1YATA

Improved calcineurin inhibition by yeast fkbp12-drug complexes. crystallographic and functional analysis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
SEVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords FK506 BINDING PROTEIN
publication title Improved calcineurin inhibition by yeast FKBP12-drug complexes. Crystallographic and functional analysis.
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yatA00
1Q6IA 2XP8A 2VN1A 3PA7A 1R9HA 1Q6HA 3O5EA 2D9FA 2ZQSA 2LJ4A 2XPBA 5DITA 2XP7A 3IKGA 1P5QA 3KAGA 1C9HA 2FKEA 2RUQA 4ODMA 2MNTA 2JZVA 2M2AA 4J4NA 1YATA 4ODLA 1U79A 4DH0A 4DRNA 1QPFA 4DRMA 3GPKA 1L1PA 2PV3A 4ODNA 2KR7A 4U86A 3H9RB 3NTPA 3FAPA 3KAIA 4J4OA 3PRDA 4JYSA 1ZCNA 4QIBA 2F2DA 4DRQA 3UI4A 4JFKA 1Q6UA 3UQIA 1A7XA 2KO7A 2RQSA 3JXVA 4QT2A 1J4IA 3B7XA 2MLYA 3KCEA 1YW5A 4GGQA 1D7HA 1T11A 1ZK6A 2LGOA 3NRKA 2ITKA 4JFIA 1ROTA 2F21A 2LPVA 4NNRA 4DROA 1JNTA 3PRBA 4JFJA 4DT4A 1Q1CA 3O5DA 4G50A 1FKRA 2KFWA 1PBKA 1FKBA 1D6OA 1FKGA 2RSEA 2MLZA 3VAWA 2OFNA 3IHZA 5HT1A 1FD9A 1FKTA 2PPNA 4TNSA 3RGCA 5HW6A 3I6CA 3CGNA 3MDYB 3IKDA 4TW8A 3O5IA 5HUAA 3EY6A 1TCOC 2PPPA 2PV2A 3UQAA 2XP3A 4TW7A 5J6EA 4TYOA 1M5YA 2ZQVA 4DRHA 4LAWA 2PPOA 4TW6A 1PINA 4LAXA 4DRPA 5B8IC 2KI3A 5DIUA 3KABA 3UQBA 4W9PA 1Y0OA 3KAHA 4G2PA 4DRKA 4DZ2A 1FKIA 2KGJA 3JYMA 2IF4A 1FKFA 2RUDA 2UZ5A 2RURA 3CGMA 2DG3A 2MLXA 2FAPA 5HW8A 4LAYA 2PV1A 5HW7A 4W9QA 1JVWA 4N19A 2ZQUA 2VCDA 1D7IA 2XP9A 3O5QA 3KZ7A 2K8IA 2ZR4A 3UI6A 3JYJA 1FKJA 3O5RA 4QT3A 2F4EA 3KADA 4U85A 1JNSA 1FAPA 1EYMA 1FKLA 2L2SA 4ODRA 3UI5A 2MF9A 4DRJA 1HXVA 2Q5AA 3O5OA 3TC5A 1EQ3A 3ODKA 4BF8A 1FKHA 5DIVA 2AWGA 2RUCA 1ROUA 2Y78A 5D75A 4TX0A 5HTGA 4C02B 4ODKA 4GIVA 4DRIA 3KAFA 4IQ2A 4FAPA 5I98A 4LAVA 1BL4A 1J4RA 3LUOA 3O5PA 2KE0A 1D7JA 2XP4A 1FKDA 1FKSA 3OOBA 3TDBA 4ODQA 4DIPA 1NSGA 2ZQTA 5BXJA 3O5GA 2M1IA 1FKKA 4ODPA 2DG9A 3O5KA 4JFMA 2ZR6A 3O5LA 2M08A 2N87A 2XP5A 1KT0A 1NMVA 4FN2A 5GPGA 4DZ3A 5HKGA 4W9OA 4ODOA 4ITZA 4MGVA 1J6YA 3UF8A 4MSPA 2ZR5A 1NMWA 3IK8A 1N1AA 4IPXA 1J4HA 1BKFA 1QPLA 4U84A 4R0XA 5HWCA 4JFLA 1QZ2A 5HWBA 4O2TA 3O5MA 3WH0A 2MPHA 1B6CA 1KT1A 3O5JA 2XP6A 1F40A 3RFWA 2PBCA 1F8AB 2DG4A 3KACA 3O5FA 2XPAA 1W26A 3NI6A 1FJDA 2LKNA 4IQCA 3TCZA
chains in the Genus database with same CATH superfamily
4Q22A 3PA7A 1R9HA 4Z2GA 2PI6A 4HBEA 1W9UA 2D9FA 4WKHA 4WK9A 1CTNA 1LL7A 3ARZA 4Z2IA 2DT1A 1HJXA 5HBFA 4ODLA 3B9DA 1U79A 4DRNA 1L1PA 4PTMA 3RM4A 3B9AA 4ODNA 3W4RA 1SYTA 5GQBA 3KAIA 4QIBA 2WK2A 3CHFA 4DRQA 2KO7A 4MAVA 2RQSA 3JXVA 1RD6A 1J4IA 1TFVA 1XHGA 1D7HA 1T11A 3NRKA 2LPVA 2F21A 3WIJA 3GU0A 3PRBA 4DT4A 1Q1CA 1HJWA 1SR0A 2KFWA 2WLYA 1D6OA 1FKGA 2PPNA 3GTYX 4TNSA 3MDYB 1JNEA 3CHEA 3WQVA 4P8WA 2PV2A 5J6EA 3AS3A 4LAXA 4DRPA 4P8UA 5DIUA 3KABA 1Y0OA 5GPRA 4DRKA 3ARXA 1ZL1A 2DPEA 2A3BA 2RUDA 1W1YA 5HW8A 4LAYA 4WKFA 1JVWA 4N19A 2ZQUA 3KZ7A 1LL6A 1ROUA 4IT4A 4C02B 4IQ2A 1BL4A 1J4RA 4KR0B 1D2KA 4DIPA 2ZQTA 5GPGA 1WB0A 4W9OA 1JNDA 1J6YA 4Q7NA 3B9EA 2B31A 3IK8A 2ZR5A 2WM0A 1UR8A 4ZPWR 4NSBA 1GPFA 4O2TA 3QOKA 4ZPTR 4XAKA 1KT1A 1H0GA 3O5FA 1W26A 1FFQA 4IQCA 2QF8A 2VN1A 2O9OA 1Q6HA 3O5EA 3WD4A 1P5QA 4QZVB 2FKEA 4ODMA 2DT3A 1ITXA 1ZBWA 2JZVA 2DSVA 4DH0A 3ALGA 3PR9A 2DSWA 4ML4A 3ARTA 4U86A 3H9RB 3ARYA 5DF0A 4P8VA 1Q6UA 1GUVA 2B5UB 4S3JA 3AS2A 1YW5A 1ROTA 4NNRA 4JFJA 3O5DA 3CHDA 2WLZA 3ARWA 1FKRA 1FKBA 4IT6A 3VAWA 1FKTA 4R5EA 3RGCA 1W1VA 1E6PA 4TW7A 4L72B 4TYOA 5DEZA 2ZQVA 2PN0A 4L3NA 2PPOA 1PINA 5B8IC 3AROA 2KI3A 3UQBA 1NWTA 3KAHA 1GOIA 5DO2A 2IF4A 4DWSB 1O6IA 3G6MA 3CGMA 4URIA 2A3CA 2PV1A 1D7IA 3UI6A 3WD1A 2ZR4A 1FKJA 4DWSA 2EULA 3KADA 1JNSA 1FKLA 1FKHA 2RUCA 3G6LA 2G8ZA 4Z2LA 3TDBA 3AQUA 2DSUA 4ODQA 1NSGA 5BXJA 3O5GA 4DWSD 2DG9A 4JFMA 2ZR6A 3O5LA 2XP5A 4DZ3A 1UR9A 1ZBCA 1HKKA 3UF8A 2O92A 4IPXA 1QPLA 4WIWA 1QZ2A 5HWBA 2G41A 1XRVA 2XP6A 3O5JA 1F40A 2YBUA 2XPAA 3NI6A 3TCZA 1Q6IA 2XP8A 1OGBA 4S3KA 1X6NA 2ESCA 2XPBA 3ARVA 2MNTA 2F23A 1YATA 2YBTA 4DRMA 3GPKA 4LGXA 2PV3A 2KR7A 3WD2A 3NTPA 3FAPA 3PRDA 1W1PA 1ZBVA 3FXYA 4Z2JA 2F2DA 3RM8A 4JFKA 3ALFA 3UQIA 1A7XA 3B7XA 2MLYA 3KCEA 4JYSA 1ZK6A 4JFIA 3WKZA 1JNTA 4HARA 4G50A 2MLZA 2OFNA 3IHZA 5HT1A 3I6CA 3IKDA 4TW8A 1WNOA 1TCOC 2PPPA 3EY6A 1M5YA 2FDMA 4ZPVR 4DRHA 1NWRA 2DT2A 3OA5A 1FFRA 3ARSA 4W9PA 1W1TA 1IX5A 4DZ2A 1FKIA 2KGJA 3JYMA 4P8XA 1FKFA 2UZ5A 1NWSA 2RURA 3WD0A 2MLXA 1W9PA 1X6LA 2VCDA 1E6RA 2XP9A 3O5QA 1GRJA 4ZS6A 1HKMA 2F4EA 4U85A 1EYMA 2L2SA 2MF9A 2Q5AA 3O5OA 1EQ3A 4BF8A 4MNMA 5DIVA 2AWGA 2Y78A 5HTGA 1K9TA 4TX0A 4GIVA 4DRIA 3KAFA 4FAPA 5I98A 4LAVA 3AS1A 3O5PA 1D7JA 1FKSA 2M1IA 3O5KA 3WD3A 1E6NA 2DT0A 5HKGA 4ODOA 4ITZA 3CZ8A 1LG2A 1NWUA 1NMWA 1LL4A 3ARPA 1BKFA 3RMEA 3FY1A 2P4VA 3O5MA 2MPHA 3PRAA 1B6CA 3B8SA 1FJDA 3KACA 1F8AB 1HKJA 4WKAA 3AS0A 4MNLA 1EDQA 3BMBA 1H0IA 2ZQSA 2LJ4A 1KFWA 5DITA 3WL1A 2XP7A 1ZU8A 3IKGA 3KAGA 1C9HA 2RUQA 3CHCA 1E44A 4J4NA 4AY1A 2M2AA 1QPFA 1ZBKA 4WJXA 3ARRA 4J4OA 1ZCNA 1ZB5A 1LG1A 3UI4A 1W9VA 2DSZA 1WAWA 1OGGA 4QT2A 4GGQA 2LGOA 2ITKA 4DROA 4DWSC 1EIBA 1PBKA 2RSEA 4HBOA 1LJYA 1FD9A 4MPKA 4W5UA 5HW6A 3CGNA 3WL0A 2AOSA 3O5IA 5HUAA 3CH9A 3UQAA 2XP3A 4Z2KA 3RM9A 5JH8A 4MNJA 4LAWA 4MNKA 4Z2HA 4TW6A 1HKIA 2ETNA 2IUZA 1EHNA 4G2PA 3EIPA 2DG3A 2FAPA 5HW7A 3WQWA 4W9QA 1E6ZA 1JCHB 2K8IA 3JYJA 3O5RA 1LQ0A 4QT3A 4UDMA 1FAPA 3BXWA 4ODRA 3UI5A 4DRJA 1HXVA 3TC5A 3ODKA 5D75A 4ODKA 2A3EA 3LUOA 2KE0A 2XP4A 3OOBA 1FKDA 4NZCA 1E9LA 1FKKA 4ODPA 1NH6A 4FN2A 2M08A 2N87A 1KT0A 1NMVA 1VF8A 4KQZA 1E15A 4MGVA 4MSPA 1N1AA 2A3AA 1J4HA 4U84A 4R0XA 5HWCA 4JFLA 3WH0A 1HJVA 2OLHA 1OWQA 2PBCA 3RFWA 2DG4A 3ARQA 2LKNA 4MTVA 3ARUA
chains in the Genus database with same CATH topology
4Q22A 3PA7A 1R9HA 4Z2GA 2PI6A 4HBEA 1W9UA 2D9FA 4WKHA 4WK9A 1CTNA 1LL7A 3ARZA 4Z2IA 2DT1A 1HJXA 5HBFA 4ODLA 3B9DA 1U79A 4DRNA 1L1PA 4PTMA 3RM4A 3B9AA 4ODNA 3W4RA 1SYTA 5GQBA 3KAIA 4QIBA 2WK2A 3CHFA 4DRQA 2KO7A 4MAVA 2RQSA 3JXVA 1RD6A 1J4IA 1TFVA 1XHGA 1D7HA 1T11A 3NRKA 2LPVA 2F21A 3WIJA 3PRBA 4DT4A 1Q1CA 1HJWA 1SR0A 2KFWA 2WLYA 1D6OA 1FKGA 2PPNA 4TNSA 3MDYB 1JNEA 3CHEA 3WQVA 4P8WA 2PV2A 5J6EA 3AS3A 4LAXA 4DRPA 4P8UA 5DIUA 3KABA 1Y0OA 5GPRA 4DRKA 3ARXA 1ZL1A 2DPEA 2A3BA 2RUDA 1W1YA 5HW8A 4LAYA 4WKFA 1JVWA 4N19A 2ZQUA 3KZ7A 1LL6A 1ROUA 4IT4A 4C02B 4IQ2A 1BL4A 1J4RA 4KR0B 1D2KA 4DIPA 2ZQTA 5GPGA 1WB0A 4W9OA 1JNDA 1J6YA 4Q7NA 3B9EA 2B31A 3IK8A 2ZR5A 2WM0A 1UR8A 4ZPWR 4NSBA 1GPFA 4O2TA 3QOKA 4ZPTR 4XAKA 1KT1A 1H0GA 3O5FA 1W26A 1FFQA 4IQCA 2QF8A 2VN1A 2O9OA 1Q6HA 3O5EA 3WD4A 1P5QA 4QZVB 2FKEA 4ODMA 2DT3A 1ITXA 1ZBWA 2JZVA 2DSVA 4DH0A 3ALGA 3PR9A 2DSWA 4ML4A 3ARTA 4U86A 3H9RB 3ARYA 5DF0A 4P8VA 1Q6UA 1GUVA 4S3JA 3AS2A 1YW5A 1ROTA 4NNRA 4JFJA 3O5DA 3CHDA 2WLZA 3ARWA 1FKRA 1FKBA 4IT6A 3VAWA 1FKTA 4R5EA 3RGCA 1W1VA 1E6PA 4TW7A 4L72B 4TYOA 5DEZA 2ZQVA 4L3NA 2PPOA 1PINA 5B8IC 3AROA 2KI3A 3UQBA 1NWTA 3KAHA 1GOIA 5DO2A 2IF4A 4DWSB 1O6IA 3G6MA 3CGMA 4URIA 2A3CA 2PV1A 1D7IA 3UI6A 3WD1A 2ZR4A 1FKJA 4DWSA 3KADA 1JNSA 1FKLA 1FKHA 2RUCA 3G6LA 2G8ZA 4Z2LA 3TDBA 3AQUA 2DSUA 4ODQA 1NSGA 5BXJA 3O5GA 4DWSD 2DG9A 4JFMA 2ZR6A 3O5LA 2XP5A 4DZ3A 1UR9A 1ZBCA 1HKKA 3UF8A 2O92A 4IPXA 1QPLA 4WIWA 1QZ2A 5HWBA 2G41A 3O5JA 1XRVA 2XP6A 1F40A 2YBUA 2XPAA 3NI6A 3TCZA 1Q6IA 2XP8A 1OGBA 4S3KA 1X6NA 2ESCA 2XPBA 3ARVA 2MNTA 1YATA 2YBTA 4DRMA 3GPKA 4LGXA 2PV3A 2KR7A 3WD2A 3NTPA 3FAPA 3PRDA 1W1PA 1ZBVA 3FXYA 4Z2JA 2F2DA 3RM8A 4JFKA 3ALFA 3UQIA 1A7XA 3B7XA 2MLYA 3KCEA 4JYSA 1ZK6A 4JFIA 3WKZA 1JNTA 4HARA 4G50A 2MLZA 2OFNA 3IHZA 5HT1A 3I6CA 3IKDA 4TW8A 1WNOA 1TCOC 2PPPA 3EY6A 1M5YA 2FDMA 4ZPVR 4DRHA 1NWRA 2DT2A 3OA5A 1FFRA 3ARSA 4W9PA 1W1TA 1IX5A 4DZ2A 1FKIA 2KGJA 3JYMA 4P8XA 1FKFA 2UZ5A 1NWSA 2RURA 3WD0A 2MLXA 1W9PA 1X6LA 2VCDA 1E6RA 2XP9A 3O5QA 4ZS6A 1HKMA 2F4EA 4U85A 1EYMA 2L2SA 2MF9A 2Q5AA 3O5OA 1EQ3A 4BF8A 4MNMA 5DIVA 2AWGA 2Y78A 5HTGA 1K9TA 4TX0A 4GIVA 4DRIA 3KAFA 4FAPA 5I98A 4LAVA 3AS1A 3O5PA 1D7JA 1FKSA 2M1IA 3O5KA 3WD3A 1E6NA 2DT0A 5HKGA 4ODOA 4ITZA 3CZ8A 1LG2A 1NWUA 1NMWA 1LL4A 3ARPA 1BKFA 3RMEA 3FY1A 3O5MA 2MPHA 3PRAA 1B6CA 3B8SA 1FJDA 3KACA 1F8AB 1HKJA 4WKAA 3AS0A 4MNLA 1EDQA 1H0IA 2ZQSA 2LJ4A 1KFWA 5DITA 3WL1A 2XP7A 1ZU8A 3IKGA 3KAGA 1C9HA 2RUQA 3CHCA 4J4NA 4AY1A 2M2AA 1QPFA 1ZBKA 4WJXA 3ARRA 4J4OA 1ZCNA 1ZB5A 1LG1A 3UI4A 1W9VA 2DSZA 1WAWA 1OGGA 4QT2A 4GGQA 2LGOA 2ITKA 4DROA 4DWSC 1EIBA 1PBKA 2RSEA 4HBOA 1LJYA 1FD9A 4MPKA 4W5UA 5HW6A 3CGNA 3WL0A 2AOSA 3O5IA 5HUAA 3CH9A 3UQAA 2XP3A 4Z2KA 3RM9A 5JH8A 4MNJA 4LAWA 4MNKA 4Z2HA 4TW6A 1HKIA 2IUZA 1EHNA 4G2PA 2DG3A 2FAPA 5HW7A 3WQWA 4W9QA 1E6ZA 2K8IA 3JYJA 3O5RA 1LQ0A 4QT3A 1FAPA 3BXWA 4ODRA 3UI5A 4DRJA 1HXVA 3TC5A 3ODKA 5D75A 4ODKA 2A3EA 3LUOA 2KE0A 2XP4A 3OOBA 1FKDA 4NZCA 1E9LA 1FKKA 4ODPA 1NH6A 4FN2A 2M08A 2N87A 1KT0A 1NMVA 1VF8A 4KQZA 1E15A 4MGVA 4MSPA 1N1AA 2A3AA 1J4HA 4U84A 4R0XA 5HWCA 4JFLA 3WH0A 1HJVA 2OLHA 1OWQA 2PBCA 3RFWA 2DG4A 3ARQA 2LKNA 4MTVA 3ARUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6I A;  2XP8 A;  2VN1 A;  3PA7 A;  1R9H A;  1Q6H A;  3O5E A;  2D9F A;  2ZQS A;  2LJ4 A;  2XPB A;  5DIT A;  2XP7 A;  3IKG A;  1P5Q A;  3KAG A;  1C9H A;  2FKE A;  2RUQ A;  4ODM A;  2MNT A;  2JZV A;  2M2A A;  4J4N A;  1YAT A;  4ODL A;  1U79 A;  4DH0 A;  4DRN A;  1QPF A;  4DRM A;  3GPK A;  1L1P A;  2PV3 A;  4ODN A;  2KR7 A;  4U86 A;  3H9R B;  3NTP A;  3FAP A;  3KAI A;  4J4O A;  3PRD A;  4JYS A;  1ZCN A;  4QIB A;  2F2D A;  4DRQ A;  3UI4 A;  4JFK A;  1Q6U A;  3UQI A;  1A7X A;  2KO7 A;  2RQS A;  3JXV A;  4QT2 A;  1J4I A;  3B7X A;  2MLY A;  3KCE A;  1YW5 A;  4GGQ A;  1D7H A;  1T11 A;  1ZK6 A;  2LGO A;  3NRK A;  2ITK A;  4JFI A;  1ROT A;  2F21 A;  2LPV A;  4NNR A;  4DRO A;  1JNT A;  3PRB A;  4JFJ A;  4DT4 A;  1Q1C A;  3O5D A;  4G50 A;  1FKR A;  2KFW A;  1PBK A;  1FKB A;  1D6O A;  1FKG A;  2RSE A;  2MLZ A;  3VAW A;  2OFN A;  3IHZ A;  5HT1 A;  1FD9 A;  1FKT A;  2PPN A;  4TNS A;  3RGC A;  5HW6 A;  3I6C A;  3CGN A;  3MDY B;  3IKD A;  4TW8 A;  3O5I A;  5HUA A;  3EY6 A;  1TCO C;  2PPP A;  2PV2 A;  3UQA A;  2XP3 A;  4TW7 A;  5J6E A;  4TYO A;  1M5Y A;  2ZQV A;  4DRH A;  4LAW A;  2PPO A;  4TW6 A;  1PIN A;  4LAX A;  4DRP A;  5B8I C;  2KI3 A;  5DIU A;  3KAB A;  3UQB A;  4W9P A;  1Y0O A;  3KAH A;  4G2P A;  4DRK A;  4DZ2 A;  1FKI A;  2KGJ A;  3JYM A;  2IF4 A;  1FKF A;  2RUD A;  2UZ5 A;  2RUR A;  3CGM A;  2DG3 A;  2MLX A;  2FAP A;  5HW8 A;  4LAY A;  2PV1 A;  5HW7 A;  4W9Q A;  1JVW A;  4N19 A;  2ZQU A;  2VCD A;  1D7I A;  2XP9 A;  3O5Q A;  3KZ7 A;  2K8I A;  2ZR4 A;  3UI6 A;  3JYJ A;  1FKJ A;  3O5R A;  4QT3 A;  2F4E A;  3KAD A;  4U85 A;  1JNS A;  1FAP A;  1EYM A;  1FKL A;  2L2S A;  4ODR A;  3UI5 A;  2MF9 A;  4DRJ A;  1HXV A;  2Q5A A;  3O5O A;  3TC5 A;  1EQ3 A;  3ODK A;  4BF8 A;  1FKH A;  5DIV A;  2AWG A;  2RUC A;  1ROU A;  2Y78 A;  5D75 A;  4TX0 A;  5HTG A;  4C02 B;  4ODK A;  4GIV A;  4DRI A;  3KAF A;  4IQ2 A;  4FAP A;  5I98 A;  4LAV A;  1BL4 A;  1J4R A;  3LUO A;  3O5P A;  2KE0 A;  1D7J A;  2XP4 A;  1FKD A;  1FKS A;  3OOB A;  3TDB A;  4ODQ A;  4DIP A;  1NSG A;  2ZQT A;  5BXJ A;  3O5G A;  2M1I A;  1FKK A;  4ODP A;  2DG9 A;  3O5K A;  4JFM A;  2ZR6 A;  3O5L A;  2M08 A;  2N87 A;  2XP5 A;  1KT0 A;  1NMV A;  4FN2 A;  5GPG A;  4DZ3 A;  5HKG A;  4W9O A;  4ODO A;  4ITZ A;  4MGV A;  1J6Y A;  3UF8 A;  4MSP A;  2ZR5 A;  1NMW A;  3IK8 A;  1N1A A;  4IPX A;  1J4H A;  1BKF A;  1QPL A;  4U84 A;  4R0X A;  5HWC A;  4JFL A;  1QZ2 A;  5HWB A;  4O2T A;  3O5M A;  3WH0 A;  2MPH A;  1B6C A;  1KT1 A;  3O5J A;  2XP6 A;  1F40 A;  3RFW A;  2PBC A;  1F8A B;  2DG4 A;  3KAC A;  3O5F A;  2XPA A;  1W26 A;  3NI6 A;  1FJD A;  2LKN A;  4IQC A;  3TCZ A; 
#chains in the Genus database with same CATH topology
 4Q22 A;  3PA7 A;  1R9H A;  4Z2G A;  2PI6 A;  4HBE A;  1W9U A;  2D9F A;  4WKH A;  4WK9 A;  1CTN A;  1LL7 A;  3ARZ A;  4Z2I A;  2DT1 A;  1HJX A;  5HBF A;  4ODL A;  3B9D A;  1U79 A;  4DRN A;  1L1P A;  4PTM A;  3RM4 A;  3B9A A;  4ODN A;  3W4R A;  1SYT A;  5GQB A;  3KAI A;  4QIB A;  2WK2 A;  3CHF A;  4DRQ A;  2KO7 A;  4MAV A;  2RQS A;  3JXV A;  1RD6 A;  1J4I A;  1TFV A;  1XHG A;  1D7H A;  1T11 A;  3NRK A;  2LPV A;  2F21 A;  3WIJ A;  3GU0 A;  3PRB A;  4DT4 A;  1Q1C A;  1HJW A;  1SR0 A;  2KFW A;  2WLY A;  1D6O A;  1FKG A;  2PPN A;  3GTY X;  4TNS A;  3MDY B;  1JNE A;  3CHE A;  3WQV A;  4P8W A;  2PV2 A;  5J6E A;  3AS3 A;  4LAX A;  4DRP A;  4P8U A;  5DIU A;  3KAB A;  1Y0O A;  5GPR A;  4DRK A;  3ARX A;  1ZL1 A;  2DPE A;  2A3B A;  2RUD A;  1W1Y A;  5HW8 A;  4LAY A;  4WKF A;  1JVW A;  4N19 A;  2ZQU A;  3KZ7 A;  1LL6 A;  1ROU A;  4IT4 A;  4C02 B;  4IQ2 A;  1BL4 A;  1J4R A;  4KR0 B;  1D2K A;  4DIP A;  2ZQT A;  5GPG A;  1WB0 A;  4W9O A;  1JND A;  1J6Y A;  4Q7N A;  3B9E A;  2B31 A;  3IK8 A;  2ZR5 A;  2WM0 A;  1UR8 A;  4ZPW R;  4NSB A;  1GPF A;  4O2T A;  3QOK A;  4ZPT R;  4XAK A;  1KT1 A;  1H0G A;  3O5F A;  1W26 A;  1FFQ A;  4IQC A;  2QF8 A;  2VN1 A;  2O9O A;  1Q6H A;  3O5E A;  3WD4 A;  1P5Q A;  4QZV B;  2FKE A;  4ODM A;  2DT3 A;  1ITX A;  1ZBW A;  2JZV A;  2DSV A;  4DH0 A;  3ALG A;  3PR9 A;  2DSW A;  4ML4 A;  3ART A;  4U86 A;  3H9R B;  3ARY A;  5DF0 A;  4P8V A;  1Q6U A;  1GUV A;  2B5U B;  4S3J A;  3AS2 A;  1YW5 A;  1ROT A;  4NNR A;  4JFJ A;  3O5D A;  3CHD A;  2WLZ A;  3ARW A;  1FKR A;  1FKB A;  4IT6 A;  3VAW A;  1FKT A;  4R5E A;  3RGC A;  1W1V A;  1E6P A;  4TW7 A;  4L72 B;  4TYO A;  5DEZ A;  2ZQV A;  2PN0 A;  4L3N A;  2PPO A;  1PIN A;  5B8I C;  3ARO A;  2KI3 A;  3UQB A;  1NWT A;  3KAH A;  1GOI A;  5DO2 A;  2IF4 A;  4DWS B;  1O6I A;  3G6M A;  3CGM A;  4URI A;  2A3C A;  2PV1 A;  1D7I A;  3UI6 A;  3WD1 A;  2ZR4 A;  1FKJ A;  4DWS A;  2EUL A;  3KAD A;  1JNS A;  1FKL A;  1FKH A;  2RUC A;  3G6L A;  2G8Z A;  4Z2L A;  3TDB A;  3AQU A;  2DSU A;  4ODQ A;  1NSG A;  5BXJ A;  3O5G A;  4DWS D;  2DG9 A;  4JFM A;  2ZR6 A;  3O5L A;  2XP5 A;  4DZ3 A;  1UR9 A;  1ZBC A;  1HKK A;  3UF8 A;  2O92 A;  4IPX A;  1QPL A;  4WIW A;  1QZ2 A;  5HWB A;  2G41 A;  1XRV A;  2XP6 A;  3O5J A;  1F40 A;  2YBU A;  2XPA A;  3NI6 A;  3TCZ A;  1Q6I A;  2XP8 A;  1OGB A;  4S3K A;  1X6N A;  2ESC A;  2XPB A;  3ARV A;  2MNT A;  2F23 A;  1YAT A;  2YBT A;  4DRM A;  3GPK A;  4LGX A;  2PV3 A;  2KR7 A;  3WD2 A;  3NTP A;  3FAP A;  3PRD A;  1W1P A;  1ZBV A;  3FXY A;  4Z2J A;  2F2D A;  3RM8 A;  4JFK A;  3ALF A;  3UQI A;  1A7X A;  3B7X A;  2MLY A;  3KCE A;  4JYS A;  1ZK6 A;  4JFI A;  3WKZ A;  1JNT A;  4HAR A;  4G50 A;  2MLZ A;  2OFN A;  3IHZ A;  5HT1 A;  3I6C A;  3IKD A;  4TW8 A;  1WNO A;  1TCO C;  2PPP A;  3EY6 A;  1M5Y A;  2FDM A;  4ZPV R;  4DRH A;  1NWR A;  2DT2 A;  3OA5 A;  1FFR A;  3ARS A;  4W9P A;  1W1T A;  1IX5 A;  4DZ2 A;  1FKI A;  2KGJ A;  3JYM A;  4P8X A;  1FKF A;  2UZ5 A;  1NWS A;  2RUR A;  3WD0 A;  2MLX A;  1W9P A;  1X6L A;  2VCD A;  1E6R A;  2XP9 A;  3O5Q A;  1GRJ A;  4ZS6 A;  1HKM A;  2F4E A;  4U85 A;  1EYM A;  2L2S A;  2MF9 A;  2Q5A A;  3O5O A;  1EQ3 A;  4BF8 A;  4MNM A;  5DIV A;  2AWG A;  2Y78 A;  5HTG A;  1K9T A;  4TX0 A;  4GIV A;  4DRI A;  3KAF A;  4FAP A;  5I98 A;  4LAV A;  3AS1 A;  3O5P A;  1D7J A;  1FKS A;  2M1I A;  3O5K A;  3WD3 A;  1E6N A;  2DT0 A;  5HKG A;  4ODO A;  4ITZ A;  3CZ8 A;  1LG2 A;  1NWU A;  1NMW A;  1LL4 A;  3ARP A;  1BKF A;  3RME A;  3FY1 A;  2P4V A;  3O5M A;  2MPH A;  3PRA A;  1B6C A;  3B8S A;  1FJD A;  3KAC A;  1F8A B;  1HKJ A;  4WKA A;  3AS0 A;  4MNL A;  1EDQ A;  3BMB A;  1H0I A;  2ZQS A;  2LJ4 A;  1KFW A;  5DIT A;  3WL1 A;  2XP7 A;  1ZU8 A;  3IKG A;  3KAG A;  1C9H A;  2RUQ A;  3CHC A;  1E44 A;  4J4N A;  4AY1 A;  2M2A A;  1QPF A;  1ZBK A;  4WJX A;  3ARR A;  4J4O A;  1ZCN A;  1ZB5 A;  1LG1 A;  3UI4 A;  1W9V A;  2DSZ A;  1WAW A;  1OGG A;  4QT2 A;  4GGQ A;  2LGO A;  2ITK A;  4DRO A;  4DWS C;  1EIB A;  1PBK A;  2RSE A;  4HBO A;  1LJY A;  1FD9 A;  4MPK A;  4W5U A;  5HW6 A;  3CGN A;  3WL0 A;  2AOS A;  3O5I A;  5HUA A;  3CH9 A;  3UQA A;  2XP3 A;  4Z2K A;  3RM9 A;  5JH8 A;  4MNJ A;  4LAW A;  4MNK A;  4Z2H A;  4TW6 A;  1HKI A;  2ETN A;  2IUZ A;  1EHN A;  4G2P A;  3EIP A;  2DG3 A;  2FAP A;  5HW7 A;  3WQW A;  4W9Q A;  1E6Z A;  1JCH B;  2K8I A;  3JYJ A;  3O5R A;  1LQ0 A;  4QT3 A;  4UDM A;  1FAP A;  3BXW A;  4ODR A;  3UI5 A;  4DRJ A;  1HXV A;  3TC5 A;  3ODK A;  5D75 A;  4ODK A;  2A3E A;  3LUO A;  2KE0 A;  2XP4 A;  3OOB A;  1FKD A;  4NZC A;  1E9L A;  1FKK A;  4ODP A;  1NH6 A;  4FN2 A;  2M08 A;  2N87 A;  1KT0 A;  1NMV A;  1VF8 A;  4KQZ A;  1E15 A;  4MGV A;  4MSP A;  1N1A A;  2A3A A;  1J4H A;  4U84 A;  4R0X A;  5HWC A;  4JFL A;  3WH0 A;  1HJV A;  2OLH A;  1OWQ A;  2PBC A;  3RFW A;  2DG4 A;  3ARQ A;  2LKN A;  4MTV A;  3ARU A; 
#chains in the Genus database with same CATH homology
 4Q22 A;  3PA7 A;  1R9H A;  4Z2G A;  2PI6 A;  4HBE A;  1W9U A;  2D9F A;  4WKH A;  4WK9 A;  1CTN A;  1LL7 A;  3ARZ A;  4Z2I A;  2DT1 A;  1HJX A;  5HBF A;  4ODL A;  3B9D A;  1U79 A;  4DRN A;  1L1P A;  4PTM A;  3RM4 A;  3B9A A;  4ODN A;  3W4R A;  1SYT A;  5GQB A;  3KAI A;  4QIB A;  2WK2 A;  3CHF A;  4DRQ A;  2KO7 A;  4MAV A;  2RQS A;  3JXV A;  1RD6 A;  1J4I A;  1TFV A;  1XHG A;  1D7H A;  1T11 A;  3NRK A;  2LPV A;  2F21 A;  3WIJ A;  3PRB A;  4DT4 A;  1Q1C A;  1HJW A;  1SR0 A;  2KFW A;  2WLY A;  1D6O A;  1FKG A;  2PPN A;  4TNS A;  3MDY B;  1JNE A;  3CHE A;  3WQV A;  4P8W A;  2PV2 A;  5J6E A;  3AS3 A;  4LAX A;  4DRP A;  4P8U A;  5DIU A;  3KAB A;  1Y0O A;  5GPR A;  4DRK A;  3ARX A;  1ZL1 A;  2DPE A;  2A3B A;  2RUD A;  1W1Y A;  5HW8 A;  4LAY A;  4WKF A;  1JVW A;  4N19 A;  2ZQU A;  3KZ7 A;  1LL6 A;  1ROU A;  4IT4 A;  4C02 B;  4IQ2 A;  1BL4 A;  1J4R A;  4KR0 B;  1D2K A;  4DIP A;  2ZQT A;  5GPG A;  1WB0 A;  4W9O A;  1JND A;  1J6Y A;  4Q7N A;  3B9E A;  2B31 A;  3IK8 A;  2ZR5 A;  2WM0 A;  1UR8 A;  4ZPW R;  4NSB A;  1GPF A;  4O2T A;  3QOK A;  4ZPT R;  4XAK A;  1KT1 A;  1H0G A;  3O5F A;  1W26 A;  1FFQ A;  4IQC A;  2QF8 A;  2VN1 A;  2O9O A;  1Q6H A;  3O5E A;  3WD4 A;  1P5Q A;  4QZV B;  2FKE A;  4ODM A;  2DT3 A;  1ITX A;  1ZBW A;  2JZV A;  2DSV A;  4DH0 A;  3ALG A;  3PR9 A;  2DSW A;  4ML4 A;  3ART A;  4U86 A;  3H9R B;  3ARY A;  5DF0 A;  4P8V A;  1Q6U A;  1GUV A;  4S3J A;  3AS2 A;  1YW5 A;  1ROT A;  4NNR A;  4JFJ A;  3O5D A;  3CHD A;  2WLZ A;  3ARW A;  1FKR A;  1FKB A;  4IT6 A;  3VAW A;  1FKT A;  4R5E A;  3RGC A;  1W1V A;  1E6P A;  4TW7 A;  4L72 B;  4TYO A;  5DEZ A;  2ZQV A;  4L3N A;  2PPO A;  1PIN A;  5B8I C;  3ARO A;  2KI3 A;  3UQB A;  1NWT A;  3KAH A;  1GOI A;  5DO2 A;  2IF4 A;  4DWS B;  1O6I A;  3G6M A;  3CGM A;  4URI A;  2A3C A;  2PV1 A;  1D7I A;  3UI6 A;  3WD1 A;  2ZR4 A;  1FKJ A;  4DWS A;  3KAD A;  1JNS A;  1FKL A;  1FKH A;  2RUC A;  3G6L A;  2G8Z A;  4Z2L A;  3TDB A;  3AQU A;  2DSU A;  4ODQ A;  1NSG A;  5BXJ A;  3O5G A;  4DWS D;  2DG9 A;  4JFM A;  2ZR6 A;  3O5L A;  2XP5 A;  4DZ3 A;  1UR9 A;  1ZBC A;  1HKK A;  3UF8 A;  2O92 A;  4IPX A;  1QPL A;  4WIW A;  1QZ2 A;  5HWB A;  2G41 A;  3O5J A;  1XRV A;  2XP6 A;  1F40 A;  2YBU A;  2XPA A;  3NI6 A;  3TCZ A;  1Q6I A;  2XP8 A;  1OGB A;  4S3K A;  1X6N A;  2ESC A;  2XPB A;  3ARV A;  2MNT A;  1YAT A;  2YBT A;  4DRM A;  3GPK A;  4LGX A;  2PV3 A;  2KR7 A;  3WD2 A;  3NTP A;  3FAP A;  3PRD A;  1W1P A;  1ZBV A;  3FXY A;  4Z2J A;  2F2D A;  3RM8 A;  4JFK A;  3ALF A;  3UQI A;  1A7X A;  3B7X A;  2MLY A;  3KCE A;  4JYS A;  1ZK6 A;  4JFI A;  3WKZ A;  1JNT A;  4HAR A;  4G50 A;  2MLZ A;  2OFN A;  3IHZ A;  5HT1 A;  3I6C A;  3IKD A;  4TW8 A;  1WNO A;  1TCO C;  2PPP A;  3EY6 A;  1M5Y A;  2FDM A;  4ZPV R;  4DRH A;  1NWR A;  2DT2 A;  3OA5 A;  1FFR A;  3ARS A;  4W9P A;  1W1T A;  1IX5 A;  4DZ2 A;  1FKI A;  2KGJ A;  3JYM A;  4P8X A;  1FKF A;  2UZ5 A;  1NWS A;  2RUR A;  3WD0 A;  2MLX A;  1W9P A;  1X6L A;  2VCD A;  1E6R A;  2XP9 A;  3O5Q A;  4ZS6 A;  1HKM A;  2F4E A;  4U85 A;  1EYM A;  2L2S A;  2MF9 A;  2Q5A A;  3O5O A;  1EQ3 A;  4BF8 A;  4MNM A;  5DIV A;  2AWG A;  2Y78 A;  5HTG A;  1K9T A;  4TX0 A;  4GIV A;  4DRI A;  3KAF A;  4FAP A;  5I98 A;  4LAV A;  3AS1 A;  3O5P A;  1D7J A;  1FKS A;  2M1I A;  3O5K A;  3WD3 A;  1E6N A;  2DT0 A;  5HKG A;  4ODO A;  4ITZ A;  3CZ8 A;  1LG2 A;  1NWU A;  1NMW A;  1LL4 A;  3ARP A;  1BKF A;  3RME A;  3FY1 A;  3O5M A;  2MPH A;  3PRA A;  1B6C A;  3B8S A;  1FJD A;  3KAC A;  1F8A B;  1HKJ A;  4WKA A;  3AS0 A;  4MNL A;  1EDQ A;  1H0I A;  2ZQS A;  2LJ4 A;  1KFW A;  5DIT A;  3WL1 A;  2XP7 A;  1ZU8 A;  3IKG A;  3KAG A;  1C9H A;  2RUQ A;  3CHC A;  4J4N A;  4AY1 A;  2M2A A;  1QPF A;  1ZBK A;  4WJX A;  3ARR A;  4J4O A;  1ZCN A;  1ZB5 A;  1LG1 A;  3UI4 A;  1W9V A;  2DSZ A;  1WAW A;  1OGG A;  4QT2 A;  4GGQ A;  2LGO A;  2ITK A;  4DRO A;  4DWS C;  1EIB A;  1PBK A;  2RSE A;  4HBO A;  1LJY A;  1FD9 A;  4MPK A;  4W5U A;  5HW6 A;  3CGN A;  3WL0 A;  2AOS A;  3O5I A;  5HUA A;  3CH9 A;  3UQA A;  2XP3 A;  4Z2K A;  3RM9 A;  5JH8 A;  4MNJ A;  4LAW A;  4MNK A;  4Z2H A;  4TW6 A;  1HKI A;  2IUZ A;  1EHN A;  4G2P A;  2DG3 A;  2FAP A;  5HW7 A;  3WQW A;  4W9Q A;  1E6Z A;  2K8I A;  3JYJ A;  3O5R A;  1LQ0 A;  4QT3 A;  1FAP A;  3BXW A;  4ODR A;  3UI5 A;  4DRJ A;  1HXV A;  3TC5 A;  3ODK A;  5D75 A;  4ODK A;  2A3E A;  3LUO A;  2KE0 A;  2XP4 A;  3OOB A;  1FKD A;  4NZC A;  1E9L A;  1FKK A;  4ODP A;  1NH6 A;  4FN2 A;  2M08 A;  2N87 A;  1KT0 A;  1NMV A;  1VF8 A;  4KQZ A;  1E15 A;  4MGV A;  4MSP A;  1N1A A;  2A3A A;  1J4H A;  4U84 A;  4R0X A;  5HWC A;  4JFL A;  3WH0 A;  1HJV A;  2OLH A;  1OWQ A;  2PBC A;  3RFW A;  2DG4 A;  3ARQ A;  2LKN A;  4MTV A;  3ARU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...