4ODRA

Structure of slyd delta-if from thermus thermophilus in complex with fk506
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 24
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odrA00
1JVWA 2XP5A 2N87A 3KAIA 3O5OA 3KACA 2F4EA 3ODKA 5HT1A 5BXJA 3UI5A 1ZCNA 4QT3A 2XP9A 3VAWA 3UF8A 4ODLA 3UI6A 3IHZA 3UQBA 1Q1CA 2XP4A 3EY6A 4G2PA 2KE0A 5DIVA 2LPVA 3O5DA 3CGMA 2L2SA 2RQSA 2DG4A 1EQ3A 1J4RA 4W9OA 4ODKA 2M2AA 4U86A 2MLYA 4DRQA 2IF4A 2PV3A 4LAYA 2XPBA 3FAPA 1KT0A 4LAXA 1FKLA 2MF9A 2KGJA 1FKDA 2AWGA 2LJ4A 2MNTA 2RUQA 3NI6A 4IQCA 3RFWA 3NTPA 3UQIA 4DRPA 1BL4A 5HWBA 1NSGA 2VCDA 3O5MA 3KADA 3WH0A 2XP3A 3MDYB 4ODRA 2FKEA 3UI4A 4DRHA 5HW7A 1FKHA 1FKGA 1N1AA 2MLZA 2PBCA 2LKNA 3CGNA 3IKGA 4LAVA 4ODQA 4TX0A 3O5EA 2PV2A 1D7HA 4DRJA 3O5PA 1FKBA 3KZ7A 3KAFA 2RUCA 4GIVA 2XP7A 4DZ2A 1D6OA 1EYMA 3NRKA 3O5QA 4JFIA 1FAPA 3O5IA 1W26A 4JFMA 5DITA 2RSEA 3UQAA 3KABA 3KAGA 4JYSA 5HKGA 4TNSA 1FKKA 4ODOA 2PPOA 2RUDA 4QIBA 2KFWA 1J4IA 1Q6IA 3IKDA 1Y0OA 4R0XA 2KO7A 3O5GA 1PINA 2OFNA 2F2DA 2PPNA 2XPAA 2LGOA 2M1IA 4DZ3A 4FAPA 4J4OA 4GGQA 1D7IA 2KR7A 1PBKA 2DG9A 2MPHA 2ZR5A 3B7XA 2M08A 2ZR6A 3O5KA 4N19A 3TC5A 2XP6A 3I6CA 3GPKA 1Q6HA 3PRDA 1NMWA 4TYOA 1JNSA 5HW6A 2KI3A 3O5RA 4IPXA 4DRIA 3O5FA 1FD9A 1P5QA 2ZR4A 3OOBA 1KT1A 4QT2A 1F8AB 4W9QA 1L1PA 4W9PA 4BF8A 4DRKA 4TW8A 3KCEA 5HTGA 3IK8A 1U79A 5HWCA 1NMVA 2F21A 1YW5A 2ZQUA 1F40A 3TCZA 2PPPA 2PV1A 2Y78A 4JFJA 1TCOC 2D9FA 4LAWA 1J6YA 1C9HA 4NNRA 2DG3A 4DIPA 2RURA 5GPGA 2ZQSA 4ODNA 1FKTA 2XP8A 3JYMA 4G50A 2UZ5A 3PA7A 1JNTA 1B6CA 2ITKA 4IQ2A 4J4NA 2K8IA 1Q6UA 2ZQVA 3RGCA 4JFLA 4MSPA 3O5JA 5J6EA 1BKFA 3JXVA 1J4HA 4O2TA 4MGVA 4ODPA 1FKIA 1ZK6A 4DRMA 1YATA 3LUOA 5HW8A 2FAPA 2Q5AA 1FKSA 1R9HA 1D7JA 2VN1A 3KAHA 4TW7A 4TW6A 4U84A 4DH0A 3O5LA 4DRNA 1ROUA 2ZQTA 1QPLA 3TDBA 4C02B 3PRBA 4U85A 1FKFA 4DT4A 1FKRA 5D75A 1FKJA 5DIUA 2JZVA 1A7XA 1QZ2A 3JYJA 5HUAA 4ITZA 1HXVA 1T11A 1M5YA 1QPFA 4ODMA 4FN2A 5B8IC 3H9RB 5I98A 1ROTA 2MLXA 4DROA 1FJDA 4JFKA
chains in the Genus database with same CATH superfamily
4ZPTR 2XP5A 3B9AA 3KAIA 3KACA 1ZCNA 2P4VA 3UF8A 4ODLA 1JNDA 2XP4A 2G8ZA 3WQVA 3CGMA 2RQSA 1EQ3A 4W9OA 1E6NA 4MPKA 2MLYA 1FFQA 3FAPA 4L72B 1GUVA 4LAXA 4DRPA 3NI6A 3WIJA 4IQCA 1BL4A 1NSGA 1UR8A 4MTVA 3KADA 4W5UA 1LG2A 4DRHA 5HW7A 3CGNA 2MLZA 2PBCA 1OWQA 4DRJA 1FKBA 3KAFA 4DZ2A 3EIPA 4JFIA 5DITA 1W26A 3KAGA 3IKDA 1VF8A 1Y0OA 1K9TA 4WKHA 1ZU8A 3O5GA 1W9PA 2M1IA 4WK9A 1E6RA 2B31A 3CH9A 1D7IA 2KR7A 4HBOA 4P8XA 4ZPWR 3O5KA 3TC5A 3B7XA 3ARYA 2XP6A 1NMWA 2KI3A 1W9VA 1WB0A 1P5QA 2ZR4A 1KT1A 4P8WA 1F8AB 1ZBCA 3ALFA 4IT4A 4BF8A 1X6NA 1YW5A 1ZBKA 2F21A 1W1PA 1W1YA 4NSBA 4LAWA 5GPRA 4DIPA 1ZL1A 4Z2IA 2ZQSA 1FKTA 1RD6A 2A3BA 3JYMA 4MNMA 3WD0A 4Z2JA 4IQ2A 4J4NA 3WD1A 5J6EA 1YATA 3LUOA 5HW8A 2FAPA 3KAHA 4DH0A 4TW6A 3ARPA 2YBUA 2ZQTA 1FKRA 3G6MA 4MNJA 5D75A 4WKAA 1NWSA 4ZPVR 1ROTA 1L1PA 1FJDA 4JFKA 4MAVA 4ODRA 2A3CA 1TFVA 1HKJA 5HT1A 2DSUA 5BXJA 3RM9A 2QF8A 3WKZA 2XP9A 3ARWA 3UI6A 3UQBA 2G41A 2KE0A 3O5DA 2L2SA 1UR9A 2IF4A 2PV3A 1SYTA 2KGJA 1FKDA 2LJ4A 2RUQA 5HWBA 4L3NA 2VCDA 2XP3A 2FKEA 2PI6A 1SR0A 3O5EA 3O5PA 1EDQA 1LQ0A 1EYMA 4JFMA 3O5IA 3UQAA 5HKGA 3B9DA 2PPOA 1E15A 3ARRA 1WNOA 1Q6IA 4R0XA 3FY1A 2OFNA 3WL0A 2LGOA 1OGBA 4DZ3A 4AY1A 3BXWA 1PBKA 2DG9A 4N19A 1GPFA 3PRDA 1GOIA 3O5RA 3AS2A 4LGXA 4XAKA 1W1TA 4W9QA 4WJXA 2DSVA 5HTGA 2PV1A 2Y78A 1TCOC 2D9FA 4DWSC 1HJVA 4NNRA 5DF0A 2DT0A 4Q7NA 1ZBWA 2UZ5A 1NWUA 1JNTA 3B8SA 5JH8A 4QZVB 1KFWA 1JCHB 2ZQVA 1HKMA 4URIA 1BKFA 1W9UA 3JXVA 1WAWA 1J4HA 4S3KA 2OLHA 1FKIA 1ZK6A 3ARTA 2WLZA 1FKSA 4TW7A 4DRNA 3OA5A 4U85A 2JZVA 3RM4A 1A7XA 1LL6A 4Z2LA 4DROA 3WD4A 1JVWA 2B5UB 3CHDA 4DWSB 2N87A 3AS3A 3O5OA 3UI5A 3VAWA 1Q1CA 1GRJA 1HJXA 4G2PA 2DG4A 4ML4A 4ODKA 3AQUA 1D2KA 4ZS6A 4MNKA 1KT0A 3CHEA 1FKLA 3PRAA 1FKHA 3ARVA 2O9OA 1W1VA 3IKGA 4LAVA 1D7HA 3KZ7A 2RUCA 2XP7A 1ZBVA 2WM0A 2WK2A 4JYSA 1FKKA 3QOKA 4ODOA 2RUDA 4QIBA 2KFWA 1CTNA 1HKKA 2AOSA 1NWTA 1PINA 2XPAA 3FXYA 4FAPA 3ARUA 4J4OA 4GGQA 1NH6A 2M08A 3PR9A 1Q6HA 3B9EA 1JNSA 4IPXA 4DRIA 1HKIA 1IX5A 2DT3A 3OOBA 4MNLA 4QT2A 2ETNA 3GTYX 3KCEA 1U79A 2ZQUA 1F40A 1ZB5A 2A3EA 2PPPA 3CZ8A 3TCZA 4Z2GA 1J6YA 1C9HA 2RURA 4WKFA 5GPGA 4ODNA 3PA7A 2DSZA 5DO2A 3RMEA 2ITKA 3CHCA 4R5EA 1NWRA 4MSPA 3O5JA 2EULA 3G6LA 4DWSD 2FDMA 4O2TA 4ODPA 5HBFA 2Q5AA 4U84A 1R9HA 3O5LA 3TDBA 5DEZA 1FKFA 3W4RA 2DT1A 5DIUA 1XRVA 1QZ2A 2O92A 3CHFA 4ITZA 1HXVA 1M5YA 1QPFA 4ODMA 4FN2A 5B8IC 3H9RB 2MLXA 4TX0A 4KR0B 2A3AA 1O6IA 4Q22A 2YBTA 2F4EA 3ODKA 3WD2A 4QT3A 4DWSA 3ARXA 3IHZA 5GQBA 3EY6A 5DIVA 2LPVA 1LJYA 2IUZA 1J4RA 1EIBA 2M2AA 4U86A 4DRQA 4LAYA 2XPBA 2ESCA 2PN0A 3AS1A 2MF9A 2AWGA 2MNTA 3RFWA 3NTPA 3UQIA 3O5MA 3ARSA 3WH0A 3MDYB 4PTMA 3UI4A 3WD3A 1HJWA 1FKGA 1N1AA 2LKNA 4ODQA 3ARZA 2PV2A 2DPEA 1LL7A 4GIVA 4Z2HA 1D6OA 3NRKA 3O5QA 1FAPA 1ITXA 2RSEA 3KABA 3ALGA 4IT6A 4TNSA 1JNEA 1LG1A 2DSWA 1J4IA 2F23A 2KO7A 2F2DA 2PPNA 1H0IA 3AROA 1E44A 4WIWA 2MPHA 2ZR5A 2ZR6A 3WQWA 3I6CA 3GPKA 4TYOA 5HW6A 3GU0A 3O5FA 1FD9A 1XHGA 4KQZA 4W9PA 4DRKA 4TW8A 2WLYA 3IK8A 5HWCA 1NMVA 1LL4A 1EHNA 4NZCA 4S3JA 1H0GA 4JFJA 2DG3A 3ARQA 1X6LA 2XP8A 4G50A 4Z2KA 1B6CA 1FFRA 2K8IA 1Q6UA 1E6PA 3RGCA 4JFLA 1E9LA 4HARA 3BMBA 3RM8A 3WL1A 4MGVA 4DRMA 2VN1A 1D7JA 4UDMA 1E6ZA 1ROUA 1QPLA 4C02B 4DT4A 3PRBA 4HBEA 4P8UA 1FKJA 4P8VA 3AS0A 3JYJA 5HUAA 1T11A 1OGGA 5I98A 2DT2A
chains in the Genus database with same CATH topology
4ZPTR 2XP5A 3B9AA 3KAIA 3KACA 1ZCNA 3UF8A 4ODLA 1JNDA 2XP4A 2G8ZA 3WQVA 3CGMA 2RQSA 1EQ3A 4W9OA 1E6NA 4MPKA 2MLYA 1FFQA 3FAPA 4L72B 1GUVA 4LAXA 4DRPA 3NI6A 3WIJA 4IQCA 1BL4A 1NSGA 1UR8A 4MTVA 3KADA 4W5UA 1LG2A 4DRHA 5HW7A 3CGNA 2MLZA 2PBCA 1OWQA 4DRJA 1FKBA 3KAFA 4DZ2A 4JFIA 5DITA 1W26A 3KAGA 3IKDA 1VF8A 1Y0OA 1K9TA 4WKHA 1ZU8A 3O5GA 1W9PA 2M1IA 4WK9A 1E6RA 2B31A 3CH9A 1D7IA 2KR7A 4HBOA 4P8XA 4ZPWR 3O5KA 3TC5A 3B7XA 3ARYA 2XP6A 1NMWA 2KI3A 1W9VA 1WB0A 1P5QA 2ZR4A 1KT1A 4P8WA 1F8AB 1ZBCA 3ALFA 4IT4A 4BF8A 1X6NA 1YW5A 1ZBKA 2F21A 1W1PA 1W1YA 4NSBA 4LAWA 5GPRA 4DIPA 1ZL1A 4Z2IA 2ZQSA 1FKTA 1RD6A 2A3BA 3JYMA 4MNMA 3WD0A 4Z2JA 4IQ2A 4J4NA 3WD1A 5J6EA 1YATA 3LUOA 5HW8A 2FAPA 3KAHA 4DH0A 4TW6A 3ARPA 2YBUA 2ZQTA 1FKRA 3G6MA 4MNJA 5D75A 4WKAA 1NWSA 4ZPVR 1ROTA 1L1PA 1FJDA 4JFKA 4MAVA 4ODRA 2A3CA 1TFVA 1HKJA 5HT1A 2DSUA 5BXJA 3RM9A 2QF8A 3WKZA 2XP9A 3ARWA 3UI6A 3UQBA 2G41A 2KE0A 3O5DA 2L2SA 1UR9A 2IF4A 2PV3A 1SYTA 2KGJA 1FKDA 2LJ4A 2RUQA 5HWBA 4L3NA 2VCDA 2XP3A 2FKEA 2PI6A 1SR0A 3O5EA 3O5PA 1EDQA 1LQ0A 1EYMA 4JFMA 3O5IA 3UQAA 5HKGA 3B9DA 2PPOA 1E15A 3ARRA 1WNOA 1Q6IA 4R0XA 3FY1A 2OFNA 3WL0A 2LGOA 1OGBA 4DZ3A 4AY1A 3BXWA 1PBKA 2DG9A 4N19A 1GPFA 3PRDA 1GOIA 3O5RA 3AS2A 4LGXA 4XAKA 1W1TA 4W9QA 4WJXA 2DSVA 5HTGA 2PV1A 2Y78A 1TCOC 2D9FA 4DWSC 1HJVA 4NNRA 5DF0A 2DT0A 4Q7NA 1ZBWA 2UZ5A 1NWUA 1JNTA 3B8SA 5JH8A 4QZVB 1KFWA 2ZQVA 1HKMA 4URIA 1BKFA 1W9UA 3JXVA 1WAWA 1J4HA 4S3KA 2OLHA 1FKIA 1ZK6A 3ARTA 2WLZA 1FKSA 4TW7A 4DRNA 3OA5A 4U85A 2JZVA 3RM4A 1A7XA 1LL6A 4Z2LA 4DROA 3WD4A 1JVWA 3CHDA 4DWSB 2N87A 3AS3A 3O5OA 3UI5A 3VAWA 1Q1CA 1HJXA 4G2PA 2DG4A 4ML4A 4ODKA 3AQUA 1D2KA 4ZS6A 4MNKA 1KT0A 3CHEA 1FKLA 3PRAA 1FKHA 3ARVA 2O9OA 1W1VA 3IKGA 4LAVA 1D7HA 3KZ7A 2RUCA 2XP7A 1ZBVA 2WM0A 2WK2A 4JYSA 1FKKA 3QOKA 4ODOA 2RUDA 4QIBA 2KFWA 1CTNA 1HKKA 2AOSA 1NWTA 1PINA 2XPAA 3FXYA 4FAPA 3ARUA 4J4OA 4GGQA 1NH6A 2M08A 3PR9A 1Q6HA 3B9EA 1JNSA 4IPXA 4DRIA 1HKIA 1IX5A 2DT3A 3OOBA 4MNLA 4QT2A 3KCEA 1U79A 2ZQUA 1F40A 1ZB5A 2A3EA 2PPPA 3CZ8A 3TCZA 4Z2GA 1J6YA 1C9HA 2RURA 4WKFA 5GPGA 4ODNA 3PA7A 2DSZA 5DO2A 3RMEA 2ITKA 3CHCA 4R5EA 1NWRA 4MSPA 3O5JA 3G6LA 4DWSD 2FDMA 4O2TA 4ODPA 5HBFA 2Q5AA 4U84A 1R9HA 3O5LA 3TDBA 5DEZA 1FKFA 3W4RA 2DT1A 5DIUA 1XRVA 1QZ2A 2O92A 3CHFA 4ITZA 1HXVA 1M5YA 1QPFA 4ODMA 4FN2A 5B8IC 3H9RB 2MLXA 4TX0A 4KR0B 2A3AA 1O6IA 4Q22A 2YBTA 2F4EA 3ODKA 3WD2A 4QT3A 4DWSA 3ARXA 3IHZA 5GQBA 3EY6A 5DIVA 2LPVA 1LJYA 2IUZA 1J4RA 1EIBA 2M2AA 4U86A 4DRQA 4LAYA 2XPBA 2ESCA 3AS1A 2MF9A 2AWGA 2MNTA 3RFWA 3NTPA 3UQIA 3O5MA 3ARSA 3WH0A 3MDYB 4PTMA 3UI4A 3WD3A 1HJWA 1FKGA 1N1AA 2LKNA 4ODQA 3ARZA 2PV2A 2DPEA 1LL7A 4GIVA 4Z2HA 1D6OA 3NRKA 3O5QA 1FAPA 1ITXA 2RSEA 3KABA 3ALGA 4IT6A 4TNSA 1JNEA 1LG1A 2DSWA 1J4IA 2KO7A 2F2DA 2PPNA 1H0IA 3AROA 4WIWA 2MPHA 2ZR5A 2ZR6A 3WQWA 3I6CA 3GPKA 4TYOA 5HW6A 3O5FA 1FD9A 1XHGA 4KQZA 4W9PA 4DRKA 4TW8A 2WLYA 3IK8A 5HWCA 1NMVA 1LL4A 1EHNA 4NZCA 4S3JA 1H0GA 4JFJA 2DG3A 3ARQA 1X6LA 2XP8A 4G50A 4Z2KA 1B6CA 1FFRA 2K8IA 1Q6UA 1E6PA 3RGCA 4JFLA 1E9LA 4HARA 3RM8A 3WL1A 4MGVA 4DRMA 2VN1A 1D7JA 1E6ZA 1ROUA 1QPLA 4C02B 4DT4A 3PRBA 4HBEA 4P8UA 1FKJA 4P8VA 3AS0A 3JYJA 5HUAA 1T11A 1OGGA 5I98A 2DT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVW A;  2XP5 A;  2N87 A;  3KAI A;  3O5O A;  3KAC A;  2F4E A;  3ODK A;  5HT1 A;  5BXJ A;  3UI5 A;  1ZCN A;  4QT3 A;  2XP9 A;  3VAW A;  3UF8 A;  4ODL A;  3UI6 A;  3IHZ A;  3UQB A;  1Q1C A;  2XP4 A;  3EY6 A;  4G2P A;  2KE0 A;  5DIV A;  2LPV A;  3O5D A;  3CGM A;  2L2S A;  2RQS A;  2DG4 A;  1EQ3 A;  1J4R A;  4W9O A;  4ODK A;  2M2A A;  4U86 A;  2MLY A;  4DRQ A;  2IF4 A;  2PV3 A;  4LAY A;  2XPB A;  3FAP A;  1KT0 A;  4LAX A;  1FKL A;  2MF9 A;  2KGJ A;  1FKD A;  2AWG A;  2LJ4 A;  2MNT A;  2RUQ A;  3NI6 A;  4IQC A;  3RFW A;  3NTP A;  3UQI A;  4DRP A;  1BL4 A;  5HWB A;  1NSG A;  2VCD A;  3O5M A;  3KAD A;  3WH0 A;  2XP3 A;  3MDY B;  4ODR A;  2FKE A;  3UI4 A;  4DRH A;  5HW7 A;  1FKH A;  1FKG A;  1N1A A;  2MLZ A;  2PBC A;  2LKN A;  3CGN A;  3IKG A;  4LAV A;  4ODQ A;  4TX0 A;  3O5E A;  2PV2 A;  1D7H A;  4DRJ A;  3O5P A;  1FKB A;  3KZ7 A;  3KAF A;  2RUC A;  4GIV A;  2XP7 A;  4DZ2 A;  1D6O A;  1EYM A;  3NRK A;  3O5Q A;  4JFI A;  1FAP A;  3O5I A;  1W26 A;  4JFM A;  5DIT A;  2RSE A;  3UQA A;  3KAB A;  3KAG A;  4JYS A;  5HKG A;  4TNS A;  1FKK A;  4ODO A;  2PPO A;  2RUD A;  4QIB A;  2KFW A;  1J4I A;  1Q6I A;  3IKD A;  1Y0O A;  4R0X A;  2KO7 A;  3O5G A;  1PIN A;  2OFN A;  2F2D A;  2PPN A;  2XPA A;  2LGO A;  2M1I A;  4DZ3 A;  4FAP A;  4J4O A;  4GGQ A;  1D7I A;  2KR7 A;  1PBK A;  2DG9 A;  2MPH A;  2ZR5 A;  3B7X A;  2M08 A;  2ZR6 A;  3O5K A;  4N19 A;  3TC5 A;  2XP6 A;  3I6C A;  3GPK A;  1Q6H A;  3PRD A;  1NMW A;  4TYO A;  1JNS A;  5HW6 A;  2KI3 A;  3O5R A;  4IPX A;  4DRI A;  3O5F A;  1FD9 A;  1P5Q A;  2ZR4 A;  3OOB A;  1KT1 A;  4QT2 A;  1F8A B;  4W9Q A;  1L1P A;  4W9P A;  4BF8 A;  4DRK A;  4TW8 A;  3KCE A;  5HTG A;  3IK8 A;  1U79 A;  5HWC A;  1NMV A;  2F21 A;  1YW5 A;  2ZQU A;  1F40 A;  3TCZ A;  2PPP A;  2PV1 A;  2Y78 A;  4JFJ A;  1TCO C;  2D9F A;  4LAW A;  1J6Y A;  1C9H A;  4NNR A;  2DG3 A;  4DIP A;  2RUR A;  5GPG A;  2ZQS A;  4ODN A;  1FKT A;  2XP8 A;  3JYM A;  4G50 A;  2UZ5 A;  3PA7 A;  1JNT A;  1B6C A;  2ITK A;  4IQ2 A;  4J4N A;  2K8I A;  1Q6U A;  2ZQV A;  3RGC A;  4JFL A;  4MSP A;  3O5J A;  5J6E A;  1BKF A;  3JXV A;  1J4H A;  4O2T A;  4MGV A;  4ODP A;  1FKI A;  1ZK6 A;  4DRM A;  1YAT A;  3LUO A;  5HW8 A;  2FAP A;  2Q5A A;  1FKS A;  1R9H A;  1D7J A;  2VN1 A;  3KAH A;  4TW7 A;  4TW6 A;  4U84 A;  4DH0 A;  3O5L A;  4DRN A;  1ROU A;  2ZQT A;  1QPL A;  3TDB A;  4C02 B;  3PRB A;  4U85 A;  1FKF A;  4DT4 A;  1FKR A;  5D75 A;  1FKJ A;  5DIU A;  2JZV A;  1A7X A;  1QZ2 A;  3JYJ A;  5HUA A;  4ITZ A;  1HXV A;  1T11 A;  1M5Y A;  1QPF A;  4ODM A;  4FN2 A;  5B8I C;  3H9R B;  5I98 A;  1ROT A;  2MLX A;  4DRO A;  1FJD A;  4JFK A; 
#chains in the Genus database with same CATH topology
 4ZPT R;  2XP5 A;  3B9A A;  3KAI A;  3KAC A;  1ZCN A;  2P4V A;  3UF8 A;  4ODL A;  1JND A;  2XP4 A;  2G8Z A;  3WQV A;  3CGM A;  2RQS A;  1EQ3 A;  4W9O A;  1E6N A;  4MPK A;  2MLY A;  1FFQ A;  3FAP A;  4L72 B;  1GUV A;  4LAX A;  4DRP A;  3NI6 A;  3WIJ A;  4IQC A;  1BL4 A;  1NSG A;  1UR8 A;  4MTV A;  3KAD A;  4W5U A;  1LG2 A;  4DRH A;  5HW7 A;  3CGN A;  2MLZ A;  2PBC A;  1OWQ A;  4DRJ A;  1FKB A;  3KAF A;  4DZ2 A;  3EIP A;  4JFI A;  5DIT A;  1W26 A;  3KAG A;  3IKD A;  1VF8 A;  1Y0O A;  1K9T A;  4WKH A;  1ZU8 A;  3O5G A;  1W9P A;  2M1I A;  4WK9 A;  1E6R A;  2B31 A;  3CH9 A;  1D7I A;  2KR7 A;  4HBO A;  4P8X A;  4ZPW R;  3O5K A;  3TC5 A;  3B7X A;  3ARY A;  2XP6 A;  1NMW A;  2KI3 A;  1W9V A;  1WB0 A;  1P5Q A;  2ZR4 A;  1KT1 A;  4P8W A;  1F8A B;  1ZBC A;  3ALF A;  4IT4 A;  4BF8 A;  1X6N A;  1YW5 A;  1ZBK A;  2F21 A;  1W1P A;  1W1Y A;  4NSB A;  4LAW A;  5GPR A;  4DIP A;  1ZL1 A;  4Z2I A;  2ZQS A;  1FKT A;  1RD6 A;  2A3B A;  3JYM A;  4MNM A;  3WD0 A;  4Z2J A;  4IQ2 A;  4J4N A;  3WD1 A;  5J6E A;  1YAT A;  3LUO A;  5HW8 A;  2FAP A;  3KAH A;  4DH0 A;  4TW6 A;  3ARP A;  2YBU A;  2ZQT A;  1FKR A;  3G6M A;  4MNJ A;  5D75 A;  4WKA A;  1NWS A;  4ZPV R;  1ROT A;  1L1P A;  1FJD A;  4JFK A;  4MAV A;  4ODR A;  2A3C A;  1TFV A;  1HKJ A;  5HT1 A;  2DSU A;  5BXJ A;  3RM9 A;  2QF8 A;  3WKZ A;  2XP9 A;  3ARW A;  3UI6 A;  3UQB A;  2G41 A;  2KE0 A;  3O5D A;  2L2S A;  1UR9 A;  2IF4 A;  2PV3 A;  1SYT A;  2KGJ A;  1FKD A;  2LJ4 A;  2RUQ A;  5HWB A;  4L3N A;  2VCD A;  2XP3 A;  2FKE A;  2PI6 A;  1SR0 A;  3O5E A;  3O5P A;  1EDQ A;  1LQ0 A;  1EYM A;  4JFM A;  3O5I A;  3UQA A;  5HKG A;  3B9D A;  2PPO A;  1E15 A;  3ARR A;  1WNO A;  1Q6I A;  4R0X A;  3FY1 A;  2OFN A;  3WL0 A;  2LGO A;  1OGB A;  4DZ3 A;  4AY1 A;  3BXW A;  1PBK A;  2DG9 A;  4N19 A;  1GPF A;  3PRD A;  1GOI A;  3O5R A;  3AS2 A;  4LGX A;  4XAK A;  1W1T A;  4W9Q A;  4WJX A;  2DSV A;  5HTG A;  2PV1 A;  2Y78 A;  1TCO C;  2D9F A;  4DWS C;  1HJV A;  4NNR A;  5DF0 A;  2DT0 A;  4Q7N A;  1ZBW A;  2UZ5 A;  1NWU A;  1JNT A;  3B8S A;  5JH8 A;  4QZV B;  1KFW A;  1JCH B;  2ZQV A;  1HKM A;  4URI A;  1BKF A;  1W9U A;  3JXV A;  1WAW A;  1J4H A;  4S3K A;  2OLH A;  1FKI A;  1ZK6 A;  3ART A;  2WLZ A;  1FKS A;  4TW7 A;  4DRN A;  3OA5 A;  4U85 A;  2JZV A;  3RM4 A;  1A7X A;  1LL6 A;  4Z2L A;  4DRO A;  3WD4 A;  1JVW A;  2B5U B;  3CHD A;  4DWS B;  2N87 A;  3AS3 A;  3O5O A;  3UI5 A;  3VAW A;  1Q1C A;  1GRJ A;  1HJX A;  4G2P A;  2DG4 A;  4ML4 A;  4ODK A;  3AQU A;  1D2K A;  4ZS6 A;  4MNK A;  1KT0 A;  3CHE A;  1FKL A;  3PRA A;  1FKH A;  3ARV A;  2O9O A;  1W1V A;  3IKG A;  4LAV A;  1D7H A;  3KZ7 A;  2RUC A;  2XP7 A;  1ZBV A;  2WM0 A;  2WK2 A;  4JYS A;  1FKK A;  3QOK A;  4ODO A;  2RUD A;  4QIB A;  2KFW A;  1CTN A;  1HKK A;  2AOS A;  1NWT A;  1PIN A;  2XPA A;  3FXY A;  4FAP A;  3ARU A;  4J4O A;  4GGQ A;  1NH6 A;  2M08 A;  3PR9 A;  1Q6H A;  3B9E A;  1JNS A;  4IPX A;  4DRI A;  1HKI A;  1IX5 A;  2DT3 A;  3OOB A;  4MNL A;  4QT2 A;  2ETN A;  3GTY X;  3KCE A;  1U79 A;  2ZQU A;  1F40 A;  1ZB5 A;  2A3E A;  2PPP A;  3CZ8 A;  3TCZ A;  4Z2G A;  1J6Y A;  1C9H A;  2RUR A;  4WKF A;  5GPG A;  4ODN A;  3PA7 A;  2DSZ A;  5DO2 A;  3RME A;  2ITK A;  3CHC A;  4R5E A;  1NWR A;  4MSP A;  3O5J A;  2EUL A;  3G6L A;  4DWS D;  2FDM A;  4O2T A;  4ODP A;  5HBF A;  2Q5A A;  4U84 A;  1R9H A;  3O5L A;  3TDB A;  5DEZ A;  1FKF A;  3W4R A;  2DT1 A;  5DIU A;  1XRV A;  1QZ2 A;  2O92 A;  3CHF A;  4ITZ A;  1HXV A;  1M5Y A;  1QPF A;  4ODM A;  4FN2 A;  5B8I C;  3H9R B;  2MLX A;  4TX0 A;  4KR0 B;  2A3A A;  1O6I A;  4Q22 A;  2YBT A;  2F4E A;  3ODK A;  3WD2 A;  4QT3 A;  4DWS A;  3ARX A;  3IHZ A;  5GQB A;  3EY6 A;  5DIV A;  2LPV A;  1LJY A;  2IUZ A;  1J4R A;  1EIB A;  2M2A A;  4U86 A;  4DRQ A;  4LAY A;  2XPB A;  2ESC A;  2PN0 A;  3AS1 A;  2MF9 A;  2AWG A;  2MNT A;  3RFW A;  3NTP A;  3UQI A;  3O5M A;  3ARS A;  3WH0 A;  3MDY B;  4PTM A;  3UI4 A;  3WD3 A;  1HJW A;  1FKG A;  1N1A A;  2LKN A;  4ODQ A;  3ARZ A;  2PV2 A;  2DPE A;  1LL7 A;  4GIV A;  4Z2H A;  1D6O A;  3NRK A;  3O5Q A;  1FAP A;  1ITX A;  2RSE A;  3KAB A;  3ALG A;  4IT6 A;  4TNS A;  1JNE A;  1LG1 A;  2DSW A;  1J4I A;  2F23 A;  2KO7 A;  2F2D A;  2PPN A;  1H0I A;  3ARO A;  1E44 A;  4WIW A;  2MPH A;  2ZR5 A;  2ZR6 A;  3WQW A;  3I6C A;  3GPK A;  4TYO A;  5HW6 A;  3GU0 A;  3O5F A;  1FD9 A;  1XHG A;  4KQZ A;  4W9P A;  4DRK A;  4TW8 A;  2WLY A;  3IK8 A;  5HWC A;  1NMV A;  1LL4 A;  1EHN A;  4NZC A;  4S3J A;  1H0G A;  4JFJ A;  2DG3 A;  3ARQ A;  1X6L A;  2XP8 A;  4G50 A;  4Z2K A;  1B6C A;  1FFR A;  2K8I A;  1Q6U A;  1E6P A;  3RGC A;  4JFL A;  1E9L A;  4HAR A;  3BMB A;  3RM8 A;  3WL1 A;  4MGV A;  4DRM A;  2VN1 A;  1D7J A;  4UDM A;  1E6Z A;  1ROU A;  1QPL A;  4C02 B;  4DT4 A;  3PRB A;  4HBE A;  4P8U A;  1FKJ A;  4P8V A;  3AS0 A;  3JYJ A;  5HUA A;  1T11 A;  1OGG A;  5I98 A;  2DT2 A; 
#chains in the Genus database with same CATH homology
 4ZPT R;  2XP5 A;  3B9A A;  3KAI A;  3KAC A;  1ZCN A;  3UF8 A;  4ODL A;  1JND A;  2XP4 A;  2G8Z A;  3WQV A;  3CGM A;  2RQS A;  1EQ3 A;  4W9O A;  1E6N A;  4MPK A;  2MLY A;  1FFQ A;  3FAP A;  4L72 B;  1GUV A;  4LAX A;  4DRP A;  3NI6 A;  3WIJ A;  4IQC A;  1BL4 A;  1NSG A;  1UR8 A;  4MTV A;  3KAD A;  4W5U A;  1LG2 A;  4DRH A;  5HW7 A;  3CGN A;  2MLZ A;  2PBC A;  1OWQ A;  4DRJ A;  1FKB A;  3KAF A;  4DZ2 A;  4JFI A;  5DIT A;  1W26 A;  3KAG A;  3IKD A;  1VF8 A;  1Y0O A;  1K9T A;  4WKH A;  1ZU8 A;  3O5G A;  1W9P A;  2M1I A;  4WK9 A;  1E6R A;  2B31 A;  3CH9 A;  1D7I A;  2KR7 A;  4HBO A;  4P8X A;  4ZPW R;  3O5K A;  3TC5 A;  3B7X A;  3ARY A;  2XP6 A;  1NMW A;  2KI3 A;  1W9V A;  1WB0 A;  1P5Q A;  2ZR4 A;  1KT1 A;  4P8W A;  1F8A B;  1ZBC A;  3ALF A;  4IT4 A;  4BF8 A;  1X6N A;  1YW5 A;  1ZBK A;  2F21 A;  1W1P A;  1W1Y A;  4NSB A;  4LAW A;  5GPR A;  4DIP A;  1ZL1 A;  4Z2I A;  2ZQS A;  1FKT A;  1RD6 A;  2A3B A;  3JYM A;  4MNM A;  3WD0 A;  4Z2J A;  4IQ2 A;  4J4N A;  3WD1 A;  5J6E A;  1YAT A;  3LUO A;  5HW8 A;  2FAP A;  3KAH A;  4DH0 A;  4TW6 A;  3ARP A;  2YBU A;  2ZQT A;  1FKR A;  3G6M A;  4MNJ A;  5D75 A;  4WKA A;  1NWS A;  4ZPV R;  1ROT A;  1L1P A;  1FJD A;  4JFK A;  4MAV A;  4ODR A;  2A3C A;  1TFV A;  1HKJ A;  5HT1 A;  2DSU A;  5BXJ A;  3RM9 A;  2QF8 A;  3WKZ A;  2XP9 A;  3ARW A;  3UI6 A;  3UQB A;  2G41 A;  2KE0 A;  3O5D A;  2L2S A;  1UR9 A;  2IF4 A;  2PV3 A;  1SYT A;  2KGJ A;  1FKD A;  2LJ4 A;  2RUQ A;  5HWB A;  4L3N A;  2VCD A;  2XP3 A;  2FKE A;  2PI6 A;  1SR0 A;  3O5E A;  3O5P A;  1EDQ A;  1LQ0 A;  1EYM A;  4JFM A;  3O5I A;  3UQA A;  5HKG A;  3B9D A;  2PPO A;  1E15 A;  3ARR A;  1WNO A;  1Q6I A;  4R0X A;  3FY1 A;  2OFN A;  3WL0 A;  2LGO A;  1OGB A;  4DZ3 A;  4AY1 A;  3BXW A;  1PBK A;  2DG9 A;  4N19 A;  1GPF A;  3PRD A;  1GOI A;  3O5R A;  3AS2 A;  4LGX A;  4XAK A;  1W1T A;  4W9Q A;  4WJX A;  2DSV A;  5HTG A;  2PV1 A;  2Y78 A;  1TCO C;  2D9F A;  4DWS C;  1HJV A;  4NNR A;  5DF0 A;  2DT0 A;  4Q7N A;  1ZBW A;  2UZ5 A;  1NWU A;  1JNT A;  3B8S A;  5JH8 A;  4QZV B;  1KFW A;  2ZQV A;  1HKM A;  4URI A;  1BKF A;  1W9U A;  3JXV A;  1WAW A;  1J4H A;  4S3K A;  2OLH A;  1FKI A;  1ZK6 A;  3ART A;  2WLZ A;  1FKS A;  4TW7 A;  4DRN A;  3OA5 A;  4U85 A;  2JZV A;  3RM4 A;  1A7X A;  1LL6 A;  4Z2L A;  4DRO A;  3WD4 A;  1JVW A;  3CHD A;  4DWS B;  2N87 A;  3AS3 A;  3O5O A;  3UI5 A;  3VAW A;  1Q1C A;  1HJX A;  4G2P A;  2DG4 A;  4ML4 A;  4ODK A;  3AQU A;  1D2K A;  4ZS6 A;  4MNK A;  1KT0 A;  3CHE A;  1FKL A;  3PRA A;  1FKH A;  3ARV A;  2O9O A;  1W1V A;  3IKG A;  4LAV A;  1D7H A;  3KZ7 A;  2RUC A;  2XP7 A;  1ZBV A;  2WM0 A;  2WK2 A;  4JYS A;  1FKK A;  3QOK A;  4ODO A;  2RUD A;  4QIB A;  2KFW A;  1CTN A;  1HKK A;  2AOS A;  1NWT A;  1PIN A;  2XPA A;  3FXY A;  4FAP A;  3ARU A;  4J4O A;  4GGQ A;  1NH6 A;  2M08 A;  3PR9 A;  1Q6H A;  3B9E A;  1JNS A;  4IPX A;  4DRI A;  1HKI A;  1IX5 A;  2DT3 A;  3OOB A;  4MNL A;  4QT2 A;  3KCE A;  1U79 A;  2ZQU A;  1F40 A;  1ZB5 A;  2A3E A;  2PPP A;  3CZ8 A;  3TCZ A;  4Z2G A;  1J6Y A;  1C9H A;  2RUR A;  4WKF A;  5GPG A;  4ODN A;  3PA7 A;  2DSZ A;  5DO2 A;  3RME A;  2ITK A;  3CHC A;  4R5E A;  1NWR A;  4MSP A;  3O5J A;  3G6L A;  4DWS D;  2FDM A;  4O2T A;  4ODP A;  5HBF A;  2Q5A A;  4U84 A;  1R9H A;  3O5L A;  3TDB A;  5DEZ A;  1FKF A;  3W4R A;  2DT1 A;  5DIU A;  1XRV A;  1QZ2 A;  2O92 A;  3CHF A;  4ITZ A;  1HXV A;  1M5Y A;  1QPF A;  4ODM A;  4FN2 A;  5B8I C;  3H9R B;  2MLX A;  4TX0 A;  4KR0 B;  2A3A A;  1O6I A;  4Q22 A;  2YBT A;  2F4E A;  3ODK A;  3WD2 A;  4QT3 A;  4DWS A;  3ARX A;  3IHZ A;  5GQB A;  3EY6 A;  5DIV A;  2LPV A;  1LJY A;  2IUZ A;  1J4R A;  1EIB A;  2M2A A;  4U86 A;  4DRQ A;  4LAY A;  2XPB A;  2ESC A;  3AS1 A;  2MF9 A;  2AWG A;  2MNT A;  3RFW A;  3NTP A;  3UQI A;  3O5M A;  3ARS A;  3WH0 A;  3MDY B;  4PTM A;  3UI4 A;  3WD3 A;  1HJW A;  1FKG A;  1N1A A;  2LKN A;  4ODQ A;  3ARZ A;  2PV2 A;  2DPE A;  1LL7 A;  4GIV A;  4Z2H A;  1D6O A;  3NRK A;  3O5Q A;  1FAP A;  1ITX A;  2RSE A;  3KAB A;  3ALG A;  4IT6 A;  4TNS A;  1JNE A;  1LG1 A;  2DSW A;  1J4I A;  2KO7 A;  2F2D A;  2PPN A;  1H0I A;  3ARO A;  4WIW A;  2MPH A;  2ZR5 A;  2ZR6 A;  3WQW A;  3I6C A;  3GPK A;  4TYO A;  5HW6 A;  3O5F A;  1FD9 A;  1XHG A;  4KQZ A;  4W9P A;  4DRK A;  4TW8 A;  2WLY A;  3IK8 A;  5HWC A;  1NMV A;  1LL4 A;  1EHN A;  4NZC A;  4S3J A;  1H0G A;  4JFJ A;  2DG3 A;  3ARQ A;  1X6L A;  2XP8 A;  4G50 A;  4Z2K A;  1B6C A;  1FFR A;  2K8I A;  1Q6U A;  1E6P A;  3RGC A;  4JFL A;  1E9L A;  4HAR A;  3RM8 A;  3WL1 A;  4MGV A;  4DRM A;  2VN1 A;  1D7J A;  1E6Z A;  1ROU A;  1QPL A;  4C02 B;  4DT4 A;  3PRB A;  4HBE A;  4P8U A;  1FKJ A;  4P8V A;  3AS0 A;  3JYJ A;  5HUA A;  1T11 A;  1OGG A;  5I98 A;  2DT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...