2PV2A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
b'TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone surA
publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 29
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv2A00
4QIBA 5DIUA 1JVWA 2ITKA 2LGOA 5B8IC 2ZR4A 3O5OA 4ODNA 3H9RB 5BXJA 2PPPA 3UQAA 1J4IA 2FAPA 4G2PA 4J4NA 1D6OA 1FKLA 2RSEA 3LUOA 3O5PA 2MLZA 3TC5A 4W9OA 4R0XA 1FKTA 5HWCA 5J6EA 1J6YA 4JFIA 1JNSA 2N87A 3UQBA 2FKEA 4U85A 2MNTA 4LAVA 1Q6IA 2PBCA 4ODPA 2DG9A 1ZCNA 4N19A 4MSPA 5HTGA 3UQIA 3CGNA 2MF9A 1Q6UA 4LAYA 3JXVA 4TW6A 2XP9A 1HXVA 3KAGA 4NNRA 1F40A 3KADA 4GGQA 3GPKA 3TDBA 1KT1A 1FKSA 2K8IA 2DG3A 2XP6A 3I6CA 3KZ7A 2KI3A 3O5DA 3UI6A 2VN1A 4ODKA 4DZ2A 1EYMA 2XP4A 4U84A 2LKNA 5I98A 3O5IA 5HW6A 4IQCA 3KCEA 4JYSA 1JNTA 4DRNA 1D7HA 4ODRA 4BF8A 1TCOC 3PRBA 4U86A 2ZQUA 1FKGA 3O5QA 4TNSA 1J4RA 4ODQA 1J4HA 2RQSA 4DRMA 1Q1CA 3NTPA 1NMWA 1T11A 1U79A 3IK8A 3O5LA 3ODKA 4J4OA 4MGVA 4DRPA 4ODLA 1P5QA 1QZ2A 2ZQSA 3O5GA 1QPFA 4DROA 1EQ3A 2UZ5A 4IQ2A 4W9QA 2F2DA 2XP7A 4TW7A 1ROUA 1FKIA 2OFNA 3PA7A 2JZVA 2KR7A 1M5YA 3O5EA 5HUAA 2XP5A 1BKFA 2XPAA 1D7IA 4DRJA 3B7XA 4DRQA 3KAHA 4DRIA 2ZR5A 2ZQTA 3O5FA 1FKJA 2L2SA 1W26A 1Y0OA 2PV2A 5DITA 2M2AA 1R9HA 3IHZA 3O5JA 2LJ4A 3WH0A 4DZ3A 3UI4A 4TW8A 4C02B 2PPNA 1ROTA 2MLYA 2IF4A 2XP3A 3OOBA 4ITZA 2ZR6A 4FAPA 3UI5A 3JYJA 5HW7A 2LPVA 2M1IA 5HKGA 1FKRA 3NI6A 2VCDA 4ODMA 5HW8A 2MLXA 4TYOA 3IKDA 2F21A 2M08A 4FN2A 3RGCA 3UF8A 3TCZA 1ZK6A 2RURA 3KABA 2AWGA 2DG4A 3IKGA 3RFWA 1L1PA 2Y78A 2KFWA 1FKDA 1FKFA 4IPXA 4DIPA 3MDYB 5D75A 3VAWA 4QT3A 2RUCA 2RUQA 1D7JA 1NMVA 2XPBA 4GIVA 1FJDA 4JFKA 5DIVA 1FKHA 2ZQVA 1FKBA 3FAPA 1C9HA 3O5MA 4JFMA 2XP8A 3NRKA 3JYMA 2KGJA 1N1AA 4QT2A 1YW5A 5GPGA 1PBKA 1QPLA 4JFLA 2KO7A 5HWBA 1FAPA 1NSGA 2KE0A 1F8AB 3CGMA 4W9PA 4DH0A 4DRKA 2F4EA 1B6CA 4ODOA 2D9FA 3PRDA 1FD9A 2Q5AA 1Q6HA 1BL4A 3EY6A 4LAWA 3O5RA 2PV3A 3KAIA 4LAXA 5HT1A 1A7XA 1KT0A 4O2TA 3O5KA 1PINA 2PPOA 4DT4A 4G50A 4DRHA 2PV1A 2MPHA 1FKKA 1YATA 2RUDA 3KACA 4JFJA 3KAFA 4TX0A
chains in the Genus database with same CATH superfamily
5DIUA 1W9VA 4MTVA 3WIJA 4IT6A 1OGGA 3BXWA 4P8UA 2RSEA 3RM8A 5DF0A 1J6YA 2DSZA 3UQBA 4U85A 2MNTA 1Q6IA 2PBCA 3CGNA 1VF8A 4PTMA 3KAGA 4GGQA 2K8IA 3UI6A 2DG3A 3WD3A 2VN1A 4ODKA 4DZ2A 3O5IA 3ARTA 3KCEA 3ARQA 3G6MA 3PRBA 1ZBCA 1XHGA 3O5QA 3WD1A 1D2KA 4ODQA 3O5LA 2A3BA 4J4OA 1HKJA 4ZS6A 1X6LA 1P5QA 1QZ2A 1EQ3A 4Q7NA 2JZVA 2KR7A 2XP5A 3WQWA 1ZBWA 4DRQA 4MNJA 1IX5A 1NWSA 1W26A 4MNKA 3WD4A 1ROTA 2MLYA 4FAPA 4Z2LA 2DT2A 2M1IA 5HKGA 3AS3A 2OLHA 3RGCA 4DWSA 3AS2A 1ZU8A 1H0IA 2DG4A 3IKGA 4IPXA 4LGXA 1NMVA 1OGBA 5DIVA 1LQ0A 1FKHA 1OWQA 2ZQVA 3PRAA 2DPEA 1UR8A 4QT2A 1YW5A 1LL7A 4JFLA 2PI6A 1NSGA 4P8WA 1B6CA 4DWSB 2F23A 3GU0A 1FD9A 1TFVA 4ZPWR 3EY6A 2PV3A 2B5UB 1A7XA 5HBFA 3O5KA 4G50A 4ML4A 3ARRA 1FKKA 2WLYA 4QT3A 3AS0A 4HBEA 3ALFA 5B8IC 3UQAA 4G2PA 1NWRA 2MLZA 1FKTA 5J6EA 2G8ZA 1W1TA 1EDQA 3OA5A 3RM4A 1JCHB 4ODPA 5HTGA 3UQIA 1LG2A 4LAYA 2A3AA 2XP9A 1F40A 3KADA 1KT1A 3I6CA 3AQUA 3CHDA 1EYMA 2XP4A 2LKNA 4MPKA 1JNTA 1LG1A 1ZBVA 2G41A 1D7HA 4DRNA 3FY1A 4U86A 1FKGA 4ZPTR 1K9TA 3NTPA 4MNMA 1GPFA 3ODKA 1E6NA 4DRPA 4Q22A 2ZQSA 1QPFA 2UZ5A 4Z2GA 4KQZA 1WB0A 3PA7A 5HUAA 1FFRA 1HKMA 3B7XA 4URIA 1Y0OA 5DITA 1R9HA 3WH0A 4QZVB 4TW8A 3AS1A 3UI4A 1FFQA 3OOBA 2IF4A 4ITZA 2ZR6A 2EULA 3UI5A 5HW7A 2VCDA 4FN2A 2F21A 2M08A 3TCZA 3PR9A 3KABA 4Z2KA 1FKDA 1E9LA 3MDYB 5JH8A 2RUQA 1D7JA 2YBUA 1FJDA 3ARSA 4JFKA 3FAPA 2PN0A 3WQVA 3JYMA 1PBKA 1QPLA 1HJXA 2KO7A 1E6ZA 4P8VA 4LAXA 4Z2JA 1EIBA 4O2TA 1PINA 3W4RA 2IUZA 4DRHA 2PV1A 3B8SA 3KAFA 2RUDA 4JFJA 5I98A 3CH9A 1WNOA 3GTYX 4QIBA 1ITXA 1JVWA 1LL4A 2LGOA 1GUVA 2ZR4A 3O5OA 4ODNA 3WL1A 5BXJA 1J4IA 1H0GA 2ESCA 2FAPA 4J4NA 1D6OA 3CHFA 3TC5A 4W9OA 1NWUA 4JFIA 3QOKA 2N87A 2DG9A 1KFWA 1ZCNA 4N19A 4NSBA 2MF9A 3G6LA 4WIWA 4TW6A 1HXVA 4XAKA 4NNRA 3B9EA 3ALGA 3O5DA 1FKSA 2DT3A 3KZ7A 2YBTA 4WKHA 2DSWA 3RMEA 4KR0B 4U84A 4WKAA 5HW6A 4S3JA 3WL0A 4JYSA 4ODRA 2ZQUA 4TNSA 1CTNA 1J4HA 1ZBKA 4R5EA 2RQSA 1NMWA 1T11A 1U79A 2O92A 4MGVA 4ODLA 3O5GA 4DROA 4AY1A 4HARA 4IQ2A 4W5UA 1NWTA 2F2DA 2XP7A 3ARXA 3ARWA 4TW7A 1HKKA 1LJYA 1XRVA 1SR0A 5GQBA 1D7IA 4DRIA 3CHEA 2ZQTA 2L2SA 2PV2A 3IHZA 3O5JA 4DZ3A 1GOIA 2QF8A 1HKIA 2O9OA 2PPNA 4S3KA 4C02B 2XP3A 3JYJA 2LPVA 1FKRA 4ODMA 5HW8A 2MLXA 3UF8A 1ZK6A 2AWGA 4P8XA 3ARVA 3RFWA 1L1PA 2Y78A 2KFWA 1E6RA 5D75A 3VAWA 2RUCA 4GIVA 3AROA 1ZL1A 1W1PA 4JFMA 2XP8A 3NRKA 2KGJA 5GPGA 5HWBA 1FAPA 2KE0A 1F8AB 3CGMA 4W9PA 4DH0A 2F4EA 2DT1A 3EIPA 2D9FA 1WAWA 2Q5AA 1BL4A 4LAWA 3CZ8A 3O5RA 2DT0A 1EHNA 3KAIA 4HBOA 4ZPVR 5HT1A 1KT0A 4WJXA 2DSUA 2PPOA 4DT4A 1JNDA 2MPHA 1W9UA 2ITKA 3H9RB 2PPPA 4UDMA 2A3EA 1FKLA 1W1YA 3LUOA 3O5PA 4R0XA 5HWCA 1JNSA 1GRJA 2FKEA 4LAVA 1JNEA 3CHCA 4MSPA 1Q6UA 2WK2A 3WD2A 1W1VA 3JXVA 3GPKA 3TDBA 4L3NA 2XP6A 5GPRA 2KI3A 5DEZA 4L72B 4IQCA 3ARYA 4DWSC 4BF8A 1TCOC 3BMBA 2AOSA 1J4RA 2B31A 3WD0A 1Q1CA 4DRMA 3IK8A 1HJVA 1W9PA 4W9QA 3ARPA 1O6IA 1E6PA 1ROUA 1FKIA 2OFNA 1M5YA 3WKZA 3O5EA 1BKFA 2XPAA 4Z2IA 4DRJA 3ARUA 3KAHA 2ZR5A 3O5FA 1FKJA 4MNLA 2M2AA 3B9DA 2LJ4A 2A3CA 2ETNA 2FDMA 2DSVA 4WKFA 3NI6A 1E44A 4TYOA 3IKDA 1HJWA 2RURA 4DWSD 1FKFA 4DIPA 2WLZA 4IT4A 1E15A 1SYTA 2XPBA 1FKBA 1C9HA 4WK9A 1NH6A 3O5MA 2WM0A 1N1AA 1UR9A 4MAVA 3B9AA 4DRKA 4ODOA 4Z2HA 1RD6A 2P4VA 3PRDA 1Q6HA 5DO2A 4NZCA 1X6NA 3RM9A 1ZB5A 3ARZA 1YATA 3FXYA 3KACA 1LL6A 4TX0A
chains in the Genus database with same CATH topology
5DIUA 1W9VA 4MTVA 3WIJA 4IT6A 1OGGA 3BXWA 4P8UA 2RSEA 3RM8A 5DF0A 1J6YA 2DSZA 3UQBA 4U85A 2MNTA 1Q6IA 2PBCA 3CGNA 1VF8A 4PTMA 3KAGA 4GGQA 2K8IA 3UI6A 2DG3A 3WD3A 2VN1A 4ODKA 4DZ2A 3O5IA 3ARTA 3KCEA 3ARQA 3G6MA 3PRBA 1ZBCA 1XHGA 3O5QA 3WD1A 1D2KA 4ODQA 3O5LA 2A3BA 4J4OA 1HKJA 4ZS6A 1X6LA 1P5QA 1QZ2A 1EQ3A 4Q7NA 2JZVA 2KR7A 2XP5A 3WQWA 1ZBWA 4DRQA 4MNJA 1IX5A 1NWSA 1W26A 4MNKA 3WD4A 1ROTA 2MLYA 4FAPA 4Z2LA 2DT2A 2M1IA 5HKGA 3AS3A 2OLHA 3RGCA 4DWSA 3AS2A 1ZU8A 1H0IA 2DG4A 3IKGA 4IPXA 4LGXA 1NMVA 1OGBA 5DIVA 1LQ0A 1FKHA 1OWQA 2ZQVA 3PRAA 2DPEA 1UR8A 4QT2A 1YW5A 1LL7A 4JFLA 2PI6A 1NSGA 4P8WA 1B6CA 4DWSB 1FD9A 1TFVA 4ZPWR 3EY6A 2PV3A 1A7XA 5HBFA 3O5KA 4G50A 4ML4A 3ARRA 1FKKA 2WLYA 4QT3A 3AS0A 4HBEA 3ALFA 5B8IC 3UQAA 4G2PA 1NWRA 2MLZA 1FKTA 5J6EA 2G8ZA 1W1TA 1EDQA 3OA5A 3RM4A 4ODPA 5HTGA 3UQIA 1LG2A 4LAYA 2A3AA 2XP9A 1F40A 3KADA 1KT1A 3I6CA 3AQUA 3CHDA 1EYMA 2XP4A 2LKNA 4MPKA 1JNTA 1LG1A 1ZBVA 2G41A 1D7HA 4DRNA 3FY1A 4U86A 1FKGA 4ZPTR 1K9TA 3NTPA 4MNMA 1GPFA 3ODKA 1E6NA 4DRPA 4Q22A 2ZQSA 1QPFA 2UZ5A 4Z2GA 4KQZA 1WB0A 3PA7A 5HUAA 1FFRA 1HKMA 3B7XA 4URIA 1Y0OA 5DITA 1R9HA 3WH0A 4QZVB 4TW8A 3AS1A 3UI4A 1FFQA 3OOBA 2IF4A 4ITZA 2ZR6A 3UI5A 5HW7A 2VCDA 4FN2A 2F21A 2M08A 3TCZA 3PR9A 3KABA 4Z2KA 1FKDA 1E9LA 3MDYB 5JH8A 2RUQA 1D7JA 2YBUA 1FJDA 3ARSA 4JFKA 3FAPA 3WQVA 3JYMA 1PBKA 1QPLA 1HJXA 2KO7A 1E6ZA 4P8VA 4LAXA 4Z2JA 1EIBA 4O2TA 1PINA 3W4RA 2IUZA 4DRHA 2PV1A 3B8SA 3KAFA 2RUDA 4JFJA 5I98A 3CH9A 1WNOA 4QIBA 1ITXA 1JVWA 1LL4A 2LGOA 1GUVA 2ZR4A 3O5OA 4ODNA 3WL1A 5BXJA 1J4IA 1H0GA 2ESCA 2FAPA 4J4NA 1D6OA 3CHFA 3TC5A 4W9OA 1NWUA 4JFIA 3QOKA 2N87A 2DG9A 1KFWA 1ZCNA 4N19A 4NSBA 2MF9A 3G6LA 4WIWA 4TW6A 1HXVA 4XAKA 4NNRA 3B9EA 3ALGA 3O5DA 1FKSA 2DT3A 3KZ7A 2YBTA 4WKHA 2DSWA 3RMEA 4KR0B 4U84A 4WKAA 5HW6A 4S3JA 3WL0A 4JYSA 4ODRA 2ZQUA 4TNSA 1CTNA 1J4HA 1ZBKA 4R5EA 2RQSA 1NMWA 1T11A 1U79A 2O92A 4MGVA 4ODLA 3O5GA 4DROA 4AY1A 4HARA 4IQ2A 4W5UA 1NWTA 2F2DA 2XP7A 3ARXA 3ARWA 4TW7A 1HKKA 1LJYA 1XRVA 1SR0A 5GQBA 1D7IA 4DRIA 3CHEA 2ZQTA 2L2SA 2PV2A 3IHZA 3O5JA 4DZ3A 1GOIA 2QF8A 1HKIA 2O9OA 2PPNA 4S3KA 4C02B 2XP3A 3JYJA 2LPVA 1FKRA 4ODMA 5HW8A 2MLXA 3UF8A 1ZK6A 2AWGA 4P8XA 3ARVA 3RFWA 1L1PA 2Y78A 2KFWA 1E6RA 5D75A 3VAWA 2RUCA 4GIVA 3AROA 1ZL1A 1W1PA 4JFMA 2XP8A 3NRKA 2KGJA 5GPGA 5HWBA 1FAPA 2KE0A 1F8AB 3CGMA 4W9PA 4DH0A 2F4EA 2DT1A 2D9FA 1WAWA 2Q5AA 1BL4A 4LAWA 3CZ8A 3O5RA 2DT0A 1EHNA 3KAIA 4HBOA 4ZPVR 5HT1A 1KT0A 4WJXA 2DSUA 2PPOA 4DT4A 1JNDA 2MPHA 1W9UA 2ITKA 3H9RB 2PPPA 2A3EA 1FKLA 1W1YA 3LUOA 3O5PA 4R0XA 5HWCA 1JNSA 2FKEA 4LAVA 1JNEA 3CHCA 4MSPA 1Q6UA 2WK2A 3WD2A 1W1VA 3JXVA 3GPKA 3TDBA 4L3NA 2XP6A 5GPRA 2KI3A 5DEZA 4L72B 4IQCA 3ARYA 4DWSC 4BF8A 1TCOC 2AOSA 1J4RA 2B31A 3WD0A 1Q1CA 4DRMA 3IK8A 1HJVA 1W9PA 4W9QA 3ARPA 1O6IA 1E6PA 1ROUA 1FKIA 2OFNA 1M5YA 3WKZA 3O5EA 1BKFA 2XPAA 4Z2IA 4DRJA 3ARUA 3KAHA 2ZR5A 3O5FA 1FKJA 4MNLA 2M2AA 3B9DA 2LJ4A 2A3CA 2FDMA 2DSVA 4WKFA 3NI6A 4TYOA 3IKDA 1HJWA 2RURA 4DWSD 1FKFA 4DIPA 2WLZA 4IT4A 1E15A 1SYTA 2XPBA 1FKBA 1C9HA 4WK9A 1NH6A 3O5MA 2WM0A 1N1AA 1UR9A 4MAVA 3B9AA 4DRKA 4ODOA 4Z2HA 1RD6A 3PRDA 1Q6HA 5DO2A 4NZCA 1X6NA 3RM9A 1ZB5A 3ARZA 1YATA 3FXYA 3KACA 1LL6A 4TX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIB A;  5DIU A;  1JVW A;  2ITK A;  2LGO A;  5B8I C;  2ZR4 A;  3O5O A;  4ODN A;  3H9R B;  5BXJ A;  2PPP A;  3UQA A;  1J4I A;  2FAP A;  4G2P A;  4J4N A;  1D6O A;  1FKL A;  2RSE A;  3LUO A;  3O5P A;  2MLZ A;  3TC5 A;  4W9O A;  4R0X A;  1FKT A;  5HWC A;  5J6E A;  1J6Y A;  4JFI A;  1JNS A;  2N87 A;  3UQB A;  2FKE A;  4U85 A;  2MNT A;  4LAV A;  1Q6I A;  2PBC A;  4ODP A;  2DG9 A;  1ZCN A;  4N19 A;  4MSP A;  5HTG A;  3UQI A;  3CGN A;  2MF9 A;  1Q6U A;  4LAY A;  3JXV A;  4TW6 A;  2XP9 A;  1HXV A;  3KAG A;  4NNR A;  1F40 A;  3KAD A;  4GGQ A;  3GPK A;  3TDB A;  1KT1 A;  1FKS A;  2K8I A;  2DG3 A;  2XP6 A;  3I6C A;  3KZ7 A;  2KI3 A;  3O5D A;  3UI6 A;  2VN1 A;  4ODK A;  4DZ2 A;  1EYM A;  2XP4 A;  4U84 A;  2LKN A;  5I98 A;  3O5I A;  5HW6 A;  4IQC A;  3KCE A;  4JYS A;  1JNT A;  4DRN A;  1D7H A;  4ODR A;  4BF8 A;  1TCO C;  3PRB A;  4U86 A;  2ZQU A;  1FKG A;  3O5Q A;  4TNS A;  1J4R A;  4ODQ A;  1J4H A;  2RQS A;  4DRM A;  1Q1C A;  3NTP A;  1NMW A;  1T11 A;  1U79 A;  3IK8 A;  3O5L A;  3ODK A;  4J4O A;  4MGV A;  4DRP A;  4ODL A;  1P5Q A;  1QZ2 A;  2ZQS A;  3O5G A;  1QPF A;  4DRO A;  1EQ3 A;  2UZ5 A;  4IQ2 A;  4W9Q A;  2F2D A;  2XP7 A;  4TW7 A;  1ROU A;  1FKI A;  2OFN A;  3PA7 A;  2JZV A;  2KR7 A;  1M5Y A;  3O5E A;  5HUA A;  2XP5 A;  1BKF A;  2XPA A;  1D7I A;  4DRJ A;  3B7X A;  4DRQ A;  3KAH A;  4DRI A;  2ZR5 A;  2ZQT A;  3O5F A;  1FKJ A;  2L2S A;  1W26 A;  1Y0O A;  2PV2 A;  5DIT A;  2M2A A;  1R9H A;  3IHZ A;  3O5J A;  2LJ4 A;  3WH0 A;  4DZ3 A;  3UI4 A;  4TW8 A;  4C02 B;  2PPN A;  1ROT A;  2MLY A;  2IF4 A;  2XP3 A;  3OOB A;  4ITZ A;  2ZR6 A;  4FAP A;  3UI5 A;  3JYJ A;  5HW7 A;  2LPV A;  2M1I A;  5HKG A;  1FKR A;  3NI6 A;  2VCD A;  4ODM A;  5HW8 A;  2MLX A;  4TYO A;  3IKD A;  2F21 A;  2M08 A;  4FN2 A;  3RGC A;  3UF8 A;  3TCZ A;  1ZK6 A;  2RUR A;  3KAB A;  2AWG A;  2DG4 A;  3IKG A;  3RFW A;  1L1P A;  2Y78 A;  2KFW A;  1FKD A;  1FKF A;  4IPX A;  4DIP A;  3MDY B;  5D75 A;  3VAW A;  4QT3 A;  2RUC A;  2RUQ A;  1D7J A;  1NMV A;  2XPB A;  4GIV A;  1FJD A;  4JFK A;  5DIV A;  1FKH A;  2ZQV A;  1FKB A;  3FAP A;  1C9H A;  3O5M A;  4JFM A;  2XP8 A;  3NRK A;  3JYM A;  2KGJ A;  1N1A A;  4QT2 A;  1YW5 A;  5GPG A;  1PBK A;  1QPL A;  4JFL A;  2KO7 A;  5HWB A;  1FAP A;  1NSG A;  2KE0 A;  1F8A B;  3CGM A;  4W9P A;  4DH0 A;  4DRK A;  2F4E A;  1B6C A;  4ODO A;  2D9F A;  3PRD A;  1FD9 A;  2Q5A A;  1Q6H A;  1BL4 A;  3EY6 A;  4LAW A;  3O5R A;  2PV3 A;  3KAI A;  4LAX A;  5HT1 A;  1A7X A;  1KT0 A;  4O2T A;  3O5K A;  1PIN A;  2PPO A;  4DT4 A;  4G50 A;  4DRH A;  2PV1 A;  2MPH A;  1FKK A;  1YAT A;  2RUD A;  3KAC A;  4JFJ A;  3KAF A;  4TX0 A; 
#chains in the Genus database with same CATH topology
 5DIU A;  1W9V A;  4MTV A;  3WIJ A;  4IT6 A;  1OGG A;  3BXW A;  4P8U A;  2RSE A;  3RM8 A;  5DF0 A;  1J6Y A;  2DSZ A;  3UQB A;  4U85 A;  2MNT A;  1Q6I A;  2PBC A;  3CGN A;  1VF8 A;  4PTM A;  3KAG A;  4GGQ A;  2K8I A;  3UI6 A;  2DG3 A;  3WD3 A;  2VN1 A;  4ODK A;  4DZ2 A;  3O5I A;  3ART A;  3KCE A;  3ARQ A;  3G6M A;  3PRB A;  1ZBC A;  1XHG A;  3O5Q A;  3WD1 A;  1D2K A;  4ODQ A;  3O5L A;  2A3B A;  4J4O A;  1HKJ A;  4ZS6 A;  1X6L A;  1P5Q A;  1QZ2 A;  1EQ3 A;  4Q7N A;  2JZV A;  2KR7 A;  2XP5 A;  3WQW A;  1ZBW A;  4DRQ A;  4MNJ A;  1IX5 A;  1NWS A;  1W26 A;  4MNK A;  3WD4 A;  1ROT A;  2MLY A;  4FAP A;  4Z2L A;  2DT2 A;  2M1I A;  5HKG A;  3AS3 A;  2OLH A;  3RGC A;  4DWS A;  3AS2 A;  1ZU8 A;  1H0I A;  2DG4 A;  3IKG A;  4IPX A;  4LGX A;  1NMV A;  1OGB A;  5DIV A;  1LQ0 A;  1FKH A;  1OWQ A;  2ZQV A;  3PRA A;  2DPE A;  1UR8 A;  4QT2 A;  1YW5 A;  1LL7 A;  4JFL A;  2PI6 A;  1NSG A;  4P8W A;  1B6C A;  4DWS B;  2F23 A;  3GU0 A;  1FD9 A;  1TFV A;  4ZPW R;  3EY6 A;  2PV3 A;  2B5U B;  1A7X A;  5HBF A;  3O5K A;  4G50 A;  4ML4 A;  3ARR A;  1FKK A;  2WLY A;  4QT3 A;  3AS0 A;  4HBE A;  3ALF A;  5B8I C;  3UQA A;  4G2P A;  1NWR A;  2MLZ A;  1FKT A;  5J6E A;  2G8Z A;  1W1T A;  1EDQ A;  3OA5 A;  3RM4 A;  1JCH B;  4ODP A;  5HTG A;  3UQI A;  1LG2 A;  4LAY A;  2A3A A;  2XP9 A;  1F40 A;  3KAD A;  1KT1 A;  3I6C A;  3AQU A;  3CHD A;  1EYM A;  2XP4 A;  2LKN A;  4MPK A;  1JNT A;  1LG1 A;  1ZBV A;  2G41 A;  1D7H A;  4DRN A;  3FY1 A;  4U86 A;  1FKG A;  4ZPT R;  1K9T A;  3NTP A;  4MNM A;  1GPF A;  3ODK A;  1E6N A;  4DRP A;  4Q22 A;  2ZQS A;  1QPF A;  2UZ5 A;  4Z2G A;  4KQZ A;  1WB0 A;  3PA7 A;  5HUA A;  1FFR A;  1HKM A;  3B7X A;  4URI A;  1Y0O A;  5DIT A;  1R9H A;  3WH0 A;  4QZV B;  4TW8 A;  3AS1 A;  3UI4 A;  1FFQ A;  3OOB A;  2IF4 A;  4ITZ A;  2ZR6 A;  2EUL A;  3UI5 A;  5HW7 A;  2VCD A;  4FN2 A;  2F21 A;  2M08 A;  3TCZ A;  3PR9 A;  3KAB A;  4Z2K A;  1FKD A;  1E9L A;  3MDY B;  5JH8 A;  2RUQ A;  1D7J A;  2YBU A;  1FJD A;  3ARS A;  4JFK A;  3FAP A;  2PN0 A;  3WQV A;  3JYM A;  1PBK A;  1QPL A;  1HJX A;  2KO7 A;  1E6Z A;  4P8V A;  4LAX A;  4Z2J A;  1EIB A;  4O2T A;  1PIN A;  3W4R A;  2IUZ A;  4DRH A;  2PV1 A;  3B8S A;  3KAF A;  2RUD A;  4JFJ A;  5I98 A;  3CH9 A;  1WNO A;  3GTY X;  4QIB A;  1ITX A;  1JVW A;  1LL4 A;  2LGO A;  1GUV A;  2ZR4 A;  3O5O A;  4ODN A;  3WL1 A;  5BXJ A;  1J4I A;  1H0G A;  2ESC A;  2FAP A;  4J4N A;  1D6O A;  3CHF A;  3TC5 A;  4W9O A;  1NWU A;  4JFI A;  3QOK A;  2N87 A;  2DG9 A;  1KFW A;  1ZCN A;  4N19 A;  4NSB A;  2MF9 A;  3G6L A;  4WIW A;  4TW6 A;  1HXV A;  4XAK A;  4NNR A;  3B9E A;  3ALG A;  3O5D A;  1FKS A;  2DT3 A;  3KZ7 A;  2YBT A;  4WKH A;  2DSW A;  3RME A;  4KR0 B;  4U84 A;  4WKA A;  5HW6 A;  4S3J A;  3WL0 A;  4JYS A;  4ODR A;  2ZQU A;  4TNS A;  1CTN A;  1J4H A;  1ZBK A;  4R5E A;  2RQS A;  1NMW A;  1T11 A;  1U79 A;  2O92 A;  4MGV A;  4ODL A;  3O5G A;  4DRO A;  4AY1 A;  4HAR A;  4IQ2 A;  4W5U A;  1NWT A;  2F2D A;  2XP7 A;  3ARX A;  3ARW A;  4TW7 A;  1HKK A;  1LJY A;  1XRV A;  1SR0 A;  5GQB A;  1D7I A;  4DRI A;  3CHE A;  2ZQT A;  2L2S A;  2PV2 A;  3IHZ A;  3O5J A;  4DZ3 A;  1GOI A;  2QF8 A;  1HKI A;  2O9O A;  2PPN A;  4S3K A;  4C02 B;  2XP3 A;  3JYJ A;  2LPV A;  1FKR A;  4ODM A;  5HW8 A;  2MLX A;  3UF8 A;  1ZK6 A;  2AWG A;  4P8X A;  3ARV A;  3RFW A;  1L1P A;  2Y78 A;  2KFW A;  1E6R A;  5D75 A;  3VAW A;  2RUC A;  4GIV A;  3ARO A;  1ZL1 A;  1W1P A;  4JFM A;  2XP8 A;  3NRK A;  2KGJ A;  5GPG A;  5HWB A;  1FAP A;  2KE0 A;  1F8A B;  3CGM A;  4W9P A;  4DH0 A;  2F4E A;  2DT1 A;  3EIP A;  2D9F A;  1WAW A;  2Q5A A;  1BL4 A;  4LAW A;  3CZ8 A;  3O5R A;  2DT0 A;  1EHN A;  3KAI A;  4HBO A;  4ZPV R;  5HT1 A;  1KT0 A;  4WJX A;  2DSU A;  2PPO A;  4DT4 A;  1JND A;  2MPH A;  1W9U A;  2ITK A;  3H9R B;  2PPP A;  4UDM A;  2A3E A;  1FKL A;  1W1Y A;  3LUO A;  3O5P A;  4R0X A;  5HWC A;  1JNS A;  1GRJ A;  2FKE A;  4LAV A;  1JNE A;  3CHC A;  4MSP A;  1Q6U A;  2WK2 A;  3WD2 A;  1W1V A;  3JXV A;  3GPK A;  3TDB A;  4L3N A;  2XP6 A;  5GPR A;  2KI3 A;  5DEZ A;  4L72 B;  4IQC A;  3ARY A;  4DWS C;  4BF8 A;  1TCO C;  3BMB A;  2AOS A;  1J4R A;  2B31 A;  3WD0 A;  1Q1C A;  4DRM A;  3IK8 A;  1HJV A;  1W9P A;  4W9Q A;  3ARP A;  1O6I A;  1E6P A;  1ROU A;  1FKI A;  2OFN A;  1M5Y A;  3WKZ A;  3O5E A;  1BKF A;  2XPA A;  4Z2I A;  4DRJ A;  3ARU A;  3KAH A;  2ZR5 A;  3O5F A;  1FKJ A;  4MNL A;  2M2A A;  3B9D A;  2LJ4 A;  2A3C A;  2ETN A;  2FDM A;  2DSV A;  4WKF A;  3NI6 A;  1E44 A;  4TYO A;  3IKD A;  1HJW A;  2RUR A;  4DWS D;  1FKF A;  4DIP A;  2WLZ A;  4IT4 A;  1E15 A;  1SYT A;  2XPB A;  1FKB A;  1C9H A;  4WK9 A;  1NH6 A;  3O5M A;  2WM0 A;  1N1A A;  1UR9 A;  4MAV A;  3B9A A;  4DRK A;  4ODO A;  4Z2H A;  1RD6 A;  2P4V A;  3PRD A;  1Q6H A;  5DO2 A;  4NZC A;  1X6N A;  3RM9 A;  1ZB5 A;  3ARZ A;  1YAT A;  3FXY A;  3KAC A;  1LL6 A;  4TX0 A; 
#chains in the Genus database with same CATH homology
 5DIU A;  1W9V A;  4MTV A;  3WIJ A;  4IT6 A;  1OGG A;  3BXW A;  4P8U A;  2RSE A;  3RM8 A;  5DF0 A;  1J6Y A;  2DSZ A;  3UQB A;  4U85 A;  2MNT A;  1Q6I A;  2PBC A;  3CGN A;  1VF8 A;  4PTM A;  3KAG A;  4GGQ A;  2K8I A;  3UI6 A;  2DG3 A;  3WD3 A;  2VN1 A;  4ODK A;  4DZ2 A;  3O5I A;  3ART A;  3KCE A;  3ARQ A;  3G6M A;  3PRB A;  1ZBC A;  1XHG A;  3O5Q A;  3WD1 A;  1D2K A;  4ODQ A;  3O5L A;  2A3B A;  4J4O A;  1HKJ A;  4ZS6 A;  1X6L A;  1P5Q A;  1QZ2 A;  1EQ3 A;  4Q7N A;  2JZV A;  2KR7 A;  2XP5 A;  3WQW A;  1ZBW A;  4DRQ A;  4MNJ A;  1IX5 A;  1NWS A;  1W26 A;  4MNK A;  3WD4 A;  1ROT A;  2MLY A;  4FAP A;  4Z2L A;  2DT2 A;  2M1I A;  5HKG A;  3AS3 A;  2OLH A;  3RGC A;  4DWS A;  3AS2 A;  1ZU8 A;  1H0I A;  2DG4 A;  3IKG A;  4IPX A;  4LGX A;  1NMV A;  1OGB A;  5DIV A;  1LQ0 A;  1FKH A;  1OWQ A;  2ZQV A;  3PRA A;  2DPE A;  1UR8 A;  4QT2 A;  1YW5 A;  1LL7 A;  4JFL A;  2PI6 A;  1NSG A;  4P8W A;  1B6C A;  4DWS B;  1FD9 A;  1TFV A;  4ZPW R;  3EY6 A;  2PV3 A;  1A7X A;  5HBF A;  3O5K A;  4G50 A;  4ML4 A;  3ARR A;  1FKK A;  2WLY A;  4QT3 A;  3AS0 A;  4HBE A;  3ALF A;  5B8I C;  3UQA A;  4G2P A;  1NWR A;  2MLZ A;  1FKT A;  5J6E A;  2G8Z A;  1W1T A;  1EDQ A;  3OA5 A;  3RM4 A;  4ODP A;  5HTG A;  3UQI A;  1LG2 A;  4LAY A;  2A3A A;  2XP9 A;  1F40 A;  3KAD A;  1KT1 A;  3I6C A;  3AQU A;  3CHD A;  1EYM A;  2XP4 A;  2LKN A;  4MPK A;  1JNT A;  1LG1 A;  1ZBV A;  2G41 A;  1D7H A;  4DRN A;  3FY1 A;  4U86 A;  1FKG A;  4ZPT R;  1K9T A;  3NTP A;  4MNM A;  1GPF A;  3ODK A;  1E6N A;  4DRP A;  4Q22 A;  2ZQS A;  1QPF A;  2UZ5 A;  4Z2G A;  4KQZ A;  1WB0 A;  3PA7 A;  5HUA A;  1FFR A;  1HKM A;  3B7X A;  4URI A;  1Y0O A;  5DIT A;  1R9H A;  3WH0 A;  4QZV B;  4TW8 A;  3AS1 A;  3UI4 A;  1FFQ A;  3OOB A;  2IF4 A;  4ITZ A;  2ZR6 A;  3UI5 A;  5HW7 A;  2VCD A;  4FN2 A;  2F21 A;  2M08 A;  3TCZ A;  3PR9 A;  3KAB A;  4Z2K A;  1FKD A;  1E9L A;  3MDY B;  5JH8 A;  2RUQ A;  1D7J A;  2YBU A;  1FJD A;  3ARS A;  4JFK A;  3FAP A;  3WQV A;  3JYM A;  1PBK A;  1QPL A;  1HJX A;  2KO7 A;  1E6Z A;  4P8V A;  4LAX A;  4Z2J A;  1EIB A;  4O2T A;  1PIN A;  3W4R A;  2IUZ A;  4DRH A;  2PV1 A;  3B8S A;  3KAF A;  2RUD A;  4JFJ A;  5I98 A;  3CH9 A;  1WNO A;  4QIB A;  1ITX A;  1JVW A;  1LL4 A;  2LGO A;  1GUV A;  2ZR4 A;  3O5O A;  4ODN A;  3WL1 A;  5BXJ A;  1J4I A;  1H0G A;  2ESC A;  2FAP A;  4J4N A;  1D6O A;  3CHF A;  3TC5 A;  4W9O A;  1NWU A;  4JFI A;  3QOK A;  2N87 A;  2DG9 A;  1KFW A;  1ZCN A;  4N19 A;  4NSB A;  2MF9 A;  3G6L A;  4WIW A;  4TW6 A;  1HXV A;  4XAK A;  4NNR A;  3B9E A;  3ALG A;  3O5D A;  1FKS A;  2DT3 A;  3KZ7 A;  2YBT A;  4WKH A;  2DSW A;  3RME A;  4KR0 B;  4U84 A;  4WKA A;  5HW6 A;  4S3J A;  3WL0 A;  4JYS A;  4ODR A;  2ZQU A;  4TNS A;  1CTN A;  1J4H A;  1ZBK A;  4R5E A;  2RQS A;  1NMW A;  1T11 A;  1U79 A;  2O92 A;  4MGV A;  4ODL A;  3O5G A;  4DRO A;  4AY1 A;  4HAR A;  4IQ2 A;  4W5U A;  1NWT A;  2F2D A;  2XP7 A;  3ARX A;  3ARW A;  4TW7 A;  1HKK A;  1LJY A;  1XRV A;  1SR0 A;  5GQB A;  1D7I A;  4DRI A;  3CHE A;  2ZQT A;  2L2S A;  2PV2 A;  3IHZ A;  3O5J A;  4DZ3 A;  1GOI A;  2QF8 A;  1HKI A;  2O9O A;  2PPN A;  4S3K A;  4C02 B;  2XP3 A;  3JYJ A;  2LPV A;  1FKR A;  4ODM A;  5HW8 A;  2MLX A;  3UF8 A;  1ZK6 A;  2AWG A;  4P8X A;  3ARV A;  3RFW A;  1L1P A;  2Y78 A;  2KFW A;  1E6R A;  5D75 A;  3VAW A;  2RUC A;  4GIV A;  3ARO A;  1ZL1 A;  1W1P A;  4JFM A;  2XP8 A;  3NRK A;  2KGJ A;  5GPG A;  5HWB A;  1FAP A;  2KE0 A;  1F8A B;  3CGM A;  4W9P A;  4DH0 A;  2F4E A;  2DT1 A;  2D9F A;  1WAW A;  2Q5A A;  1BL4 A;  4LAW A;  3CZ8 A;  3O5R A;  2DT0 A;  1EHN A;  3KAI A;  4HBO A;  4ZPV R;  5HT1 A;  1KT0 A;  4WJX A;  2DSU A;  2PPO A;  4DT4 A;  1JND A;  2MPH A;  1W9U A;  2ITK A;  3H9R B;  2PPP A;  2A3E A;  1FKL A;  1W1Y A;  3LUO A;  3O5P A;  4R0X A;  5HWC A;  1JNS A;  2FKE A;  4LAV A;  1JNE A;  3CHC A;  4MSP A;  1Q6U A;  2WK2 A;  3WD2 A;  1W1V A;  3JXV A;  3GPK A;  3TDB A;  4L3N A;  2XP6 A;  5GPR A;  2KI3 A;  5DEZ A;  4L72 B;  4IQC A;  3ARY A;  4DWS C;  4BF8 A;  1TCO C;  2AOS A;  1J4R A;  2B31 A;  3WD0 A;  1Q1C A;  4DRM A;  3IK8 A;  1HJV A;  1W9P A;  4W9Q A;  3ARP A;  1O6I A;  1E6P A;  1ROU A;  1FKI A;  2OFN A;  1M5Y A;  3WKZ A;  3O5E A;  1BKF A;  2XPA A;  4Z2I A;  4DRJ A;  3ARU A;  3KAH A;  2ZR5 A;  3O5F A;  1FKJ A;  4MNL A;  2M2A A;  3B9D A;  2LJ4 A;  2A3C A;  2FDM A;  2DSV A;  4WKF A;  3NI6 A;  4TYO A;  3IKD A;  1HJW A;  2RUR A;  4DWS D;  1FKF A;  4DIP A;  2WLZ A;  4IT4 A;  1E15 A;  1SYT A;  2XPB A;  1FKB A;  1C9H A;  4WK9 A;  1NH6 A;  3O5M A;  2WM0 A;  1N1A A;  1UR9 A;  4MAV A;  3B9A A;  4DRK A;  4ODO A;  4Z2H A;  1RD6 A;  3PRD A;  1Q6H A;  5DO2 A;  4NZC A;  1X6N A;  3RM9 A;  1ZB5 A;  3ARZ A;  1YAT A;  3FXY A;  3KAC A;  1LL6 A;  4TX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...