2PV2A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone surA
publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 29
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv2A00
1F40A 1FKIA 1J4RA 4JFIA 1FKGA 2PPOA 1FKHA 2XPBA 4ODRA 4DIPA 3KAFA 2RUDA 4TNSA 3EY6A 2F4EA 2MNTA 2DG3A 2MLZA 2MPHA 4O2TA 5HWCA 1FKLA 1C9HA 3UI4A 2M1IA 3IKDA 4DRNA 1EQ3A 4FN2A 4DZ3A 2KR7A 3NI6A 2F2DA 1HXVA 1ZK6A 3TCZA 5HUAA 1D7JA 1FKTA 1KT0A 4IPXA 1FD9A 2XPAA 3O5PA 3NRKA 4JYSA 4LAYA 1JNSA 4ODQA 3KCEA 2FAPA 1P5QA 2RUCA 4QT2A 3FAPA 3KADA 2PV2A 2VCDA 2AWGA 2KI3A 4U85A 2Q5AA 4IQCA 5HTGA 2PPPA 1Y0OA 2ZR6A 4C02B 3O5MA 1N1AA 3PRBA 4QIBA 2LGOA 1D7IA 3CGNA 4R0XA 3RFWA 2LKNA 1Q6IA 2XP3A 5DIUA 3JYMA 5BXJA 4ODMA 5HW6A 1PBKA 3IKGA 1T11A 1L1PA 4TYOA 1J6YA 3JYJA 4G50A 4ODLA 4U84A 2K8IA 4W9QA 2ZQSA 2DG9A 2MLYA 3KACA 3TC5A 3O5IA 4GGQA 2ZQTA 2IF4A 5HWBA 4TX0A 5D75A 4W9OA 1FKJA 1FKFA 2M08A 3PRDA 3PA7A 4TW8A 2MF9A 4DRKA 4DRMA 1D7HA 2ITKA 2VN1A 1ZCNA 3WH0A 2FKEA 3NTPA 4DRJA 2RQSA 1FKRA 1W26A 1Q6HA 2ZR4A 2XP6A 3UF8A 3O5JA 4MSPA 1Q1CA 2PBCA 2M2AA 1B6CA 1J4IA 2XP7A 4W9PA 3UI5A 3UQAA 3ODKA 4J4OA 3O5LA 3H9RB 4GIVA 5DITA 3VAWA 4N19A 5I98A 4IQ2A 2JZVA 2ZR5A 2PPNA 1BL4A 3KAGA 4NNRA 4DRHA 2XP8A 4J4NA 4JFKA 5J6EA 5GPGA 1FKBA 3MDYB 1JNTA 1ROUA 2KO7A 2MLXA 3IHZA 3O5EA 1YATA 4DZ2A 2L2SA 1U79A 2N87A 4LAWA 2PV3A 3UQIA 3LUOA 1EYMA 4MGVA 3JXVA 4DT4A 1M5YA 4DROA 1BKFA 1NMWA 4BF8A 4DRQA 4ODOA 5B8IC 2DG4A 1QZ2A 4JFMA 4QT3A 2XP9A 3RGCA 4DH0A 4FAPA 3TDBA 1J4HA 2KGJA 4LAXA 4DRIA 1FKKA 2PV1A 1D6OA 2OFNA 1NMVA 5HW8A 2LPVA 1FKSA 1QPLA 2RURA 3IK8A 2KE0A 3O5QA 4ODKA 4TW7A 3KZ7A 1FJDA 4JFLA 1Q6UA 3I6CA 5HW7A 1F8AB 1NSGA 2RUQA 1QPFA 2UZ5A 1KT1A 3KABA 4ODNA 1JVWA 5DIVA 2ZQUA 4LAVA 4ODPA 4TW6A 4U86A 5HKGA 3O5DA 3KAIA 1FAPA 3B7XA 3OOBA 4DRPA 3UI6A 2ZQVA 2RSEA 3O5RA 3GPKA 4JFJA 1R9HA 2KFWA 4ITZA 2F21A 3O5KA 3O5GA 4G2PA 1YW5A 1ROTA 1FKDA 3O5OA 1PINA 2XP5A 1TCOC 3KAHA 3O5FA 3UQBA 2LJ4A 3CGMA 2XP4A 5HT1A 2D9FA 2Y78A 1A7XA
chains in the Genus database with same CATH superfamily
3RM9A 2YBUA 4JFIA 2PPOA 4WKHA 1FKHA 4WKAA 3AS1A 2RUDA 3B9EA 3EY6A 4TNSA 3WKZA 3CH9A 1LG1A 3UI4A 4Q22A 4FN2A 2KR7A 2F2DA 1HXVA 1ZK6A 1FKTA 3AQUA 2FAPA 4QT2A 2DSUA 4L3NA 5DF0A 2VCDA 2Q5AA 4P8VA 1LG2A 1WB0A 3AS3A 4MNLA 2PPPA 4R0XA 1Q6IA 5DIUA 4P8UA 3WL0A 4G50A 1D2KA 2K8IA 4Z2IA 3TC5A 2IF4A 4TX0A 5GPRA 4WK9A 4W9OA 1FKJA 1GUVA 2M08A 3PRDA 1IX5A 2MF9A 4DRJA 3NTPA 1FKRA 4MSPA 3EIPA 1GOIA 4Z2KA 1X6NA 1JNDA 3ALFA 4KQZA 4MTVA 4S3JA 3O5LA 4GIVA 2DPEA 5I98A 1BL4A 3KAGA 4DRHA 3PR9A 4P8XA 2KO7A 3GTYX 2A3EA 4HARA 1ZBVA 4LAWA 1FFQA 1EDQA 1ZBKA 3WIJA 2PI6A 1BKFA 1EIBA 3WD1A 1NMWA 4DRQA 3FY1A 3ARYA 1HKKA 2KGJA 1SR0A 2OFNA 1NMVA 3GU0A 2WM0A 3WQVA 3AS0A 4S3KA 3IK8A 1H0GA 3O5QA 4TW7A 4DWSD 1FJDA 5HW7A 1E6RA 4MPKA 1NSGA 2UZ5A 3KABA 1ZBCA 4ODNA 5DIVA 4TW6A 1H0IA 4Z2LA 3B7XA 3ARXA 3UI6A 2ZQVA 2RSEA 1LL6A 3O5RA 1ROTA 1FKDA 3O5FA 1TCOC 3CGMA 2XP4A 3RMEA 1NWUA 4DIPA 1HJVA 2F4EA 2DG3A 5DEZA 2MPHA 4Z2HA 1C9HA 1EQ3A 1TFVA 4DZ3A 1HKMA 3WD2A 3WD4A 1KT0A 3B9DA 4JYSA 3ARVA 3FXYA 4ZPWR 3OA5A 1Y0OA 5JH8A 4C02B 3O5MA 4W5UA 2LGOA 3CGNA 2XP3A 4QZVB 4ODMA 5HW6A 1L1PA 1J6YA 3JYJA 4U84A 2ZQSA 2MLYA 1HKJA 1W9VA 1LQ0A 4DWSC 2DT1A 3CZ8A 4TW8A 1ZCNA 2FKEA 4ZS6A 1Q6HA 3UF8A 4IT4A 3CHFA 4XAKA 2M2AA 3UI5A 3VAWA 3H9RB 4IQ2A 2ZR5A 2PPNA 3B8SA 2XP8A 2FDMA 5J6EA 5GPGA 1NWTA 1ROUA 2QF8A 2MLXA 2L2SA 1U79A 2N87A 2PV3A 1JCHB 1W1YA 1EYMA 1W1TA 4MGVA 3JXVA 1A7XA 1M5YA 1EHNA 4NZCA 2DG4A 3BMBA 2WK2A 4QT3A 3TDBA 1FKKA 2PV1A 3CHEA 1D6OA 1W9UA 1QPLA 2KE0A 1FFRA 4JFLA 1LJYA 1QPFA 4DH0A 1NWSA 1JVWA 2ZQUA 3ARWA 4LAVA 1X6LA 2WLZA 3OOBA 4DRPA 1K9TA 1LL7A 4AY1A 2KFWA 4ITZA 4G2PA 3O5GA 4URIA 3G6LA 4ZPVR 1PINA 2XP5A 4P8WA 2LJ4A 4ZPTR 2Y78A 1J4RA 1RD6A 4R5EA 4ODRA 1E6NA 2IUZA 4O2TA 5HWCA 1NH6A 2M1IA 1ZB5A 1O6IA 3NI6A 3TCZA 2P4VA 5HUAA 3O5PA 2XPAA 3NRKA 2PN0A 2DSVA 1OGGA 3WL1A 2RUCA 3KADA 2PV2A 4U85A 2DT0A 1E9LA 5DO2A 1GPFA 2ZR6A 3RFWA 1W9PA 1VF8A 3JYMA 1OGBA 1PBKA 3IKGA 1T11A 1NWRA 4PTMA 3KACA 1E15A 4WKFA 1HJXA 4GGQA 2ZQTA 5HWBA 1ZU8A 4HBOA 1HJWA 5D75A 1FKFA 2A3AA 3AS2A 3PA7A 3ARRA 4DRKA 2ITKA 3AROA 4Z2GA 4MNJA 4MNMA 3B9AA 5HBFA 2OLHA 4Q7NA 2EULA 3O5JA 2PBCA 2ETNA 2XP7A 4W9PA 3ODKA 4J4OA 4LGXA 5DITA 2JZVA 1WNOA 4JFKA 1ZL1A 2G8ZA 3ARSA 3W4RA 4NSBA 1YATA 2AOSA 2A3CA 4DWSB 4DT4A 3WD3A 5B8IC 4JFMA 1QZ2A 2XP9A 2DSWA 5HW8A 2LPVA 2RURA 1OWQA 3KZ7A 2DT3A 1F8AB 2RUQA 4HBEA 4L72B 5GQBA 1E44A 3O5DA 4UDMA 1KFWA 3WD0A 1FAPA 1WAWA 5HTGA 4JFJA 1YW5A 1ITXA 2YBTA 3KAHA 1ZBWA 5HT1A 3IHZA 1F40A 1E6PA 1FKIA 3ARPA 1FKGA 2XPBA 3KAFA 2O9OA 2MNTA 2MLZA 1FKLA 3RM8A 4DRNA 3ARUA 3WQWA 3ARQA 1D7JA 3CHCA 4IPXA 1FD9A 4KR0B 4LAYA 3RM4A 4ODQA 3KCEA 1P5QA 1XHGA 3FAPA 2A3BA 2AWGA 2KI3A 2ESCA 4IQCA 1N1AA 3PRBA 4QIBA 1D7IA 1UR9A 2LKNA 5BXJA 4TYOA 4ODLA 4W9QA 2DG9A 3O5IA 1HKIA 4Z2JA 4DRMA 1D7HA 2VN1A 1JNEA 3WH0A 2RQSA 4WIWA 1W26A 3QOKA 2ZR4A 2XP6A 4MNKA 2F23A 1CTNA 1Q1CA 1B6CA 3ARTA 1J4IA 3UQAA 2O92A 4N19A 3ARZA 4NNRA 4DWSA 4J4NA 1FKBA 3MDYB 1JNTA 3O5EA 4DZ2A 1SYTA 3G6MA 3UQIA 3LUOA 4DROA 3PRAA 4WJXA 1W1VA 4BF8A 4ODOA 2B31A 1UR8A 4FAPA 3RGCA 3CHDA 1J4HA 4LAXA 4DRIA 2DT2A 2G41A 1FKSA 1XRVA 4ODKA 2B5UB 1Q6UA 3I6CA 1LL4A 1KT1A 5HKGA 4U86A 2DSZA 3BXWA 4ODPA 3KAIA 4ML4A 3GPKA 1R9HA 2F21A 3O5KA 1E6ZA 1GRJA 4IT6A 1JNSA 3O5OA 3UQBA 2WLYA 4MAVA 1W1PA 2D9FA 3IKDA 3ALGA
chains in the Genus database with same CATH topology
3RM9A 2YBUA 4JFIA 2PPOA 4WKHA 1FKHA 4WKAA 3AS1A 2RUDA 3B9EA 3EY6A 4TNSA 3WKZA 3CH9A 1LG1A 3UI4A 4Q22A 4FN2A 2KR7A 2F2DA 1HXVA 1ZK6A 1FKTA 3AQUA 2FAPA 4QT2A 2DSUA 4L3NA 5DF0A 2VCDA 2Q5AA 4P8VA 1LG2A 1WB0A 3AS3A 4MNLA 2PPPA 4R0XA 1Q6IA 5DIUA 4P8UA 3WL0A 4G50A 1D2KA 2K8IA 4Z2IA 3TC5A 2IF4A 4TX0A 5GPRA 4WK9A 4W9OA 1FKJA 1GUVA 2M08A 3PRDA 1IX5A 2MF9A 4DRJA 3NTPA 1FKRA 4MSPA 1GOIA 4Z2KA 1X6NA 1JNDA 3ALFA 4KQZA 4MTVA 4S3JA 3O5LA 4GIVA 2DPEA 5I98A 1BL4A 3KAGA 4DRHA 3PR9A 4P8XA 2KO7A 2A3EA 4HARA 1ZBVA 4LAWA 1FFQA 1EDQA 1ZBKA 3WIJA 2PI6A 1BKFA 1EIBA 3WD1A 1NMWA 4DRQA 3FY1A 3ARYA 1HKKA 2KGJA 1SR0A 2OFNA 1NMVA 2WM0A 3WQVA 3AS0A 4S3KA 3IK8A 1H0GA 3O5QA 4TW7A 4DWSD 1FJDA 5HW7A 1E6RA 4MPKA 1NSGA 2UZ5A 3KABA 1ZBCA 4ODNA 5DIVA 4TW6A 1H0IA 4Z2LA 3B7XA 3ARXA 3UI6A 2ZQVA 2RSEA 1LL6A 3O5RA 1ROTA 1FKDA 3O5FA 1TCOC 3CGMA 2XP4A 3RMEA 1NWUA 4DIPA 1HJVA 2F4EA 2DG3A 5DEZA 2MPHA 4Z2HA 1C9HA 1EQ3A 1TFVA 4DZ3A 1HKMA 3WD2A 3WD4A 1KT0A 3B9DA 4JYSA 3ARVA 3FXYA 4ZPWR 3OA5A 1Y0OA 5JH8A 4C02B 3O5MA 4W5UA 2LGOA 3CGNA 2XP3A 4QZVB 4ODMA 5HW6A 1L1PA 1J6YA 3JYJA 4U84A 2ZQSA 2MLYA 1HKJA 1W9VA 1LQ0A 4DWSC 2DT1A 3CZ8A 4TW8A 1ZCNA 2FKEA 4ZS6A 1Q6HA 3UF8A 4IT4A 3CHFA 4XAKA 2M2AA 3UI5A 3VAWA 3H9RB 4IQ2A 2ZR5A 2PPNA 3B8SA 2XP8A 2FDMA 5J6EA 5GPGA 1NWTA 1ROUA 2QF8A 2MLXA 2L2SA 1U79A 2N87A 2PV3A 1W1YA 1EYMA 1W1TA 4MGVA 3JXVA 1A7XA 1M5YA 1EHNA 4NZCA 2DG4A 2WK2A 4QT3A 3TDBA 1FKKA 2PV1A 3CHEA 1D6OA 1W9UA 1QPLA 2KE0A 1FFRA 4JFLA 1LJYA 1QPFA 4DH0A 1NWSA 1JVWA 2ZQUA 3ARWA 4LAVA 1X6LA 2WLZA 3OOBA 4DRPA 1K9TA 1LL7A 4AY1A 2KFWA 4ITZA 4G2PA 3O5GA 4URIA 3G6LA 4ZPVR 1PINA 2XP5A 4P8WA 2LJ4A 4ZPTR 2Y78A 1J4RA 1RD6A 4R5EA 4ODRA 1E6NA 2IUZA 4O2TA 5HWCA 1NH6A 2M1IA 1ZB5A 1O6IA 3NI6A 3TCZA 5HUAA 3O5PA 2XPAA 3NRKA 2DSVA 1OGGA 3WL1A 2RUCA 3KADA 2PV2A 4U85A 2DT0A 1E9LA 5DO2A 1GPFA 2ZR6A 3RFWA 1W9PA 1VF8A 3JYMA 1OGBA 1PBKA 3IKGA 1T11A 1NWRA 4PTMA 3KACA 1E15A 4WKFA 1HJXA 4GGQA 2ZQTA 5HWBA 1ZU8A 4HBOA 1HJWA 5D75A 1FKFA 2A3AA 3AS2A 3PA7A 3ARRA 4DRKA 2ITKA 3AROA 4Z2GA 4MNJA 4MNMA 3B9AA 5HBFA 2OLHA 4Q7NA 3O5JA 2PBCA 2XP7A 4W9PA 3ODKA 4J4OA 4LGXA 5DITA 2JZVA 1WNOA 4JFKA 1ZL1A 2G8ZA 3ARSA 3W4RA 4NSBA 1YATA 2AOSA 2A3CA 4DWSB 4DT4A 3WD3A 5B8IC 4JFMA 1QZ2A 2XP9A 2DSWA 5HW8A 2LPVA 2RURA 1OWQA 3KZ7A 2DT3A 1F8AB 2RUQA 4HBEA 4L72B 5GQBA 3O5DA 1KFWA 3WD0A 1FAPA 1WAWA 5HTGA 4JFJA 1YW5A 1ITXA 2YBTA 3KAHA 1ZBWA 5HT1A 3IHZA 1F40A 1E6PA 1FKIA 3ARPA 1FKGA 2XPBA 3KAFA 2O9OA 2MNTA 2MLZA 1FKLA 3RM8A 4DRNA 3ARUA 3WQWA 3ARQA 1D7JA 3CHCA 4IPXA 1FD9A 4KR0B 4LAYA 3RM4A 4ODQA 3KCEA 1P5QA 1XHGA 3FAPA 2A3BA 2AWGA 2KI3A 2ESCA 4IQCA 1N1AA 3PRBA 4QIBA 1D7IA 1UR9A 2LKNA 5BXJA 4TYOA 4ODLA 4W9QA 2DG9A 3O5IA 1HKIA 4Z2JA 4DRMA 1D7HA 2VN1A 1JNEA 3WH0A 2RQSA 4WIWA 1W26A 3QOKA 2ZR4A 2XP6A 4MNKA 1CTNA 1Q1CA 1B6CA 3ARTA 1J4IA 3UQAA 2O92A 4N19A 3ARZA 4NNRA 4DWSA 4J4NA 1FKBA 3MDYB 1JNTA 3O5EA 4DZ2A 1SYTA 3G6MA 3UQIA 3LUOA 4DROA 3PRAA 4WJXA 1W1VA 4BF8A 4ODOA 2B31A 1UR8A 4FAPA 3RGCA 3CHDA 1J4HA 4LAXA 4DRIA 2DT2A 2G41A 1FKSA 1XRVA 4ODKA 1Q6UA 3I6CA 1LL4A 1KT1A 5HKGA 4U86A 2DSZA 3BXWA 4ODPA 3KAIA 4ML4A 3GPKA 1R9HA 2F21A 3O5KA 1E6ZA 4IT6A 1JNSA 3O5OA 3UQBA 2WLYA 4MAVA 1W1PA 2D9FA 3IKDA 3ALGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F40 A;  1FKI A;  1J4R A;  4JFI A;  1FKG A;  2PPO A;  1FKH A;  2XPB A;  4ODR A;  4DIP A;  3KAF A;  2RUD A;  4TNS A;  3EY6 A;  2F4E A;  2MNT A;  2DG3 A;  2MLZ A;  2MPH A;  4O2T A;  5HWC A;  1FKL A;  1C9H A;  3UI4 A;  2M1I A;  3IKD A;  4DRN A;  1EQ3 A;  4FN2 A;  4DZ3 A;  2KR7 A;  3NI6 A;  2F2D A;  1HXV A;  1ZK6 A;  3TCZ A;  5HUA A;  1D7J A;  1FKT A;  1KT0 A;  4IPX A;  1FD9 A;  2XPA A;  3O5P A;  3NRK A;  4JYS A;  4LAY A;  1JNS A;  4ODQ A;  3KCE A;  2FAP A;  1P5Q A;  2RUC A;  4QT2 A;  3FAP A;  3KAD A;  2PV2 A;  2VCD A;  2AWG A;  2KI3 A;  4U85 A;  2Q5A A;  4IQC A;  5HTG A;  2PPP A;  1Y0O A;  2ZR6 A;  4C02 B;  3O5M A;  1N1A A;  3PRB A;  4QIB A;  2LGO A;  1D7I A;  3CGN A;  4R0X A;  3RFW A;  2LKN A;  1Q6I A;  2XP3 A;  5DIU A;  3JYM A;  5BXJ A;  4ODM A;  5HW6 A;  1PBK A;  3IKG A;  1T11 A;  1L1P A;  4TYO A;  1J6Y A;  3JYJ A;  4G50 A;  4ODL A;  4U84 A;  2K8I A;  4W9Q A;  2ZQS A;  2DG9 A;  2MLY A;  3KAC A;  3TC5 A;  3O5I A;  4GGQ A;  2ZQT A;  2IF4 A;  5HWB A;  4TX0 A;  5D75 A;  4W9O A;  1FKJ A;  1FKF A;  2M08 A;  3PRD A;  3PA7 A;  4TW8 A;  2MF9 A;  4DRK A;  4DRM A;  1D7H A;  2ITK A;  2VN1 A;  1ZCN A;  3WH0 A;  2FKE A;  3NTP A;  4DRJ A;  2RQS A;  1FKR A;  1W26 A;  1Q6H A;  2ZR4 A;  2XP6 A;  3UF8 A;  3O5J A;  4MSP A;  1Q1C A;  2PBC A;  2M2A A;  1B6C A;  1J4I A;  2XP7 A;  4W9P A;  3UI5 A;  3UQA A;  3ODK A;  4J4O A;  3O5L A;  3H9R B;  4GIV A;  5DIT A;  3VAW A;  4N19 A;  5I98 A;  4IQ2 A;  2JZV A;  2ZR5 A;  2PPN A;  1BL4 A;  3KAG A;  4NNR A;  4DRH A;  2XP8 A;  4J4N A;  4JFK A;  5J6E A;  5GPG A;  1FKB A;  3MDY B;  1JNT A;  1ROU A;  2KO7 A;  2MLX A;  3IHZ A;  3O5E A;  1YAT A;  4DZ2 A;  2L2S A;  1U79 A;  2N87 A;  4LAW A;  2PV3 A;  3UQI A;  3LUO A;  1EYM A;  4MGV A;  3JXV A;  4DT4 A;  1M5Y A;  4DRO A;  1BKF A;  1NMW A;  4BF8 A;  4DRQ A;  4ODO A;  5B8I C;  2DG4 A;  1QZ2 A;  4JFM A;  4QT3 A;  2XP9 A;  3RGC A;  4DH0 A;  4FAP A;  3TDB A;  1J4H A;  2KGJ A;  4LAX A;  4DRI A;  1FKK A;  2PV1 A;  1D6O A;  2OFN A;  1NMV A;  5HW8 A;  2LPV A;  1FKS A;  1QPL A;  2RUR A;  3IK8 A;  2KE0 A;  3O5Q A;  4ODK A;  4TW7 A;  3KZ7 A;  1FJD A;  4JFL A;  1Q6U A;  3I6C A;  5HW7 A;  1F8A B;  1NSG A;  2RUQ A;  1QPF A;  2UZ5 A;  1KT1 A;  3KAB A;  4ODN A;  1JVW A;  5DIV A;  2ZQU A;  4LAV A;  4ODP A;  4TW6 A;  4U86 A;  5HKG A;  3O5D A;  3KAI A;  1FAP A;  3B7X A;  3OOB A;  4DRP A;  3UI6 A;  2ZQV A;  2RSE A;  3O5R A;  3GPK A;  4JFJ A;  1R9H A;  2KFW A;  4ITZ A;  2F21 A;  3O5K A;  3O5G A;  4G2P A;  1YW5 A;  1ROT A;  1FKD A;  3O5O A;  1PIN A;  2XP5 A;  1TCO C;  3KAH A;  3O5F A;  3UQB A;  2LJ4 A;  3CGM A;  2XP4 A;  5HT1 A;  2D9F A;  2Y78 A;  1A7X A; 
#chains in the Genus database with same CATH topology
 3RM9 A;  2YBU A;  4JFI A;  2PPO A;  4WKH A;  1FKH A;  4WKA A;  3AS1 A;  2RUD A;  3B9E A;  3EY6 A;  4TNS A;  3WKZ A;  3CH9 A;  1LG1 A;  3UI4 A;  4Q22 A;  4FN2 A;  2KR7 A;  2F2D A;  1HXV A;  1ZK6 A;  1FKT A;  3AQU A;  2FAP A;  4QT2 A;  2DSU A;  4L3N A;  5DF0 A;  2VCD A;  2Q5A A;  4P8V A;  1LG2 A;  1WB0 A;  3AS3 A;  4MNL A;  2PPP A;  4R0X A;  1Q6I A;  5DIU A;  4P8U A;  3WL0 A;  4G50 A;  1D2K A;  2K8I A;  4Z2I A;  3TC5 A;  2IF4 A;  4TX0 A;  5GPR A;  4WK9 A;  4W9O A;  1FKJ A;  1GUV A;  2M08 A;  3PRD A;  1IX5 A;  2MF9 A;  4DRJ A;  3NTP A;  1FKR A;  4MSP A;  3EIP A;  1GOI A;  4Z2K A;  1X6N A;  1JND A;  3ALF A;  4KQZ A;  4MTV A;  4S3J A;  3O5L A;  4GIV A;  2DPE A;  5I98 A;  1BL4 A;  3KAG A;  4DRH A;  3PR9 A;  4P8X A;  2KO7 A;  3GTY X;  2A3E A;  4HAR A;  1ZBV A;  4LAW A;  1FFQ A;  1EDQ A;  1ZBK A;  3WIJ A;  2PI6 A;  1BKF A;  1EIB A;  3WD1 A;  1NMW A;  4DRQ A;  3FY1 A;  3ARY A;  1HKK A;  2KGJ A;  1SR0 A;  2OFN A;  1NMV A;  3GU0 A;  2WM0 A;  3WQV A;  3AS0 A;  4S3K A;  3IK8 A;  1H0G A;  3O5Q A;  4TW7 A;  4DWS D;  1FJD A;  5HW7 A;  1E6R A;  4MPK A;  1NSG A;  2UZ5 A;  3KAB A;  1ZBC A;  4ODN A;  5DIV A;  4TW6 A;  1H0I A;  4Z2L A;  3B7X A;  3ARX A;  3UI6 A;  2ZQV A;  2RSE A;  1LL6 A;  3O5R A;  1ROT A;  1FKD A;  3O5F A;  1TCO C;  3CGM A;  2XP4 A;  3RME A;  1NWU A;  4DIP A;  1HJV A;  2F4E A;  2DG3 A;  5DEZ A;  2MPH A;  4Z2H A;  1C9H A;  1EQ3 A;  1TFV A;  4DZ3 A;  1HKM A;  3WD2 A;  3WD4 A;  1KT0 A;  3B9D A;  4JYS A;  3ARV A;  3FXY A;  4ZPW R;  3OA5 A;  1Y0O A;  5JH8 A;  4C02 B;  3O5M A;  4W5U A;  2LGO A;  3CGN A;  2XP3 A;  4QZV B;  4ODM A;  5HW6 A;  1L1P A;  1J6Y A;  3JYJ A;  4U84 A;  2ZQS A;  2MLY A;  1HKJ A;  1W9V A;  1LQ0 A;  4DWS C;  2DT1 A;  3CZ8 A;  4TW8 A;  1ZCN A;  2FKE A;  4ZS6 A;  1Q6H A;  3UF8 A;  4IT4 A;  3CHF A;  4XAK A;  2M2A A;  3UI5 A;  3VAW A;  3H9R B;  4IQ2 A;  2ZR5 A;  2PPN A;  3B8S A;  2XP8 A;  2FDM A;  5J6E A;  5GPG A;  1NWT A;  1ROU A;  2QF8 A;  2MLX A;  2L2S A;  1U79 A;  2N87 A;  2PV3 A;  1JCH B;  1W1Y A;  1EYM A;  1W1T A;  4MGV A;  3JXV A;  1A7X A;  1M5Y A;  1EHN A;  4NZC A;  2DG4 A;  3BMB A;  2WK2 A;  4QT3 A;  3TDB A;  1FKK A;  2PV1 A;  3CHE A;  1D6O A;  1W9U A;  1QPL A;  2KE0 A;  1FFR A;  4JFL A;  1LJY A;  1QPF A;  4DH0 A;  1NWS A;  1JVW A;  2ZQU A;  3ARW A;  4LAV A;  1X6L A;  2WLZ A;  3OOB A;  4DRP A;  1K9T A;  1LL7 A;  4AY1 A;  2KFW A;  4ITZ A;  4G2P A;  3O5G A;  4URI A;  3G6L A;  4ZPV R;  1PIN A;  2XP5 A;  4P8W A;  2LJ4 A;  4ZPT R;  2Y78 A;  1J4R A;  1RD6 A;  4R5E A;  4ODR A;  1E6N A;  2IUZ A;  4O2T A;  5HWC A;  1NH6 A;  2M1I A;  1ZB5 A;  1O6I A;  3NI6 A;  3TCZ A;  2P4V A;  5HUA A;  3O5P A;  2XPA A;  3NRK A;  2PN0 A;  2DSV A;  1OGG A;  3WL1 A;  2RUC A;  3KAD A;  2PV2 A;  4U85 A;  2DT0 A;  1E9L A;  5DO2 A;  1GPF A;  2ZR6 A;  3RFW A;  1W9P A;  1VF8 A;  3JYM A;  1OGB A;  1PBK A;  3IKG A;  1T11 A;  1NWR A;  4PTM A;  3KAC A;  1E15 A;  4WKF A;  1HJX A;  4GGQ A;  2ZQT A;  5HWB A;  1ZU8 A;  4HBO A;  1HJW A;  5D75 A;  1FKF A;  2A3A A;  3AS2 A;  3PA7 A;  3ARR A;  4DRK A;  2ITK A;  3ARO A;  4Z2G A;  4MNJ A;  4MNM A;  3B9A A;  5HBF A;  2OLH A;  4Q7N A;  2EUL A;  3O5J A;  2PBC A;  2ETN A;  2XP7 A;  4W9P A;  3ODK A;  4J4O A;  4LGX A;  5DIT A;  2JZV A;  1WNO A;  4JFK A;  1ZL1 A;  2G8Z A;  3ARS A;  3W4R A;  4NSB A;  1YAT A;  2AOS A;  2A3C A;  4DWS B;  4DT4 A;  3WD3 A;  5B8I C;  4JFM A;  1QZ2 A;  2XP9 A;  2DSW A;  5HW8 A;  2LPV A;  2RUR A;  1OWQ A;  3KZ7 A;  2DT3 A;  1F8A B;  2RUQ A;  4HBE A;  4L72 B;  5GQB A;  1E44 A;  3O5D A;  4UDM A;  1KFW A;  3WD0 A;  1FAP A;  1WAW A;  5HTG A;  4JFJ A;  1YW5 A;  1ITX A;  2YBT A;  3KAH A;  1ZBW A;  5HT1 A;  3IHZ A;  1F40 A;  1E6P A;  1FKI A;  3ARP A;  1FKG A;  2XPB A;  3KAF A;  2O9O A;  2MNT A;  2MLZ A;  1FKL A;  3RM8 A;  4DRN A;  3ARU A;  3WQW A;  3ARQ A;  1D7J A;  3CHC A;  4IPX A;  1FD9 A;  4KR0 B;  4LAY A;  3RM4 A;  4ODQ A;  3KCE A;  1P5Q A;  1XHG A;  3FAP A;  2A3B A;  2AWG A;  2KI3 A;  2ESC A;  4IQC A;  1N1A A;  3PRB A;  4QIB A;  1D7I A;  1UR9 A;  2LKN A;  5BXJ A;  4TYO A;  4ODL A;  4W9Q A;  2DG9 A;  3O5I A;  1HKI A;  4Z2J A;  4DRM A;  1D7H A;  2VN1 A;  1JNE A;  3WH0 A;  2RQS A;  4WIW A;  1W26 A;  3QOK A;  2ZR4 A;  2XP6 A;  4MNK A;  2F23 A;  1CTN A;  1Q1C A;  1B6C A;  3ART A;  1J4I A;  3UQA A;  2O92 A;  4N19 A;  3ARZ A;  4NNR A;  4DWS A;  4J4N A;  1FKB A;  3MDY B;  1JNT A;  3O5E A;  4DZ2 A;  1SYT A;  3G6M A;  3UQI A;  3LUO A;  4DRO A;  3PRA A;  4WJX A;  1W1V A;  4BF8 A;  4ODO A;  2B31 A;  1UR8 A;  4FAP A;  3RGC A;  3CHD A;  1J4H A;  4LAX A;  4DRI A;  2DT2 A;  2G41 A;  1FKS A;  1XRV A;  4ODK A;  2B5U B;  1Q6U A;  3I6C A;  1LL4 A;  1KT1 A;  5HKG A;  4U86 A;  2DSZ A;  3BXW A;  4ODP A;  3KAI A;  4ML4 A;  3GPK A;  1R9H A;  2F21 A;  3O5K A;  1E6Z A;  1GRJ A;  4IT6 A;  1JNS A;  3O5O A;  3UQB A;  2WLY A;  4MAV A;  1W1P A;  2D9F A;  3IKD A;  3ALG A; 
#chains in the Genus database with same CATH homology
 3RM9 A;  2YBU A;  4JFI A;  2PPO A;  4WKH A;  1FKH A;  4WKA A;  3AS1 A;  2RUD A;  3B9E A;  3EY6 A;  4TNS A;  3WKZ A;  3CH9 A;  1LG1 A;  3UI4 A;  4Q22 A;  4FN2 A;  2KR7 A;  2F2D A;  1HXV A;  1ZK6 A;  1FKT A;  3AQU A;  2FAP A;  4QT2 A;  2DSU A;  4L3N A;  5DF0 A;  2VCD A;  2Q5A A;  4P8V A;  1LG2 A;  1WB0 A;  3AS3 A;  4MNL A;  2PPP A;  4R0X A;  1Q6I A;  5DIU A;  4P8U A;  3WL0 A;  4G50 A;  1D2K A;  2K8I A;  4Z2I A;  3TC5 A;  2IF4 A;  4TX0 A;  5GPR A;  4WK9 A;  4W9O A;  1FKJ A;  1GUV A;  2M08 A;  3PRD A;  1IX5 A;  2MF9 A;  4DRJ A;  3NTP A;  1FKR A;  4MSP A;  1GOI A;  4Z2K A;  1X6N A;  1JND A;  3ALF A;  4KQZ A;  4MTV A;  4S3J A;  3O5L A;  4GIV A;  2DPE A;  5I98 A;  1BL4 A;  3KAG A;  4DRH A;  3PR9 A;  4P8X A;  2KO7 A;  2A3E A;  4HAR A;  1ZBV A;  4LAW A;  1FFQ A;  1EDQ A;  1ZBK A;  3WIJ A;  2PI6 A;  1BKF A;  1EIB A;  3WD1 A;  1NMW A;  4DRQ A;  3FY1 A;  3ARY A;  1HKK A;  2KGJ A;  1SR0 A;  2OFN A;  1NMV A;  2WM0 A;  3WQV A;  3AS0 A;  4S3K A;  3IK8 A;  1H0G A;  3O5Q A;  4TW7 A;  4DWS D;  1FJD A;  5HW7 A;  1E6R A;  4MPK A;  1NSG A;  2UZ5 A;  3KAB A;  1ZBC A;  4ODN A;  5DIV A;  4TW6 A;  1H0I A;  4Z2L A;  3B7X A;  3ARX A;  3UI6 A;  2ZQV A;  2RSE A;  1LL6 A;  3O5R A;  1ROT A;  1FKD A;  3O5F A;  1TCO C;  3CGM A;  2XP4 A;  3RME A;  1NWU A;  4DIP A;  1HJV A;  2F4E A;  2DG3 A;  5DEZ A;  2MPH A;  4Z2H A;  1C9H A;  1EQ3 A;  1TFV A;  4DZ3 A;  1HKM A;  3WD2 A;  3WD4 A;  1KT0 A;  3B9D A;  4JYS A;  3ARV A;  3FXY A;  4ZPW R;  3OA5 A;  1Y0O A;  5JH8 A;  4C02 B;  3O5M A;  4W5U A;  2LGO A;  3CGN A;  2XP3 A;  4QZV B;  4ODM A;  5HW6 A;  1L1P A;  1J6Y A;  3JYJ A;  4U84 A;  2ZQS A;  2MLY A;  1HKJ A;  1W9V A;  1LQ0 A;  4DWS C;  2DT1 A;  3CZ8 A;  4TW8 A;  1ZCN A;  2FKE A;  4ZS6 A;  1Q6H A;  3UF8 A;  4IT4 A;  3CHF A;  4XAK A;  2M2A A;  3UI5 A;  3VAW A;  3H9R B;  4IQ2 A;  2ZR5 A;  2PPN A;  3B8S A;  2XP8 A;  2FDM A;  5J6E A;  5GPG A;  1NWT A;  1ROU A;  2QF8 A;  2MLX A;  2L2S A;  1U79 A;  2N87 A;  2PV3 A;  1W1Y A;  1EYM A;  1W1T A;  4MGV A;  3JXV A;  1A7X A;  1M5Y A;  1EHN A;  4NZC A;  2DG4 A;  2WK2 A;  4QT3 A;  3TDB A;  1FKK A;  2PV1 A;  3CHE A;  1D6O A;  1W9U A;  1QPL A;  2KE0 A;  1FFR A;  4JFL A;  1LJY A;  1QPF A;  4DH0 A;  1NWS A;  1JVW A;  2ZQU A;  3ARW A;  4LAV A;  1X6L A;  2WLZ A;  3OOB A;  4DRP A;  1K9T A;  1LL7 A;  4AY1 A;  2KFW A;  4ITZ A;  4G2P A;  3O5G A;  4URI A;  3G6L A;  4ZPV R;  1PIN A;  2XP5 A;  4P8W A;  2LJ4 A;  4ZPT R;  2Y78 A;  1J4R A;  1RD6 A;  4R5E A;  4ODR A;  1E6N A;  2IUZ A;  4O2T A;  5HWC A;  1NH6 A;  2M1I A;  1ZB5 A;  1O6I A;  3NI6 A;  3TCZ A;  5HUA A;  3O5P A;  2XPA A;  3NRK A;  2DSV A;  1OGG A;  3WL1 A;  2RUC A;  3KAD A;  2PV2 A;  4U85 A;  2DT0 A;  1E9L A;  5DO2 A;  1GPF A;  2ZR6 A;  3RFW A;  1W9P A;  1VF8 A;  3JYM A;  1OGB A;  1PBK A;  3IKG A;  1T11 A;  1NWR A;  4PTM A;  3KAC A;  1E15 A;  4WKF A;  1HJX A;  4GGQ A;  2ZQT A;  5HWB A;  1ZU8 A;  4HBO A;  1HJW A;  5D75 A;  1FKF A;  2A3A A;  3AS2 A;  3PA7 A;  3ARR A;  4DRK A;  2ITK A;  3ARO A;  4Z2G A;  4MNJ A;  4MNM A;  3B9A A;  5HBF A;  2OLH A;  4Q7N A;  3O5J A;  2PBC A;  2XP7 A;  4W9P A;  3ODK A;  4J4O A;  4LGX A;  5DIT A;  2JZV A;  1WNO A;  4JFK A;  1ZL1 A;  2G8Z A;  3ARS A;  3W4R A;  4NSB A;  1YAT A;  2AOS A;  2A3C A;  4DWS B;  4DT4 A;  3WD3 A;  5B8I C;  4JFM A;  1QZ2 A;  2XP9 A;  2DSW A;  5HW8 A;  2LPV A;  2RUR A;  1OWQ A;  3KZ7 A;  2DT3 A;  1F8A B;  2RUQ A;  4HBE A;  4L72 B;  5GQB A;  3O5D A;  1KFW A;  3WD0 A;  1FAP A;  1WAW A;  5HTG A;  4JFJ A;  1YW5 A;  1ITX A;  2YBT A;  3KAH A;  1ZBW A;  5HT1 A;  3IHZ A;  1F40 A;  1E6P A;  1FKI A;  3ARP A;  1FKG A;  2XPB A;  3KAF A;  2O9O A;  2MNT A;  2MLZ A;  1FKL A;  3RM8 A;  4DRN A;  3ARU A;  3WQW A;  3ARQ A;  1D7J A;  3CHC A;  4IPX A;  1FD9 A;  4KR0 B;  4LAY A;  3RM4 A;  4ODQ A;  3KCE A;  1P5Q A;  1XHG A;  3FAP A;  2A3B A;  2AWG A;  2KI3 A;  2ESC A;  4IQC A;  1N1A A;  3PRB A;  4QIB A;  1D7I A;  1UR9 A;  2LKN A;  5BXJ A;  4TYO A;  4ODL A;  4W9Q A;  2DG9 A;  3O5I A;  1HKI A;  4Z2J A;  4DRM A;  1D7H A;  2VN1 A;  1JNE A;  3WH0 A;  2RQS A;  4WIW A;  1W26 A;  3QOK A;  2ZR4 A;  2XP6 A;  4MNK A;  1CTN A;  1Q1C A;  1B6C A;  3ART A;  1J4I A;  3UQA A;  2O92 A;  4N19 A;  3ARZ A;  4NNR A;  4DWS A;  4J4N A;  1FKB A;  3MDY B;  1JNT A;  3O5E A;  4DZ2 A;  1SYT A;  3G6M A;  3UQI A;  3LUO A;  4DRO A;  3PRA A;  4WJX A;  1W1V A;  4BF8 A;  4ODO A;  2B31 A;  1UR8 A;  4FAP A;  3RGC A;  3CHD A;  1J4H A;  4LAX A;  4DRI A;  2DT2 A;  2G41 A;  1FKS A;  1XRV A;  4ODK A;  1Q6U A;  3I6C A;  1LL4 A;  1KT1 A;  5HKG A;  4U86 A;  2DSZ A;  3BXW A;  4ODP A;  3KAI A;  4ML4 A;  3GPK A;  1R9H A;  2F21 A;  3O5K A;  1E6Z A;  4IT6 A;  1JNS A;  3O5O A;  3UQB A;  2WLY A;  4MAV A;  1W1P A;  2D9F A;  3IKD A;  3ALG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...