4R0XA

Allosteric coupling of conformational transitions in the fk1 domain of fkbp51 near the site of steroid receptor interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
b'MEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPGIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Coupling of Conformational Transitions in the N-terminal Domain of the 51-kDa FK506-binding Protein (FKBP51) Near Its Site of Interaction with the Steroid Receptor Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 30
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4r0xA00
3O5JA 5BXJA 1T11A 3O5OA 4MSPA 1EQ3A 4JFLA 1J6YA 4ODKA 5DIVA 5B8IC 3KAFA 2DG4A 1BKFA 3O5QA 2KE0A 4LAVA 3UQBA 3KZ7A 1F40A 2XP8A 3LUOA 4ODQA 3CGNA 4JYSA 3IKGA 3IKDA 3FAPA 4LAYA 2LJ4A 2PBCA 3JYMA 4ITZA 5HTGA 3WH0A 1R9HA 1L1PA 3O5RA 4ODRA 5HKGA 2MNTA 3KCEA 3PA7A 5D75A 2KGJA 1Q6HA 4DRMA 1FKJA 4DRKA 4NNRA 3KAHA 5HW6A 1A7XA 4U84A 4LAXA 4TYOA 4W9PA 1FKSA 5DIUA 2XP5A 2ZR4A 4ODMA 2PPNA 4N19A 4QT2A 1JNSA 5HWCA 5J6EA 2LKNA 4DZ2A 2K8IA 3IK8A 2KI3A 1Q6UA 3O5EA 4G50A 2IF4A 3TDBA 2MLYA 1NSGA 1Y0OA 1FKLA 2XP3A 2ZQTA 3JYJA 3CGMA 4BF8A 3NI6A 1D6OA 4JFMA 4ODLA 4JFJA 2F4EA 5HWBA 1J4IA 2M08A 2DG9A 2N87A 3KABA 3KAIA 4R0XA 3O5PA 4IPXA 1FKRA 1PBKA 1FKGA 2PV1A 2PV3A 3O5GA 3PRBA 4DIPA 1QZ2A 4QT3A 3O5LA 1FAPA 2MPHA 4W9QA 3UI5A 2PPPA 2UZ5A 2M1IA 1JVWA 1Q1CA 2ZQUA 1Q6IA 5GPGA 5I98A 4DRQA 1M5YA 2ZR6A 3B7XA 3PRDA 4J4OA 2XPBA 1ROTA 4GIVA 4JFIA 2RSEA 2XP9A 4U86A 2XPAA 4QIBA 1KT1A 3UQIA 3ODKA 4DRIA 2Q5AA 4DH0A 5HT1A 4J4NA 2OFNA 4ODPA 1FD9A 1FJDA 3UI4A 4TW8A 4DZ3A 3MDYB 4G2PA 1N1AA 3TC5A 1FKTA 3GPKA 4TW7A 1J4HA 3KAGA 4JFKA 4FAPA 4LAWA 1ZCNA 3NRKA 5HUAA 1JNTA 2MF9A 3NTPA 1ZK6A 4U85A 4TW6A 2KO7A 2PPOA 2MLXA 2KR7A 1BL4A 3JXVA 4DRHA 4GGQA 1ROUA 3I6CA 3O5FA 4DRNA 4TX0A 3TCZA 1J4RA 1QPFA 2D9FA 2ITKA 3O5IA 2KFWA 1YATA 2FKEA 2XP6A 4C02B 4DT4A 2ZQSA 1TCOC 2XP4A 2ZQVA 3O5MA 4ODOA 3UQAA 2RUDA 2FAPA 1U79A 3KACA 1B6CA 3UI6A 4FN2A 1FKHA 5DITA 3UF8A 1D7HA 1EYMA 3EY6A 2ZR5A 5HW8A 1FKBA 1NMVA 3RGCA 2AWGA 2F21A 2LPVA 3H9RB 3O5DA 4IQ2A 4IQCA 1HXVA 1NMWA 1FKFA 1C9HA 1KT0A 3OOBA 1F8AB 1FKIA 3O5KA 2RQSA 1FKKA 1YW5A 2PV2A 2MLZA 2RUCA 2Y78A 2RURA 3IHZA 4DRPA 2LGOA 4O2TA 4W9OA 3VAWA 2VCDA 4ODNA 1D7JA 2F2DA 2RUQA 3KADA 1D7IA 4DROA 1P5QA 1PINA 2JZVA 3RFWA 4DRJA 2VN1A 1FKDA 2L2SA 2M2AA 2DG3A 4TNSA 4MGVA 2XP7A 5HW7A 1QPLA 1W26A
chains in the Genus database with same CATH superfamily
1EDQA 3PRAA 1ZBKA 4JFLA 1O6IA 4ODKA 2DG4A 3O5QA 3UQBA 2YBTA 4UDMA 2DSVA 3IKGA 4WIWA 4Q22A 1L1PA 2WK2A 4DRKA 1A7XA 5JH8A 5DIUA 1LG2A 2PPNA 4N19A 1HJWA 3WD0A 2LKNA 2K8IA 3IK8A 4Z2HA 4G50A 3EIPA 1SR0A 2MLYA 4BF8A 4S3JA 3NI6A 2F4EA 4R0XA 2N87A 3KAIA 3O5PA 1FKRA 1PBKA 1FKGA 3ARRA 3O5GA 4DIPA 4QT3A 4S3KA 3UI5A 2DT0A 2PPPA 1RD6A 1JVWA 4P8UA 1M5YA 2ZR6A 1GPFA 1OGBA 5DF0A 4GIVA 4URIA 1SYTA 2XPAA 1X6LA 3ODKA 2Q5AA 4DH0A 1H0IA 3W4RA 1GRJA 4ZPWR 4TW8A 4DZ3A 3MDYB 1FKTA 5DO2A 4Z2KA 2B5UB 4DWSA 2DT1A 4U85A 3NTPA 2PPOA 3B9AA 4W5UA 2KR7A 1BL4A 4DRNA 4TX0A 3O5IA 2D9FA 4C02B 2KFWA 2FKEA 1W1TA 1TCOC 1E6RA 3QOKA 1E44A 3KACA 3UI6A 1NWSA 1JCHB 1D7HA 1EYMA 4XAKA 3UF8A 2ETNA 1WAWA 2LPVA 4MNJA 3O5KA 2RQSA 2PV2A 2QF8A 2MLZA 2RUCA 4DRPA 3ALFA 3ARTA 3RM4A 4ML4A 3VAWA 1D7JA 2RUQA 2AOSA 4Z2GA 2VN1A 2M2AA 3ARQA 5DEZA 4HBEA 3CZ8A 2XP7A 4LGXA 3O5JA 3O5OA 1K9TA 1VF8A 4WKFA 2KE0A 1H0GA 3CGNA 3AROA 2LJ4A 3JYMA 1GUVA 3ALGA 3WH0A 3O5RA 5HKGA 2DSUA 1ZB5A 4NNRA 3KAHA 5HW6A 3GU0A 4ODMA 1UR9A 4QT2A 5HWCA 1ZL1A 2DSZA 4DZ2A 4DWSB 2KI3A 3O5EA 2EULA 3BMBA 1FKLA 2ZQTA 3WQWA 4JFJA 5HWBA 1J4IA 2DG9A 3KABA 3G6MA 4IPXA 3PRBA 1OWQA 1QZ2A 1E6NA 1FAPA 4W9QA 1Q1CA 5I98A 4L3NA 2XPBA 1ROTA 3ARYA 1EHNA 4JFIA 1FFRA 1WNOA 5HT1A 4WJXA 1HKMA 3ARWA 1FJDA 4ZPVR 3TC5A 1N1AA 3GPKA 4DWSC 1ZCNA 5HUAA 4QZVB 4TW6A 2KO7A 4IT4A 3ARPA 4DRHA 3TCZA 2PN0A 1YATA 3WD4A 3WD2A 3ARVA 1LL4A 1W9UA 3RM8A 3RGCA 2AWGA 3H9RB 2A3BA 1HXVA 1NMWA 4ZPTR 1C9HA 1F8AB 1FFQA 5GPRA 3IHZA 2RURA 1E15A 4O2TA 1CTNA 3ARUA 1LJYA 2PI6A 2DSWA 2F2DA 2A3AA 1PINA 2YBUA 2G41A 2OLHA 3O5DA 1NWUA 1J6YA 3KAFA 4LAVA 1W1VA 1F40A 2XP8A 3LUOA 4ODQA 1E9LA 4ITZA 1EIBA 1R9HA 3PR9A 4MPKA 4NZCA 3KCEA 2A3CA 1FKJA 3B9DA 4U84A 3CHEA 4LAXA 4W9PA 1FKSA 2XP5A 1HJVA 1Q6UA 2FDMA 2IF4A 3TDBA 1HJXA 2XP3A 3JYJA 3WKZA 3CGMA 4JFMA 2M08A 4R5EA 1XRVA 1ITXA 4MNKA 2MPHA 5GPGA 2UZ5A 1XHGA 3CH9A 2M1IA 2ZQUA 1LG1A 1Q6IA 1JNEA 4DRQA 1W1PA 3B7XA 3PRDA 2XP9A 1IX5A 4QIBA 1KT1A 3CHDA 4J4NA 3UI4A 1J4HA 3KAGA 3AQUA 1ZBCA 4LAWA 3NRKA 3CHFA 1JNTA 3ARXA 1LL6A 1E6PA 3JXVA 1ROUA 3I6CA 2WLZA 1J4RA 1QPFA 2F23A 1JNDA 2ZQSA 2XP4A 1LL7A 1GOIA 3UQAA 2RUDA 1B6CA 2DT2A 4WKAA 2ZR5A 5GQBA 1FKBA 2F21A 4IQCA 4Q7NA 1KT0A 3OOBA 1HKJA 3GTYX 3RMEA 3WL1A 2LGOA 4HBOA 1W9VA 2VCDA 3AS1A 2A3EA 3WL0A 3RFWA 2L2SA 2DG3A 5HW7A 4MGVA 4AY1A 1QPLA 5BXJA 1T11A 1ZU8A 1NWRA 1ZBVA 4MSPA 1EQ3A 2DT3A 5DIVA 5B8IC 1OGGA 1BKFA 3KZ7A 4JYSA 1ZBWA 1HKIA 3IKDA 4P8VA 1TFVA 3FAPA 4LAYA 3AS3A 2PBCA 5HTGA 3CHCA 3BXWA 4ODRA 2O9OA 2MNTA 3PA7A 4DRMA 5D75A 2KGJA 1Q6HA 4PTMA 4NSBA 4TYOA 1NWTA 2ZR4A 2WM0A 2G8ZA 3B9EA 3WIJA 4MNLA 4MAVA 1JNSA 3WQVA 4MTVA 5J6EA 4DWSD 3FXYA 3AS0A 1NSGA 1Y0OA 1D2KA 4ODLA 1D6OA 4Z2JA 4MNMA 2PV1A 2WLYA 2PV3A 4P8WA 3G6LA 3O5LA 1X6NA 1NH6A 4WK9A 4J4OA 5HBFA 2RSEA 1HKKA 2P4VA 4Z2LA 4U86A 4DRIA 3UQIA 4WKHA 2OFNA 4Z2IA 1KFWA 4ODPA 1FD9A 4L72B 2B31A 4G2PA 4HARA 4TW7A 4JFKA 4FAPA 2MF9A 1ZK6A 2MLXA 4GGQA 3O5FA 2O92A 2ITKA 4DT4A 4KQZA 4P8XA 4ZS6A 3ARZA 2ZQVA 3O5MA 4ODOA 2FAPA 1U79A 4FN2A 1FKHA 4IT6A 5DITA 3EY6A 3OA5A 5HW8A 1NMVA 1UR8A 4IQ2A 1WB0A 1W9PA 1FKFA 3WD1A 3B8SA 1FKIA 2DPEA 1FKKA 2Y78A 1YW5A 1LQ0A 4KR0B 3ARSA 1E6ZA 3RM9A 3AS2A 4W9OA 3FY1A 4ODNA 3KADA 2ESCA 4DROA 1D7IA 1P5QA 2JZVA 1W1YA 4DRJA 1FKDA 4TNSA 3WD3A 2IUZA 2XP6A 1W26A
chains in the Genus database with same CATH topology
1EDQA 3PRAA 1ZBKA 4JFLA 1O6IA 4ODKA 2DG4A 3O5QA 3UQBA 2YBTA 2DSVA 3IKGA 4WIWA 4Q22A 1L1PA 2WK2A 4DRKA 1A7XA 5JH8A 5DIUA 1LG2A 2PPNA 4N19A 1HJWA 3WD0A 2LKNA 2K8IA 3IK8A 4Z2HA 4G50A 1SR0A 2MLYA 4BF8A 4S3JA 3NI6A 2F4EA 4R0XA 2N87A 3KAIA 3O5PA 1FKRA 1PBKA 1FKGA 3ARRA 3O5GA 4DIPA 4QT3A 4S3KA 3UI5A 2DT0A 2PPPA 1RD6A 1JVWA 4P8UA 1M5YA 2ZR6A 1GPFA 1OGBA 5DF0A 4GIVA 4URIA 1SYTA 2XPAA 1X6LA 3ODKA 2Q5AA 4DH0A 1H0IA 3W4RA 4ZPWR 4TW8A 4DZ3A 3MDYB 1FKTA 5DO2A 4Z2KA 4DWSA 2DT1A 4U85A 3NTPA 2PPOA 3B9AA 4W5UA 2KR7A 1BL4A 4DRNA 4TX0A 3O5IA 2D9FA 4C02B 2KFWA 2FKEA 1W1TA 1TCOC 1E6RA 3QOKA 3KACA 3UI6A 1NWSA 3UF8A 1D7HA 1EYMA 4XAKA 1WAWA 2LPVA 4MNJA 3O5KA 2RQSA 2PV2A 2QF8A 2MLZA 2RUCA 4DRPA 3ALFA 3ARTA 3RM4A 4ML4A 3VAWA 1D7JA 2RUQA 2AOSA 4Z2GA 2VN1A 2M2AA 3ARQA 5DEZA 4HBEA 3CZ8A 2XP7A 4LGXA 3O5JA 3O5OA 1K9TA 1VF8A 4WKFA 2KE0A 1H0GA 3CGNA 3AROA 2LJ4A 3JYMA 1GUVA 3ALGA 3WH0A 3O5RA 5HKGA 2DSUA 1ZB5A 4NNRA 3KAHA 5HW6A 4ODMA 1UR9A 4QT2A 5HWCA 1ZL1A 2DSZA 4DZ2A 4DWSB 2KI3A 3O5EA 1FKLA 2ZQTA 3WQWA 4JFJA 5HWBA 1J4IA 2DG9A 3KABA 3G6MA 4IPXA 3PRBA 1OWQA 1QZ2A 1E6NA 1FAPA 4W9QA 1Q1CA 5I98A 4L3NA 2XPBA 1ROTA 3ARYA 1EHNA 4JFIA 1FFRA 1WNOA 5HT1A 4WJXA 1HKMA 3ARWA 1FJDA 4ZPVR 3TC5A 1N1AA 3GPKA 4DWSC 1ZCNA 5HUAA 4QZVB 4TW6A 2KO7A 4IT4A 3ARPA 4DRHA 3TCZA 1YATA 3WD4A 3WD2A 3ARVA 1LL4A 1W9UA 3RM8A 3RGCA 2AWGA 3H9RB 2A3BA 1HXVA 1NMWA 4ZPTR 1C9HA 1F8AB 1FFQA 5GPRA 3IHZA 2RURA 1E15A 4O2TA 1CTNA 3ARUA 1LJYA 2PI6A 2DSWA 2F2DA 2A3AA 1PINA 2YBUA 2G41A 2OLHA 3O5DA 1NWUA 1J6YA 3KAFA 4LAVA 1W1VA 1F40A 2XP8A 3LUOA 4ODQA 1E9LA 4ITZA 1EIBA 1R9HA 3PR9A 4MPKA 4NZCA 3KCEA 2A3CA 1FKJA 3B9DA 4U84A 3CHEA 4LAXA 4W9PA 1FKSA 2XP5A 1HJVA 1Q6UA 2FDMA 2IF4A 3TDBA 1HJXA 2XP3A 3JYJA 3WKZA 3CGMA 4JFMA 2M08A 4R5EA 1XRVA 1ITXA 4MNKA 2MPHA 5GPGA 2UZ5A 1XHGA 3CH9A 2M1IA 2ZQUA 1LG1A 1Q6IA 1JNEA 4DRQA 1W1PA 3B7XA 3PRDA 2XP9A 1IX5A 4QIBA 1KT1A 3CHDA 4J4NA 3UI4A 1J4HA 3KAGA 3AQUA 1ZBCA 4LAWA 3NRKA 3CHFA 1JNTA 3ARXA 1LL6A 1E6PA 3JXVA 1ROUA 3I6CA 2WLZA 1J4RA 1QPFA 1JNDA 2ZQSA 2XP4A 1LL7A 1GOIA 3UQAA 2RUDA 1B6CA 2DT2A 4WKAA 2ZR5A 5GQBA 1FKBA 2F21A 4IQCA 4Q7NA 1KT0A 3OOBA 1HKJA 3RMEA 3WL1A 2LGOA 4HBOA 1W9VA 2VCDA 3AS1A 2A3EA 3WL0A 3RFWA 2L2SA 2DG3A 5HW7A 4MGVA 4AY1A 1QPLA 5BXJA 1T11A 1ZU8A 1NWRA 1ZBVA 4MSPA 1EQ3A 2DT3A 5DIVA 5B8IC 1OGGA 1BKFA 3KZ7A 4JYSA 1ZBWA 1HKIA 3IKDA 4P8VA 1TFVA 3FAPA 4LAYA 3AS3A 2PBCA 5HTGA 3CHCA 3BXWA 4ODRA 2O9OA 2MNTA 3PA7A 4DRMA 5D75A 2KGJA 1Q6HA 4PTMA 4NSBA 4TYOA 1NWTA 2ZR4A 2WM0A 2G8ZA 3B9EA 3WIJA 4MNLA 4MAVA 1JNSA 3WQVA 4MTVA 5J6EA 4DWSD 3FXYA 3AS0A 1NSGA 1Y0OA 1D2KA 4ODLA 1D6OA 4Z2JA 4MNMA 2PV1A 2WLYA 2PV3A 4P8WA 3G6LA 3O5LA 1X6NA 1NH6A 4WK9A 4J4OA 5HBFA 2RSEA 1HKKA 4Z2LA 4U86A 4DRIA 3UQIA 4WKHA 2OFNA 4Z2IA 1KFWA 4ODPA 1FD9A 4L72B 2B31A 4G2PA 4HARA 4TW7A 4JFKA 4FAPA 2MF9A 1ZK6A 2MLXA 4GGQA 3O5FA 2O92A 2ITKA 4DT4A 4KQZA 4P8XA 4ZS6A 3ARZA 2ZQVA 3O5MA 4ODOA 2FAPA 1U79A 4FN2A 1FKHA 4IT6A 5DITA 3EY6A 3OA5A 5HW8A 1NMVA 1UR8A 4IQ2A 1WB0A 1W9PA 1FKFA 3WD1A 3B8SA 1FKIA 2DPEA 1FKKA 2Y78A 1YW5A 1LQ0A 4KR0B 3ARSA 1E6ZA 3RM9A 3AS2A 4W9OA 3FY1A 4ODNA 3KADA 2ESCA 4DROA 1D7IA 1P5QA 2JZVA 1W1YA 4DRJA 1FKDA 4TNSA 3WD3A 2IUZA 2XP6A 1W26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5J A;  5BXJ A;  1T11 A;  3O5O A;  4MSP A;  1EQ3 A;  4JFL A;  1J6Y A;  4ODK A;  5DIV A;  5B8I C;  3KAF A;  2DG4 A;  1BKF A;  3O5Q A;  2KE0 A;  4LAV A;  3UQB A;  3KZ7 A;  1F40 A;  2XP8 A;  3LUO A;  4ODQ A;  3CGN A;  4JYS A;  3IKG A;  3IKD A;  3FAP A;  4LAY A;  2LJ4 A;  2PBC A;  3JYM A;  4ITZ A;  5HTG A;  3WH0 A;  1R9H A;  1L1P A;  3O5R A;  4ODR A;  5HKG A;  2MNT A;  3KCE A;  3PA7 A;  5D75 A;  2KGJ A;  1Q6H A;  4DRM A;  1FKJ A;  4DRK A;  4NNR A;  3KAH A;  5HW6 A;  1A7X A;  4U84 A;  4LAX A;  4TYO A;  4W9P A;  1FKS A;  5DIU A;  2XP5 A;  2ZR4 A;  4ODM A;  2PPN A;  4N19 A;  4QT2 A;  1JNS A;  5HWC A;  5J6E A;  2LKN A;  4DZ2 A;  2K8I A;  3IK8 A;  2KI3 A;  1Q6U A;  3O5E A;  4G50 A;  2IF4 A;  3TDB A;  2MLY A;  1NSG A;  1Y0O A;  1FKL A;  2XP3 A;  2ZQT A;  3JYJ A;  3CGM A;  4BF8 A;  3NI6 A;  1D6O A;  4JFM A;  4ODL A;  4JFJ A;  2F4E A;  5HWB A;  1J4I A;  2M08 A;  2DG9 A;  2N87 A;  3KAB A;  3KAI A;  4R0X A;  3O5P A;  4IPX A;  1FKR A;  1PBK A;  1FKG A;  2PV1 A;  2PV3 A;  3O5G A;  3PRB A;  4DIP A;  1QZ2 A;  4QT3 A;  3O5L A;  1FAP A;  2MPH A;  4W9Q A;  3UI5 A;  2PPP A;  2UZ5 A;  2M1I A;  1JVW A;  1Q1C A;  2ZQU A;  1Q6I A;  5GPG A;  5I98 A;  4DRQ A;  1M5Y A;  2ZR6 A;  3B7X A;  3PRD A;  4J4O A;  2XPB A;  1ROT A;  4GIV A;  4JFI A;  2RSE A;  2XP9 A;  4U86 A;  2XPA A;  4QIB A;  1KT1 A;  3UQI A;  3ODK A;  4DRI A;  2Q5A A;  4DH0 A;  5HT1 A;  4J4N A;  2OFN A;  4ODP A;  1FD9 A;  1FJD A;  3UI4 A;  4TW8 A;  4DZ3 A;  3MDY B;  4G2P A;  1N1A A;  3TC5 A;  1FKT A;  3GPK A;  4TW7 A;  1J4H A;  3KAG A;  4JFK A;  4FAP A;  4LAW A;  1ZCN A;  3NRK A;  5HUA A;  1JNT A;  2MF9 A;  3NTP A;  1ZK6 A;  4U85 A;  4TW6 A;  2KO7 A;  2PPO A;  2MLX A;  2KR7 A;  1BL4 A;  3JXV A;  4DRH A;  4GGQ A;  1ROU A;  3I6C A;  3O5F A;  4DRN A;  4TX0 A;  3TCZ A;  1J4R A;  1QPF A;  2D9F A;  2ITK A;  3O5I A;  2KFW A;  1YAT A;  2FKE A;  2XP6 A;  4C02 B;  4DT4 A;  2ZQS A;  1TCO C;  2XP4 A;  2ZQV A;  3O5M A;  4ODO A;  3UQA A;  2RUD A;  2FAP A;  1U79 A;  3KAC A;  1B6C A;  3UI6 A;  4FN2 A;  1FKH A;  5DIT A;  3UF8 A;  1D7H A;  1EYM A;  3EY6 A;  2ZR5 A;  5HW8 A;  1FKB A;  1NMV A;  3RGC A;  2AWG A;  2F21 A;  2LPV A;  3H9R B;  3O5D A;  4IQ2 A;  4IQC A;  1HXV A;  1NMW A;  1FKF A;  1C9H A;  1KT0 A;  3OOB A;  1F8A B;  1FKI A;  3O5K A;  2RQS A;  1FKK A;  1YW5 A;  2PV2 A;  2MLZ A;  2RUC A;  2Y78 A;  2RUR A;  3IHZ A;  4DRP A;  2LGO A;  4O2T A;  4W9O A;  3VAW A;  2VCD A;  4ODN A;  1D7J A;  2F2D A;  2RUQ A;  3KAD A;  1D7I A;  4DRO A;  1P5Q A;  1PIN A;  2JZV A;  3RFW A;  4DRJ A;  2VN1 A;  1FKD A;  2L2S A;  2M2A A;  2DG3 A;  4TNS A;  4MGV A;  2XP7 A;  5HW7 A;  1QPL A;  1W26 A; 
#chains in the Genus database with same CATH topology
 1EDQ A;  3PRA A;  1ZBK A;  4JFL A;  1O6I A;  4ODK A;  2DG4 A;  3O5Q A;  3UQB A;  2YBT A;  4UDM A;  2DSV A;  3IKG A;  4WIW A;  4Q22 A;  1L1P A;  2WK2 A;  4DRK A;  1A7X A;  5JH8 A;  5DIU A;  1LG2 A;  2PPN A;  4N19 A;  1HJW A;  3WD0 A;  2LKN A;  2K8I A;  3IK8 A;  4Z2H A;  4G50 A;  3EIP A;  1SR0 A;  2MLY A;  4BF8 A;  4S3J A;  3NI6 A;  2F4E A;  4R0X A;  2N87 A;  3KAI A;  3O5P A;  1FKR A;  1PBK A;  1FKG A;  3ARR A;  3O5G A;  4DIP A;  4QT3 A;  4S3K A;  3UI5 A;  2DT0 A;  2PPP A;  1RD6 A;  1JVW A;  4P8U A;  1M5Y A;  2ZR6 A;  1GPF A;  1OGB A;  5DF0 A;  4GIV A;  4URI A;  1SYT A;  2XPA A;  1X6L A;  3ODK A;  2Q5A A;  4DH0 A;  1H0I A;  3W4R A;  1GRJ A;  4ZPW R;  4TW8 A;  4DZ3 A;  3MDY B;  1FKT A;  5DO2 A;  4Z2K A;  2B5U B;  4DWS A;  2DT1 A;  4U85 A;  3NTP A;  2PPO A;  3B9A A;  4W5U A;  2KR7 A;  1BL4 A;  4DRN A;  4TX0 A;  3O5I A;  2D9F A;  4C02 B;  2KFW A;  2FKE A;  1W1T A;  1TCO C;  1E6R A;  3QOK A;  1E44 A;  3KAC A;  3UI6 A;  1NWS A;  1JCH B;  1D7H A;  1EYM A;  4XAK A;  3UF8 A;  2ETN A;  1WAW A;  2LPV A;  4MNJ A;  3O5K A;  2RQS A;  2PV2 A;  2QF8 A;  2MLZ A;  2RUC A;  4DRP A;  3ALF A;  3ART A;  3RM4 A;  4ML4 A;  3VAW A;  1D7J A;  2RUQ A;  2AOS A;  4Z2G A;  2VN1 A;  2M2A A;  3ARQ A;  5DEZ A;  4HBE A;  3CZ8 A;  2XP7 A;  4LGX A;  3O5J A;  3O5O A;  1K9T A;  1VF8 A;  4WKF A;  2KE0 A;  1H0G A;  3CGN A;  3ARO A;  2LJ4 A;  3JYM A;  1GUV A;  3ALG A;  3WH0 A;  3O5R A;  5HKG A;  2DSU A;  1ZB5 A;  4NNR A;  3KAH A;  5HW6 A;  3GU0 A;  4ODM A;  1UR9 A;  4QT2 A;  5HWC A;  1ZL1 A;  2DSZ A;  4DZ2 A;  4DWS B;  2KI3 A;  3O5E A;  2EUL A;  3BMB A;  1FKL A;  2ZQT A;  3WQW A;  4JFJ A;  5HWB A;  1J4I A;  2DG9 A;  3KAB A;  3G6M A;  4IPX A;  3PRB A;  1OWQ A;  1QZ2 A;  1E6N A;  1FAP A;  4W9Q A;  1Q1C A;  5I98 A;  4L3N A;  2XPB A;  1ROT A;  3ARY A;  1EHN A;  4JFI A;  1FFR A;  1WNO A;  5HT1 A;  4WJX A;  1HKM A;  3ARW A;  1FJD A;  4ZPV R;  3TC5 A;  1N1A A;  3GPK A;  4DWS C;  1ZCN A;  5HUA A;  4QZV B;  4TW6 A;  2KO7 A;  4IT4 A;  3ARP A;  4DRH A;  3TCZ A;  2PN0 A;  1YAT A;  3WD4 A;  3WD2 A;  3ARV A;  1LL4 A;  1W9U A;  3RM8 A;  3RGC A;  2AWG A;  3H9R B;  2A3B A;  1HXV A;  1NMW A;  4ZPT R;  1C9H A;  1F8A B;  1FFQ A;  5GPR A;  3IHZ A;  2RUR A;  1E15 A;  4O2T A;  1CTN A;  3ARU A;  1LJY A;  2PI6 A;  2DSW A;  2F2D A;  2A3A A;  1PIN A;  2YBU A;  2G41 A;  2OLH A;  3O5D A;  1NWU A;  1J6Y A;  3KAF A;  4LAV A;  1W1V A;  1F40 A;  2XP8 A;  3LUO A;  4ODQ A;  1E9L A;  4ITZ A;  1EIB A;  1R9H A;  3PR9 A;  4MPK A;  4NZC A;  3KCE A;  2A3C A;  1FKJ A;  3B9D A;  4U84 A;  3CHE A;  4LAX A;  4W9P A;  1FKS A;  2XP5 A;  1HJV A;  1Q6U A;  2FDM A;  2IF4 A;  3TDB A;  1HJX A;  2XP3 A;  3JYJ A;  3WKZ A;  3CGM A;  4JFM A;  2M08 A;  4R5E A;  1XRV A;  1ITX A;  4MNK A;  2MPH A;  5GPG A;  2UZ5 A;  1XHG A;  3CH9 A;  2M1I A;  2ZQU A;  1LG1 A;  1Q6I A;  1JNE A;  4DRQ A;  1W1P A;  3B7X A;  3PRD A;  2XP9 A;  1IX5 A;  4QIB A;  1KT1 A;  3CHD A;  4J4N A;  3UI4 A;  1J4H A;  3KAG A;  3AQU A;  1ZBC A;  4LAW A;  3NRK A;  3CHF A;  1JNT A;  3ARX A;  1LL6 A;  1E6P A;  3JXV A;  1ROU A;  3I6C A;  2WLZ A;  1J4R A;  1QPF A;  2F23 A;  1JND A;  2ZQS A;  2XP4 A;  1LL7 A;  1GOI A;  3UQA A;  2RUD A;  1B6C A;  2DT2 A;  4WKA A;  2ZR5 A;  5GQB A;  1FKB A;  2F21 A;  4IQC A;  4Q7N A;  1KT0 A;  3OOB A;  1HKJ A;  3GTY X;  3RME A;  3WL1 A;  2LGO A;  4HBO A;  1W9V A;  2VCD A;  3AS1 A;  2A3E A;  3WL0 A;  3RFW A;  2L2S A;  2DG3 A;  5HW7 A;  4MGV A;  4AY1 A;  1QPL A;  5BXJ A;  1T11 A;  1ZU8 A;  1NWR A;  1ZBV A;  4MSP A;  1EQ3 A;  2DT3 A;  5DIV A;  5B8I C;  1OGG A;  1BKF A;  3KZ7 A;  4JYS A;  1ZBW A;  1HKI A;  3IKD A;  4P8V A;  1TFV A;  3FAP A;  4LAY A;  3AS3 A;  2PBC A;  5HTG A;  3CHC A;  3BXW A;  4ODR A;  2O9O A;  2MNT A;  3PA7 A;  4DRM A;  5D75 A;  2KGJ A;  1Q6H A;  4PTM A;  4NSB A;  4TYO A;  1NWT A;  2ZR4 A;  2WM0 A;  2G8Z A;  3B9E A;  3WIJ A;  4MNL A;  4MAV A;  1JNS A;  3WQV A;  4MTV A;  5J6E A;  4DWS D;  3FXY A;  3AS0 A;  1NSG A;  1Y0O A;  1D2K A;  4ODL A;  1D6O A;  4Z2J A;  4MNM A;  2PV1 A;  2WLY A;  2PV3 A;  4P8W A;  3G6L A;  3O5L A;  1X6N A;  1NH6 A;  4WK9 A;  4J4O A;  5HBF A;  2RSE A;  1HKK A;  2P4V A;  4Z2L A;  4U86 A;  4DRI A;  3UQI A;  4WKH A;  2OFN A;  4Z2I A;  1KFW A;  4ODP A;  1FD9 A;  4L72 B;  2B31 A;  4G2P A;  4HAR A;  4TW7 A;  4JFK A;  4FAP A;  2MF9 A;  1ZK6 A;  2MLX A;  4GGQ A;  3O5F A;  2O92 A;  2ITK A;  4DT4 A;  4KQZ A;  4P8X A;  4ZS6 A;  3ARZ A;  2ZQV A;  3O5M A;  4ODO A;  2FAP A;  1U79 A;  4FN2 A;  1FKH A;  4IT6 A;  5DIT A;  3EY6 A;  3OA5 A;  5HW8 A;  1NMV A;  1UR8 A;  4IQ2 A;  1WB0 A;  1W9P A;  1FKF A;  3WD1 A;  3B8S A;  1FKI A;  2DPE A;  1FKK A;  2Y78 A;  1YW5 A;  1LQ0 A;  4KR0 B;  3ARS A;  1E6Z A;  3RM9 A;  3AS2 A;  4W9O A;  3FY1 A;  4ODN A;  3KAD A;  2ESC A;  4DRO A;  1D7I A;  1P5Q A;  2JZV A;  1W1Y A;  4DRJ A;  1FKD A;  4TNS A;  3WD3 A;  2IUZ A;  2XP6 A;  1W26 A; 
#chains in the Genus database with same CATH homology
 1EDQ A;  3PRA A;  1ZBK A;  4JFL A;  1O6I A;  4ODK A;  2DG4 A;  3O5Q A;  3UQB A;  2YBT A;  2DSV A;  3IKG A;  4WIW A;  4Q22 A;  1L1P A;  2WK2 A;  4DRK A;  1A7X A;  5JH8 A;  5DIU A;  1LG2 A;  2PPN A;  4N19 A;  1HJW A;  3WD0 A;  2LKN A;  2K8I A;  3IK8 A;  4Z2H A;  4G50 A;  1SR0 A;  2MLY A;  4BF8 A;  4S3J A;  3NI6 A;  2F4E A;  4R0X A;  2N87 A;  3KAI A;  3O5P A;  1FKR A;  1PBK A;  1FKG A;  3ARR A;  3O5G A;  4DIP A;  4QT3 A;  4S3K A;  3UI5 A;  2DT0 A;  2PPP A;  1RD6 A;  1JVW A;  4P8U A;  1M5Y A;  2ZR6 A;  1GPF A;  1OGB A;  5DF0 A;  4GIV A;  4URI A;  1SYT A;  2XPA A;  1X6L A;  3ODK A;  2Q5A A;  4DH0 A;  1H0I A;  3W4R A;  4ZPW R;  4TW8 A;  4DZ3 A;  3MDY B;  1FKT A;  5DO2 A;  4Z2K A;  4DWS A;  2DT1 A;  4U85 A;  3NTP A;  2PPO A;  3B9A A;  4W5U A;  2KR7 A;  1BL4 A;  4DRN A;  4TX0 A;  3O5I A;  2D9F A;  4C02 B;  2KFW A;  2FKE A;  1W1T A;  1TCO C;  1E6R A;  3QOK A;  3KAC A;  3UI6 A;  1NWS A;  3UF8 A;  1D7H A;  1EYM A;  4XAK A;  1WAW A;  2LPV A;  4MNJ A;  3O5K A;  2RQS A;  2PV2 A;  2QF8 A;  2MLZ A;  2RUC A;  4DRP A;  3ALF A;  3ART A;  3RM4 A;  4ML4 A;  3VAW A;  1D7J A;  2RUQ A;  2AOS A;  4Z2G A;  2VN1 A;  2M2A A;  3ARQ A;  5DEZ A;  4HBE A;  3CZ8 A;  2XP7 A;  4LGX A;  3O5J A;  3O5O A;  1K9T A;  1VF8 A;  4WKF A;  2KE0 A;  1H0G A;  3CGN A;  3ARO A;  2LJ4 A;  3JYM A;  1GUV A;  3ALG A;  3WH0 A;  3O5R A;  5HKG A;  2DSU A;  1ZB5 A;  4NNR A;  3KAH A;  5HW6 A;  4ODM A;  1UR9 A;  4QT2 A;  5HWC A;  1ZL1 A;  2DSZ A;  4DZ2 A;  4DWS B;  2KI3 A;  3O5E A;  1FKL A;  2ZQT A;  3WQW A;  4JFJ A;  5HWB A;  1J4I A;  2DG9 A;  3KAB A;  3G6M A;  4IPX A;  3PRB A;  1OWQ A;  1QZ2 A;  1E6N A;  1FAP A;  4W9Q A;  1Q1C A;  5I98 A;  4L3N A;  2XPB A;  1ROT A;  3ARY A;  1EHN A;  4JFI A;  1FFR A;  1WNO A;  5HT1 A;  4WJX A;  1HKM A;  3ARW A;  1FJD A;  4ZPV R;  3TC5 A;  1N1A A;  3GPK A;  4DWS C;  1ZCN A;  5HUA A;  4QZV B;  4TW6 A;  2KO7 A;  4IT4 A;  3ARP A;  4DRH A;  3TCZ A;  1YAT A;  3WD4 A;  3WD2 A;  3ARV A;  1LL4 A;  1W9U A;  3RM8 A;  3RGC A;  2AWG A;  3H9R B;  2A3B A;  1HXV A;  1NMW A;  4ZPT R;  1C9H A;  1F8A B;  1FFQ A;  5GPR A;  3IHZ A;  2RUR A;  1E15 A;  4O2T A;  1CTN A;  3ARU A;  1LJY A;  2PI6 A;  2DSW A;  2F2D A;  2A3A A;  1PIN A;  2YBU A;  2G41 A;  2OLH A;  3O5D A;  1NWU A;  1J6Y A;  3KAF A;  4LAV A;  1W1V A;  1F40 A;  2XP8 A;  3LUO A;  4ODQ A;  1E9L A;  4ITZ A;  1EIB A;  1R9H A;  3PR9 A;  4MPK A;  4NZC A;  3KCE A;  2A3C A;  1FKJ A;  3B9D A;  4U84 A;  3CHE A;  4LAX A;  4W9P A;  1FKS A;  2XP5 A;  1HJV A;  1Q6U A;  2FDM A;  2IF4 A;  3TDB A;  1HJX A;  2XP3 A;  3JYJ A;  3WKZ A;  3CGM A;  4JFM A;  2M08 A;  4R5E A;  1XRV A;  1ITX A;  4MNK A;  2MPH A;  5GPG A;  2UZ5 A;  1XHG A;  3CH9 A;  2M1I A;  2ZQU A;  1LG1 A;  1Q6I A;  1JNE A;  4DRQ A;  1W1P A;  3B7X A;  3PRD A;  2XP9 A;  1IX5 A;  4QIB A;  1KT1 A;  3CHD A;  4J4N A;  3UI4 A;  1J4H A;  3KAG A;  3AQU A;  1ZBC A;  4LAW A;  3NRK A;  3CHF A;  1JNT A;  3ARX A;  1LL6 A;  1E6P A;  3JXV A;  1ROU A;  3I6C A;  2WLZ A;  1J4R A;  1QPF A;  1JND A;  2ZQS A;  2XP4 A;  1LL7 A;  1GOI A;  3UQA A;  2RUD A;  1B6C A;  2DT2 A;  4WKA A;  2ZR5 A;  5GQB A;  1FKB A;  2F21 A;  4IQC A;  4Q7N A;  1KT0 A;  3OOB A;  1HKJ A;  3RME A;  3WL1 A;  2LGO A;  4HBO A;  1W9V A;  2VCD A;  3AS1 A;  2A3E A;  3WL0 A;  3RFW A;  2L2S A;  2DG3 A;  5HW7 A;  4MGV A;  4AY1 A;  1QPL A;  5BXJ A;  1T11 A;  1ZU8 A;  1NWR A;  1ZBV A;  4MSP A;  1EQ3 A;  2DT3 A;  5DIV A;  5B8I C;  1OGG A;  1BKF A;  3KZ7 A;  4JYS A;  1ZBW A;  1HKI A;  3IKD A;  4P8V A;  1TFV A;  3FAP A;  4LAY A;  3AS3 A;  2PBC A;  5HTG A;  3CHC A;  3BXW A;  4ODR A;  2O9O A;  2MNT A;  3PA7 A;  4DRM A;  5D75 A;  2KGJ A;  1Q6H A;  4PTM A;  4NSB A;  4TYO A;  1NWT A;  2ZR4 A;  2WM0 A;  2G8Z A;  3B9E A;  3WIJ A;  4MNL A;  4MAV A;  1JNS A;  3WQV A;  4MTV A;  5J6E A;  4DWS D;  3FXY A;  3AS0 A;  1NSG A;  1Y0O A;  1D2K A;  4ODL A;  1D6O A;  4Z2J A;  4MNM A;  2PV1 A;  2WLY A;  2PV3 A;  4P8W A;  3G6L A;  3O5L A;  1X6N A;  1NH6 A;  4WK9 A;  4J4O A;  5HBF A;  2RSE A;  1HKK A;  4Z2L A;  4U86 A;  4DRI A;  3UQI A;  4WKH A;  2OFN A;  4Z2I A;  1KFW A;  4ODP A;  1FD9 A;  4L72 B;  2B31 A;  4G2P A;  4HAR A;  4TW7 A;  4JFK A;  4FAP A;  2MF9 A;  1ZK6 A;  2MLX A;  4GGQ A;  3O5F A;  2O92 A;  2ITK A;  4DT4 A;  4KQZ A;  4P8X A;  4ZS6 A;  3ARZ A;  2ZQV A;  3O5M A;  4ODO A;  2FAP A;  1U79 A;  4FN2 A;  1FKH A;  4IT6 A;  5DIT A;  3EY6 A;  3OA5 A;  5HW8 A;  1NMV A;  1UR8 A;  4IQ2 A;  1WB0 A;  1W9P A;  1FKF A;  3WD1 A;  3B8S A;  1FKI A;  2DPE A;  1FKK A;  2Y78 A;  1YW5 A;  1LQ0 A;  4KR0 B;  3ARS A;  1E6Z A;  3RM9 A;  3AS2 A;  4W9O A;  3FY1 A;  4ODN A;  3KAD A;  2ESC A;  4DRO A;  1D7I A;  1P5Q A;  2JZV A;  1W1Y A;  4DRJ A;  1FKD A;  4TNS A;  3WD3 A;  2IUZ A;  2XP6 A;  1W26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...