXHP 4ES1A 1BB0B 3SV3A 4WJG2 1RT5A 1UVOA 1GHVH 1QRZA 4KY3A 1WXRA 4X64F 3CCWA 3F68H 2V67A 2OPRA 4IC6A 3Q8PB 4DSEA 2D8WA 2ZH7A 2WW4A 1FJEB 1FJGJ 1RTKA 3HFKA 2A3BA 3A8EA 1XUFA 1Z8RA 4K8YA 2LQBA 1PQ7A 2IJD1 3DFLA 3M7QA 3HJVA 3B8SA 3PTWA 4M5GA 2OLGA 2AGQA 5IV4A 4JI7F 3EA8A 4WXIA 4KTUA 3E1XB 3SMZA 4CYUA 5E3QA 1RWUA 3KJQB 3T6JA 1HBMA 4IN2A 3AY0A 1Q8BA 3GY3A 2KXFA 4TKTA 1EP4B 2DNQA 4HLBA 1GHBG 4L6V3 1Q79A 4NYPA 1SOZA 1S6HA 3I0RB 2J9DE 2V69A 3N6NA 4QIFA 4GIVA 4O3NA 4UZCA 3UNQA 2IJOB 1AN1E 3IWLA 2IJRA 1ZBCA 2ATCB 4I32A 4K2XA 5BPEA 1X0PA 1KLIH 4LFBF 1NROH 3K5PA 1SR0A 5DF0A 5LXRA 3OFND 3BGUA 1J6YA 4NLQA 5CYMA 1YRTA 2G5NA 2G4BA 4EU0A 4LVOP 1HAVA 1WU1A 1W2IA 3SSRA 5F8IA 1TX7A 4N56A 4JZDH 1V2MT 2EXUA 4KAIA 1TL1A 5C1XA 3H20A 4M94A 4RI0A 1NMVA 3MFHA 1VRTA 1JXPA 2PUXB 3MM6A 4H42U 1EKRA 5E0OA 1BUIA 4ACAA 4A1VA 3BGRA 2B5JA 3RC5A 2UXDJ 1QL9A 3ZTRA 2A1BA 3CCTA 5D78A 2PPPA 1NJYA 4MIWA 1L5UA 3HPTB 4NA8A 4XO0A 2UV8G 4FYXB 1P11E 1T3OA 3C66A 1TA2A 3CCUS 2XTTB 3K5MA 3SGAE 1TKDA 2V4QA 2AWGA 3O5TB 2BLVA 2D7SA 3WW7A 3TJAA 4Y79A 1YJNS 5KFDA 4MKYA 4CBNA 4ECRA 4XFQA 4Q44A 1ZAVA 2ZFSA 5SZTA 5HXFA 2K1RB 3SN8A 1C4Y2 4H4OB 3KDOA 3QBCA 5A0YB 1D6OA 1N6XA 1AROP 1RTJB 1SKWA 4JI4J 2E9RX 4P72A 2SGQE 4KO0B 2BYAX 1NSKL 1C0UB 2X3GA 2GMTB 3O8DA 3RXUA 1PYOB 5L1JA 5F9LA 1SG8B 2HGLA 5EXMA 2ODYB 5HP1B 4U96A 1K9TA 5EXNA 1A3EH 3AA8A 3BO4A 4K4XA 4FETA 3R6LB 2XOKD 7LPRA 4C8YA 4DV6J 2HLUA 3UN2A 3KHVA 2BMBA 4GVUA 1BHXB 3O5KA 4USTA 2NSBA 4OI6A 4RW4A 3ZZTA 1B0VA 4FKYA 4CLPA 2Y78A 4ZP7A 4ILMA 3IO1A 3P3DA 5AHGH 3LA0A 4OZ0A 3POTB 4C0HA 2HQIA 3P92A 1C4V2 1FFQA 2LQJA 2G1DA 5HJYA 1M5YA 4FKXA 4Y8ZA 2EFNA 3H5SA 4IRCA 2BA9A 3DRPB 1XNRF 4R8UA 1U2FA 4EEYA 2DKOB 4FBUA 5KT2A 3M5NA 3OA5A 1NAQA 4ZVTB 4P71A 3T2NA 1S99A 1YPJH 1NHVA 3NBPB 4QOTA 3GCTF 3A8AA 1LQDB 5C1UA 3A82A 1WYKA 3W62A 1MTWA 3CCRS 4OYWA 4JYVH 3DU5A 4L75A 5F8ZA 3S9CA 1RT5B 2G52A 1UVKA 2B4VA 1A7GE 1CA8B 1SLUB 2BJ3A 4ICLB 4D3HA 1HUTH 3BR8A 5ITHA 2PI4A 4HFPB 3TH2H 3DRRA 1RCXB 1UW4A 3V3MA 1GJCB 4JI3J 2OPRB 2XYHB 3SV7A 5AF9H 1INCA 3I87A 1RD3B 4OZJA 4A6LA 3MECB 4JV5F 1BWEA 1HAHH 2VPYB 4Y0FA 1UCYK 2HNTF 2A31A 1P2OA 4BTUB 1P2JA 4ZPVR 1FCAA 1Q6HA 3W63A 4CYUB 4HT5A 3LONA 3MOJB 3IWXA 1HBMB 3UDVA 4DFPA 1LL7A 5M2RA 1TLDA 2WHXA 1GJ7B 3FQKA 4OJHA 1K1PA 2ZGCA 5J4QA 5AFZH 1MQ6A 1F9HA 2XMUA 1IBCB 5H4IB 1HLWA 3IK8A 3CUNA 4DL2A 1PKUA 2JKHA 3T41A 4EZ6A 3RXPA 1HHTP 2YQ3A 4F4OC 2W4DA 1HNVA 1QY7A 4OI3A 4NIXA 2CQCA 2LP4A 2A4GA 4DR2F 3M30A 2FYXA 2I6WA 3GG1A 4OX6A 3UAIC 1ZJDA 2G4UA 2VBWA 2W6JD 4H4KC 2LA6A 4L74A 1ULRA 4B3TF 1O38A 3RU4D 2ZFQH 1HAVB 3R5JB 3OYPA 2I1RA 2H4YB 1Q8IA 3N28A 4YY3F 5EX3A 3LH3A 4USUA 2CHAC 4BTTB 1TL1B 4HI2A 3VGSA 4NGAH 6GCHF 1TOMH 1GWAA 1PPZA 1SYTA 1N5QA 4QWDA 5LOQA 4I8JA 2AYWA 3MM6B 2HVZA 4L76A 1KN6A 3A85A 2X1FA 2CF9H 5KFPA 1NFWA 2V3MA 1FONA 1SL2A 1GK8A 4B9NA 4Q0BA 1UVPA 4X4NA 1SKSA 3N9UC 1SCJB 4NLUA 3G87A 3M35A 1FWPA 3UN5A 3ZZOA 1GBBA 1FERA 4ITSA 4LF8F 4FUGA 2GDDA 1W9UA 1XUGA 1G3BA 3KZ7A 1EHNA 1IKWA 2YBVA 3CCJS 1AFIA 2Z9GA 4MNVA 3QJLA 4IUFA 4C0BA 4ZN1A 2C22A 3EWGA 3BXWA 4GHTA 4ZK7M 3MTYA 2UUAF 4WFZA 2FI3E 5DP9A 1AA1B 1DVAH 3FP7E 3PTBA 4AYBD 2NU1E 4Y3CA 2J97A 1RQ0A 1CJKB 2F4LA 4IO1A 1OPHB 2PKAA 2EK1A 2Y1JA 3MCSA 1P2MA 4OFZA 1YBTA 1A0JA 4K1EA 2GCHG 1TABE 3ZZDA 3PRVA 5C20A 4Y34A 3CC7S 3K2UA 2WSFC 5A09A 4QYZJ 4Z0KA 3QWCH 1KDNA 3RLWH 1TV6A 4DUTA 2AMPA 4RPFA 4BTIB 1LW0A 2C2OB 3GYNA 4KHMA 4RW4B 5FPSA 3QRQA 2K7KA 3ZFVA 3ZNJ1 3S0NA 2DNNA 1C1VH 1UMJA 2I9SA 4P7VA 2XS5A 3TAMA 2RF2A 3UVJA 1GG6B 3RBDA 3NCQA 5B09A 1TRMA 4USVA 2AX1A 2J0XA 1S6PA 1IJEB 2DH7A 2E1RA 4R8UB 5KG2A 2E9TA 1NH7A 4YB1P 4I7FA 3W5ZA 2GNKA 3TP2A 4KTSA 1RHKB 4X4QA 1V5VA 2MSSA 4LRDA 3ZTQA 1NUEA 3NMAA 3AXMA 2C28A 3FCVA 1HMVA 2UWLA 2DHGA 1O2JA 4LXBH 4ENOA 2V0NA 1HXFH 2PGQB 1YZ6A 1VITG 3EICA 4J4OA 1ARBA 3DRRB 1NSAA 1GJ6A 1IJFB 1GBJA 1XTZA 2J9CA 4ISLA 2NPIA 3Q0AA 3NCLA 3UFCX 3MZIA 4F25A 1BTZA 3D66A 4X4RA 3VG8A 4DV7F 3D67A 2IN2A 3QGHA 1E38B 2UU9J 4HACB 4RT0A 3LGHA 1FKFA 5HT1A 1V3RA 1E9LA 3DHKH 2E5GA 2CPFA 3BYRA 1LVBA 4DF8A 4FN5A 2F4VF 1FDAA 4DIPA 1F7ZA 2VU8E 2F9VA 4JZEH 2IVYA 2RSEA 4JI2F 5BRRE 3GCNA 3W8GA 3CD6S 1N36J 2SNWA 1DHMA 4LIRA 1S83A 4YESB 4B9VA 4BC7A 5EOKA 2QV6A 5DQIA 1OWJA 1HNVB 4XOJA 5HO4A 4YHHJ 3M30B 3BV8A 2LP6A 5RUBA 1TNGA 2LQ5A 1YG0A 4DSJA 2MZ1A 1NBMD 1SGNE 2ZU5A 3ET6A 3U28C 5CH7B 2PIIA 4MGVA 1QA7A 2XI2A 4KQZA 4AL7A 2HYIB 3D3CJ 1VQNS 3GIMA 2UZ5A 2CF8H 1DZ5A 3TWZA 2GVZA 1C5ZB 4W9OA 2FESH 1U7LA 1ZPVA 5E2QA 3DRYA 4AG2A 2ZNYA 4IRDA 4MTVA 2Q6CA 4K2JA 3UD3P 2A2QH 4DUYJ 2BD9A 4OYZA 2VJ1A 1QFKH 4PUOB 4LAXA 4Q0BB 4FU9A 3GV5B 5HLFA 4JFLA 2ZH8A 4OJGA 1BWVA 2E5JA 2W9AA 1RTHA 4LF5F 4KRWA 2AERH 3FRYA 1IKWB 3AHPA 1U6BA 1GHAF 1S84A 3BREA 2F4EA 3CEDA 2VG6B 1RHMB 2K2PA 4DR7F 2R8HA 1XMOJ 2XPAA 1FEHA 2IRYA 1B7FA 1P57B 3B78A 1M5SA 2KXNB 1FX2A 2W3KA 2LDYA 2DT3A 1HFEL 4TX0A 2ZH3A 1NWTA 2CPZA 4CHAC 3M3SA 3B82A 2BX6A 4C11A 3VVUA 4U7UD 1Z8GA 2VB6A 3OFGA 2PKAB 4NA7A 2DNZA 1WELA 4LZ4B 1O6IA 1UL3A 3CDBA 3RXJA 2XW9A 3GV7B 4HTIA 4WK3A 2KFNA 2PFDA 3F1SB 3KG0A 1KXAA 3MAHA 4FXGH 4WPAA 4INHA 2FOMB 3PG9A 1PGZA 2HHVA 2CPDA 3U8TH 2ILZA 3I5CA 1JCHB 3MEEA 2HFOA 1WKLA 3H2VE 3E01A 1LW0B 2MY7A 4WP8A 3MFIA 1LFWA 4M8LA 5KFRA 1Q1CA 1CQMA 4S3KA 3P49B 2A7JA 1P27B 4N7TA 2J9EA 1TK5A 2VG5A 3SNEA 1NWUA 3C46A 4QWBA 5KT3A 5C2ZA 1MWQA 3TAMB 1P04A 4YMEA 1RHJB 4LQ9A 1ZL1A 1ZS6A 4FU8A 1NKCA 3J81j 3JSMA 4CLSA 4WYLA 1E0FD 3KABA 4WFNQ 4WMDA 1HAYB 3QGPA 1T9XA 1ZHMA 4I8KA 1UFKA 4I7FB 1ZHPA 3IITA 3ZTOA 4DR3J 3BPSP 3OL8A 3RXEA 1T94A 4LOYH 1SLVB 2KM8B 1Z8IB 3THTA 5E0GA 3UCZP 1RJXB 1X5PA 1R89A 5HI7A 2GHWA 4YR0A 1EHWA 4K4UA 1LWFA 5HAOA 1O3LA 3EGNA 2DNGA 4X4TA 2FVCA 4K4TA 1TELA 1W10U 1TGSZ 3ARZA 1CGHA 2GMTC 2LELA 2BDYA 2A1DB 1S4FA 4F50A 2OXSA 4RBTA 2V7QD 3R7NB 1U1MA 1DURA 2NZCA 2VC0A 2Z2MA 4J7CA 1BZXE 3E90B 1M0SA 1GDNA 4ED1A 4CLWA 2BY7X 1V2UT 2FS9A 2XCPA 2R2MB 4UFEH 1J16A 2VA2A 3OXLA 2QFJA 1H9HE 1O2TA 3KJVA 3UTUH 4YR2A 3A8KA 2P3TB 5DEZA 1GI5A 1XHGA 1A1RA 2L9NA 1RB0A 3R3GB 2ZPQA 4O2TA 4PYDA 4F3MA 4KTCA 4ZKOU 3I96A 2C8WB 5K5MA 1MCTA 3CGMA 3KK1A 2VFVA 4CT9A 3DLKA 3MCMA 4R0EA 3HSGA 4PG7A 3S9BA 1YBUA 3HLUA 1UJ1A 1A4WH 4F2SA 5C24B 1RZMA 2AP6A 3ET6B 2VQEJ 1AO5A 2RRNA 3PHTA 2P9EA 4CO3A 2MLZA 2FP7B 1LTOA 3UNSA 1THPB 3C16A 5E3PA 1G3OA 2JFKA 1X31C 4LRCA 4Q5VA 5T1VA 2GVZB 5D8HB 2BACA 5ETTA 1F6TA 1Y5IB 4L73A 3A7XA 1YPLH 1SBRA 5EGYA 1RTDA 3RXAA 4KTQA 3NUMA 1Y3XA 3KN2A 2BKPA 5KOWA 2V9WA 1OSCA 1WOOA 1BLUA 4PRFA 1AVGH 1CBWC 3ZVDA 4ABHA 1FD9A 4ZHRA 1LHFH 3UN3A 2XNRA 5HLFB 1R6YA 3MTKA 2FEQH 1F3VA 4F0MA 2D2DA 3LU9B 2JDID 2GX4A 4OV6A 4DPOA 4EBDA 1TK8A 3WWFA 1Q8KA 4INLA 2LPVA 4RLEA 1CTNA 3TNSA 8GCHG 1XWLA 1ZJKA 2G81E 3GY5A 3MPVA 2DGSA 1WACA 2DVIA 4NSYA 3LAMA 1W0KD 2F21A 3TU7H 4FBTA 1EATA 4DT4A 5HTGA 5AXKA 2R3UA 1LQEA 3CO0P 3ISNC 2RUSA 1GBAA 4XBBA 1HRTH 3BJYA 3MR3A 2LFVA 2KAIB 1LKBA 4C11B 3DLGA 1S0NA 2LEBA 2QZ8A 1TL7B 1QD1A 2EBGA 4LZ1H 4DPWA 1QPFA 2JEGA 3OD2A 2MJNA 3W2WA 2ZFFH 4JYAF 2YMSB 1WG1A 3OTDA 2BLQA 2ZDNA 1QTFA 2M1IA 5GVQA 2LU1A 2WVBA 4I6YA 2ZHWH 3N79A 1HQUA 3IKDA 2BQ6B 5DO4H 1FY1A 3SUFA 2B4PA 3QX5H 4ABGA 3J81U 4I8GA 2VG5B 1SGCA 2F63A 1U1RA 1NJZA 2ZQ2A 3O5RA 3CULA 3GV8B 3GLJA 2LNCA 1N52B 1NK9A 1UTKA 2KYXA 3ZZYA 3OUYB 2LGOA 5DP3A 1KMHB 3GCHB 2EC2A 4UOCA 7KMEH 2JFDA 3TOQA 1U0HB 1PPCE 4NMXA 2HZAA 2OIHA 3FMBA 4VGCC 2N4DA 5KG3A 4CQ1A 5CQGA 4QQBA 2G1HA 1C2EA 3SJIA 3W8PA 3GG0A 4MK7A 4J9PA 3VB5A 1QGFA 2O67A 3ODKA 2Y80A 2ZC3A 1GXLA 1KNZA 4DZ3A 3WC2A 3FBEA 4DRQA 1E35B 4MMOA 2C8YB 1KKHA 1LWFB 1S1VA 2GD4B 4X66J 5CABA 2ZJPQ 4TY8A 5J1EB 5F41A 2XGQA 6CHAB 1A0LA 3LJOA 1BITA 5L1LA 5CYJA 1XBWA 4D7GA 1BQYA 2MNTA 1ZPBA 1J4IA 1FZZA 5GIBA 2TGTA 1FV9A 2STBE 4B6EA 1T9WA 3CJTA 3PO4A 5A8WA 5JUMA 4P8VA 3LH2S 4Q2LA 3HM9A 1O5JA 2MQNA 2BQ7B 4GVLA 3RC6A 2HURA 1MN7A 2CDRB 3ARPA 5DP7A 2EFOA 3C6TB 3KLVA 1GVZA 2M70A 2VDIA 2OSRA 1YCPM 3SJ8A 1U2CA 1OX1A 5T6DA 3Q89A 1YZ7A 4MNWA 3BEIB 1JLEA 3KJVB 2DG3A 1UR8A 4LFCF 1C5QA 2PKSC 1ANDA 2Y5GA 3ENSB 2FTRA 2J76E 1RI7A 1KOOA 4MKVA 2QLJB 1PC4A 1O2GH 3HI9A 3FN8A 4JV1A 5CCLA 2ZKTA 1F0XA 4PXEA 3W5YA 5EHHA 3DLKB 4ZIWA 2OLHA 2H65B 4PXDA 3RM8A 3J7A1 3W3SA 4I2QB 1T05A 4EUVA 4NLGA 3TC5A 1BRAA 5BXIA 3G8QA 3ODFA 4NWLA 3C16B 1P2NA 3W5XA 1TL3A 1BMMH 4SGBE 4LF6J 5CHAC 2WV4A 2FLBH 3RMMH 4DV4J 1F0UA 1N1LA 3U1IB 5ESTE 2FPHX 4ESTE 1BBRK 1SGQE 4TWYA 1KVIA 1VCTA 2FHJA 4IN1A 3G9CA 1RTDB 2GW8A 3PYDA 3LGTA 2F8EX 1VC6A 2PSZA 1Z1JA 2R7RA 5FD1A 2PN0A 1RD6A 3JYTA 2FHMA 3K17A 4OX7A 3MMAA 3IFEA 4DR5F 3UWTA 1UCNA 2UXCF 3RBXA 1R0AA 1JLFB 1OSDA 2XGPA 2AEJA 4TLRA 1NK0A 2JEIA 3JYMA 2O8TA 3O8WA 4Q7NA 3D1OA 2EEYA 3TGJE 1W25A 1TNJA 3QUMP 2Q3PA 1OP0A 2H48B 3MEDA 1AVXA 1GMDG 1MN9A 3O5LA 2MGZB 2XNQA 4DCPB 1BTWA 2CJIA 2JVRA 5EQRA 2ASLA 1T4UH 1HAPH 2C93B 1SQFA 5DITA 4DV0F 2W9CA 3LC3A 4DSFA 4EI2A 3W2WB 1H2VZ 2DXFA 2ZI2H 1X60A 4ED0A 2DSWA 2HWIA 5K9FA 1O0DH 1E6VA 2DHSA 1HFDA 3AQUA 3K2YA 1IKYA 4DRNA 3LGWA 4HYKA 4OYIA 1HLTH 1L3UA 1HQUB 4DZ6A 3BGFA 4ECXA 5AXLA 1COWD 1C1UH 1YP9A 2NU2E 2UVWA 3CDUA 3NGDA 1DICA 4W90B 4AZ2B 3L09A 1Q7YT 2C3MA 4YQWA 2O8LA 5E8EH 1N8OB 3M2UB 1Y9OA 1O2VA 2MYFA 2CMYA 2GMJA 5DO2A 4V1Ak 4IKAA 4H4FA 3L7PA 5F8GA 3D4JA 2JZVA 5KFBA 2VHGA 3MYWA 1U2RA 2EI7A 2Y8YA 3M6UA 4FPIA 2ZIQH 1X9MA 5FJ4A 3V12A 4AGJA 4N5SA 2B9XA 1EQ3A 4X6OA 3H5XA 2ALPA 4F02A 4RW8A 2B4OA 3DLBA 1WSVA 4NXNF 4RW7A 1JLCA 3CE8A 3FEZA 4DX8H 4WWSA 1A3BH 1DDJA 1TONA 4I7YH 3ISZA 5KFGA 1BBRH 5DK1A 1S1VB 1SQEA 3D6MB 3FFIA 4TY8B 3KHRA 5B0EA 4Y10E 4OZ2A 3VZHA 3UQOA 3P5BP 2KZ4A 2QT7A 1MZDA 2XLJA 3V6DA 2J34A 1A46H 1HJXA 1GNKA 2E7XA 3EMTA 2H1UA 5EWFA 3HK2A 2J95A 5I3UA 1CHGA 1RAIB 1O3GA 3US5A 3QFWA 3LP0A 2DNKA 5A8WB 5IYTA 2FMJA 4ES3A 3BG8A 2XC4A 1Y11A 2TGPZ 1UW7A 4D3GA 1BRCE 4O3SA 1LHEH 4M5IA 1UJ4A 1L0ZA 7ESTE 1Z2ZA 4DRIA 3M36A 5J2PA 4BAMB 2CGAA 3O5EA 2CPHA 1K9OE 1H8ED 2HLTA 4YTAA 1Q16B 3EXYA 1CE5A 2KVIA 1KXBA 3F73A 1FNMA 4LRFA 2YNAA 2Z2ZA 4PWWA 4FP9A 1CU1A 2FD2A 1ZMNA 3RUBL 2YH0A 3JXVA 1Q95G 3OL7A 4DR4F 3OLBA 1HBUA 2E5LF 2H4WB 4B74A 2I0XA 4K0KF 1RTLA 3W95A 1V2KT 1NRQH 4KHRA 3AJ2A 5GAGI 1QAIA 2EW9A 3IGNA 5EQSA 2XMJA 1ID5H 2XM3A 1HGTH 1VKYA 1S1TB 2LKZA 2Z2YB 3VTIA 4WKRA 2UUWA 1NRRH 3DFEA 4DBQA 2KM0A 5C0UA 2KM8C 3VWSA 5HMAA 1W9PA 4DR1F 2B0GA 4QPTA 1ETTH 2HRTA 3BEGB 2MEWA 4CRFA 5EQQA 1APSA 1S72S 3HD1A 3C27B 1UFLA 4N8NA 1K1MA 3I9V9 1X9SA 1XMNB 2QSWA 1KDQB 1JIHA 4DRHA 3JYTB 2XMWA 1J5EF 1FJSA 1LHGH 7GCHF 4UOGA 4ILRA 3MMAB 4V19J 1R27B 3E0PB 2DSUA 2V94A 3H90A 3Q8QB 4GRSA 1R0AB 1TB6H 3G6ES 2R2UA 4G2PA 2NLWA 1TMTH 1TAUA 1K0TA 4Q7XA 2RKIA 1Z6JH 1S6LA 2OK5A 2ROPA 4NLXA 2OUGA 1U48A 1AFJA 3OJUA 2ZWPA 2M9KA 1ABJH 1JXLA 3JQMA 4USJC 1CSOE 3RLYH 5HM9A 1SMFE 3AS3A 3J7ZT 3KLIA 3UCUP 1VQKS 1GCTC 2MHEA 2OP9A 4Y2KA 4DL0C 4IGDA 3NGSA 2CPYA 4X65J 2ZPSA 4IT4A 3NP5A 1FJGF 2SXLA 4CCHA 2HHWA 1Q82T 2B5TB 2WB1D 1WB0A 1PYSB 2H6MA 1L3KA 2RG3A 2ADCA 2LXFA 2I6SA 4B9SA 1DFPA 2QF3A 3H40A 1O2KA 1Q4RA 2J9DA 3A88A 1FDDA 1RTIA 2IAJB 5HM2A 4UQTA 4DI6A 1XXDA 3TA0A 1Q1KA 2L6OA 2WPIS 1O2XA 1PBAA 2XWXA 2RDJA 2ZHFH 4GPGA 1G3CA 3DGPA 4EFAC 1FTRA 6AT1B 2V6NA 4DRMA 3MWIU 1VGCC 4YDDB 2WV5A 2GAGC 5DM7Q 2RU3A 2A7CA 2RHQB 1VBZA 4LREA 1NKEA 3D23A 2W2NP 4JI0F 4ZCMA 2YKOA 3MMCA 4H4MA 1BMQB 5FBEA 4MK8A 4UFDH 2W1BA 3CVKA 4U84A 4IOAQ 2CRLA 1Q8LA 3PROA 8KME2 1J14A 2EA3A 2LEAA 3CC4S 2UUCF 3WD4A 2CPJA 5KOXA 1C1PA 1F0RA 3IWMA 4KP0A 3DMJB 1SQAA 2F9NA 2XS2A 1MTNB 5HROA 1C1CB 2BZAA 1WOPA 2CADA 3MF5A 1LPKB 5KTQA 4YOGA 2A45B 4ECVA 4PKDB 4IQXA 2UXDF 3ELAH 4KKOA 2BVXH 3FFIB 3QGGA 2BW2A 5KGOA 2P59A 4XIUA 1L3SA 3KYFA 2ZE2A 3V6DB 2VGCB 2WYJA 3MD3A 1R8PA 3IM8A 4MSPA 4LSLA 3IC1A 4RUCA 5I3UB 1MD8A 2XXLA 5BJRA 1PAUB 4UOHA 3IR7B 2CQ4A 2H9HA 1MLAA 2Z9LA 2LDIA 1E6ZA 3THPA 4DCDA 1FY5A 3RXQA 4J9MA 2MKKA 3KLFB 1SB6A 5GQBA 4USWA 2HLCA 1G6BA 2M5TA 2DRAA 1O37A 4LF1A 3OR2A 5D0EA 3WIUA 4X84A 2QJ3A 3TX8A 5K8OA 4JI4F 4GLYA 1WC6A 2M5YA 1H1BA 4C97A 1BC6A 2LA4A 2DT2A 4M5HA 4AFQA 4YO9A 2EG2A 2L9WA 3QT7A 4DFKA 2HBQB 4RJVA 1I94J 1HBUB 2AGIX 3BMBA 2DT9A 2KN4A 2VG7A 3CJKA 5E0HA 3TYTA 2VIDA 5FCRA 2ASJA 5T6FA 1UTMA 4L3NA 5LSRA 2XMMA 5AXMA 1LL6A 1ACMB 3NRLA 1JLAA 5KG5A 5DP8A 4DV6F 1MCVA 5IV3A 1K21H 1C5YB 1MWYA 3ZZRA 4TY6A 1HJ9A 2W2PP 4DX5A 4BNRA 2NZ4A 3G6XA 3Q8SB 2PHBA 3BN9A 4OZ3A 3L6PA 1VQLS 3Q23A 2K8GA 3R2DJ 1H2TZ 4OYXA 1RAAB 5DG8A 1NN6A 6CHAC 1OQ6A 3ZZ8A 3SNDA 1QCPA 3RBZA 4K8BA 1S6QB 2CQ2A 1XN9A 1HNZJ 1FNXH 3RXSA 2P93A 2YWGA 4IDKA 2AGGX 4J9OA 3PYEA 2BHGA 2APOA 3C15A 5DM6Q 2DNLA 4Y2AA 4WP3A 1KRPA 1FTCA 1VYAA 4UF4A 1D3TB 1UK2A 2DGXA 3W2VA 3A7VA 2V50A 4B1TA 4H6TA 3Q8VA 4ZVPB 1O5AB 3P8GA 1GMWD 1Z71A 1TCOC 4M95A 4WBFA 1H2UX 4Z6AH 3AS1A 3FQLA 1UTLM 2C2ZB 4DL4A 2SGFE 3K89A 2OGUA 4DOZA 2DNYA 1DSTA 2FOBA 1N1AA 2KE0A 3FBCA 2EI6A 2ZU2A 3NLCA 1HI1A 2NYIA 5TCCA 4UD9H 1ACBE 4LRAA 3PW5A 1OWKA 4JI3F 4FYYB 4EMDA 3KLIB 4ZVHA 4NSVA 3ZO7A 4NPOA 1BKFA 5ETSA 1P2KA 3H7TA 1P02A 2Y5FA 1TK0A 2K06A 5DDQC 1GI4A 2JDJA 4P00A 4U2WA 5EG4A 4GSOA 1QL7A 2LYVA 2BEFA 2EKYA 4PABA 3EVMA 2RDEA 4F48B 2FDAA 2VFUA 4OJ3A 2J38A 2B9EA 3V2UC 4KIAA 2QE7D 1S6FA 1V2JT 5EJ1A 1UEVA 1UAWA 3RXOA 5KT5A 1L3VA 1XNQJ 2ZP0H 3V6KA 4J5OA 1TYNA 3SORA 4M5LA 5G4DA 3FEXB 4WXOA 1F0SA 3DGPB 1ZAXA 4ZCLA 4XE4A 3RFWA 4ANEA 1HWJA 3N6LA 2JETB 1KQSR 1FFSB 1PYTD 2OSQA 4MAVA 4G6VB 5HWCA 1RT6A 3A8IA 3MMCB 2ZECA 4DG4A 1FRKA 1TR0A 1EJMA 5CDFE 2OPPB 3O5DA 2RUDA 3HHLA 4F3OA 1LNQA 3JTPA 3E3XA 2F9PA 1LK5A 1EAUA 2HG4A 2PMWA 1YJTA 2HFUA 4RUBA 4ED2A 1CBKA 2ALVA 3QFHA 3ARSA 4JZFH 1NMEB 4K4YA 5F0WA 3TI0A 1KD1T 3UI4A 1X4FA 3DDIA 3IG1A 5HROB 1RWVB 1GH8A 3SJOA 3GCTG 2Y0SD 2FZGB 5LMUJ 3LGIA 1KT0A 8RUCA 3KKFA 3O5PA 2NS1B 2GCTB 4QR2A 3UQIA 4KKOB 1GGDB 2G55A 2B8PA 2POKA 3MR7A 2DPJA 4OYMA 2MQOA 2ZE2B 1TX8A 1SH2A 4NRTA 1P01A 5H9EJ 4ZPCA 3ZC4A 3MR5A 4CR9A 3BV9B 1V3SA 2XC0A 5E2OA 3U1MA 3CCVS 3IA0A 2ZU1A 3UW1A 4PXBA 2JJ2D 3ZZ5A 2ZUAA 3SYJA 4N77A 3H0PA 1D9IA 4TWWA 3A7ZA 5KEDA 3OR2B 2Y8WA 4LJMA 3O6QA 5KFHA 1VJQA 1D4PB 1IQNA 3H9RB 4R5PA 2XZWA 4FUCA 4NLTA 4QT8C 1RBOB 3NZIA 1ZB5A 3EUNA 3T1AA 1M5KC 4K3JA 3T25A 1N8OC 3NI6A 4IOBA 4QIVA 1B5GH 1O6XA 2HEKA 4B71A 3KDNA 4MJKA 5EODA 4PPZA 4CI0B 1A9NB 4I69A 1YBAA 2XSFA 1QNJA 3ZZZA 2WINI 2VG7B 3NGTA 3CJKB 1KTSB 7FDRA 1DJ0A 1HJAC 2R7OA 1A6LA 4XRNA 2HFSA 5IQQA 3BQ0A 2ZU4A 1FF2A 2IC3A 1C9PA 1BTYA 1JVWA 3RXKA 2L74A 2UVVA 2KFZA 1JKHA 3T5FH 2MQQA 2KCPA 4CLUA 2TRMA 4AG1A 4P75A 2E9ZA 3MO3A 1LOUA 1ETRH 3MNCA 4ZPTR 1HKIA 2JC1A 3ZIAD 4QYZK 3K5NA 1XIQA 1VITH 2DGOA 2RIJA 3NMRA 1G2MA 4WP9A 4NZLA 2FLPA 2TBSA 1GMVA 1O51A 8LPRA 2CXEA 4P2FA 2FIRH 2EULA 5A8XA 4NLDA 5BXJA 3ENVA 1G2EA 5DP6A 2MKSA 1R43A 6GCHG 3VXFH 2IFXA 1WDTA 2ETNA 3PY8A 3TUPA 3M37A 4YT6H 1D3DB 3BYPA 3GSIA 1NU9A 2ILNA 4BAQB 4IDKB 2V2QA 3A3NB 3B54A 2YH1A 2VWNA 4P2MA 3I0SA 3C15B 1EB0A 1G32B 2PPOA 4C8MA 2BDIA 2ADBA 4DFJA 2HHQA 3ZZ6A 1SQTA 4I6AA 2W7OA 2W25A 2L9DA 4C3LA 3EPGA 4Z2XA 3SW2B 1Y5NB 2BOHB 1X6LA 5A8KA 1LWEB 5TCAA 2HVYB 6ESTA 1X5OA 1WKKA 1O3NA 2OKQA 5B6OA 2Y5HA 3DD2H 2A5AA 2FJVA 2MXYA 3MH6A 3A8DA 3TX0A 1IHSH 1NPRA 2F65A 4NZ6A 2FOHA 4MH8A 2EQNA 3FSYA 2Z94A 4BXWA 1YLXA 4XPEA 2WPDD 1NFYA 2ZGBH 1XEZA 1W1YA 4DCJB 1A5GH 4LR9A 2KI2A 2FHKA 4X6NA 1I51B 3VGUA 4CLKA 3GCOA 2RD5C 2GGPB 1DXWA 2AGEX 4IMQA 2RFKC 2DG4A 5CHBA 4IG0A 2V34A 1AFEH 1ZAWA 3U1NA 3QK1A 1LJYA 2OTLS 1JB0C 3F44A 2CNOB 2PWXA 1FKLA 3JTNA 4O0NA 4DOQA 3NKYA 2ZOMA 2QTWA 2ZR5A 4JYUH 4H54A 1RLDA 2G4TA 3ATIA 5D4LA 1RGVA 3MOZA 1N36F 1L4ZA 1G7CB 1QSYA 3CW2C 2N7CA 1EAWA 2UUBJ 1MMJN 1W2KH 3GY2A 1GHZA 4O9VA 1O3FA 5KFWA 1PPHE 4YHHF 2D9FA 2A2CA 3HHLB 4ECWA 2BUNA 1IBMJ 5D77A 1PCAA 3PHEA 4B02A 3FP6E 5C2GA 3AROA 4NCGB 2LVWA 3OXFA 4LQ3A 1C5MD 2V2ZA 2AEIH 2ZITA 2COLA 4DIHH 5GAHU 3NNHA 1EETA 3MO6A 2BE2B 4DUYF 5IM0A 1VOMA 5KECA 4PR6A 1HAIH 3STJA 1YPEH 5EIYA 3AD7C 1ELAA 1FMGA 1NK8A 2AKWB 4IW4E 2ZDPA 4IBLH 4KH0B 3DOKB 1SR5C 1TQ0B 3PMJA 4QWAA 1ELDE 1RP5A 2HS3A 4GHQA 1GJ8B 2OEMA 4ZIVA 1J9CH 2PC6A 1YJRA 3TZZA 4JI8J 5L6NH 1TFWA 1RAEB 1AT1B 5DP4A 1XMOF 3E51A 2XZDB 3OFEA 3CS7A 1ZTLA 3PM9A 1T9UA 3UNGC 5C7PA 2IA0A 4R5PB 2Y9HA 4OZ1A 3CJ3A 3OX7U 4ZVGA 4GKKF 3R7BB 2A4OA 2HPQH 2MMYA 2F3CE 3GOVB 5J2NA 4LSZB 4JYTA 2O66A 4RW9B 4PG4A 1BA8B 3EGWB 4Y28C 3DLHA 5AJ3J 3HD2A 3CENA 2ASUB 4X1QU 3SU5A 1P1TA 2DBBA 2YKMB 3UQSA 3OVSA 3MR6A 3I77A 3EYZA 2VBYA 1VJWA 1YSJA 1TQ7B 5E3RA 5A2QY 4QIBA 2YKNA 2D69A 1PQ8A 2BKOA 3C3LA 1HA1A 2IDLA 2V8VA 1O2OA 4FVMA 3TH4H 4HI3A 1WDDA 2GVFA 3LC5A 5A8RB 3ZV9A 1VF8A 1P9SA 2RRBA 2B6AA 1S0RA 3BPDA 3DKDA 3CJ5A 1PBKA 4BBYA 2NSCA 3L95X 1YPKH 4K60A 4ZS6A 1U25A 2BDPA 3TQEA 1KIGH 2DUCA 4K7QA 4DPXA 4B2BA 2VGCC 3PJ9A 1FESA 4O44B 1CC8A 2HHUA 3BG4B 2EG1A 3OT9A 2QMUB 3GZ7A 1QLNA 1W11U 1XVOA 1TGNA 5DLFA 1LQ9A 1RT7B 5K14A 2R7WA 1Y59T 1EQMA 3AK5A 4DR3F 4MT1A 3IHZA 3ZTPA 3CHDA 3SZ2A 3H7OA