4R0XA

Allosteric coupling of conformational transitions in the fk1 domain of fkbp51 near the site of steroid receptor interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
MEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPGIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of Conformational Transitions in the N-terminal Domain of the 51-kDa FK506-binding Protein (FKBP51) Near Its Site of Interaction with the Steroid Receptor Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 30
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4r0xA00
1QZ2A 2FAPA 4FAPA 4U85A 3H9RB 1KT0A 4DRJA 3O5RA 1ZK6A 2ZR6A 2PV2A 5HW6A 4DZ2A 4DRPA 2M1IA 2VN1A 1ROUA 2RSEA 2KO7A 2LGOA 3UQIA 2MLZA 4ODPA 1M5YA 3O5KA 4NNRA 4U84A 2F4EA 2JZVA 1Y0OA 1N1AA 3O5DA 4QIBA 1FKLA 1Q1CA 3IKGA 2ITKA 5HW7A 3KACA 3JYJA 3KAGA 4C02B 4QT3A 2RQSA 3IK8A 3UF8A 4QT2A 2K8IA 4DRIA 3KAHA 3RFWA 1NMWA 4DROA 5HWBA 2XP8A 1D7IA 3CGMA 4LAXA 3JYMA 2F21A 4DIPA 3UQBA 3I6CA 3O5IA 1FAPA 1F8AB 2VCDA 4J4OA 4JFKA 4DH0A 4DRQA 1JNSA 3CGNA 1NMVA 4W9OA 1D6OA 1FKRA 1J4RA 2OFNA 2AWGA 1FJDA 2ZQVA 4DRMA 3UQAA 2KI3A 4ODRA 4TW6A 5DIUA 1Q6HA 2PPPA 4JYSA 4G2PA 1FKFA 2RUCA 2RUQA 1FKIA 3WH0A 1FKJA 2XPAA 4ODMA 3O5PA 5D75A 2PPOA 3O5GA 1FKDA 1ROTA 2Y78A 2ZQSA 1PBKA 5DIVA 4ITZA 4J4NA 1J4HA 1D7HA 3OOBA 4O2TA 4ODKA 3TC5A 1NSGA 2PV3A 1F40A 3O5JA 1FKGA 3B7XA 1BL4A 4MGVA 3KAIA 1U79A 2RURA 1A7XA 3ODKA 2XPBA 2LJ4A 2PPNA 2N87A 2XP6A 4LAVA 2LPVA 1JVWA 2ZQTA 3O5QA 1TCOC 5BXJA 2ZQUA 4JFMA 2IF4A 4DRHA 1D7JA 1FKKA 5J6EA 3KABA 1W26A 3RGCA 3MDYB 4GIVA 5HT1A 1ZCNA 2KFWA 2L2SA 1YW5A 3JXVA 4DT4A 3NRKA 2D9FA 4GGQA 2DG3A 4ODNA 2XP4A 3PRDA 1FKBA 2KE0A 2UZ5A 4IPXA 1YATA 3TDBA 2KR7A 4ODQA 1PINA 5GPGA 3LUOA 4JFIA 5HTGA 1J6YA 3IHZA 4TW8A 4W9PA 4MSPA 4TYOA 3O5EA 5HUAA 5B8IC 2ZR4A 2M08A 1Q6UA 1FD9A 1QPLA 3KCEA 4TW7A 2LKNA 3KZ7A 5I98A 1B6CA 1KT1A 2MPHA 4N19A 4R0XA 1HXVA 4FN2A 1BKFA 2ZR5A 3O5MA 5HWCA 1EQ3A 1C9HA 3EY6A 3FAPA 3NI6A 2XP5A 1FKTA 2MLXA 1P5QA 4IQ2A 3UI4A 2DG9A 2MF9A 4U86A 4JFLA 3TCZA 5HW8A 4JFJA 3KADA 1J4IA 1Q6IA 2MLYA 2PV1A 2Q5AA 3O5FA 2RUDA 2M2AA 3UI6A 2XP7A 4DRKA 1T11A 3O5LA 4LAYA 4G50A 4ODOA 2PBCA 3IKDA 4TX0A 4DRNA 5HKGA 2XP3A 2FKEA 1R9HA 4IQCA 3VAWA 1FKSA 4W9QA 1QPFA 3GPKA 3KAFA 4LAWA 3UI5A 4DZ3A 4ODLA 1EYMA 2KGJA 3PA7A 4TNSA 1FKHA 3PRBA 2MNTA 5DITA 1JNTA 2F2DA 3O5OA 1L1PA 4BF8A 2XP9A 3NTPA 2DG4A
chains in the Genus database with same CATH superfamily
3B8SA 3H9RB 4W5UA 1W9PA 4DRJA 3O5RA 1ZK6A 4UDMA 1ROUA 1ZBVA 2JZVA 4XAKA 1FKLA 3IKGA 4MNLA 3KACA 3JYJA 1ZBCA 4Z2GA 2VCDA 4DRQA 2P4VA 2B5UB 1D6OA 1FKRA 3B9DA 3ARPA 2OFNA 4HARA 1FJDA 1E6PA 4ODRA 5DIUA 1O6IA 3ARXA 4JYSA 4ZPVR 4G2PA 4DWSA 2PPOA 3O5GA 1W1PA 1LQ0A 5DIVA 1D7HA 3OOBA 5DEZA 2YBUA 1FKGA 3B7XA 4MGVA 1A7XA 3ARUA 4HBEA 2PPNA 1LL6A 5BXJA 4DRHA 1XRVA 4DWSD 3CHEA 3MDYB 1ZCNA 2KFWA 2PN0A 2G8ZA 1ZL1A 2KE0A 4IPXA 5GPGA 1ZBKA 4JFIA 3QOKA 4W9PA 4TYOA 1D2KA 1CTNA 5B8IC 2ZR4A 1QPLA 3KCEA 1FD9A 1K9TA 4NZCA 1B6CA 1KT1A 2OLHA 2AOSA 3FAPA 4IQ2A 2DSUA 1P5QA 3WKZA 4DWSC 3KADA 2Q5AA 3O5FA 2M2AA 4LAYA 4S3JA 4DRNA 2XP3A 3WQWA 3GPKA 3KAFA 2WLZA 4DZ3A 3PA7A 1FKHA 2DPEA 3PRBA 5DITA 1JNTA 3B9AA 3O5OA 1L1PA 2ZR5A 1ZB5A 2DT0A 2FAPA 4WKFA 2DSWA 4DRPA 2VN1A 4WKAA 2LGOA 1GOIA 4ODPA 3W4RA 4Q22A 1N1AA 3O5DA 1JNEA 4QT3A 2RQSA 1H0GA 4DRIA 5DO2A 1OGGA 1D7IA 3CGMA 3JYMA 3UQBA 3I6CA 1FAPA 2A3BA 4J4OA 1JNSA 4NSBA 4W9OA 3CHCA 3AROA 2WLYA 3UQAA 1Q6HA 1UR9A 1LG1A 2XPAA 4Z2JA 1E6ZA 2Y78A 4WK9A 4J4NA 1J4HA 4O2TA 3TC5A 2PV3A 3O5JA 1RD6A 1E6RA 1U79A 2YBTA 1LL4A 2XP6A 2N87A 3WIJA 2ZQTA 3O5QA 1TCOC 3FY1A 1FKKA 3KABA 5HT1A 1XHGA 2DSVA 2L2SA 1YW5A 5JH8A 1SYTA 3NRKA 3WD4A 2D9FA 4GGQA 4MTVA 4ODNA 3CH9A 1UR8A 3PRDA 1FKBA 1E15A 1YATA 2KR7A 4ODQA 3ARRA 3AS2A 4IT6A 4WKHA 3O5EA 5HUAA 5I98A 2LKNA 2MPHA 1VF8A 4N19A 4S3KA 3ARSA 2MF9A 4JFLA 1HKIA 2MLYA 2RUDA 1NWRA 3O5LA 4P8XA 3RM9A 1X6NA 2A3CA 2FKEA 3VAWA 3ALGA 4ODLA 2KGJA 5DF0A 2MNTA 1W1YA 3NI6A 2DG4A 1QZ2A 3BMBA 4MAVA 3CHDA 3ARTA 2ZR6A 1WAWA 2PV2A 5HW6A 3WD3A 2M1IA 2KO7A 4Z2KA 3UQIA 4Z2HA 2MLZA 3ARYA 4U84A 2DT3A 3ARQA 4P8WA 4QIBA 1Q1CA 1ZBWA 5HW7A 1NWUA 3AS1A 4QT2A 1SR0A 4HBOA 3RFWA 1NMWA 1OWQA 3WD2A 3G6MA 4LAXA 2F21A 3O5IA 1F8AB 3PR9A 3CGNA 3RM8A 1LL7A 3AQUA 1JCHB 2ESCA 2ZQVA 2KI3A 4TW6A 2PPPA 4MPKA 3AS3A 1FKFA 2A3AA 2RUQA 3WH0A 1FKJA 3O5PA 5D75A 3WL0A 4KR0B 3BXWA 1IX5A 1E44A 1LG2A 1NSGA 1F40A 4MNJA 4ML4A 3WD0A 1BL4A 3KAIA 2RURA 5GPRA 2F23A 3ODKA 2LPVA 1HJWA 1EDQA 2ZQUA 4JFMA 3WL1A 5J6EA 2B31A 4DT4A 2DG3A 4L72B 1FFRA 1W1TA 3ALFA 3TDBA 1FFQA 1PINA 3LUOA 5HTGA 3IHZA 4Q7NA 1H0IA 1WNOA 4P8UA 2A3EA 4R5EA 4ZS6A 1HXVA 1BKFA 5HWCA 1C9HA 4KQZA 2MLXA 2IUZA 3CZ8A 2DG9A 2ETNA 4JFJA 1J4IA 1Q6IA 4ZPWR 2PV1A 3UI6A 4PTMA 1GPFA 1T11A 4QZVB 3ARWA 2G41A 4ODOA 3IKDA 5HKGA 1R9HA 4IQCA 1NH6A 1FKSA 3UI5A 1EYMA 4Z2LA 1HJXA 2F2DA 2XP9A 3NTPA 4FAPA 4U85A 1HKMA 1KT0A 3GTYX 4DZ2A 1EIBA 4MNKA 2RSEA 3EIPA 1M5YA 3O5KA 4NNRA 4AY1A 1WB0A 2F4EA 3RMEA 1TFVA 1Y0OA 2ITKA 3WQVA 3KAGA 4C02B 4ZPTR 3IK8A 4P8VA 4WIWA 3UF8A 2K8IA 3KAHA 4DROA 1E9LA 4Z2IA 5HWBA 2XP8A 5GQBA 1GRJA 4DIPA 3RM4A 4JFKA 1HKJA 1OGBA 4DH0A 1NMVA 3G6LA 1J4RA 2AWGA 4DRMA 3B9EA 2WK2A 2RUCA 1FKIA 4ODMA 1FKDA 1ROTA 2ZQSA 3FXYA 3WD1A 1PBKA 4ITZA 3PRAA 4ODKA 3ARZA 1HKKA 3AS0A 3OA5A 2XPBA 2LJ4A 4LAVA 1JVWA 3GU0A 1JNDA 2IF4A 1D7JA 4WJXA 3RGCA 1NWSA 1W26A 4GIVA 3CHFA 1GUVA 2FDMA 3JXVA 2QF8A 1X6LA 4LGXA 1W9UA 1W9VA 2XP4A 3ARVA 2UZ5A 1KFWA 2EULA 2PI6A 1J6YA 2WM0A 4TW8A 4MSPA 1NWTA 4URIA 2M08A 1Q6UA 4MNMA 4TW7A 3KZ7A 4DWSB 4R0XA 2DT2A 4FN2A 3O5MA 5HBFA 1EQ3A 3EY6A 1E6NA 2XP5A 1HJVA 1FKTA 1W1VA 4L3NA 3UI4A 2O9OA 2O92A 4U86A 3TCZA 5HW8A 1ITXA 2XP7A 4DRKA 4IT4A 4G50A 2PBCA 4TX0A 1ZU8A 2DT1A 4W9QA 1QPFA 4LAWA 4TNSA 1EHNA 1LJYA 2DSZA 4BF8A
chains in the Genus database with same CATH topology
3B8SA 3H9RB 4W5UA 1W9PA 4DRJA 3O5RA 1ZK6A 1ROUA 1ZBVA 2JZVA 4XAKA 1FKLA 3IKGA 4MNLA 3KACA 3JYJA 1ZBCA 4Z2GA 2VCDA 4DRQA 1D6OA 1FKRA 3B9DA 3ARPA 2OFNA 4HARA 1FJDA 1E6PA 4ODRA 5DIUA 1O6IA 3ARXA 4JYSA 4ZPVR 4G2PA 4DWSA 2PPOA 3O5GA 1W1PA 1LQ0A 5DIVA 1D7HA 3OOBA 5DEZA 2YBUA 1FKGA 3B7XA 4MGVA 1A7XA 3ARUA 4HBEA 2PPNA 1LL6A 5BXJA 4DRHA 1XRVA 4DWSD 3CHEA 3MDYB 1ZCNA 2KFWA 2G8ZA 1ZL1A 2KE0A 4IPXA 5GPGA 1ZBKA 4JFIA 3QOKA 4W9PA 4TYOA 1D2KA 1CTNA 5B8IC 2ZR4A 1QPLA 3KCEA 1FD9A 1K9TA 4NZCA 1B6CA 1KT1A 2OLHA 2AOSA 3FAPA 4IQ2A 2DSUA 1P5QA 3WKZA 4DWSC 3KADA 2Q5AA 3O5FA 2M2AA 4LAYA 4S3JA 4DRNA 2XP3A 3WQWA 3GPKA 3KAFA 2WLZA 4DZ3A 3PA7A 1FKHA 2DPEA 3PRBA 5DITA 1JNTA 3B9AA 3O5OA 1L1PA 2ZR5A 1ZB5A 2DT0A 2FAPA 4WKFA 2DSWA 4DRPA 2VN1A 4WKAA 2LGOA 1GOIA 4ODPA 3W4RA 4Q22A 1N1AA 3O5DA 1JNEA 4QT3A 2RQSA 1H0GA 4DRIA 5DO2A 1OGGA 1D7IA 3CGMA 3JYMA 3UQBA 3I6CA 1FAPA 2A3BA 4J4OA 1JNSA 4NSBA 4W9OA 3CHCA 3AROA 2WLYA 3UQAA 1Q6HA 1UR9A 1LG1A 2XPAA 4Z2JA 1E6ZA 2Y78A 4WK9A 4J4NA 1J4HA 4O2TA 3TC5A 2PV3A 3O5JA 1RD6A 1E6RA 1U79A 2YBTA 1LL4A 2XP6A 2N87A 3WIJA 2ZQTA 3O5QA 1TCOC 3FY1A 1FKKA 3KABA 5HT1A 1XHGA 2DSVA 2L2SA 1YW5A 5JH8A 1SYTA 3NRKA 3WD4A 2D9FA 4GGQA 4MTVA 4ODNA 3CH9A 1UR8A 3PRDA 1FKBA 1E15A 1YATA 2KR7A 4ODQA 3ARRA 3AS2A 4IT6A 4WKHA 3O5EA 5HUAA 5I98A 2LKNA 2MPHA 1VF8A 4N19A 4S3KA 3ARSA 2MF9A 4JFLA 1HKIA 2MLYA 2RUDA 1NWRA 3O5LA 4P8XA 3RM9A 1X6NA 2A3CA 2FKEA 3VAWA 3ALGA 4ODLA 2KGJA 5DF0A 2MNTA 1W1YA 3NI6A 2DG4A 1QZ2A 4MAVA 3CHDA 3ARTA 2ZR6A 1WAWA 2PV2A 5HW6A 3WD3A 2M1IA 2KO7A 4Z2KA 3UQIA 4Z2HA 2MLZA 3ARYA 4U84A 2DT3A 3ARQA 4P8WA 4QIBA 1Q1CA 1ZBWA 5HW7A 1NWUA 3AS1A 4QT2A 1SR0A 4HBOA 3RFWA 1NMWA 1OWQA 3WD2A 3G6MA 4LAXA 2F21A 3O5IA 1F8AB 3PR9A 3CGNA 3RM8A 1LL7A 3AQUA 2ESCA 2ZQVA 2KI3A 4TW6A 2PPPA 4MPKA 3AS3A 1FKFA 2A3AA 2RUQA 3WH0A 1FKJA 3O5PA 5D75A 3WL0A 4KR0B 3BXWA 1IX5A 1LG2A 1NSGA 1F40A 4MNJA 4ML4A 3WD0A 1BL4A 3KAIA 2RURA 5GPRA 3ODKA 2LPVA 1HJWA 1EDQA 2ZQUA 4JFMA 3WL1A 5J6EA 2B31A 4DT4A 2DG3A 4L72B 1FFRA 1W1TA 3ALFA 3TDBA 1FFQA 1PINA 3LUOA 5HTGA 3IHZA 4Q7NA 1H0IA 1WNOA 4P8UA 2A3EA 4R5EA 4ZS6A 1HXVA 1BKFA 5HWCA 4KQZA 1C9HA 2MLXA 2IUZA 3CZ8A 2DG9A 4JFJA 1J4IA 1Q6IA 4ZPWR 2PV1A 3UI6A 4PTMA 1GPFA 1T11A 4QZVB 3ARWA 2G41A 4ODOA 3IKDA 5HKGA 1R9HA 4IQCA 1NH6A 1FKSA 3UI5A 1EYMA 4Z2LA 1HJXA 2F2DA 2XP9A 3NTPA 4FAPA 4U85A 1HKMA 1KT0A 4DZ2A 1EIBA 4MNKA 2RSEA 1M5YA 3O5KA 4NNRA 4AY1A 1WB0A 2F4EA 3RMEA 1TFVA 1Y0OA 2ITKA 3WQVA 3KAGA 4C02B 4ZPTR 3IK8A 4P8VA 4WIWA 3UF8A 2K8IA 3KAHA 4DROA 1E9LA 4Z2IA 5HWBA 2XP8A 5GQBA 4DIPA 3RM4A 4JFKA 1HKJA 1OGBA 4DH0A 1NMVA 3G6LA 1J4RA 2AWGA 4DRMA 3B9EA 2WK2A 2RUCA 1FKIA 4ODMA 1FKDA 1ROTA 2ZQSA 3FXYA 3WD1A 1PBKA 4ITZA 3PRAA 4ODKA 3ARZA 1HKKA 3AS0A 3OA5A 2XPBA 2LJ4A 4LAVA 1JVWA 1JNDA 2IF4A 1D7JA 4WJXA 3RGCA 1NWSA 1W26A 4GIVA 3CHFA 1GUVA 2FDMA 3JXVA 2QF8A 1X6LA 4LGXA 1W9UA 1W9VA 2XP4A 3ARVA 2UZ5A 1KFWA 2PI6A 1J6YA 2WM0A 4TW8A 4MSPA 1NWTA 4URIA 2M08A 1Q6UA 4MNMA 4TW7A 3KZ7A 4DWSB 4R0XA 2DT2A 4FN2A 3O5MA 5HBFA 1EQ3A 3EY6A 1E6NA 2XP5A 1HJVA 1FKTA 1W1VA 4L3NA 3UI4A 2O9OA 2O92A 4U86A 3TCZA 5HW8A 1ITXA 2XP7A 4DRKA 4IT4A 4G50A 2PBCA 4TX0A 1ZU8A 2DT1A 4W9QA 1QPFA 4LAWA 4TNSA 1EHNA 1LJYA 2DSZA 4BF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  2FAP A;  4FAP A;  4U85 A;  3H9R B;  1KT0 A;  4DRJ A;  3O5R A;  1ZK6 A;  2ZR6 A;  2PV2 A;  5HW6 A;  4DZ2 A;  4DRP A;  2M1I A;  2VN1 A;  1ROU A;  2RSE A;  2KO7 A;  2LGO A;  3UQI A;  2MLZ A;  4ODP A;  1M5Y A;  3O5K A;  4NNR A;  4U84 A;  2F4E A;  2JZV A;  1Y0O A;  1N1A A;  3O5D A;  4QIB A;  1FKL A;  1Q1C A;  3IKG A;  2ITK A;  5HW7 A;  3KAC A;  3JYJ A;  3KAG A;  4C02 B;  4QT3 A;  2RQS A;  3IK8 A;  3UF8 A;  4QT2 A;  2K8I A;  4DRI A;  3KAH A;  3RFW A;  1NMW A;  4DRO A;  5HWB A;  2XP8 A;  1D7I A;  3CGM A;  4LAX A;  3JYM A;  2F21 A;  4DIP A;  3UQB A;  3I6C A;  3O5I A;  1FAP A;  1F8A B;  2VCD A;  4J4O A;  4JFK A;  4DH0 A;  4DRQ A;  1JNS A;  3CGN A;  1NMV A;  4W9O A;  1D6O A;  1FKR A;  1J4R A;  2OFN A;  2AWG A;  1FJD A;  2ZQV A;  4DRM A;  3UQA A;  2KI3 A;  4ODR A;  4TW6 A;  5DIU A;  1Q6H A;  2PPP A;  4JYS A;  4G2P A;  1FKF A;  2RUC A;  2RUQ A;  1FKI A;  3WH0 A;  1FKJ A;  2XPA A;  4ODM A;  3O5P A;  5D75 A;  2PPO A;  3O5G A;  1FKD A;  1ROT A;  2Y78 A;  2ZQS A;  1PBK A;  5DIV A;  4ITZ A;  4J4N A;  1J4H A;  1D7H A;  3OOB A;  4O2T A;  4ODK A;  3TC5 A;  1NSG A;  2PV3 A;  1F40 A;  3O5J A;  1FKG A;  3B7X A;  1BL4 A;  4MGV A;  3KAI A;  1U79 A;  2RUR A;  1A7X A;  3ODK A;  2XPB A;  2LJ4 A;  2PPN A;  2N87 A;  2XP6 A;  4LAV A;  2LPV A;  1JVW A;  2ZQT A;  3O5Q A;  1TCO C;  5BXJ A;  2ZQU A;  4JFM A;  2IF4 A;  4DRH A;  1D7J A;  1FKK A;  5J6E A;  3KAB A;  1W26 A;  3RGC A;  3MDY B;  4GIV A;  5HT1 A;  1ZCN A;  2KFW A;  2L2S A;  1YW5 A;  3JXV A;  4DT4 A;  3NRK A;  2D9F A;  4GGQ A;  2DG3 A;  4ODN A;  2XP4 A;  3PRD A;  1FKB A;  2KE0 A;  2UZ5 A;  4IPX A;  1YAT A;  3TDB A;  2KR7 A;  4ODQ A;  1PIN A;  5GPG A;  3LUO A;  4JFI A;  5HTG A;  1J6Y A;  3IHZ A;  4TW8 A;  4W9P A;  4MSP A;  4TYO A;  3O5E A;  5HUA A;  5B8I C;  2ZR4 A;  2M08 A;  1Q6U A;  1FD9 A;  1QPL A;  3KCE A;  4TW7 A;  2LKN A;  3KZ7 A;  5I98 A;  1B6C A;  1KT1 A;  2MPH A;  4N19 A;  4R0X A;  1HXV A;  4FN2 A;  1BKF A;  2ZR5 A;  3O5M A;  5HWC A;  1EQ3 A;  1C9H A;  3EY6 A;  3FAP A;  3NI6 A;  2XP5 A;  1FKT A;  2MLX A;  1P5Q A;  4IQ2 A;  3UI4 A;  2DG9 A;  2MF9 A;  4U86 A;  4JFL A;  3TCZ A;  5HW8 A;  4JFJ A;  3KAD A;  1J4I A;  1Q6I A;  2MLY A;  2PV1 A;  2Q5A A;  3O5F A;  2RUD A;  2M2A A;  3UI6 A;  2XP7 A;  4DRK A;  1T11 A;  3O5L A;  4LAY A;  4G50 A;  4ODO A;  2PBC A;  3IKD A;  4TX0 A;  4DRN A;  5HKG A;  2XP3 A;  2FKE A;  1R9H A;  4IQC A;  3VAW A;  1FKS A;  4W9Q A;  1QPF A;  3GPK A;  3KAF A;  4LAW A;  3UI5 A;  4DZ3 A;  4ODL A;  1EYM A;  2KGJ A;  3PA7 A;  4TNS A;  1FKH A;  3PRB A;  2MNT A;  5DIT A;  1JNT A;  2F2D A;  3O5O A;  1L1P A;  4BF8 A;  2XP9 A;  3NTP A;  2DG4 A; 
#chains in the Genus database with same CATH topology
 3B8S A;  3H9R B;  4W5U A;  1W9P A;  4DRJ A;  3O5R A;  1ZK6 A;  4UDM A;  1ROU A;  1ZBV A;  2JZV A;  4XAK A;  1FKL A;  3IKG A;  4MNL A;  3KAC A;  3JYJ A;  1ZBC A;  4Z2G A;  2VCD A;  4DRQ A;  2P4V A;  2B5U B;  1D6O A;  1FKR A;  3B9D A;  3ARP A;  2OFN A;  4HAR A;  1FJD A;  1E6P A;  4ODR A;  5DIU A;  1O6I A;  3ARX A;  4JYS A;  4ZPV R;  4G2P A;  4DWS A;  2PPO A;  3O5G A;  1W1P A;  1LQ0 A;  5DIV A;  1D7H A;  3OOB A;  5DEZ A;  2YBU A;  1FKG A;  3B7X A;  4MGV A;  1A7X A;  3ARU A;  4HBE A;  2PPN A;  1LL6 A;  5BXJ A;  4DRH A;  1XRV A;  4DWS D;  3CHE A;  3MDY B;  1ZCN A;  2KFW A;  2PN0 A;  2G8Z A;  1ZL1 A;  2KE0 A;  4IPX A;  5GPG A;  1ZBK A;  4JFI A;  3QOK A;  4W9P A;  4TYO A;  1D2K A;  1CTN A;  5B8I C;  2ZR4 A;  1QPL A;  3KCE A;  1FD9 A;  1K9T A;  4NZC A;  1B6C A;  1KT1 A;  2OLH A;  2AOS A;  3FAP A;  4IQ2 A;  2DSU A;  1P5Q A;  3WKZ A;  4DWS C;  3KAD A;  2Q5A A;  3O5F A;  2M2A A;  4LAY A;  4S3J A;  4DRN A;  2XP3 A;  3WQW A;  3GPK A;  3KAF A;  2WLZ A;  4DZ3 A;  3PA7 A;  1FKH A;  2DPE A;  3PRB A;  5DIT A;  1JNT A;  3B9A A;  3O5O A;  1L1P A;  2ZR5 A;  1ZB5 A;  2DT0 A;  2FAP A;  4WKF A;  2DSW A;  4DRP A;  2VN1 A;  4WKA A;  2LGO A;  1GOI A;  4ODP A;  3W4R A;  4Q22 A;  1N1A A;  3O5D A;  1JNE A;  4QT3 A;  2RQS A;  1H0G A;  4DRI A;  5DO2 A;  1OGG A;  1D7I A;  3CGM A;  3JYM A;  3UQB A;  3I6C A;  1FAP A;  2A3B A;  4J4O A;  1JNS A;  4NSB A;  4W9O A;  3CHC A;  3ARO A;  2WLY A;  3UQA A;  1Q6H A;  1UR9 A;  1LG1 A;  2XPA A;  4Z2J A;  1E6Z A;  2Y78 A;  4WK9 A;  4J4N A;  1J4H A;  4O2T A;  3TC5 A;  2PV3 A;  3O5J A;  1RD6 A;  1E6R A;  1U79 A;  2YBT A;  1LL4 A;  2XP6 A;  2N87 A;  3WIJ A;  2ZQT A;  3O5Q A;  1TCO C;  3FY1 A;  1FKK A;  3KAB A;  5HT1 A;  1XHG A;  2DSV A;  2L2S A;  1YW5 A;  5JH8 A;  1SYT A;  3NRK A;  3WD4 A;  2D9F A;  4GGQ A;  4MTV A;  4ODN A;  3CH9 A;  1UR8 A;  3PRD A;  1FKB A;  1E15 A;  1YAT A;  2KR7 A;  4ODQ A;  3ARR A;  3AS2 A;  4IT6 A;  4WKH A;  3O5E A;  5HUA A;  5I98 A;  2LKN A;  2MPH A;  1VF8 A;  4N19 A;  4S3K A;  3ARS A;  2MF9 A;  4JFL A;  1HKI A;  2MLY A;  2RUD A;  1NWR A;  3O5L A;  4P8X A;  3RM9 A;  1X6N A;  2A3C A;  2FKE A;  3VAW A;  3ALG A;  4ODL A;  2KGJ A;  5DF0 A;  2MNT A;  1W1Y A;  3NI6 A;  2DG4 A;  1QZ2 A;  3BMB A;  4MAV A;  3CHD A;  3ART A;  2ZR6 A;  1WAW A;  2PV2 A;  5HW6 A;  3WD3 A;  2M1I A;  2KO7 A;  4Z2K A;  3UQI A;  4Z2H A;  2MLZ A;  3ARY A;  4U84 A;  2DT3 A;  3ARQ A;  4P8W A;  4QIB A;  1Q1C A;  1ZBW A;  5HW7 A;  1NWU A;  3AS1 A;  4QT2 A;  1SR0 A;  4HBO A;  3RFW A;  1NMW A;  1OWQ A;  3WD2 A;  3G6M A;  4LAX A;  2F21 A;  3O5I A;  1F8A B;  3PR9 A;  3CGN A;  3RM8 A;  1LL7 A;  3AQU A;  1JCH B;  2ESC A;  2ZQV A;  2KI3 A;  4TW6 A;  2PPP A;  4MPK A;  3AS3 A;  1FKF A;  2A3A A;  2RUQ A;  3WH0 A;  1FKJ A;  3O5P A;  5D75 A;  3WL0 A;  4KR0 B;  3BXW A;  1IX5 A;  1E44 A;  1LG2 A;  1NSG A;  1F40 A;  4MNJ A;  4ML4 A;  3WD0 A;  1BL4 A;  3KAI A;  2RUR A;  5GPR A;  2F23 A;  3ODK A;  2LPV A;  1HJW A;  1EDQ A;  2ZQU A;  4JFM A;  3WL1 A;  5J6E A;  2B31 A;  4DT4 A;  2DG3 A;  4L72 B;  1FFR A;  1W1T A;  3ALF A;  3TDB A;  1FFQ A;  1PIN A;  3LUO A;  5HTG A;  3IHZ A;  4Q7N A;  1H0I A;  1WNO A;  4P8U A;  2A3E A;  4R5E A;  4ZS6 A;  1HXV A;  1BKF A;  5HWC A;  1C9H A;  4KQZ A;  2MLX A;  2IUZ A;  3CZ8 A;  2DG9 A;  2ETN A;  4JFJ A;  1J4I A;  1Q6I A;  4ZPW R;  2PV1 A;  3UI6 A;  4PTM A;  1GPF A;  1T11 A;  4QZV B;  3ARW A;  2G41 A;  4ODO A;  3IKD A;  5HKG A;  1R9H A;  4IQC A;  1NH6 A;  1FKS A;  3UI5 A;  1EYM A;  4Z2L A;  1HJX A;  2F2D A;  2XP9 A;  3NTP A;  4FAP A;  4U85 A;  1HKM A;  1KT0 A;  3GTY X;  4DZ2 A;  1EIB A;  4MNK A;  2RSE A;  3EIP A;  1M5Y A;  3O5K A;  4NNR A;  4AY1 A;  1WB0 A;  2F4E A;  3RME A;  1TFV A;  1Y0O A;  2ITK A;  3WQV A;  3KAG A;  4C02 B;  4ZPT R;  3IK8 A;  4P8V A;  4WIW A;  3UF8 A;  2K8I A;  3KAH A;  4DRO A;  1E9L A;  4Z2I A;  5HWB A;  2XP8 A;  5GQB A;  1GRJ A;  4DIP A;  3RM4 A;  4JFK A;  1HKJ A;  1OGB A;  4DH0 A;  1NMV A;  3G6L A;  1J4R A;  2AWG A;  4DRM A;  3B9E A;  2WK2 A;  2RUC A;  1FKI A;  4ODM A;  1FKD A;  1ROT A;  2ZQS A;  3FXY A;  3WD1 A;  1PBK A;  4ITZ A;  3PRA A;  4ODK A;  3ARZ A;  1HKK A;  3AS0 A;  3OA5 A;  2XPB A;  2LJ4 A;  4LAV A;  1JVW A;  3GU0 A;  1JND A;  2IF4 A;  1D7J A;  4WJX A;  3RGC A;  1NWS A;  1W26 A;  4GIV A;  3CHF A;  1GUV A;  2FDM A;  3JXV A;  2QF8 A;  1X6L A;  4LGX A;  1W9U A;  1W9V A;  2XP4 A;  3ARV A;  2UZ5 A;  1KFW A;  2EUL A;  2PI6 A;  1J6Y A;  2WM0 A;  4TW8 A;  4MSP A;  1NWT A;  4URI A;  2M08 A;  1Q6U A;  4MNM A;  4TW7 A;  3KZ7 A;  4DWS B;  4R0X A;  2DT2 A;  4FN2 A;  3O5M A;  5HBF A;  1EQ3 A;  3EY6 A;  1E6N A;  2XP5 A;  1HJV A;  1FKT A;  1W1V A;  4L3N A;  3UI4 A;  2O9O A;  2O92 A;  4U86 A;  3TCZ A;  5HW8 A;  1ITX A;  2XP7 A;  4DRK A;  4IT4 A;  4G50 A;  2PBC A;  4TX0 A;  1ZU8 A;  2DT1 A;  4W9Q A;  1QPF A;  4LAW A;  4TNS A;  1EHN A;  1LJY A;  2DSZ A;  4BF8 A; 
#chains in the Genus database with same CATH homology
 3B8S A;  3H9R B;  4W5U A;  1W9P A;  4DRJ A;  3O5R A;  1ZK6 A;  1ROU A;  1ZBV A;  2JZV A;  4XAK A;  1FKL A;  3IKG A;  4MNL A;  3KAC A;  3JYJ A;  1ZBC A;  4Z2G A;  2VCD A;  4DRQ A;  1D6O A;  1FKR A;  3B9D A;  3ARP A;  2OFN A;  4HAR A;  1FJD A;  1E6P A;  4ODR A;  5DIU A;  1O6I A;  3ARX A;  4JYS A;  4ZPV R;  4G2P A;  4DWS A;  2PPO A;  3O5G A;  1W1P A;  1LQ0 A;  5DIV A;  1D7H A;  3OOB A;  5DEZ A;  2YBU A;  1FKG A;  3B7X A;  4MGV A;  1A7X A;  3ARU A;  4HBE A;  2PPN A;  1LL6 A;  5BXJ A;  4DRH A;  1XRV A;  4DWS D;  3CHE A;  3MDY B;  1ZCN A;  2KFW A;  2G8Z A;  1ZL1 A;  2KE0 A;  4IPX A;  5GPG A;  1ZBK A;  4JFI A;  3QOK A;  4W9P A;  4TYO A;  1D2K A;  1CTN A;  5B8I C;  2ZR4 A;  1QPL A;  3KCE A;  1FD9 A;  1K9T A;  4NZC A;  1B6C A;  1KT1 A;  2OLH A;  2AOS A;  3FAP A;  4IQ2 A;  2DSU A;  1P5Q A;  3WKZ A;  4DWS C;  3KAD A;  2Q5A A;  3O5F A;  2M2A A;  4LAY A;  4S3J A;  4DRN A;  2XP3 A;  3WQW A;  3GPK A;  3KAF A;  2WLZ A;  4DZ3 A;  3PA7 A;  1FKH A;  2DPE A;  3PRB A;  5DIT A;  1JNT A;  3B9A A;  3O5O A;  1L1P A;  2ZR5 A;  1ZB5 A;  2DT0 A;  2FAP A;  4WKF A;  2DSW A;  4DRP A;  2VN1 A;  4WKA A;  2LGO A;  1GOI A;  4ODP A;  3W4R A;  4Q22 A;  1N1A A;  3O5D A;  1JNE A;  4QT3 A;  2RQS A;  1H0G A;  4DRI A;  5DO2 A;  1OGG A;  1D7I A;  3CGM A;  3JYM A;  3UQB A;  3I6C A;  1FAP A;  2A3B A;  4J4O A;  1JNS A;  4NSB A;  4W9O A;  3CHC A;  3ARO A;  2WLY A;  3UQA A;  1Q6H A;  1UR9 A;  1LG1 A;  2XPA A;  4Z2J A;  1E6Z A;  2Y78 A;  4WK9 A;  4J4N A;  1J4H A;  4O2T A;  3TC5 A;  2PV3 A;  3O5J A;  1RD6 A;  1E6R A;  1U79 A;  2YBT A;  1LL4 A;  2XP6 A;  2N87 A;  3WIJ A;  2ZQT A;  3O5Q A;  1TCO C;  3FY1 A;  1FKK A;  3KAB A;  5HT1 A;  1XHG A;  2DSV A;  2L2S A;  1YW5 A;  5JH8 A;  1SYT A;  3NRK A;  3WD4 A;  2D9F A;  4GGQ A;  4MTV A;  4ODN A;  3CH9 A;  1UR8 A;  3PRD A;  1FKB A;  1E15 A;  1YAT A;  2KR7 A;  4ODQ A;  3ARR A;  3AS2 A;  4IT6 A;  4WKH A;  3O5E A;  5HUA A;  5I98 A;  2LKN A;  2MPH A;  1VF8 A;  4N19 A;  4S3K A;  3ARS A;  2MF9 A;  4JFL A;  1HKI A;  2MLY A;  2RUD A;  1NWR A;  3O5L A;  4P8X A;  3RM9 A;  1X6N A;  2A3C A;  2FKE A;  3VAW A;  3ALG A;  4ODL A;  2KGJ A;  5DF0 A;  2MNT A;  1W1Y A;  3NI6 A;  2DG4 A;  1QZ2 A;  4MAV A;  3CHD A;  3ART A;  2ZR6 A;  1WAW A;  2PV2 A;  5HW6 A;  3WD3 A;  2M1I A;  2KO7 A;  4Z2K A;  3UQI A;  4Z2H A;  2MLZ A;  3ARY A;  4U84 A;  2DT3 A;  3ARQ A;  4P8W A;  4QIB A;  1Q1C A;  1ZBW A;  5HW7 A;  1NWU A;  3AS1 A;  4QT2 A;  1SR0 A;  4HBO A;  3RFW A;  1NMW A;  1OWQ A;  3WD2 A;  3G6M A;  4LAX A;  2F21 A;  3O5I A;  1F8A B;  3PR9 A;  3CGN A;  3RM8 A;  1LL7 A;  3AQU A;  2ESC A;  2ZQV A;  2KI3 A;  4TW6 A;  2PPP A;  4MPK A;  3AS3 A;  1FKF A;  2A3A A;  2RUQ A;  3WH0 A;  1FKJ A;  3O5P A;  5D75 A;  3WL0 A;  4KR0 B;  3BXW A;  1IX5 A;  1LG2 A;  1NSG A;  1F40 A;  4MNJ A;  4ML4 A;  3WD0 A;  1BL4 A;  3KAI A;  2RUR A;  5GPR A;  3ODK A;  2LPV A;  1HJW A;  1EDQ A;  2ZQU A;  4JFM A;  3WL1 A;  5J6E A;  2B31 A;  4DT4 A;  2DG3 A;  4L72 B;  1FFR A;  1W1T A;  3ALF A;  3TDB A;  1FFQ A;  1PIN A;  3LUO A;  5HTG A;  3IHZ A;  4Q7N A;  1H0I A;  1WNO A;  4P8U A;  2A3E A;  4R5E A;  4ZS6 A;  1HXV A;  1BKF A;  5HWC A;  4KQZ A;  1C9H A;  2MLX A;  2IUZ A;  3CZ8 A;  2DG9 A;  4JFJ A;  1J4I A;  1Q6I A;  4ZPW R;  2PV1 A;  3UI6 A;  4PTM A;  1GPF A;  1T11 A;  4QZV B;  3ARW A;  2G41 A;  4ODO A;  3IKD A;  5HKG A;  1R9H A;  4IQC A;  1NH6 A;  1FKS A;  3UI5 A;  1EYM A;  4Z2L A;  1HJX A;  2F2D A;  2XP9 A;  3NTP A;  4FAP A;  4U85 A;  1HKM A;  1KT0 A;  4DZ2 A;  1EIB A;  4MNK A;  2RSE A;  1M5Y A;  3O5K A;  4NNR A;  4AY1 A;  1WB0 A;  2F4E A;  3RME A;  1TFV A;  1Y0O A;  2ITK A;  3WQV A;  3KAG A;  4C02 B;  4ZPT R;  3IK8 A;  4P8V A;  4WIW A;  3UF8 A;  2K8I A;  3KAH A;  4DRO A;  1E9L A;  4Z2I A;  5HWB A;  2XP8 A;  5GQB A;  4DIP A;  3RM4 A;  4JFK A;  1HKJ A;  1OGB A;  4DH0 A;  1NMV A;  3G6L A;  1J4R A;  2AWG A;  4DRM A;  3B9E A;  2WK2 A;  2RUC A;  1FKI A;  4ODM A;  1FKD A;  1ROT A;  2ZQS A;  3FXY A;  3WD1 A;  1PBK A;  4ITZ A;  3PRA A;  4ODK A;  3ARZ A;  1HKK A;  3AS0 A;  3OA5 A;  2XPB A;  2LJ4 A;  4LAV A;  1JVW A;  1JND A;  2IF4 A;  1D7J A;  4WJX A;  3RGC A;  1NWS A;  1W26 A;  4GIV A;  3CHF A;  1GUV A;  2FDM A;  3JXV A;  2QF8 A;  1X6L A;  4LGX A;  1W9U A;  1W9V A;  2XP4 A;  3ARV A;  2UZ5 A;  1KFW A;  2PI6 A;  1J6Y A;  2WM0 A;  4TW8 A;  4MSP A;  1NWT A;  4URI A;  2M08 A;  1Q6U A;  4MNM A;  4TW7 A;  3KZ7 A;  4DWS B;  4R0X A;  2DT2 A;  4FN2 A;  3O5M A;  5HBF A;  1EQ3 A;  3EY6 A;  1E6N A;  2XP5 A;  1HJV A;  1FKT A;  1W1V A;  4L3N A;  3UI4 A;  2O9O A;  2O92 A;  4U86 A;  3TCZ A;  5HW8 A;  1ITX A;  2XP7 A;  4DRK A;  4IT4 A;  4G50 A;  2PBC A;  4TX0 A;  1ZU8 A;  2DT1 A;  4W9Q A;  1QPF A;  4LAW A;  4TNS A;  1EHN A;  1LJY A;  2DSZ A;  4BF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...