2PV2A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Chaperone surA
publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv2A00
1D7JA 2M1IA 2KI3A 3MDYB 2RUQA 3EY6A 3PA7A 2XP9A 1KT0A 4G2PA 4DIPA 2JZVA 5GPGA 3UF8A 3UQAA 4IQ2A 1QPLA 3KAGA 4JFLA 4LAYA 2XP6A 2M08A 4U86A 2Q5AA 3TDBA 1J4IA 2MPHA 1BKFA 3O5PA 2PBCA 1F8AB 4JFKA 4W9QA 3KAFA 4BF8A 2XPBA 4DH0A 1B6CA 1ZCNA 1D7IA 2RQSA 4DRMA 1J6YA 1TCOC 4ODLA 4TYOA 4QIBA 3UQIA 2ZR6A 3UQBA 2XP7A 3O5RA 2PV1A 2ZQUA 1R9HA 3B7XA 3RFWA 1EQ3A 3FAPA 4J4NA 2FAPA 1NSGA 4ODQA 5J6EA 4TX0A 4DZ3A 1QPFA 2RURA 3O5FA 1T11A 2ZQTA 4C02B 4ODPA 3NTPA 4ODRA 3JYJA 1FKSA 3GPKA 5HWBA 3O5KA 4GIVA 4TNSA 5HW6A 1F40A 5DITA 2ITKA 2ZQSA 2LPVA 2RUCA 3H9RB 2MLYA 2KR7A 2PV2A 2F21A 3TCZA 2MNTA 1Q6HA 5BXJA 1NMVA 1J4RA 1P5QA 4W9PA 5I98A 1HXVA 1FKJA 2F4EA 4DROA 4QT3A 3KAIA 4TW8A 4NNRA 3CGMA 4DRNA 2XPAA 4ODOA 2OFNA 4MGVA 3VAWA 4DRJA 4DRQA 4JFJA 3O5LA 4R0XA 2FKEA 5HUAA 4IPXA 1M5YA 4JFIA 2LKNA 4U84A 1D7HA 2PPOA 2VCDA 1FKTA 5DIUA 1PBKA 1ZK6A 2KE0A 1FKIA 4ODKA 5D75A 3NRKA 4IQCA 1FKFA 3UI6A 1EYMA 2KO7A 1N1AA 4QT2A 1JNSA 5HW8A 4MSPA 4DRPA 1ROUA 3IK8A 4FAPA 1D6OA 4J4OA 5HKGA 2MLXA 2ZR4A 1FKRA 3O5OA 1Y0OA 2Y78A 3IKDA 3O5JA 1BL4A 2PPPA 1FKDA 4TW6A 4DZ2A 2RSEA 4DRHA 2DG9A 1FAPA 2LGOA 3I6CA 2N87A 3PRDA 4JYSA 4ODNA 1FD9A 3KABA 4DRIA 1FKGA 4DRKA 1FKBA 1QZ2A 1JNTA 3OOBA 4LAWA 1KT1A 4LAVA 2DG4A 2XP3A 4ITZA 3CGNA 5HT1A 2XP4A 3O5EA 2K8IA 1FKLA 4GGQA 3ODKA 3O5QA 3KADA 2AWGA 2VN1A 3KCEA 4N19A 3TC5A 1ROTA 5DIVA 1FJDA 2MLZA 1A7XA 4FN2A 2M2AA 3NI6A 4ODMA 3KAHA 4O2TA 2IF4A 1C9HA 3JYMA 3WH0A 3IKGA 1FKKA 2UZ5A 2ZQVA 1J4HA 1Q6IA 3RGCA 5B8IC 1YATA 3KZ7A 4LAXA 5HTGA 5HW7A 4W9OA 3IHZA 1W26A 2PV3A 1Q6UA 2D9FA 2XP5A 3PRBA 2DG3A 1YW5A 2MF9A 1FKHA 4DT4A 5HWCA 2PPNA 3UI5A 3O5MA 1L1PA 2KGJA 2KFWA 3UI4A 1JVWA 3O5GA 2XP8A 4U85A 2ZR5A 2LJ4A 1Q1CA 1NMWA 4JFMA 2RUDA 3LUOA 1PINA 3O5DA 4G50A 3O5IA 3KACA 4TW7A 3JXVA 1U79A 2L2SA 2F2DA
chains in the Genus database with same CATH superfamily
3RM9A 2DSUA 2RUQA 4IQ2A 3KAGA 1LL4A 1BKFA 1W9UA 4BF8A 4DH0A 1HKJA 3B9DA 3UQIA 3UQBA 4DWSC 3FAPA 4J4NA 4ZS6A 1T11A 4Z2LA 2ZQTA 4C02B 3NTPA 3JYJA 4HBOA 5HBFA 3O5KA 4NSBA 5HW6A 3ARVA 2ITKA 2LPVA 2RUCA 5BXJA 3AQUA 3QOKA 1OGGA 2FDMA 1NWSA 5GQBA 4ODOA 2OFNA 3WIJA 4Z2IA 3ARUA 4JFJA 2FKEA 1E6NA 3TCZA 2LKNA 5DIUA 4ODKA 4NZCA 1ZBWA 4IQCA 4QT2A 1LL7A 4MSPA 2B5UB 1D6OA 2ZR4A 4ZPVR 1BL4A 2PPPA 4TW6A 4DZ2A 2RSEA 4ODNA 1FKGA 1WAWA 1FKBA 4DWSA 5HT1A 2XP4A 3ARXA 2VN1A 1FJDA 5DIVA 3GU0A 4O2TA 3JYMA 3WH0A 4W5UA 1J4HA 1Q6IA 4P8XA 4S3JA 2PV3A 3WQVA 2MF9A 1GPFA 3WD1A 2WK2A 3WD0A 1LL6A 3ARYA 2XP8A 4Z2HA 4G50A 4MNLA 1LG2A 3IKDA 3MDYB 3BXWA 2A3CA 4G2PA 3UF8A 1VF8A 3ARPA 4JFLA 1QPLA 4S3KA 3WL1A 2Q5AA 3ARTA 3WD3A 2XPBA 1ZCNA 2RQSA 1D7IA 3AROA 4WKFA 4Z2JA 1J6YA 1NWRA 4ODLA 4XAKA 2ZR6A 3O5RA 2ZQUA 1EQ3A 1NSGA 4TX0A 4DZ3A 3CHEA 4UDMA 2RURA 1ITXA 1FFQA 1ZBCA 4TNSA 1F40A 2ZQSA 3H9RB 2MLYA 1ZL1A 2DSZA 3B9AA 4HARA 2F21A 1OWQA 1WNOA 3WKZA 2P4VA 5I98A 4MTVA 1JNEA 3CZ8A 2G41A 4NNRA 2XPAA 2DSWA 3VAWA 1EIBA 1SR0A 4MPKA 1FKIA 3NRKA 3UI6A 1JNSA 1E6ZA 1ZBVA 5GPRA 4FAPA 3OA5A 5HKGA 2AOSA 2MLXA 1FKRA 1TFVA 2Y78A 3O5JA 1FKDA 1ZBKA 2DG9A 1FAPA 2LGOA 1E44A 1FD9A 3KABA 4DRIA 3OOBA 3B9EA 1ZB5A 1KT1A 2XP3A 3CHCA 4ITZA 5JH8A 3ALGA 4DWSB 3O5EA 1RD6A 3KADA 1E15A 2AWGA 2PN0A 3RMEA 3TC5A 4L72B 1W9VA 2MLZA 4FN2A 2M2AA 3KAHA 3RGCA 3FY1A 3PRBA 2D9FA 1XHGA 5HWCA 4DT4A 3AS2A 2PPNA 3O5MA 2DT1A 1SYTA 1JVWA 2LJ4A 3CHFA 1OGBA 1LQ0A 4TW7A 3RM8A 4N19A 2L2SA 1HKIA 3EY6A 3PA7A 4WK9A 2XP9A 4DIPA 2JZVA 3UQAA 4LAYA 4L3NA 1J4IA 1X6NA 2MPHA 4IT6A 4P8WA 1E9LA 3CHDA 4JFKA 4W9QA 3KAFA 4Z2KA 4DRMA 2IUZA 1TCOC 4TYOA 4ZPWR 2PV1A 1R9HA 3B7XA 3RFWA 3ARRA 1H0GA 5J6EA 1QPFA 3O5FA 5DEZA 1W1YA 4R5EA 5HWBA 4GIVA 1W9PA 2KR7A 2PV2A 2MNTA 1Q6HA 1NMVA 3PR9A 4W9PA 4KQZA 4IT4A 2F4EA 1HJWA 4MNMA 4TW8A 5DF0A 4DRNA 4MGVA 4URIA 1M5YA 4JFIA 4U84A 1D7HA 2VCDA 1PBKA 2ETNA 5D75A 2KO7A 1N1AA 1FFRA 2A3EA 3ARWA 2A3BA 1Y0OA 4HBEA 2YBTA 4DRHA 3I6CA 3PRDA 2N87A 4WJXA 3AS0A 1QZ2A 1JNTA 4WKAA 4LAVA 2DG4A 3CGNA 3ALFA 3ARSA 4GGQA 2K8IA 3ODKA 1EDQA 1W1TA 3O5QA 1ROTA 1UR8A 3EIPA 4Q22A 2DSVA 2EULA 4ML4A 3IHZA 2QF8A 1Q6UA 3GTYX 2DG3A 3WL0A 2F23A 3UI5A 1L1PA 3UI4A 2KFWA 1UR9A 3O5GA 4U85A 2ZR5A 2ESCA 1NMWA 2RUDA 3LUOA 1PINA 3O5IA 3RM4A 4WKHA 3KACA 2WLZA 3CGMA 4U86A 1D7JA 2M1IA 2KI3A 3G6LA 1KT0A 3WD4A 1E6PA 5GPGA 1JCHB 4DWSD 3TDBA 4MNJA 2XP6A 2M08A 1D2KA 2YBUA 3O5PA 2G8ZA 1F8AB 2PBCA 1HJXA 3W4RA 1B6CA 1XRVA 1W1VA 4QIBA 3WD2A 1CTNA 2XP7A 3BMBA 2B31A 1WB0A 1X6LA 4KR0B 2FAPA 3CH9A 4ODQA 4Q7NA 1NWUA 2A3AA 4ODPA 4ODRA 1FKSA 3GPKA 4Z2GA 1KFWA 5DITA 3FXYA 4LGXA 4P8VA 3AS3A 1LG1A 1J4RA 1P5QA 1HXVA 1FKJA 3ARZA 3PRAA 4DROA 4MNKA 1LJYA 4QT3A 3KAIA 1NWTA 2WLYA 1HKKA 5DO2A 4DRJA 4DRQA 3O5LA 4R0XA 4ZPTR 5HUAA 4IPXA 1HKMA 2PPOA 1W1PA 4MAVA 1FKTA 1ZK6A 2KE0A 1IX5A 1FKFA 1EYMA 5HW8A 1HJVA 4DRPA 1ROUA 3IK8A 1EHNA 1NH6A 4J4OA 1JNDA 2DPEA 2DT2A 3O5OA 2PI6A 1GUVA 3G6MA 1K9TA 2DT0A 4WIWA 4JYSA 4DRKA 1H0IA 4LAWA 3WQWA 3B8SA 1FKLA 2O92A 4QZVB 1GOIA 3KCEA 3ARQA 1O6IA 1A7XA 3NI6A 4ODMA 2IF4A 1C9HA 3IKGA 1FKKA 2UZ5A 1GRJA 2ZQVA 5B8IC 1YATA 1E6RA 3KZ7A 4LAXA 5HTGA 5HW7A 3AS1A 4W9OA 4P8UA 1W26A 2OLHA 2XP5A 4PTMA 1YW5A 1FKHA 2DT3A 2KGJA 1Q1CA 4JFMA 4AY1A 2O9OA 3O5DA 1ZU8A 2WM0A 3JXVA 1U79A 2F2DA
chains in the Genus database with same CATH topology
3RM9A 2DSUA 2RUQA 4IQ2A 3KAGA 1LL4A 1BKFA 1W9UA 4BF8A 4DH0A 1HKJA 3B9DA 3UQIA 3UQBA 4DWSC 3FAPA 4J4NA 4ZS6A 1T11A 4Z2LA 2ZQTA 4C02B 3NTPA 3JYJA 4HBOA 5HBFA 3O5KA 4NSBA 5HW6A 3ARVA 2ITKA 2LPVA 2RUCA 5BXJA 3AQUA 3QOKA 1OGGA 2FDMA 1NWSA 5GQBA 4ODOA 2OFNA 3WIJA 4Z2IA 3ARUA 4JFJA 2FKEA 1E6NA 3TCZA 2LKNA 5DIUA 4ODKA 4NZCA 1ZBWA 4IQCA 4QT2A 1LL7A 4MSPA 1D6OA 2ZR4A 4ZPVR 1BL4A 2PPPA 4TW6A 4DZ2A 2RSEA 4ODNA 1FKGA 1WAWA 1FKBA 4DWSA 5HT1A 2XP4A 3ARXA 2VN1A 1FJDA 5DIVA 4O2TA 3JYMA 3WH0A 4W5UA 1J4HA 1Q6IA 4P8XA 4S3JA 2PV3A 3WQVA 2MF9A 1GPFA 3WD1A 2WK2A 3WD0A 1LL6A 3ARYA 2XP8A 4Z2HA 4G50A 4MNLA 1LG2A 3IKDA 3MDYB 3BXWA 2A3CA 4G2PA 3UF8A 1VF8A 3ARPA 4JFLA 1QPLA 4S3KA 3WL1A 2Q5AA 3ARTA 3WD3A 2XPBA 1ZCNA 2RQSA 1D7IA 3AROA 4WKFA 4Z2JA 1J6YA 1NWRA 4ODLA 4XAKA 2ZR6A 3O5RA 2ZQUA 1EQ3A 1NSGA 4TX0A 4DZ3A 3CHEA 2RURA 1ITXA 1FFQA 1ZBCA 4TNSA 1F40A 2ZQSA 3H9RB 2MLYA 1ZL1A 2DSZA 3B9AA 4HARA 2F21A 1OWQA 1WNOA 3WKZA 5I98A 4MTVA 1JNEA 3CZ8A 2G41A 4NNRA 2XPAA 2DSWA 3VAWA 1EIBA 1SR0A 4MPKA 1FKIA 3NRKA 3UI6A 1JNSA 1E6ZA 1ZBVA 5GPRA 4FAPA 3OA5A 5HKGA 2AOSA 2MLXA 1FKRA 1TFVA 2Y78A 3O5JA 1FKDA 1ZBKA 2DG9A 1FAPA 2LGOA 1FD9A 3KABA 4DRIA 3OOBA 3B9EA 1ZB5A 1KT1A 2XP3A 3CHCA 4ITZA 5JH8A 3ALGA 4DWSB 3O5EA 1RD6A 1E15A 2AWGA 3KADA 3RMEA 3TC5A 4L72B 1W9VA 2MLZA 4FN2A 2M2AA 3KAHA 3RGCA 3FY1A 3PRBA 2D9FA 1XHGA 5HWCA 4DT4A 3AS2A 2PPNA 3O5MA 2DT1A 1SYTA 1JVWA 2LJ4A 3CHFA 1OGBA 1LQ0A 4TW7A 3RM8A 4N19A 2L2SA 1HKIA 3EY6A 3PA7A 4WK9A 2XP9A 4DIPA 2JZVA 3UQAA 4LAYA 4L3NA 1J4IA 1X6NA 2MPHA 4IT6A 4P8WA 1E9LA 3CHDA 4JFKA 4W9QA 3KAFA 4Z2KA 4DRMA 2IUZA 1TCOC 4TYOA 4ZPWR 2PV1A 1R9HA 3B7XA 3RFWA 3ARRA 1H0GA 5J6EA 1QPFA 3O5FA 5DEZA 1W1YA 4R5EA 5HWBA 4GIVA 1W9PA 2KR7A 2PV2A 2MNTA 1Q6HA 1NMVA 3PR9A 4W9PA 4KQZA 4IT4A 2F4EA 1HJWA 4MNMA 4TW8A 5DF0A 4DRNA 4MGVA 4URIA 1M5YA 4JFIA 4U84A 1D7HA 2VCDA 1PBKA 5D75A 2KO7A 1N1AA 1FFRA 2A3EA 3ARWA 2A3BA 1Y0OA 4HBEA 2YBTA 4DRHA 3I6CA 3PRDA 2N87A 4WJXA 3AS0A 1QZ2A 1JNTA 4WKAA 4LAVA 2DG4A 3CGNA 3ALFA 3ARSA 4GGQA 2K8IA 3ODKA 1EDQA 1W1TA 3O5QA 1ROTA 1UR8A 4Q22A 2DSVA 4ML4A 3IHZA 2QF8A 1Q6UA 2DG3A 3WL0A 3UI5A 1L1PA 3UI4A 2KFWA 1UR9A 3O5GA 4U85A 2ZR5A 2ESCA 1NMWA 2RUDA 3LUOA 1PINA 3O5IA 3RM4A 4WKHA 3KACA 2WLZA 3CGMA 4U86A 1D7JA 2M1IA 2KI3A 3G6LA 1KT0A 3WD4A 1E6PA 5GPGA 4DWSD 3TDBA 4MNJA 2XP6A 2M08A 1D2KA 2YBUA 3O5PA 2G8ZA 1F8AB 2PBCA 1HJXA 3W4RA 1B6CA 1XRVA 1W1VA 4QIBA 3WD2A 1CTNA 2XP7A 2B31A 1WB0A 1X6LA 4KR0B 2FAPA 3CH9A 4ODQA 4Q7NA 1NWUA 2A3AA 4ODPA 4ODRA 1FKSA 3GPKA 4Z2GA 1KFWA 5DITA 3FXYA 4LGXA 4P8VA 3AS3A 1LG1A 1J4RA 1P5QA 1HXVA 1FKJA 3ARZA 3PRAA 4DROA 4MNKA 1LJYA 4QT3A 3KAIA 1NWTA 2WLYA 1HKKA 5DO2A 4DRJA 4DRQA 3O5LA 4R0XA 4ZPTR 5HUAA 4IPXA 1HKMA 2PPOA 1W1PA 4MAVA 1FKTA 1ZK6A 2KE0A 1IX5A 1FKFA 1EYMA 5HW8A 1HJVA 4DRPA 1ROUA 3IK8A 1EHNA 1NH6A 4J4OA 1JNDA 2DPEA 2DT2A 3O5OA 2PI6A 1GUVA 3G6MA 1K9TA 2DT0A 4WIWA 4JYSA 4DRKA 1H0IA 4LAWA 3WQWA 3B8SA 1FKLA 2O92A 4QZVB 1GOIA 3KCEA 3ARQA 1O6IA 1A7XA 3NI6A 4ODMA 2IF4A 1C9HA 3IKGA 1FKKA 2UZ5A 2ZQVA 5B8IC 1YATA 1E6RA 3KZ7A 4LAXA 5HTGA 5HW7A 3AS1A 4W9OA 4P8UA 1W26A 2OLHA 2XP5A 4PTMA 1YW5A 1FKHA 2DT3A 2KGJA 1Q1CA 4JFMA 4AY1A 2O9OA 3O5DA 1ZU8A 2WM0A 3JXVA 1U79A 2F2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7J A;  2M1I A;  2KI3 A;  3MDY B;  2RUQ A;  3EY6 A;  3PA7 A;  2XP9 A;  1KT0 A;  4G2P A;  4DIP A;  2JZV A;  5GPG A;  3UF8 A;  3UQA A;  4IQ2 A;  1QPL A;  3KAG A;  4JFL A;  4LAY A;  2XP6 A;  2M08 A;  4U86 A;  2Q5A A;  3TDB A;  1J4I A;  2MPH A;  1BKF A;  3O5P A;  2PBC A;  1F8A B;  4JFK A;  4W9Q A;  3KAF A;  4BF8 A;  2XPB A;  4DH0 A;  1B6C A;  1ZCN A;  1D7I A;  2RQS A;  4DRM A;  1J6Y A;  1TCO C;  4ODL A;  4TYO A;  4QIB A;  3UQI A;  2ZR6 A;  3UQB A;  2XP7 A;  3O5R A;  2PV1 A;  2ZQU A;  1R9H A;  3B7X A;  3RFW A;  1EQ3 A;  3FAP A;  4J4N A;  2FAP A;  1NSG A;  4ODQ A;  5J6E A;  4TX0 A;  4DZ3 A;  1QPF A;  2RUR A;  3O5F A;  1T11 A;  2ZQT A;  4C02 B;  4ODP A;  3NTP A;  4ODR A;  3JYJ A;  1FKS A;  3GPK A;  5HWB A;  3O5K A;  4GIV A;  4TNS A;  5HW6 A;  1F40 A;  5DIT A;  2ITK A;  2ZQS A;  2LPV A;  2RUC A;  3H9R B;  2MLY A;  2KR7 A;  2PV2 A;  2F21 A;  3TCZ A;  2MNT A;  1Q6H A;  5BXJ A;  1NMV A;  1J4R A;  1P5Q A;  4W9P A;  5I98 A;  1HXV A;  1FKJ A;  2F4E A;  4DRO A;  4QT3 A;  3KAI A;  4TW8 A;  4NNR A;  3CGM A;  4DRN A;  2XPA A;  4ODO A;  2OFN A;  4MGV A;  3VAW A;  4DRJ A;  4DRQ A;  4JFJ A;  3O5L A;  4R0X A;  2FKE A;  5HUA A;  4IPX A;  1M5Y A;  4JFI A;  2LKN A;  4U84 A;  1D7H A;  2PPO A;  2VCD A;  1FKT A;  5DIU A;  1PBK A;  1ZK6 A;  2KE0 A;  1FKI A;  4ODK A;  5D75 A;  3NRK A;  4IQC A;  1FKF A;  3UI6 A;  1EYM A;  2KO7 A;  1N1A A;  4QT2 A;  1JNS A;  5HW8 A;  4MSP A;  4DRP A;  1ROU A;  3IK8 A;  4FAP A;  1D6O A;  4J4O A;  5HKG A;  2MLX A;  2ZR4 A;  1FKR A;  3O5O A;  1Y0O A;  2Y78 A;  3IKD A;  3O5J A;  1BL4 A;  2PPP A;  1FKD A;  4TW6 A;  4DZ2 A;  2RSE A;  4DRH A;  2DG9 A;  1FAP A;  2LGO A;  3I6C A;  2N87 A;  3PRD A;  4JYS A;  4ODN A;  1FD9 A;  3KAB A;  4DRI A;  1FKG A;  4DRK A;  1FKB A;  1QZ2 A;  1JNT A;  3OOB A;  4LAW A;  1KT1 A;  4LAV A;  2DG4 A;  2XP3 A;  4ITZ A;  3CGN A;  5HT1 A;  2XP4 A;  3O5E A;  2K8I A;  1FKL A;  4GGQ A;  3ODK A;  3O5Q A;  3KAD A;  2AWG A;  2VN1 A;  3KCE A;  4N19 A;  3TC5 A;  1ROT A;  5DIV A;  1FJD A;  2MLZ A;  1A7X A;  4FN2 A;  2M2A A;  3NI6 A;  4ODM A;  3KAH A;  4O2T A;  2IF4 A;  1C9H A;  3JYM A;  3WH0 A;  3IKG A;  1FKK A;  2UZ5 A;  2ZQV A;  1J4H A;  1Q6I A;  3RGC A;  5B8I C;  1YAT A;  3KZ7 A;  4LAX A;  5HTG A;  5HW7 A;  4W9O A;  3IHZ A;  1W26 A;  2PV3 A;  1Q6U A;  2D9F A;  2XP5 A;  3PRB A;  2DG3 A;  1YW5 A;  2MF9 A;  1FKH A;  4DT4 A;  5HWC A;  2PPN A;  3UI5 A;  3O5M A;  1L1P A;  2KGJ A;  2KFW A;  3UI4 A;  1JVW A;  3O5G A;  2XP8 A;  4U85 A;  2ZR5 A;  2LJ4 A;  1Q1C A;  1NMW A;  4JFM A;  2RUD A;  3LUO A;  1PIN A;  3O5D A;  4G50 A;  3O5I A;  3KAC A;  4TW7 A;  3JXV A;  1U79 A;  2L2S A;  2F2D A; 
#chains in the Genus database with same CATH topology
 3RM9 A;  2DSU A;  2RUQ A;  4IQ2 A;  3KAG A;  1LL4 A;  1BKF A;  1W9U A;  4BF8 A;  4DH0 A;  1HKJ A;  3B9D A;  3UQI A;  3UQB A;  4DWS C;  3FAP A;  4J4N A;  4ZS6 A;  1T11 A;  4Z2L A;  2ZQT A;  4C02 B;  3NTP A;  3JYJ A;  4HBO A;  5HBF A;  3O5K A;  4NSB A;  5HW6 A;  3ARV A;  2ITK A;  2LPV A;  2RUC A;  5BXJ A;  3AQU A;  3QOK A;  1OGG A;  2FDM A;  1NWS A;  5GQB A;  4ODO A;  2OFN A;  3WIJ A;  4Z2I A;  3ARU A;  4JFJ A;  2FKE A;  1E6N A;  3TCZ A;  2LKN A;  5DIU A;  4ODK A;  4NZC A;  1ZBW A;  4IQC A;  4QT2 A;  1LL7 A;  4MSP A;  2B5U B;  1D6O A;  2ZR4 A;  4ZPV R;  1BL4 A;  2PPP A;  4TW6 A;  4DZ2 A;  2RSE A;  4ODN A;  1FKG A;  1WAW A;  1FKB A;  4DWS A;  5HT1 A;  2XP4 A;  3ARX A;  2VN1 A;  1FJD A;  5DIV A;  3GU0 A;  4O2T A;  3JYM A;  3WH0 A;  4W5U A;  1J4H A;  1Q6I A;  4P8X A;  4S3J A;  2PV3 A;  3WQV A;  2MF9 A;  1GPF A;  3WD1 A;  2WK2 A;  3WD0 A;  1LL6 A;  3ARY A;  2XP8 A;  4Z2H A;  4G50 A;  4MNL A;  1LG2 A;  3IKD A;  3MDY B;  3BXW A;  2A3C A;  4G2P A;  3UF8 A;  1VF8 A;  3ARP A;  4JFL A;  1QPL A;  4S3K A;  3WL1 A;  2Q5A A;  3ART A;  3WD3 A;  2XPB A;  1ZCN A;  2RQS A;  1D7I A;  3ARO A;  4WKF A;  4Z2J A;  1J6Y A;  1NWR A;  4ODL A;  4XAK A;  2ZR6 A;  3O5R A;  2ZQU A;  1EQ3 A;  1NSG A;  4TX0 A;  4DZ3 A;  3CHE A;  4UDM A;  2RUR A;  1ITX A;  1FFQ A;  1ZBC A;  4TNS A;  1F40 A;  2ZQS A;  3H9R B;  2MLY A;  1ZL1 A;  2DSZ A;  3B9A A;  4HAR A;  2F21 A;  1OWQ A;  1WNO A;  3WKZ A;  2P4V A;  5I98 A;  4MTV A;  1JNE A;  3CZ8 A;  2G41 A;  4NNR A;  2XPA A;  2DSW A;  3VAW A;  1EIB A;  1SR0 A;  4MPK A;  1FKI A;  3NRK A;  3UI6 A;  1JNS A;  1E6Z A;  1ZBV A;  5GPR A;  4FAP A;  3OA5 A;  5HKG A;  2AOS A;  2MLX A;  1FKR A;  1TFV A;  2Y78 A;  3O5J A;  1FKD A;  1ZBK A;  2DG9 A;  1FAP A;  2LGO A;  1E44 A;  1FD9 A;  3KAB A;  4DRI A;  3OOB A;  3B9E A;  1ZB5 A;  1KT1 A;  2XP3 A;  3CHC A;  4ITZ A;  5JH8 A;  3ALG A;  4DWS B;  3O5E A;  1RD6 A;  3KAD A;  1E15 A;  2AWG A;  2PN0 A;  3RME A;  3TC5 A;  4L72 B;  1W9V A;  2MLZ A;  4FN2 A;  2M2A A;  3KAH A;  3RGC A;  3FY1 A;  3PRB A;  2D9F A;  1XHG A;  5HWC A;  4DT4 A;  3AS2 A;  2PPN A;  3O5M A;  2DT1 A;  1SYT A;  1JVW A;  2LJ4 A;  3CHF A;  1OGB A;  1LQ0 A;  4TW7 A;  3RM8 A;  4N19 A;  2L2S A;  1HKI A;  3EY6 A;  3PA7 A;  4WK9 A;  2XP9 A;  4DIP A;  2JZV A;  3UQA A;  4LAY A;  4L3N A;  1J4I A;  1X6N A;  2MPH A;  4IT6 A;  4P8W A;  1E9L A;  3CHD A;  4JFK A;  4W9Q A;  3KAF A;  4Z2K A;  4DRM A;  2IUZ A;  1TCO C;  4TYO A;  4ZPW R;  2PV1 A;  1R9H A;  3B7X A;  3RFW A;  3ARR A;  1H0G A;  5J6E A;  1QPF A;  3O5F A;  5DEZ A;  1W1Y A;  4R5E A;  5HWB A;  4GIV A;  1W9P A;  2KR7 A;  2PV2 A;  2MNT A;  1Q6H A;  1NMV A;  3PR9 A;  4W9P A;  4KQZ A;  4IT4 A;  2F4E A;  1HJW A;  4MNM A;  4TW8 A;  5DF0 A;  4DRN A;  4MGV A;  4URI A;  1M5Y A;  4JFI A;  4U84 A;  1D7H A;  2VCD A;  1PBK A;  2ETN A;  5D75 A;  2KO7 A;  1N1A A;  1FFR A;  2A3E A;  3ARW A;  2A3B A;  1Y0O A;  4HBE A;  2YBT A;  4DRH A;  3I6C A;  3PRD A;  2N87 A;  4WJX A;  3AS0 A;  1QZ2 A;  1JNT A;  4WKA A;  4LAV A;  2DG4 A;  3CGN A;  3ALF A;  3ARS A;  4GGQ A;  2K8I A;  3ODK A;  1EDQ A;  1W1T A;  3O5Q A;  1ROT A;  1UR8 A;  3EIP A;  4Q22 A;  2DSV A;  2EUL A;  4ML4 A;  3IHZ A;  2QF8 A;  1Q6U A;  3GTY X;  2DG3 A;  3WL0 A;  2F23 A;  3UI5 A;  1L1P A;  3UI4 A;  2KFW A;  1UR9 A;  3O5G A;  4U85 A;  2ZR5 A;  2ESC A;  1NMW A;  2RUD A;  3LUO A;  1PIN A;  3O5I A;  3RM4 A;  4WKH A;  3KAC A;  2WLZ A;  3CGM A;  4U86 A;  1D7J A;  2M1I A;  2KI3 A;  3G6L A;  1KT0 A;  3WD4 A;  1E6P A;  5GPG A;  1JCH B;  4DWS D;  3TDB A;  4MNJ A;  2XP6 A;  2M08 A;  1D2K A;  2YBU A;  3O5P A;  2G8Z A;  1F8A B;  2PBC A;  1HJX A;  3W4R A;  1B6C A;  1XRV A;  1W1V A;  4QIB A;  3WD2 A;  1CTN A;  2XP7 A;  3BMB A;  2B31 A;  1WB0 A;  1X6L A;  4KR0 B;  2FAP A;  3CH9 A;  4ODQ A;  4Q7N A;  1NWU A;  2A3A A;  4ODP A;  4ODR A;  1FKS A;  3GPK A;  4Z2G A;  1KFW A;  5DIT A;  3FXY A;  4LGX A;  4P8V A;  3AS3 A;  1LG1 A;  1J4R A;  1P5Q A;  1HXV A;  1FKJ A;  3ARZ A;  3PRA A;  4DRO A;  4MNK A;  1LJY A;  4QT3 A;  3KAI A;  1NWT A;  2WLY A;  1HKK A;  5DO2 A;  4DRJ A;  4DRQ A;  3O5L A;  4R0X A;  4ZPT R;  5HUA A;  4IPX A;  1HKM A;  2PPO A;  1W1P A;  4MAV A;  1FKT A;  1ZK6 A;  2KE0 A;  1IX5 A;  1FKF A;  1EYM A;  5HW8 A;  1HJV A;  4DRP A;  1ROU A;  3IK8 A;  1EHN A;  1NH6 A;  4J4O A;  1JND A;  2DPE A;  2DT2 A;  3O5O A;  2PI6 A;  1GUV A;  3G6M A;  1K9T A;  2DT0 A;  4WIW A;  4JYS A;  4DRK A;  1H0I A;  4LAW A;  3WQW A;  3B8S A;  1FKL A;  2O92 A;  4QZV B;  1GOI A;  3KCE A;  3ARQ A;  1O6I A;  1A7X A;  3NI6 A;  4ODM A;  2IF4 A;  1C9H A;  3IKG A;  1FKK A;  2UZ5 A;  1GRJ A;  2ZQV A;  5B8I C;  1YAT A;  1E6R A;  3KZ7 A;  4LAX A;  5HTG A;  5HW7 A;  3AS1 A;  4W9O A;  4P8U A;  1W26 A;  2OLH A;  2XP5 A;  4PTM A;  1YW5 A;  1FKH A;  2DT3 A;  2KGJ A;  1Q1C A;  4JFM A;  4AY1 A;  2O9O A;  3O5D A;  1ZU8 A;  2WM0 A;  3JXV A;  1U79 A;  2F2D A; 
#chains in the Genus database with same CATH homology
 3RM9 A;  2DSU A;  2RUQ A;  4IQ2 A;  3KAG A;  1LL4 A;  1BKF A;  1W9U A;  4BF8 A;  4DH0 A;  1HKJ A;  3B9D A;  3UQI A;  3UQB A;  4DWS C;  3FAP A;  4J4N A;  4ZS6 A;  1T11 A;  4Z2L A;  2ZQT A;  4C02 B;  3NTP A;  3JYJ A;  4HBO A;  5HBF A;  3O5K A;  4NSB A;  5HW6 A;  3ARV A;  2ITK A;  2LPV A;  2RUC A;  5BXJ A;  3AQU A;  3QOK A;  1OGG A;  2FDM A;  1NWS A;  5GQB A;  4ODO A;  2OFN A;  3WIJ A;  4Z2I A;  3ARU A;  4JFJ A;  2FKE A;  1E6N A;  3TCZ A;  2LKN A;  5DIU A;  4ODK A;  4NZC A;  1ZBW A;  4IQC A;  4QT2 A;  1LL7 A;  4MSP A;  1D6O A;  2ZR4 A;  4ZPV R;  1BL4 A;  2PPP A;  4TW6 A;  4DZ2 A;  2RSE A;  4ODN A;  1FKG A;  1WAW A;  1FKB A;  4DWS A;  5HT1 A;  2XP4 A;  3ARX A;  2VN1 A;  1FJD A;  5DIV A;  4O2T A;  3JYM A;  3WH0 A;  4W5U A;  1J4H A;  1Q6I A;  4P8X A;  4S3J A;  2PV3 A;  3WQV A;  2MF9 A;  1GPF A;  3WD1 A;  2WK2 A;  3WD0 A;  1LL6 A;  3ARY A;  2XP8 A;  4Z2H A;  4G50 A;  4MNL A;  1LG2 A;  3IKD A;  3MDY B;  3BXW A;  2A3C A;  4G2P A;  3UF8 A;  1VF8 A;  3ARP A;  4JFL A;  1QPL A;  4S3K A;  3WL1 A;  2Q5A A;  3ART A;  3WD3 A;  2XPB A;  1ZCN A;  2RQS A;  1D7I A;  3ARO A;  4WKF A;  4Z2J A;  1J6Y A;  1NWR A;  4ODL A;  4XAK A;  2ZR6 A;  3O5R A;  2ZQU A;  1EQ3 A;  1NSG A;  4TX0 A;  4DZ3 A;  3CHE A;  2RUR A;  1ITX A;  1FFQ A;  1ZBC A;  4TNS A;  1F40 A;  2ZQS A;  3H9R B;  2MLY A;  1ZL1 A;  2DSZ A;  3B9A A;  4HAR A;  2F21 A;  1OWQ A;  1WNO A;  3WKZ A;  5I98 A;  4MTV A;  1JNE A;  3CZ8 A;  2G41 A;  4NNR A;  2XPA A;  2DSW A;  3VAW A;  1EIB A;  1SR0 A;  4MPK A;  1FKI A;  3NRK A;  3UI6 A;  1JNS A;  1E6Z A;  1ZBV A;  5GPR A;  4FAP A;  3OA5 A;  5HKG A;  2AOS A;  2MLX A;  1FKR A;  1TFV A;  2Y78 A;  3O5J A;  1FKD A;  1ZBK A;  2DG9 A;  1FAP A;  2LGO A;  1FD9 A;  3KAB A;  4DRI A;  3OOB A;  3B9E A;  1ZB5 A;  1KT1 A;  2XP3 A;  3CHC A;  4ITZ A;  5JH8 A;  3ALG A;  4DWS B;  3O5E A;  1RD6 A;  1E15 A;  2AWG A;  3KAD A;  3RME A;  3TC5 A;  4L72 B;  1W9V A;  2MLZ A;  4FN2 A;  2M2A A;  3KAH A;  3RGC A;  3FY1 A;  3PRB A;  2D9F A;  1XHG A;  5HWC A;  4DT4 A;  3AS2 A;  2PPN A;  3O5M A;  2DT1 A;  1SYT A;  1JVW A;  2LJ4 A;  3CHF A;  1OGB A;  1LQ0 A;  4TW7 A;  3RM8 A;  4N19 A;  2L2S A;  1HKI A;  3EY6 A;  3PA7 A;  4WK9 A;  2XP9 A;  4DIP A;  2JZV A;  3UQA A;  4LAY A;  4L3N A;  1J4I A;  1X6N A;  2MPH A;  4IT6 A;  4P8W A;  1E9L A;  3CHD A;  4JFK A;  4W9Q A;  3KAF A;  4Z2K A;  4DRM A;  2IUZ A;  1TCO C;  4TYO A;  4ZPW R;  2PV1 A;  1R9H A;  3B7X A;  3RFW A;  3ARR A;  1H0G A;  5J6E A;  1QPF A;  3O5F A;  5DEZ A;  1W1Y A;  4R5E A;  5HWB A;  4GIV A;  1W9P A;  2KR7 A;  2PV2 A;  2MNT A;  1Q6H A;  1NMV A;  3PR9 A;  4W9P A;  4KQZ A;  4IT4 A;  2F4E A;  1HJW A;  4MNM A;  4TW8 A;  5DF0 A;  4DRN A;  4MGV A;  4URI A;  1M5Y A;  4JFI A;  4U84 A;  1D7H A;  2VCD A;  1PBK A;  5D75 A;  2KO7 A;  1N1A A;  1FFR A;  2A3E A;  3ARW A;  2A3B A;  1Y0O A;  4HBE A;  2YBT A;  4DRH A;  3I6C A;  3PRD A;  2N87 A;  4WJX A;  3AS0 A;  1QZ2 A;  1JNT A;  4WKA A;  4LAV A;  2DG4 A;  3CGN A;  3ALF A;  3ARS A;  4GGQ A;  2K8I A;  3ODK A;  1EDQ A;  1W1T A;  3O5Q A;  1ROT A;  1UR8 A;  4Q22 A;  2DSV A;  4ML4 A;  3IHZ A;  2QF8 A;  1Q6U A;  2DG3 A;  3WL0 A;  3UI5 A;  1L1P A;  3UI4 A;  2KFW A;  1UR9 A;  3O5G A;  4U85 A;  2ZR5 A;  2ESC A;  1NMW A;  2RUD A;  3LUO A;  1PIN A;  3O5I A;  3RM4 A;  4WKH A;  3KAC A;  2WLZ A;  3CGM A;  4U86 A;  1D7J A;  2M1I A;  2KI3 A;  3G6L A;  1KT0 A;  3WD4 A;  1E6P A;  5GPG A;  4DWS D;  3TDB A;  4MNJ A;  2XP6 A;  2M08 A;  1D2K A;  2YBU A;  3O5P A;  2G8Z A;  1F8A B;  2PBC A;  1HJX A;  3W4R A;  1B6C A;  1XRV A;  1W1V A;  4QIB A;  3WD2 A;  1CTN A;  2XP7 A;  2B31 A;  1WB0 A;  1X6L A;  4KR0 B;  2FAP A;  3CH9 A;  4ODQ A;  4Q7N A;  1NWU A;  2A3A A;  4ODP A;  4ODR A;  1FKS A;  3GPK A;  4Z2G A;  1KFW A;  5DIT A;  3FXY A;  4LGX A;  4P8V A;  3AS3 A;  1LG1 A;  1J4R A;  1P5Q A;  1HXV A;  1FKJ A;  3ARZ A;  3PRA A;  4DRO A;  4MNK A;  1LJY A;  4QT3 A;  3KAI A;  1NWT A;  2WLY A;  1HKK A;  5DO2 A;  4DRJ A;  4DRQ A;  3O5L A;  4R0X A;  4ZPT R;  5HUA A;  4IPX A;  1HKM A;  2PPO A;  1W1P A;  4MAV A;  1FKT A;  1ZK6 A;  2KE0 A;  1IX5 A;  1FKF A;  1EYM A;  5HW8 A;  1HJV A;  4DRP A;  1ROU A;  3IK8 A;  1EHN A;  1NH6 A;  4J4O A;  1JND A;  2DPE A;  2DT2 A;  3O5O A;  2PI6 A;  1GUV A;  3G6M A;  1K9T A;  2DT0 A;  4WIW A;  4JYS A;  4DRK A;  1H0I A;  4LAW A;  3WQW A;  3B8S A;  1FKL A;  2O92 A;  4QZV B;  1GOI A;  3KCE A;  3ARQ A;  1O6I A;  1A7X A;  3NI6 A;  4ODM A;  2IF4 A;  1C9H A;  3IKG A;  1FKK A;  2UZ5 A;  2ZQV A;  5B8I C;  1YAT A;  1E6R A;  3KZ7 A;  4LAX A;  5HTG A;  5HW7 A;  3AS1 A;  4W9O A;  4P8U A;  1W26 A;  2OLH A;  2XP5 A;  4PTM A;  1YW5 A;  1FKH A;  2DT3 A;  2KGJ A;  1Q1C A;  4JFM A;  4AY1 A;  2O9O A;  3O5D A;  1ZU8 A;  2WM0 A;  3JXV A;  1U79 A;  2F2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...