4DRJA

O-crystal structure of the ppiase domain of fkbp52, rapamycin and the frb fragment of mtor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
PMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 27
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drjA00
1Y0OA 2XPAA 3O5RA 1BKFA 1JNSA 3NI6A 3NTPA 4W9QA 2LKNA 2PPPA 1NMVA 2RUCA 4IPXA 2XP9A 3ODKA 4J4OA 4O2TA 2Q5AA 4U85A 2ZQVA 3O5FA 1ROUA 4IQCA 4W9OA 5HW8A 5J6EA 2KR7A 5HUAA 4C02B 3O5JA 4LAVA 2MPHA 1J4IA 1JVWA 4JFKA 3UI6A 3O5PA 4DRIA 2M2AA 3KAHA 4FN2A 4DROA 4DRHA 5HW6A 4QIBA 2RQSA 1N1AA 1FKBA 2XP7A 2KE0A 1FKSA 3IHZA 4GGQA 4DRQA 1HXVA 3CGMA 5DITA 2JZVA 1FKGA 1PBKA 2VCDA 3KCEA 3PRBA 1T11A 1ZK6A 1YW5A 5HWCA 3UI4A 2N87A 1FKFA 1Q6HA 4LAWA 2KI3A 2KO7A 2ZR6A 2L2SA 1FKIA 1FD9A 3KAFA 4ITZA 4FAPA 3UQBA 3KABA 2RSEA 2D9FA 2ZQUA 2XPBA 4J4NA 4R0XA 1D7JA 1Q1CA 5HTGA 3GPKA 3UI5A 2MLYA 3PA7A 4U84A 4G50A 2ZQTA 4QT2A 2UZ5A 1P5QA 1U79A 2F21A 2PV1A 3IK8A 4MGVA 4U86A 3O5IA 5B8IC 3O5OA 2LGOA 5D75A 1BL4A 1D7HA 3CGNA 1F8AB 4GIVA 2DG4A 2XP6A 5I98A 3EY6A 4QT3A 3LUOA 5DIVA 5BXJA 1B6CA 3RFWA 3JYJA 3O5EA 1C9HA 2PBCA 2ZR5A 4JFLA 5DIUA 4TW6A 1EYMA 1TCOC 3B7XA 1FKTA 1L1PA 1D7IA 2MF9A 1FKLA 4JFJA 4DT4A 4DIPA 5HT1A 1JNTA 4G2PA 1EQ3A 1A7XA 2ITKA 1D6OA 2KGJA 1FAPA 2MLXA 2KFWA 3UQIA 4DRJA 2XP5A 3OOBA 5GPGA 3O5LA 4DRNA 4TW7A 5HKGA 3UF8A 2VN1A 4TW8A 1R9HA 2IF4A 4BF8A 2F4EA 3H9RB 1ZCNA 2M1IA 3UQAA 2MNTA 3O5GA 3O5DA 1FKKA 2LPVA 3O5QA 4NNRA 3IKGA 4ODOA 1FKRA 3TC5A 1J6YA 2XP8A 3IKDA 4DRPA 1FKDA 1PINA 4TX0A 4LAYA 3JYMA 2DG3A 4ODKA 4ODPA 2LJ4A 4DRMA 2RUDA 4ODNA 2RURA 1FJDA 2DG9A 1J4HA 2MLZA 1F40A 2Y78A 1Q6UA 4DZ2A 3KACA 4JFMA 2PV3A 2ZR4A 3KAIA 4N19A 4ODQA 4TYOA 3VAWA 3RGCA 3JXVA 1ROTA 2M08A 4ODMA 3PRDA 3WH0A 4DRKA 4ODLA 1FKJA 1KT0A 1QPFA 3KADA 2F2DA 3O5MA 4IQ2A 1FKHA 4JYSA 4TNSA 2PV2A 3TDBA 1NSGA 1YATA 2RUQA 3I6CA 1NMWA 4LAXA 4DZ3A 1QZ2A 2PPNA 4ODRA 4W9PA 3FAPA 1QPLA 2AWGA 1J4RA 1KT1A 2XP3A 4JFIA 5HW7A 5HWBA 3NRKA 3O5KA 4MSPA 3KZ7A 2PPOA 2FAPA 3KAGA 2OFNA 3MDYB 4DH0A 2XP4A 1W26A 2FKEA 3TCZA 1Q6IA 1M5YA 2ZQSA 2K8IA
chains in the Genus database with same CATH superfamily
3NTPA 5DEZA 3AQUA 3ARZA 4P8UA 1ZBWA 1E6NA 4DWSB 4U85A 4Z2IA 5HUAA 2IUZA 4C02B 2MPHA 1HJWA 4FAPA 2WLYA 3KAHA 4IT4A 1FKSA 4DRQA 1HXVA 2QF8A 1IX5A 1VF8A 4S3JA 3AS2A 3ARXA 2N87A 1Q6HA 2KO7A 3WD1A 2O92A 1E9LA 1FD9A 1OGGA 1W1TA 2ZQUA 4J4NA 1D7JA 2MLYA 4LGXA 1H0GA 2AOSA 1P5QA 1U79A 2F21A 3CHDA 1WNOA 5D75A 3WD3A 1LJYA 1F8AB 3ARUA 3AS0A 2XP6A 5I98A 5BXJA 2DPEA 4JFLA 4MPKA 3B7XA 3ALGA 2MF9A 5HT1A 1NWSA 4DRJA 4TW7A 1ITXA 3G6MA 2M1IA 2EULA 3UQAA 1W9PA 4NNRA 4ODOA 1J6YA 2O9OA 3GU0A 3AS3A 1FKDA 1PINA 4ODKA 1FJDA 2RUDA 3KACA 4JFMA 2PV3A 3WIJA 2A3CA 4TYOA 4ODMA 2YBTA 4DWSC 4JYSA 2DSWA 4XAKA 1SYTA 4Z2HA 3I6CA 4DZ3A 3FAPA 2AWGA 1J4RA 3WL0A 5HW7A 5HWBA 3NRKA 4MSPA 3KZ7A 2PPOA 2OFNA 2FKEA 4Z2JA 3TCZA 1Q6IA 2DT0A 3ARVA 2ZQSA 4W9QA 2LKNA 2PPPA 2YBUA 3ODKA 2A3BA 3PRAA 3WKZA 4IQCA 1GPFA 1ROUA 3O5FA 4W9OA 1LL4A 4LAVA 4JFKA 1J4IA 3CH9A 3UI6A 4DRIA 4DRHA 2M2AA 1NWTA 5HW6A 4GGQA 1E6PA 2VCDA 3KCEA 1T11A 3ALFA 4LAWA 1H0IA 1FFRA 2KI3A 2L2SA 2ETNA 4W5UA 3KABA 2B31A 5DF0A 3GPKA 3WL1A 3OA5A 3WD0A 4MNMA 1TFVA 4G50A 2ZQTA 4QT2A 2UZ5A 1O6IA 3IK8A 5B8IC 4U86A 1ZU8A 2WM0A 1BL4A 3FXYA 4AY1A 1E44A 4ZS6A 3PR9A 1B6CA 1C9HA 2ZR5A 1ZL1A 5GPRA 1D7IA 2DT3A 4S3KA 4JFJA 1EDQA 4L3NA 4G2PA 4L72B 1A7XA 2ITKA 3ARQA 3O5LA 3RMEA 3ARYA 2IF4A 4BF8A 4Z2KA 2MNTA 2P4VA 3O5DA 1FKKA 1LL7A 3ARRA 3CZ8A 1FKRA 4DRPA 4TX0A 1ZBKA 3JYMA 2DG3A 4DRMA 1X6NA 3B8SA 2F23A 4WIWA 1HKKA 1LL6A 3VAWA 3RGCA 3JXVA 2M08A 3PRDA 4ODLA 4Q22A 1FKJA 5HW8A 3CHEA 2F2DA 4KR0B 1FKHA 2PV2A 4WKHA 3BXWA 2PPNA 1KT1A 1OGBA 4HARA 2B5UB 3WQWA 4DH0A 1W9VA 1HJVA 4WKAA 4MNKA 4ZPVR 1Y0OA 2XPAA 1BKFA 1NH6A 4WK9A 3NI6A 1NMVA 4IPXA 2XP9A 3AROA 4J4OA 2Q5AA 2KR7A 4UDMA 3O5JA 1XRVA 4DROA 3O5PA 4FN2A 4QIBA 4NSBA 2XP7A 2KE0A 3IHZA 3CGMA 1W9UA 1WAWA 2JZVA 1FKGA 2DT1A 1YW5A 1HKMA 3UI4A 1FKFA 1XHGA 1OWQA 1UR9A 4P8VA 1ZBCA 3KAFA 3UQBA 3ARPA 2FDMA 2RSEA 4R0XA 3WD2A 1Q1CA 3UI5A 1UR8A 3PA7A 4U84A 1EHNA 1NWUA 1LG1A 2OLHA 2G41A 3O5IA 1GRJA 1D7HA 4HBEA 3CGNA 4GIVA 2DG4A 1HKJA 4QT3A 2WLZA 3RFWA 3CHFA 3JYJA 3O5EA 2PBCA 1TCOC 4MAVA 1L1PA 1FKTA 4Z2GA 4WKFA 1SR0A 4IT6A 1ZBVA 1FAPA 4HBOA 3UQIA 1K9TA 2XP5A 3OOBA 5GPGA 3UF8A 4TW8A 1JNDA 2F4EA 3H9RB 3QOKA 5JH8A 1NWRA 4R5EA 2LPVA 1RD6A 3B9DA 1D2KA 4LAYA 2LJ4A 4ODNA 2RURA 2DG9A 2MLZA 3EIPA 1E6RA 1GUVA 3GTYX 4Q7NA 4KQZA 4N19A 1FFQA 5DO2A 3WH0A 4P8WA 1KT0A 3O5MA 4IQ2A 3TDBA 1YATA 2RUQA 4PTMA 4LAXA 3FY1A 1QPLA 4JFIA 3B9AA 3ARTA 1LG2A 3MDYB 1W26A 3ARSA 3AS1A 2A3AA 1M5YA 1W1PA 2K8IA 1ZB5A 1LQ0A 3O5RA 1JNSA 4WJXA 3WD4A 2RUCA 4O2TA 2ZQVA 5J6EA 3RM4A 1JVWA 2G8ZA 4DWSD 2RQSA 1N1AA 1FKBA 1GOIA 5DITA 1PBKA 3G6LA 4DWSA 1E15A 3PRBA 1ZK6A 2DT2A 5HWCA 1EIBA 2PI6A 1W1YA 3ARWA 2ZR6A 2A3EA 3RM8A 1FKIA 3RM9A 4ITZA 2D9FA 2XPBA 4QZVB 5HTGA 5GQBA 3WQVA 3CHCA 5HBFA 2PV1A 1JCHB 4MGVA 4MTVA 3O5OA 2LGOA 1HKIA 1W1VA 4ZPWR 3B9EA 2DSZA 3EY6A 1CTNA 3LUOA 5DIVA 2DSVA 5DIUA 1E6ZA 4TW6A 1EYMA 4MNJA 1X6LA 1FKLA 4DT4A 4DIPA 4MNLA 1JNTA 1EQ3A 2KGJA 2MLXA 1D6OA 4ZPTR 2KFWA 4DRNA 1KFWA 4URIA 5HKGA 4Z2LA 2VN1A 1R9HA 4NZCA 1ZCNA 3O5GA 3BMBA 3O5QA 3IKGA 3TC5A 2XP8A 3IKDA 4ODPA 1J4HA 2DSUA 1JNEA 1F40A 2Y78A 1Q6UA 4DZ2A 2WK2A 2ESCA 2ZR4A 3KAIA 4ODQA 1ROTA 4DRKA 2PN0A 1QPFA 3KADA 4TNSA 4P8XA 1NSGA 1NMWA 1QZ2A 4W9PA 4ODRA 2XP3A 3O5KA 3W4RA 1WB0A 2FAPA 3KAGA 2XP4A 1HJXA 4ML4A
chains in the Genus database with same CATH topology
3NTPA 5DEZA 3AQUA 3ARZA 4P8UA 1ZBWA 1E6NA 4DWSB 4U85A 4Z2IA 5HUAA 2IUZA 4C02B 2MPHA 1HJWA 4FAPA 2WLYA 3KAHA 4IT4A 1FKSA 4DRQA 1HXVA 2QF8A 1IX5A 1VF8A 4S3JA 3AS2A 3ARXA 2N87A 1Q6HA 2KO7A 3WD1A 2O92A 1E9LA 1FD9A 1OGGA 1W1TA 2ZQUA 4J4NA 1D7JA 2MLYA 4LGXA 1H0GA 2AOSA 1P5QA 1U79A 2F21A 3CHDA 1WNOA 5D75A 3WD3A 1LJYA 1F8AB 3ARUA 3AS0A 2XP6A 5I98A 5BXJA 2DPEA 4JFLA 4MPKA 3B7XA 3ALGA 2MF9A 5HT1A 1NWSA 4DRJA 4TW7A 1ITXA 3G6MA 2M1IA 3UQAA 1W9PA 4NNRA 4ODOA 1J6YA 2O9OA 3AS3A 1FKDA 1PINA 4ODKA 1FJDA 2RUDA 3KACA 4JFMA 2PV3A 3WIJA 2A3CA 4TYOA 4ODMA 2YBTA 4DWSC 4JYSA 2DSWA 4XAKA 1SYTA 4Z2HA 3I6CA 4DZ3A 3FAPA 2AWGA 1J4RA 3WL0A 5HW7A 5HWBA 3NRKA 4MSPA 3KZ7A 2PPOA 2OFNA 2FKEA 4Z2JA 3TCZA 1Q6IA 2DT0A 3ARVA 2ZQSA 4W9QA 2LKNA 2PPPA 2YBUA 3ODKA 2A3BA 3PRAA 3WKZA 4IQCA 1GPFA 1ROUA 3O5FA 4W9OA 1LL4A 4LAVA 4JFKA 1J4IA 3CH9A 3UI6A 4DRIA 4DRHA 2M2AA 1NWTA 5HW6A 4GGQA 1E6PA 2VCDA 3KCEA 1T11A 3ALFA 4LAWA 1H0IA 1FFRA 2KI3A 2L2SA 4W5UA 3KABA 2B31A 5DF0A 3GPKA 3WL1A 3OA5A 3WD0A 4MNMA 1TFVA 4G50A 2ZQTA 4QT2A 2UZ5A 1O6IA 3IK8A 5B8IC 4U86A 1ZU8A 2WM0A 1BL4A 3FXYA 4AY1A 4ZS6A 3PR9A 1B6CA 1C9HA 2ZR5A 1ZL1A 5GPRA 1D7IA 2DT3A 4S3KA 4JFJA 1EDQA 4L3NA 4G2PA 4L72B 1A7XA 2ITKA 3ARQA 3O5LA 3RMEA 3ARYA 2IF4A 4BF8A 4Z2KA 2MNTA 3O5DA 1FKKA 1LL7A 3ARRA 3CZ8A 1FKRA 4DRPA 4TX0A 1ZBKA 3JYMA 2DG3A 4DRMA 1X6NA 3B8SA 4WIWA 1HKKA 1LL6A 3VAWA 3RGCA 3JXVA 2M08A 3PRDA 4ODLA 4Q22A 1FKJA 5HW8A 3CHEA 2F2DA 4KR0B 1FKHA 2PV2A 4WKHA 3BXWA 2PPNA 1KT1A 1OGBA 4HARA 3WQWA 4DH0A 1W9VA 1HJVA 4WKAA 4MNKA 4ZPVR 1Y0OA 2XPAA 1BKFA 1NH6A 4WK9A 3NI6A 1NMVA 4IPXA 2XP9A 3AROA 4J4OA 2Q5AA 2KR7A 3O5JA 1XRVA 4DROA 3O5PA 4FN2A 4QIBA 4NSBA 2XP7A 2KE0A 3IHZA 3CGMA 1W9UA 1WAWA 2JZVA 1FKGA 2DT1A 1YW5A 1HKMA 3UI4A 1FKFA 1XHGA 1OWQA 1UR9A 4P8VA 1ZBCA 3KAFA 3UQBA 3ARPA 2FDMA 2RSEA 4R0XA 3WD2A 1Q1CA 3UI5A 1UR8A 3PA7A 4U84A 1EHNA 1NWUA 1LG1A 2OLHA 2G41A 3O5IA 1D7HA 4HBEA 3CGNA 4GIVA 2DG4A 1HKJA 4QT3A 2WLZA 3RFWA 3CHFA 3JYJA 3O5EA 2PBCA 1TCOC 4MAVA 1L1PA 1FKTA 4Z2GA 4WKFA 1SR0A 4IT6A 1ZBVA 1FAPA 4HBOA 3UQIA 1K9TA 2XP5A 3OOBA 5GPGA 3UF8A 4TW8A 1JNDA 2F4EA 3H9RB 3QOKA 5JH8A 1NWRA 4R5EA 2LPVA 1RD6A 3B9DA 1D2KA 4LAYA 2LJ4A 4ODNA 2RURA 2DG9A 2MLZA 1E6RA 1GUVA 4Q7NA 4KQZA 4N19A 1FFQA 5DO2A 3WH0A 4P8WA 1KT0A 3O5MA 4IQ2A 3TDBA 1YATA 2RUQA 4PTMA 4LAXA 3FY1A 1QPLA 4JFIA 3B9AA 3ARTA 1LG2A 3MDYB 1W26A 3ARSA 3AS1A 2A3AA 1M5YA 1W1PA 2K8IA 1ZB5A 1LQ0A 3O5RA 1JNSA 4WJXA 3WD4A 2RUCA 4O2TA 2ZQVA 5J6EA 3RM4A 1JVWA 2G8ZA 4DWSD 2RQSA 1N1AA 1FKBA 1GOIA 5DITA 1PBKA 3G6LA 4DWSA 1E15A 3PRBA 1ZK6A 2DT2A 5HWCA 1EIBA 2PI6A 1W1YA 3ARWA 2ZR6A 2A3EA 3RM8A 1FKIA 3RM9A 4ITZA 2D9FA 2XPBA 4QZVB 5HTGA 5GQBA 3WQVA 3CHCA 5HBFA 2PV1A 4MGVA 4MTVA 3O5OA 2LGOA 1HKIA 1W1VA 4ZPWR 3B9EA 2DSZA 3EY6A 1CTNA 3LUOA 5DIVA 2DSVA 5DIUA 1E6ZA 4TW6A 1EYMA 4MNJA 1X6LA 1FKLA 4DT4A 4DIPA 4MNLA 1JNTA 1EQ3A 2KGJA 2MLXA 1D6OA 4ZPTR 2KFWA 4DRNA 1KFWA 4URIA 5HKGA 4Z2LA 2VN1A 1R9HA 4NZCA 1ZCNA 3O5GA 3O5QA 3IKGA 3TC5A 2XP8A 3IKDA 4ODPA 1J4HA 2DSUA 1JNEA 1F40A 2Y78A 1Q6UA 4DZ2A 2WK2A 2ESCA 2ZR4A 3KAIA 4ODQA 1ROTA 4DRKA 1QPFA 3KADA 4TNSA 4P8XA 1NSGA 1NMWA 1QZ2A 4W9PA 4ODRA 2XP3A 3O5KA 3W4RA 1WB0A 2FAPA 3KAGA 2XP4A 1HJXA 4ML4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  2XPA A;  3O5R A;  1BKF A;  1JNS A;  3NI6 A;  3NTP A;  4W9Q A;  2LKN A;  2PPP A;  1NMV A;  2RUC A;  4IPX A;  2XP9 A;  3ODK A;  4J4O A;  4O2T A;  2Q5A A;  4U85 A;  2ZQV A;  3O5F A;  1ROU A;  4IQC A;  4W9O A;  5HW8 A;  5J6E A;  2KR7 A;  5HUA A;  4C02 B;  3O5J A;  4LAV A;  2MPH A;  1J4I A;  1JVW A;  4JFK A;  3UI6 A;  3O5P A;  4DRI A;  2M2A A;  3KAH A;  4FN2 A;  4DRO A;  4DRH A;  5HW6 A;  4QIB A;  2RQS A;  1N1A A;  1FKB A;  2XP7 A;  2KE0 A;  1FKS A;  3IHZ A;  4GGQ A;  4DRQ A;  1HXV A;  3CGM A;  5DIT A;  2JZV A;  1FKG A;  1PBK A;  2VCD A;  3KCE A;  3PRB A;  1T11 A;  1ZK6 A;  1YW5 A;  5HWC A;  3UI4 A;  2N87 A;  1FKF A;  1Q6H A;  4LAW A;  2KI3 A;  2KO7 A;  2ZR6 A;  2L2S A;  1FKI A;  1FD9 A;  3KAF A;  4ITZ A;  4FAP A;  3UQB A;  3KAB A;  2RSE A;  2D9F A;  2ZQU A;  2XPB A;  4J4N A;  4R0X A;  1D7J A;  1Q1C A;  5HTG A;  3GPK A;  3UI5 A;  2MLY A;  3PA7 A;  4U84 A;  4G50 A;  2ZQT A;  4QT2 A;  2UZ5 A;  1P5Q A;  1U79 A;  2F21 A;  2PV1 A;  3IK8 A;  4MGV A;  4U86 A;  3O5I A;  5B8I C;  3O5O A;  2LGO A;  5D75 A;  1BL4 A;  1D7H A;  3CGN A;  1F8A B;  4GIV A;  2DG4 A;  2XP6 A;  5I98 A;  3EY6 A;  4QT3 A;  3LUO A;  5DIV A;  5BXJ A;  1B6C A;  3RFW A;  3JYJ A;  3O5E A;  1C9H A;  2PBC A;  2ZR5 A;  4JFL A;  5DIU A;  4TW6 A;  1EYM A;  1TCO C;  3B7X A;  1FKT A;  1L1P A;  1D7I A;  2MF9 A;  1FKL A;  4JFJ A;  4DT4 A;  4DIP A;  5HT1 A;  1JNT A;  4G2P A;  1EQ3 A;  1A7X A;  2ITK A;  1D6O A;  2KGJ A;  1FAP A;  2MLX A;  2KFW A;  3UQI A;  4DRJ A;  2XP5 A;  3OOB A;  5GPG A;  3O5L A;  4DRN A;  4TW7 A;  5HKG A;  3UF8 A;  2VN1 A;  4TW8 A;  1R9H A;  2IF4 A;  4BF8 A;  2F4E A;  3H9R B;  1ZCN A;  2M1I A;  3UQA A;  2MNT A;  3O5G A;  3O5D A;  1FKK A;  2LPV A;  3O5Q A;  4NNR A;  3IKG A;  4ODO A;  1FKR A;  3TC5 A;  1J6Y A;  2XP8 A;  3IKD A;  4DRP A;  1FKD A;  1PIN A;  4TX0 A;  4LAY A;  3JYM A;  2DG3 A;  4ODK A;  4ODP A;  2LJ4 A;  4DRM A;  2RUD A;  4ODN A;  2RUR A;  1FJD A;  2DG9 A;  1J4H A;  2MLZ A;  1F40 A;  2Y78 A;  1Q6U A;  4DZ2 A;  3KAC A;  4JFM A;  2PV3 A;  2ZR4 A;  3KAI A;  4N19 A;  4ODQ A;  4TYO A;  3VAW A;  3RGC A;  3JXV A;  1ROT A;  2M08 A;  4ODM A;  3PRD A;  3WH0 A;  4DRK A;  4ODL A;  1FKJ A;  1KT0 A;  1QPF A;  3KAD A;  2F2D A;  3O5M A;  4IQ2 A;  1FKH A;  4JYS A;  4TNS A;  2PV2 A;  3TDB A;  1NSG A;  1YAT A;  2RUQ A;  3I6C A;  1NMW A;  4LAX A;  4DZ3 A;  1QZ2 A;  2PPN A;  4ODR A;  4W9P A;  3FAP A;  1QPL A;  2AWG A;  1J4R A;  1KT1 A;  2XP3 A;  4JFI A;  5HW7 A;  5HWB A;  3NRK A;  3O5K A;  4MSP A;  3KZ7 A;  2PPO A;  2FAP A;  3KAG A;  2OFN A;  3MDY B;  4DH0 A;  2XP4 A;  1W26 A;  2FKE A;  3TCZ A;  1Q6I A;  1M5Y A;  2ZQS A;  2K8I A; 
#chains in the Genus database with same CATH topology
 3NTP A;  5DEZ A;  3AQU A;  3ARZ A;  4P8U A;  1ZBW A;  1E6N A;  4DWS B;  4U85 A;  4Z2I A;  5HUA A;  2IUZ A;  4C02 B;  2MPH A;  1HJW A;  4FAP A;  2WLY A;  3KAH A;  4IT4 A;  1FKS A;  4DRQ A;  1HXV A;  2QF8 A;  1IX5 A;  1VF8 A;  4S3J A;  3AS2 A;  3ARX A;  2N87 A;  1Q6H A;  2KO7 A;  3WD1 A;  2O92 A;  1E9L A;  1FD9 A;  1OGG A;  1W1T A;  2ZQU A;  4J4N A;  1D7J A;  2MLY A;  4LGX A;  1H0G A;  2AOS A;  1P5Q A;  1U79 A;  2F21 A;  3CHD A;  1WNO A;  5D75 A;  3WD3 A;  1LJY A;  1F8A B;  3ARU A;  3AS0 A;  2XP6 A;  5I98 A;  5BXJ A;  2DPE A;  4JFL A;  4MPK A;  3B7X A;  3ALG A;  2MF9 A;  5HT1 A;  1NWS A;  4DRJ A;  4TW7 A;  1ITX A;  3G6M A;  2M1I A;  2EUL A;  3UQA A;  1W9P A;  4NNR A;  4ODO A;  1J6Y A;  2O9O A;  3GU0 A;  3AS3 A;  1FKD A;  1PIN A;  4ODK A;  1FJD A;  2RUD A;  3KAC A;  4JFM A;  2PV3 A;  3WIJ A;  2A3C A;  4TYO A;  4ODM A;  2YBT A;  4DWS C;  4JYS A;  2DSW A;  4XAK A;  1SYT A;  4Z2H A;  3I6C A;  4DZ3 A;  3FAP A;  2AWG A;  1J4R A;  3WL0 A;  5HW7 A;  5HWB A;  3NRK A;  4MSP A;  3KZ7 A;  2PPO A;  2OFN A;  2FKE A;  4Z2J A;  3TCZ A;  1Q6I A;  2DT0 A;  3ARV A;  2ZQS A;  4W9Q A;  2LKN A;  2PPP A;  2YBU A;  3ODK A;  2A3B A;  3PRA A;  3WKZ A;  4IQC A;  1GPF A;  1ROU A;  3O5F A;  4W9O A;  1LL4 A;  4LAV A;  4JFK A;  1J4I A;  3CH9 A;  3UI6 A;  4DRI A;  4DRH A;  2M2A A;  1NWT A;  5HW6 A;  4GGQ A;  1E6P A;  2VCD A;  3KCE A;  1T11 A;  3ALF A;  4LAW A;  1H0I A;  1FFR A;  2KI3 A;  2L2S A;  2ETN A;  4W5U A;  3KAB A;  2B31 A;  5DF0 A;  3GPK A;  3WL1 A;  3OA5 A;  3WD0 A;  4MNM A;  1TFV A;  4G50 A;  2ZQT A;  4QT2 A;  2UZ5 A;  1O6I A;  3IK8 A;  5B8I C;  4U86 A;  1ZU8 A;  2WM0 A;  1BL4 A;  3FXY A;  4AY1 A;  1E44 A;  4ZS6 A;  3PR9 A;  1B6C A;  1C9H A;  2ZR5 A;  1ZL1 A;  5GPR A;  1D7I A;  2DT3 A;  4S3K A;  4JFJ A;  1EDQ A;  4L3N A;  4G2P A;  4L72 B;  1A7X A;  2ITK A;  3ARQ A;  3O5L A;  3RME A;  3ARY A;  2IF4 A;  4BF8 A;  4Z2K A;  2MNT A;  2P4V A;  3O5D A;  1FKK A;  1LL7 A;  3ARR A;  3CZ8 A;  1FKR A;  4DRP A;  4TX0 A;  1ZBK A;  3JYM A;  2DG3 A;  4DRM A;  1X6N A;  3B8S A;  2F23 A;  4WIW A;  1HKK A;  1LL6 A;  3VAW A;  3RGC A;  3JXV A;  2M08 A;  3PRD A;  4ODL A;  4Q22 A;  1FKJ A;  5HW8 A;  3CHE A;  2F2D A;  4KR0 B;  1FKH A;  2PV2 A;  4WKH A;  3BXW A;  2PPN A;  1KT1 A;  1OGB A;  4HAR A;  2B5U B;  3WQW A;  4DH0 A;  1W9V A;  1HJV A;  4WKA A;  4MNK A;  4ZPV R;  1Y0O A;  2XPA A;  1BKF A;  1NH6 A;  4WK9 A;  3NI6 A;  1NMV A;  4IPX A;  2XP9 A;  3ARO A;  4J4O A;  2Q5A A;  2KR7 A;  4UDM A;  3O5J A;  1XRV A;  4DRO A;  3O5P A;  4FN2 A;  4QIB A;  4NSB A;  2XP7 A;  2KE0 A;  3IHZ A;  3CGM A;  1W9U A;  1WAW A;  2JZV A;  1FKG A;  2DT1 A;  1YW5 A;  1HKM A;  3UI4 A;  1FKF A;  1XHG A;  1OWQ A;  1UR9 A;  4P8V A;  1ZBC A;  3KAF A;  3UQB A;  3ARP A;  2FDM A;  2RSE A;  4R0X A;  3WD2 A;  1Q1C A;  3UI5 A;  1UR8 A;  3PA7 A;  4U84 A;  1EHN A;  1NWU A;  1LG1 A;  2OLH A;  2G41 A;  3O5I A;  1GRJ A;  1D7H A;  4HBE A;  3CGN A;  4GIV A;  2DG4 A;  1HKJ A;  4QT3 A;  2WLZ A;  3RFW A;  3CHF A;  3JYJ A;  3O5E A;  2PBC A;  1TCO C;  4MAV A;  1L1P A;  1FKT A;  4Z2G A;  4WKF A;  1SR0 A;  4IT6 A;  1ZBV A;  1FAP A;  4HBO A;  3UQI A;  1K9T A;  2XP5 A;  3OOB A;  5GPG A;  3UF8 A;  4TW8 A;  1JND A;  2F4E A;  3H9R B;  3QOK A;  5JH8 A;  1NWR A;  4R5E A;  2LPV A;  1RD6 A;  3B9D A;  1D2K A;  4LAY A;  2LJ4 A;  4ODN A;  2RUR A;  2DG9 A;  2MLZ A;  3EIP A;  1E6R A;  1GUV A;  3GTY X;  4Q7N A;  4KQZ A;  4N19 A;  1FFQ A;  5DO2 A;  3WH0 A;  4P8W A;  1KT0 A;  3O5M A;  4IQ2 A;  3TDB A;  1YAT A;  2RUQ A;  4PTM A;  4LAX A;  3FY1 A;  1QPL A;  4JFI A;  3B9A A;  3ART A;  1LG2 A;  3MDY B;  1W26 A;  3ARS A;  3AS1 A;  2A3A A;  1M5Y A;  1W1P A;  2K8I A;  1ZB5 A;  1LQ0 A;  3O5R A;  1JNS A;  4WJX A;  3WD4 A;  2RUC A;  4O2T A;  2ZQV A;  5J6E A;  3RM4 A;  1JVW A;  2G8Z A;  4DWS D;  2RQS A;  1N1A A;  1FKB A;  1GOI A;  5DIT A;  1PBK A;  3G6L A;  4DWS A;  1E15 A;  3PRB A;  1ZK6 A;  2DT2 A;  5HWC A;  1EIB A;  2PI6 A;  1W1Y A;  3ARW A;  2ZR6 A;  2A3E A;  3RM8 A;  1FKI A;  3RM9 A;  4ITZ A;  2D9F A;  2XPB A;  4QZV B;  5HTG A;  5GQB A;  3WQV A;  3CHC A;  5HBF A;  2PV1 A;  1JCH B;  4MGV A;  4MTV A;  3O5O A;  2LGO A;  1HKI A;  1W1V A;  4ZPW R;  3B9E A;  2DSZ A;  3EY6 A;  1CTN A;  3LUO A;  5DIV A;  2DSV A;  5DIU A;  1E6Z A;  4TW6 A;  1EYM A;  4MNJ A;  1X6L A;  1FKL A;  4DT4 A;  4DIP A;  4MNL A;  1JNT A;  1EQ3 A;  2KGJ A;  2MLX A;  1D6O A;  4ZPT R;  2KFW A;  4DRN A;  1KFW A;  4URI A;  5HKG A;  4Z2L A;  2VN1 A;  1R9H A;  4NZC A;  1ZCN A;  3O5G A;  3BMB A;  3O5Q A;  3IKG A;  3TC5 A;  2XP8 A;  3IKD A;  4ODP A;  1J4H A;  2DSU A;  1JNE A;  1F40 A;  2Y78 A;  1Q6U A;  4DZ2 A;  2WK2 A;  2ESC A;  2ZR4 A;  3KAI A;  4ODQ A;  1ROT A;  4DRK A;  2PN0 A;  1QPF A;  3KAD A;  4TNS A;  4P8X A;  1NSG A;  1NMW A;  1QZ2 A;  4W9P A;  4ODR A;  2XP3 A;  3O5K A;  3W4R A;  1WB0 A;  2FAP A;  3KAG A;  2XP4 A;  1HJX A;  4ML4 A; 
#chains in the Genus database with same CATH homology
 3NTP A;  5DEZ A;  3AQU A;  3ARZ A;  4P8U A;  1ZBW A;  1E6N A;  4DWS B;  4U85 A;  4Z2I A;  5HUA A;  2IUZ A;  4C02 B;  2MPH A;  1HJW A;  4FAP A;  2WLY A;  3KAH A;  4IT4 A;  1FKS A;  4DRQ A;  1HXV A;  2QF8 A;  1IX5 A;  1VF8 A;  4S3J A;  3AS2 A;  3ARX A;  2N87 A;  1Q6H A;  2KO7 A;  3WD1 A;  2O92 A;  1E9L A;  1FD9 A;  1OGG A;  1W1T A;  2ZQU A;  4J4N A;  1D7J A;  2MLY A;  4LGX A;  1H0G A;  2AOS A;  1P5Q A;  1U79 A;  2F21 A;  3CHD A;  1WNO A;  5D75 A;  3WD3 A;  1LJY A;  1F8A B;  3ARU A;  3AS0 A;  2XP6 A;  5I98 A;  5BXJ A;  2DPE A;  4JFL A;  4MPK A;  3B7X A;  3ALG A;  2MF9 A;  5HT1 A;  1NWS A;  4DRJ A;  4TW7 A;  1ITX A;  3G6M A;  2M1I A;  3UQA A;  1W9P A;  4NNR A;  4ODO A;  1J6Y A;  2O9O A;  3AS3 A;  1FKD A;  1PIN A;  4ODK A;  1FJD A;  2RUD A;  3KAC A;  4JFM A;  2PV3 A;  3WIJ A;  2A3C A;  4TYO A;  4ODM A;  2YBT A;  4DWS C;  4JYS A;  2DSW A;  4XAK A;  1SYT A;  4Z2H A;  3I6C A;  4DZ3 A;  3FAP A;  2AWG A;  1J4R A;  3WL0 A;  5HW7 A;  5HWB A;  3NRK A;  4MSP A;  3KZ7 A;  2PPO A;  2OFN A;  2FKE A;  4Z2J A;  3TCZ A;  1Q6I A;  2DT0 A;  3ARV A;  2ZQS A;  4W9Q A;  2LKN A;  2PPP A;  2YBU A;  3ODK A;  2A3B A;  3PRA A;  3WKZ A;  4IQC A;  1GPF A;  1ROU A;  3O5F A;  4W9O A;  1LL4 A;  4LAV A;  4JFK A;  1J4I A;  3CH9 A;  3UI6 A;  4DRI A;  4DRH A;  2M2A A;  1NWT A;  5HW6 A;  4GGQ A;  1E6P A;  2VCD A;  3KCE A;  1T11 A;  3ALF A;  4LAW A;  1H0I A;  1FFR A;  2KI3 A;  2L2S A;  4W5U A;  3KAB A;  2B31 A;  5DF0 A;  3GPK A;  3WL1 A;  3OA5 A;  3WD0 A;  4MNM A;  1TFV A;  4G50 A;  2ZQT A;  4QT2 A;  2UZ5 A;  1O6I A;  3IK8 A;  5B8I C;  4U86 A;  1ZU8 A;  2WM0 A;  1BL4 A;  3FXY A;  4AY1 A;  4ZS6 A;  3PR9 A;  1B6C A;  1C9H A;  2ZR5 A;  1ZL1 A;  5GPR A;  1D7I A;  2DT3 A;  4S3K A;  4JFJ A;  1EDQ A;  4L3N A;  4G2P A;  4L72 B;  1A7X A;  2ITK A;  3ARQ A;  3O5L A;  3RME A;  3ARY A;  2IF4 A;  4BF8 A;  4Z2K A;  2MNT A;  3O5D A;  1FKK A;  1LL7 A;  3ARR A;  3CZ8 A;  1FKR A;  4DRP A;  4TX0 A;  1ZBK A;  3JYM A;  2DG3 A;  4DRM A;  1X6N A;  3B8S A;  4WIW A;  1HKK A;  1LL6 A;  3VAW A;  3RGC A;  3JXV A;  2M08 A;  3PRD A;  4ODL A;  4Q22 A;  1FKJ A;  5HW8 A;  3CHE A;  2F2D A;  4KR0 B;  1FKH A;  2PV2 A;  4WKH A;  3BXW A;  2PPN A;  1KT1 A;  1OGB A;  4HAR A;  3WQW A;  4DH0 A;  1W9V A;  1HJV A;  4WKA A;  4MNK A;  4ZPV R;  1Y0O A;  2XPA A;  1BKF A;  1NH6 A;  4WK9 A;  3NI6 A;  1NMV A;  4IPX A;  2XP9 A;  3ARO A;  4J4O A;  2Q5A A;  2KR7 A;  3O5J A;  1XRV A;  4DRO A;  3O5P A;  4FN2 A;  4QIB A;  4NSB A;  2XP7 A;  2KE0 A;  3IHZ A;  3CGM A;  1W9U A;  1WAW A;  2JZV A;  1FKG A;  2DT1 A;  1YW5 A;  1HKM A;  3UI4 A;  1FKF A;  1XHG A;  1OWQ A;  1UR9 A;  4P8V A;  1ZBC A;  3KAF A;  3UQB A;  3ARP A;  2FDM A;  2RSE A;  4R0X A;  3WD2 A;  1Q1C A;  3UI5 A;  1UR8 A;  3PA7 A;  4U84 A;  1EHN A;  1NWU A;  1LG1 A;  2OLH A;  2G41 A;  3O5I A;  1D7H A;  4HBE A;  3CGN A;  4GIV A;  2DG4 A;  1HKJ A;  4QT3 A;  2WLZ A;  3RFW A;  3CHF A;  3JYJ A;  3O5E A;  2PBC A;  1TCO C;  4MAV A;  1L1P A;  1FKT A;  4Z2G A;  4WKF A;  1SR0 A;  4IT6 A;  1ZBV A;  1FAP A;  4HBO A;  3UQI A;  1K9T A;  2XP5 A;  3OOB A;  5GPG A;  3UF8 A;  4TW8 A;  1JND A;  2F4E A;  3H9R B;  3QOK A;  5JH8 A;  1NWR A;  4R5E A;  2LPV A;  1RD6 A;  3B9D A;  1D2K A;  4LAY A;  2LJ4 A;  4ODN A;  2RUR A;  2DG9 A;  2MLZ A;  1E6R A;  1GUV A;  4Q7N A;  4KQZ A;  4N19 A;  1FFQ A;  5DO2 A;  3WH0 A;  4P8W A;  1KT0 A;  3O5M A;  4IQ2 A;  3TDB A;  1YAT A;  2RUQ A;  4PTM A;  4LAX A;  3FY1 A;  1QPL A;  4JFI A;  3B9A A;  3ART A;  1LG2 A;  3MDY B;  1W26 A;  3ARS A;  3AS1 A;  2A3A A;  1M5Y A;  1W1P A;  2K8I A;  1ZB5 A;  1LQ0 A;  3O5R A;  1JNS A;  4WJX A;  3WD4 A;  2RUC A;  4O2T A;  2ZQV A;  5J6E A;  3RM4 A;  1JVW A;  2G8Z A;  4DWS D;  2RQS A;  1N1A A;  1FKB A;  1GOI A;  5DIT A;  1PBK A;  3G6L A;  4DWS A;  1E15 A;  3PRB A;  1ZK6 A;  2DT2 A;  5HWC A;  1EIB A;  2PI6 A;  1W1Y A;  3ARW A;  2ZR6 A;  2A3E A;  3RM8 A;  1FKI A;  3RM9 A;  4ITZ A;  2D9F A;  2XPB A;  4QZV B;  5HTG A;  5GQB A;  3WQV A;  3CHC A;  5HBF A;  2PV1 A;  4MGV A;  4MTV A;  3O5O A;  2LGO A;  1HKI A;  1W1V A;  4ZPW R;  3B9E A;  2DSZ A;  3EY6 A;  1CTN A;  3LUO A;  5DIV A;  2DSV A;  5DIU A;  1E6Z A;  4TW6 A;  1EYM A;  4MNJ A;  1X6L A;  1FKL A;  4DT4 A;  4DIP A;  4MNL A;  1JNT A;  1EQ3 A;  2KGJ A;  2MLX A;  1D6O A;  4ZPT R;  2KFW A;  4DRN A;  1KFW A;  4URI A;  5HKG A;  4Z2L A;  2VN1 A;  1R9H A;  4NZC A;  1ZCN A;  3O5G A;  3O5Q A;  3IKG A;  3TC5 A;  2XP8 A;  3IKD A;  4ODP A;  1J4H A;  2DSU A;  1JNE A;  1F40 A;  2Y78 A;  1Q6U A;  4DZ2 A;  2WK2 A;  2ESC A;  2ZR4 A;  3KAI A;  4ODQ A;  1ROT A;  4DRK A;  1QPF A;  3KAD A;  4TNS A;  4P8X A;  1NSG A;  1NMW A;  1QZ2 A;  4W9P A;  4ODR A;  2XP3 A;  3O5K A;  3W4R A;  1WB0 A;  2FAP A;  3KAG A;  2XP4 A;  1HJX A;  4ML4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...