4R0XA

Allosteric coupling of conformational transitions in the fk1 domain of fkbp51 near the site of steroid receptor interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
MEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPGIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Coupling of Conformational Transitions in the N-terminal Domain of the 51-kDa FK506-binding Protein (FKBP51) Near Its Site of Interaction with the Steroid Receptor Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4r0xA00
1YATA 1FKRA 4ODPA 1YW5A 1U79A 4IQCA 3RGCA 2DG3A 2LPVA 1FKDA 2MNTA 3UI5A 3WH0A 1ROTA 4FN2A 4DRQA 1J4HA 5HWBA 2KGJA 3UQAA 2MPHA 4DRNA 1KT0A 4TW7A 1FJDA 3O5QA 5HW7A 1C9HA 3O5LA 4ODOA 5DITA 2ZR4A 2M08A 2ZR6A 1L1PA 1HXVA 2VN1A 2JZVA 2LGOA 1D7JA 1FKKA 3IK8A 4ODKA 2RUCA 1R9HA 4C02B 4U84A 5DIVA 1FKGA 1QZ2A 2KE0A 2RUDA 4LAVA 4QIBA 4MSPA 3JXVA 2RSEA 2L2SA 1ZK6A 4JFKA 2ZR5A 1M5YA 3CGMA 1FKJA 3NI6A 3KAGA 3O5GA 1JVWA 3KZ7A 4LAYA 1Y0OA 4QT2A 5J6EA 3I6CA 1D6OA 3EY6A 3IKDA 3JYJA 2LJ4A 2UZ5A 2F21A 4DROA 4DRHA 2RURA 1TCOC 2PV2A 2M2AA 4JFIA 1FD9A 1BL4A 2ZQTA 1D7HA 4DH0A 2F2DA 1J4IA 1NMWA 1FAPA 2XP8A 4ODNA 3UQIA 4DZ3A 3KAFA 2KI3A 1FKBA 3GPKA 3TC5A 2PPOA 4ITZA 3VAWA 4DT4A 1J6YA 3UI4A 4DRIA 2N87A 5HW8A 1PINA 4GGQA 5GPGA 2PBCA 4ODMA 4JFLA 3KABA 5BXJA 2MLYA 1Q6UA 4U86A 3RFWA 2XP7A 2KO7A 4ODQA 3LUOA 2IF4A 4N19A 4DRMA 4ODRA 2MLXA 3IKGA 4TW8A 3O5OA 5D75A 3NRKA 2ITKA 3KAIA 5I98A 2PV1A 1FKFA 5HWCA 2F4EA 3MDYB 4G50A 4ODLA 2MLZA 2D9FA 3H9RB 1KT1A 4J4NA 3UI6A 2KR7A 4QT3A 3CGNA 4TNSA 3O5MA 4O2TA 5HTGA 3UQBA 2Q5AA 1W26A 4LAXA 4J4OA 4LAWA 5HKGA 2FAPA 3OOBA 4DRPA 3KACA 1F40A 3TCZA 1JNSA 2KFWA 4IQ2A 4FAPA 2DG4A 1P5QA 3O5KA 3PA7A 5HW6A 4DRKA 1EQ3A 2XP5A 2XP9A 2Y78A 2PPNA 3JYMA 4JYSA 4R0XA 2RUQA 1F8AB 2XPAA 2XP4A 1FKTA 3O5RA 2XP3A 4U85A 3O5PA 4GIVA 3TDBA 1QPLA 2AWGA 3O5FA 3B7XA 4W9PA 4MGVA 1A7XA 1JNTA 4NNRA 3O5DA 3UF8A 1QPFA 2PPPA 3KCEA 1FKIA 3FAPA 2XPBA 3ODKA 4JFJA 3PRBA 1FKHA 3KADA 1J4RA 1FKSA 3NTPA 2M1IA 4BF8A 1NMVA 1BKFA 1Q1CA 1Q6IA 4DIPA 4DZ2A 1NSGA 1D7IA 5HUAA 2MF9A 1FKLA 2RQSA 3KAHA 2VCDA 4TYOA 3O5JA 1ROUA 4W9OA 4IPXA 3PRDA 3O5IA 5DIUA 1EYMA 1Q6HA 2XP6A 2ZQSA 1B6CA 2PV3A 2OFNA 4JFMA 1ZCNA 4W9QA 2FKEA 2ZQUA 2K8IA 2DG9A 3O5EA 5HT1A 1N1AA 4TX0A 2LKNA 1PBKA 4TW6A 5B8IC 4DRJA 4G2PA 1T11A 2ZQVA 3IHZA
chains in the Genus database with same CATH superfamily
2PI6A 5GPRA 1CTNA 4ZPWR 1U79A 2DG3A 2MNTA 3GU0A 3QOKA 4DRQA 2KGJA 3O5QA 1C9HA 2ZR4A 1L1PA 1H0GA 2JZVA 1FKKA 3IK8A 4MTVA 4ODKA 1R9HA 4U84A 5DIVA 2KE0A 4LAVA 1HKMA 1OWQA 1LQ0A 3JXVA 4JFKA 2ZR5A 1ZBWA 4Z2IA 3ARTA 2F23A 3KZ7A 4DWSB 1OGGA 5J6EA 3B9AA 4KQZA 3IKDA 3JYJA 3RM4A 1X6NA 5DF0A 1LG2A 2F21A 4L3NA 3B9DA 4P8XA 1J4IA 1NMWA 3BMBA 1FAPA 4DZ3A 2KI3A 1GOIA 3GPKA 3TC5A 2A3CA 4P8UA 5GQBA 4DT4A 1J6YA 3WD3A 5GPGA 2PBCA 4URIA 1Q6UA 2XP7A 1HKKA 2DT3A 3CZ8A 1XHGA 4DRMA 1SR0A 3WQWA 3AROA 5I98A 5HWCA 4ODLA 2MLZA 2D9FA 4DWSA 2KR7A 3ALGA 4TNSA 2Q5AA 1W26A 4J4OA 5HKGA 1NWRA 3TCZA 3O5KA 1GUVA 1EQ3A 2Y78A 2DT1A 3JYMA 4R0XA 2RUQA 2XPAA 2XP4A 3O5RA 1HKJA 3O5PA 2B5UB 3WKZA 3TDBA 4W9PA 4MGVA 3O5DA 1IX5A 1LL4A 4W5UA 4BF8A 1NMVA 1BKFA 4HBOA 1Q1CA 4DZ2A 4ML4A 1D7IA 4Z2JA 4WK9A 4MNLA 3B8SA 1E9LA 1SYTA 1B6CA 1KFWA 4Z2LA 2OFNA 2K8IA 1GPFA 4TW6A 1E44A 4DRJA 4G2PA 4P8WA 1E6ZA 3WD1A 3WH0A 1FKDA 3WL1A 4FN2A 1J4HA 5HWBA 2IUZA 1KT0A 4DRNA 1FFQA 4HARA 2ZR6A 2M08A 1W1TA 2VN1A 1GRJA 4C02B 2RUCA 3B9EA 1W9UA 4PTMA 4MSPA 2RSEA 3CGMA 1FKJA 3NI6A 4MNJA 1NH6A 2O9OA 4LAYA 2WLYA 2LJ4A 1K9TA 4WKAA 3ARVA 4DRHA 2RURA 4DH0A 3GTYX 1FKBA 3EIPA 5HW8A 1PINA 4GGQA 3ARWA 1WB0A 2A3AA 3KABA 5BXJA 1UR9A 2KO7A 3LUOA 4N19A 4ODRA 2EULA 1HJVA 3O5OA 1FKFA 3WD0A 1LG1A 3G6LA 4HBEA 4QT3A 4IT6A 2WK2A 2FAPA 1F40A 3KACA 4Z2GA 4IQ2A 1F8AB 1JNEA 3CHCA 1JNDA 2A3EA 4GIVA 2AWGA 3O5FA 3B7XA 1FKIA 1ZBCA 4LGXA 3NTPA 1EIBA 1NSGA 5HUAA 2MF9A 1ROUA 2ETNA 4W9OA 2DSVA 4WKFA 5DIUA 4MNMA 1LL7A 3WIJA 2XP6A 4NSBA 3AS1A 2PV3A 2DSWA 2LKNA 2ZQVA 1YATA 1YW5A 4IQCA 2LPVA 3ARUA 3UI5A 1ROTA 2FDMA 3UQAA 2DPEA 2MPHA 4Z2KA 4ODOA 5DITA 1H0IA 2LGOA 1FKGA 2RUDA 1ZB5A 3ARRA 3CHFA 3AS0A 1ZBKA 3ARZA 4L72B 5DO2A 1Y0OA 2WM0A 4P8VA 3I6CA 2PN0A 3EY6A 4NZCA 4DROA 1TCOC 1JCHB 3FXYA 2PV2A 4JFIA 1BL4A 1D7HA 1E6NA 2F2DA 2WLZA 2A3BA 1RD6A 4QZVB 4IT4A 1ZBVA 4DWSD 5HBFA 4ITZA 2G8ZA 4DRIA 3ARQA 2DSZA 4JFLA 3RFWA 2IF4A 2MLXA 4TW8A 2ITKA 3ARXA 2PV1A 2F4EA 4G50A 2AOSA 3ARSA 3H9RB 1KT1A 3RM9A 3O5MA 3UQBA 4LAXA 4LAWA 3OA5A 3OOBA 1HJXA 4FAPA 4DRKA 3ARPA 2XP9A 2ESCA 4JYSA 1FKTA 4U85A 4ZS6A 1QPLA 1EDQA 2PPPA 3KCEA 3ODKA 3FAPA 1WAWA 2XPBA 4JFJA 4MNKA 2DT2A 3PRBA 1FKHA 1J4RA 1D2KA 1Q6IA 4WIWA 1FKLA 3KAHA 1W1VA 1W1YA 1EYMA 1Q6HA 2ZQSA 2B31A 1E6RA 4JFMA 1ZCNA 2YBTA 2ZQUA 3O5EA 1X6LA 4WKHA 1PBKA 1T11A 1O6IA 4MAVA 3IHZA 3PR9A 3G6MA 4ODPA 3RGCA 1FKRA 1FFRA 4TW7A 1FJDA 3O5LA 1W9VA 3W4RA 3WD2A 1HXVA 2DT0A 1ZL1A 1W1PA 1D7JA 4R5EA 2P4VA 1QZ2A 4QIBA 2YBUA 1NWSA 1ZK6A 2L2SA 1M5YA 3CH9A 3RMEA 3KAGA 3O5GA 1JVWA 1ZU8A 4QT2A 3WQVA 1D6OA 1TFVA 2UZ5A 1UR8A 1LL6A 3RM8A 2M2AA 1FD9A 2ZQTA 1NWUA 4Q22A 4XAKA 2XP8A 4ODNA 3WD4A 3UQIA 3KAFA 2PPOA 3VAWA 4KR0B 4AY1A 3UI4A 2G41A 2N87A 1HKIA 4ODMA 2MLYA 1WNOA 4U86A 3AS3A 5JH8A 4ODQA 3IKGA 3WL0A 5D75A 3NRKA 3KAIA 3ALFA 3AQUA 3BXWA 3MDYB 4Z2HA 1VF8A 4J4NA 3CHDA 4Q7NA 3UI6A 3CGNA 4O2TA 5HTGA 4ZPTR 3CHEA 1EHNA 2OLHA 4UDMA 4ZPVR 4DRPA 2KFWA 1HJWA 1P5QA 1OGBA 2DG4A 3PA7A 5HW6A 4S3KA 3PRAA 2XP5A 1ITXA 2PPNA 3FY1A 2XP3A 5HW7A 3ARYA 1A7XA 1JNTA 2O92A 4MPKA 4NNRA 2QF8A 3UF8A 1QPFA 1E6PA 4WJXA 3KADA 3AS2A 1FKSA 2M1IA 1NWTA 1W9PA 1E15A 4DIPA 1XRVA 2RQSA 4TYOA 1LJYA 2VCDA 3O5JA 4IPXA 3PRDA 3O5IA 2DSUA 5DEZA 4DWSC 4W9QA 4S3JA 2FKEA 5HT1A 2DG9A 1N1AA 4TX0A 5B8IC 1JNSA
chains in the Genus database with same CATH topology
2PI6A 5GPRA 1CTNA 4ZPWR 1U79A 2DG3A 2MNTA 4DRQA 3QOKA 2KGJA 3O5QA 1C9HA 2ZR4A 1L1PA 1H0GA 2JZVA 1FKKA 3IK8A 4MTVA 4ODKA 1R9HA 4U84A 5DIVA 2KE0A 4LAVA 1HKMA 1OWQA 1LQ0A 3JXVA 4JFKA 2ZR5A 1ZBWA 4Z2IA 3ARTA 3KZ7A 4DWSB 1OGGA 5J6EA 3B9AA 4KQZA 3IKDA 3JYJA 3RM4A 1X6NA 5DF0A 1LG2A 2F21A 4L3NA 3B9DA 4P8XA 1J4IA 1NMWA 1FAPA 4DZ3A 2KI3A 1GOIA 3GPKA 3TC5A 2A3CA 4P8UA 5GQBA 4DT4A 1J6YA 3WD3A 5GPGA 2PBCA 4URIA 1Q6UA 2XP7A 1HKKA 2DT3A 3CZ8A 1XHGA 4DRMA 1SR0A 3WQWA 3AROA 5I98A 5HWCA 4ODLA 2MLZA 2D9FA 4DWSA 2KR7A 3ALGA 4TNSA 2Q5AA 1W26A 4J4OA 5HKGA 1NWRA 3TCZA 3O5KA 1GUVA 1EQ3A 2Y78A 2DT1A 3JYMA 4R0XA 2RUQA 2XPAA 2XP4A 3O5RA 1HKJA 3O5PA 3WKZA 3TDBA 4W9PA 4MGVA 3O5DA 1IX5A 1LL4A 4W5UA 4BF8A 1NMVA 1BKFA 4HBOA 1Q1CA 4DZ2A 4ML4A 1D7IA 4Z2JA 4WK9A 4MNLA 3B8SA 1E9LA 1SYTA 1B6CA 1KFWA 4Z2LA 2OFNA 2K8IA 1GPFA 4TW6A 4DRJA 4G2PA 4P8WA 1E6ZA 3WD1A 3WH0A 1FKDA 3WL1A 4FN2A 1J4HA 5HWBA 2IUZA 1KT0A 4DRNA 1FFQA 4HARA 2ZR6A 2M08A 1W1TA 2VN1A 4C02B 2RUCA 3B9EA 1W9UA 4PTMA 4MSPA 2RSEA 3CGMA 1FKJA 3NI6A 4MNJA 1NH6A 2O9OA 4LAYA 2WLYA 2LJ4A 1K9TA 4WKAA 3ARVA 4DRHA 2RURA 4DH0A 1FKBA 5HW8A 1PINA 4GGQA 3ARWA 1WB0A 2A3AA 3KABA 5BXJA 1UR9A 2KO7A 3LUOA 4N19A 4ODRA 1HJVA 3O5OA 1FKFA 3WD0A 1LG1A 3G6LA 4HBEA 4QT3A 4IT6A 2WK2A 2FAPA 1F40A 3KACA 4Z2GA 4IQ2A 1F8AB 1JNEA 3CHCA 1JNDA 2A3EA 4GIVA 2AWGA 3O5FA 3B7XA 1FKIA 1ZBCA 4LGXA 3NTPA 1EIBA 1NSGA 5HUAA 2MF9A 1ROUA 4W9OA 2DSVA 4WKFA 5DIUA 4MNMA 1LL7A 3WIJA 2XP6A 4NSBA 3AS1A 2PV3A 2DSWA 2LKNA 2ZQVA 1YATA 1YW5A 4IQCA 2LPVA 3ARUA 3UI5A 1ROTA 2FDMA 3UQAA 2DPEA 2MPHA 4Z2KA 4ODOA 5DITA 1H0IA 2LGOA 1FKGA 2RUDA 1ZB5A 3ARRA 3CHFA 3AS0A 1ZBKA 3ARZA 4L72B 5DO2A 1Y0OA 2WM0A 4P8VA 3I6CA 3EY6A 4NZCA 4DROA 1TCOC 3FXYA 2PV2A 4JFIA 1BL4A 1D7HA 1E6NA 2F2DA 2WLZA 2A3BA 1RD6A 4QZVB 4IT4A 1ZBVA 4DWSD 5HBFA 4ITZA 2G8ZA 4DRIA 3ARQA 2DSZA 4JFLA 3RFWA 2IF4A 2MLXA 4TW8A 2ITKA 3ARXA 2PV1A 2F4EA 4G50A 2AOSA 3ARSA 3H9RB 1KT1A 3RM9A 3O5MA 3UQBA 4LAXA 4LAWA 3OA5A 3OOBA 1HJXA 4FAPA 4DRKA 3ARPA 2XP9A 2ESCA 4JYSA 1FKTA 4U85A 4ZS6A 1QPLA 1EDQA 2PPPA 3KCEA 3ODKA 3FAPA 1WAWA 2XPBA 4JFJA 4MNKA 2DT2A 3PRBA 1FKHA 1J4RA 1D2KA 1Q6IA 4WIWA 1FKLA 3KAHA 1W1VA 1W1YA 1EYMA 1Q6HA 2ZQSA 2B31A 1E6RA 4JFMA 1ZCNA 2YBTA 2ZQUA 3O5EA 1X6LA 4WKHA 1PBKA 1T11A 1O6IA 4MAVA 3IHZA 3PR9A 3G6MA 4ODPA 3RGCA 1FKRA 1FFRA 4TW7A 1FJDA 3O5LA 1W9VA 3W4RA 3WD2A 1HXVA 2DT0A 1ZL1A 1W1PA 1D7JA 4R5EA 1QZ2A 4QIBA 2YBUA 1NWSA 1ZK6A 2L2SA 1M5YA 3CH9A 3RMEA 3KAGA 3O5GA 1JVWA 1ZU8A 4QT2A 3WQVA 1D6OA 1TFVA 2UZ5A 1UR8A 1LL6A 3RM8A 2M2AA 1FD9A 2ZQTA 1NWUA 4Q22A 4XAKA 2XP8A 4ODNA 3WD4A 3UQIA 3KAFA 2PPOA 3VAWA 4KR0B 4AY1A 3UI4A 2G41A 2N87A 1HKIA 4ODMA 2MLYA 1WNOA 4U86A 3AS3A 5JH8A 4ODQA 3IKGA 3WL0A 5D75A 3NRKA 3KAIA 3ALFA 3AQUA 3BXWA 3MDYB 4Z2HA 1VF8A 4J4NA 3CHDA 4Q7NA 3UI6A 3CGNA 4O2TA 5HTGA 4ZPTR 3CHEA 1EHNA 2OLHA 4ZPVR 4DRPA 2KFWA 1HJWA 1P5QA 1OGBA 2DG4A 3PA7A 5HW6A 4S3KA 3PRAA 2XP5A 1ITXA 2PPNA 3FY1A 2XP3A 5HW7A 3ARYA 1A7XA 1JNTA 2O92A 4MPKA 4NNRA 2QF8A 3UF8A 1QPFA 1E6PA 4WJXA 3KADA 3AS2A 1FKSA 2M1IA 1NWTA 1W9PA 1E15A 4DIPA 1XRVA 2RQSA 4TYOA 1LJYA 2VCDA 3O5JA 4IPXA 3PRDA 3O5IA 2DSUA 5DEZA 4DWSC 4W9QA 4S3JA 2FKEA 5HT1A 2DG9A 1N1AA 4TX0A 5B8IC 1JNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAT A;  1FKR A;  4ODP A;  1YW5 A;  1U79 A;  4IQC A;  3RGC A;  2DG3 A;  2LPV A;  1FKD A;  2MNT A;  3UI5 A;  3WH0 A;  1ROT A;  4FN2 A;  4DRQ A;  1J4H A;  5HWB A;  2KGJ A;  3UQA A;  2MPH A;  4DRN A;  1KT0 A;  4TW7 A;  1FJD A;  3O5Q A;  5HW7 A;  1C9H A;  3O5L A;  4ODO A;  5DIT A;  2ZR4 A;  2M08 A;  2ZR6 A;  1L1P A;  1HXV A;  2VN1 A;  2JZV A;  2LGO A;  1D7J A;  1FKK A;  3IK8 A;  4ODK A;  2RUC A;  1R9H A;  4C02 B;  4U84 A;  5DIV A;  1FKG A;  1QZ2 A;  2KE0 A;  2RUD A;  4LAV A;  4QIB A;  4MSP A;  3JXV A;  2RSE A;  2L2S A;  1ZK6 A;  4JFK A;  2ZR5 A;  1M5Y A;  3CGM A;  1FKJ A;  3NI6 A;  3KAG A;  3O5G A;  1JVW A;  3KZ7 A;  4LAY A;  1Y0O A;  4QT2 A;  5J6E A;  3I6C A;  1D6O A;  3EY6 A;  3IKD A;  3JYJ A;  2LJ4 A;  2UZ5 A;  2F21 A;  4DRO A;  4DRH A;  2RUR A;  1TCO C;  2PV2 A;  2M2A A;  4JFI A;  1FD9 A;  1BL4 A;  2ZQT A;  1D7H A;  4DH0 A;  2F2D A;  1J4I A;  1NMW A;  1FAP A;  2XP8 A;  4ODN A;  3UQI A;  4DZ3 A;  3KAF A;  2KI3 A;  1FKB A;  3GPK A;  3TC5 A;  2PPO A;  4ITZ A;  3VAW A;  4DT4 A;  1J6Y A;  3UI4 A;  4DRI A;  2N87 A;  5HW8 A;  1PIN A;  4GGQ A;  5GPG A;  2PBC A;  4ODM A;  4JFL A;  3KAB A;  5BXJ A;  2MLY A;  1Q6U A;  4U86 A;  3RFW A;  2XP7 A;  2KO7 A;  4ODQ A;  3LUO A;  2IF4 A;  4N19 A;  4DRM A;  4ODR A;  2MLX A;  3IKG A;  4TW8 A;  3O5O A;  5D75 A;  3NRK A;  2ITK A;  3KAI A;  5I98 A;  2PV1 A;  1FKF A;  5HWC A;  2F4E A;  3MDY B;  4G50 A;  4ODL A;  2MLZ A;  2D9F A;  3H9R B;  1KT1 A;  4J4N A;  3UI6 A;  2KR7 A;  4QT3 A;  3CGN A;  4TNS A;  3O5M A;  4O2T A;  5HTG A;  3UQB A;  2Q5A A;  1W26 A;  4LAX A;  4J4O A;  4LAW A;  5HKG A;  2FAP A;  3OOB A;  4DRP A;  3KAC A;  1F40 A;  3TCZ A;  1JNS A;  2KFW A;  4IQ2 A;  4FAP A;  2DG4 A;  1P5Q A;  3O5K A;  3PA7 A;  5HW6 A;  4DRK A;  1EQ3 A;  2XP5 A;  2XP9 A;  2Y78 A;  2PPN A;  3JYM A;  4JYS A;  4R0X A;  2RUQ A;  1F8A B;  2XPA A;  2XP4 A;  1FKT A;  3O5R A;  2XP3 A;  4U85 A;  3O5P A;  4GIV A;  3TDB A;  1QPL A;  2AWG A;  3O5F A;  3B7X A;  4W9P A;  4MGV A;  1A7X A;  1JNT A;  4NNR A;  3O5D A;  3UF8 A;  1QPF A;  2PPP A;  3KCE A;  1FKI A;  3FAP A;  2XPB A;  3ODK A;  4JFJ A;  3PRB A;  1FKH A;  3KAD A;  1J4R A;  1FKS A;  3NTP A;  2M1I A;  4BF8 A;  1NMV A;  1BKF A;  1Q1C A;  1Q6I A;  4DIP A;  4DZ2 A;  1NSG A;  1D7I A;  5HUA A;  2MF9 A;  1FKL A;  2RQS A;  3KAH A;  2VCD A;  4TYO A;  3O5J A;  1ROU A;  4W9O A;  4IPX A;  3PRD A;  3O5I A;  5DIU A;  1EYM A;  1Q6H A;  2XP6 A;  2ZQS A;  1B6C A;  2PV3 A;  2OFN A;  4JFM A;  1ZCN A;  4W9Q A;  2FKE A;  2ZQU A;  2K8I A;  2DG9 A;  3O5E A;  5HT1 A;  1N1A A;  4TX0 A;  2LKN A;  1PBK A;  4TW6 A;  5B8I C;  4DRJ A;  4G2P A;  1T11 A;  2ZQV A;  3IHZ A; 
#chains in the Genus database with same CATH topology
 2PI6 A;  5GPR A;  1CTN A;  4ZPW R;  1U79 A;  2DG3 A;  2MNT A;  3GU0 A;  3QOK A;  4DRQ A;  2KGJ A;  3O5Q A;  1C9H A;  2ZR4 A;  1L1P A;  1H0G A;  2JZV A;  1FKK A;  3IK8 A;  4MTV A;  4ODK A;  1R9H A;  4U84 A;  5DIV A;  2KE0 A;  4LAV A;  1HKM A;  1OWQ A;  1LQ0 A;  3JXV A;  4JFK A;  2ZR5 A;  1ZBW A;  4Z2I A;  3ART A;  2F23 A;  3KZ7 A;  4DWS B;  1OGG A;  5J6E A;  3B9A A;  4KQZ A;  3IKD A;  3JYJ A;  3RM4 A;  1X6N A;  5DF0 A;  1LG2 A;  2F21 A;  4L3N A;  3B9D A;  4P8X A;  1J4I A;  1NMW A;  3BMB A;  1FAP A;  4DZ3 A;  2KI3 A;  1GOI A;  3GPK A;  3TC5 A;  2A3C A;  4P8U A;  5GQB A;  4DT4 A;  1J6Y A;  3WD3 A;  5GPG A;  2PBC A;  4URI A;  1Q6U A;  2XP7 A;  1HKK A;  2DT3 A;  3CZ8 A;  1XHG A;  4DRM A;  1SR0 A;  3WQW A;  3ARO A;  5I98 A;  5HWC A;  4ODL A;  2MLZ A;  2D9F A;  4DWS A;  2KR7 A;  3ALG A;  4TNS A;  2Q5A A;  1W26 A;  4J4O A;  5HKG A;  1NWR A;  3TCZ A;  3O5K A;  1GUV A;  1EQ3 A;  2Y78 A;  2DT1 A;  3JYM A;  4R0X A;  2RUQ A;  2XPA A;  2XP4 A;  3O5R A;  1HKJ A;  3O5P A;  2B5U B;  3WKZ A;  3TDB A;  4W9P A;  4MGV A;  3O5D A;  1IX5 A;  1LL4 A;  4W5U A;  4BF8 A;  1NMV A;  1BKF A;  4HBO A;  1Q1C A;  4DZ2 A;  4ML4 A;  1D7I A;  4Z2J A;  4WK9 A;  4MNL A;  3B8S A;  1E9L A;  1SYT A;  1B6C A;  1KFW A;  4Z2L A;  2OFN A;  2K8I A;  1GPF A;  4TW6 A;  1E44 A;  4DRJ A;  4G2P A;  4P8W A;  1E6Z A;  3WD1 A;  3WH0 A;  1FKD A;  3WL1 A;  4FN2 A;  1J4H A;  5HWB A;  2IUZ A;  1KT0 A;  4DRN A;  1FFQ A;  4HAR A;  2ZR6 A;  2M08 A;  1W1T A;  2VN1 A;  1GRJ A;  4C02 B;  2RUC A;  3B9E A;  1W9U A;  4PTM A;  4MSP A;  2RSE A;  3CGM A;  1FKJ A;  3NI6 A;  4MNJ A;  1NH6 A;  2O9O A;  4LAY A;  2WLY A;  2LJ4 A;  1K9T A;  4WKA A;  3ARV A;  4DRH A;  2RUR A;  4DH0 A;  3GTY X;  1FKB A;  3EIP A;  5HW8 A;  1PIN A;  4GGQ A;  3ARW A;  1WB0 A;  2A3A A;  3KAB A;  5BXJ A;  1UR9 A;  2KO7 A;  3LUO A;  4N19 A;  4ODR A;  2EUL A;  1HJV A;  3O5O A;  1FKF A;  3WD0 A;  1LG1 A;  3G6L A;  4HBE A;  4QT3 A;  4IT6 A;  2WK2 A;  2FAP A;  1F40 A;  3KAC A;  4Z2G A;  4IQ2 A;  1F8A B;  1JNE A;  3CHC A;  1JND A;  2A3E A;  4GIV A;  2AWG A;  3O5F A;  3B7X A;  1FKI A;  1ZBC A;  4LGX A;  3NTP A;  1EIB A;  1NSG A;  5HUA A;  2MF9 A;  1ROU A;  2ETN A;  4W9O A;  2DSV A;  4WKF A;  5DIU A;  4MNM A;  1LL7 A;  3WIJ A;  2XP6 A;  4NSB A;  3AS1 A;  2PV3 A;  2DSW A;  2LKN A;  2ZQV A;  1YAT A;  1YW5 A;  4IQC A;  2LPV A;  3ARU A;  3UI5 A;  1ROT A;  2FDM A;  3UQA A;  2DPE A;  2MPH A;  4Z2K A;  4ODO A;  5DIT A;  1H0I A;  2LGO A;  1FKG A;  2RUD A;  1ZB5 A;  3ARR A;  3CHF A;  3AS0 A;  1ZBK A;  3ARZ A;  4L72 B;  5DO2 A;  1Y0O A;  2WM0 A;  4P8V A;  3I6C A;  2PN0 A;  3EY6 A;  4NZC A;  4DRO A;  1TCO C;  1JCH B;  3FXY A;  2PV2 A;  4JFI A;  1BL4 A;  1D7H A;  1E6N A;  2F2D A;  2WLZ A;  2A3B A;  1RD6 A;  4QZV B;  4IT4 A;  1ZBV A;  4DWS D;  5HBF A;  4ITZ A;  2G8Z A;  4DRI A;  3ARQ A;  2DSZ A;  4JFL A;  3RFW A;  2IF4 A;  2MLX A;  4TW8 A;  2ITK A;  3ARX A;  2PV1 A;  2F4E A;  4G50 A;  2AOS A;  3ARS A;  3H9R B;  1KT1 A;  3RM9 A;  3O5M A;  3UQB A;  4LAX A;  4LAW A;  3OA5 A;  3OOB A;  1HJX A;  4FAP A;  4DRK A;  3ARP A;  2XP9 A;  2ESC A;  4JYS A;  1FKT A;  4U85 A;  4ZS6 A;  1QPL A;  1EDQ A;  2PPP A;  3KCE A;  3ODK A;  3FAP A;  1WAW A;  2XPB A;  4JFJ A;  4MNK A;  2DT2 A;  3PRB A;  1FKH A;  1J4R A;  1D2K A;  1Q6I A;  4WIW A;  1FKL A;  3KAH A;  1W1V A;  1W1Y A;  1EYM A;  1Q6H A;  2ZQS A;  2B31 A;  1E6R A;  4JFM A;  1ZCN A;  2YBT A;  2ZQU A;  3O5E A;  1X6L A;  4WKH A;  1PBK A;  1T11 A;  1O6I A;  4MAV A;  3IHZ A;  3PR9 A;  3G6M A;  4ODP A;  3RGC A;  1FKR A;  1FFR A;  4TW7 A;  1FJD A;  3O5L A;  1W9V A;  3W4R A;  3WD2 A;  1HXV A;  2DT0 A;  1ZL1 A;  1W1P A;  1D7J A;  4R5E A;  2P4V A;  1QZ2 A;  4QIB A;  2YBU A;  1NWS A;  1ZK6 A;  2L2S A;  1M5Y A;  3CH9 A;  3RME A;  3KAG A;  3O5G A;  1JVW A;  1ZU8 A;  4QT2 A;  3WQV A;  1D6O A;  1TFV A;  2UZ5 A;  1UR8 A;  1LL6 A;  3RM8 A;  2M2A A;  1FD9 A;  2ZQT A;  1NWU A;  4Q22 A;  4XAK A;  2XP8 A;  4ODN A;  3WD4 A;  3UQI A;  3KAF A;  2PPO A;  3VAW A;  4KR0 B;  4AY1 A;  3UI4 A;  2G41 A;  2N87 A;  1HKI A;  4ODM A;  2MLY A;  1WNO A;  4U86 A;  3AS3 A;  5JH8 A;  4ODQ A;  3IKG A;  3WL0 A;  5D75 A;  3NRK A;  3KAI A;  3ALF A;  3AQU A;  3BXW A;  3MDY B;  4Z2H A;  1VF8 A;  4J4N A;  3CHD A;  4Q7N A;  3UI6 A;  3CGN A;  4O2T A;  5HTG A;  4ZPT R;  3CHE A;  1EHN A;  2OLH A;  4UDM A;  4ZPV R;  4DRP A;  2KFW A;  1HJW A;  1P5Q A;  1OGB A;  2DG4 A;  3PA7 A;  5HW6 A;  4S3K A;  3PRA A;  2XP5 A;  1ITX A;  2PPN A;  3FY1 A;  2XP3 A;  5HW7 A;  3ARY A;  1A7X A;  1JNT A;  2O92 A;  4MPK A;  4NNR A;  2QF8 A;  3UF8 A;  1QPF A;  1E6P A;  4WJX A;  3KAD A;  3AS2 A;  1FKS A;  2M1I A;  1NWT A;  1W9P A;  1E15 A;  4DIP A;  1XRV A;  2RQS A;  4TYO A;  1LJY A;  2VCD A;  3O5J A;  4IPX A;  3PRD A;  3O5I A;  2DSU A;  5DEZ A;  4DWS C;  4W9Q A;  4S3J A;  2FKE A;  5HT1 A;  2DG9 A;  1N1A A;  4TX0 A;  5B8I C;  1JNS A; 
#chains in the Genus database with same CATH homology
 2PI6 A;  5GPR A;  1CTN A;  4ZPW R;  1U79 A;  2DG3 A;  2MNT A;  4DRQ A;  3QOK A;  2KGJ A;  3O5Q A;  1C9H A;  2ZR4 A;  1L1P A;  1H0G A;  2JZV A;  1FKK A;  3IK8 A;  4MTV A;  4ODK A;  1R9H A;  4U84 A;  5DIV A;  2KE0 A;  4LAV A;  1HKM A;  1OWQ A;  1LQ0 A;  3JXV A;  4JFK A;  2ZR5 A;  1ZBW A;  4Z2I A;  3ART A;  3KZ7 A;  4DWS B;  1OGG A;  5J6E A;  3B9A A;  4KQZ A;  3IKD A;  3JYJ A;  3RM4 A;  1X6N A;  5DF0 A;  1LG2 A;  2F21 A;  4L3N A;  3B9D A;  4P8X A;  1J4I A;  1NMW A;  1FAP A;  4DZ3 A;  2KI3 A;  1GOI A;  3GPK A;  3TC5 A;  2A3C A;  4P8U A;  5GQB A;  4DT4 A;  1J6Y A;  3WD3 A;  5GPG A;  2PBC A;  4URI A;  1Q6U A;  2XP7 A;  1HKK A;  2DT3 A;  3CZ8 A;  1XHG A;  4DRM A;  1SR0 A;  3WQW A;  3ARO A;  5I98 A;  5HWC A;  4ODL A;  2MLZ A;  2D9F A;  4DWS A;  2KR7 A;  3ALG A;  4TNS A;  2Q5A A;  1W26 A;  4J4O A;  5HKG A;  1NWR A;  3TCZ A;  3O5K A;  1GUV A;  1EQ3 A;  2Y78 A;  2DT1 A;  3JYM A;  4R0X A;  2RUQ A;  2XPA A;  2XP4 A;  3O5R A;  1HKJ A;  3O5P A;  3WKZ A;  3TDB A;  4W9P A;  4MGV A;  3O5D A;  1IX5 A;  1LL4 A;  4W5U A;  4BF8 A;  1NMV A;  1BKF A;  4HBO A;  1Q1C A;  4DZ2 A;  4ML4 A;  1D7I A;  4Z2J A;  4WK9 A;  4MNL A;  3B8S A;  1E9L A;  1SYT A;  1B6C A;  1KFW A;  4Z2L A;  2OFN A;  2K8I A;  1GPF A;  4TW6 A;  4DRJ A;  4G2P A;  4P8W A;  1E6Z A;  3WD1 A;  3WH0 A;  1FKD A;  3WL1 A;  4FN2 A;  1J4H A;  5HWB A;  2IUZ A;  1KT0 A;  4DRN A;  1FFQ A;  4HAR A;  2ZR6 A;  2M08 A;  1W1T A;  2VN1 A;  4C02 B;  2RUC A;  3B9E A;  1W9U A;  4PTM A;  4MSP A;  2RSE A;  3CGM A;  1FKJ A;  3NI6 A;  4MNJ A;  1NH6 A;  2O9O A;  4LAY A;  2WLY A;  2LJ4 A;  1K9T A;  4WKA A;  3ARV A;  4DRH A;  2RUR A;  4DH0 A;  1FKB A;  5HW8 A;  1PIN A;  4GGQ A;  3ARW A;  1WB0 A;  2A3A A;  3KAB A;  5BXJ A;  1UR9 A;  2KO7 A;  3LUO A;  4N19 A;  4ODR A;  1HJV A;  3O5O A;  1FKF A;  3WD0 A;  1LG1 A;  3G6L A;  4HBE A;  4QT3 A;  4IT6 A;  2WK2 A;  2FAP A;  1F40 A;  3KAC A;  4Z2G A;  4IQ2 A;  1F8A B;  1JNE A;  3CHC A;  1JND A;  2A3E A;  4GIV A;  2AWG A;  3O5F A;  3B7X A;  1FKI A;  1ZBC A;  4LGX A;  3NTP A;  1EIB A;  1NSG A;  5HUA A;  2MF9 A;  1ROU A;  4W9O A;  2DSV A;  4WKF A;  5DIU A;  4MNM A;  1LL7 A;  3WIJ A;  2XP6 A;  4NSB A;  3AS1 A;  2PV3 A;  2DSW A;  2LKN A;  2ZQV A;  1YAT A;  1YW5 A;  4IQC A;  2LPV A;  3ARU A;  3UI5 A;  1ROT A;  2FDM A;  3UQA A;  2DPE A;  2MPH A;  4Z2K A;  4ODO A;  5DIT A;  1H0I A;  2LGO A;  1FKG A;  2RUD A;  1ZB5 A;  3ARR A;  3CHF A;  3AS0 A;  1ZBK A;  3ARZ A;  4L72 B;  5DO2 A;  1Y0O A;  2WM0 A;  4P8V A;  3I6C A;  3EY6 A;  4NZC A;  4DRO A;  1TCO C;  3FXY A;  2PV2 A;  4JFI A;  1BL4 A;  1D7H A;  1E6N A;  2F2D A;  2WLZ A;  2A3B A;  1RD6 A;  4QZV B;  4IT4 A;  1ZBV A;  4DWS D;  5HBF A;  4ITZ A;  2G8Z A;  4DRI A;  3ARQ A;  2DSZ A;  4JFL A;  3RFW A;  2IF4 A;  2MLX A;  4TW8 A;  2ITK A;  3ARX A;  2PV1 A;  2F4E A;  4G50 A;  2AOS A;  3ARS A;  3H9R B;  1KT1 A;  3RM9 A;  3O5M A;  3UQB A;  4LAX A;  4LAW A;  3OA5 A;  3OOB A;  1HJX A;  4FAP A;  4DRK A;  3ARP A;  2XP9 A;  2ESC A;  4JYS A;  1FKT A;  4U85 A;  4ZS6 A;  1QPL A;  1EDQ A;  2PPP A;  3KCE A;  3ODK A;  3FAP A;  1WAW A;  2XPB A;  4JFJ A;  4MNK A;  2DT2 A;  3PRB A;  1FKH A;  1J4R A;  1D2K A;  1Q6I A;  4WIW A;  1FKL A;  3KAH A;  1W1V A;  1W1Y A;  1EYM A;  1Q6H A;  2ZQS A;  2B31 A;  1E6R A;  4JFM A;  1ZCN A;  2YBT A;  2ZQU A;  3O5E A;  1X6L A;  4WKH A;  1PBK A;  1T11 A;  1O6I A;  4MAV A;  3IHZ A;  3PR9 A;  3G6M A;  4ODP A;  3RGC A;  1FKR A;  1FFR A;  4TW7 A;  1FJD A;  3O5L A;  1W9V A;  3W4R A;  3WD2 A;  1HXV A;  2DT0 A;  1ZL1 A;  1W1P A;  1D7J A;  4R5E A;  1QZ2 A;  4QIB A;  2YBU A;  1NWS A;  1ZK6 A;  2L2S A;  1M5Y A;  3CH9 A;  3RME A;  3KAG A;  3O5G A;  1JVW A;  1ZU8 A;  4QT2 A;  3WQV A;  1D6O A;  1TFV A;  2UZ5 A;  1UR8 A;  1LL6 A;  3RM8 A;  2M2A A;  1FD9 A;  2ZQT A;  1NWU A;  4Q22 A;  4XAK A;  2XP8 A;  4ODN A;  3WD4 A;  3UQI A;  3KAF A;  2PPO A;  3VAW A;  4KR0 B;  4AY1 A;  3UI4 A;  2G41 A;  2N87 A;  1HKI A;  4ODM A;  2MLY A;  1WNO A;  4U86 A;  3AS3 A;  5JH8 A;  4ODQ A;  3IKG A;  3WL0 A;  5D75 A;  3NRK A;  3KAI A;  3ALF A;  3AQU A;  3BXW A;  3MDY B;  4Z2H A;  1VF8 A;  4J4N A;  3CHD A;  4Q7N A;  3UI6 A;  3CGN A;  4O2T A;  5HTG A;  4ZPT R;  3CHE A;  1EHN A;  2OLH A;  4ZPV R;  4DRP A;  2KFW A;  1HJW A;  1P5Q A;  1OGB A;  2DG4 A;  3PA7 A;  5HW6 A;  4S3K A;  3PRA A;  2XP5 A;  1ITX A;  2PPN A;  3FY1 A;  2XP3 A;  5HW7 A;  3ARY A;  1A7X A;  1JNT A;  2O92 A;  4MPK A;  4NNR A;  2QF8 A;  3UF8 A;  1QPF A;  1E6P A;  4WJX A;  3KAD A;  3AS2 A;  1FKS A;  2M1I A;  1NWT A;  1W9P A;  1E15 A;  4DIP A;  1XRV A;  2RQS A;  4TYO A;  1LJY A;  2VCD A;  3O5J A;  4IPX A;  3PRD A;  3O5I A;  2DSU A;  5DEZ A;  4DWS C;  4W9Q A;  4S3J A;  2FKE A;  5HT1 A;  2DG9 A;  1N1A A;  4TX0 A;  5B8I C;  1JNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...