4DRJA

O-crystal structure of the ppiase domain of fkbp52, rapamycin and the frb fragment of mtor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
PMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4drjA00
2ZQVA 2PV3A 1FKJA 4ODKA 3UI4A 4DRPA 1FKRA 3MDYB 2KO7A 1TCOC 3KAHA 1Q6IA 1J4HA 2KGJA 2MF9A 1FKDA 4ODMA 5HKGA 5HW8A 2PPOA 2N87A 3CGMA 5J6EA 3O5MA 3IHZA 5DIVA 2RUCA 3O5EA 2RUQA 4TW7A 1ZCNA 1JNTA 3UQIA 4IQCA 4JFKA 4W9PA 4ODNA 4DH0A 2AWGA 4DRMA 4G50A 4DROA 2UZ5A 5DITA 1A7XA 4DRJA 4GIVA 4LAYA 4U84A 4LAWA 1FKKA 2ZQSA 3IKGA 4W9QA 2IF4A 2XPAA 3I6CA 3KACA 3O5KA 1EQ3A 3ODKA 5HUAA 1BL4A 4QIBA 4ODLA 2PBCA 4O2TA 3O5RA 2RQSA 2FAPA 1L1PA 2XP5A 3WH0A 2XPBA 4DT4A 4LAXA 1KT0A 4J4NA 2LPVA 2PPNA 4NNRA 2MNTA 3UQAA 2RURA 3O5DA 3UQBA 1QPFA 1Q6HA 1N1AA 2PPPA 2LJ4A 2PV1A 3PA7A 4J4OA 3KADA 2MLZA 4MGVA 3TCZA 4JYSA 1HXVA 4MSPA 1FKIA 4W9OA 1FJDA 2ZR5A 2XP6A 2KE0A 5HWCA 5BXJA 2XP8A 2PV2A 1QZ2A 4JFIA 4IQ2A 1FKSA 1YW5A 3O5JA 2MLXA 2XP7A 4JFJA 4QT2A 3RGCA 3UI5A 2RSEA 1Q6UA 2RUDA 2F21A 1J6YA 2K8IA 2OFNA 3LUOA 3OOBA 3B7XA 3KAFA 1D7HA 3TC5A 3JXVA 4IPXA 3GPKA 5DIUA 1FKTA 1PBKA 5D75A 3JYMA 1Q1CA 3KAGA 1U79A 3EY6A 3IK8A 2VN1A 5I98A 1JNSA 2KI3A 1P5QA 3VAWA 1ROUA 2Y78A 1EYMA 2KFWA 5GPGA 1JVWA 3O5LA 2DG4A 3O5QA 4JFMA 2ZQUA 1R9HA 2MLYA 3FAPA 4ODRA 1D7JA 3KABA 1ROTA 3IKDA 2ITKA 4DRHA 5B8IC 2M1IA 1D7IA 2VCDA 1T11A 4DZ2A 2JZVA 4TW6A 1NMVA 1C9HA 1D6OA 4G2PA 1YATA 2KR7A 4U86A 1QPLA 2LKNA 4BF8A 3O5FA 1FAPA 2XP3A 4ODPA 1PINA 4U85A 2F4EA 1J4RA 2LGOA 3NI6A 4GGQA 4N19A 1J4IA 4TNSA 4DRKA 1FD9A 4FN2A 5HWBA 1FKFA 4QT3A 2M2AA 1NMWA 3UF8A 3NRKA 3CGNA 2M08A 3O5OA 4DRQA 4DRNA 5HT1A 4DIPA 2ZR4A 5HW7A 2ZQTA 4TW8A 1W26A 2FKEA 3O5IA 1B6CA 4FAPA 4ODQA 4TX0A 1FKGA 3H9RB 3RFWA 3O5PA 3KAIA 1FKLA 4ODOA 2MPHA 1BKFA 2D9FA 4LAVA 1F40A 2ZR6A 5HW6A 4DRIA 4C02B 1F8AB 3NTPA 1KT1A 4DZ3A 4JFLA 2DG3A 4ITZA 4R0XA 1M5YA 1FKBA 2L2SA 2F2DA 3KCEA 3UI6A 3TDBA 3PRBA 1ZK6A 2DG9A 3JYJA 3PRDA 5HTGA 2Q5AA 1FKHA 2XP4A 2XP9A 3KZ7A 1NSGA 3O5GA 1Y0OA 4TYOA
chains in the Genus database with same CATH superfamily
4ODKA 3GTYX 3MDYB 1UR8A 1LJYA 2KO7A 1J4HA 3ARXA 1FKDA 5J6EA 1JNTA 4HBOA 1W9VA 4ODNA 4DROA 1H0GA 1NWSA 1A7XA 4GIVA 3ALGA 2IF4A 2ESCA 1BL4A 4QIBA 1ZBCA 4ODLA 2DT1A 3O5RA 3AS3A 1E6ZA 2FAPA 1L1PA 2XP5A 4PTMA 4DT4A 4LAXA 4ZPWR 1LQ0A 1K9TA 1LG2A 1SYTA 1XRVA 3CZ8A 1KFWA 1QPFA 2B31A 2PV1A 3CHCA 3CHFA 4MGVA 2MLZA 4JYSA 4DWSA 1WAWA 4W9OA 2KE0A 5HWCA 5BXJA 1LL4A 2ETNA 1HJXA 3RGCA 1FKSA 1YW5A 2WLYA 3UI5A 1Q6UA 1J6YA 2K8IA 3LUOA 3ARTA 3W4RA 1JNEA 5D75A 3JYMA 3KAGA 3VAWA 4HBEA 1LG1A 2YBTA 2KFWA 1VF8A 2P4VA 1ZBWA 2ITKA 4DRHA 1D7IA 4WKHA 2B5UB 2JZVA 1C9HA 1D6OA 4BF8A 1YATA 1XHGA 1D2KA 1HKIA 2LKNA 3CH9A 4P8WA 2XP3A 4P8VA 4P8XA 4TNSA 1FD9A 2DT2A 3G6LA 1FKFA 4QT3A 4WKAA 1ZBVA 1NMWA 3NRKA 1W1PA 3CGNA 5HW7A 4DIPA 2ZR4A 2ZQTA 2A3EA 1OWQA 3O5PA 1FKLA 2D9FA 5HW6A 4DRIA 2O92A 1EDQA 4ITZA 4R0XA 4MNJA 3KCEA 2OLHA 3WD2A 3TDBA 3PRBA 1ZK6A 5HTGA 3BXWA 3O5GA 4UDMA 1W9UA 2ZQVA 1FKJA 3UI4A 4ZPTR 2KGJA 3RM4A 2MF9A 5HKGA 5HW8A 2PPOA 2AOSA 3CGMA 3IHZA 2PN0A 2RUQA 1ZCNA 3ARYA 4IQCA 4DRMA 4Z2JA 1W1VA 2AWGA 3ARUA 4Q22A 1SR0A 4DWSC 1X6LA 3PR9A 4U84A 4LAWA 3RM9A 3I6CA 1ZL1A 3ODKA 1E9LA 2XPBA 1ITXA 1CTNA 2LPVA 4NNRA 1HKJA 2MNTA 1UR9A 3AS2A 1HJVA 3PA7A 2LJ4A 4J4OA 3KADA 2DSWA 2F23A 3ARSA 4MTVA 2PV2A 1E15A 4L3NA 4XAKA 2XP7A 4QT2A 2RUDA 4IT4A 2OFNA 3B9EA 3JXVA 4IPXA 3GPKA 1PBKA 2PI6A 3EY6A 3IK8A 3WQVA 2VN1A 5I98A 2KI3A 1P5QA 1FFQA 3WIJA 3O5QA 4JFMA 4ODRA 5GQBA 1ROTA 3IKDA 2M1IA 1NWUA 2VCDA 1T11A 1NMVA 2KR7A 3WQWA 1QPLA 2WK2A 4N19A 1J4IA 4DRKA 3AS0A 4MPKA 2M2AA 4DRQA 5HT1A 4S3JA 4TW8A 1W26A 1W1YA 4FAPA 1IX5A 4W5UA 4WIWA 3GU0A 2ZR6A 1HJWA 2DT0A 4DZ3A 4JFLA 2DG3A 1W1TA 3B9AA 1FKBA 3WKZA 4MNMA 1HKMA 2XP4A 1X6NA 2XP9A 1NSGA 4QZVB 1NWRA 1GOIA 3ARPA 4ML4A 4DRPA 1FKRA 3KAHA 1TCOC 2G8ZA 4P8UA 3ALFA 3CHDA 2N87A 4MNKA 3O5MA 3O5EA 3UQIA 1E6NA 4JFKA 5GPRA 4DRNA 4G50A 2DSZA 5DITA 3FXYA 1GUVA 3IKGA 2WM0A 1OGBA 3QOKA 2XPAA 4W9QA 4WKFA 4MNLA 2YBUA 2PBCA 4O2TA 3WL0A 3RMEA 1KT0A 4J4NA 2PPNA 1GPFA 3O5DA 4DWSB 1Q6HA 2PPPA 1HXVA 2WLZA 3BMBA 4URIA 4MSPA 2ZR5A 2XP6A 1ZB5A 3B8SA 1QZ2A 1RD6A 3O5JA 2MLXA 4JFJA 4Q7NA 2A3CA 2F21A 2A3AA 3OOBA 3TC5A 1Q1CA 1W9PA 3PRAA 2Y78A 1EYMA 1JVWA 1R9HA 2MLYA 3FAPA 1E44A 3ARQA 2DPEA 2G41A 4U86A 3O5FA 4ODPA 4U85A 2F4EA 3NI6A 2LGOA 3FY1A 3UF8A 2M08A 3EIPA 3O5IA 4Z2HA 3WD3A 4ODQA 4TX0A 1FKGA 3H9RB 1E6PA 3KAIA 2MPHA 4C02B 2FDMA 1F8AB 3NTPA 1NWTA 4S3KA 3WD4A 3WD0A 3UI6A 3JYJA 3PRDA 1H0IA 4HARA 3KZ7A 4Z2KA 4NSBA 4KQZA 1E6RA 2DSUA 2PV3A 1ZBKA 1Q6IA 3WD1A 4ODMA 1LL6A 1OGGA 5DIVA 3B9DA 2RUCA 2DSVA 4TW7A 5DEZA 1EIBA 4W9PA 4LGXA 4WK9A 4DH0A 2UZ5A 4L72B 3ARVA 4DRJA 4LAYA 1FKKA 1HKKA 1ZU8A 2ZQSA 3O5KA 3KACA 1EQ3A 5HUAA 4WJXA 2RQSA 4R5EA 4Z2GA 2EULA 3WH0A 4ZPVR 3ARWA 4ZS6A 1JCHB 1O6IA 3UQAA 2RURA 1JNDA 3UQBA 1N1AA 2A3BA 1WB0A 1NH6A 3TCZA 3OA5A 3ARRA 1FKIA 1FJDA 4NZCA 2XP8A 2IUZA 4JFIA 4IQ2A 2RSEA 4IT6A 3B7XA 1FFRA 3KAFA 1D7HA 5DIUA 1FKTA 3G6MA 1U79A 1JNSA 3AS1A 1ROUA 2O9OA 5GPGA 4Z2IA 3O5LA 2DG4A 2ZQUA 1D7JA 3KABA 5HBFA 5B8IC 3AROA 3AQUA 5DO2A 4DZ2A 4AY1A 4TW6A 4G2PA 1FAPA 1PINA 1J4RA 4GGQA 4FN2A 1WNOA 4DWSD 5HWBA 2DT3A 3O5OA 4Z2LA 2FKEA 1B6CA 4KR0B 3CHEA 3RFWA 1EHNA 2QF8A 4ODOA 1BKFA 5DF0A 4LAVA 1F40A 3ARZA 1KT1A 3WL1A 1M5YA 3RM8A 2L2SA 2F2DA 1TFVA 5JH8A 2DG9A 2Q5AA 1FKHA 4MAVA 1LL7A 1GRJA 1Y0OA 4TYOA
chains in the Genus database with same CATH topology
4ODKA 3MDYB 1UR8A 1LJYA 2KO7A 1J4HA 3ARXA 1FKDA 5J6EA 1JNTA 4HBOA 1W9VA 4ODNA 4DROA 1H0GA 1NWSA 1A7XA 4GIVA 3ALGA 2IF4A 2ESCA 1BL4A 4QIBA 1ZBCA 4ODLA 2DT1A 3O5RA 3AS3A 1E6ZA 2FAPA 1L1PA 2XP5A 4PTMA 4DT4A 4LAXA 4ZPWR 1LQ0A 1K9TA 1LG2A 1SYTA 1XRVA 3CZ8A 1KFWA 1QPFA 2B31A 2PV1A 3CHCA 3CHFA 4MGVA 2MLZA 4JYSA 4DWSA 1WAWA 4W9OA 2KE0A 5HWCA 5BXJA 1LL4A 1HJXA 3RGCA 1FKSA 1YW5A 2WLYA 3UI5A 1Q6UA 1J6YA 2K8IA 3LUOA 3ARTA 3W4RA 1JNEA 5D75A 3JYMA 3KAGA 3VAWA 4HBEA 1LG1A 2YBTA 2KFWA 1VF8A 1ZBWA 2ITKA 4DRHA 1D7IA 4WKHA 2JZVA 1C9HA 1D6OA 4BF8A 1YATA 1XHGA 1D2KA 1HKIA 2LKNA 3CH9A 4P8WA 2XP3A 4P8VA 4P8XA 4TNSA 1FD9A 2DT2A 3G6LA 1FKFA 4QT3A 4WKAA 1ZBVA 1NMWA 3NRKA 1W1PA 3CGNA 5HW7A 4DIPA 2ZR4A 2ZQTA 2A3EA 1OWQA 3O5PA 1FKLA 2D9FA 5HW6A 4DRIA 2O92A 1EDQA 4ITZA 4R0XA 4MNJA 3KCEA 2OLHA 3WD2A 3TDBA 3PRBA 1ZK6A 5HTGA 3BXWA 3O5GA 1W9UA 2ZQVA 1FKJA 3UI4A 4ZPTR 2KGJA 3RM4A 2MF9A 5HKGA 5HW8A 2PPOA 2AOSA 3CGMA 3IHZA 2RUQA 1ZCNA 3ARYA 4IQCA 4DRMA 4Z2JA 1W1VA 2AWGA 3ARUA 4Q22A 1SR0A 4DWSC 1X6LA 3PR9A 4U84A 4LAWA 3RM9A 3I6CA 1ZL1A 3ODKA 1E9LA 2XPBA 1ITXA 1CTNA 2LPVA 4NNRA 1HKJA 2MNTA 1UR9A 3AS2A 1HJVA 3PA7A 2LJ4A 4J4OA 3KADA 2DSWA 3ARSA 4MTVA 2PV2A 1E15A 4L3NA 4XAKA 2XP7A 4QT2A 2RUDA 4IT4A 2OFNA 3B9EA 3JXVA 4IPXA 3GPKA 1PBKA 2PI6A 3EY6A 3IK8A 3WQVA 2VN1A 5I98A 2KI3A 1P5QA 1FFQA 3WIJA 3O5QA 4JFMA 4ODRA 5GQBA 1ROTA 3IKDA 2M1IA 1NWUA 2VCDA 1T11A 1NMVA 2KR7A 3WQWA 1QPLA 2WK2A 4N19A 1J4IA 4DRKA 3AS0A 4MPKA 2M2AA 4DRQA 5HT1A 4S3JA 4TW8A 1W26A 1W1YA 4FAPA 1IX5A 4W5UA 4WIWA 2ZR6A 1HJWA 2DT0A 4DZ3A 4JFLA 2DG3A 1W1TA 3B9AA 1FKBA 3WKZA 4MNMA 1HKMA 2XP4A 1X6NA 2XP9A 1NSGA 4QZVB 1NWRA 1GOIA 3ARPA 4ML4A 4DRPA 1FKRA 3KAHA 1TCOC 2G8ZA 4P8UA 3ALFA 3CHDA 2N87A 4MNKA 3O5MA 3O5EA 3UQIA 1E6NA 4JFKA 5GPRA 4DRNA 4G50A 2DSZA 5DITA 3FXYA 1GUVA 3IKGA 2WM0A 1OGBA 3QOKA 2XPAA 4W9QA 4WKFA 4MNLA 2YBUA 2PBCA 4O2TA 3WL0A 3RMEA 1KT0A 4J4NA 2PPNA 1GPFA 3O5DA 4DWSB 1Q6HA 2PPPA 1HXVA 2WLZA 4URIA 4MSPA 2ZR5A 2XP6A 1ZB5A 3B8SA 1QZ2A 1RD6A 3O5JA 2MLXA 4JFJA 4Q7NA 2A3CA 2F21A 2A3AA 3OOBA 3TC5A 1Q1CA 1W9PA 3PRAA 2Y78A 1EYMA 1JVWA 1R9HA 2MLYA 3FAPA 3ARQA 2DPEA 2G41A 4U86A 3O5FA 4ODPA 4U85A 2F4EA 3NI6A 2LGOA 3FY1A 3UF8A 2M08A 3O5IA 4Z2HA 3WD3A 4ODQA 4TX0A 1FKGA 3H9RB 1E6PA 3KAIA 2MPHA 4C02B 2FDMA 1F8AB 3NTPA 1NWTA 4S3KA 3WD4A 3WD0A 3UI6A 3JYJA 3PRDA 1H0IA 4HARA 3KZ7A 4Z2KA 4NSBA 4KQZA 1E6RA 2DSUA 2PV3A 1ZBKA 1Q6IA 3WD1A 4ODMA 1LL6A 1OGGA 5DIVA 3B9DA 2RUCA 2DSVA 4TW7A 5DEZA 1EIBA 4W9PA 4LGXA 4WK9A 4DH0A 2UZ5A 4L72B 3ARVA 4DRJA 4LAYA 1FKKA 1HKKA 1ZU8A 2ZQSA 3O5KA 3KACA 1EQ3A 5HUAA 4WJXA 2RQSA 4R5EA 4Z2GA 3WH0A 4ZPVR 3ARWA 4ZS6A 1O6IA 3UQAA 2RURA 1JNDA 3UQBA 1N1AA 2A3BA 1WB0A 1NH6A 3TCZA 3OA5A 3ARRA 1FKIA 1FJDA 4NZCA 2XP8A 2IUZA 4JFIA 4IQ2A 2RSEA 4IT6A 3B7XA 1FFRA 3KAFA 1D7HA 5DIUA 1FKTA 3G6MA 1U79A 1JNSA 3AS1A 1ROUA 2O9OA 5GPGA 4Z2IA 3O5LA 2DG4A 2ZQUA 1D7JA 3KABA 5HBFA 5B8IC 3AROA 3AQUA 5DO2A 4DZ2A 4AY1A 4TW6A 4G2PA 1FAPA 1PINA 1J4RA 4GGQA 4FN2A 1WNOA 4DWSD 5HWBA 2DT3A 3O5OA 4Z2LA 2FKEA 1B6CA 4KR0B 3CHEA 3RFWA 1EHNA 2QF8A 4ODOA 1BKFA 5DF0A 4LAVA 1F40A 3ARZA 1KT1A 3WL1A 1M5YA 3RM8A 2L2SA 2F2DA 1TFVA 5JH8A 2DG9A 2Q5AA 1FKHA 4MAVA 1LL7A 1Y0OA 4TYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQV A;  2PV3 A;  1FKJ A;  4ODK A;  3UI4 A;  4DRP A;  1FKR A;  3MDY B;  2KO7 A;  1TCO C;  3KAH A;  1Q6I A;  1J4H A;  2KGJ A;  2MF9 A;  1FKD A;  4ODM A;  5HKG A;  5HW8 A;  2PPO A;  2N87 A;  3CGM A;  5J6E A;  3O5M A;  3IHZ A;  5DIV A;  2RUC A;  3O5E A;  2RUQ A;  4TW7 A;  1ZCN A;  1JNT A;  3UQI A;  4IQC A;  4JFK A;  4W9P A;  4ODN A;  4DH0 A;  2AWG A;  4DRM A;  4G50 A;  4DRO A;  2UZ5 A;  5DIT A;  1A7X A;  4DRJ A;  4GIV A;  4LAY A;  4U84 A;  4LAW A;  1FKK A;  2ZQS A;  3IKG A;  4W9Q A;  2IF4 A;  2XPA A;  3I6C A;  3KAC A;  3O5K A;  1EQ3 A;  3ODK A;  5HUA A;  1BL4 A;  4QIB A;  4ODL A;  2PBC A;  4O2T A;  3O5R A;  2RQS A;  2FAP A;  1L1P A;  2XP5 A;  3WH0 A;  2XPB A;  4DT4 A;  4LAX A;  1KT0 A;  4J4N A;  2LPV A;  2PPN A;  4NNR A;  2MNT A;  3UQA A;  2RUR A;  3O5D A;  3UQB A;  1QPF A;  1Q6H A;  1N1A A;  2PPP A;  2LJ4 A;  2PV1 A;  3PA7 A;  4J4O A;  3KAD A;  2MLZ A;  4MGV A;  3TCZ A;  4JYS A;  1HXV A;  4MSP A;  1FKI A;  4W9O A;  1FJD A;  2ZR5 A;  2XP6 A;  2KE0 A;  5HWC A;  5BXJ A;  2XP8 A;  2PV2 A;  1QZ2 A;  4JFI A;  4IQ2 A;  1FKS A;  1YW5 A;  3O5J A;  2MLX A;  2XP7 A;  4JFJ A;  4QT2 A;  3RGC A;  3UI5 A;  2RSE A;  1Q6U A;  2RUD A;  2F21 A;  1J6Y A;  2K8I A;  2OFN A;  3LUO A;  3OOB A;  3B7X A;  3KAF A;  1D7H A;  3TC5 A;  3JXV A;  4IPX A;  3GPK A;  5DIU A;  1FKT A;  1PBK A;  5D75 A;  3JYM A;  1Q1C A;  3KAG A;  1U79 A;  3EY6 A;  3IK8 A;  2VN1 A;  5I98 A;  1JNS A;  2KI3 A;  1P5Q A;  3VAW A;  1ROU A;  2Y78 A;  1EYM A;  2KFW A;  5GPG A;  1JVW A;  3O5L A;  2DG4 A;  3O5Q A;  4JFM A;  2ZQU A;  1R9H A;  2MLY A;  3FAP A;  4ODR A;  1D7J A;  3KAB A;  1ROT A;  3IKD A;  2ITK A;  4DRH A;  5B8I C;  2M1I A;  1D7I A;  2VCD A;  1T11 A;  4DZ2 A;  2JZV A;  4TW6 A;  1NMV A;  1C9H A;  1D6O A;  4G2P A;  1YAT A;  2KR7 A;  4U86 A;  1QPL A;  2LKN A;  4BF8 A;  3O5F A;  1FAP A;  2XP3 A;  4ODP A;  1PIN A;  4U85 A;  2F4E A;  1J4R A;  2LGO A;  3NI6 A;  4GGQ A;  4N19 A;  1J4I A;  4TNS A;  4DRK A;  1FD9 A;  4FN2 A;  5HWB A;  1FKF A;  4QT3 A;  2M2A A;  1NMW A;  3UF8 A;  3NRK A;  3CGN A;  2M08 A;  3O5O A;  4DRQ A;  4DRN A;  5HT1 A;  4DIP A;  2ZR4 A;  5HW7 A;  2ZQT A;  4TW8 A;  1W26 A;  2FKE A;  3O5I A;  1B6C A;  4FAP A;  4ODQ A;  4TX0 A;  1FKG A;  3H9R B;  3RFW A;  3O5P A;  3KAI A;  1FKL A;  4ODO A;  2MPH A;  1BKF A;  2D9F A;  4LAV A;  1F40 A;  2ZR6 A;  5HW6 A;  4DRI A;  4C02 B;  1F8A B;  3NTP A;  1KT1 A;  4DZ3 A;  4JFL A;  2DG3 A;  4ITZ A;  4R0X A;  1M5Y A;  1FKB A;  2L2S A;  2F2D A;  3KCE A;  3UI6 A;  3TDB A;  3PRB A;  1ZK6 A;  2DG9 A;  3JYJ A;  3PRD A;  5HTG A;  2Q5A A;  1FKH A;  2XP4 A;  2XP9 A;  3KZ7 A;  1NSG A;  3O5G A;  1Y0O A;  4TYO A; 
#chains in the Genus database with same CATH topology
 4ODK A;  3GTY X;  3MDY B;  1UR8 A;  1LJY A;  2KO7 A;  1J4H A;  3ARX A;  1FKD A;  5J6E A;  1JNT A;  4HBO A;  1W9V A;  4ODN A;  4DRO A;  1H0G A;  1NWS A;  1A7X A;  4GIV A;  3ALG A;  2IF4 A;  2ESC A;  1BL4 A;  4QIB A;  1ZBC A;  4ODL A;  2DT1 A;  3O5R A;  3AS3 A;  1E6Z A;  2FAP A;  1L1P A;  2XP5 A;  4PTM A;  4DT4 A;  4LAX A;  4ZPW R;  1LQ0 A;  1K9T A;  1LG2 A;  1SYT A;  1XRV A;  3CZ8 A;  1KFW A;  1QPF A;  2B31 A;  2PV1 A;  3CHC A;  3CHF A;  4MGV A;  2MLZ A;  4JYS A;  4DWS A;  1WAW A;  4W9O A;  2KE0 A;  5HWC A;  5BXJ A;  1LL4 A;  2ETN A;  1HJX A;  3RGC A;  1FKS A;  1YW5 A;  2WLY A;  3UI5 A;  1Q6U A;  1J6Y A;  2K8I A;  3LUO A;  3ART A;  3W4R A;  1JNE A;  5D75 A;  3JYM A;  3KAG A;  3VAW A;  4HBE A;  1LG1 A;  2YBT A;  2KFW A;  1VF8 A;  2P4V A;  1ZBW A;  2ITK A;  4DRH A;  1D7I A;  4WKH A;  2B5U B;  2JZV A;  1C9H A;  1D6O A;  4BF8 A;  1YAT A;  1XHG A;  1D2K A;  1HKI A;  2LKN A;  3CH9 A;  4P8W A;  2XP3 A;  4P8V A;  4P8X A;  4TNS A;  1FD9 A;  2DT2 A;  3G6L A;  1FKF A;  4QT3 A;  4WKA A;  1ZBV A;  1NMW A;  3NRK A;  1W1P A;  3CGN A;  5HW7 A;  4DIP A;  2ZR4 A;  2ZQT A;  2A3E A;  1OWQ A;  3O5P A;  1FKL A;  2D9F A;  5HW6 A;  4DRI A;  2O92 A;  1EDQ A;  4ITZ A;  4R0X A;  4MNJ A;  3KCE A;  2OLH A;  3WD2 A;  3TDB A;  3PRB A;  1ZK6 A;  5HTG A;  3BXW A;  3O5G A;  4UDM A;  1W9U A;  2ZQV A;  1FKJ A;  3UI4 A;  4ZPT R;  2KGJ A;  3RM4 A;  2MF9 A;  5HKG A;  5HW8 A;  2PPO A;  2AOS A;  3CGM A;  3IHZ A;  2PN0 A;  2RUQ A;  1ZCN A;  3ARY A;  4IQC A;  4DRM A;  4Z2J A;  1W1V A;  2AWG A;  3ARU A;  4Q22 A;  1SR0 A;  4DWS C;  1X6L A;  3PR9 A;  4U84 A;  4LAW A;  3RM9 A;  3I6C A;  1ZL1 A;  3ODK A;  1E9L A;  2XPB A;  1ITX A;  1CTN A;  2LPV A;  4NNR A;  1HKJ A;  2MNT A;  1UR9 A;  3AS2 A;  1HJV A;  3PA7 A;  2LJ4 A;  4J4O A;  3KAD A;  2DSW A;  2F23 A;  3ARS A;  4MTV A;  2PV2 A;  1E15 A;  4L3N A;  4XAK A;  2XP7 A;  4QT2 A;  2RUD A;  4IT4 A;  2OFN A;  3B9E A;  3JXV A;  4IPX A;  3GPK A;  1PBK A;  2PI6 A;  3EY6 A;  3IK8 A;  3WQV A;  2VN1 A;  5I98 A;  2KI3 A;  1P5Q A;  1FFQ A;  3WIJ A;  3O5Q A;  4JFM A;  4ODR A;  5GQB A;  1ROT A;  3IKD A;  2M1I A;  1NWU A;  2VCD A;  1T11 A;  1NMV A;  2KR7 A;  3WQW A;  1QPL A;  2WK2 A;  4N19 A;  1J4I A;  4DRK A;  3AS0 A;  4MPK A;  2M2A A;  4DRQ A;  5HT1 A;  4S3J A;  4TW8 A;  1W26 A;  1W1Y A;  4FAP A;  1IX5 A;  4W5U A;  4WIW A;  3GU0 A;  2ZR6 A;  1HJW A;  2DT0 A;  4DZ3 A;  4JFL A;  2DG3 A;  1W1T A;  3B9A A;  1FKB A;  3WKZ A;  4MNM A;  1HKM A;  2XP4 A;  1X6N A;  2XP9 A;  1NSG A;  4QZV B;  1NWR A;  1GOI A;  3ARP A;  4ML4 A;  4DRP A;  1FKR A;  3KAH A;  1TCO C;  2G8Z A;  4P8U A;  3ALF A;  3CHD A;  2N87 A;  4MNK A;  3O5M A;  3O5E A;  3UQI A;  1E6N A;  4JFK A;  5GPR A;  4DRN A;  4G50 A;  2DSZ A;  5DIT A;  3FXY A;  1GUV A;  3IKG A;  2WM0 A;  1OGB A;  3QOK A;  2XPA A;  4W9Q A;  4WKF A;  4MNL A;  2YBU A;  2PBC A;  4O2T A;  3WL0 A;  3RME A;  1KT0 A;  4J4N A;  2PPN A;  1GPF A;  3O5D A;  4DWS B;  1Q6H A;  2PPP A;  1HXV A;  2WLZ A;  3BMB A;  4URI A;  4MSP A;  2ZR5 A;  2XP6 A;  1ZB5 A;  3B8S A;  1QZ2 A;  1RD6 A;  3O5J A;  2MLX A;  4JFJ A;  4Q7N A;  2A3C A;  2F21 A;  2A3A A;  3OOB A;  3TC5 A;  1Q1C A;  1W9P A;  3PRA A;  2Y78 A;  1EYM A;  1JVW A;  1R9H A;  2MLY A;  3FAP A;  1E44 A;  3ARQ A;  2DPE A;  2G41 A;  4U86 A;  3O5F A;  4ODP A;  4U85 A;  2F4E A;  3NI6 A;  2LGO A;  3FY1 A;  3UF8 A;  2M08 A;  3EIP A;  3O5I A;  4Z2H A;  3WD3 A;  4ODQ A;  4TX0 A;  1FKG A;  3H9R B;  1E6P A;  3KAI A;  2MPH A;  4C02 B;  2FDM A;  1F8A B;  3NTP A;  1NWT A;  4S3K A;  3WD4 A;  3WD0 A;  3UI6 A;  3JYJ A;  3PRD A;  1H0I A;  4HAR A;  3KZ7 A;  4Z2K A;  4NSB A;  4KQZ A;  1E6R A;  2DSU A;  2PV3 A;  1ZBK A;  1Q6I A;  3WD1 A;  4ODM A;  1LL6 A;  1OGG A;  5DIV A;  3B9D A;  2RUC A;  2DSV A;  4TW7 A;  5DEZ A;  1EIB A;  4W9P A;  4LGX A;  4WK9 A;  4DH0 A;  2UZ5 A;  4L72 B;  3ARV A;  4DRJ A;  4LAY A;  1FKK A;  1HKK A;  1ZU8 A;  2ZQS A;  3O5K A;  3KAC A;  1EQ3 A;  5HUA A;  4WJX A;  2RQS A;  4R5E A;  4Z2G A;  2EUL A;  3WH0 A;  4ZPV R;  3ARW A;  4ZS6 A;  1JCH B;  1O6I A;  3UQA A;  2RUR A;  1JND A;  3UQB A;  1N1A A;  2A3B A;  1WB0 A;  1NH6 A;  3TCZ A;  3OA5 A;  3ARR A;  1FKI A;  1FJD A;  4NZC A;  2XP8 A;  2IUZ A;  4JFI A;  4IQ2 A;  2RSE A;  4IT6 A;  3B7X A;  1FFR A;  3KAF A;  1D7H A;  5DIU A;  1FKT A;  3G6M A;  1U79 A;  1JNS A;  3AS1 A;  1ROU A;  2O9O A;  5GPG A;  4Z2I A;  3O5L A;  2DG4 A;  2ZQU A;  1D7J A;  3KAB A;  5HBF A;  5B8I C;  3ARO A;  3AQU A;  5DO2 A;  4DZ2 A;  4AY1 A;  4TW6 A;  4G2P A;  1FAP A;  1PIN A;  1J4R A;  4GGQ A;  4FN2 A;  1WNO A;  4DWS D;  5HWB A;  2DT3 A;  3O5O A;  4Z2L A;  2FKE A;  1B6C A;  4KR0 B;  3CHE A;  3RFW A;  1EHN A;  2QF8 A;  4ODO A;  1BKF A;  5DF0 A;  4LAV A;  1F40 A;  3ARZ A;  1KT1 A;  3WL1 A;  1M5Y A;  3RM8 A;  2L2S A;  2F2D A;  1TFV A;  5JH8 A;  2DG9 A;  2Q5A A;  1FKH A;  4MAV A;  1LL7 A;  1GRJ A;  1Y0O A;  4TYO A; 
#chains in the Genus database with same CATH homology
 4ODK A;  3MDY B;  1UR8 A;  1LJY A;  2KO7 A;  1J4H A;  3ARX A;  1FKD A;  5J6E A;  1JNT A;  4HBO A;  1W9V A;  4ODN A;  4DRO A;  1H0G A;  1NWS A;  1A7X A;  4GIV A;  3ALG A;  2IF4 A;  2ESC A;  1BL4 A;  4QIB A;  1ZBC A;  4ODL A;  2DT1 A;  3O5R A;  3AS3 A;  1E6Z A;  2FAP A;  1L1P A;  2XP5 A;  4PTM A;  4DT4 A;  4LAX A;  4ZPW R;  1LQ0 A;  1K9T A;  1LG2 A;  1SYT A;  1XRV A;  3CZ8 A;  1KFW A;  1QPF A;  2B31 A;  2PV1 A;  3CHC A;  3CHF A;  4MGV A;  2MLZ A;  4JYS A;  4DWS A;  1WAW A;  4W9O A;  2KE0 A;  5HWC A;  5BXJ A;  1LL4 A;  1HJX A;  3RGC A;  1FKS A;  1YW5 A;  2WLY A;  3UI5 A;  1Q6U A;  1J6Y A;  2K8I A;  3LUO A;  3ART A;  3W4R A;  1JNE A;  5D75 A;  3JYM A;  3KAG A;  3VAW A;  4HBE A;  1LG1 A;  2YBT A;  2KFW A;  1VF8 A;  1ZBW A;  2ITK A;  4DRH A;  1D7I A;  4WKH A;  2JZV A;  1C9H A;  1D6O A;  4BF8 A;  1YAT A;  1XHG A;  1D2K A;  1HKI A;  2LKN A;  3CH9 A;  4P8W A;  2XP3 A;  4P8V A;  4P8X A;  4TNS A;  1FD9 A;  2DT2 A;  3G6L A;  1FKF A;  4QT3 A;  4WKA A;  1ZBV A;  1NMW A;  3NRK A;  1W1P A;  3CGN A;  5HW7 A;  4DIP A;  2ZR4 A;  2ZQT A;  2A3E A;  1OWQ A;  3O5P A;  1FKL A;  2D9F A;  5HW6 A;  4DRI A;  2O92 A;  1EDQ A;  4ITZ A;  4R0X A;  4MNJ A;  3KCE A;  2OLH A;  3WD2 A;  3TDB A;  3PRB A;  1ZK6 A;  5HTG A;  3BXW A;  3O5G A;  1W9U A;  2ZQV A;  1FKJ A;  3UI4 A;  4ZPT R;  2KGJ A;  3RM4 A;  2MF9 A;  5HKG A;  5HW8 A;  2PPO A;  2AOS A;  3CGM A;  3IHZ A;  2RUQ A;  1ZCN A;  3ARY A;  4IQC A;  4DRM A;  4Z2J A;  1W1V A;  2AWG A;  3ARU A;  4Q22 A;  1SR0 A;  4DWS C;  1X6L A;  3PR9 A;  4U84 A;  4LAW A;  3RM9 A;  3I6C A;  1ZL1 A;  3ODK A;  1E9L A;  2XPB A;  1ITX A;  1CTN A;  2LPV A;  4NNR A;  1HKJ A;  2MNT A;  1UR9 A;  3AS2 A;  1HJV A;  3PA7 A;  2LJ4 A;  4J4O A;  3KAD A;  2DSW A;  3ARS A;  4MTV A;  2PV2 A;  1E15 A;  4L3N A;  4XAK A;  2XP7 A;  4QT2 A;  2RUD A;  4IT4 A;  2OFN A;  3B9E A;  3JXV A;  4IPX A;  3GPK A;  1PBK A;  2PI6 A;  3EY6 A;  3IK8 A;  3WQV A;  2VN1 A;  5I98 A;  2KI3 A;  1P5Q A;  1FFQ A;  3WIJ A;  3O5Q A;  4JFM A;  4ODR A;  5GQB A;  1ROT A;  3IKD A;  2M1I A;  1NWU A;  2VCD A;  1T11 A;  1NMV A;  2KR7 A;  3WQW A;  1QPL A;  2WK2 A;  4N19 A;  1J4I A;  4DRK A;  3AS0 A;  4MPK A;  2M2A A;  4DRQ A;  5HT1 A;  4S3J A;  4TW8 A;  1W26 A;  1W1Y A;  4FAP A;  1IX5 A;  4W5U A;  4WIW A;  2ZR6 A;  1HJW A;  2DT0 A;  4DZ3 A;  4JFL A;  2DG3 A;  1W1T A;  3B9A A;  1FKB A;  3WKZ A;  4MNM A;  1HKM A;  2XP4 A;  1X6N A;  2XP9 A;  1NSG A;  4QZV B;  1NWR A;  1GOI A;  3ARP A;  4ML4 A;  4DRP A;  1FKR A;  3KAH A;  1TCO C;  2G8Z A;  4P8U A;  3ALF A;  3CHD A;  2N87 A;  4MNK A;  3O5M A;  3O5E A;  3UQI A;  1E6N A;  4JFK A;  5GPR A;  4DRN A;  4G50 A;  2DSZ A;  5DIT A;  3FXY A;  1GUV A;  3IKG A;  2WM0 A;  1OGB A;  3QOK A;  2XPA A;  4W9Q A;  4WKF A;  4MNL A;  2YBU A;  2PBC A;  4O2T A;  3WL0 A;  3RME A;  1KT0 A;  4J4N A;  2PPN A;  1GPF A;  3O5D A;  4DWS B;  1Q6H A;  2PPP A;  1HXV A;  2WLZ A;  4URI A;  4MSP A;  2ZR5 A;  2XP6 A;  1ZB5 A;  3B8S A;  1QZ2 A;  1RD6 A;  3O5J A;  2MLX A;  4JFJ A;  4Q7N A;  2A3C A;  2F21 A;  2A3A A;  3OOB A;  3TC5 A;  1Q1C A;  1W9P A;  3PRA A;  2Y78 A;  1EYM A;  1JVW A;  1R9H A;  2MLY A;  3FAP A;  3ARQ A;  2DPE A;  2G41 A;  4U86 A;  3O5F A;  4ODP A;  4U85 A;  2F4E A;  3NI6 A;  2LGO A;  3FY1 A;  3UF8 A;  2M08 A;  3O5I A;  4Z2H A;  3WD3 A;  4ODQ A;  4TX0 A;  1FKG A;  3H9R B;  1E6P A;  3KAI A;  2MPH A;  4C02 B;  2FDM A;  1F8A B;  3NTP A;  1NWT A;  4S3K A;  3WD4 A;  3WD0 A;  3UI6 A;  3JYJ A;  3PRD A;  1H0I A;  4HAR A;  3KZ7 A;  4Z2K A;  4NSB A;  4KQZ A;  1E6R A;  2DSU A;  2PV3 A;  1ZBK A;  1Q6I A;  3WD1 A;  4ODM A;  1LL6 A;  1OGG A;  5DIV A;  3B9D A;  2RUC A;  2DSV A;  4TW7 A;  5DEZ A;  1EIB A;  4W9P A;  4LGX A;  4WK9 A;  4DH0 A;  2UZ5 A;  4L72 B;  3ARV A;  4DRJ A;  4LAY A;  1FKK A;  1HKK A;  1ZU8 A;  2ZQS A;  3O5K A;  3KAC A;  1EQ3 A;  5HUA A;  4WJX A;  2RQS A;  4R5E A;  4Z2G A;  3WH0 A;  4ZPV R;  3ARW A;  4ZS6 A;  1O6I A;  3UQA A;  2RUR A;  1JND A;  3UQB A;  1N1A A;  2A3B A;  1WB0 A;  1NH6 A;  3TCZ A;  3OA5 A;  3ARR A;  1FKI A;  1FJD A;  4NZC A;  2XP8 A;  2IUZ A;  4JFI A;  4IQ2 A;  2RSE A;  4IT6 A;  3B7X A;  1FFR A;  3KAF A;  1D7H A;  5DIU A;  1FKT A;  3G6M A;  1U79 A;  1JNS A;  3AS1 A;  1ROU A;  2O9O A;  5GPG A;  4Z2I A;  3O5L A;  2DG4 A;  2ZQU A;  1D7J A;  3KAB A;  5HBF A;  5B8I C;  3ARO A;  3AQU A;  5DO2 A;  4DZ2 A;  4AY1 A;  4TW6 A;  4G2P A;  1FAP A;  1PIN A;  1J4R A;  4GGQ A;  4FN2 A;  1WNO A;  4DWS D;  5HWB A;  2DT3 A;  3O5O A;  4Z2L A;  2FKE A;  1B6C A;  4KR0 B;  3CHE A;  3RFW A;  1EHN A;  2QF8 A;  4ODO A;  1BKF A;  5DF0 A;  4LAV A;  1F40 A;  3ARZ A;  1KT1 A;  3WL1 A;  1M5Y A;  3RM8 A;  2L2S A;  2F2D A;  1TFV A;  5JH8 A;  2DG9 A;  2Q5A A;  1FKH A;  4MAV A;  1LL7 A;  1Y0O A;  4TYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...