4R0XA

Allosteric coupling of conformational transitions in the fk1 domain of fkbp51 near the site of steroid receptor interaction
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
122
structure length
122
Chain Sequence
MEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPGIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Coupling of Conformational Transitions in the N-terminal Domain of the 51-kDa FK506-binding Protein (FKBP51) Near Its Site of Interaction with the Steroid Receptor Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 30
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4r0xA00
3KADA 3UQIA 4G50A 5HW8A 2LPVA 2KGJA 3O5KA 4J4OA 4W9QA 5HUAA 2ZR4A 2LGOA 3FAPA 3H9RB 1P5QA 1FKHA 2M08A 1FJDA 4ODOA 2FKEA 3NRKA 2ZQSA 4IQ2A 2MPHA 1A7XA 1FKTA 4QT2A 2PBCA 4R0XA 1ROTA 4JFLA 5DIVA 4DT4A 1FKRA 3CGNA 1M5YA 3B7XA 2PV1A 3CGMA 2MLZA 3GPKA 4DRPA 5DITA 1YATA 4DRJA 5HT1A 3TCZA 1QPFA 2FAPA 4MGVA 2XP8A 2M2AA 4ODRA 5GPGA 4FAPA 5HW6A 5HWBA 2VN1A 1QPLA 4G2PA 2XP4A 2KI3A 4GGQA 1L1PA 4QT3A 4DIPA 3NI6A 4O2TA 1NMWA 1BKFA 3KAHA 2KO7A 1ZK6A 1FAPA 1NMVA 3O5OA 2KR7A 2DG9A 4LAWA 2XP5A 4QIBA 4TW8A 4DRKA 1F40A 3LUOA 3O5QA 1T11A 4MSPA 4DRIA 3PRBA 2XP3A 3O5PA 2MNTA 2PV2A 1FKIA 1FKLA 1D7JA 2D9FA 2OFNA 3O5MA 1B6CA 3UI6A 5HWCA 2AWGA 3UF8A 3KZ7A 2RUQA 5BXJA 2XPBA 2RUDA 2PPPA 2KE0A 4JFIA 2XP7A 4BF8A 2Q5AA 2LJ4A 2RQSA 2F4EA 2ZR6A 2ZQTA 3KAIA 1JVWA 4FN2A 4IPXA 5HTGA 1HXVA 2XP6A 1D7HA 2N87A 1PBKA 2RURA 1FKDA 1Y0OA 3KAFA 3O5FA 5B8IC 4DH0A 4JYSA 4U86A 4LAVA 2PPNA 2UZ5A 1FD9A 2JZVA 3PA7A 4LAYA 4GIVA 3KCEA 3WH0A 1FKKA 2RUCA 1YW5A 4DRNA 4DZ3A 1FKJA 3O5GA 3JYJA 1ROUA 1EYMA 1NSGA 1W26A 1PINA 3MDYB 4ITZA 4JFKA 4DRMA 4DROA 3I6CA 3O5JA 4W9PA 4TW6A 1BL4A 1J4HA 3KABA 1KT0A 2XPAA 4ODLA 4J4NA 3O5RA 2L2SA 2IF4A 4TYOA 1J6YA 3NTPA 1TCOC 3UQBA 2VCDA 5J6EA 2F2DA 3IKDA 1U79A 3TC5A 3ODKA 1JNTA 3KACA 4U84A 2RSEA 1KT1A 2K8IA 2KFWA 4ODMA 3UI5A 4NNRA 2XP9A 2PV3A 2F21A 2M1IA 2PPOA 4W9OA 4ODQA 5DIUA 1FKBA 5HW7A 1FKFA 1FKSA 1J4IA 2MLXA 4ODNA 1Q6UA 1FKGA 2DG3A 1D6OA 4DRHA 4C02B 2DG4A 2ZQUA 3IHZA 3PRDA 3RFWA 1Q6IA 1D7IA 3UQAA 2LKNA 3VAWA 2ITKA 3O5EA 3O5LA 3IK8A 3KAGA 1JNSA 4N19A 4JFJA 2ZQVA 5D75A 3EY6A 4TNSA 2MF9A 1ZCNA 2ZR5A 3O5DA 4DZ2A 1Q6HA 4TW7A 1F8AB 3JXVA 5I98A 3OOBA 5HKGA 1Q1CA 1J4RA 3RGCA 4LAXA 3TDBA 1EQ3A 1C9HA 3JYMA 3O5IA 1QZ2A 4JFMA 3UI4A 4DRQA 4IQCA 4TX0A 1N1AA 2Y78A 4ODPA 4ODKA 2MLYA 3IKGA 1R9HA 4U85A
chains in the Genus database with same CATH superfamily
3UQIA 3H9RB 4Z2JA 2WM0A 4UDMA 5GPRA 3NRKA 4Z2LA 4IQ2A 4QT2A 4JFLA 3RM9A 3CGNA 1M5YA 4DRPA 1LJYA 1LL6A 5HT1A 4DRJA 4NZCA 5HW6A 1HXVA 2XP8A 5GPGA 2VN1A 4WJXA 1QPLA 2KI3A 4GGQA 5GQBA 1L1PA 4QT3A 3NI6A 3BMBA 2KO7A 2G41A 3FY1A 4TW8A 4DRKA 2XP5A 3ARWA 3O5QA 3PRAA 2MNTA 2ESCA 1ZB5A 2D9FA 4MAVA 2AWGA 3UF8A 2RUQA 2XPBA 2RUDA 2DT2A 3KAIA 4FN2A 5HTGA 1FKDA 3CHCA 3KAFA 4LAVA 2PPNA 1ZBVA 4KR0B 3ARXA 1W1PA 1D2KA 3KCEA 1ITXA 3WH0A 1FKKA 2RUCA 4DRNA 1FKJA 1W26A 3ARQA 1PINA 2FDMA 1J4HA 2XPAA 3O5RA 3NTPA 4LGXA 1X6NA 3UQBA 2F23A 2PI6A 3CHFA 3CH9A 3GU0A 2IUZA 2RSEA 2KFWA 4P8WA 3UI5A 2PV3A 3WKZA 1HJXA 5HBFA 4P8XA 4W9OA 5DIUA 3OA5A 1FKFA 1KFWA 1J4IA 1HKJA 4MTVA 1LL7A 4DRHA 2DG4A 3AS1A 3PRDA 4W5UA 3RFWA 4WKFA 4Q7NA 3UQAA 2LKNA 3O5LA 2P4VA 1JNSA 2ZQVA 1GOIA 2MF9A 4Z2GA 1EHNA 3WL1A 4NSBA 3WD0A 3JXVA 3WL0A 3RGCA 1EQ3A 3O5IA 4DRQA 4IQCA 2OLHA 4TX0A 2AOSA 2PN0A 4MNMA 3IKGA 3KADA 2O9OA 4G50A 1K9TA 3O5KA 4J4OA 2LGOA 1FJDA 3WD1A 3AROA 2MPHA 4R0XA 4ZPWR 5DIVA 1H0IA 3ARUA 3GPKA 3B7XA 3PR9A 1SR0A 5DITA 4MNLA 1YATA 3TCZA 2FAPA 4ODRA 4FAPA 4Z2IA 4PTMA 3WQVA 4DIPA 1NMWA 3KAHA 1FAPA 1E9LA 1EDQA 4LAWA 3WQWA 3LUOA 1CTNA 1H0GA 2PV2A 3RM8A 3KZ7A 1O6IA 5BXJA 4L72B 4JFIA 2ZQTA 1JVWA 4IPXA 2A3BA 1E6NA 3B9EA 2DSUA 2XP6A 1PBKA 1LG1A 2RURA 4Z2KA 4DWSB 5B8IC 4DH0A 3AS0A 1WB0A 1LL4A 2UZ5A 2JZVA 4LAYA 3JYJA 1EYMA 4JFKA 4DRMA 4DROA 1NWSA 4WKHA 4TW6A 3WD3A 1OGGA 3KABA 4ODLA 4ZS6A 3W4RA 2L2SA 2IF4A 1EIBA 5J6EA 3IKDA 1OWQA 1U79A 1FFRA 1NWRA 4U84A 4IT4A 3B9DA 4HBEA 2M1IA 2A3EA 1ZL1A 2MLXA 1FKGA 1NH6A 1D6OA 4XAKA 3WD4A 4C02B 2ZQUA 5DO2A 1Q6IA 2EULA 1W1VA 2ITKA 4WK9A 3IK8A 4N19A 2ZR5A 3O5DA 4TW7A 5HKGA 3ALGA 2DT3A 1FFQA 3TDBA 1C9HA 2A3CA 4JFMA 4Q22A 3ARTA 3CHDA 2B5UB 4MPKA 2MLYA 1UR8A 1W9VA 1R9HA 3ARZA 5HW8A 2LPVA 2KGJA 4W9QA 3FAPA 1LQ0A 1P5QA 1GPFA 1OGBA 3AS2A 2ZQSA 1E6RA 4L3NA 1FKTA 3BXWA 4QZVB 4Z2HA 1FKRA 3CGMA 2PV1A 4DWSA 1QPFA 2G8ZA 4URIA 4S3KA 3ARYA 1ZK6A 1NMVA 4P8UA 1F40A 2QF8A 4MSPA 4DRIA 1ZBKA 3O5PA 2YBUA 1FKIA 2OFNA 3O5MA 3UI6A 1B6CA 3EIPA 2KE0A 4HARA 2Q5AA 3AS3A 2LJ4A 2RQSA 2F4EA 2ZR6A 3CHEA 2N87A 1Y0OA 2WLZA 1FD9A 4HBOA 2DSWA 3PA7A 4ZPVR 4GIVA 1YW5A 2DPEA 2DT0A 1ROUA 1NSGA 1ZU8A 3MDYB 4ITZA 3I6CA 4W9PA 1BL4A 4J4NA 1LG2A 4TYOA 3G6LA 2VCDA 2F2DA 4ODMA 1KT1A 4NNRA 2XP9A 4MNJA 1WAWA 3RMEA 2PPOA 4ODQA 1FKBA 2ETNA 4ODNA 1ZBCA 1Q6UA 2DG3A 1WNOA 3IHZA 2DSVA 1D7IA 3CZ8A 3KAGA 3QOKA 4ML4A 4JFJA 3ARSA 3EY6A 1E44A 4DZ2A 1E15A 1Q6HA 1F8AB 3OOBA 1HKMA 1Q1CA 1J4RA 3WIJA 4LAXA 3JYMA 1QZ2A 4WKAA 1JCHB 1W1TA 1E6PA 2WK2A 1GUVA 1N1AA 4ODPA 2O92A 1HKIA 5HUAA 1W9PA 2ZR4A 5DF0A 4IT6A 1FKHA 2M08A 4ODOA 2FKEA 1A7XA 2PBCA 1ROTA 3G6MA 4DT4A 1XHGA 2MLZA 1IX5A 3GTYX 3B9AA 5I98A 4MGVA 1X6LA 2M2AA 3AQUA 1HKKA 5HWBA 4G2PA 1JNEA 4MNKA 2XP4A 1W1YA 2DSZA 4O2TA 1BKFA 1RD6A 3O5OA 4KQZA 4QIBA 2KR7A 2DG9A 1UR9A 1T11A 3PRBA 2XP3A 1FKLA 1E6ZA 1D7JA 5HWCA 4WIWA 2PPPA 2XP7A 4BF8A 3ARRA 1SYTA 4AY1A 1D7HA 3WD2A 3B8SA 3O5FA 4JYSA 4U86A 4DWSD 4DWSC 3ALFA 4DZ3A 2YBTA 3O5GA 2A3AA 1JNDA 1NWTA 1NWUA 3ARVA 3O5JA 1HJWA 1KT0A 4S3JA 1J6YA 1TFVA 3FXYA 1W9UA 1TCOC 3TC5A 3ODKA 1JNTA 3KACA 2K8IA 2F21A 3ARPA 1FKSA 2WLYA 1ZBWA 3VAWA 3O5EA 3RM4A 1GRJA 5D75A 4TNSA 1ZCNA 1HJVA 2B31A 5DEZA 4ZPTR 5JH8A 1XRVA 2DT1A 4R5EA 3UI4A 2Y78A 4P8VA 4ODKA 1VF8A 5HW7A 4U85A
chains in the Genus database with same CATH topology
3UQIA 3H9RB 4Z2JA 2WM0A 5GPRA 3NRKA 4Z2LA 4IQ2A 4QT2A 4JFLA 3RM9A 3CGNA 1M5YA 4DRPA 1LJYA 1LL6A 5HT1A 4DRJA 4NZCA 5HW6A 1HXVA 2XP8A 5GPGA 2VN1A 4WJXA 1QPLA 2KI3A 4GGQA 5GQBA 1L1PA 4QT3A 3NI6A 2KO7A 2G41A 3FY1A 4TW8A 4DRKA 2XP5A 3ARWA 3O5QA 3PRAA 2MNTA 2ESCA 1ZB5A 2D9FA 4MAVA 2AWGA 3UF8A 2RUQA 2XPBA 2RUDA 2DT2A 3KAIA 4FN2A 5HTGA 1FKDA 3CHCA 3KAFA 4LAVA 2PPNA 1ZBVA 4KR0B 3ARXA 1W1PA 1D2KA 3KCEA 1ITXA 3WH0A 1FKKA 2RUCA 4DRNA 1FKJA 1W26A 3ARQA 1PINA 2FDMA 1J4HA 2XPAA 3O5RA 3NTPA 4LGXA 1X6NA 3UQBA 2PI6A 3CHFA 3CH9A 2IUZA 2RSEA 2KFWA 4P8WA 3UI5A 2PV3A 3WKZA 1HJXA 5HBFA 4P8XA 4W9OA 5DIUA 3OA5A 1FKFA 1KFWA 1J4IA 1HKJA 4MTVA 1LL7A 4DRHA 2DG4A 3AS1A 3PRDA 4W5UA 3RFWA 4WKFA 4Q7NA 3UQAA 2LKNA 3O5LA 1JNSA 2ZQVA 1GOIA 2MF9A 4Z2GA 1EHNA 3WL1A 4NSBA 3WD0A 3JXVA 3WL0A 3RGCA 1EQ3A 3O5IA 4DRQA 4IQCA 2OLHA 4TX0A 2AOSA 4MNMA 3IKGA 3KADA 2O9OA 4G50A 1K9TA 3O5KA 4J4OA 2LGOA 1FJDA 3WD1A 3AROA 2MPHA 4R0XA 4ZPWR 5DIVA 1H0IA 3ARUA 3GPKA 3B7XA 3PR9A 1SR0A 5DITA 4MNLA 1YATA 3TCZA 2FAPA 4ODRA 4FAPA 4Z2IA 4PTMA 3WQVA 4DIPA 1NMWA 3KAHA 1FAPA 1E9LA 1EDQA 4LAWA 3WQWA 3LUOA 1CTNA 1H0GA 2PV2A 3RM8A 3KZ7A 1O6IA 5BXJA 4L72B 4JFIA 2ZQTA 1JVWA 4IPXA 2A3BA 1E6NA 3B9EA 2DSUA 2XP6A 1PBKA 1LG1A 2RURA 4Z2KA 4DWSB 5B8IC 4DH0A 3AS0A 1WB0A 1LL4A 2UZ5A 2JZVA 4LAYA 3JYJA 1EYMA 4JFKA 4DRMA 4DROA 1NWSA 4WKHA 4TW6A 3WD3A 1OGGA 3KABA 4ODLA 4ZS6A 3W4RA 2L2SA 2IF4A 1EIBA 5J6EA 1OWQA 3IKDA 1U79A 1FFRA 1NWRA 4U84A 4IT4A 3B9DA 4HBEA 2M1IA 2A3EA 1ZL1A 2MLXA 1FKGA 1NH6A 1D6OA 4XAKA 3WD4A 4C02B 2ZQUA 5DO2A 1Q6IA 1W1VA 2ITKA 4WK9A 3IK8A 4N19A 2ZR5A 3O5DA 4TW7A 5HKGA 3ALGA 2DT3A 1FFQA 3TDBA 1C9HA 2A3CA 4JFMA 4Q22A 3ARTA 3CHDA 4MPKA 2MLYA 1UR8A 1W9VA 1R9HA 3ARZA 5HW8A 2LPVA 2KGJA 4W9QA 3FAPA 1LQ0A 1P5QA 1GPFA 1OGBA 3AS2A 2ZQSA 1E6RA 4L3NA 1FKTA 3BXWA 4QZVB 4Z2HA 1FKRA 3CGMA 2PV1A 4DWSA 1QPFA 2G8ZA 4URIA 4S3KA 3ARYA 1ZK6A 1NMVA 4P8UA 1F40A 2QF8A 4MSPA 4DRIA 1ZBKA 3O5PA 2YBUA 1FKIA 2OFNA 3O5MA 3UI6A 1B6CA 2KE0A 4HARA 2Q5AA 3AS3A 2LJ4A 2RQSA 2F4EA 2ZR6A 3CHEA 2N87A 1Y0OA 2WLZA 1FD9A 4HBOA 2DSWA 3PA7A 4ZPVR 4GIVA 1YW5A 2DPEA 2DT0A 1ROUA 1NSGA 1ZU8A 3MDYB 4ITZA 3I6CA 4W9PA 1BL4A 4J4NA 1LG2A 4TYOA 3G6LA 2VCDA 2F2DA 4ODMA 1KT1A 4NNRA 2XP9A 4MNJA 1WAWA 3RMEA 2PPOA 4ODQA 1FKBA 4ODNA 1ZBCA 1Q6UA 2DG3A 1WNOA 3IHZA 2DSVA 1D7IA 3CZ8A 3KAGA 3QOKA 4ML4A 4JFJA 3ARSA 3EY6A 4DZ2A 1E15A 1Q6HA 1F8AB 3OOBA 1HKMA 1Q1CA 1J4RA 3WIJA 4LAXA 3JYMA 1QZ2A 4WKAA 1W1TA 1E6PA 2WK2A 1GUVA 1N1AA 4ODPA 2O92A 1HKIA 5HUAA 1W9PA 2ZR4A 5DF0A 4IT6A 1FKHA 2M08A 4ODOA 2FKEA 1A7XA 2PBCA 1ROTA 3G6MA 4DT4A 1XHGA 2MLZA 1IX5A 3B9AA 5I98A 4MGVA 1X6LA 2M2AA 3AQUA 1HKKA 5HWBA 4G2PA 1JNEA 4MNKA 2XP4A 1W1YA 2DSZA 4O2TA 1BKFA 3O5OA 1RD6A 4KQZA 4QIBA 2KR7A 2DG9A 1UR9A 1T11A 3PRBA 2XP3A 1FKLA 1E6ZA 1D7JA 5HWCA 4WIWA 2PPPA 2XP7A 4BF8A 3ARRA 1SYTA 4AY1A 1D7HA 3WD2A 3B8SA 3O5FA 4JYSA 4U86A 4DWSD 4DWSC 3ALFA 4DZ3A 2YBTA 3O5GA 2A3AA 1JNDA 1NWTA 1NWUA 3ARVA 3O5JA 1HJWA 1KT0A 4S3JA 1J6YA 1TFVA 3FXYA 1W9UA 1TCOC 3TC5A 3ODKA 1JNTA 3KACA 2K8IA 2F21A 3ARPA 1FKSA 2WLYA 1ZBWA 3VAWA 3O5EA 3RM4A 5D75A 4TNSA 1ZCNA 1HJVA 2B31A 5DEZA 4ZPTR 5JH8A 1XRVA 2DT1A 4R5EA 3UI4A 2Y78A 4P8VA 4ODKA 1VF8A 5HW7A 4U85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAD A;  3UQI A;  4G50 A;  5HW8 A;  2LPV A;  2KGJ A;  3O5K A;  4J4O A;  4W9Q A;  5HUA A;  2ZR4 A;  2LGO A;  3FAP A;  3H9R B;  1P5Q A;  1FKH A;  2M08 A;  1FJD A;  4ODO A;  2FKE A;  3NRK A;  2ZQS A;  4IQ2 A;  2MPH A;  1A7X A;  1FKT A;  4QT2 A;  2PBC A;  4R0X A;  1ROT A;  4JFL A;  5DIV A;  4DT4 A;  1FKR A;  3CGN A;  1M5Y A;  3B7X A;  2PV1 A;  3CGM A;  2MLZ A;  3GPK A;  4DRP A;  5DIT A;  1YAT A;  4DRJ A;  5HT1 A;  3TCZ A;  1QPF A;  2FAP A;  4MGV A;  2XP8 A;  2M2A A;  4ODR A;  5GPG A;  4FAP A;  5HW6 A;  5HWB A;  2VN1 A;  1QPL A;  4G2P A;  2XP4 A;  2KI3 A;  4GGQ A;  1L1P A;  4QT3 A;  4DIP A;  3NI6 A;  4O2T A;  1NMW A;  1BKF A;  3KAH A;  2KO7 A;  1ZK6 A;  1FAP A;  1NMV A;  3O5O A;  2KR7 A;  2DG9 A;  4LAW A;  2XP5 A;  4QIB A;  4TW8 A;  4DRK A;  1F40 A;  3LUO A;  3O5Q A;  1T11 A;  4MSP A;  4DRI A;  3PRB A;  2XP3 A;  3O5P A;  2MNT A;  2PV2 A;  1FKI A;  1FKL A;  1D7J A;  2D9F A;  2OFN A;  3O5M A;  1B6C A;  3UI6 A;  5HWC A;  2AWG A;  3UF8 A;  3KZ7 A;  2RUQ A;  5BXJ A;  2XPB A;  2RUD A;  2PPP A;  2KE0 A;  4JFI A;  2XP7 A;  4BF8 A;  2Q5A A;  2LJ4 A;  2RQS A;  2F4E A;  2ZR6 A;  2ZQT A;  3KAI A;  1JVW A;  4FN2 A;  4IPX A;  5HTG A;  1HXV A;  2XP6 A;  1D7H A;  2N87 A;  1PBK A;  2RUR A;  1FKD A;  1Y0O A;  3KAF A;  3O5F A;  5B8I C;  4DH0 A;  4JYS A;  4U86 A;  4LAV A;  2PPN A;  2UZ5 A;  1FD9 A;  2JZV A;  3PA7 A;  4LAY A;  4GIV A;  3KCE A;  3WH0 A;  1FKK A;  2RUC A;  1YW5 A;  4DRN A;  4DZ3 A;  1FKJ A;  3O5G A;  3JYJ A;  1ROU A;  1EYM A;  1NSG A;  1W26 A;  1PIN A;  3MDY B;  4ITZ A;  4JFK A;  4DRM A;  4DRO A;  3I6C A;  3O5J A;  4W9P A;  4TW6 A;  1BL4 A;  1J4H A;  3KAB A;  1KT0 A;  2XPA A;  4ODL A;  4J4N A;  3O5R A;  2L2S A;  2IF4 A;  4TYO A;  1J6Y A;  3NTP A;  1TCO C;  3UQB A;  2VCD A;  5J6E A;  2F2D A;  3IKD A;  1U79 A;  3TC5 A;  3ODK A;  1JNT A;  3KAC A;  4U84 A;  2RSE A;  1KT1 A;  2K8I A;  2KFW A;  4ODM A;  3UI5 A;  4NNR A;  2XP9 A;  2PV3 A;  2F21 A;  2M1I A;  2PPO A;  4W9O A;  4ODQ A;  5DIU A;  1FKB A;  5HW7 A;  1FKF A;  1FKS A;  1J4I A;  2MLX A;  4ODN A;  1Q6U A;  1FKG A;  2DG3 A;  1D6O A;  4DRH A;  4C02 B;  2DG4 A;  2ZQU A;  3IHZ A;  3PRD A;  3RFW A;  1Q6I A;  1D7I A;  3UQA A;  2LKN A;  3VAW A;  2ITK A;  3O5E A;  3O5L A;  3IK8 A;  3KAG A;  1JNS A;  4N19 A;  4JFJ A;  2ZQV A;  5D75 A;  3EY6 A;  4TNS A;  2MF9 A;  1ZCN A;  2ZR5 A;  3O5D A;  4DZ2 A;  1Q6H A;  4TW7 A;  1F8A B;  3JXV A;  5I98 A;  3OOB A;  5HKG A;  1Q1C A;  1J4R A;  3RGC A;  4LAX A;  3TDB A;  1EQ3 A;  1C9H A;  3JYM A;  3O5I A;  1QZ2 A;  4JFM A;  3UI4 A;  4DRQ A;  4IQC A;  4TX0 A;  1N1A A;  2Y78 A;  4ODP A;  4ODK A;  2MLY A;  3IKG A;  1R9H A;  4U85 A; 
#chains in the Genus database with same CATH topology
 3UQI A;  3H9R B;  4Z2J A;  2WM0 A;  4UDM A;  5GPR A;  3NRK A;  4Z2L A;  4IQ2 A;  4QT2 A;  4JFL A;  3RM9 A;  3CGN A;  1M5Y A;  4DRP A;  1LJY A;  1LL6 A;  5HT1 A;  4DRJ A;  4NZC A;  5HW6 A;  1HXV A;  2XP8 A;  5GPG A;  2VN1 A;  4WJX A;  1QPL A;  2KI3 A;  4GGQ A;  5GQB A;  1L1P A;  4QT3 A;  3NI6 A;  3BMB A;  2KO7 A;  2G41 A;  3FY1 A;  4TW8 A;  4DRK A;  2XP5 A;  3ARW A;  3O5Q A;  3PRA A;  2MNT A;  2ESC A;  1ZB5 A;  2D9F A;  4MAV A;  2AWG A;  3UF8 A;  2RUQ A;  2XPB A;  2RUD A;  2DT2 A;  3KAI A;  4FN2 A;  5HTG A;  1FKD A;  3CHC A;  3KAF A;  4LAV A;  2PPN A;  1ZBV A;  4KR0 B;  3ARX A;  1W1P A;  1D2K A;  3KCE A;  1ITX A;  3WH0 A;  1FKK A;  2RUC A;  4DRN A;  1FKJ A;  1W26 A;  3ARQ A;  1PIN A;  2FDM A;  1J4H A;  2XPA A;  3O5R A;  3NTP A;  4LGX A;  1X6N A;  3UQB A;  2F23 A;  2PI6 A;  3CHF A;  3CH9 A;  3GU0 A;  2IUZ A;  2RSE A;  2KFW A;  4P8W A;  3UI5 A;  2PV3 A;  3WKZ A;  1HJX A;  5HBF A;  4P8X A;  4W9O A;  5DIU A;  3OA5 A;  1FKF A;  1KFW A;  1J4I A;  1HKJ A;  4MTV A;  1LL7 A;  4DRH A;  2DG4 A;  3AS1 A;  3PRD A;  4W5U A;  3RFW A;  4WKF A;  4Q7N A;  3UQA A;  2LKN A;  3O5L A;  2P4V A;  1JNS A;  2ZQV A;  1GOI A;  2MF9 A;  4Z2G A;  1EHN A;  3WL1 A;  4NSB A;  3WD0 A;  3JXV A;  3WL0 A;  3RGC A;  1EQ3 A;  3O5I A;  4DRQ A;  4IQC A;  2OLH A;  4TX0 A;  2AOS A;  2PN0 A;  4MNM A;  3IKG A;  3KAD A;  2O9O A;  4G50 A;  1K9T A;  3O5K A;  4J4O A;  2LGO A;  1FJD A;  3WD1 A;  3ARO A;  2MPH A;  4R0X A;  4ZPW R;  5DIV A;  1H0I A;  3ARU A;  3GPK A;  3B7X A;  3PR9 A;  1SR0 A;  5DIT A;  4MNL A;  1YAT A;  3TCZ A;  2FAP A;  4ODR A;  4FAP A;  4Z2I A;  4PTM A;  3WQV A;  4DIP A;  1NMW A;  3KAH A;  1FAP A;  1E9L A;  1EDQ A;  4LAW A;  3WQW A;  3LUO A;  1CTN A;  1H0G A;  2PV2 A;  3RM8 A;  3KZ7 A;  1O6I A;  5BXJ A;  4L72 B;  4JFI A;  2ZQT A;  1JVW A;  4IPX A;  2A3B A;  1E6N A;  3B9E A;  2DSU A;  2XP6 A;  1PBK A;  1LG1 A;  2RUR A;  4Z2K A;  4DWS B;  5B8I C;  4DH0 A;  3AS0 A;  1WB0 A;  1LL4 A;  2UZ5 A;  2JZV A;  4LAY A;  3JYJ A;  1EYM A;  4JFK A;  4DRM A;  4DRO A;  1NWS A;  4WKH A;  4TW6 A;  3WD3 A;  1OGG A;  3KAB A;  4ODL A;  4ZS6 A;  3W4R A;  2L2S A;  2IF4 A;  1EIB A;  5J6E A;  3IKD A;  1OWQ A;  1U79 A;  1FFR A;  1NWR A;  4U84 A;  4IT4 A;  3B9D A;  4HBE A;  2M1I A;  2A3E A;  1ZL1 A;  2MLX A;  1FKG A;  1NH6 A;  1D6O A;  4XAK A;  3WD4 A;  4C02 B;  2ZQU A;  5DO2 A;  1Q6I A;  2EUL A;  1W1V A;  2ITK A;  4WK9 A;  3IK8 A;  4N19 A;  2ZR5 A;  3O5D A;  4TW7 A;  5HKG A;  3ALG A;  2DT3 A;  1FFQ A;  3TDB A;  1C9H A;  2A3C A;  4JFM A;  4Q22 A;  3ART A;  3CHD A;  2B5U B;  4MPK A;  2MLY A;  1UR8 A;  1W9V A;  1R9H A;  3ARZ A;  5HW8 A;  2LPV A;  2KGJ A;  4W9Q A;  3FAP A;  1LQ0 A;  1P5Q A;  1GPF A;  1OGB A;  3AS2 A;  2ZQS A;  1E6R A;  4L3N A;  1FKT A;  3BXW A;  4QZV B;  4Z2H A;  1FKR A;  3CGM A;  2PV1 A;  4DWS A;  1QPF A;  2G8Z A;  4URI A;  4S3K A;  3ARY A;  1ZK6 A;  1NMV A;  4P8U A;  1F40 A;  2QF8 A;  4MSP A;  4DRI A;  1ZBK A;  3O5P A;  2YBU A;  1FKI A;  2OFN A;  3O5M A;  3UI6 A;  1B6C A;  3EIP A;  2KE0 A;  4HAR A;  2Q5A A;  3AS3 A;  2LJ4 A;  2RQS A;  2F4E A;  2ZR6 A;  3CHE A;  2N87 A;  1Y0O A;  2WLZ A;  1FD9 A;  4HBO A;  2DSW A;  3PA7 A;  4ZPV R;  4GIV A;  1YW5 A;  2DPE A;  2DT0 A;  1ROU A;  1NSG A;  1ZU8 A;  3MDY B;  4ITZ A;  3I6C A;  4W9P A;  1BL4 A;  4J4N A;  1LG2 A;  4TYO A;  3G6L A;  2VCD A;  2F2D A;  4ODM A;  1KT1 A;  4NNR A;  2XP9 A;  4MNJ A;  1WAW A;  3RME A;  2PPO A;  4ODQ A;  1FKB A;  2ETN A;  4ODN A;  1ZBC A;  1Q6U A;  2DG3 A;  1WNO A;  3IHZ A;  2DSV A;  1D7I A;  3CZ8 A;  3KAG A;  3QOK A;  4ML4 A;  4JFJ A;  3ARS A;  3EY6 A;  1E44 A;  4DZ2 A;  1E15 A;  1Q6H A;  1F8A B;  3OOB A;  1HKM A;  1Q1C A;  1J4R A;  3WIJ A;  4LAX A;  3JYM A;  1QZ2 A;  4WKA A;  1JCH B;  1W1T A;  1E6P A;  2WK2 A;  1GUV A;  1N1A A;  4ODP A;  2O92 A;  1HKI A;  5HUA A;  1W9P A;  2ZR4 A;  5DF0 A;  4IT6 A;  1FKH A;  2M08 A;  4ODO A;  2FKE A;  1A7X A;  2PBC A;  1ROT A;  3G6M A;  4DT4 A;  1XHG A;  2MLZ A;  1IX5 A;  3GTY X;  3B9A A;  5I98 A;  4MGV A;  1X6L A;  2M2A A;  3AQU A;  1HKK A;  5HWB A;  4G2P A;  1JNE A;  4MNK A;  2XP4 A;  1W1Y A;  2DSZ A;  4O2T A;  1BKF A;  1RD6 A;  3O5O A;  4KQZ A;  4QIB A;  2KR7 A;  2DG9 A;  1UR9 A;  1T11 A;  3PRB A;  2XP3 A;  1FKL A;  1E6Z A;  1D7J A;  5HWC A;  4WIW A;  2PPP A;  2XP7 A;  4BF8 A;  3ARR A;  1SYT A;  4AY1 A;  1D7H A;  3WD2 A;  3B8S A;  3O5F A;  4JYS A;  4U86 A;  4DWS D;  4DWS C;  3ALF A;  4DZ3 A;  2YBT A;  3O5G A;  2A3A A;  1JND A;  1NWT A;  1NWU A;  3ARV A;  3O5J A;  1HJW A;  1KT0 A;  4S3J A;  1J6Y A;  1TFV A;  3FXY A;  1W9U A;  1TCO C;  3TC5 A;  3ODK A;  1JNT A;  3KAC A;  2K8I A;  2F21 A;  3ARP A;  1FKS A;  2WLY A;  1ZBW A;  3VAW A;  3O5E A;  3RM4 A;  1GRJ A;  5D75 A;  4TNS A;  1ZCN A;  1HJV A;  2B31 A;  5DEZ A;  4ZPT R;  5JH8 A;  1XRV A;  2DT1 A;  4R5E A;  3UI4 A;  2Y78 A;  4P8V A;  4ODK A;  1VF8 A;  5HW7 A;  4U85 A; 
#chains in the Genus database with same CATH homology
 3UQI A;  3H9R B;  4Z2J A;  2WM0 A;  5GPR A;  3NRK A;  4Z2L A;  4IQ2 A;  4QT2 A;  4JFL A;  3RM9 A;  3CGN A;  1M5Y A;  4DRP A;  1LJY A;  1LL6 A;  5HT1 A;  4DRJ A;  4NZC A;  5HW6 A;  1HXV A;  2XP8 A;  5GPG A;  2VN1 A;  4WJX A;  1QPL A;  2KI3 A;  4GGQ A;  5GQB A;  1L1P A;  4QT3 A;  3NI6 A;  2KO7 A;  2G41 A;  3FY1 A;  4TW8 A;  4DRK A;  2XP5 A;  3ARW A;  3O5Q A;  3PRA A;  2MNT A;  2ESC A;  1ZB5 A;  2D9F A;  4MAV A;  2AWG A;  3UF8 A;  2RUQ A;  2XPB A;  2RUD A;  2DT2 A;  3KAI A;  4FN2 A;  5HTG A;  1FKD A;  3CHC A;  3KAF A;  4LAV A;  2PPN A;  1ZBV A;  4KR0 B;  3ARX A;  1W1P A;  1D2K A;  3KCE A;  1ITX A;  3WH0 A;  1FKK A;  2RUC A;  4DRN A;  1FKJ A;  1W26 A;  3ARQ A;  1PIN A;  2FDM A;  1J4H A;  2XPA A;  3O5R A;  3NTP A;  4LGX A;  1X6N A;  3UQB A;  2PI6 A;  3CHF A;  3CH9 A;  2IUZ A;  2RSE A;  2KFW A;  4P8W A;  3UI5 A;  2PV3 A;  3WKZ A;  1HJX A;  5HBF A;  4P8X A;  4W9O A;  5DIU A;  3OA5 A;  1FKF A;  1KFW A;  1J4I A;  1HKJ A;  4MTV A;  1LL7 A;  4DRH A;  2DG4 A;  3AS1 A;  3PRD A;  4W5U A;  3RFW A;  4WKF A;  4Q7N A;  3UQA A;  2LKN A;  3O5L A;  1JNS A;  2ZQV A;  1GOI A;  2MF9 A;  4Z2G A;  1EHN A;  3WL1 A;  4NSB A;  3WD0 A;  3JXV A;  3WL0 A;  3RGC A;  1EQ3 A;  3O5I A;  4DRQ A;  4IQC A;  2OLH A;  4TX0 A;  2AOS A;  4MNM A;  3IKG A;  3KAD A;  2O9O A;  4G50 A;  1K9T A;  3O5K A;  4J4O A;  2LGO A;  1FJD A;  3WD1 A;  3ARO A;  2MPH A;  4R0X A;  4ZPW R;  5DIV A;  1H0I A;  3ARU A;  3GPK A;  3B7X A;  3PR9 A;  1SR0 A;  5DIT A;  4MNL A;  1YAT A;  3TCZ A;  2FAP A;  4ODR A;  4FAP A;  4Z2I A;  4PTM A;  3WQV A;  4DIP A;  1NMW A;  3KAH A;  1FAP A;  1E9L A;  1EDQ A;  4LAW A;  3WQW A;  3LUO A;  1CTN A;  1H0G A;  2PV2 A;  3RM8 A;  3KZ7 A;  1O6I A;  5BXJ A;  4L72 B;  4JFI A;  2ZQT A;  1JVW A;  4IPX A;  2A3B A;  1E6N A;  3B9E A;  2DSU A;  2XP6 A;  1PBK A;  1LG1 A;  2RUR A;  4Z2K A;  4DWS B;  5B8I C;  4DH0 A;  3AS0 A;  1WB0 A;  1LL4 A;  2UZ5 A;  2JZV A;  4LAY A;  3JYJ A;  1EYM A;  4JFK A;  4DRM A;  4DRO A;  1NWS A;  4WKH A;  4TW6 A;  3WD3 A;  1OGG A;  3KAB A;  4ODL A;  4ZS6 A;  3W4R A;  2L2S A;  2IF4 A;  1EIB A;  5J6E A;  1OWQ A;  3IKD A;  1U79 A;  1FFR A;  1NWR A;  4U84 A;  4IT4 A;  3B9D A;  4HBE A;  2M1I A;  2A3E A;  1ZL1 A;  2MLX A;  1FKG A;  1NH6 A;  1D6O A;  4XAK A;  3WD4 A;  4C02 B;  2ZQU A;  5DO2 A;  1Q6I A;  1W1V A;  2ITK A;  4WK9 A;  3IK8 A;  4N19 A;  2ZR5 A;  3O5D A;  4TW7 A;  5HKG A;  3ALG A;  2DT3 A;  1FFQ A;  3TDB A;  1C9H A;  2A3C A;  4JFM A;  4Q22 A;  3ART A;  3CHD A;  4MPK A;  2MLY A;  1UR8 A;  1W9V A;  1R9H A;  3ARZ A;  5HW8 A;  2LPV A;  2KGJ A;  4W9Q A;  3FAP A;  1LQ0 A;  1P5Q A;  1GPF A;  1OGB A;  3AS2 A;  2ZQS A;  1E6R A;  4L3N A;  1FKT A;  3BXW A;  4QZV B;  4Z2H A;  1FKR A;  3CGM A;  2PV1 A;  4DWS A;  1QPF A;  2G8Z A;  4URI A;  4S3K A;  3ARY A;  1ZK6 A;  1NMV A;  4P8U A;  1F40 A;  2QF8 A;  4MSP A;  4DRI A;  1ZBK A;  3O5P A;  2YBU A;  1FKI A;  2OFN A;  3O5M A;  3UI6 A;  1B6C A;  2KE0 A;  4HAR A;  2Q5A A;  3AS3 A;  2LJ4 A;  2RQS A;  2F4E A;  2ZR6 A;  3CHE A;  2N87 A;  1Y0O A;  2WLZ A;  1FD9 A;  4HBO A;  2DSW A;  3PA7 A;  4ZPV R;  4GIV A;  1YW5 A;  2DPE A;  2DT0 A;  1ROU A;  1NSG A;  1ZU8 A;  3MDY B;  4ITZ A;  3I6C A;  4W9P A;  1BL4 A;  4J4N A;  1LG2 A;  4TYO A;  3G6L A;  2VCD A;  2F2D A;  4ODM A;  1KT1 A;  4NNR A;  2XP9 A;  4MNJ A;  1WAW A;  3RME A;  2PPO A;  4ODQ A;  1FKB A;  4ODN A;  1ZBC A;  1Q6U A;  2DG3 A;  1WNO A;  3IHZ A;  2DSV A;  1D7I A;  3CZ8 A;  3KAG A;  3QOK A;  4ML4 A;  4JFJ A;  3ARS A;  3EY6 A;  4DZ2 A;  1E15 A;  1Q6H A;  1F8A B;  3OOB A;  1HKM A;  1Q1C A;  1J4R A;  3WIJ A;  4LAX A;  3JYM A;  1QZ2 A;  4WKA A;  1W1T A;  1E6P A;  2WK2 A;  1GUV A;  1N1A A;  4ODP A;  2O92 A;  1HKI A;  5HUA A;  1W9P A;  2ZR4 A;  5DF0 A;  4IT6 A;  1FKH A;  2M08 A;  4ODO A;  2FKE A;  1A7X A;  2PBC A;  1ROT A;  3G6M A;  4DT4 A;  1XHG A;  2MLZ A;  1IX5 A;  3B9A A;  5I98 A;  4MGV A;  1X6L A;  2M2A A;  3AQU A;  1HKK A;  5HWB A;  4G2P A;  1JNE A;  4MNK A;  2XP4 A;  1W1Y A;  2DSZ A;  4O2T A;  1BKF A;  3O5O A;  1RD6 A;  4KQZ A;  4QIB A;  2KR7 A;  2DG9 A;  1UR9 A;  1T11 A;  3PRB A;  2XP3 A;  1FKL A;  1E6Z A;  1D7J A;  5HWC A;  4WIW A;  2PPP A;  2XP7 A;  4BF8 A;  3ARR A;  1SYT A;  4AY1 A;  1D7H A;  3WD2 A;  3B8S A;  3O5F A;  4JYS A;  4U86 A;  4DWS D;  4DWS C;  3ALF A;  4DZ3 A;  2YBT A;  3O5G A;  2A3A A;  1JND A;  1NWT A;  1NWU A;  3ARV A;  3O5J A;  1HJW A;  1KT0 A;  4S3J A;  1J6Y A;  1TFV A;  3FXY A;  1W9U A;  1TCO C;  3TC5 A;  3ODK A;  1JNT A;  3KAC A;  2K8I A;  2F21 A;  3ARP A;  1FKS A;  2WLY A;  1ZBW A;  3VAW A;  3O5E A;  3RM4 A;  5D75 A;  4TNS A;  1ZCN A;  1HJV A;  2B31 A;  5DEZ A;  4ZPT R;  5JH8 A;  1XRV A;  2DT1 A;  4R5E A;  3UI4 A;  2Y78 A;  4P8V A;  4ODK A;  1VF8 A;  5HW7 A;  4U85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...