4ODRA

Structure of slyd delta-if from thermus thermophilus in complex with fk506
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 24
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odrA00
2ZR4A 2AWGA 2VCDA 4JFMA 4ODRA 4U84A 2DG3A 4ODOA 2ZQSA 2F2DA 3IHZA 1J6YA 1NMWA 1ZCNA 1TCOC 2RQSA 2ZQVA 3I6CA 1D7IA 3NI6A 3UQBA 3KCEA 1EYMA 1FKSA 3CGNA 4ITZA 2PBCA 3NTPA 4N19A 2KGJA 4ODPA 3O5QA 4ODMA 3RFWA 4DRHA 1FJDA 1Y0OA 4FN2A 4DROA 2MPHA 3KZ7A 4J4OA 1Q6UA 2XPAA 2Y78A 4G50A 4JFKA 4W9PA 2MLZA 1M5YA 5D75A 1R9HA 2RUDA 3O5GA 1J4HA 1F40A 1PBKA 2FAPA 1D7HA 4DRPA 1EQ3A 1QPLA 3IKDA 1J4RA 2DG4A 3CGMA 4U85A 4W9OA 1C9HA 4MGVA 4TW7A 3O5MA 2F21A 4IPXA 4C02B 3KADA 4LAVA 4ODKA 2LKNA 1Q1CA 3KABA 3O5PA 2M2AA 4IQ2A 3TDBA 4R0XA 2XP3A 5DIUA 1FKDA 3TCZA 4DT4A 1FKJA 3UF8A 2Q5AA 4DRMA 1BL4A 4DZ2A 2MLYA 5DITA 2D9FA 4JFJA 1P5QA 3ODKA 2KI3A 1NMVA 3FAPA 2N87A 2PV3A 2M1IA 1KT0A 3O5JA 3PRDA 2LPVA 4U86A 5HT1A 4TNSA 3TC5A 5HTGA 1NSGA 2PV1A 2ZQTA 5B8IC 3GPKA 2OFNA 3KAGA 3UI6A 1JNTA 2MLXA 3H9RB 3KAFA 2KFWA 3O5OA 1B6CA 3LUOA 2RUCA 3PRBA 2DG9A 1YW5A 4GGQA 1ROUA 2PPOA 4DRKA 2XP5A 4QT3A 1QZ2A 5HKGA 2PV2A 3NRKA 2KE0A 2ITKA 3IKGA 3OOBA 2XP6A 4DRIA 4TW8A 4DH0A 1QPFA 2FKEA 2JZVA 2F4EA 1U79A 4ODLA 4W9QA 1J4IA 1JVWA 2ZQUA 1FKBA 1L1PA 4DRJA 4DZ3A 5GPGA 4BF8A 3JYJA 4NNRA 2L2SA 2LGOA 3KAIA 5HWBA 1FKGA 2K8IA 2UZ5A 4QT2A 5DIVA 5HW7A 1FKRA 5J6EA 1ROTA 4J4NA 3MDYB 1D6OA 1BKFA 1FKHA 1Q6HA 2PPNA 5HW6A 4JFLA 2RSEA 4G2PA 4TX0A 3O5LA 3O5RA 4QIBA 1JNSA 2PPPA 3B7XA 3UI5A 1FD9A 4JFIA 3WH0A 5BXJA 5HW8A 1Q6IA 2KR7A 4DIPA 5HWCA 2IF4A 4IQCA 3UQAA 4FAPA 3IK8A 3PA7A 2VN1A 1F8AB 4ODNA 4TYOA 1D7JA 1FKFA 3KAHA 1FKKA 1T11A 1W26A 4TW6A 2MF9A 2LJ4A 3KACA 4GIVA 1N1AA 2ZR6A 1FKLA 1PINA 4DRQA 3EY6A 2RUQA 1FAPA 2XP8A 3O5KA 1YATA 1A7XA 1FKTA 3VAWA 4LAXA 5I98A 1ZK6A 1KT1A 2XPBA 3JYMA 1HXVA 1FKIA 2KO7A 2MNTA 3JXVA 3UQIA 2XP9A 4LAWA 4JYSA 4DRNA 3O5EA 3O5IA 4O2TA 2RURA 2XP7A 3UI4A 3RGCA 5HUAA 3O5DA 2ZR5A 4ODQA 2M08A 2XP4A 4LAYA 3O5FA 4MSPA
chains in the Genus database with same CATH superfamily
2AWGA 4JFMA 2DG3A 4ODOA 2F2DA 4Z2JA 1NMWA 2G41A 4R5EA 3UQBA 1UR8A 3GTYX 4N19A 4DRHA 1EDQA 3KZ7A 4JFKA 2Y78A 1NH6A 2MLZA 3FXYA 2RUDA 1XRVA 5GQBA 1PBKA 4DRPA 1X6NA 3WL0A 1ZBWA 4NSBA 1J4RA 4C02B 1NWSA 1JCHB 1WB0A 3B9EA 4R0XA 1E6NA 1UR9A 2XP3A 3WD1A 3TCZA 1FKJA 2A3AA 2MLYA 5DITA 4DWSD 4JFJA 3ODKA 3FAPA 2M1IA 5HTGA 4U86A 3FY1A 2G8ZA 2PV1A 2ZQTA 3AS3A 3B9AA 1H0GA 3KAFA 3PR9A 1W1VA 1IX5A 2WK2A 2RUCA 2XP5A 1H0IA 2JZVA 2F4EA 4W9QA 1JVWA 2ZQUA 1FKBA 2ESCA 4WJXA 4MNLA 4WKAA 4DRJA 3RMEA 1HKJA 3KAIA 2K8IA 1ROTA 3B9DA 1OGGA 3ARQA 3ALFA 2PPNA 3AS1A 4P8UA 5HW6A 4JFLA 2A3BA 2PPPA 3UI5A 3QOKA 4JFIA 2YBTA 1FFQA 1SR0A 2IF4A 3WD2A 4AY1A 3UQAA 3PA7A 1T11A 4LGXA 3W4RA 2LJ4A 2DSVA 2ZR6A 1FKLA 4DRQA 3EY6A 4P8VA 4PTMA 1W1TA 4LAXA 4IT4A 2XPBA 3JYMA 4S3JA 1FKIA 2KO7A 3CHFA 4L3NA 4W5UA 4Q22A 3G6MA 2P4VA 3O5IA 4O2TA 3RGCA 3ARYA 5HUAA 3O5DA 4P8XA 4LAYA 2ZR4A 1E15A 3IHZA 2ZQVA 3WQVA 2EULA 1FKSA 3CGNA 4ITZA 2PBCA 1X6LA 1OWQA 2MPHA 2XPAA 1M5YA 1LL4A 1OGBA 4HBOA 1QPLA 1W1YA 2DG4A 4W9OA 3GU0A 1TFVA 1C9HA 4WIWA 3KADA 4LAVA 1Q1CA 3KABA 4IQ2A 2A3EA 1E6RA 1LJYA 1GRJA 4DRMA 2D9FA 3ARXA 2KI3A 3PRDA 1KT0A 3O5JA 2LPVA 3TC5A 4TNSA 1ZBCA 2B5UB 2O9OA 5B8IC 3KAGA 3RM9A 1JNTA 1KFWA 3H9RB 2KFWA 1ZB5A 3LUOA 1GOIA 2DG9A 4GGQA 1ROUA 1ZU8A 3RM8A 3NRKA 2KE0A 3IKGA 3OOBA 2XP6A 4DRIA 1QPFA 2FKEA 1J4IA 3ARTA 5GPGA 4BF8A 3JYJA 3G6LA 2L2SA 4UDMA 5HWBA 4QT2A 1FKRA 4Z2KA 5J6EA 4J4NA 4QZVB 3ARPA 1BKFA 1W9UA 3O5LA 1O6IA 1FD9A 5HW8A 3PRAA 1ZL1A 1Q6IA 2KR7A 5HWCA 1LG1A 5DF0A 4FAPA 5JH8A 3IK8A 2VN1A 4IT6A 1FKFA 3KAHA 3ARRA 1W26A 2MF9A 4NZCA 4L72B 2DSWA 1W9VA 2FDMA 4GIVA 2WLZA 2XP8A 1ITXA 4ZPWR 4MNJA 5GPRA 4LAWA 4DRNA 3UI4A 2XP7A 2M08A 3O5FA 1JNDA 4DWSA 2F23A 2WM0A 1FFRA 2ZQSA 1E6ZA 1J6YA 1ZCNA 1TCOC 3I6CA 1D7IA 3NI6A 2DPEA 1EYMA 3KCEA 2OLHA 4KQZA 1D2KA 4ODPA 3O5QA 4WKHA 1Y0OA 4FN2A 4DROA 4ML4A 4J4OA 1Q6UA 2QF8A 4G50A 5DEZA 1J4HA 1NWRA 1D7HA 1EQ3A 1HJVA 3ARZA 3IKDA 2WLYA 4U85A 4MGVA 4TW7A 2F21A 2LKNA 3CHDA 1HKIA 3O5PA 3ARUA 3CH9A 4URIA 3TDBA 5DIUA 1FKDA 4DT4A 4DWSB 1WNOA 3UF8A 4DZ2A 1P5QA 3WL1A 4MAVA 3UQIA 2N87A 2PV3A 5HT1A 3WD3A 3BMBA 1XHGA 3GPKA 2OFNA 3AS0A 3CHCA 2MLXA 3O5OA 1WAWA 5DO2A 4MPKA 4QT3A 1QZ2A 1HJXA 2PV2A 3WKZA 5HKGA 1EIBA 2ITKA 4Z2IA 4MNKA 1GPFA 1U79A 3AS2A 2DT1A 4NNRA 2LGOA 2UZ5A 5DIVA 1D6OA 1SYTA 2DT3A 3AROA 2PI6A 3O5RA 4QIBA 1JNSA 3B7XA 2IUZA 3WH0A 4IQCA 3AQUA 4TYOA 3WD4A 4TW6A 4P8WA 4WK9A 3KACA 2DSZA 1N1AA 2AOSA 3WIJA 1PINA 2RUQA 1FKTA 3VAWA 5I98A 1E6PA 2MNTA 3JXVA 2XP9A 3O5EA 1GUVA 2RURA 1NWTA 2ZR5A 4DIPA 2XP4A 1HJWA 2VCDA 4ODRA 4U84A 1LL7A 2RQSA 2ETNA 3NTPA 2KGJA 3RFWA 4ODMA 1FJDA 1CTNA 1LG2A 4W9PA 5D75A 1R9HA 1ZBVA 3O5GA 1F40A 4KR0B 4MTVA 2FAPA 3ARWA 1LL6A 3CGMA 2DSUA 3O5MA 3WQWA 4Z2LA 4IPXA 4ODKA 1E9LA 4DWSC 2M2AA 4HBEA 2O92A 4ZPTR 2B31A 1W9PA 2Q5AA 2DT2A 3BXWA 1BL4A 1NMVA 1NSGA 3UI6A 2A3CA 4S3KA 1B6CA 3PRBA 1YW5A 2PN0A 2PPOA 4DRKA 3B8SA 3ARSA 4Z2HA 4TW8A 3CHEA 4DH0A 1HKMA 1NWUA 4ODLA 1RD6A 1E44A 4ZPVR 1L1PA 4DZ3A 3OA5A 1K9TA 1FKGA 5HW7A 3MDYB 4ZS6A 3WD0A 4Q7NA 1FKHA 1Q6HA 1VF8A 3CZ8A 2RSEA 4G2PA 1EHNA 4TX0A 3ALGA 3ARVA 5BXJA 3EIPA 4HARA 1W1PA 4MNMA 4ODNA 1F8AB 1HKKA 1LQ0A 1D7JA 1FKKA 4Z2GA 2YBUA 1FAPA 3O5KA 1JNEA 1ZBKA 1YATA 1A7XA 4XAKA 3RM4A 1ZK6A 1KT1A 1HXVA 2DT0A 4JYSA 4WKFA 5HBFA 4ODQA 4MSPA
chains in the Genus database with same CATH topology
2AWGA 4JFMA 2DG3A 4ODOA 2F2DA 4Z2JA 1NMWA 2G41A 4R5EA 3UQBA 1UR8A 4N19A 4DRHA 1EDQA 3KZ7A 4JFKA 2Y78A 1NH6A 2MLZA 3FXYA 2RUDA 1XRVA 5GQBA 1PBKA 4DRPA 1X6NA 3WL0A 1ZBWA 4NSBA 1J4RA 4C02B 1NWSA 1WB0A 3B9EA 4R0XA 1E6NA 1UR9A 2XP3A 3WD1A 3TCZA 1FKJA 2A3AA 2MLYA 5DITA 4DWSD 4JFJA 3ODKA 3FAPA 2M1IA 5HTGA 4U86A 3FY1A 2G8ZA 2PV1A 2ZQTA 3AS3A 3B9AA 1H0GA 3KAFA 3PR9A 1W1VA 1IX5A 2WK2A 2RUCA 2XP5A 1H0IA 2JZVA 2F4EA 4W9QA 1JVWA 2ZQUA 1FKBA 2ESCA 4WJXA 4MNLA 4WKAA 4DRJA 3RMEA 1HKJA 3KAIA 2K8IA 1ROTA 3B9DA 1OGGA 3ARQA 3ALFA 2PPNA 3AS1A 4P8UA 5HW6A 4JFLA 2A3BA 2PPPA 3UI5A 3QOKA 4JFIA 2YBTA 1FFQA 1SR0A 2IF4A 3WD2A 4AY1A 3UQAA 3PA7A 1T11A 4LGXA 3W4RA 2LJ4A 2DSVA 2ZR6A 1FKLA 4DRQA 3EY6A 4P8VA 4PTMA 1W1TA 4LAXA 4IT4A 2XPBA 3JYMA 4S3JA 1FKIA 2KO7A 3CHFA 4L3NA 4W5UA 4Q22A 3G6MA 3O5IA 4O2TA 3RGCA 3ARYA 5HUAA 3O5DA 4P8XA 4LAYA 2ZR4A 1E15A 3IHZA 2ZQVA 3WQVA 1FKSA 3CGNA 4ITZA 2PBCA 1X6LA 1OWQA 2MPHA 2XPAA 1M5YA 1LL4A 1OGBA 4HBOA 1QPLA 1W1YA 2DG4A 4W9OA 1TFVA 1C9HA 4WIWA 3KADA 4LAVA 1Q1CA 3KABA 4IQ2A 2A3EA 1E6RA 1LJYA 4DRMA 2D9FA 3ARXA 2KI3A 3PRDA 1KT0A 3O5JA 2LPVA 3TC5A 4TNSA 1ZBCA 2O9OA 5B8IC 3KAGA 3RM9A 1JNTA 1KFWA 3H9RB 2KFWA 1ZB5A 3LUOA 1GOIA 2DG9A 4GGQA 1ROUA 1ZU8A 3RM8A 3NRKA 2KE0A 3IKGA 3OOBA 2XP6A 4DRIA 1QPFA 2FKEA 1J4IA 3ARTA 5GPGA 4BF8A 3JYJA 3G6LA 2L2SA 5HWBA 4QT2A 1FKRA 4Z2KA 5J6EA 4J4NA 4QZVB 3ARPA 1BKFA 1W9UA 3O5LA 1O6IA 1FD9A 5HW8A 3PRAA 1ZL1A 1Q6IA 2KR7A 5HWCA 1LG1A 5DF0A 4FAPA 5JH8A 3IK8A 2VN1A 4IT6A 1FKFA 3KAHA 3ARRA 1W26A 2MF9A 4NZCA 4L72B 2DSWA 1W9VA 2FDMA 4GIVA 2WLZA 2XP8A 1ITXA 4ZPWR 4MNJA 5GPRA 4LAWA 4DRNA 3UI4A 2XP7A 2M08A 3O5FA 1JNDA 4DWSA 2WM0A 1FFRA 2ZQSA 1E6ZA 1J6YA 1ZCNA 1TCOC 3I6CA 1D7IA 3NI6A 2DPEA 1EYMA 3KCEA 2OLHA 4KQZA 1D2KA 4ODPA 3O5QA 4WKHA 1Y0OA 4FN2A 4DROA 4ML4A 4J4OA 1Q6UA 2QF8A 4G50A 5DEZA 1J4HA 1NWRA 1D7HA 1EQ3A 1HJVA 3ARZA 3IKDA 2WLYA 4U85A 4MGVA 4TW7A 2F21A 2LKNA 3CHDA 1HKIA 3O5PA 3ARUA 3CH9A 4URIA 3TDBA 5DIUA 1FKDA 4DT4A 4DWSB 1WNOA 3UF8A 4DZ2A 1P5QA 3WL1A 4MAVA 3UQIA 2N87A 2PV3A 5HT1A 3WD3A 1XHGA 3GPKA 2OFNA 3AS0A 3CHCA 2MLXA 3O5OA 1WAWA 5DO2A 4MPKA 4QT3A 1QZ2A 1HJXA 2PV2A 3WKZA 5HKGA 1EIBA 2ITKA 4Z2IA 4MNKA 1GPFA 1U79A 3AS2A 2DT1A 4NNRA 2LGOA 2UZ5A 5DIVA 1D6OA 1SYTA 2DT3A 3AROA 2PI6A 3O5RA 4QIBA 1JNSA 3B7XA 2IUZA 3WH0A 4IQCA 3AQUA 4TYOA 3WD4A 4TW6A 4P8WA 4WK9A 3KACA 2DSZA 1N1AA 2AOSA 3WIJA 1PINA 2RUQA 1FKTA 3VAWA 5I98A 1E6PA 2MNTA 3JXVA 2XP9A 3O5EA 1GUVA 2RURA 1NWTA 2ZR5A 4DIPA 2XP4A 1HJWA 2VCDA 4ODRA 4U84A 1LL7A 2RQSA 3NTPA 2KGJA 3RFWA 4ODMA 1FJDA 1CTNA 1LG2A 4W9PA 5D75A 1R9HA 1ZBVA 3O5GA 1F40A 4KR0B 4MTVA 2FAPA 3ARWA 1LL6A 3CGMA 2DSUA 3O5MA 3WQWA 4Z2LA 4IPXA 4ODKA 1E9LA 4DWSC 2M2AA 4HBEA 2O92A 4ZPTR 2B31A 1W9PA 2Q5AA 2DT2A 3BXWA 1BL4A 1NMVA 1NSGA 3UI6A 2A3CA 4S3KA 1B6CA 3PRBA 1YW5A 2PPOA 4DRKA 3B8SA 3ARSA 4Z2HA 4TW8A 3CHEA 4DH0A 1HKMA 1NWUA 4ODLA 1RD6A 4ZPVR 1L1PA 4DZ3A 3OA5A 1K9TA 1FKGA 5HW7A 3MDYB 4ZS6A 3WD0A 4Q7NA 1FKHA 1Q6HA 1VF8A 3CZ8A 2RSEA 4G2PA 1EHNA 4TX0A 3ALGA 3ARVA 5BXJA 4HARA 1W1PA 4MNMA 4ODNA 1F8AB 1HKKA 1LQ0A 1D7JA 1FKKA 4Z2GA 2YBUA 1FAPA 3O5KA 1JNEA 1ZBKA 1YATA 1A7XA 4XAKA 3RM4A 1ZK6A 1KT1A 1HXVA 2DT0A 4JYSA 4WKFA 5HBFA 4ODQA 4MSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR4 A;  2AWG A;  2VCD A;  4JFM A;  4ODR A;  4U84 A;  2DG3 A;  4ODO A;  2ZQS A;  2F2D A;  3IHZ A;  1J6Y A;  1NMW A;  1ZCN A;  1TCO C;  2RQS A;  2ZQV A;  3I6C A;  1D7I A;  3NI6 A;  3UQB A;  3KCE A;  1EYM A;  1FKS A;  3CGN A;  4ITZ A;  2PBC A;  3NTP A;  4N19 A;  2KGJ A;  4ODP A;  3O5Q A;  4ODM A;  3RFW A;  4DRH A;  1FJD A;  1Y0O A;  4FN2 A;  4DRO A;  2MPH A;  3KZ7 A;  4J4O A;  1Q6U A;  2XPA A;  2Y78 A;  4G50 A;  4JFK A;  4W9P A;  2MLZ A;  1M5Y A;  5D75 A;  1R9H A;  2RUD A;  3O5G A;  1J4H A;  1F40 A;  1PBK A;  2FAP A;  1D7H A;  4DRP A;  1EQ3 A;  1QPL A;  3IKD A;  1J4R A;  2DG4 A;  3CGM A;  4U85 A;  4W9O A;  1C9H A;  4MGV A;  4TW7 A;  3O5M A;  2F21 A;  4IPX A;  4C02 B;  3KAD A;  4LAV A;  4ODK A;  2LKN A;  1Q1C A;  3KAB A;  3O5P A;  2M2A A;  4IQ2 A;  3TDB A;  4R0X A;  2XP3 A;  5DIU A;  1FKD A;  3TCZ A;  4DT4 A;  1FKJ A;  3UF8 A;  2Q5A A;  4DRM A;  1BL4 A;  4DZ2 A;  2MLY A;  5DIT A;  2D9F A;  4JFJ A;  1P5Q A;  3ODK A;  2KI3 A;  1NMV A;  3FAP A;  2N87 A;  2PV3 A;  2M1I A;  1KT0 A;  3O5J A;  3PRD A;  2LPV A;  4U86 A;  5HT1 A;  4TNS A;  3TC5 A;  5HTG A;  1NSG A;  2PV1 A;  2ZQT A;  5B8I C;  3GPK A;  2OFN A;  3KAG A;  3UI6 A;  1JNT A;  2MLX A;  3H9R B;  3KAF A;  2KFW A;  3O5O A;  1B6C A;  3LUO A;  2RUC A;  3PRB A;  2DG9 A;  1YW5 A;  4GGQ A;  1ROU A;  2PPO A;  4DRK A;  2XP5 A;  4QT3 A;  1QZ2 A;  5HKG A;  2PV2 A;  3NRK A;  2KE0 A;  2ITK A;  3IKG A;  3OOB A;  2XP6 A;  4DRI A;  4TW8 A;  4DH0 A;  1QPF A;  2FKE A;  2JZV A;  2F4E A;  1U79 A;  4ODL A;  4W9Q A;  1J4I A;  1JVW A;  2ZQU A;  1FKB A;  1L1P A;  4DRJ A;  4DZ3 A;  5GPG A;  4BF8 A;  3JYJ A;  4NNR A;  2L2S A;  2LGO A;  3KAI A;  5HWB A;  1FKG A;  2K8I A;  2UZ5 A;  4QT2 A;  5DIV A;  5HW7 A;  1FKR A;  5J6E A;  1ROT A;  4J4N A;  3MDY B;  1D6O A;  1BKF A;  1FKH A;  1Q6H A;  2PPN A;  5HW6 A;  4JFL A;  2RSE A;  4G2P A;  4TX0 A;  3O5L A;  3O5R A;  4QIB A;  1JNS A;  2PPP A;  3B7X A;  3UI5 A;  1FD9 A;  4JFI A;  3WH0 A;  5BXJ A;  5HW8 A;  1Q6I A;  2KR7 A;  4DIP A;  5HWC A;  2IF4 A;  4IQC A;  3UQA A;  4FAP A;  3IK8 A;  3PA7 A;  2VN1 A;  1F8A B;  4ODN A;  4TYO A;  1D7J A;  1FKF A;  3KAH A;  1FKK A;  1T11 A;  1W26 A;  4TW6 A;  2MF9 A;  2LJ4 A;  3KAC A;  4GIV A;  1N1A A;  2ZR6 A;  1FKL A;  1PIN A;  4DRQ A;  3EY6 A;  2RUQ A;  1FAP A;  2XP8 A;  3O5K A;  1YAT A;  1A7X A;  1FKT A;  3VAW A;  4LAX A;  5I98 A;  1ZK6 A;  1KT1 A;  2XPB A;  3JYM A;  1HXV A;  1FKI A;  2KO7 A;  2MNT A;  3JXV A;  3UQI A;  2XP9 A;  4LAW A;  4JYS A;  4DRN A;  3O5E A;  3O5I A;  4O2T A;  2RUR A;  2XP7 A;  3UI4 A;  3RGC A;  5HUA A;  3O5D A;  2ZR5 A;  4ODQ A;  2M08 A;  2XP4 A;  4LAY A;  3O5F A;  4MSP A; 
#chains in the Genus database with same CATH topology
 2AWG A;  4JFM A;  2DG3 A;  4ODO A;  2F2D A;  4Z2J A;  1NMW A;  2G41 A;  4R5E A;  3UQB A;  1UR8 A;  3GTY X;  4N19 A;  4DRH A;  1EDQ A;  3KZ7 A;  4JFK A;  2Y78 A;  1NH6 A;  2MLZ A;  3FXY A;  2RUD A;  1XRV A;  5GQB A;  1PBK A;  4DRP A;  1X6N A;  3WL0 A;  1ZBW A;  4NSB A;  1J4R A;  4C02 B;  1NWS A;  1JCH B;  1WB0 A;  3B9E A;  4R0X A;  1E6N A;  1UR9 A;  2XP3 A;  3WD1 A;  3TCZ A;  1FKJ A;  2A3A A;  2MLY A;  5DIT A;  4DWS D;  4JFJ A;  3ODK A;  3FAP A;  2M1I A;  5HTG A;  4U86 A;  3FY1 A;  2G8Z A;  2PV1 A;  2ZQT A;  3AS3 A;  3B9A A;  1H0G A;  3KAF A;  3PR9 A;  1W1V A;  1IX5 A;  2WK2 A;  2RUC A;  2XP5 A;  1H0I A;  2JZV A;  2F4E A;  4W9Q A;  1JVW A;  2ZQU A;  1FKB A;  2ESC A;  4WJX A;  4MNL A;  4WKA A;  4DRJ A;  3RME A;  1HKJ A;  3KAI A;  2K8I A;  1ROT A;  3B9D A;  1OGG A;  3ARQ A;  3ALF A;  2PPN A;  3AS1 A;  4P8U A;  5HW6 A;  4JFL A;  2A3B A;  2PPP A;  3UI5 A;  3QOK A;  4JFI A;  2YBT A;  1FFQ A;  1SR0 A;  2IF4 A;  3WD2 A;  4AY1 A;  3UQA A;  3PA7 A;  1T11 A;  4LGX A;  3W4R A;  2LJ4 A;  2DSV A;  2ZR6 A;  1FKL A;  4DRQ A;  3EY6 A;  4P8V A;  4PTM A;  1W1T A;  4LAX A;  4IT4 A;  2XPB A;  3JYM A;  4S3J A;  1FKI A;  2KO7 A;  3CHF A;  4L3N A;  4W5U A;  4Q22 A;  3G6M A;  2P4V A;  3O5I A;  4O2T A;  3RGC A;  3ARY A;  5HUA A;  3O5D A;  4P8X A;  4LAY A;  2ZR4 A;  1E15 A;  3IHZ A;  2ZQV A;  3WQV A;  2EUL A;  1FKS A;  3CGN A;  4ITZ A;  2PBC A;  1X6L A;  1OWQ A;  2MPH A;  2XPA A;  1M5Y A;  1LL4 A;  1OGB A;  4HBO A;  1QPL A;  1W1Y A;  2DG4 A;  4W9O A;  3GU0 A;  1TFV A;  1C9H A;  4WIW A;  3KAD A;  4LAV A;  1Q1C A;  3KAB A;  4IQ2 A;  2A3E A;  1E6R A;  1LJY A;  1GRJ A;  4DRM A;  2D9F A;  3ARX A;  2KI3 A;  3PRD A;  1KT0 A;  3O5J A;  2LPV A;  3TC5 A;  4TNS A;  1ZBC A;  2B5U B;  2O9O A;  5B8I C;  3KAG A;  3RM9 A;  1JNT A;  1KFW A;  3H9R B;  2KFW A;  1ZB5 A;  3LUO A;  1GOI A;  2DG9 A;  4GGQ A;  1ROU A;  1ZU8 A;  3RM8 A;  3NRK A;  2KE0 A;  3IKG A;  3OOB A;  2XP6 A;  4DRI A;  1QPF A;  2FKE A;  1J4I A;  3ART A;  5GPG A;  4BF8 A;  3JYJ A;  3G6L A;  2L2S A;  4UDM A;  5HWB A;  4QT2 A;  1FKR A;  4Z2K A;  5J6E A;  4J4N A;  4QZV B;  3ARP A;  1BKF A;  1W9U A;  3O5L A;  1O6I A;  1FD9 A;  5HW8 A;  3PRA A;  1ZL1 A;  1Q6I A;  2KR7 A;  5HWC A;  1LG1 A;  5DF0 A;  4FAP A;  5JH8 A;  3IK8 A;  2VN1 A;  4IT6 A;  1FKF A;  3KAH A;  3ARR A;  1W26 A;  2MF9 A;  4NZC A;  4L72 B;  2DSW A;  1W9V A;  2FDM A;  4GIV A;  2WLZ A;  2XP8 A;  1ITX A;  4ZPW R;  4MNJ A;  5GPR A;  4LAW A;  4DRN A;  3UI4 A;  2XP7 A;  2M08 A;  3O5F A;  1JND A;  4DWS A;  2F23 A;  2WM0 A;  1FFR A;  2ZQS A;  1E6Z A;  1J6Y A;  1ZCN A;  1TCO C;  3I6C A;  1D7I A;  3NI6 A;  2DPE A;  1EYM A;  3KCE A;  2OLH A;  4KQZ A;  1D2K A;  4ODP A;  3O5Q A;  4WKH A;  1Y0O A;  4FN2 A;  4DRO A;  4ML4 A;  4J4O A;  1Q6U A;  2QF8 A;  4G50 A;  5DEZ A;  1J4H A;  1NWR A;  1D7H A;  1EQ3 A;  1HJV A;  3ARZ A;  3IKD A;  2WLY A;  4U85 A;  4MGV A;  4TW7 A;  2F21 A;  2LKN A;  3CHD A;  1HKI A;  3O5P A;  3ARU A;  3CH9 A;  4URI A;  3TDB A;  5DIU A;  1FKD A;  4DT4 A;  4DWS B;  1WNO A;  3UF8 A;  4DZ2 A;  1P5Q A;  3WL1 A;  4MAV A;  3UQI A;  2N87 A;  2PV3 A;  5HT1 A;  3WD3 A;  3BMB A;  1XHG A;  3GPK A;  2OFN A;  3AS0 A;  3CHC A;  2MLX A;  3O5O A;  1WAW A;  5DO2 A;  4MPK A;  4QT3 A;  1QZ2 A;  1HJX A;  2PV2 A;  3WKZ A;  5HKG A;  1EIB A;  2ITK A;  4Z2I A;  4MNK A;  1GPF A;  1U79 A;  3AS2 A;  2DT1 A;  4NNR A;  2LGO A;  2UZ5 A;  5DIV A;  1D6O A;  1SYT A;  2DT3 A;  3ARO A;  2PI6 A;  3O5R A;  4QIB A;  1JNS A;  3B7X A;  2IUZ A;  3WH0 A;  4IQC A;  3AQU A;  4TYO A;  3WD4 A;  4TW6 A;  4P8W A;  4WK9 A;  3KAC A;  2DSZ A;  1N1A A;  2AOS A;  3WIJ A;  1PIN A;  2RUQ A;  1FKT A;  3VAW A;  5I98 A;  1E6P A;  2MNT A;  3JXV A;  2XP9 A;  3O5E A;  1GUV A;  2RUR A;  1NWT A;  2ZR5 A;  4DIP A;  2XP4 A;  1HJW A;  2VCD A;  4ODR A;  4U84 A;  1LL7 A;  2RQS A;  2ETN A;  3NTP A;  2KGJ A;  3RFW A;  4ODM A;  1FJD A;  1CTN A;  1LG2 A;  4W9P A;  5D75 A;  1R9H A;  1ZBV A;  3O5G A;  1F40 A;  4KR0 B;  4MTV A;  2FAP A;  3ARW A;  1LL6 A;  3CGM A;  2DSU A;  3O5M A;  3WQW A;  4Z2L A;  4IPX A;  4ODK A;  1E9L A;  4DWS C;  2M2A A;  4HBE A;  2O92 A;  4ZPT R;  2B31 A;  1W9P A;  2Q5A A;  2DT2 A;  3BXW A;  1BL4 A;  1NMV A;  1NSG A;  3UI6 A;  2A3C A;  4S3K A;  1B6C A;  3PRB A;  1YW5 A;  2PN0 A;  2PPO A;  4DRK A;  3B8S A;  3ARS A;  4Z2H A;  4TW8 A;  3CHE A;  4DH0 A;  1HKM A;  1NWU A;  4ODL A;  1RD6 A;  1E44 A;  4ZPV R;  1L1P A;  4DZ3 A;  3OA5 A;  1K9T A;  1FKG A;  5HW7 A;  3MDY B;  4ZS6 A;  3WD0 A;  4Q7N A;  1FKH A;  1Q6H A;  1VF8 A;  3CZ8 A;  2RSE A;  4G2P A;  1EHN A;  4TX0 A;  3ALG A;  3ARV A;  5BXJ A;  3EIP A;  4HAR A;  1W1P A;  4MNM A;  4ODN A;  1F8A B;  1HKK A;  1LQ0 A;  1D7J A;  1FKK A;  4Z2G A;  2YBU A;  1FAP A;  3O5K A;  1JNE A;  1ZBK A;  1YAT A;  1A7X A;  4XAK A;  3RM4 A;  1ZK6 A;  1KT1 A;  1HXV A;  2DT0 A;  4JYS A;  4WKF A;  5HBF A;  4ODQ A;  4MSP A; 
#chains in the Genus database with same CATH homology
 2AWG A;  4JFM A;  2DG3 A;  4ODO A;  2F2D A;  4Z2J A;  1NMW A;  2G41 A;  4R5E A;  3UQB A;  1UR8 A;  4N19 A;  4DRH A;  1EDQ A;  3KZ7 A;  4JFK A;  2Y78 A;  1NH6 A;  2MLZ A;  3FXY A;  2RUD A;  1XRV A;  5GQB A;  1PBK A;  4DRP A;  1X6N A;  3WL0 A;  1ZBW A;  4NSB A;  1J4R A;  4C02 B;  1NWS A;  1WB0 A;  3B9E A;  4R0X A;  1E6N A;  1UR9 A;  2XP3 A;  3WD1 A;  3TCZ A;  1FKJ A;  2A3A A;  2MLY A;  5DIT A;  4DWS D;  4JFJ A;  3ODK A;  3FAP A;  2M1I A;  5HTG A;  4U86 A;  3FY1 A;  2G8Z A;  2PV1 A;  2ZQT A;  3AS3 A;  3B9A A;  1H0G A;  3KAF A;  3PR9 A;  1W1V A;  1IX5 A;  2WK2 A;  2RUC A;  2XP5 A;  1H0I A;  2JZV A;  2F4E A;  4W9Q A;  1JVW A;  2ZQU A;  1FKB A;  2ESC A;  4WJX A;  4MNL A;  4WKA A;  4DRJ A;  3RME A;  1HKJ A;  3KAI A;  2K8I A;  1ROT A;  3B9D A;  1OGG A;  3ARQ A;  3ALF A;  2PPN A;  3AS1 A;  4P8U A;  5HW6 A;  4JFL A;  2A3B A;  2PPP A;  3UI5 A;  3QOK A;  4JFI A;  2YBT A;  1FFQ A;  1SR0 A;  2IF4 A;  3WD2 A;  4AY1 A;  3UQA A;  3PA7 A;  1T11 A;  4LGX A;  3W4R A;  2LJ4 A;  2DSV A;  2ZR6 A;  1FKL A;  4DRQ A;  3EY6 A;  4P8V A;  4PTM A;  1W1T A;  4LAX A;  4IT4 A;  2XPB A;  3JYM A;  4S3J A;  1FKI A;  2KO7 A;  3CHF A;  4L3N A;  4W5U A;  4Q22 A;  3G6M A;  3O5I A;  4O2T A;  3RGC A;  3ARY A;  5HUA A;  3O5D A;  4P8X A;  4LAY A;  2ZR4 A;  1E15 A;  3IHZ A;  2ZQV A;  3WQV A;  1FKS A;  3CGN A;  4ITZ A;  2PBC A;  1X6L A;  1OWQ A;  2MPH A;  2XPA A;  1M5Y A;  1LL4 A;  1OGB A;  4HBO A;  1QPL A;  1W1Y A;  2DG4 A;  4W9O A;  1TFV A;  1C9H A;  4WIW A;  3KAD A;  4LAV A;  1Q1C A;  3KAB A;  4IQ2 A;  2A3E A;  1E6R A;  1LJY A;  4DRM A;  2D9F A;  3ARX A;  2KI3 A;  3PRD A;  1KT0 A;  3O5J A;  2LPV A;  3TC5 A;  4TNS A;  1ZBC A;  2O9O A;  5B8I C;  3KAG A;  3RM9 A;  1JNT A;  1KFW A;  3H9R B;  2KFW A;  1ZB5 A;  3LUO A;  1GOI A;  2DG9 A;  4GGQ A;  1ROU A;  1ZU8 A;  3RM8 A;  3NRK A;  2KE0 A;  3IKG A;  3OOB A;  2XP6 A;  4DRI A;  1QPF A;  2FKE A;  1J4I A;  3ART A;  5GPG A;  4BF8 A;  3JYJ A;  3G6L A;  2L2S A;  5HWB A;  4QT2 A;  1FKR A;  4Z2K A;  5J6E A;  4J4N A;  4QZV B;  3ARP A;  1BKF A;  1W9U A;  3O5L A;  1O6I A;  1FD9 A;  5HW8 A;  3PRA A;  1ZL1 A;  1Q6I A;  2KR7 A;  5HWC A;  1LG1 A;  5DF0 A;  4FAP A;  5JH8 A;  3IK8 A;  2VN1 A;  4IT6 A;  1FKF A;  3KAH A;  3ARR A;  1W26 A;  2MF9 A;  4NZC A;  4L72 B;  2DSW A;  1W9V A;  2FDM A;  4GIV A;  2WLZ A;  2XP8 A;  1ITX A;  4ZPW R;  4MNJ A;  5GPR A;  4LAW A;  4DRN A;  3UI4 A;  2XP7 A;  2M08 A;  3O5F A;  1JND A;  4DWS A;  2WM0 A;  1FFR A;  2ZQS A;  1E6Z A;  1J6Y A;  1ZCN A;  1TCO C;  3I6C A;  1D7I A;  3NI6 A;  2DPE A;  1EYM A;  3KCE A;  2OLH A;  4KQZ A;  1D2K A;  4ODP A;  3O5Q A;  4WKH A;  1Y0O A;  4FN2 A;  4DRO A;  4ML4 A;  4J4O A;  1Q6U A;  2QF8 A;  4G50 A;  5DEZ A;  1J4H A;  1NWR A;  1D7H A;  1EQ3 A;  1HJV A;  3ARZ A;  3IKD A;  2WLY A;  4U85 A;  4MGV A;  4TW7 A;  2F21 A;  2LKN A;  3CHD A;  1HKI A;  3O5P A;  3ARU A;  3CH9 A;  4URI A;  3TDB A;  5DIU A;  1FKD A;  4DT4 A;  4DWS B;  1WNO A;  3UF8 A;  4DZ2 A;  1P5Q A;  3WL1 A;  4MAV A;  3UQI A;  2N87 A;  2PV3 A;  5HT1 A;  3WD3 A;  1XHG A;  3GPK A;  2OFN A;  3AS0 A;  3CHC A;  2MLX A;  3O5O A;  1WAW A;  5DO2 A;  4MPK A;  4QT3 A;  1QZ2 A;  1HJX A;  2PV2 A;  3WKZ A;  5HKG A;  1EIB A;  2ITK A;  4Z2I A;  4MNK A;  1GPF A;  1U79 A;  3AS2 A;  2DT1 A;  4NNR A;  2LGO A;  2UZ5 A;  5DIV A;  1D6O A;  1SYT A;  2DT3 A;  3ARO A;  2PI6 A;  3O5R A;  4QIB A;  1JNS A;  3B7X A;  2IUZ A;  3WH0 A;  4IQC A;  3AQU A;  4TYO A;  3WD4 A;  4TW6 A;  4P8W A;  4WK9 A;  3KAC A;  2DSZ A;  1N1A A;  2AOS A;  3WIJ A;  1PIN A;  2RUQ A;  1FKT A;  3VAW A;  5I98 A;  1E6P A;  2MNT A;  3JXV A;  2XP9 A;  3O5E A;  1GUV A;  2RUR A;  1NWT A;  2ZR5 A;  4DIP A;  2XP4 A;  1HJW A;  2VCD A;  4ODR A;  4U84 A;  1LL7 A;  2RQS A;  3NTP A;  2KGJ A;  3RFW A;  4ODM A;  1FJD A;  1CTN A;  1LG2 A;  4W9P A;  5D75 A;  1R9H A;  1ZBV A;  3O5G A;  1F40 A;  4KR0 B;  4MTV A;  2FAP A;  3ARW A;  1LL6 A;  3CGM A;  2DSU A;  3O5M A;  3WQW A;  4Z2L A;  4IPX A;  4ODK A;  1E9L A;  4DWS C;  2M2A A;  4HBE A;  2O92 A;  4ZPT R;  2B31 A;  1W9P A;  2Q5A A;  2DT2 A;  3BXW A;  1BL4 A;  1NMV A;  1NSG A;  3UI6 A;  2A3C A;  4S3K A;  1B6C A;  3PRB A;  1YW5 A;  2PPO A;  4DRK A;  3B8S A;  3ARS A;  4Z2H A;  4TW8 A;  3CHE A;  4DH0 A;  1HKM A;  1NWU A;  4ODL A;  1RD6 A;  4ZPV R;  1L1P A;  4DZ3 A;  3OA5 A;  1K9T A;  1FKG A;  5HW7 A;  3MDY B;  4ZS6 A;  3WD0 A;  4Q7N A;  1FKH A;  1Q6H A;  1VF8 A;  3CZ8 A;  2RSE A;  4G2P A;  1EHN A;  4TX0 A;  3ALG A;  3ARV A;  5BXJ A;  4HAR A;  1W1P A;  4MNM A;  4ODN A;  1F8A B;  1HKK A;  1LQ0 A;  1D7J A;  1FKK A;  4Z2G A;  2YBU A;  1FAP A;  3O5K A;  1JNE A;  1ZBK A;  1YAT A;  1A7X A;  4XAK A;  3RM4 A;  1ZK6 A;  1KT1 A;  1HXV A;  2DT0 A;  4JYS A;  4WKF A;  5HBF A;  4ODQ A;  4MSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...