2PV2A

Crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Periplasmic Bacterial Molecular Chaperone SurA Adapts its Structure to Bind Peptides in Different Conformations to Assert a Sequence Preference for Aromatic Residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Chaperone surA
total genus 29
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2pv2A00
4TW7A 5I98A 1FKFA 3H9RB 1C9HA 1Y0OA 2XP8A 2KGJA 5HKGA 2ZQUA 4GIVA 4DRIA 4DRQA 3UF8A 3NTPA 1D6OA 4G2PA 2DG4A 2MF9A 4U85A 3KAHA 4TX0A 4ODOA 1L1PA 3ODKA 4IPXA 2KE0A 2RUDA 4FAPA 3MDYB 2XP4A 4J4NA 1FD9A 2RUQA 4LAWA 4W9OA 5BXJA 2XP5A 1FKGA 5D75A 5HT1A 4IQ2A 4ODMA 1FKTA 2LGOA 2L2SA 1YW5A 4O2TA 4DZ3A 2FAPA 4DRPA 4DH0A 4TW6A 2PV2A 4J4OA 1BKFA 2PPOA 2LKNA 1FKKA 2Y78A 5HW7A 4DRNA 1J4RA 1P5QA 2F2DA 3KABA 1FKBA 2F21A 2RUCA 4R0XA 2VN1A 3O5QA 1FKIA 4LAVA 1ZCNA 4G50A 4LAYA 1N1AA 3O5PA 3TC5A 5HW6A 1JNTA 2ITKA 3KZ7A 4MGVA 3LUOA 1M5YA 1PINA 2DG3A 2D9FA 2ZQVA 2K8IA 2UZ5A 4ODQA 3O5FA 4W9PA 2MLYA 3TCZA 4N19A 2KR7A 4QT2A 3FAPA 4DRKA 2KO7A 1Q6HA 1PBKA 2LJ4A 2ZR6A 2IF4A 3KACA 2KI3A 2XP3A 2PPPA 3NRKA 3VAWA 1B6CA 5DITA 3JYMA 3UI5A 3O5EA 4JFJA 3RFWA 1A7XA 1Q6IA 2KFWA 3UQBA 2VCDA 3KAGA 2MNTA 3O5DA 3RGCA 3NI6A 5HW8A 2XPAA 3O5JA 3O5LA 3PA7A 3JXVA 2PV1A 1EQ3A 2PV3A 3UI4A 4MSPA 5GPGA 2XP6A 3WH0A 4ODKA 1F40A 3GPKA 3O5GA 4DROA 1D7IA 2M2AA 3IKDA 1HXVA 4C02B 1FKHA 4QIBA 1F8AB 3IHZA 1D7HA 2N87A 4JFIA 2XP9A 2ZQTA 3O5IA 3OOBA 4TW8A 1FKSA 2RQSA 3B7XA 3UQAA 4IQCA 2LPVA 1J4HA 1FKJA 1T11A 2MLZA 3KAIA 2ZR5A 4JYSA 4ODPA 5HTGA 5J6EA 2XP7A 3KAFA 2JZVA 2RURA 3KADA 3CGMA 4JFLA 2XPBA 2ZQSA 3EY6A 1J6YA 4DRHA 5DIUA 1QPFA 4LAXA 5HWBA 1FJDA 4DRJA 3O5OA 4ODRA 2PPNA 1EYMA 5B8IC 5HUAA 3JYJA 3UQIA 2Q5AA 3PRDA 4FN2A 4JFMA 2AWGA 1J4IA 1BL4A 2M08A 1FKDA 3IK8A 3KCEA 4ODLA 4GGQA 1ZK6A 3I6CA 4ITZA 3O5MA 1FAPA 4U84A 1U79A 4ODNA 5DIVA 4TYOA 1JNSA 2ZR4A 1D7JA 4W9QA 1YATA 4NNRA 1FKLA 1NSGA 1FKRA 4U86A 4DT4A 3O5RA 4QT3A 3O5KA 4DRMA 1QZ2A 2OFNA 2MLXA 1KT1A 1NMWA 5HWCA 1W26A 2F4EA 2PBCA 3TDBA 4DZ2A 2M1IA 4JFKA 4TNSA 4DIPA 1QPLA 1R9HA 3IKGA 4BF8A 1JVWA 1KT0A 2MPHA 1NMVA 1Q1CA 2FKEA 3PRBA 1Q6UA 3CGNA 2DG9A 1TCOC 1ROTA 1ROUA 2RSEA 3UI6A
chains in the Genus database with same CATH superfamily
4URIA 1ZBVA 2AOSA 5HKGA 2ZQUA 3UF8A 2DG4A 2MF9A 1RD6A 4TX0A 4ODOA 4FAPA 3OA5A 4LAWA 4UDMA 1FKTA 4L3NA 2LGOA 1O6IA 2L2SA 4O2TA 2WLYA 2FAPA 1WNOA 3AROA 4Z2JA 5HW7A 1JNDA 1UR8A 1J4RA 1X6NA 3WD3A 1E9LA 1ZCNA 4LAYA 2ETNA 2WM0A 3TC5A 5HW6A 4XAKA 1LL7A 2ITKA 3B9AA 3KZ7A 5JH8A 2K8IA 2UZ5A 3O5FA 4W9PA 3BMBA 3TCZA 3WL1A 3AS1A 1ITXA 3VAWA 5DITA 4L72B 3RFWA 3WQVA 1W9PA 2VCDA 4S3JA 2MNTA 3WKZA 3NI6A 3JXVA 1VF8A 4MSPA 1GOIA 3CZ8A 1LL6A 3IKDA 1HKJA 4C02B 4MTVA 4QIBA 1HKKA 3IHZA 2N87A 4JFIA 5DO2A 2A3CA 2XP9A 1FKSA 2RQSA 3CHDA 3UQAA 3KAIA 3W4RA 1WAWA 1ZU8A 2JZVA 2RURA 4JFLA 2XPBA 1J6YA 3RM8A 3O5OA 2PPNA 3JYJA 3UQIA 2Q5AA 3PRDA 4MNKA 4WK9A 4JFMA 4MNLA 1FKDA 1FAPA 5DIVA 1CTNA 1ZBCA 2ZR4A 1D7JA 3ALFA 3GU0A 4QT3A 1GRJA 5HWCA 1W26A 4DZ2A 1LJYA 3IKGA 2MPHA 1NMVA 1K9TA 4DWSC 2O92A 3CHFA 3FY1A 5D75A 3UI6A 1NWUA 1Y0OA 1W1TA 4GIVA 4DRIA 4DRQA 3NTPA 4G2PA 4P8UA 4U85A 2RUDA 1SR0A 3ARYA 3MDYB 2RUQA 1ZBWA 4QZVB 5HT1A 4IQ2A 4ODMA 2YBUA 2DSVA 4TW6A 4IT6A 5DF0A 2LKNA 1JNEA 1FKKA 3ARQA 3QOKA 4DRNA 1P5QA 2F2DA 3O5QA 1JNSA 2DSWA 1N1AA 3B8SA 3O5PA 4P8WA 1E6ZA 4HBEA 2A3EA 4MGVA 3LUOA 4S3KA 2ZQVA 4LGXA 2MLYA 4WKHA 4N19A 4QT2A 1NH6A 3FAPA 4DRKA 2DT1A 1HJVA 1PBKA 1ZL1A 2IF4A 2ZR6A 2A3AA 3NRKA 1B6CA 4W5UA 1JCHB 5GQBA 5HBFA 1UR9A 3KAGA 3RGCA 4DWSD 2XPAA 1E44A 3O5LA 3PA7A 3PRAA 2PV1A 1EQ3A 4WKFA 4DROA 2M2AA 1HXVA 4PTMA 1F8AB 1FFQA 3ARZA 3ARUA 2ZQTA 1HJWA 1T11A 2MLZA 1OGGA 2ZR5A 1E6RA 1SYTA 4HARA 3KAFA 4IT4A 4KQZA 4AY1A 3CHCA 1QPFA 3ARPA 4DRJA 4ML4A 1HKMA 4HBOA 4DWSA 2DSZA 3BXWA 1HKIA 3G6MA 3IK8A 3KCEA 4GGQA 1XRVA 4ODNA 1NSGA 3AS2A 1OGBA 4DT4A 2WK2A 4MAVA 3FXYA 3AS3A 2M1IA 3RM4A 4BF8A 4ZPVR 4MNJA 5DIUA 1ZB5A 1EYMA 1ROTA 4TW7A 5GPRA 1C9HA 2PI6A 4Q22A 1D6OA 3WIJA 1L1PA 2OLHA 2KE0A 4IPXA 2IUZA 1FD9A 1HJXA 4MNMA 1YW5A 4DZ3A 4DRPA 4DH0A 2B5UB 1BKFA 2PPOA 2Y78A 3RMEA 1FKIA 4LAVA 2WLZA 4MPKA 1JNTA 2F23A 1PINA 3WD0A 1LG1A 2KR7A 2KO7A 2O9OA 4P8XA 1GPFA 2KI3A 2XP3A 3B9DA 3JYMA 4Z2HA 1ZBKA 1TFVA 3UQBA 2DSUA 3CH9A 3O5DA 3O5JA 1WB0A 4Z2GA 2PV3A 1H0IA 5GPGA 1IX5A 2XP6A 3PR9A 3WH0A 4ODKA 3GTYX 1D7IA 3WQWA 3ARXA 4DWSB 1FKHA 4NSBA 1D7HA 3O5IA 3OOBA 4IQCA 1J4HA 1FKJA 2B31A 5HTGA 4JYSA 3CGMA 1GUVA 2ZQSA 3EY6A 4DRHA 1OWQA 1LQ0A 4LAXA 5HWBA 4ODRA 5HUAA 1J4IA 1BL4A 2DT2A 2DT3A 1D2KA 2M08A 2YBTA 5DEZA 1ZK6A 4P8VA 1U79A 4TYOA 1YATA 1FKRA 4U86A 3B9EA 3O5RA 4DRMA 1QZ2A 3CHEA 2MLXA 1KT1A 3TDBA 2PBCA 1R9HA 4Q7NA 1NWTA 1W9VA 3PRBA 1Q6UA 3CGNA 1E6NA 2DG9A 1TCOC 2RSEA 5I98A 1FKFA 3H9RB 4ZS6A 2XP8A 2KGJA 1LG2A 2A3BA 4WJXA 3KAHA 4KR0B 3ODKA 2DPEA 2XP4A 4J4NA 4W9OA 5BXJA 2XP5A 1FKGA 2PN0A 3ALGA 3ARVA 2PV2A 4J4OA 2P4VA 3KABA 1FKBA 2F21A 2RUCA 1W1YA 2EULA 2VN1A 4R0XA 2G8ZA 4G50A 1LL4A 1M5YA 2DG3A 2D9FA 4R5EA 3EIPA 2QF8A 4ODQA 4ZPTR 3RM9A 1Q6HA 2LJ4A 3KACA 1W1VA 1KFWA 4Z2LA 3G6LA 2PPPA 1NWRA 1W1PA 4ZPWR 3UI5A 3O5EA 4JFJA 1A7XA 2G41A 1E6PA 1Q6IA 1EHNA 2KFWA 3WD4A 5HW8A 4NZCA 2ESCA 3UI4A 1H0GA 3ARSA 1F40A 3GPKA 3O5GA 3ARTA 3AS0A 1X6LA 4TW8A 4Z2KA 3B7XA 2LPVA 4ODPA 5J6EA 3ARRA 2XP7A 3KADA 3AQUA 1FJDA 3WL0A 4Z2IA 5B8IC 1E15A 4FN2A 1EIBA 1EDQA 2AWGA 4ODLA 1NWSA 1FFRA 3I6CA 4ITZA 3O5MA 4U84A 4W9QA 1XHGA 1W9UA 4NNRA 1FKLA 4WKAA 3O5KA 2OFNA 3WD1A 1NMWA 4WIWA 2F4EA 3WD2A 2DT0A 4JFKA 4TNSA 2FDMA 4DIPA 1QPLA 1JVWA 1KT0A 1Q1CA 2FKEA 3ARWA 1ROUA
chains in the Genus database with same CATH topology
4URIA 1ZBVA 2AOSA 5HKGA 2ZQUA 3UF8A 2DG4A 2MF9A 1RD6A 4TX0A 4ODOA 4FAPA 3OA5A 4LAWA 1FKTA 4L3NA 2LGOA 1O6IA 2L2SA 4O2TA 2WLYA 2FAPA 1WNOA 3AROA 4Z2JA 5HW7A 1JNDA 1UR8A 1J4RA 1X6NA 3WD3A 1E9LA 1ZCNA 4LAYA 5HW6A 2WM0A 3TC5A 4XAKA 1LL7A 2ITKA 3B9AA 3KZ7A 5JH8A 2K8IA 2UZ5A 3O5FA 4W9PA 3TCZA 3WL1A 3AS1A 1ITXA 3VAWA 5DITA 4L72B 3RFWA 3WQVA 1W9PA 2VCDA 4S3JA 2MNTA 3WKZA 3NI6A 3JXVA 1VF8A 4MSPA 1GOIA 3CZ8A 1LL6A 3IKDA 1HKJA 4C02B 4MTVA 4QIBA 1HKKA 3IHZA 2N87A 4JFIA 5DO2A 2A3CA 2XP9A 1FKSA 2RQSA 3CHDA 3UQAA 3KAIA 3W4RA 1WAWA 1ZU8A 2JZVA 2RURA 4JFLA 2XPBA 1J6YA 3RM8A 3O5OA 2PPNA 3JYJA 3UQIA 2Q5AA 3PRDA 4MNKA 4WK9A 4JFMA 4MNLA 1FKDA 1FAPA 5DIVA 1CTNA 1ZBCA 2ZR4A 1D7JA 3ALFA 4QT3A 5HWCA 1W26A 4DZ2A 1LJYA 3IKGA 2MPHA 1NMVA 1K9TA 4DWSC 2O92A 3CHFA 3FY1A 5D75A 3UI6A 1NWUA 1Y0OA 1W1TA 4GIVA 4DRIA 4DRQA 3NTPA 4G2PA 4P8UA 4U85A 2RUDA 1SR0A 3ARYA 3MDYB 2RUQA 1ZBWA 4QZVB 5HT1A 4IQ2A 4ODMA 2YBUA 2DSVA 4TW6A 4IT6A 5DF0A 2LKNA 1JNEA 1FKKA 3ARQA 3QOKA 4DRNA 1P5QA 2F2DA 3O5QA 1JNSA 2DSWA 1N1AA 3B8SA 3O5PA 4P8WA 1E6ZA 4HBEA 2A3EA 4MGVA 3LUOA 4S3KA 2ZQVA 4LGXA 2MLYA 4WKHA 4N19A 4QT2A 1NH6A 3FAPA 4DRKA 2DT1A 1HJVA 1PBKA 1ZL1A 2IF4A 2ZR6A 2A3AA 3NRKA 1B6CA 4W5UA 5GQBA 5HBFA 1UR9A 3KAGA 3RGCA 4DWSD 2XPAA 3PA7A 3O5LA 3PRAA 2PV1A 1EQ3A 4WKFA 4DROA 2M2AA 1HXVA 4PTMA 1F8AB 1FFQA 3ARZA 3ARUA 2ZQTA 1HJWA 1T11A 2MLZA 1OGGA 2ZR5A 1E6RA 1SYTA 4HARA 3KAFA 4IT4A 4KQZA 4AY1A 3CHCA 1QPFA 3ARPA 4DRJA 4ML4A 1HKMA 4HBOA 4DWSA 2DSZA 3BXWA 1HKIA 3G6MA 3IK8A 3KCEA 4GGQA 1XRVA 4ODNA 1NSGA 3AS2A 1OGBA 4DT4A 2WK2A 4MAVA 3FXYA 3AS3A 2M1IA 3RM4A 4BF8A 4ZPVR 4MNJA 5DIUA 1ZB5A 1EYMA 1ROTA 4TW7A 5GPRA 1C9HA 2PI6A 4Q22A 1D6OA 3WIJA 1L1PA 2OLHA 2KE0A 4IPXA 2IUZA 1FD9A 1HJXA 4MNMA 1YW5A 4DZ3A 4DRPA 4DH0A 1BKFA 2PPOA 2Y78A 3RMEA 1FKIA 4LAVA 2WLZA 4MPKA 1JNTA 1PINA 3WD0A 1LG1A 2KR7A 2KO7A 2O9OA 4P8XA 1GPFA 2KI3A 2XP3A 3B9DA 3JYMA 4Z2HA 1ZBKA 1TFVA 3UQBA 2DSUA 3CH9A 3O5DA 3O5JA 1WB0A 4Z2GA 2PV3A 1H0IA 5GPGA 1IX5A 2XP6A 3PR9A 3WH0A 4ODKA 1D7IA 3WQWA 3ARXA 4DWSB 1FKHA 4NSBA 1D7HA 3O5IA 3OOBA 4IQCA 1J4HA 1FKJA 2B31A 5HTGA 4JYSA 3CGMA 1GUVA 2ZQSA 3EY6A 4DRHA 1OWQA 1LQ0A 4LAXA 5HWBA 4ODRA 5HUAA 1J4IA 1BL4A 2DT2A 2DT3A 1D2KA 2M08A 2YBTA 5DEZA 1ZK6A 4P8VA 1U79A 4TYOA 1YATA 1FKRA 4U86A 3B9EA 3O5RA 4DRMA 1QZ2A 3CHEA 2MLXA 1KT1A 3TDBA 2PBCA 1R9HA 4Q7NA 1NWTA 1W9VA 3PRBA 1Q6UA 3CGNA 1E6NA 2DG9A 1TCOC 2RSEA 5I98A 1FKFA 3H9RB 4ZS6A 2XP8A 2KGJA 1LG2A 2A3BA 4WJXA 3KAHA 4KR0B 3ODKA 2DPEA 2XP4A 4J4NA 4W9OA 5BXJA 2XP5A 1FKGA 3ALGA 3ARVA 2PV2A 4J4OA 3KABA 1FKBA 2F21A 2RUCA 1W1YA 2VN1A 4R0XA 2G8ZA 4G50A 1LL4A 1M5YA 2DG3A 2D9FA 4R5EA 2QF8A 4ODQA 4ZPTR 3RM9A 1Q6HA 2LJ4A 3KACA 1W1VA 1KFWA 4Z2LA 3G6LA 2PPPA 1NWRA 1W1PA 4ZPWR 3UI5A 3O5EA 4JFJA 1A7XA 2G41A 1E6PA 1Q6IA 1EHNA 2KFWA 3WD4A 5HW8A 4NZCA 2ESCA 3UI4A 1H0GA 3ARSA 1F40A 3GPKA 3O5GA 3ARTA 3AS0A 1X6LA 4TW8A 4Z2KA 3B7XA 2LPVA 4ODPA 5J6EA 3ARRA 2XP7A 3KADA 3AQUA 1FJDA 3WL0A 4Z2IA 5B8IC 1E15A 4FN2A 1EIBA 1EDQA 2AWGA 4ODLA 1NWSA 1FFRA 3I6CA 4ITZA 3O5MA 4U84A 4W9QA 1XHGA 1W9UA 4NNRA 1FKLA 4WKAA 3O5KA 2OFNA 3WD1A 1NMWA 4WIWA 2F4EA 3WD2A 2DT0A 4JFKA 4TNSA 2FDMA 4DIPA 1QPLA 1JVWA 1KT0A 1Q1CA 2FKEA 3ARWA 1ROUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW7 A;  5I98 A;  1FKF A;  3H9R B;  1C9H A;  1Y0O A;  2XP8 A;  2KGJ A;  5HKG A;  2ZQU A;  4GIV A;  4DRI A;  4DRQ A;  3UF8 A;  3NTP A;  1D6O A;  4G2P A;  2DG4 A;  2MF9 A;  4U85 A;  3KAH A;  4TX0 A;  4ODO A;  1L1P A;  3ODK A;  4IPX A;  2KE0 A;  2RUD A;  4FAP A;  3MDY B;  2XP4 A;  4J4N A;  1FD9 A;  2RUQ A;  4LAW A;  4W9O A;  5BXJ A;  2XP5 A;  1FKG A;  5D75 A;  5HT1 A;  4IQ2 A;  4ODM A;  1FKT A;  2LGO A;  2L2S A;  1YW5 A;  4O2T A;  4DZ3 A;  2FAP A;  4DRP A;  4DH0 A;  4TW6 A;  2PV2 A;  4J4O A;  1BKF A;  2PPO A;  2LKN A;  1FKK A;  2Y78 A;  5HW7 A;  4DRN A;  1J4R A;  1P5Q A;  2F2D A;  3KAB A;  1FKB A;  2F21 A;  2RUC A;  4R0X A;  2VN1 A;  3O5Q A;  1FKI A;  4LAV A;  1ZCN A;  4G50 A;  4LAY A;  1N1A A;  3O5P A;  3TC5 A;  5HW6 A;  1JNT A;  2ITK A;  3KZ7 A;  4MGV A;  3LUO A;  1M5Y A;  1PIN A;  2DG3 A;  2D9F A;  2ZQV A;  2K8I A;  2UZ5 A;  4ODQ A;  3O5F A;  4W9P A;  2MLY A;  3TCZ A;  4N19 A;  2KR7 A;  4QT2 A;  3FAP A;  4DRK A;  2KO7 A;  1Q6H A;  1PBK A;  2LJ4 A;  2ZR6 A;  2IF4 A;  3KAC A;  2KI3 A;  2XP3 A;  2PPP A;  3NRK A;  3VAW A;  1B6C A;  5DIT A;  3JYM A;  3UI5 A;  3O5E A;  4JFJ A;  3RFW A;  1A7X A;  1Q6I A;  2KFW A;  3UQB A;  2VCD A;  3KAG A;  2MNT A;  3O5D A;  3RGC A;  3NI6 A;  5HW8 A;  2XPA A;  3O5J A;  3O5L A;  3PA7 A;  3JXV A;  2PV1 A;  1EQ3 A;  2PV3 A;  3UI4 A;  4MSP A;  5GPG A;  2XP6 A;  3WH0 A;  4ODK A;  1F40 A;  3GPK A;  3O5G A;  4DRO A;  1D7I A;  2M2A A;  3IKD A;  1HXV A;  4C02 B;  1FKH A;  4QIB A;  1F8A B;  3IHZ A;  1D7H A;  2N87 A;  4JFI A;  2XP9 A;  2ZQT A;  3O5I A;  3OOB A;  4TW8 A;  1FKS A;  2RQS A;  3B7X A;  3UQA A;  4IQC A;  2LPV A;  1J4H A;  1FKJ A;  1T11 A;  2MLZ A;  3KAI A;  2ZR5 A;  4JYS A;  4ODP A;  5HTG A;  5J6E A;  2XP7 A;  3KAF A;  2JZV A;  2RUR A;  3KAD A;  3CGM A;  4JFL A;  2XPB A;  2ZQS A;  3EY6 A;  1J6Y A;  4DRH A;  5DIU A;  1QPF A;  4LAX A;  5HWB A;  1FJD A;  4DRJ A;  3O5O A;  4ODR A;  2PPN A;  1EYM A;  5B8I C;  5HUA A;  3JYJ A;  3UQI A;  2Q5A A;  3PRD A;  4FN2 A;  4JFM A;  2AWG A;  1J4I A;  1BL4 A;  2M08 A;  1FKD A;  3IK8 A;  3KCE A;  4ODL A;  4GGQ A;  1ZK6 A;  3I6C A;  4ITZ A;  3O5M A;  1FAP A;  4U84 A;  1U79 A;  4ODN A;  5DIV A;  4TYO A;  1JNS A;  2ZR4 A;  1D7J A;  4W9Q A;  1YAT A;  4NNR A;  1FKL A;  1NSG A;  1FKR A;  4U86 A;  4DT4 A;  3O5R A;  4QT3 A;  3O5K A;  4DRM A;  1QZ2 A;  2OFN A;  2MLX A;  1KT1 A;  1NMW A;  5HWC A;  1W26 A;  2F4E A;  2PBC A;  3TDB A;  4DZ2 A;  2M1I A;  4JFK A;  4TNS A;  4DIP A;  1QPL A;  1R9H A;  3IKG A;  4BF8 A;  1JVW A;  1KT0 A;  2MPH A;  1NMV A;  1Q1C A;  2FKE A;  3PRB A;  1Q6U A;  3CGN A;  2DG9 A;  1TCO C;  1ROT A;  1ROU A;  2RSE A;  3UI6 A; 
#chains in the Genus database with same CATH topology
 4URI A;  1ZBV A;  2AOS A;  5HKG A;  2ZQU A;  3UF8 A;  2DG4 A;  2MF9 A;  1RD6 A;  4TX0 A;  4ODO A;  4FAP A;  3OA5 A;  4LAW A;  4UDM A;  1FKT A;  4L3N A;  2LGO A;  1O6I A;  2L2S A;  4O2T A;  2WLY A;  2FAP A;  1WNO A;  3ARO A;  4Z2J A;  5HW7 A;  1JND A;  1UR8 A;  1J4R A;  1X6N A;  3WD3 A;  1E9L A;  1ZCN A;  4LAY A;  2ETN A;  2WM0 A;  3TC5 A;  5HW6 A;  4XAK A;  1LL7 A;  2ITK A;  3B9A A;  3KZ7 A;  5JH8 A;  2K8I A;  2UZ5 A;  3O5F A;  4W9P A;  3BMB A;  3TCZ A;  3WL1 A;  3AS1 A;  1ITX A;  3VAW A;  5DIT A;  4L72 B;  3RFW A;  3WQV A;  1W9P A;  2VCD A;  4S3J A;  2MNT A;  3WKZ A;  3NI6 A;  3JXV A;  1VF8 A;  4MSP A;  1GOI A;  3CZ8 A;  1LL6 A;  3IKD A;  1HKJ A;  4C02 B;  4MTV A;  4QIB A;  1HKK A;  3IHZ A;  2N87 A;  4JFI A;  5DO2 A;  2A3C A;  2XP9 A;  1FKS A;  2RQS A;  3CHD A;  3UQA A;  3KAI A;  3W4R A;  1WAW A;  1ZU8 A;  2JZV A;  2RUR A;  4JFL A;  2XPB A;  1J6Y A;  3RM8 A;  3O5O A;  2PPN A;  3JYJ A;  3UQI A;  2Q5A A;  3PRD A;  4MNK A;  4WK9 A;  4JFM A;  4MNL A;  1FKD A;  1FAP A;  5DIV A;  1CTN A;  1ZBC A;  2ZR4 A;  1D7J A;  3ALF A;  3GU0 A;  4QT3 A;  1GRJ A;  5HWC A;  1W26 A;  4DZ2 A;  1LJY A;  3IKG A;  2MPH A;  1NMV A;  1K9T A;  4DWS C;  2O92 A;  3CHF A;  3FY1 A;  5D75 A;  3UI6 A;  1NWU A;  1Y0O A;  1W1T A;  4GIV A;  4DRI A;  4DRQ A;  3NTP A;  4G2P A;  4P8U A;  4U85 A;  2RUD A;  1SR0 A;  3ARY A;  3MDY B;  2RUQ A;  1ZBW A;  4QZV B;  5HT1 A;  4IQ2 A;  4ODM A;  2YBU A;  2DSV A;  4TW6 A;  4IT6 A;  5DF0 A;  2LKN A;  1JNE A;  1FKK A;  3ARQ A;  3QOK A;  4DRN A;  1P5Q A;  2F2D A;  3O5Q A;  1JNS A;  2DSW A;  1N1A A;  3B8S A;  3O5P A;  4P8W A;  1E6Z A;  4HBE A;  2A3E A;  4MGV A;  3LUO A;  4S3K A;  2ZQV A;  4LGX A;  2MLY A;  4WKH A;  4N19 A;  4QT2 A;  1NH6 A;  3FAP A;  4DRK A;  2DT1 A;  1HJV A;  1PBK A;  1ZL1 A;  2IF4 A;  2ZR6 A;  2A3A A;  3NRK A;  1B6C A;  4W5U A;  1JCH B;  5GQB A;  5HBF A;  1UR9 A;  3KAG A;  3RGC A;  4DWS D;  2XPA A;  1E44 A;  3O5L A;  3PA7 A;  3PRA A;  2PV1 A;  1EQ3 A;  4WKF A;  4DRO A;  2M2A A;  1HXV A;  4PTM A;  1F8A B;  1FFQ A;  3ARZ A;  3ARU A;  2ZQT A;  1HJW A;  1T11 A;  2MLZ A;  1OGG A;  2ZR5 A;  1E6R A;  1SYT A;  4HAR A;  3KAF A;  4IT4 A;  4KQZ A;  4AY1 A;  3CHC A;  1QPF A;  3ARP A;  4DRJ A;  4ML4 A;  1HKM A;  4HBO A;  4DWS A;  2DSZ A;  3BXW A;  1HKI A;  3G6M A;  3IK8 A;  3KCE A;  4GGQ A;  1XRV A;  4ODN A;  1NSG A;  3AS2 A;  1OGB A;  4DT4 A;  2WK2 A;  4MAV A;  3FXY A;  3AS3 A;  2M1I A;  3RM4 A;  4BF8 A;  4ZPV R;  4MNJ A;  5DIU A;  1ZB5 A;  1EYM A;  1ROT A;  4TW7 A;  5GPR A;  1C9H A;  2PI6 A;  4Q22 A;  1D6O A;  3WIJ A;  1L1P A;  2OLH A;  2KE0 A;  4IPX A;  2IUZ A;  1FD9 A;  1HJX A;  4MNM A;  1YW5 A;  4DZ3 A;  4DRP A;  4DH0 A;  2B5U B;  1BKF A;  2PPO A;  2Y78 A;  3RME A;  1FKI A;  4LAV A;  2WLZ A;  4MPK A;  1JNT A;  2F23 A;  1PIN A;  3WD0 A;  1LG1 A;  2KR7 A;  2KO7 A;  2O9O A;  4P8X A;  1GPF A;  2KI3 A;  2XP3 A;  3B9D A;  3JYM A;  4Z2H A;  1ZBK A;  1TFV A;  3UQB A;  2DSU A;  3CH9 A;  3O5D A;  3O5J A;  1WB0 A;  4Z2G A;  2PV3 A;  1H0I A;  5GPG A;  1IX5 A;  2XP6 A;  3PR9 A;  3WH0 A;  4ODK A;  3GTY X;  1D7I A;  3WQW A;  3ARX A;  4DWS B;  1FKH A;  4NSB A;  1D7H A;  3O5I A;  3OOB A;  4IQC A;  1J4H A;  1FKJ A;  2B31 A;  5HTG A;  4JYS A;  3CGM A;  1GUV A;  2ZQS A;  3EY6 A;  4DRH A;  1OWQ A;  1LQ0 A;  4LAX A;  5HWB A;  4ODR A;  5HUA A;  1J4I A;  1BL4 A;  2DT2 A;  2DT3 A;  1D2K A;  2M08 A;  2YBT A;  5DEZ A;  1ZK6 A;  4P8V A;  1U79 A;  4TYO A;  1YAT A;  1FKR A;  4U86 A;  3B9E A;  3O5R A;  4DRM A;  1QZ2 A;  3CHE A;  2MLX A;  1KT1 A;  3TDB A;  2PBC A;  1R9H A;  4Q7N A;  1NWT A;  1W9V A;  3PRB A;  1Q6U A;  3CGN A;  1E6N A;  2DG9 A;  1TCO C;  2RSE A;  5I98 A;  1FKF A;  3H9R B;  4ZS6 A;  2XP8 A;  2KGJ A;  1LG2 A;  2A3B A;  4WJX A;  3KAH A;  4KR0 B;  3ODK A;  2DPE A;  2XP4 A;  4J4N A;  4W9O A;  5BXJ A;  2XP5 A;  1FKG A;  2PN0 A;  3ALG A;  3ARV A;  2PV2 A;  4J4O A;  2P4V A;  3KAB A;  1FKB A;  2F21 A;  2RUC A;  1W1Y A;  2EUL A;  2VN1 A;  4R0X A;  2G8Z A;  4G50 A;  1LL4 A;  1M5Y A;  2DG3 A;  2D9F A;  4R5E A;  3EIP A;  2QF8 A;  4ODQ A;  4ZPT R;  3RM9 A;  1Q6H A;  2LJ4 A;  3KAC A;  1W1V A;  1KFW A;  4Z2L A;  3G6L A;  2PPP A;  1NWR A;  1W1P A;  4ZPW R;  3UI5 A;  3O5E A;  4JFJ A;  1A7X A;  2G41 A;  1E6P A;  1Q6I A;  1EHN A;  2KFW A;  3WD4 A;  5HW8 A;  4NZC A;  2ESC A;  3UI4 A;  1H0G A;  3ARS A;  1F40 A;  3GPK A;  3O5G A;  3ART A;  3AS0 A;  1X6L A;  4TW8 A;  4Z2K A;  3B7X A;  2LPV A;  4ODP A;  5J6E A;  3ARR A;  2XP7 A;  3KAD A;  3AQU A;  1FJD A;  3WL0 A;  4Z2I A;  5B8I C;  1E15 A;  4FN2 A;  1EIB A;  1EDQ A;  2AWG A;  4ODL A;  1NWS A;  1FFR A;  3I6C A;  4ITZ A;  3O5M A;  4U84 A;  4W9Q A;  1XHG A;  1W9U A;  4NNR A;  1FKL A;  4WKA A;  3O5K A;  2OFN A;  3WD1 A;  1NMW A;  4WIW A;  2F4E A;  3WD2 A;  2DT0 A;  4JFK A;  4TNS A;  2FDM A;  4DIP A;  1QPL A;  1JVW A;  1KT0 A;  1Q1C A;  2FKE A;  3ARW A;  1ROU A; 
#chains in the Genus database with same CATH homology
 4URI A;  1ZBV A;  2AOS A;  5HKG A;  2ZQU A;  3UF8 A;  2DG4 A;  2MF9 A;  1RD6 A;  4TX0 A;  4ODO A;  4FAP A;  3OA5 A;  4LAW A;  1FKT A;  4L3N A;  2LGO A;  1O6I A;  2L2S A;  4O2T A;  2WLY A;  2FAP A;  1WNO A;  3ARO A;  4Z2J A;  5HW7 A;  1JND A;  1UR8 A;  1J4R A;  1X6N A;  3WD3 A;  1E9L A;  1ZCN A;  4LAY A;  5HW6 A;  2WM0 A;  3TC5 A;  4XAK A;  1LL7 A;  2ITK A;  3B9A A;  3KZ7 A;  5JH8 A;  2K8I A;  2UZ5 A;  3O5F A;  4W9P A;  3TCZ A;  3WL1 A;  3AS1 A;  1ITX A;  3VAW A;  5DIT A;  4L72 B;  3RFW A;  3WQV A;  1W9P A;  2VCD A;  4S3J A;  2MNT A;  3WKZ A;  3NI6 A;  3JXV A;  1VF8 A;  4MSP A;  1GOI A;  3CZ8 A;  1LL6 A;  3IKD A;  1HKJ A;  4C02 B;  4MTV A;  4QIB A;  1HKK A;  3IHZ A;  2N87 A;  4JFI A;  5DO2 A;  2A3C A;  2XP9 A;  1FKS A;  2RQS A;  3CHD A;  3UQA A;  3KAI A;  3W4R A;  1WAW A;  1ZU8 A;  2JZV A;  2RUR A;  4JFL A;  2XPB A;  1J6Y A;  3RM8 A;  3O5O A;  2PPN A;  3JYJ A;  3UQI A;  2Q5A A;  3PRD A;  4MNK A;  4WK9 A;  4JFM A;  4MNL A;  1FKD A;  1FAP A;  5DIV A;  1CTN A;  1ZBC A;  2ZR4 A;  1D7J A;  3ALF A;  4QT3 A;  5HWC A;  1W26 A;  4DZ2 A;  1LJY A;  3IKG A;  2MPH A;  1NMV A;  1K9T A;  4DWS C;  2O92 A;  3CHF A;  3FY1 A;  5D75 A;  3UI6 A;  1NWU A;  1Y0O A;  1W1T A;  4GIV A;  4DRI A;  4DRQ A;  3NTP A;  4G2P A;  4P8U A;  4U85 A;  2RUD A;  1SR0 A;  3ARY A;  3MDY B;  2RUQ A;  1ZBW A;  4QZV B;  5HT1 A;  4IQ2 A;  4ODM A;  2YBU A;  2DSV A;  4TW6 A;  4IT6 A;  5DF0 A;  2LKN A;  1JNE A;  1FKK A;  3ARQ A;  3QOK A;  4DRN A;  1P5Q A;  2F2D A;  3O5Q A;  1JNS A;  2DSW A;  1N1A A;  3B8S A;  3O5P A;  4P8W A;  1E6Z A;  4HBE A;  2A3E A;  4MGV A;  3LUO A;  4S3K A;  2ZQV A;  4LGX A;  2MLY A;  4WKH A;  4N19 A;  4QT2 A;  1NH6 A;  3FAP A;  4DRK A;  2DT1 A;  1HJV A;  1PBK A;  1ZL1 A;  2IF4 A;  2ZR6 A;  2A3A A;  3NRK A;  1B6C A;  4W5U A;  5GQB A;  5HBF A;  1UR9 A;  3KAG A;  3RGC A;  4DWS D;  2XPA A;  3PA7 A;  3O5L A;  3PRA A;  2PV1 A;  1EQ3 A;  4WKF A;  4DRO A;  2M2A A;  1HXV A;  4PTM A;  1F8A B;  1FFQ A;  3ARZ A;  3ARU A;  2ZQT A;  1HJW A;  1T11 A;  2MLZ A;  1OGG A;  2ZR5 A;  1E6R A;  1SYT A;  4HAR A;  3KAF A;  4IT4 A;  4KQZ A;  4AY1 A;  3CHC A;  1QPF A;  3ARP A;  4DRJ A;  4ML4 A;  1HKM A;  4HBO A;  4DWS A;  2DSZ A;  3BXW A;  1HKI A;  3G6M A;  3IK8 A;  3KCE A;  4GGQ A;  1XRV A;  4ODN A;  1NSG A;  3AS2 A;  1OGB A;  4DT4 A;  2WK2 A;  4MAV A;  3FXY A;  3AS3 A;  2M1I A;  3RM4 A;  4BF8 A;  4ZPV R;  4MNJ A;  5DIU A;  1ZB5 A;  1EYM A;  1ROT A;  4TW7 A;  5GPR A;  1C9H A;  2PI6 A;  4Q22 A;  1D6O A;  3WIJ A;  1L1P A;  2OLH A;  2KE0 A;  4IPX A;  2IUZ A;  1FD9 A;  1HJX A;  4MNM A;  1YW5 A;  4DZ3 A;  4DRP A;  4DH0 A;  1BKF A;  2PPO A;  2Y78 A;  3RME A;  1FKI A;  4LAV A;  2WLZ A;  4MPK A;  1JNT A;  1PIN A;  3WD0 A;  1LG1 A;  2KR7 A;  2KO7 A;  2O9O A;  4P8X A;  1GPF A;  2KI3 A;  2XP3 A;  3B9D A;  3JYM A;  4Z2H A;  1ZBK A;  1TFV A;  3UQB A;  2DSU A;  3CH9 A;  3O5D A;  3O5J A;  1WB0 A;  4Z2G A;  2PV3 A;  1H0I A;  5GPG A;  1IX5 A;  2XP6 A;  3PR9 A;  3WH0 A;  4ODK A;  1D7I A;  3WQW A;  3ARX A;  4DWS B;  1FKH A;  4NSB A;  1D7H A;  3O5I A;  3OOB A;  4IQC A;  1J4H A;  1FKJ A;  2B31 A;  5HTG A;  4JYS A;  3CGM A;  1GUV A;  2ZQS A;  3EY6 A;  4DRH A;  1OWQ A;  1LQ0 A;  4LAX A;  5HWB A;  4ODR A;  5HUA A;  1J4I A;  1BL4 A;  2DT2 A;  2DT3 A;  1D2K A;  2M08 A;  2YBT A;  5DEZ A;  1ZK6 A;  4P8V A;  1U79 A;  4TYO A;  1YAT A;  1FKR A;  4U86 A;  3B9E A;  3O5R A;  4DRM A;  1QZ2 A;  3CHE A;  2MLX A;  1KT1 A;  3TDB A;  2PBC A;  1R9H A;  4Q7N A;  1NWT A;  1W9V A;  3PRB A;  1Q6U A;  3CGN A;  1E6N A;  2DG9 A;  1TCO C;  2RSE A;  5I98 A;  1FKF A;  3H9R B;  4ZS6 A;  2XP8 A;  2KGJ A;  1LG2 A;  2A3B A;  4WJX A;  3KAH A;  4KR0 B;  3ODK A;  2DPE A;  2XP4 A;  4J4N A;  4W9O A;  5BXJ A;  2XP5 A;  1FKG A;  3ALG A;  3ARV A;  2PV2 A;  4J4O A;  3KAB A;  1FKB A;  2F21 A;  2RUC A;  1W1Y A;  2VN1 A;  4R0X A;  2G8Z A;  4G50 A;  1LL4 A;  1M5Y A;  2DG3 A;  2D9F A;  4R5E A;  2QF8 A;  4ODQ A;  4ZPT R;  3RM9 A;  1Q6H A;  2LJ4 A;  3KAC A;  1W1V A;  1KFW A;  4Z2L A;  3G6L A;  2PPP A;  1NWR A;  1W1P A;  4ZPW R;  3UI5 A;  3O5E A;  4JFJ A;  1A7X A;  2G41 A;  1E6P A;  1Q6I A;  1EHN A;  2KFW A;  3WD4 A;  5HW8 A;  4NZC A;  2ESC A;  3UI4 A;  1H0G A;  3ARS A;  1F40 A;  3GPK A;  3O5G A;  3ART A;  3AS0 A;  1X6L A;  4TW8 A;  4Z2K A;  3B7X A;  2LPV A;  4ODP A;  5J6E A;  3ARR A;  2XP7 A;  3KAD A;  3AQU A;  1FJD A;  3WL0 A;  4Z2I A;  5B8I C;  1E15 A;  4FN2 A;  1EIB A;  1EDQ A;  2AWG A;  4ODL A;  1NWS A;  1FFR A;  3I6C A;  4ITZ A;  3O5M A;  4U84 A;  4W9Q A;  1XHG A;  1W9U A;  4NNR A;  1FKL A;  4WKA A;  3O5K A;  2OFN A;  3WD1 A;  1NMW A;  4WIW A;  2F4E A;  3WD2 A;  2DT0 A;  4JFK A;  4TNS A;  2FDM A;  4DIP A;  1QPL A;  1JVW A;  1KT0 A;  1Q1C A;  2FKE A;  3ARW A;  1ROU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...