1YATA

Improved calcineurin inhibition by yeast fkbp12-drug complexes. crystallographic and functional analysis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
SEVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improved calcineurin inhibition by yeast FKBP12-drug complexes. Crystallographic and functional analysis.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Binding protein
molecule keywords FK506 BINDING PROTEIN
total genus 29
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yatA00
3RFWA 3UQIA 3IHZA 1KT1A 1QZ2A 2Y78A 1FD9A 4GGQA 3O5QA 3OOBA 1JVWA 3O5LA 5HWCA 4G50A 5J6EA 4FAPA 2XP5A 2RUDA 4QT2A 3UQBA 1FKSA 2F2DA 2Q5AA 2VCDA 5D75A 5DITA 3B7XA 3KCEA 1Q6UA 2MLYA 1J4IA 1D7IA 3PA7A 4QT3A 2DG3A 2ZR4A 5GPGA 4TW6A 1P5QA 4J4NA 4G2PA 1J4RA 2RSEA 4JFJA 5HKGA 2XP6A 2FKEA 1ROUA 3IKGA 3KAGA 4MGVA 1YW5A 2RURA 1F40A 1Q6IA 3CGNA 5DIUA 3UI5A 3VAWA 3LUOA 4DRIA 3EY6A 3O5GA 2UZ5A 4MSPA 1FKJA 4GIVA 1D7HA 4ODNA 4DRMA 3O5DA 1QPFA 3TCZA 3KAFA 1N1AA 2DG9A 4DROA 1FKRA 2MLZA 4NNRA 2VN1A 3UI6A 3O5IA 1FJDA 2PPNA 1TCOC 2KE0A 4TYOA 3JYMA 5HW7A 5HWBA 1J4HA 2M2AA 2MNTA 1HXVA 2XPAA 3PRBA 3KAHA 1D7JA 1D6OA 4JYSA 4DZ2A 5HW8A 1JNSA 2LGOA 4N19A 3PRDA 4DRPA 1FKDA 1PINA 1B6CA 2PPOA 2RUQA 1JNTA 1FKKA 2IF4A 4DH0A 4IQ2A 3O5EA 2KGJA 3CGMA 2MPHA 4ODKA 4U84A 4ODLA 3UI4A 4DRKA 2XP3A 3O5JA 1F8AB 2OFNA 2LKNA 2LPVA 1M5YA 3JXVA 3UQAA 2KR7A 1PBKA 2LJ4A 1NMWA 1BKFA 2L2SA 4W9PA 5HTGA 1A7XA 4DT4A 1L1PA 2JZVA 1T11A 4ITZA 1FKGA 4TX0A 2XP8A 4LAXA 3KADA 1Q1CA 2ZR6A 4BF8A 5I98A 2RQSA 1FAPA 5DIVA 3TDBA 4ODPA 1Q6HA 3RGCA 3TC5A 4ODRA 2XPBA 2MF9A 2PV3A 4U85A 1EYMA 3O5FA 2MLXA 2XP4A 3UF8A 3FAPA 4ODQA 2F4EA 2ZR5A 3MDYB 4W9QA 2ZQSA 3O5KA 1Y0OA 1YATA 1FKTA 2KFWA 4LAWA 2XP7A 1NMVA 2PV1A 4DZ3A 2KI3A 4JFMA 3O5MA 1FKIA 4FN2A 2M08A 3IK8A 4W9OA 4C02B 1J6YA 2M1IA 1FKHA 3KABA 4JFIA 2PV2A 3NTPA 3O5PA 4JFKA 2AWGA 3JYJA 4R0XA 5HW6A 1C9HA 1QPLA 3KAIA 1BL4A 1W26A 2XP9A 3KACA 4J4OA 2PPPA 1EQ3A 5HT1A 4DRQA 4TNSA 5BXJA 1ROTA 4DIPA 1FKFA 3O5RA 3ODKA 4LAVA 1NSGA 4DRNA 1KT0A 2DG4A 3O5OA 4U86A 3WH0A 4O2TA 5HUAA 4JFLA 2ZQTA 4ODOA 4IPXA 2FAPA 2K8IA 2ZQVA 2RUCA 2PBCA 3IKDA 5B8IC 4IQCA 4ODMA 4TW7A 2ZQUA 3H9RB 2KO7A 3GPKA 1R9HA 1U79A 3KZ7A 4LAYA 1ZCNA 4QIBA 4TW8A 4DRHA 2D9FA 1FKLA 1ZK6A 3NI6A 4DRJA 2F21A 2ITKA 1FKBA 3NRKA 3I6CA 2N87A
chains in the Genus database with same CATH superfamily
4HARA 3B9AA 3IHZA 1KT1A 1QZ2A 4NSBA 4GGQA 1K9TA 1ZBWA 2IUZA 5HWCA 4QT2A 1FKSA 2Q5AA 3KCEA 2B5UB 4QT3A 1LL7A 4Z2LA 4Z2HA 2RSEA 3OA5A 3B8SA 4PTMA 3UI5A 4KR0B 3LUOA 3FY1A 3O5GA 5GPRA 1D7HA 3ARTA 3O5DA 3TCZA 2DG9A 4L3NA 4L72B 3O5IA 4P8XA 5DEZA 1SYTA 1HXVA 1W9PA 3PRBA 4S3JA 1ITXA 1D7JA 4JYSA 1ZBKA 1LL6A 3PRDA 4DRPA 3CHEA 4P8WA 1B6CA 3AQUA 3ARZA 4U84A 2XP3A 1F8AB 4AY1A 4Q7NA 2KR7A 2L2SA 1L1PA 4DT4A 4ITZA 4MNKA 2XP8A 1E44A 2ZR6A 4Q22A 3RGCA 3TC5A 4DWSB 2MF9A 3CH9A 4U85A 3O5FA 2F4EA 3MDYB 3QOKA 2ZQSA 3GTYX 2DT1A 4UDMA 1Y0OA 2DSZA 5GQBA 1E6RA 2DSWA 4JFMA 2P4VA 4Z2IA 1FKIA 1NH6A 1UR8A 3IK8A 4W9OA 4C02B 1FKHA 4JFIA 1WB0A 2AWGA 4R0XA 5HW6A 4IT4A 1E6ZA 1GRJA 1E9LA 3W4RA 1EQ3A 3FXYA 4DRQA 5BXJA 3WQWA 3RM9A 1TFVA 2AOSA 1ROTA 3ODKA 3GU0A 1NSGA 3O5OA 4O2TA 1W1PA 2K8IA 2ZQVA 3G6MA 4WIWA 2PBCA 3WQVA 2ZQUA 5HWBA 4LAYA 1R9HA 4TW8A 2D9FA 1ZK6A 4DRJA 5DITA 3I6CA 2N87A 4WKAA 3UQIA 1E6PA 4P8UA 1JNDA 2Y78A 1FFQA 3OOBA 4P8VA 4G50A 5J6EA 3AS2A 2XP5A 4FAPA 3UQBA 2VCDA 1KFWA 2MLYA 4WKHA 3AROA 5GPGA 1LJYA 3AS1A 1P5QA 3WKZA 1J4RA 4JFJA 2FDMA 3IKGA 3KAGA 4MGVA 1YW5A 2RURA 1F40A 1Q6IA 3WD4A 3WD0A 4ODNA 1RD6A 1LG1A 3KAFA 1N1AA 2DSVA 2MLZA 3UI6A 1E6NA 2XPAA 2DSUA 4DZ2A 5HW8A 2LGOA 3CHCA 2RUQA 2WM0A 1JNTA 1FKKA 2IF4A 4DH0A 4IQ2A 2KGJA 1W1VA 1ZBVA 2MPHA 3CGMA 4ODKA 4ODLA 2OLHA 3CHDA 2OFNA 2LKNA 1M5YA 2LJ4A 1T11A 1FKGA 3KADA 1Q1CA 2RQSA 2F23A 1EHNA 1E15A 2XPBA 3ARYA 3AS0A 3UF8A 3FAPA 1D2KA 2ZR5A 4MNLA 3O5KA 2WK2A 1FKTA 2PV1A 4DZ3A 3O5MA 2M08A 3RM4A 1J6YA 2M1IA 2A3AA 2PV2A 2A3CA 1QPLA 2ETNA 1W26A 2XP9A 3WIJA 4J4OA 2PPPA 5HT1A 3WL0A 1VF8A 4TNSA 1LQ0A 1HKJA 1LG2A 1H0GA 4DIPA 4LAVA 4U86A 3CHFA 4JFLA 1CTNA 4ML4A 1W1TA 2RUCA 1WNOA 3CZ8A 4TW7A 5DIUA 3ARUA 4QIBA 3KZ7A 3ARPA 1ZCNA 1FKLA 3NI6A 2F21A 1FKBA 3O5LA 3NRKA 3UQAA 4ZPVR 2G8ZA 3WD3A 2O9OA 1FD9A 1H0IA 1JVWA 4NZCA 2YBTA 2RUDA 2F2DA 1W9UA 5D75A 2G41A 3PA7A 2ZR4A 4TW6A 1WAWA 5HKGA 2XP6A 1ROUA 3CGNA 3WD1A 3VAWA 4DRIA 4WJXA 3WL1A 2WLYA 1FKJA 4DRMA 1QPFA 3B9DA 1GOIA 4DROA 4NNRA 4R5EA 1ZBCA 2PPNA 2KE0A 4TYOA 1OGGA 3JYMA 3RMEA 1J4HA 3KAHA 4HBEA 1GUVA 2O92A 1NWUA 4ZPWR 3AS3A 3PRAA 1ZU8A 4IT6A 1FKDA 3WD2A 1HJXA 3O5EA 1EDQA 4Z2GA 2DT3A 3UI4A 3JXVA 1NWTA 1NMWA 4ZS6A 1BKFA 5HTGA 1A7XA 4Z2KA 5I98A 2A3EA 5DIVA 2PI6A 4MPKA 3TDBA 4ODPA 4ZPTR 4ODRA 1EYMA 4ODQA 1XHGA 1YATA 1HKKA 1ZB5A 1OGBA 1NMVA 2YBUA 2KI3A 1X6NA 1W1YA 4MAVA 4FN2A 1W9VA 3KABA 1C9HA 1UR9A 3KAIA 1BL4A 4MNMA 1IX5A 4QZVB 1HJVA 1FKFA 1OWQA 3BXWA 2DG4A 3RM8A 2ZQTA 4ODOA 1SR0A 4IPXA 2FAPA 3IKDA 5B8IC 4DRHA 1HKMA 2WLZA 1U79A 3GPKA 4S3KA 4Z2JA 1O6IA 3RFWA 3G6LA 3O5QA 2DPEA 4DWSA 1NWSA 3ARRA 5HBFA 3B7XA 5DO2A 4WK9A 1Q6UA 1J4IA 1D7IA 1JCHB 2DG3A 1JNEA 3ALFA 2PN0A 4J4NA 4G2PA 1NWRA 2EULA 2FKEA 1GPFA 3ARWA 3PR9A 3EY6A 2UZ5A 4MSPA 4GIVA 1FKRA 4DWSC 2VN1A 1FJDA 2QF8A 4XAKA 1TCOC 5HW7A 2DT2A 2M2AA 2MNTA 4KQZA 1D6OA 1JNSA 3ARVA 1X6LA 4N19A 1LL4A 1XRVA 3ARSA 1PINA 2PPOA 5JH8A 2ESCA 1ZL1A 2B31A 4LGXA 1EIBA 4DRKA 3O5JA 2LPVA 1FFRA 1PBKA 3ARQA 4W9PA 2JZVA 4TX0A 2A3BA 4LAXA 4BF8A 1FAPA 1HJWA 1Q6HA 2DT0A 3ALGA 2PV3A 4DWSD 2MLXA 2XP4A 4W9QA 1HKIA 3ARXA 2KFWA 4LAWA 2XP7A 5DF0A 4MNJA 3NTPA 3O5PA 4JFKA 4URIA 4W5UA 3JYJA 4MTVA 3KACA 3O5RA 3EIPA 4DRNA 1KT0A 5HUAA 3WH0A 3B9EA 3BMBA 4IQCA 4ODMA 3H9RB 2KO7A 4WKFA 2ITKA 4HBOA
chains in the Genus database with same CATH topology
4HARA 3B9AA 3IHZA 1KT1A 1QZ2A 4NSBA 4GGQA 1K9TA 1ZBWA 2IUZA 5HWCA 4QT2A 1FKSA 2Q5AA 3KCEA 4QT3A 1LL7A 4Z2LA 4Z2HA 2RSEA 3OA5A 3B8SA 4PTMA 3UI5A 4KR0B 3LUOA 3FY1A 3O5GA 5GPRA 1D7HA 3ARTA 3O5DA 3TCZA 2DG9A 4L3NA 4L72B 3O5IA 4P8XA 5DEZA 1SYTA 1HXVA 1W9PA 3PRBA 4S3JA 1ITXA 1D7JA 4JYSA 1ZBKA 1LL6A 3PRDA 4DRPA 3CHEA 4P8WA 1B6CA 3AQUA 3ARZA 4U84A 2XP3A 1F8AB 4AY1A 4Q7NA 2KR7A 2L2SA 1L1PA 4DT4A 4ITZA 4MNKA 2XP8A 2ZR6A 4Q22A 3RGCA 3TC5A 4DWSB 2MF9A 3CH9A 4U85A 3O5FA 2F4EA 3MDYB 3QOKA 2ZQSA 2DT1A 1Y0OA 2DSZA 5GQBA 1E6RA 2DSWA 4JFMA 4Z2IA 1FKIA 1NH6A 1UR8A 3IK8A 4W9OA 4C02B 1FKHA 4JFIA 1WB0A 2AWGA 4R0XA 5HW6A 4IT4A 1E6ZA 1E9LA 3W4RA 1EQ3A 3FXYA 4DRQA 5BXJA 3WQWA 3RM9A 1TFVA 2AOSA 1ROTA 3ODKA 1NSGA 3O5OA 4O2TA 1W1PA 2K8IA 2ZQVA 3G6MA 4WIWA 2PBCA 3WQVA 2ZQUA 5HWBA 4LAYA 1R9HA 4TW8A 2D9FA 1ZK6A 4DRJA 5DITA 3I6CA 2N87A 4WKAA 3UQIA 1E6PA 4P8UA 1JNDA 2Y78A 1FFQA 3OOBA 4P8VA 4G50A 5J6EA 3AS2A 2XP5A 4FAPA 3UQBA 2VCDA 1KFWA 2MLYA 4WKHA 3AROA 5GPGA 1LJYA 3AS1A 1P5QA 3WKZA 1J4RA 4JFJA 2FDMA 3IKGA 3KAGA 4MGVA 1YW5A 2RURA 1F40A 1Q6IA 3WD4A 3WD0A 4ODNA 1RD6A 1LG1A 3KAFA 1N1AA 2DSVA 2MLZA 3UI6A 1E6NA 2XPAA 2DSUA 4DZ2A 5HW8A 2LGOA 3CHCA 2RUQA 2WM0A 1JNTA 1FKKA 2IF4A 4DH0A 4IQ2A 2KGJA 1W1VA 1ZBVA 2MPHA 3CGMA 4ODKA 4ODLA 2OLHA 3CHDA 2OFNA 2LKNA 1M5YA 2LJ4A 1T11A 1FKGA 3KADA 1Q1CA 2RQSA 1EHNA 1E15A 2XPBA 3ARYA 3AS0A 3UF8A 3FAPA 1D2KA 2ZR5A 4MNLA 3O5KA 2WK2A 1FKTA 2PV1A 4DZ3A 3O5MA 2M08A 3RM4A 1J6YA 2M1IA 2A3AA 2PV2A 2A3CA 1QPLA 1W26A 2XP9A 3WIJA 4J4OA 2PPPA 5HT1A 3WL0A 1VF8A 4TNSA 1LQ0A 1HKJA 1LG2A 1H0GA 4DIPA 4LAVA 4U86A 3CHFA 4JFLA 1CTNA 4ML4A 1W1TA 2RUCA 1WNOA 3CZ8A 4TW7A 5DIUA 3ARUA 4QIBA 3KZ7A 3ARPA 1ZCNA 1FKLA 3NI6A 2F21A 1FKBA 3O5LA 3NRKA 3UQAA 4ZPVR 2G8ZA 3WD3A 2O9OA 1FD9A 1H0IA 1JVWA 4NZCA 2YBTA 2RUDA 2F2DA 1W9UA 5D75A 2G41A 3PA7A 2ZR4A 4TW6A 1WAWA 5HKGA 2XP6A 1ROUA 3CGNA 3WD1A 3VAWA 4DRIA 4WJXA 3WL1A 2WLYA 1FKJA 4DRMA 1QPFA 3B9DA 1GOIA 4DROA 4NNRA 4R5EA 1ZBCA 2PPNA 2KE0A 4TYOA 1OGGA 3JYMA 3RMEA 1J4HA 3KAHA 4HBEA 1GUVA 2O92A 1NWUA 4ZPWR 3AS3A 3PRAA 1ZU8A 4IT6A 1FKDA 3WD2A 1HJXA 3O5EA 1EDQA 4Z2GA 2DT3A 3UI4A 3JXVA 1NWTA 1NMWA 4ZS6A 1BKFA 5HTGA 1A7XA 4Z2KA 5I98A 2A3EA 5DIVA 2PI6A 4MPKA 3TDBA 4ODPA 4ZPTR 4ODRA 1EYMA 4ODQA 1XHGA 1YATA 1HKKA 1ZB5A 1OGBA 1NMVA 2YBUA 2KI3A 1X6NA 1W1YA 4MAVA 4FN2A 1W9VA 3KABA 1C9HA 1UR9A 3KAIA 1BL4A 4MNMA 1IX5A 4QZVB 1HJVA 1FKFA 1OWQA 3BXWA 2DG4A 3RM8A 2ZQTA 4ODOA 1SR0A 4IPXA 2FAPA 3IKDA 5B8IC 4DRHA 1HKMA 2WLZA 1U79A 3GPKA 4S3KA 4Z2JA 1O6IA 3RFWA 3G6LA 3O5QA 2DPEA 4DWSA 1NWSA 3ARRA 5HBFA 3B7XA 5DO2A 4WK9A 1Q6UA 1J4IA 1D7IA 2DG3A 1JNEA 3ALFA 4J4NA 4G2PA 1NWRA 2FKEA 1GPFA 3ARWA 3PR9A 3EY6A 2UZ5A 4MSPA 4GIVA 1FKRA 4DWSC 2VN1A 1FJDA 2QF8A 4XAKA 1TCOC 5HW7A 2DT2A 2M2AA 2MNTA 4KQZA 1D6OA 1JNSA 3ARVA 1X6LA 4N19A 1LL4A 1XRVA 3ARSA 1PINA 2PPOA 5JH8A 2ESCA 1ZL1A 2B31A 4LGXA 1EIBA 4DRKA 3O5JA 2LPVA 1FFRA 1PBKA 3ARQA 4W9PA 2JZVA 4TX0A 2A3BA 4LAXA 4BF8A 1FAPA 1HJWA 1Q6HA 2DT0A 3ALGA 2PV3A 4DWSD 2MLXA 2XP4A 4W9QA 1HKIA 3ARXA 2KFWA 4LAWA 2XP7A 5DF0A 4MNJA 3NTPA 3O5PA 4JFKA 4URIA 4W5UA 3JYJA 4MTVA 3KACA 3O5RA 4DRNA 1KT0A 5HUAA 3WH0A 3B9EA 4IQCA 4ODMA 3H9RB 2KO7A 4WKFA 2ITKA 4HBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFW A;  3UQI A;  3IHZ A;  1KT1 A;  1QZ2 A;  2Y78 A;  1FD9 A;  4GGQ A;  3O5Q A;  3OOB A;  1JVW A;  3O5L A;  5HWC A;  4G50 A;  5J6E A;  4FAP A;  2XP5 A;  2RUD A;  4QT2 A;  3UQB A;  1FKS A;  2F2D A;  2Q5A A;  2VCD A;  5D75 A;  5DIT A;  3B7X A;  3KCE A;  1Q6U A;  2MLY A;  1J4I A;  1D7I A;  3PA7 A;  4QT3 A;  2DG3 A;  2ZR4 A;  5GPG A;  4TW6 A;  1P5Q A;  4J4N A;  4G2P A;  1J4R A;  2RSE A;  4JFJ A;  5HKG A;  2XP6 A;  2FKE A;  1ROU A;  3IKG A;  3KAG A;  4MGV A;  1YW5 A;  2RUR A;  1F40 A;  1Q6I A;  3CGN A;  5DIU A;  3UI5 A;  3VAW A;  3LUO A;  4DRI A;  3EY6 A;  3O5G A;  2UZ5 A;  4MSP A;  1FKJ A;  4GIV A;  1D7H A;  4ODN A;  4DRM A;  3O5D A;  1QPF A;  3TCZ A;  3KAF A;  1N1A A;  2DG9 A;  4DRO A;  1FKR A;  2MLZ A;  4NNR A;  2VN1 A;  3UI6 A;  3O5I A;  1FJD A;  2PPN A;  1TCO C;  2KE0 A;  4TYO A;  3JYM A;  5HW7 A;  5HWB A;  1J4H A;  2M2A A;  2MNT A;  1HXV A;  2XPA A;  3PRB A;  3KAH A;  1D7J A;  1D6O A;  4JYS A;  4DZ2 A;  5HW8 A;  1JNS A;  2LGO A;  4N19 A;  3PRD A;  4DRP A;  1FKD A;  1PIN A;  1B6C A;  2PPO A;  2RUQ A;  1JNT A;  1FKK A;  2IF4 A;  4DH0 A;  4IQ2 A;  3O5E A;  2KGJ A;  3CGM A;  2MPH A;  4ODK A;  4U84 A;  4ODL A;  3UI4 A;  4DRK A;  2XP3 A;  3O5J A;  1F8A B;  2OFN A;  2LKN A;  2LPV A;  1M5Y A;  3JXV A;  3UQA A;  2KR7 A;  1PBK A;  2LJ4 A;  1NMW A;  1BKF A;  2L2S A;  4W9P A;  5HTG A;  1A7X A;  4DT4 A;  1L1P A;  2JZV A;  1T11 A;  4ITZ A;  1FKG A;  4TX0 A;  2XP8 A;  4LAX A;  3KAD A;  1Q1C A;  2ZR6 A;  4BF8 A;  5I98 A;  2RQS A;  1FAP A;  5DIV A;  3TDB A;  4ODP A;  1Q6H A;  3RGC A;  3TC5 A;  4ODR A;  2XPB A;  2MF9 A;  2PV3 A;  4U85 A;  1EYM A;  3O5F A;  2MLX A;  2XP4 A;  3UF8 A;  3FAP A;  4ODQ A;  2F4E A;  2ZR5 A;  3MDY B;  4W9Q A;  2ZQS A;  3O5K A;  1Y0O A;  1YAT A;  1FKT A;  2KFW A;  4LAW A;  2XP7 A;  1NMV A;  2PV1 A;  4DZ3 A;  2KI3 A;  4JFM A;  3O5M A;  1FKI A;  4FN2 A;  2M08 A;  3IK8 A;  4W9O A;  4C02 B;  1J6Y A;  2M1I A;  1FKH A;  3KAB A;  4JFI A;  2PV2 A;  3NTP A;  3O5P A;  4JFK A;  2AWG A;  3JYJ A;  4R0X A;  5HW6 A;  1C9H A;  1QPL A;  3KAI A;  1BL4 A;  1W26 A;  2XP9 A;  3KAC A;  4J4O A;  2PPP A;  1EQ3 A;  5HT1 A;  4DRQ A;  4TNS A;  5BXJ A;  1ROT A;  4DIP A;  1FKF A;  3O5R A;  3ODK A;  4LAV A;  1NSG A;  4DRN A;  1KT0 A;  2DG4 A;  3O5O A;  4U86 A;  3WH0 A;  4O2T A;  5HUA A;  4JFL A;  2ZQT A;  4ODO A;  4IPX A;  2FAP A;  2K8I A;  2ZQV A;  2RUC A;  2PBC A;  3IKD A;  5B8I C;  4IQC A;  4ODM A;  4TW7 A;  2ZQU A;  3H9R B;  2KO7 A;  3GPK A;  1R9H A;  1U79 A;  3KZ7 A;  4LAY A;  1ZCN A;  4QIB A;  4TW8 A;  4DRH A;  2D9F A;  1FKL A;  1ZK6 A;  3NI6 A;  4DRJ A;  2F21 A;  2ITK A;  1FKB A;  3NRK A;  3I6C A;  2N87 A; 
#chains in the Genus database with same CATH topology
 4HAR A;  3B9A A;  3IHZ A;  1KT1 A;  1QZ2 A;  4NSB A;  4GGQ A;  1K9T A;  1ZBW A;  2IUZ A;  5HWC A;  4QT2 A;  1FKS A;  2Q5A A;  3KCE A;  2B5U B;  4QT3 A;  1LL7 A;  4Z2L A;  4Z2H A;  2RSE A;  3OA5 A;  3B8S A;  4PTM A;  3UI5 A;  4KR0 B;  3LUO A;  3FY1 A;  3O5G A;  5GPR A;  1D7H A;  3ART A;  3O5D A;  3TCZ A;  2DG9 A;  4L3N A;  4L72 B;  3O5I A;  4P8X A;  5DEZ A;  1SYT A;  1HXV A;  1W9P A;  3PRB A;  4S3J A;  1ITX A;  1D7J A;  4JYS A;  1ZBK A;  1LL6 A;  3PRD A;  4DRP A;  3CHE A;  4P8W A;  1B6C A;  3AQU A;  3ARZ A;  4U84 A;  2XP3 A;  1F8A B;  4AY1 A;  4Q7N A;  2KR7 A;  2L2S A;  1L1P A;  4DT4 A;  4ITZ A;  4MNK A;  2XP8 A;  1E44 A;  2ZR6 A;  4Q22 A;  3RGC A;  3TC5 A;  4DWS B;  2MF9 A;  3CH9 A;  4U85 A;  3O5F A;  2F4E A;  3MDY B;  3QOK A;  2ZQS A;  3GTY X;  2DT1 A;  4UDM A;  1Y0O A;  2DSZ A;  5GQB A;  1E6R A;  2DSW A;  4JFM A;  2P4V A;  4Z2I A;  1FKI A;  1NH6 A;  1UR8 A;  3IK8 A;  4W9O A;  4C02 B;  1FKH A;  4JFI A;  1WB0 A;  2AWG A;  4R0X A;  5HW6 A;  4IT4 A;  1E6Z A;  1GRJ A;  1E9L A;  3W4R A;  1EQ3 A;  3FXY A;  4DRQ A;  5BXJ A;  3WQW A;  3RM9 A;  1TFV A;  2AOS A;  1ROT A;  3ODK A;  3GU0 A;  1NSG A;  3O5O A;  4O2T A;  1W1P A;  2K8I A;  2ZQV A;  3G6M A;  4WIW A;  2PBC A;  3WQV A;  2ZQU A;  5HWB A;  4LAY A;  1R9H A;  4TW8 A;  2D9F A;  1ZK6 A;  4DRJ A;  5DIT A;  3I6C A;  2N87 A;  4WKA A;  3UQI A;  1E6P A;  4P8U A;  1JND A;  2Y78 A;  1FFQ A;  3OOB A;  4P8V A;  4G50 A;  5J6E A;  3AS2 A;  2XP5 A;  4FAP A;  3UQB A;  2VCD A;  1KFW A;  2MLY A;  4WKH A;  3ARO A;  5GPG A;  1LJY A;  3AS1 A;  1P5Q A;  3WKZ A;  1J4R A;  4JFJ A;  2FDM A;  3IKG A;  3KAG A;  4MGV A;  1YW5 A;  2RUR A;  1F40 A;  1Q6I A;  3WD4 A;  3WD0 A;  4ODN A;  1RD6 A;  1LG1 A;  3KAF A;  1N1A A;  2DSV A;  2MLZ A;  3UI6 A;  1E6N A;  2XPA A;  2DSU A;  4DZ2 A;  5HW8 A;  2LGO A;  3CHC A;  2RUQ A;  2WM0 A;  1JNT A;  1FKK A;  2IF4 A;  4DH0 A;  4IQ2 A;  2KGJ A;  1W1V A;  1ZBV A;  2MPH A;  3CGM A;  4ODK A;  4ODL A;  2OLH A;  3CHD A;  2OFN A;  2LKN A;  1M5Y A;  2LJ4 A;  1T11 A;  1FKG A;  3KAD A;  1Q1C A;  2RQS A;  2F23 A;  1EHN A;  1E15 A;  2XPB A;  3ARY A;  3AS0 A;  3UF8 A;  3FAP A;  1D2K A;  2ZR5 A;  4MNL A;  3O5K A;  2WK2 A;  1FKT A;  2PV1 A;  4DZ3 A;  3O5M A;  2M08 A;  3RM4 A;  1J6Y A;  2M1I A;  2A3A A;  2PV2 A;  2A3C A;  1QPL A;  2ETN A;  1W26 A;  2XP9 A;  3WIJ A;  4J4O A;  2PPP A;  5HT1 A;  3WL0 A;  1VF8 A;  4TNS A;  1LQ0 A;  1HKJ A;  1LG2 A;  1H0G A;  4DIP A;  4LAV A;  4U86 A;  3CHF A;  4JFL A;  1CTN A;  4ML4 A;  1W1T A;  2RUC A;  1WNO A;  3CZ8 A;  4TW7 A;  5DIU A;  3ARU A;  4QIB A;  3KZ7 A;  3ARP A;  1ZCN A;  1FKL A;  3NI6 A;  2F21 A;  1FKB A;  3O5L A;  3NRK A;  3UQA A;  4ZPV R;  2G8Z A;  3WD3 A;  2O9O A;  1FD9 A;  1H0I A;  1JVW A;  4NZC A;  2YBT A;  2RUD A;  2F2D A;  1W9U A;  5D75 A;  2G41 A;  3PA7 A;  2ZR4 A;  4TW6 A;  1WAW A;  5HKG A;  2XP6 A;  1ROU A;  3CGN A;  3WD1 A;  3VAW A;  4DRI A;  4WJX A;  3WL1 A;  2WLY A;  1FKJ A;  4DRM A;  1QPF A;  3B9D A;  1GOI A;  4DRO A;  4NNR A;  4R5E A;  1ZBC A;  2PPN A;  2KE0 A;  4TYO A;  1OGG A;  3JYM A;  3RME A;  1J4H A;  3KAH A;  4HBE A;  1GUV A;  2O92 A;  1NWU A;  4ZPW R;  3AS3 A;  3PRA A;  1ZU8 A;  4IT6 A;  1FKD A;  3WD2 A;  1HJX A;  3O5E A;  1EDQ A;  4Z2G A;  2DT3 A;  3UI4 A;  3JXV A;  1NWT A;  1NMW A;  4ZS6 A;  1BKF A;  5HTG A;  1A7X A;  4Z2K A;  5I98 A;  2A3E A;  5DIV A;  2PI6 A;  4MPK A;  3TDB A;  4ODP A;  4ZPT R;  4ODR A;  1EYM A;  4ODQ A;  1XHG A;  1YAT A;  1HKK A;  1ZB5 A;  1OGB A;  1NMV A;  2YBU A;  2KI3 A;  1X6N A;  1W1Y A;  4MAV A;  4FN2 A;  1W9V A;  3KAB A;  1C9H A;  1UR9 A;  3KAI A;  1BL4 A;  4MNM A;  1IX5 A;  4QZV B;  1HJV A;  1FKF A;  1OWQ A;  3BXW A;  2DG4 A;  3RM8 A;  2ZQT A;  4ODO A;  1SR0 A;  4IPX A;  2FAP A;  3IKD A;  5B8I C;  4DRH A;  1HKM A;  2WLZ A;  1U79 A;  3GPK A;  4S3K A;  4Z2J A;  1O6I A;  3RFW A;  3G6L A;  3O5Q A;  2DPE A;  4DWS A;  1NWS A;  3ARR A;  5HBF A;  3B7X A;  5DO2 A;  4WK9 A;  1Q6U A;  1J4I A;  1D7I A;  1JCH B;  2DG3 A;  1JNE A;  3ALF A;  2PN0 A;  4J4N A;  4G2P A;  1NWR A;  2EUL A;  2FKE A;  1GPF A;  3ARW A;  3PR9 A;  3EY6 A;  2UZ5 A;  4MSP A;  4GIV A;  1FKR A;  4DWS C;  2VN1 A;  1FJD A;  2QF8 A;  4XAK A;  1TCO C;  5HW7 A;  2DT2 A;  2M2A A;  2MNT A;  4KQZ A;  1D6O A;  1JNS A;  3ARV A;  1X6L A;  4N19 A;  1LL4 A;  1XRV A;  3ARS A;  1PIN A;  2PPO A;  5JH8 A;  2ESC A;  1ZL1 A;  2B31 A;  4LGX A;  1EIB A;  4DRK A;  3O5J A;  2LPV A;  1FFR A;  1PBK A;  3ARQ A;  4W9P A;  2JZV A;  4TX0 A;  2A3B A;  4LAX A;  4BF8 A;  1FAP A;  1HJW A;  1Q6H A;  2DT0 A;  3ALG A;  2PV3 A;  4DWS D;  2MLX A;  2XP4 A;  4W9Q A;  1HKI A;  3ARX A;  2KFW A;  4LAW A;  2XP7 A;  5DF0 A;  4MNJ A;  3NTP A;  3O5P A;  4JFK A;  4URI A;  4W5U A;  3JYJ A;  4MTV A;  3KAC A;  3O5R A;  3EIP A;  4DRN A;  1KT0 A;  5HUA A;  3WH0 A;  3B9E A;  3BMB A;  4IQC A;  4ODM A;  3H9R B;  2KO7 A;  4WKF A;  2ITK A;  4HBO A; 
#chains in the Genus database with same CATH homology
 4HAR A;  3B9A A;  3IHZ A;  1KT1 A;  1QZ2 A;  4NSB A;  4GGQ A;  1K9T A;  1ZBW A;  2IUZ A;  5HWC A;  4QT2 A;  1FKS A;  2Q5A A;  3KCE A;  4QT3 A;  1LL7 A;  4Z2L A;  4Z2H A;  2RSE A;  3OA5 A;  3B8S A;  4PTM A;  3UI5 A;  4KR0 B;  3LUO A;  3FY1 A;  3O5G A;  5GPR A;  1D7H A;  3ART A;  3O5D A;  3TCZ A;  2DG9 A;  4L3N A;  4L72 B;  3O5I A;  4P8X A;  5DEZ A;  1SYT A;  1HXV A;  1W9P A;  3PRB A;  4S3J A;  1ITX A;  1D7J A;  4JYS A;  1ZBK A;  1LL6 A;  3PRD A;  4DRP A;  3CHE A;  4P8W A;  1B6C A;  3AQU A;  3ARZ A;  4U84 A;  2XP3 A;  1F8A B;  4AY1 A;  4Q7N A;  2KR7 A;  2L2S A;  1L1P A;  4DT4 A;  4ITZ A;  4MNK A;  2XP8 A;  2ZR6 A;  4Q22 A;  3RGC A;  3TC5 A;  4DWS B;  2MF9 A;  3CH9 A;  4U85 A;  3O5F A;  2F4E A;  3MDY B;  3QOK A;  2ZQS A;  2DT1 A;  1Y0O A;  2DSZ A;  5GQB A;  1E6R A;  2DSW A;  4JFM A;  4Z2I A;  1FKI A;  1NH6 A;  1UR8 A;  3IK8 A;  4W9O A;  4C02 B;  1FKH A;  4JFI A;  1WB0 A;  2AWG A;  4R0X A;  5HW6 A;  4IT4 A;  1E6Z A;  1E9L A;  3W4R A;  1EQ3 A;  3FXY A;  4DRQ A;  5BXJ A;  3WQW A;  3RM9 A;  1TFV A;  2AOS A;  1ROT A;  3ODK A;  1NSG A;  3O5O A;  4O2T A;  1W1P A;  2K8I A;  2ZQV A;  3G6M A;  4WIW A;  2PBC A;  3WQV A;  2ZQU A;  5HWB A;  4LAY A;  1R9H A;  4TW8 A;  2D9F A;  1ZK6 A;  4DRJ A;  5DIT A;  3I6C A;  2N87 A;  4WKA A;  3UQI A;  1E6P A;  4P8U A;  1JND A;  2Y78 A;  1FFQ A;  3OOB A;  4P8V A;  4G50 A;  5J6E A;  3AS2 A;  2XP5 A;  4FAP A;  3UQB A;  2VCD A;  1KFW A;  2MLY A;  4WKH A;  3ARO A;  5GPG A;  1LJY A;  3AS1 A;  1P5Q A;  3WKZ A;  1J4R A;  4JFJ A;  2FDM A;  3IKG A;  3KAG A;  4MGV A;  1YW5 A;  2RUR A;  1F40 A;  1Q6I A;  3WD4 A;  3WD0 A;  4ODN A;  1RD6 A;  1LG1 A;  3KAF A;  1N1A A;  2DSV A;  2MLZ A;  3UI6 A;  1E6N A;  2XPA A;  2DSU A;  4DZ2 A;  5HW8 A;  2LGO A;  3CHC A;  2RUQ A;  2WM0 A;  1JNT A;  1FKK A;  2IF4 A;  4DH0 A;  4IQ2 A;  2KGJ A;  1W1V A;  1ZBV A;  2MPH A;  3CGM A;  4ODK A;  4ODL A;  2OLH A;  3CHD A;  2OFN A;  2LKN A;  1M5Y A;  2LJ4 A;  1T11 A;  1FKG A;  3KAD A;  1Q1C A;  2RQS A;  1EHN A;  1E15 A;  2XPB A;  3ARY A;  3AS0 A;  3UF8 A;  3FAP A;  1D2K A;  2ZR5 A;  4MNL A;  3O5K A;  2WK2 A;  1FKT A;  2PV1 A;  4DZ3 A;  3O5M A;  2M08 A;  3RM4 A;  1J6Y A;  2M1I A;  2A3A A;  2PV2 A;  2A3C A;  1QPL A;  1W26 A;  2XP9 A;  3WIJ A;  4J4O A;  2PPP A;  5HT1 A;  3WL0 A;  1VF8 A;  4TNS A;  1LQ0 A;  1HKJ A;  1LG2 A;  1H0G A;  4DIP A;  4LAV A;  4U86 A;  3CHF A;  4JFL A;  1CTN A;  4ML4 A;  1W1T A;  2RUC A;  1WNO A;  3CZ8 A;  4TW7 A;  5DIU A;  3ARU A;  4QIB A;  3KZ7 A;  3ARP A;  1ZCN A;  1FKL A;  3NI6 A;  2F21 A;  1FKB A;  3O5L A;  3NRK A;  3UQA A;  4ZPV R;  2G8Z A;  3WD3 A;  2O9O A;  1FD9 A;  1H0I A;  1JVW A;  4NZC A;  2YBT A;  2RUD A;  2F2D A;  1W9U A;  5D75 A;  2G41 A;  3PA7 A;  2ZR4 A;  4TW6 A;  1WAW A;  5HKG A;  2XP6 A;  1ROU A;  3CGN A;  3WD1 A;  3VAW A;  4DRI A;  4WJX A;  3WL1 A;  2WLY A;  1FKJ A;  4DRM A;  1QPF A;  3B9D A;  1GOI A;  4DRO A;  4NNR A;  4R5E A;  1ZBC A;  2PPN A;  2KE0 A;  4TYO A;  1OGG A;  3JYM A;  3RME A;  1J4H A;  3KAH A;  4HBE A;  1GUV A;  2O92 A;  1NWU A;  4ZPW R;  3AS3 A;  3PRA A;  1ZU8 A;  4IT6 A;  1FKD A;  3WD2 A;  1HJX A;  3O5E A;  1EDQ A;  4Z2G A;  2DT3 A;  3UI4 A;  3JXV A;  1NWT A;  1NMW A;  4ZS6 A;  1BKF A;  5HTG A;  1A7X A;  4Z2K A;  5I98 A;  2A3E A;  5DIV A;  2PI6 A;  4MPK A;  3TDB A;  4ODP A;  4ZPT R;  4ODR A;  1EYM A;  4ODQ A;  1XHG A;  1YAT A;  1HKK A;  1ZB5 A;  1OGB A;  1NMV A;  2YBU A;  2KI3 A;  1X6N A;  1W1Y A;  4MAV A;  4FN2 A;  1W9V A;  3KAB A;  1C9H A;  1UR9 A;  3KAI A;  1BL4 A;  4MNM A;  1IX5 A;  4QZV B;  1HJV A;  1FKF A;  1OWQ A;  3BXW A;  2DG4 A;  3RM8 A;  2ZQT A;  4ODO A;  1SR0 A;  4IPX A;  2FAP A;  3IKD A;  5B8I C;  4DRH A;  1HKM A;  2WLZ A;  1U79 A;  3GPK A;  4S3K A;  4Z2J A;  1O6I A;  3RFW A;  3G6L A;  3O5Q A;  2DPE A;  4DWS A;  1NWS A;  3ARR A;  5HBF A;  3B7X A;  5DO2 A;  4WK9 A;  1Q6U A;  1J4I A;  1D7I A;  2DG3 A;  1JNE A;  3ALF A;  4J4N A;  4G2P A;  1NWR A;  2FKE A;  1GPF A;  3ARW A;  3PR9 A;  3EY6 A;  2UZ5 A;  4MSP A;  4GIV A;  1FKR A;  4DWS C;  2VN1 A;  1FJD A;  2QF8 A;  4XAK A;  1TCO C;  5HW7 A;  2DT2 A;  2M2A A;  2MNT A;  4KQZ A;  1D6O A;  1JNS A;  3ARV A;  1X6L A;  4N19 A;  1LL4 A;  1XRV A;  3ARS A;  1PIN A;  2PPO A;  5JH8 A;  2ESC A;  1ZL1 A;  2B31 A;  4LGX A;  1EIB A;  4DRK A;  3O5J A;  2LPV A;  1FFR A;  1PBK A;  3ARQ A;  4W9P A;  2JZV A;  4TX0 A;  2A3B A;  4LAX A;  4BF8 A;  1FAP A;  1HJW A;  1Q6H A;  2DT0 A;  3ALG A;  2PV3 A;  4DWS D;  2MLX A;  2XP4 A;  4W9Q A;  1HKI A;  3ARX A;  2KFW A;  4LAW A;  2XP7 A;  5DF0 A;  4MNJ A;  3NTP A;  3O5P A;  4JFK A;  4URI A;  4W5U A;  3JYJ A;  4MTV A;  3KAC A;  3O5R A;  4DRN A;  1KT0 A;  5HUA A;  3WH0 A;  3B9E A;  4IQC A;  4ODM A;  3H9R B;  2KO7 A;  4WKF A;  2ITK A;  4HBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...