2PV2A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Chaperone surA
total genus 29
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv2A00
2FAPA 2VCDA 1ZK6A 1HXVA 2IF4A 1EYMA 2FKEA 2MF9A 4JYSA 1D7HA 2PPPA 4ODMA 4TNSA 3RGCA 3UF8A 3KAIA 4DT4A 2N87A 1J4IA 2KI3A 3KADA 4J4OA 3NRKA 5HW7A 1NSGA 1BKFA 3O5JA 1T11A 1PINA 4G50A 5DIUA 5DITA 5HUAA 2PV2A 3PA7A 5D75A 2M1IA 2RSEA 3IHZA 1KT0A 3TC5A 3O5RA 4JFLA 4DRNA 2PV3A 2KO7A 3O5GA 5HW6A 4U85A 2M08A 2XP7A 4ODOA 4DROA 2RUCA 1Q6HA 2D9FA 1J4HA 3EY6A 4NNRA 1C9HA 3IKGA 1FKKA 4LAXA 1QPLA 3H9RB 4C02B 2ZQVA 1B6CA 2LPVA 4W9QA 3KAGA 3MDYB 2F4EA 3UQBA 4ODRA 3O5KA 2XP5A 4IPXA 1F8AB 2XPAA 1FD9A 4QT3A 3PRDA 1R9HA 4QT2A 2Y78A 2XPBA 2ZQSA 4JFIA 5BXJA 1FKDA 2ZR4A 1J6YA 3O5PA 2PPNA 2LJ4A 1QPFA 3JYJA 2PPOA 4TW7A 1Q6IA 4TW8A 3O5EA 3PRBA 1JNSA 4MGVA 1NMWA 3O5LA 5GPGA 4ODPA 2XP6A 4ODQA 2RUDA 1TCOC 1FKIA 1YW5A 3B7XA 3JXVA 4LAYA 2KFWA 2XP8A 4MSPA 4U84A 3O5QA 4DZ3A 5HWBA 4DIPA 5HTGA 1Q1CA 2XP4A 1Y0OA 3OOBA 1QZ2A 1D7JA 3RFWA 2XP9A 1F40A 1P5QA 1FKHA 5HT1A 4DRKA 1ZCNA 4DRQA 2F2DA 5I98A 2ZR5A 3WH0A 2LKNA 2ZQTA 4IQCA 1FJDA 4DZ2A 3KZ7A 4ODNA 1FKLA 2ZR6A 2JZVA 1BL4A 3ODKA 3UQAA 2K8IA 4DRMA 1L1PA 3O5IA 4J4NA 2RUQA 3GPKA 3O5FA 2DG4A 3NTPA 4DRHA 4GGQA 3I6CA 1JVWA 2MLYA 2KR7A 3O5OA 2PV1A 4W9PA 4GIVA 1FKTA 4FAPA 4U86A 4DH0A 4DRJA 1FKRA 4TX0A 3KABA 3UI6A 4FN2A 5HKGA 2F21A 4G2PA 1KT1A 3KCEA 4JFKA 4BF8A 1ROTA 4TW6A 4W9OA 2OFNA 1J4RA 1D6OA 3NI6A 5HW8A 1D7IA 2MNTA 2AWGA 1FKSA 2UZ5A 3UI5A 4DRIA 3KAFA 3LUOA 1FKJA 2KGJA 2VN1A 4ODLA 2L2SA 4TYOA 2M2AA 3TDBA 4DRPA 2PBCA 3IK8A 1NMVA 5B8IC 4JFJA 3UQIA 3JYMA 4R0XA 1FAPA 3CGMA 1FKFA 5DIVA 1FKBA 1ROUA 3FAPA 2ITKA 3KACA 3O5DA 4IQ2A 1Q6UA 1A7XA 1JNTA 1M5YA 1YATA 3O5MA 4O2TA 2MLXA 3CGNA 4LAWA 3KAHA 2LGOA 5HWCA 5J6EA 1N1AA 1PBKA 1EQ3A 2ZQUA 2MPHA 3VAWA 2XP3A 4JFMA 2Q5AA 2DG9A 4ODKA 2DG3A 1U79A 2KE0A 1W26A 2RQSA 2MLZA 4ITZA 2RURA 4N19A 4LAVA 4QIBA 3TCZA 3IKDA 1FKGA 3UI4A
chains in the Genus database with same CATH superfamily
1LG2A 2VCDA 1HXVA 1EYMA 1EDQA 4JYSA 1D7HA 1SR0A 3AS2A 2N87A 4WIWA 3KADA 3ARXA 3NRKA 2O9OA 1NSGA 4G50A 3WD1A 1HKIA 3PA7A 2M1IA 1WNOA 2ESCA 3IHZA 2G8ZA 4NSBA 4DRNA 3FXYA 4Z2KA 2B31A 4ODOA 4DROA 5DF0A 1FKKA 2G41A 4Z2HA 2ZQVA 3QOKA 2LPVA 4W9QA 1X6LA 4ODRA 3O5KA 1F8AB 1LL4A 2XPAA 2EULA 4QT3A 4WKHA 3PRDA 1OGGA 2Y78A 2ZQSA 5BXJA 4LGXA 1QPFA 4TW7A 3AS1A 4S3KA 1Q6IA 3CHFA 3O5EA 3PRBA 1HJWA 3O5LA 2XP6A 5GPRA 3JXVA 2KFWA 3OOBA 1QZ2A 1D7JA 3RFWA 1LL6A 4DRKA 1ZCNA 4URIA 4IQCA 4W5UA 4ODNA 2F23A 2DT2A 4WKAA 3UQAA 2K8IA 3O5IA 2DG4A 1ZB5A 3I6CA 1TFVA 4Q22A 3O5OA 2KR7A 1JNDA 4DH0A 1NWRA 2ETNA 3KABA 5HKGA 4MNKA 4MNLA 3WIJA 2AOSA 2DSZA 1J4RA 4ZPVR 1D7IA 2WLZA 1FKSA 3ARQA 3KAFA 1FKJA 3ARSA 2PI6A 1LQ0A 3AROA 1JCHB 3ARPA 4JFJA 2DT0A 1H0GA 1FKFA 3B9DA 1FKBA 1ROUA 2ITKA 1Q6UA 1M5YA 2MLXA 3CGNA 3FY1A 2LGOA 2ZQUA 1ZBVA 3WD3A 4Z2JA 1ZU8A 3VAWA 1RD6A 2Q5AA 4ODKA 2DG3A 4N19A 1W26A 2KE0A 1HKJA 2DPEA 2RURA 4IT6A 1W1YA 4HARA 2FAPA 1ZK6A 2FKEA 2MF9A 4R5EA 3RGCA 2WK2A 3UF8A 4DT4A 2KI3A 4DWSB 4P8XA 3WD0A 1H0IA 4WKFA 1BKFA 1GPFA 5DITA 1EHNA 1PINA 3WL0A 5D75A 5HBFA 3TC5A 2KO7A 4U85A 2M08A 2XP7A 1J4HA 2YBUA 2YBTA 3EY6A 4NNRA 4LAXA 1QPLA 4MTVA 1B6CA 1SYTA 1FD9A 1K9TA 1R9HA 4QT2A 2XPBA 1FKDA 2ZR4A 1W1VA 3JYJA 2IUZA 2PPOA 1JNSA 4ODPA 2RUDA 2XP8A 3ARVA 1W9UA 5HTGA 1Q1CA 2XP4A 5DO2A 1Y0OA 1E6ZA 1F40A 4Z2LA 2ZR5A 2LKNA 3KZ7A 1FKLA 1BL4A 1L1PA 4DRMA 4J4NA 3O5FA 3NTPA 3PRAA 1JVWA 3ALGA 2PN0A 4FAPA 4DRJA 1FKRA 2A3EA 4TX0A 5GQBA 4FN2A 2F21A 1KT1A 1LL7A 3KCEA 4JFKA 4WJXA 3WQVA 4TW6A 1HKKA 2OFNA 1D6OA 3NI6A 2AWGA 2A3BA 1LG1A 1XHGA 3ARYA 1E6PA 2B5UB 2KGJA 2OLHA 1LJYA 3G6LA 4ZS6A 3AS0A 4DWSC 1E9LA 3KACA 1A7XA 4DWSD 1JNTA 1YATA 4Z2GA 4PTMA 3WQWA 1PBKA 4MNMA 4S3JA 4UDMA 2MPHA 3BXWA 1FFRA 2XP3A 4JFMA 4QIBA 3B9AA 4LAVA 3IKDA 2WM0A 4ZPTR 3WD2A 1EIBA 4TNSA 1WB0A 3ARTA 4MPKA 3AQUA 1NWSA 5HUAA 1T11A 1WAWA 2PV2A 3ALFA 4KQZA 3CHCA 3O5RA 4JFLA 5HW6A 4L72B 1Q6HA 2D9FA 3B8SA 1C9HA 3CH9A 3IKGA 3WKZA 1KFWA 2F4EA 3ARZA 2XP5A 4IPXA 1OWQA 4WK9A 4JFIA 1J6YA 3O5PA 2LJ4A 4MAVA 4TW8A 4L3NA 4ODQA 3RM4A 2DT1A 1FKIA 1YW5A 4U84A 3O5QA 4DZ3A 5HWBA 1FKHA 5HT1A 4QZVB 4DRQA 2F2DA 3CZ8A 3CHDA 4DZ2A 1GRJA 4NZCA 2RUQA 1O6IA 1ZBKA 2MLYA 2PV1A 1UR9A 4XAKA 1CTNA 2DSVA 4ZPWR 4G2PA 4BF8A 4IT4A 1ROTA 1NH6A 4W9OA 5HW8A 2UZ5A 3UI5A 1W1PA 1W9VA 1ZBCA 1NWUA 3ARUA 1HKMA 3B9EA 3LUOA 1NWTA 3EIPA 2VN1A 4ODLA 2L2SA 3G6MA 2M2AA 4TYOA 1NMVA 1FFQA 4R0XA 1FAPA 3CGMA 3FAPA 1JNEA 3O5DA 2DSUA 4O2TA 4P8UA 2QF8A 1GOIA 4DWSA 5J6EA 1EQ3A 2A3CA 5DEZA 1HJXA 1U79A 2RQSA 4ITZA 2MLZA 1XRVA 1ITXA 1FKGA 3UI4A 2IF4A 1W1TA 1OGBA 2PPPA 4ODMA 3KAIA 1J4IA 3GU0A 1X6NA 4J4OA 5HW7A 3O5JA 5DIUA 3ARRA 2O92A 3WL1A 3PR9A 2RSEA 1KT0A 1VF8A 1HJVA 2PV3A 3O5GA 2WLYA 2DSWA 2RUCA 1E15A 1E6RA 3RMEA 3H9RB 4C02B 3KAGA 3MDYB 3UQBA 1W9PA 2A3AA 3CHEA 4KR0B 4P8WA 2PPNA 4MGVA 1NMWA 4HBEA 5GPGA 4Z2IA 1TCOC 4LAYA 4MSPA 3B7XA 2FDMA 4DIPA 1E44A 2XP9A 1P5QA 1E6NA 5I98A 3WH0A 1FJDA 2ZQTA 2DT3A 3GTYX 4AY1A 2ZR6A 2JZVA 3ODKA 4Q7NA 4MNJA 3GPKA 4DRHA 4GGQA 4W9PA 4GIVA 1FKTA 4U86A 3UI6A 1D2KA 3W4RA 1GUVA 2MNTA 2P4VA 4P8VA 4DRIA 3OA5A 3RM8A 3ARWA 3TDBA 4DRPA 5JH8A 2PBCA 3IK8A 3WD4A 5B8IC 3UQIA 3JYMA 5DIVA 1UR8A 4IQ2A 3O5MA 4LAWA 4ML4A 3RM9A 3KAHA 5HWCA 1IX5A 1N1AA 1ZL1A 4HBOA 2DG9A 3AS3A 3BMBA 3TCZA 1ZBWA
chains in the Genus database with same CATH topology
1LG2A 2VCDA 1HXVA 1EYMA 1EDQA 4JYSA 1D7HA 1SR0A 3AS2A 2N87A 4WIWA 3KADA 3ARXA 3NRKA 2O9OA 1NSGA 4G50A 3WD1A 1HKIA 3PA7A 2M1IA 1WNOA 2ESCA 3IHZA 2G8ZA 4NSBA 4DRNA 3FXYA 4Z2KA 2B31A 4ODOA 4DROA 5DF0A 1FKKA 2G41A 4Z2HA 2ZQVA 3QOKA 2LPVA 4W9QA 1X6LA 4ODRA 3O5KA 1F8AB 1LL4A 2XPAA 4WKHA 4QT3A 3PRDA 1OGGA 2Y78A 2ZQSA 5BXJA 4LGXA 1QPFA 4TW7A 3AS1A 4S3KA 1Q6IA 3CHFA 3O5EA 3PRBA 1HJWA 3O5LA 2XP6A 5GPRA 3JXVA 2KFWA 3OOBA 1QZ2A 1D7JA 3RFWA 1LL6A 4DRKA 1ZCNA 4URIA 4IQCA 4W5UA 4ODNA 2DT2A 4WKAA 3UQAA 2K8IA 3O5IA 2DG4A 1ZB5A 3I6CA 1TFVA 4Q22A 3O5OA 2KR7A 1JNDA 4DH0A 1NWRA 3KABA 5HKGA 4MNKA 4MNLA 3WIJA 2AOSA 2DSZA 1J4RA 4ZPVR 1D7IA 2WLZA 1FKSA 3ARQA 3KAFA 1FKJA 3ARSA 2PI6A 1LQ0A 3AROA 3ARPA 4JFJA 2DT0A 1H0GA 1FKFA 3B9DA 1FKBA 1ROUA 2ITKA 1Q6UA 1M5YA 2MLXA 3CGNA 3FY1A 2LGOA 2ZQUA 1ZBVA 3WD3A 4Z2JA 1ZU8A 3VAWA 1RD6A 2Q5AA 4ODKA 2DG3A 4N19A 1W26A 2KE0A 1HKJA 2DPEA 2RURA 4IT6A 1W1YA 4HARA 2FAPA 1ZK6A 2FKEA 2MF9A 4R5EA 3RGCA 2WK2A 3UF8A 4DT4A 2KI3A 4DWSB 4P8XA 3WD0A 1H0IA 4WKFA 1BKFA 1GPFA 5DITA 1EHNA 1PINA 3WL0A 5D75A 5HBFA 3TC5A 2KO7A 4U85A 2M08A 2XP7A 1J4HA 2YBUA 2YBTA 3EY6A 4NNRA 4LAXA 1QPLA 4MTVA 1B6CA 1SYTA 1FD9A 1K9TA 1R9HA 4QT2A 2XPBA 1FKDA 2ZR4A 1W1VA 3JYJA 2IUZA 2PPOA 1JNSA 4ODPA 2RUDA 2XP8A 3ARVA 1W9UA 5HTGA 1Q1CA 2XP4A 5DO2A 1Y0OA 1E6ZA 1F40A 4Z2LA 2ZR5A 2LKNA 3KZ7A 1FKLA 1BL4A 1L1PA 4DRMA 4J4NA 3O5FA 3NTPA 3PRAA 1JVWA 3ALGA 4FAPA 4DRJA 1FKRA 2A3EA 4TX0A 5GQBA 4FN2A 2F21A 1KT1A 1LL7A 3KCEA 4JFKA 4WJXA 3WQVA 4TW6A 1HKKA 2OFNA 1D6OA 3NI6A 2AWGA 2A3BA 1LG1A 1XHGA 3ARYA 1E6PA 2KGJA 2OLHA 1LJYA 3G6LA 4ZS6A 3AS0A 4DWSC 1E9LA 3KACA 1A7XA 4DWSD 1JNTA 1YATA 4Z2GA 4PTMA 3WQWA 1PBKA 4MNMA 4S3JA 2MPHA 3BXWA 1FFRA 2XP3A 4JFMA 4QIBA 3B9AA 4LAVA 3IKDA 2WM0A 4ZPTR 3WD2A 1EIBA 4TNSA 1WB0A 3ARTA 4MPKA 3AQUA 1NWSA 5HUAA 1T11A 1WAWA 2PV2A 3ALFA 4KQZA 3CHCA 3O5RA 4JFLA 5HW6A 4L72B 1Q6HA 2D9FA 3B8SA 1C9HA 3CH9A 3IKGA 3WKZA 1KFWA 2F4EA 3ARZA 2XP5A 4IPXA 1OWQA 4WK9A 4JFIA 1J6YA 3O5PA 2LJ4A 4MAVA 4TW8A 4L3NA 4ODQA 3RM4A 2DT1A 1FKIA 1YW5A 4U84A 3O5QA 4DZ3A 5HWBA 1FKHA 5HT1A 4QZVB 4DRQA 2F2DA 3CZ8A 3CHDA 4DZ2A 4NZCA 2RUQA 1O6IA 1ZBKA 2MLYA 2PV1A 1UR9A 4XAKA 1CTNA 2DSVA 4ZPWR 4G2PA 4BF8A 4IT4A 1ROTA 1NH6A 4W9OA 5HW8A 2UZ5A 3UI5A 1W1PA 1W9VA 1ZBCA 1NWUA 3ARUA 1HKMA 3B9EA 3LUOA 1NWTA 2VN1A 4ODLA 2L2SA 3G6MA 2M2AA 4TYOA 1NMVA 1FFQA 4R0XA 1FAPA 3CGMA 3FAPA 1JNEA 3O5DA 2DSUA 4O2TA 4P8UA 2QF8A 1GOIA 4DWSA 5J6EA 1EQ3A 2A3CA 5DEZA 1HJXA 1U79A 2RQSA 4ITZA 2MLZA 1XRVA 1ITXA 1FKGA 3UI4A 2IF4A 1W1TA 1OGBA 2PPPA 4ODMA 3KAIA 1J4IA 1X6NA 4J4OA 5HW7A 3O5JA 5DIUA 3ARRA 2O92A 3WL1A 3PR9A 2RSEA 1KT0A 1VF8A 1HJVA 2PV3A 3O5GA 2WLYA 2DSWA 2RUCA 1E15A 1E6RA 3RMEA 3H9RB 4C02B 3KAGA 3MDYB 3UQBA 1W9PA 2A3AA 3CHEA 4KR0B 4P8WA 2PPNA 4MGVA 1NMWA 4HBEA 5GPGA 4Z2IA 1TCOC 4LAYA 4MSPA 3B7XA 2FDMA 4DIPA 2XP9A 1P5QA 1E6NA 5I98A 3WH0A 1FJDA 2ZQTA 2DT3A 4AY1A 2ZR6A 2JZVA 3ODKA 4Q7NA 4MNJA 3GPKA 4DRHA 4GGQA 4W9PA 4GIVA 1FKTA 4U86A 3UI6A 1D2KA 3W4RA 1GUVA 2MNTA 4P8VA 4DRIA 3OA5A 3RM8A 3ARWA 3TDBA 4DRPA 5JH8A 2PBCA 3IK8A 3WD4A 5B8IC 3UQIA 3JYMA 5DIVA 1UR8A 4IQ2A 3O5MA 4LAWA 4ML4A 3RM9A 3KAHA 5HWCA 1IX5A 1N1AA 1ZL1A 4HBOA 2DG9A 3AS3A 3TCZA 1ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  2VCD A;  1ZK6 A;  1HXV A;  2IF4 A;  1EYM A;  2FKE A;  2MF9 A;  4JYS A;  1D7H A;  2PPP A;  4ODM A;  4TNS A;  3RGC A;  3UF8 A;  3KAI A;  4DT4 A;  2N87 A;  1J4I A;  2KI3 A;  3KAD A;  4J4O A;  3NRK A;  5HW7 A;  1NSG A;  1BKF A;  3O5J A;  1T11 A;  1PIN A;  4G50 A;  5DIU A;  5DIT A;  5HUA A;  2PV2 A;  3PA7 A;  5D75 A;  2M1I A;  2RSE A;  3IHZ A;  1KT0 A;  3TC5 A;  3O5R A;  4JFL A;  4DRN A;  2PV3 A;  2KO7 A;  3O5G A;  5HW6 A;  4U85 A;  2M08 A;  2XP7 A;  4ODO A;  4DRO A;  2RUC A;  1Q6H A;  2D9F A;  1J4H A;  3EY6 A;  4NNR A;  1C9H A;  3IKG A;  1FKK A;  4LAX A;  1QPL A;  3H9R B;  4C02 B;  2ZQV A;  1B6C A;  2LPV A;  4W9Q A;  3KAG A;  3MDY B;  2F4E A;  3UQB A;  4ODR A;  3O5K A;  2XP5 A;  4IPX A;  1F8A B;  2XPA A;  1FD9 A;  4QT3 A;  3PRD A;  1R9H A;  4QT2 A;  2Y78 A;  2XPB A;  2ZQS A;  4JFI A;  5BXJ A;  1FKD A;  2ZR4 A;  1J6Y A;  3O5P A;  2PPN A;  2LJ4 A;  1QPF A;  3JYJ A;  2PPO A;  4TW7 A;  1Q6I A;  4TW8 A;  3O5E A;  3PRB A;  1JNS A;  4MGV A;  1NMW A;  3O5L A;  5GPG A;  4ODP A;  2XP6 A;  4ODQ A;  2RUD A;  1TCO C;  1FKI A;  1YW5 A;  3B7X A;  3JXV A;  4LAY A;  2KFW A;  2XP8 A;  4MSP A;  4U84 A;  3O5Q A;  4DZ3 A;  5HWB A;  4DIP A;  5HTG A;  1Q1C A;  2XP4 A;  1Y0O A;  3OOB A;  1QZ2 A;  1D7J A;  3RFW A;  2XP9 A;  1F40 A;  1P5Q A;  1FKH A;  5HT1 A;  4DRK A;  1ZCN A;  4DRQ A;  2F2D A;  5I98 A;  2ZR5 A;  3WH0 A;  2LKN A;  2ZQT A;  4IQC A;  1FJD A;  4DZ2 A;  3KZ7 A;  4ODN A;  1FKL A;  2ZR6 A;  2JZV A;  1BL4 A;  3ODK A;  3UQA A;  2K8I A;  4DRM A;  1L1P A;  3O5I A;  4J4N A;  2RUQ A;  3GPK A;  3O5F A;  2DG4 A;  3NTP A;  4DRH A;  4GGQ A;  3I6C A;  1JVW A;  2MLY A;  2KR7 A;  3O5O A;  2PV1 A;  4W9P A;  4GIV A;  1FKT A;  4FAP A;  4U86 A;  4DH0 A;  4DRJ A;  1FKR A;  4TX0 A;  3KAB A;  3UI6 A;  4FN2 A;  5HKG A;  2F21 A;  4G2P A;  1KT1 A;  3KCE A;  4JFK A;  4BF8 A;  1ROT A;  4TW6 A;  4W9O A;  2OFN A;  1J4R A;  1D6O A;  3NI6 A;  5HW8 A;  1D7I A;  2MNT A;  2AWG A;  1FKS A;  2UZ5 A;  3UI5 A;  4DRI A;  3KAF A;  3LUO A;  1FKJ A;  2KGJ A;  2VN1 A;  4ODL A;  2L2S A;  4TYO A;  2M2A A;  3TDB A;  4DRP A;  2PBC A;  3IK8 A;  1NMV A;  5B8I C;  4JFJ A;  3UQI A;  3JYM A;  4R0X A;  1FAP A;  3CGM A;  1FKF A;  5DIV A;  1FKB A;  1ROU A;  3FAP A;  2ITK A;  3KAC A;  3O5D A;  4IQ2 A;  1Q6U A;  1A7X A;  1JNT A;  1M5Y A;  1YAT A;  3O5M A;  4O2T A;  2MLX A;  3CGN A;  4LAW A;  3KAH A;  2LGO A;  5HWC A;  5J6E A;  1N1A A;  1PBK A;  1EQ3 A;  2ZQU A;  2MPH A;  3VAW A;  2XP3 A;  4JFM A;  2Q5A A;  2DG9 A;  4ODK A;  2DG3 A;  1U79 A;  2KE0 A;  1W26 A;  2RQS A;  2MLZ A;  4ITZ A;  2RUR A;  4N19 A;  4LAV A;  4QIB A;  3TCZ A;  3IKD A;  1FKG A;  3UI4 A; 
#chains in the Genus database with same CATH topology
 1LG2 A;  2VCD A;  1HXV A;  1EYM A;  1EDQ A;  4JYS A;  1D7H A;  1SR0 A;  3AS2 A;  2N87 A;  4WIW A;  3KAD A;  3ARX A;  3NRK A;  2O9O A;  1NSG A;  4G50 A;  3WD1 A;  1HKI A;  3PA7 A;  2M1I A;  1WNO A;  2ESC A;  3IHZ A;  2G8Z A;  4NSB A;  4DRN A;  3FXY A;  4Z2K A;  2B31 A;  4ODO A;  4DRO A;  5DF0 A;  1FKK A;  2G41 A;  4Z2H A;  2ZQV A;  3QOK A;  2LPV A;  4W9Q A;  1X6L A;  4ODR A;  3O5K A;  1F8A B;  1LL4 A;  2XPA A;  2EUL A;  4QT3 A;  4WKH A;  3PRD A;  1OGG A;  2Y78 A;  2ZQS A;  5BXJ A;  4LGX A;  1QPF A;  4TW7 A;  3AS1 A;  4S3K A;  1Q6I A;  3CHF A;  3O5E A;  3PRB A;  1HJW A;  3O5L A;  2XP6 A;  5GPR A;  3JXV A;  2KFW A;  3OOB A;  1QZ2 A;  1D7J A;  3RFW A;  1LL6 A;  4DRK A;  1ZCN A;  4URI A;  4IQC A;  4W5U A;  4ODN A;  2F23 A;  2DT2 A;  4WKA A;  3UQA A;  2K8I A;  3O5I A;  2DG4 A;  1ZB5 A;  3I6C A;  1TFV A;  4Q22 A;  3O5O A;  2KR7 A;  1JND A;  4DH0 A;  1NWR A;  2ETN A;  3KAB A;  5HKG A;  4MNK A;  4MNL A;  3WIJ A;  2AOS A;  2DSZ A;  1J4R A;  4ZPV R;  1D7I A;  2WLZ A;  1FKS A;  3ARQ A;  3KAF A;  1FKJ A;  3ARS A;  2PI6 A;  1LQ0 A;  3ARO A;  1JCH B;  3ARP A;  4JFJ A;  2DT0 A;  1H0G A;  1FKF A;  3B9D A;  1FKB A;  1ROU A;  2ITK A;  1Q6U A;  1M5Y A;  2MLX A;  3CGN A;  3FY1 A;  2LGO A;  2ZQU A;  1ZBV A;  3WD3 A;  4Z2J A;  1ZU8 A;  3VAW A;  1RD6 A;  2Q5A A;  4ODK A;  2DG3 A;  4N19 A;  1W26 A;  2KE0 A;  1HKJ A;  2DPE A;  2RUR A;  4IT6 A;  1W1Y A;  4HAR A;  2FAP A;  1ZK6 A;  2FKE A;  2MF9 A;  4R5E A;  3RGC A;  2WK2 A;  3UF8 A;  4DT4 A;  2KI3 A;  4DWS B;  4P8X A;  3WD0 A;  1H0I A;  4WKF A;  1BKF A;  1GPF A;  5DIT A;  1EHN A;  1PIN A;  3WL0 A;  5D75 A;  5HBF A;  3TC5 A;  2KO7 A;  4U85 A;  2M08 A;  2XP7 A;  1J4H A;  2YBU A;  2YBT A;  3EY6 A;  4NNR A;  4LAX A;  1QPL A;  4MTV A;  1B6C A;  1SYT A;  1FD9 A;  1K9T A;  1R9H A;  4QT2 A;  2XPB A;  1FKD A;  2ZR4 A;  1W1V A;  3JYJ A;  2IUZ A;  2PPO A;  1JNS A;  4ODP A;  2RUD A;  2XP8 A;  3ARV A;  1W9U A;  5HTG A;  1Q1C A;  2XP4 A;  5DO2 A;  1Y0O A;  1E6Z A;  1F40 A;  4Z2L A;  2ZR5 A;  2LKN A;  3KZ7 A;  1FKL A;  1BL4 A;  1L1P A;  4DRM A;  4J4N A;  3O5F A;  3NTP A;  3PRA A;  1JVW A;  3ALG A;  2PN0 A;  4FAP A;  4DRJ A;  1FKR A;  2A3E A;  4TX0 A;  5GQB A;  4FN2 A;  2F21 A;  1KT1 A;  1LL7 A;  3KCE A;  4JFK A;  4WJX A;  3WQV A;  4TW6 A;  1HKK A;  2OFN A;  1D6O A;  3NI6 A;  2AWG A;  2A3B A;  1LG1 A;  1XHG A;  3ARY A;  1E6P A;  2B5U B;  2KGJ A;  2OLH A;  1LJY A;  3G6L A;  4ZS6 A;  3AS0 A;  4DWS C;  1E9L A;  3KAC A;  1A7X A;  4DWS D;  1JNT A;  1YAT A;  4Z2G A;  4PTM A;  3WQW A;  1PBK A;  4MNM A;  4S3J A;  4UDM A;  2MPH A;  3BXW A;  1FFR A;  2XP3 A;  4JFM A;  4QIB A;  3B9A A;  4LAV A;  3IKD A;  2WM0 A;  4ZPT R;  3WD2 A;  1EIB A;  4TNS A;  1WB0 A;  3ART A;  4MPK A;  3AQU A;  1NWS A;  5HUA A;  1T11 A;  1WAW A;  2PV2 A;  3ALF A;  4KQZ A;  3CHC A;  3O5R A;  4JFL A;  5HW6 A;  4L72 B;  1Q6H A;  2D9F A;  3B8S A;  1C9H A;  3CH9 A;  3IKG A;  3WKZ A;  1KFW A;  2F4E A;  3ARZ A;  2XP5 A;  4IPX A;  1OWQ A;  4WK9 A;  4JFI A;  1J6Y A;  3O5P A;  2LJ4 A;  4MAV A;  4TW8 A;  4L3N A;  4ODQ A;  3RM4 A;  2DT1 A;  1FKI A;  1YW5 A;  4U84 A;  3O5Q A;  4DZ3 A;  5HWB A;  1FKH A;  5HT1 A;  4QZV B;  4DRQ A;  2F2D A;  3CZ8 A;  3CHD A;  4DZ2 A;  1GRJ A;  4NZC A;  2RUQ A;  1O6I A;  1ZBK A;  2MLY A;  2PV1 A;  1UR9 A;  4XAK A;  1CTN A;  2DSV A;  4ZPW R;  4G2P A;  4BF8 A;  4IT4 A;  1ROT A;  1NH6 A;  4W9O A;  5HW8 A;  2UZ5 A;  3UI5 A;  1W1P A;  1W9V A;  1ZBC A;  1NWU A;  3ARU A;  1HKM A;  3B9E A;  3LUO A;  1NWT A;  3EIP A;  2VN1 A;  4ODL A;  2L2S A;  3G6M A;  2M2A A;  4TYO A;  1NMV A;  1FFQ A;  4R0X A;  1FAP A;  3CGM A;  3FAP A;  1JNE A;  3O5D A;  2DSU A;  4O2T A;  4P8U A;  2QF8 A;  1GOI A;  4DWS A;  5J6E A;  1EQ3 A;  2A3C A;  5DEZ A;  1HJX A;  1U79 A;  2RQS A;  4ITZ A;  2MLZ A;  1XRV A;  1ITX A;  1FKG A;  3UI4 A;  2IF4 A;  1W1T A;  1OGB A;  2PPP A;  4ODM A;  3KAI A;  1J4I A;  3GU0 A;  1X6N A;  4J4O A;  5HW7 A;  3O5J A;  5DIU A;  3ARR A;  2O92 A;  3WL1 A;  3PR9 A;  2RSE A;  1KT0 A;  1VF8 A;  1HJV A;  2PV3 A;  3O5G A;  2WLY A;  2DSW A;  2RUC A;  1E15 A;  1E6R A;  3RME A;  3H9R B;  4C02 B;  3KAG A;  3MDY B;  3UQB A;  1W9P A;  2A3A A;  3CHE A;  4KR0 B;  4P8W A;  2PPN A;  4MGV A;  1NMW A;  4HBE A;  5GPG A;  4Z2I A;  1TCO C;  4LAY A;  4MSP A;  3B7X A;  2FDM A;  4DIP A;  1E44 A;  2XP9 A;  1P5Q A;  1E6N A;  5I98 A;  3WH0 A;  1FJD A;  2ZQT A;  2DT3 A;  3GTY X;  4AY1 A;  2ZR6 A;  2JZV A;  3ODK A;  4Q7N A;  4MNJ A;  3GPK A;  4DRH A;  4GGQ A;  4W9P A;  4GIV A;  1FKT A;  4U86 A;  3UI6 A;  1D2K A;  3W4R A;  1GUV A;  2MNT A;  2P4V A;  4P8V A;  4DRI A;  3OA5 A;  3RM8 A;  3ARW A;  3TDB A;  4DRP A;  5JH8 A;  2PBC A;  3IK8 A;  3WD4 A;  5B8I C;  3UQI A;  3JYM A;  5DIV A;  1UR8 A;  4IQ2 A;  3O5M A;  4LAW A;  4ML4 A;  3RM9 A;  3KAH A;  5HWC A;  1IX5 A;  1N1A A;  1ZL1 A;  4HBO A;  2DG9 A;  3AS3 A;  3BMB A;  3TCZ A;  1ZBW A; 
#chains in the Genus database with same CATH homology
 1LG2 A;  2VCD A;  1HXV A;  1EYM A;  1EDQ A;  4JYS A;  1D7H A;  1SR0 A;  3AS2 A;  2N87 A;  4WIW A;  3KAD A;  3ARX A;  3NRK A;  2O9O A;  1NSG A;  4G50 A;  3WD1 A;  1HKI A;  3PA7 A;  2M1I A;  1WNO A;  2ESC A;  3IHZ A;  2G8Z A;  4NSB A;  4DRN A;  3FXY A;  4Z2K A;  2B31 A;  4ODO A;  4DRO A;  5DF0 A;  1FKK A;  2G41 A;  4Z2H A;  2ZQV A;  3QOK A;  2LPV A;  4W9Q A;  1X6L A;  4ODR A;  3O5K A;  1F8A B;  1LL4 A;  2XPA A;  4WKH A;  4QT3 A;  3PRD A;  1OGG A;  2Y78 A;  2ZQS A;  5BXJ A;  4LGX A;  1QPF A;  4TW7 A;  3AS1 A;  4S3K A;  1Q6I A;  3CHF A;  3O5E A;  3PRB A;  1HJW A;  3O5L A;  2XP6 A;  5GPR A;  3JXV A;  2KFW A;  3OOB A;  1QZ2 A;  1D7J A;  3RFW A;  1LL6 A;  4DRK A;  1ZCN A;  4URI A;  4IQC A;  4W5U A;  4ODN A;  2DT2 A;  4WKA A;  3UQA A;  2K8I A;  3O5I A;  2DG4 A;  1ZB5 A;  3I6C A;  1TFV A;  4Q22 A;  3O5O A;  2KR7 A;  1JND A;  4DH0 A;  1NWR A;  3KAB A;  5HKG A;  4MNK A;  4MNL A;  3WIJ A;  2AOS A;  2DSZ A;  1J4R A;  4ZPV R;  1D7I A;  2WLZ A;  1FKS A;  3ARQ A;  3KAF A;  1FKJ A;  3ARS A;  2PI6 A;  1LQ0 A;  3ARO A;  3ARP A;  4JFJ A;  2DT0 A;  1H0G A;  1FKF A;  3B9D A;  1FKB A;  1ROU A;  2ITK A;  1Q6U A;  1M5Y A;  2MLX A;  3CGN A;  3FY1 A;  2LGO A;  2ZQU A;  1ZBV A;  3WD3 A;  4Z2J A;  1ZU8 A;  3VAW A;  1RD6 A;  2Q5A A;  4ODK A;  2DG3 A;  4N19 A;  1W26 A;  2KE0 A;  1HKJ A;  2DPE A;  2RUR A;  4IT6 A;  1W1Y A;  4HAR A;  2FAP A;  1ZK6 A;  2FKE A;  2MF9 A;  4R5E A;  3RGC A;  2WK2 A;  3UF8 A;  4DT4 A;  2KI3 A;  4DWS B;  4P8X A;  3WD0 A;  1H0I A;  4WKF A;  1BKF A;  1GPF A;  5DIT A;  1EHN A;  1PIN A;  3WL0 A;  5D75 A;  5HBF A;  3TC5 A;  2KO7 A;  4U85 A;  2M08 A;  2XP7 A;  1J4H A;  2YBU A;  2YBT A;  3EY6 A;  4NNR A;  4LAX A;  1QPL A;  4MTV A;  1B6C A;  1SYT A;  1FD9 A;  1K9T A;  1R9H A;  4QT2 A;  2XPB A;  1FKD A;  2ZR4 A;  1W1V A;  3JYJ A;  2IUZ A;  2PPO A;  1JNS A;  4ODP A;  2RUD A;  2XP8 A;  3ARV A;  1W9U A;  5HTG A;  1Q1C A;  2XP4 A;  5DO2 A;  1Y0O A;  1E6Z A;  1F40 A;  4Z2L A;  2ZR5 A;  2LKN A;  3KZ7 A;  1FKL A;  1BL4 A;  1L1P A;  4DRM A;  4J4N A;  3O5F A;  3NTP A;  3PRA A;  1JVW A;  3ALG A;  4FAP A;  4DRJ A;  1FKR A;  2A3E A;  4TX0 A;  5GQB A;  4FN2 A;  2F21 A;  1KT1 A;  1LL7 A;  3KCE A;  4JFK A;  4WJX A;  3WQV A;  4TW6 A;  1HKK A;  2OFN A;  1D6O A;  3NI6 A;  2AWG A;  2A3B A;  1LG1 A;  1XHG A;  3ARY A;  1E6P A;  2KGJ A;  2OLH A;  1LJY A;  3G6L A;  4ZS6 A;  3AS0 A;  4DWS C;  1E9L A;  3KAC A;  1A7X A;  4DWS D;  1JNT A;  1YAT A;  4Z2G A;  4PTM A;  3WQW A;  1PBK A;  4MNM A;  4S3J A;  2MPH A;  3BXW A;  1FFR A;  2XP3 A;  4JFM A;  4QIB A;  3B9A A;  4LAV A;  3IKD A;  2WM0 A;  4ZPT R;  3WD2 A;  1EIB A;  4TNS A;  1WB0 A;  3ART A;  4MPK A;  3AQU A;  1NWS A;  5HUA A;  1T11 A;  1WAW A;  2PV2 A;  3ALF A;  4KQZ A;  3CHC A;  3O5R A;  4JFL A;  5HW6 A;  4L72 B;  1Q6H A;  2D9F A;  3B8S A;  1C9H A;  3CH9 A;  3IKG A;  3WKZ A;  1KFW A;  2F4E A;  3ARZ A;  2XP5 A;  4IPX A;  1OWQ A;  4WK9 A;  4JFI A;  1J6Y A;  3O5P A;  2LJ4 A;  4MAV A;  4TW8 A;  4L3N A;  4ODQ A;  3RM4 A;  2DT1 A;  1FKI A;  1YW5 A;  4U84 A;  3O5Q A;  4DZ3 A;  5HWB A;  1FKH A;  5HT1 A;  4QZV B;  4DRQ A;  2F2D A;  3CZ8 A;  3CHD A;  4DZ2 A;  4NZC A;  2RUQ A;  1O6I A;  1ZBK A;  2MLY A;  2PV1 A;  1UR9 A;  4XAK A;  1CTN A;  2DSV A;  4ZPW R;  4G2P A;  4BF8 A;  4IT4 A;  1ROT A;  1NH6 A;  4W9O A;  5HW8 A;  2UZ5 A;  3UI5 A;  1W1P A;  1W9V A;  1ZBC A;  1NWU A;  3ARU A;  1HKM A;  3B9E A;  3LUO A;  1NWT A;  2VN1 A;  4ODL A;  2L2S A;  3G6M A;  2M2A A;  4TYO A;  1NMV A;  1FFQ A;  4R0X A;  1FAP A;  3CGM A;  3FAP A;  1JNE A;  3O5D A;  2DSU A;  4O2T A;  4P8U A;  2QF8 A;  1GOI A;  4DWS A;  5J6E A;  1EQ3 A;  2A3C A;  5DEZ A;  1HJX A;  1U79 A;  2RQS A;  4ITZ A;  2MLZ A;  1XRV A;  1ITX A;  1FKG A;  3UI4 A;  2IF4 A;  1W1T A;  1OGB A;  2PPP A;  4ODM A;  3KAI A;  1J4I A;  1X6N A;  4J4O A;  5HW7 A;  3O5J A;  5DIU A;  3ARR A;  2O92 A;  3WL1 A;  3PR9 A;  2RSE A;  1KT0 A;  1VF8 A;  1HJV A;  2PV3 A;  3O5G A;  2WLY A;  2DSW A;  2RUC A;  1E15 A;  1E6R A;  3RME A;  3H9R B;  4C02 B;  3KAG A;  3MDY B;  3UQB A;  1W9P A;  2A3A A;  3CHE A;  4KR0 B;  4P8W A;  2PPN A;  4MGV A;  1NMW A;  4HBE A;  5GPG A;  4Z2I A;  1TCO C;  4LAY A;  4MSP A;  3B7X A;  2FDM A;  4DIP A;  2XP9 A;  1P5Q A;  1E6N A;  5I98 A;  3WH0 A;  1FJD A;  2ZQT A;  2DT3 A;  4AY1 A;  2ZR6 A;  2JZV A;  3ODK A;  4Q7N A;  4MNJ A;  3GPK A;  4DRH A;  4GGQ A;  4W9P A;  4GIV A;  1FKT A;  4U86 A;  3UI6 A;  1D2K A;  3W4R A;  1GUV A;  2MNT A;  4P8V A;  4DRI A;  3OA5 A;  3RM8 A;  3ARW A;  3TDB A;  4DRP A;  5JH8 A;  2PBC A;  3IK8 A;  3WD4 A;  5B8I C;  3UQI A;  3JYM A;  5DIV A;  1UR8 A;  4IQ2 A;  3O5M A;  4LAW A;  4ML4 A;  3RM9 A;  3KAH A;  5HWC A;  1IX5 A;  1N1A A;  1ZL1 A;  4HBO A;  2DG9 A;  3AS3 A;  3TCZ A;  1ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...