4ODRA

Structure of slyd delta-if from thermus thermophilus in complex with fk506
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 24
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odrA00
4IPXA 2M2AA 1FKRA 5HT1A 1BKFA 2F21A 4LAYA 4DROA 3O5LA 3O5EA 4QT2A 3O5RA 5HUAA 4J4NA 2XP7A 4IQ2A 4N19A 2MLXA 1YW5A 1QPLA 3KAIA 3KAGA 3I6CA 3KABA 2XP5A 2MLZA 2XPAA 4G50A 4ITZA 2PV1A 3KCEA 4ODLA 5DIUA 3KACA 3MDYB 1Q6IA 1QPFA 3OOBA 2M1IA 2MF9A 3O5KA 5HWBA 4ODOA 2VCDA 3GPKA 4FAPA 4ODRA 1A7XA 3FAPA 2PV2A 2KGJA 3ODKA 5BXJA 3KAHA 2KO7A 2RUDA 5I98A 2PV3A 2JZVA 5DITA 3KZ7A 2LJ4A 1BL4A 2PBCA 1EYMA 2XP6A 1Q6UA 3IK8A 4JYSA 2F2DA 3CGNA 4W9OA 2N87A 1L1PA 2KE0A 1FKTA 3O5FA 1FD9A 1FKSA 3UQBA 1D7HA 4DRKA 2ZR4A 2FKEA 2ZQUA 3PA7A 5HW7A 3B7XA 4JFMA 3WH0A 1FKDA 3UI4A 4NNRA 4ODPA 1KT1A 3UI6A 1ZK6A 3IHZA 4LAWA 3O5QA 4JFKA 1FKBA 2F4EA 2LKNA 2ZR6A 2KFWA 1PBKA 2RUCA 4ODKA 3PRBA 4W9PA 4BF8A 1EQ3A 2VN1A 1F40A 1M5YA 2ZQVA 2L2SA 2RURA 4U86A 4LAXA 4ODQA 1B6CA 2XP9A 4O2TA 5J6EA 1JNSA 1HXVA 3UF8A 2ITKA 2PPNA 2OFNA 1FKLA 1YATA 4DRQA 1Q6HA 1N1AA 3NRKA 5HW8A 1NMVA 4JFJA 2MPHA 1TCOC 1KT0A 4DH0A 2AWGA 1W26A 2XP3A 2D9FA 2RSEA 2PPOA 3UI5A 4DRHA 1QZ2A 3JXVA 5HWCA 4W9QA 3O5MA 1P5QA 1FKFA 3O5PA 4DRJA 3TCZA 3UQAA 2Y78A 1Q1CA 3JYJA 5D75A 1FKHA 4ODNA 2DG3A 4C02B 4IQCA 4U84A 2M08A 4DIPA 1FKJA 1Y0OA 5B8IC 4DRMA 2XPBA 2MLYA 2UZ5A 3VAWA 3TC5A 1D7IA 1D7JA 1F8AB 2Q5AA 2DG4A 1C9HA 2KR7A 3NI6A 3H9RB 5HKGA 5HTGA 1FKIA 4QT3A 4TW8A 4FN2A 2ZR5A 4JFIA 4GIVA 4DRPA 1T11A 1ROUA 2XP4A 4MSPA 3RGCA 2RQSA 1J6YA 2ZQSA 1J4RA 2FAPA 4DRIA 1ZCNA 1PINA 2K8IA 2LGOA 1J4IA 4QIBA 3EY6A 1FKGA 3O5JA 1FKKA 1NSGA 4U85A 3JYMA 4JFLA 4DZ3A 3IKDA 3NTPA 3O5OA 4GGQA 4TYOA 4LAVA 5DIVA 3IKGA 3KAFA 2DG9A 3O5DA 3PRDA 2KI3A 4TNSA 5HW6A 1JVWA 3O5IA 1D6OA 3CGMA 4TW7A 4DZ2A 4G2PA 3TDBA 4TW6A 4J4OA 1JNTA 1J4HA 1U79A 3LUOA 3KADA 4TX0A 1NMWA 5GPGA 4DT4A 2PPPA 4R0XA 1FJDA 3UQIA 2RUQA 2ZQTA 2MNTA 4ODMA 1ROTA 3O5GA 4DRNA 3RFWA 2IF4A 2XP8A 2LPVA 4MGVA 1R9HA 1FAPA
chains in the Genus database with same CATH superfamily
2F21A 3O5RA 4HBEA 4W5UA 1EHNA 3ALGA 3KAIA 4Q7NA 1SR0A 3KABA 2XPAA 3KACA 3OOBA 1QPFA 2M1IA 1WNOA 4ODOA 4AY1A 2KO7A 5I98A 2PV3A 1ZL1A 3KZ7A 2LJ4A 1BL4A 1W1VA 1EYMA 2PBCA 3IK8A 1L1PA 1E44A 2KE0A 3O5FA 1D7HA 1JCHB 2FKEA 1ZU8A 1FKDA 4NNRA 3EIPA 2DT3A 3UI6A 3IHZA 2F4EA 2OLHA 2RUCA 1EQ3A 2VN1A 3AQUA 4ODQA 1XHGA 1LL6A 1JNSA 1VF8A 3CHDA 3RM4A 1W9PA 1LG1A 2QF8A 3QOKA 4Z2IA 5DO2A 2PPOA 1GPFA 1NWRA 4DRHA 2YBUA 3RM9A 1ITXA 4DRJA 4MAVA 3WD0A 4C02B 1FKHA 2WLYA 1HKJA 4KR0B 4HARA 3BMBA 4FN2A 1IX5A 3CZ8A 1ROUA 2ZQSA 4WKHA 3O5JA 3OA5A 1FKKA 1NSGA 1FFQA 4U85A 3WL0A 3ARXA 4JFLA 4DZ3A 3NTPA 4P8XA 1E6RA 4TYOA 4LAVA 2DSUA 1NWTA 2DG9A 2KI3A 1JVWA 3O5IA 4L3NA 1D6OA 1W1YA 3PRAA 1UR8A 4TW6A 4J4OA 4Z2JA 1J4HA 3LUOA 2RUQA 1ROTA 3RFWA 5HTGA 2XP8A 4JFJA 1R9HA 4LGXA 1FKRA 2M2AA 2DT2A 1BKFA 1E15A 4DROA 3O5LA 3O5EA 4QT2A 4Z2GA 5HUAA 3WQVA 1CTNA 4QZVB 1YW5A 1HKKA 3KCEA 1Q6IA 4MNKA 3G6LA 3GPKA 1W9VA 4ZPVR 2KGJA 3W4RA 2JZVA 3CHFA 3TCZA 2N87A 1FKTA 3ALFA 1E6ZA 1FKSA 3ARUA 3WD4A 3B9EA 3B9AA 2ZQUA 3ARVA 5HW7A 3B7XA 1W9UA 4JFMA 3WH0A 3FXYA 1E6NA 4ODPA 1KT1A 2F23A 4R5EA 1ZK6A 1GUVA 3ARZA 4LAWA 3O5QA 2ZR6A 1EDQA 1M5YA 2DT1A 2ZQVA 2L2SA 1K9TA 2RURA 4LAXA 1HXVA 3UF8A 2ESCA 4DRQA 1YATA 4DWSC 1KFWA 1WAWA 1NMVA 2MPHA 3ARSA 1KT0A 2YBTA 4DH0A 2AWGA 2XP3A 2D9FA 2RSEA 1QZ2A 1GRJA 3O5MA 1OGGA 2AOSA 4KQZA 4IQCA 3AS0A 2M08A 1TFVA 2EULA 4P8UA 2MLYA 5GPRA 3TC5A 1D7JA 1NH6A 3NI6A 3H9RB 5JH8A 4WKAA 4QT3A 4URIA 2ZR5A 4JFIA 4GIVA 4DRPA 4MSPA 1J4RA 4DRIA 2LGOA 4QIBA 2O9OA 1D2KA 1W1TA 1FKGA 2B31A 4P8WA 2DSWA 3JYMA 1FFRA 3IKDA 2A3CA 3IKGA 3KAFA 3O5DA 4DWSB 4DZ2A 4G2PA 3TDBA 1JNTA 2DPEA 1U79A 3KADA 1NMWA 4DT4A 2O92A 2PPPA 4NSBA 1FJDA 3WIJA 1JNEA 4WJXA 3ARTA 4Z2LA 2LPVA 3PR9A 2PI6A 1SYTA 5HT1A 4ZS6A 4IQ2A 4N19A 4MNMA 4G50A 4ITZA 4ODLA 2PV1A 3MDYB 3O5KA 1E9LA 4ODRA 1A7XA 3FAPA 3ODKA 1ZB5A 3KAHA 3B8SA 1GOIA 2XP6A 2G41A 4W9OA 3CGNA 3B9DA 3ARYA 5HBFA 2ZR4A 3GTYX 2ETNA 1LJYA 4WIWA 4NZCA 4Q22A 2DT0A 4ZPWR 1LL4A 1PBKA 2KFWA 3PRBA 4W9PA 4U86A 1B6CA 2XP9A 4O2TA 3AS1A 2ITKA 2A3AA 3RM8A 1FKLA 1Q6HA 3WD3A 1H0GA 1OWQA 3UI5A 3JXVA 3O5PA 1FKFA 1XRVA 3WKZA 3G6MA 2Y78A 4ML4A 4DWSD 1Q1CA 3FY1A 5D75A 4MTVA 4ODNA 1X6LA 2DG3A 3GU0A 4Z2KA 1WB0A 4Z2HA 4IT6A 4U84A 4DIPA 1FKJA 1Y0OA 5B8IC 4DRMA 2UZ5A 3VAWA 4WK9A 1F8AB 2Q5AA 1C9HA 2KR7A 2WM0A 3ARRA 1FKIA 4TW8A 4ZPTR 2FDMA 1OGBA 1J6YA 2FAPA 1ZCNA 1J4IA 4MNJA 1HJVA 3EY6A 5DF0A 1HJXA 4GGQA 5DIVA 4WKFA 4TNSA 5HW6A 3BXWA 3CGMA 4TW7A 1O6IA 3UQBA 3ARWA 4R0XA 2MNTA 1JNDA 3CHEA 4DRNA 2IF4A 4MGVA 4IPXA 4LAYA 3AS2A 4J4NA 2XP7A 2MLXA 1QPLA 3CH9A 3KAGA 3I6CA 2IUZA 2MLZA 2XP5A 1RD6A 5DIUA 3ARPA 2MF9A 1H0IA 5HWBA 2B5UB 2VCDA 4FAPA 5DEZA 2PV2A 1ZBWA 5BXJA 1X6NA 2RUDA 5DITA 4JYSA 4BF8A 1Q6UA 2F2DA 3AS3A 1FD9A 4DRKA 1HKMA 3PA7A 3UI4A 1ZBCA 3RMEA 4JFKA 1FKBA 2LKNA 4ODKA 1F40A 4MNLA 1HJWA 5J6EA 2WLZA 2PPNA 2OFNA 4S3KA 2P4VA 1N1AA 2WK2A 3NRKA 2PN0A 5HW8A 1LL7A 1TCOC 1NWUA 1W26A 1EIBA 4PTMA 2G8ZA 1NWSA 1W1PA 4P8VA 5HWCA 4W9QA 3WQWA 1P5QA 5GQBA 3UQAA 1HKIA 3JYJA 3WD2A 3WD1A 2A3EA 1ZBKA 2XPBA 1D7IA 1LG2A 2DG4A 4MPKA 5HKGA 4XAKA 1T11A 2XP4A 3RGCA 2RQSA 4HBOA 1LQ0A 1PINA 1E6PA 2K8IA 4L72B 2DSZA 4IT4A 1UR9A 3O5OA 3CHCA 3WL1A 4UDMA 3PRDA 4S3JA 2DSVA 3ARQA 4TX0A 5GPGA 3AROA 2A3BA 3UQIA 2ZQTA 4ODMA 3O5GA 1ZBVA 4DWSA 1FAPA
chains in the Genus database with same CATH topology
2F21A 3O5RA 4HBEA 4W5UA 1EHNA 3ALGA 3KAIA 4Q7NA 1SR0A 3KABA 2XPAA 3KACA 3OOBA 1QPFA 2M1IA 1WNOA 4ODOA 4AY1A 2KO7A 5I98A 2PV3A 1ZL1A 3KZ7A 2LJ4A 1BL4A 1W1VA 1EYMA 2PBCA 3IK8A 1L1PA 2KE0A 3O5FA 1D7HA 2FKEA 1ZU8A 1FKDA 4NNRA 2DT3A 3UI6A 3IHZA 2F4EA 2OLHA 2RUCA 1EQ3A 2VN1A 3AQUA 4ODQA 1XHGA 1LL6A 1JNSA 1VF8A 3CHDA 3RM4A 1W9PA 1LG1A 2QF8A 3QOKA 4Z2IA 5DO2A 2PPOA 1GPFA 1NWRA 4DRHA 2YBUA 3RM9A 1ITXA 4DRJA 4MAVA 3WD0A 4C02B 1FKHA 2WLYA 1HKJA 4KR0B 4HARA 4FN2A 1IX5A 3CZ8A 1ROUA 2ZQSA 4WKHA 3O5JA 3OA5A 1FKKA 1NSGA 1FFQA 4U85A 3WL0A 3ARXA 4JFLA 4DZ3A 3NTPA 4P8XA 1E6RA 4TYOA 4LAVA 2DSUA 1NWTA 2DG9A 2KI3A 1JVWA 3O5IA 4L3NA 1D6OA 1W1YA 3PRAA 1UR8A 4TW6A 4J4OA 4Z2JA 1J4HA 3LUOA 2RUQA 1ROTA 3RFWA 5HTGA 2XP8A 4JFJA 1R9HA 4LGXA 1FKRA 2M2AA 2DT2A 1BKFA 1E15A 4DROA 3O5LA 3O5EA 4QT2A 4Z2GA 5HUAA 3WQVA 1CTNA 4QZVB 1YW5A 1HKKA 3KCEA 1Q6IA 4MNKA 3G6LA 3GPKA 1W9VA 4ZPVR 2KGJA 3W4RA 2JZVA 3CHFA 3TCZA 2N87A 1FKTA 3ALFA 1E6ZA 1FKSA 3ARUA 3WD4A 3B9EA 3B9AA 2ZQUA 3ARVA 5HW7A 3B7XA 1W9UA 4JFMA 3WH0A 3FXYA 1E6NA 4ODPA 1KT1A 4R5EA 1ZK6A 1GUVA 3ARZA 4LAWA 3O5QA 2ZR6A 1EDQA 1M5YA 2DT1A 2ZQVA 2L2SA 1K9TA 2RURA 4LAXA 1HXVA 3UF8A 2ESCA 4DRQA 1YATA 4DWSC 1KFWA 1WAWA 1NMVA 2MPHA 3ARSA 1KT0A 2YBTA 4DH0A 2AWGA 2XP3A 2D9FA 2RSEA 1QZ2A 3O5MA 1OGGA 2AOSA 4KQZA 4IQCA 3AS0A 2M08A 1TFVA 4P8UA 2MLYA 5GPRA 3TC5A 1D7JA 1NH6A 3NI6A 3H9RB 5JH8A 4WKAA 4QT3A 4URIA 2ZR5A 4JFIA 4GIVA 4DRPA 4MSPA 1J4RA 4DRIA 2LGOA 4QIBA 2O9OA 1D2KA 1W1TA 1FKGA 2B31A 4P8WA 2DSWA 3JYMA 1FFRA 3IKDA 2A3CA 3IKGA 3KAFA 3O5DA 4DWSB 4DZ2A 4G2PA 3TDBA 1JNTA 2DPEA 1U79A 3KADA 1NMWA 4DT4A 2O92A 2PPPA 4NSBA 1FJDA 3WIJA 1JNEA 4WJXA 3ARTA 4Z2LA 2LPVA 3PR9A 2PI6A 1SYTA 5HT1A 4ZS6A 4IQ2A 4N19A 4MNMA 4G50A 4ITZA 4ODLA 2PV1A 3MDYB 3O5KA 1E9LA 4ODRA 1A7XA 3FAPA 3ODKA 1ZB5A 3KAHA 3B8SA 1GOIA 2XP6A 2G41A 4W9OA 3CGNA 3B9DA 3ARYA 5HBFA 2ZR4A 1LJYA 4WIWA 4NZCA 4Q22A 2DT0A 4ZPWR 1LL4A 1PBKA 2KFWA 3PRBA 4W9PA 4U86A 1B6CA 2XP9A 4O2TA 3AS1A 2ITKA 2A3AA 3RM8A 1FKLA 1Q6HA 3WD3A 1H0GA 1OWQA 3UI5A 3JXVA 3O5PA 1FKFA 1XRVA 3WKZA 3G6MA 2Y78A 4ML4A 4DWSD 1Q1CA 3FY1A 5D75A 4MTVA 4ODNA 1X6LA 2DG3A 4Z2KA 1WB0A 4Z2HA 4IT6A 4U84A 4DIPA 1FKJA 1Y0OA 5B8IC 4DRMA 2UZ5A 3VAWA 4WK9A 1F8AB 2Q5AA 1C9HA 2KR7A 2WM0A 3ARRA 1FKIA 4TW8A 4ZPTR 2FDMA 1OGBA 1J6YA 2FAPA 1ZCNA 1J4IA 4MNJA 1HJVA 3EY6A 5DF0A 1HJXA 4GGQA 5DIVA 4WKFA 4TNSA 5HW6A 3BXWA 3CGMA 4TW7A 1O6IA 3UQBA 3ARWA 4R0XA 2MNTA 1JNDA 3CHEA 4DRNA 2IF4A 4MGVA 4IPXA 4LAYA 3AS2A 4J4NA 2XP7A 2MLXA 1QPLA 3CH9A 3KAGA 3I6CA 2IUZA 2MLZA 2XP5A 1RD6A 5DIUA 3ARPA 2MF9A 1H0IA 5HWBA 2VCDA 4FAPA 5DEZA 2PV2A 1ZBWA 5BXJA 1X6NA 2RUDA 5DITA 4JYSA 4BF8A 1Q6UA 2F2DA 3AS3A 1FD9A 4DRKA 1HKMA 3PA7A 3UI4A 1ZBCA 3RMEA 4JFKA 1FKBA 2LKNA 4ODKA 1F40A 4MNLA 1HJWA 5J6EA 2WLZA 2PPNA 2OFNA 4S3KA 1N1AA 2WK2A 3NRKA 5HW8A 1LL7A 1TCOC 1NWUA 1W26A 1EIBA 4PTMA 2G8ZA 1NWSA 1W1PA 4P8VA 5HWCA 4W9QA 3WQWA 1P5QA 5GQBA 3UQAA 1HKIA 3JYJA 3WD2A 3WD1A 2A3EA 1ZBKA 2XPBA 1D7IA 1LG2A 2DG4A 4MPKA 5HKGA 4XAKA 1T11A 2XP4A 3RGCA 2RQSA 4HBOA 1LQ0A 1PINA 1E6PA 2K8IA 4L72B 2DSZA 4IT4A 1UR9A 3O5OA 3CHCA 3WL1A 3PRDA 4S3JA 2DSVA 3ARQA 4TX0A 5GPGA 3AROA 2A3BA 3UQIA 2ZQTA 4ODMA 3O5GA 1ZBVA 4DWSA 1FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPX A;  2M2A A;  1FKR A;  5HT1 A;  1BKF A;  2F21 A;  4LAY A;  4DRO A;  3O5L A;  3O5E A;  4QT2 A;  3O5R A;  5HUA A;  4J4N A;  2XP7 A;  4IQ2 A;  4N19 A;  2MLX A;  1YW5 A;  1QPL A;  3KAI A;  3KAG A;  3I6C A;  3KAB A;  2XP5 A;  2MLZ A;  2XPA A;  4G50 A;  4ITZ A;  2PV1 A;  3KCE A;  4ODL A;  5DIU A;  3KAC A;  3MDY B;  1Q6I A;  1QPF A;  3OOB A;  2M1I A;  2MF9 A;  3O5K A;  5HWB A;  4ODO A;  2VCD A;  3GPK A;  4FAP A;  4ODR A;  1A7X A;  3FAP A;  2PV2 A;  2KGJ A;  3ODK A;  5BXJ A;  3KAH A;  2KO7 A;  2RUD A;  5I98 A;  2PV3 A;  2JZV A;  5DIT A;  3KZ7 A;  2LJ4 A;  1BL4 A;  2PBC A;  1EYM A;  2XP6 A;  1Q6U A;  3IK8 A;  4JYS A;  2F2D A;  3CGN A;  4W9O A;  2N87 A;  1L1P A;  2KE0 A;  1FKT A;  3O5F A;  1FD9 A;  1FKS A;  3UQB A;  1D7H A;  4DRK A;  2ZR4 A;  2FKE A;  2ZQU A;  3PA7 A;  5HW7 A;  3B7X A;  4JFM A;  3WH0 A;  1FKD A;  3UI4 A;  4NNR A;  4ODP A;  1KT1 A;  3UI6 A;  1ZK6 A;  3IHZ A;  4LAW A;  3O5Q A;  4JFK A;  1FKB A;  2F4E A;  2LKN A;  2ZR6 A;  2KFW A;  1PBK A;  2RUC A;  4ODK A;  3PRB A;  4W9P A;  4BF8 A;  1EQ3 A;  2VN1 A;  1F40 A;  1M5Y A;  2ZQV A;  2L2S A;  2RUR A;  4U86 A;  4LAX A;  4ODQ A;  1B6C A;  2XP9 A;  4O2T A;  5J6E A;  1JNS A;  1HXV A;  3UF8 A;  2ITK A;  2PPN A;  2OFN A;  1FKL A;  1YAT A;  4DRQ A;  1Q6H A;  1N1A A;  3NRK A;  5HW8 A;  1NMV A;  4JFJ A;  2MPH A;  1TCO C;  1KT0 A;  4DH0 A;  2AWG A;  1W26 A;  2XP3 A;  2D9F A;  2RSE A;  2PPO A;  3UI5 A;  4DRH A;  1QZ2 A;  3JXV A;  5HWC A;  4W9Q A;  3O5M A;  1P5Q A;  1FKF A;  3O5P A;  4DRJ A;  3TCZ A;  3UQA A;  2Y78 A;  1Q1C A;  3JYJ A;  5D75 A;  1FKH A;  4ODN A;  2DG3 A;  4C02 B;  4IQC A;  4U84 A;  2M08 A;  4DIP A;  1FKJ A;  1Y0O A;  5B8I C;  4DRM A;  2XPB A;  2MLY A;  2UZ5 A;  3VAW A;  3TC5 A;  1D7I A;  1D7J A;  1F8A B;  2Q5A A;  2DG4 A;  1C9H A;  2KR7 A;  3NI6 A;  3H9R B;  5HKG A;  5HTG A;  1FKI A;  4QT3 A;  4TW8 A;  4FN2 A;  2ZR5 A;  4JFI A;  4GIV A;  4DRP A;  1T11 A;  1ROU A;  2XP4 A;  4MSP A;  3RGC A;  2RQS A;  1J6Y A;  2ZQS A;  1J4R A;  2FAP A;  4DRI A;  1ZCN A;  1PIN A;  2K8I A;  2LGO A;  1J4I A;  4QIB A;  3EY6 A;  1FKG A;  3O5J A;  1FKK A;  1NSG A;  4U85 A;  3JYM A;  4JFL A;  4DZ3 A;  3IKD A;  3NTP A;  3O5O A;  4GGQ A;  4TYO A;  4LAV A;  5DIV A;  3IKG A;  3KAF A;  2DG9 A;  3O5D A;  3PRD A;  2KI3 A;  4TNS A;  5HW6 A;  1JVW A;  3O5I A;  1D6O A;  3CGM A;  4TW7 A;  4DZ2 A;  4G2P A;  3TDB A;  4TW6 A;  4J4O A;  1JNT A;  1J4H A;  1U79 A;  3LUO A;  3KAD A;  4TX0 A;  1NMW A;  5GPG A;  4DT4 A;  2PPP A;  4R0X A;  1FJD A;  3UQI A;  2RUQ A;  2ZQT A;  2MNT A;  4ODM A;  1ROT A;  3O5G A;  4DRN A;  3RFW A;  2IF4 A;  2XP8 A;  2LPV A;  4MGV A;  1R9H A;  1FAP A; 
#chains in the Genus database with same CATH topology
 2F21 A;  3O5R A;  4HBE A;  4W5U A;  1EHN A;  3ALG A;  3KAI A;  4Q7N A;  1SR0 A;  3KAB A;  2XPA A;  3KAC A;  3OOB A;  1QPF A;  2M1I A;  1WNO A;  4ODO A;  4AY1 A;  2KO7 A;  5I98 A;  2PV3 A;  1ZL1 A;  3KZ7 A;  2LJ4 A;  1BL4 A;  1W1V A;  1EYM A;  2PBC A;  3IK8 A;  1L1P A;  1E44 A;  2KE0 A;  3O5F A;  1D7H A;  1JCH B;  2FKE A;  1ZU8 A;  1FKD A;  4NNR A;  3EIP A;  2DT3 A;  3UI6 A;  3IHZ A;  2F4E A;  2OLH A;  2RUC A;  1EQ3 A;  2VN1 A;  3AQU A;  4ODQ A;  1XHG A;  1LL6 A;  1JNS A;  1VF8 A;  3CHD A;  3RM4 A;  1W9P A;  1LG1 A;  2QF8 A;  3QOK A;  4Z2I A;  5DO2 A;  2PPO A;  1GPF A;  1NWR A;  4DRH A;  2YBU A;  3RM9 A;  1ITX A;  4DRJ A;  4MAV A;  3WD0 A;  4C02 B;  1FKH A;  2WLY A;  1HKJ A;  4KR0 B;  4HAR A;  3BMB A;  4FN2 A;  1IX5 A;  3CZ8 A;  1ROU A;  2ZQS A;  4WKH A;  3O5J A;  3OA5 A;  1FKK A;  1NSG A;  1FFQ A;  4U85 A;  3WL0 A;  3ARX A;  4JFL A;  4DZ3 A;  3NTP A;  4P8X A;  1E6R A;  4TYO A;  4LAV A;  2DSU A;  1NWT A;  2DG9 A;  2KI3 A;  1JVW A;  3O5I A;  4L3N A;  1D6O A;  1W1Y A;  3PRA A;  1UR8 A;  4TW6 A;  4J4O A;  4Z2J A;  1J4H A;  3LUO A;  2RUQ A;  1ROT A;  3RFW A;  5HTG A;  2XP8 A;  4JFJ A;  1R9H A;  4LGX A;  1FKR A;  2M2A A;  2DT2 A;  1BKF A;  1E15 A;  4DRO A;  3O5L A;  3O5E A;  4QT2 A;  4Z2G A;  5HUA A;  3WQV A;  1CTN A;  4QZV B;  1YW5 A;  1HKK A;  3KCE A;  1Q6I A;  4MNK A;  3G6L A;  3GPK A;  1W9V A;  4ZPV R;  2KGJ A;  3W4R A;  2JZV A;  3CHF A;  3TCZ A;  2N87 A;  1FKT A;  3ALF A;  1E6Z A;  1FKS A;  3ARU A;  3WD4 A;  3B9E A;  3B9A A;  2ZQU A;  3ARV A;  5HW7 A;  3B7X A;  1W9U A;  4JFM A;  3WH0 A;  3FXY A;  1E6N A;  4ODP A;  1KT1 A;  2F23 A;  4R5E A;  1ZK6 A;  1GUV A;  3ARZ A;  4LAW A;  3O5Q A;  2ZR6 A;  1EDQ A;  1M5Y A;  2DT1 A;  2ZQV A;  2L2S A;  1K9T A;  2RUR A;  4LAX A;  1HXV A;  3UF8 A;  2ESC A;  4DRQ A;  1YAT A;  4DWS C;  1KFW A;  1WAW A;  1NMV A;  2MPH A;  3ARS A;  1KT0 A;  2YBT A;  4DH0 A;  2AWG A;  2XP3 A;  2D9F A;  2RSE A;  1QZ2 A;  1GRJ A;  3O5M A;  1OGG A;  2AOS A;  4KQZ A;  4IQC A;  3AS0 A;  2M08 A;  1TFV A;  2EUL A;  4P8U A;  2MLY A;  5GPR A;  3TC5 A;  1D7J A;  1NH6 A;  3NI6 A;  3H9R B;  5JH8 A;  4WKA A;  4QT3 A;  4URI A;  2ZR5 A;  4JFI A;  4GIV A;  4DRP A;  4MSP A;  1J4R A;  4DRI A;  2LGO A;  4QIB A;  2O9O A;  1D2K A;  1W1T A;  1FKG A;  2B31 A;  4P8W A;  2DSW A;  3JYM A;  1FFR A;  3IKD A;  2A3C A;  3IKG A;  3KAF A;  3O5D A;  4DWS B;  4DZ2 A;  4G2P A;  3TDB A;  1JNT A;  2DPE A;  1U79 A;  3KAD A;  1NMW A;  4DT4 A;  2O92 A;  2PPP A;  4NSB A;  1FJD A;  3WIJ A;  1JNE A;  4WJX A;  3ART A;  4Z2L A;  2LPV A;  3PR9 A;  2PI6 A;  1SYT A;  5HT1 A;  4ZS6 A;  4IQ2 A;  4N19 A;  4MNM A;  4G50 A;  4ITZ A;  4ODL A;  2PV1 A;  3MDY B;  3O5K A;  1E9L A;  4ODR A;  1A7X A;  3FAP A;  3ODK A;  1ZB5 A;  3KAH A;  3B8S A;  1GOI A;  2XP6 A;  2G41 A;  4W9O A;  3CGN A;  3B9D A;  3ARY A;  5HBF A;  2ZR4 A;  3GTY X;  2ETN A;  1LJY A;  4WIW A;  4NZC A;  4Q22 A;  2DT0 A;  4ZPW R;  1LL4 A;  1PBK A;  2KFW A;  3PRB A;  4W9P A;  4U86 A;  1B6C A;  2XP9 A;  4O2T A;  3AS1 A;  2ITK A;  2A3A A;  3RM8 A;  1FKL A;  1Q6H A;  3WD3 A;  1H0G A;  1OWQ A;  3UI5 A;  3JXV A;  3O5P A;  1FKF A;  1XRV A;  3WKZ A;  3G6M A;  2Y78 A;  4ML4 A;  4DWS D;  1Q1C A;  3FY1 A;  5D75 A;  4MTV A;  4ODN A;  1X6L A;  2DG3 A;  3GU0 A;  4Z2K A;  1WB0 A;  4Z2H A;  4IT6 A;  4U84 A;  4DIP A;  1FKJ A;  1Y0O A;  5B8I C;  4DRM A;  2UZ5 A;  3VAW A;  4WK9 A;  1F8A B;  2Q5A A;  1C9H A;  2KR7 A;  2WM0 A;  3ARR A;  1FKI A;  4TW8 A;  4ZPT R;  2FDM A;  1OGB A;  1J6Y A;  2FAP A;  1ZCN A;  1J4I A;  4MNJ A;  1HJV A;  3EY6 A;  5DF0 A;  1HJX A;  4GGQ A;  5DIV A;  4WKF A;  4TNS A;  5HW6 A;  3BXW A;  3CGM A;  4TW7 A;  1O6I A;  3UQB A;  3ARW A;  4R0X A;  2MNT A;  1JND A;  3CHE A;  4DRN A;  2IF4 A;  4MGV A;  4IPX A;  4LAY A;  3AS2 A;  4J4N A;  2XP7 A;  2MLX A;  1QPL A;  3CH9 A;  3KAG A;  3I6C A;  2IUZ A;  2MLZ A;  2XP5 A;  1RD6 A;  5DIU A;  3ARP A;  2MF9 A;  1H0I A;  5HWB A;  2B5U B;  2VCD A;  4FAP A;  5DEZ A;  2PV2 A;  1ZBW A;  5BXJ A;  1X6N A;  2RUD A;  5DIT A;  4JYS A;  4BF8 A;  1Q6U A;  2F2D A;  3AS3 A;  1FD9 A;  4DRK A;  1HKM A;  3PA7 A;  3UI4 A;  1ZBC A;  3RME A;  4JFK A;  1FKB A;  2LKN A;  4ODK A;  1F40 A;  4MNL A;  1HJW A;  5J6E A;  2WLZ A;  2PPN A;  2OFN A;  4S3K A;  2P4V A;  1N1A A;  2WK2 A;  3NRK A;  2PN0 A;  5HW8 A;  1LL7 A;  1TCO C;  1NWU A;  1W26 A;  1EIB A;  4PTM A;  2G8Z A;  1NWS A;  1W1P A;  4P8V A;  5HWC A;  4W9Q A;  3WQW A;  1P5Q A;  5GQB A;  3UQA A;  1HKI A;  3JYJ A;  3WD2 A;  3WD1 A;  2A3E A;  1ZBK A;  2XPB A;  1D7I A;  1LG2 A;  2DG4 A;  4MPK A;  5HKG A;  4XAK A;  1T11 A;  2XP4 A;  3RGC A;  2RQS A;  4HBO A;  1LQ0 A;  1PIN A;  1E6P A;  2K8I A;  4L72 B;  2DSZ A;  4IT4 A;  1UR9 A;  3O5O A;  3CHC A;  3WL1 A;  4UDM A;  3PRD A;  4S3J A;  2DSV A;  3ARQ A;  4TX0 A;  5GPG A;  3ARO A;  2A3B A;  3UQI A;  2ZQT A;  4ODM A;  3O5G A;  1ZBV A;  4DWS A;  1FAP A; 
#chains in the Genus database with same CATH homology
 2F21 A;  3O5R A;  4HBE A;  4W5U A;  1EHN A;  3ALG A;  3KAI A;  4Q7N A;  1SR0 A;  3KAB A;  2XPA A;  3KAC A;  3OOB A;  1QPF A;  2M1I A;  1WNO A;  4ODO A;  4AY1 A;  2KO7 A;  5I98 A;  2PV3 A;  1ZL1 A;  3KZ7 A;  2LJ4 A;  1BL4 A;  1W1V A;  1EYM A;  2PBC A;  3IK8 A;  1L1P A;  2KE0 A;  3O5F A;  1D7H A;  2FKE A;  1ZU8 A;  1FKD A;  4NNR A;  2DT3 A;  3UI6 A;  3IHZ A;  2F4E A;  2OLH A;  2RUC A;  1EQ3 A;  2VN1 A;  3AQU A;  4ODQ A;  1XHG A;  1LL6 A;  1JNS A;  1VF8 A;  3CHD A;  3RM4 A;  1W9P A;  1LG1 A;  2QF8 A;  3QOK A;  4Z2I A;  5DO2 A;  2PPO A;  1GPF A;  1NWR A;  4DRH A;  2YBU A;  3RM9 A;  1ITX A;  4DRJ A;  4MAV A;  3WD0 A;  4C02 B;  1FKH A;  2WLY A;  1HKJ A;  4KR0 B;  4HAR A;  4FN2 A;  1IX5 A;  3CZ8 A;  1ROU A;  2ZQS A;  4WKH A;  3O5J A;  3OA5 A;  1FKK A;  1NSG A;  1FFQ A;  4U85 A;  3WL0 A;  3ARX A;  4JFL A;  4DZ3 A;  3NTP A;  4P8X A;  1E6R A;  4TYO A;  4LAV A;  2DSU A;  1NWT A;  2DG9 A;  2KI3 A;  1JVW A;  3O5I A;  4L3N A;  1D6O A;  1W1Y A;  3PRA A;  1UR8 A;  4TW6 A;  4J4O A;  4Z2J A;  1J4H A;  3LUO A;  2RUQ A;  1ROT A;  3RFW A;  5HTG A;  2XP8 A;  4JFJ A;  1R9H A;  4LGX A;  1FKR A;  2M2A A;  2DT2 A;  1BKF A;  1E15 A;  4DRO A;  3O5L A;  3O5E A;  4QT2 A;  4Z2G A;  5HUA A;  3WQV A;  1CTN A;  4QZV B;  1YW5 A;  1HKK A;  3KCE A;  1Q6I A;  4MNK A;  3G6L A;  3GPK A;  1W9V A;  4ZPV R;  2KGJ A;  3W4R A;  2JZV A;  3CHF A;  3TCZ A;  2N87 A;  1FKT A;  3ALF A;  1E6Z A;  1FKS A;  3ARU A;  3WD4 A;  3B9E A;  3B9A A;  2ZQU A;  3ARV A;  5HW7 A;  3B7X A;  1W9U A;  4JFM A;  3WH0 A;  3FXY A;  1E6N A;  4ODP A;  1KT1 A;  4R5E A;  1ZK6 A;  1GUV A;  3ARZ A;  4LAW A;  3O5Q A;  2ZR6 A;  1EDQ A;  1M5Y A;  2DT1 A;  2ZQV A;  2L2S A;  1K9T A;  2RUR A;  4LAX A;  1HXV A;  3UF8 A;  2ESC A;  4DRQ A;  1YAT A;  4DWS C;  1KFW A;  1WAW A;  1NMV A;  2MPH A;  3ARS A;  1KT0 A;  2YBT A;  4DH0 A;  2AWG A;  2XP3 A;  2D9F A;  2RSE A;  1QZ2 A;  3O5M A;  1OGG A;  2AOS A;  4KQZ A;  4IQC A;  3AS0 A;  2M08 A;  1TFV A;  4P8U A;  2MLY A;  5GPR A;  3TC5 A;  1D7J A;  1NH6 A;  3NI6 A;  3H9R B;  5JH8 A;  4WKA A;  4QT3 A;  4URI A;  2ZR5 A;  4JFI A;  4GIV A;  4DRP A;  4MSP A;  1J4R A;  4DRI A;  2LGO A;  4QIB A;  2O9O A;  1D2K A;  1W1T A;  1FKG A;  2B31 A;  4P8W A;  2DSW A;  3JYM A;  1FFR A;  3IKD A;  2A3C A;  3IKG A;  3KAF A;  3O5D A;  4DWS B;  4DZ2 A;  4G2P A;  3TDB A;  1JNT A;  2DPE A;  1U79 A;  3KAD A;  1NMW A;  4DT4 A;  2O92 A;  2PPP A;  4NSB A;  1FJD A;  3WIJ A;  1JNE A;  4WJX A;  3ART A;  4Z2L A;  2LPV A;  3PR9 A;  2PI6 A;  1SYT A;  5HT1 A;  4ZS6 A;  4IQ2 A;  4N19 A;  4MNM A;  4G50 A;  4ITZ A;  4ODL A;  2PV1 A;  3MDY B;  3O5K A;  1E9L A;  4ODR A;  1A7X A;  3FAP A;  3ODK A;  1ZB5 A;  3KAH A;  3B8S A;  1GOI A;  2XP6 A;  2G41 A;  4W9O A;  3CGN A;  3B9D A;  3ARY A;  5HBF A;  2ZR4 A;  1LJY A;  4WIW A;  4NZC A;  4Q22 A;  2DT0 A;  4ZPW R;  1LL4 A;  1PBK A;  2KFW A;  3PRB A;  4W9P A;  4U86 A;  1B6C A;  2XP9 A;  4O2T A;  3AS1 A;  2ITK A;  2A3A A;  3RM8 A;  1FKL A;  1Q6H A;  3WD3 A;  1H0G A;  1OWQ A;  3UI5 A;  3JXV A;  3O5P A;  1FKF A;  1XRV A;  3WKZ A;  3G6M A;  2Y78 A;  4ML4 A;  4DWS D;  1Q1C A;  3FY1 A;  5D75 A;  4MTV A;  4ODN A;  1X6L A;  2DG3 A;  4Z2K A;  1WB0 A;  4Z2H A;  4IT6 A;  4U84 A;  4DIP A;  1FKJ A;  1Y0O A;  5B8I C;  4DRM A;  2UZ5 A;  3VAW A;  4WK9 A;  1F8A B;  2Q5A A;  1C9H A;  2KR7 A;  2WM0 A;  3ARR A;  1FKI A;  4TW8 A;  4ZPT R;  2FDM A;  1OGB A;  1J6Y A;  2FAP A;  1ZCN A;  1J4I A;  4MNJ A;  1HJV A;  3EY6 A;  5DF0 A;  1HJX A;  4GGQ A;  5DIV A;  4WKF A;  4TNS A;  5HW6 A;  3BXW A;  3CGM A;  4TW7 A;  1O6I A;  3UQB A;  3ARW A;  4R0X A;  2MNT A;  1JND A;  3CHE A;  4DRN A;  2IF4 A;  4MGV A;  4IPX A;  4LAY A;  3AS2 A;  4J4N A;  2XP7 A;  2MLX A;  1QPL A;  3CH9 A;  3KAG A;  3I6C A;  2IUZ A;  2MLZ A;  2XP5 A;  1RD6 A;  5DIU A;  3ARP A;  2MF9 A;  1H0I A;  5HWB A;  2VCD A;  4FAP A;  5DEZ A;  2PV2 A;  1ZBW A;  5BXJ A;  1X6N A;  2RUD A;  5DIT A;  4JYS A;  4BF8 A;  1Q6U A;  2F2D A;  3AS3 A;  1FD9 A;  4DRK A;  1HKM A;  3PA7 A;  3UI4 A;  1ZBC A;  3RME A;  4JFK A;  1FKB A;  2LKN A;  4ODK A;  1F40 A;  4MNL A;  1HJW A;  5J6E A;  2WLZ A;  2PPN A;  2OFN A;  4S3K A;  1N1A A;  2WK2 A;  3NRK A;  5HW8 A;  1LL7 A;  1TCO C;  1NWU A;  1W26 A;  1EIB A;  4PTM A;  2G8Z A;  1NWS A;  1W1P A;  4P8V A;  5HWC A;  4W9Q A;  3WQW A;  1P5Q A;  5GQB A;  3UQA A;  1HKI A;  3JYJ A;  3WD2 A;  3WD1 A;  2A3E A;  1ZBK A;  2XPB A;  1D7I A;  1LG2 A;  2DG4 A;  4MPK A;  5HKG A;  4XAK A;  1T11 A;  2XP4 A;  3RGC A;  2RQS A;  4HBO A;  1LQ0 A;  1PIN A;  1E6P A;  2K8I A;  4L72 B;  2DSZ A;  4IT4 A;  1UR9 A;  3O5O A;  3CHC A;  3WL1 A;  3PRD A;  4S3J A;  2DSV A;  3ARQ A;  4TX0 A;  5GPG A;  3ARO A;  2A3B A;  3UQI A;  2ZQT A;  4ODM A;  3O5G A;  1ZBV A;  4DWS A;  1FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...