1YATA

Improved calcineurin inhibition by yeast fkbp12-drug complexes. crystallographic and functional analysis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
SEVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Improved calcineurin inhibition by yeast FKBP12-drug complexes. Crystallographic and functional analysis.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Binding protein
total genus 29
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yatA00
1FD9A 1D6OA 2PBCA 2XP3A 4C02B 2F4EA 4W9QA 3KAHA 1QPLA 4R0XA 5D75A 1ZCNA 4DH0A 4ODMA 2M08A 3NTPA 1L1PA 2LKNA 5DITA 3UF8A 1NMWA 3TCZA 5HWCA 1FKBA 4JYSA 3UI5A 1U79A 2LGOA 2XP7A 4ODLA 2DG3A 2LJ4A 3O5JA 2PV1A 4JFKA 2MF9A 5HWBA 4DRHA 3KAIA 5I98A 4DRIA 2PPOA 3PRDA 5HW7A 2Q5AA 3O5KA 2XP9A 1EQ3A 1TCOC 1YW5A 1PBKA 2KGJA 5HUAA 4DRQA 2XPAA 2PV2A 3KACA 1Y0OA 1BL4A 2ZQUA 2ZR5A 1Q1CA 3IK8A 2XP6A 5B8IC 3NI6A 1FKFA 3EY6A 4DROA 1F8AB 1D7IA 1PINA 2OFNA 3ODKA 2JZVA 1D7JA 1J4IA 2LPVA 4JFMA 2KFWA 1KT1A 3KZ7A 4U85A 1M5YA 1ROTA 1FAPA 1J4HA 3O5MA 5DIUA 3RFWA 1JVWA 3O5GA 1ZK6A 1T11A 4J4NA 1ROUA 2Y78A 3KAGA 2KI3A 2RSEA 2MPHA 3I6CA 2KE0A 2PPPA 3KCEA 3O5OA 4ODKA 3VAWA 3IKGA 4U84A 3FAPA 1EYMA 1JNSA 2AWGA 4TW6A 1FKRA 4J4OA 1KT0A 3O5LA 2K8IA 2VCDA 2F2DA 2M1IA 2ZQTA 4TW8A 4FAPA 1HXVA 4NNRA 4TYOA 1F40A 1FKJA 4N19A 4O2TA 2DG4A 3UQBA 2KR7A 2UZ5A 5HW8A 2MLZA 4LAYA 1R9HA 4DZ3A 4U86A 1FKGA 4QIBA 1FJDA 4ODOA 3O5IA 4DIPA 1J4RA 4DRPA 2IF4A 2RUQA 3GPKA 4DRNA 4ITZA 2N87A 1NMVA 4DRJA 1B6CA 3CGNA 1W26A 4MSPA 4W9PA 4DT4A 4JFLA 3TC5A 4GIVA 1Q6UA 5GPGA 3WH0A 1FKDA 4FN2A 1BKFA 3CGMA 4MGVA 2ZQVA 2PV3A 3O5PA 3KAFA 4IQCA 1N1AA 4IPXA 2RUDA 5J6EA 3MDYB 2XPBA 4LAVA 4W9OA 1D7HA 2KO7A 4TX0A 3UQAA 1J6YA 3RGCA 1JNTA 2ITKA 1Q6IA 3B7XA 3KADA 2MNTA 1Q6HA 3O5RA 4ODQA 1QZ2A 2F21A 3JYJA 4QT2A 5HKGA 2FAPA 1FKKA 1NSGA 1FKIA 2DG9A 3O5DA 1A7XA 4IQ2A 3LUOA 5DIVA 3O5QA 3O5FA 2XP8A 2XP4A 3KABA 4DRMA 5BXJA 3TDBA 3IKDA 3UQIA 4G2PA 2RURA 1FKLA 4GGQA 1FKHA 1YATA 3H9RB 4DRKA 4QT3A 2FKEA 3PRBA 2MLXA 3JXVA 3UI6A 1FKSA 4ODNA 5HT1A 1P5QA 4BF8A 2MLYA 4G50A 2RQSA 1QPFA 2ZR6A 4JFJA 4LAWA 5HW6A 2VN1A 3NRKA 4DZ2A 2M2AA 2XP5A 3IHZA 2RUCA 3PA7A 5HTGA 1C9HA 2ZR4A 4ODRA 1FKTA 2PPNA 2L2SA 3O5EA 3JYMA 3UI4A 4JFIA 4TNSA 4TW7A 4LAXA 2ZQSA 4ODPA 3OOBA 2D9FA
chains in the Genus database with same CATH superfamily
1HKJA 1D6OA 1FFRA 2F4EA 1W1VA 1QPLA 4R0XA 1XRVA 1SYTA 3CHFA 4ML4A 1WNOA 5DITA 3UF8A 1NMWA 2PV1A 4JFKA 2MF9A 3EIPA 4ZPWR 1EHNA 2QF8A 1ZL1A 2DT0A 5DO2A 4MAVA 1LL7A 1W9PA 2XP9A 4WKFA 1W1TA 1PBKA 3RMEA 2KGJA 1BL4A 3BMBA 3EY6A 1D2KA 1OGGA 1WAWA 2OFNA 3GU0A 3AQUA 4JFMA 2KFWA 4W5UA 1ITXA 2WK2A 3WKZA 1FAPA 5DIUA 4UDMA 4MNKA 4J4NA 5DEZA 2Y78A 4XAKA 4IT6A 3I6CA 2KE0A 4PTMA 3O5OA 4ZS6A 3PR9A 1EYMA 1E6ZA 2VCDA 4NNRA 4N19A 2PN0A 4L3NA 1E44A 4QIBA 4U86A 4WK9A 4DIPA 4HBEA 4DRPA 3ARVA 2RUQA 1UR9A 3CGNA 3ARZA 4DT4A 3RM4A 4P8VA 2AOSA 5GPGA 3WH0A 1XHGA 3KAFA 1RD6A 4KR0B 1JNTA 4R5EA 2MNTA 3O5RA 4ODQA 1NWTA 4QT2A 1FKKA 1GUVA 5DIVA 2XP8A 2XP4A 2RURA 1FKLA 1W1YA 1YATA 4NZCA 4DRKA 1OGBA 2DSWA 4ODNA 2DT3A 4G50A 1QPFA 4LAWA 3CHEA 1HKIA 3NRKA 2B31A 5HTGA 2ZR4A 3WD2A 2PPNA 2L2SA 3O5EA 4HARA 4TW7A 5HWCA 2ZQSA 4ODPA 3W4RA 2A3BA 3OOBA 3GTYX 2PBCA 2XP3A 1JCHB 3WQWA 1H0IA 4DH0A 4ODMA 3NTPA 1H0GA 2LKNA 1LQ0A 2OLHA 1LL6A 4S3KA 1FKBA 3UI5A 4MNLA 4ODLA 2DG3A 4ZPTR 1NWRA 1SR0A 3KAIA 2FDMA 3B9DA 4Z2KA 5HW7A 4WKHA 4DRQA 3CHCA 3KACA 2ESCA 3IK8A 2XP6A 5B8IC 2PI6A 2G8ZA 4DROA 1F8AB 3ARRA 1PINA 2A3EA 4Z2IA 3KZ7A 1J4HA 1ZBKA 2ETNA 3O5MA 3RFWA 2DPEA 1E15A 3QOKA 4ODKA 4U84A 5GQBA 4TW6A 1FKRA 1OWQA 1ZU8A 4QZVB 4TW8A 4FAPA 4TYOA 1FKJA 2KR7A 2UZ5A 5HW8A 4MNMA 1R9HA 1FJDA 1J4RA 2IF4A 4Z2HA 4ITZA 4Z2LA 1KFWA 1X6LA 3OA5A 4JFLA 1Q6UA 2YBTA 2DSZA 2ZQVA 3O5PA 5HBFA 4IPXA 5J6EA 3B8SA 4LAVA 1D7HA 2KO7A 3UQAA 3RGCA 2ITKA 3B7XA 1Q6IA 3KADA 1HJWA 1QZ2A 2B5UB 5HKGA 2FAPA 2DG9A 4S3JA 1A7XA 3LUOA 3O5QA 3O5FA 5BXJA 4MPKA 3UQIA 4G2PA 4QT3A 4NSBA 3BXWA 4KQZA 1P5QA 2WLYA 4JFJA 3ARSA 2VN1A 2M2AA 1X6NA 3G6LA 1FKTA 3UI4A 4TNSA 4FN2A 1W9UA 2WLZA 3ALGA 4W9QA 1HJVA 4Q7NA 5D75A 1L1PA 4JYSA 1U79A 2LGOA 1VF8A 2IUZA 3O5JA 5HWBA 4DRHA 5I98A 4DRIA 2DSUA 3FY1A 2Q5AA 1ZB5A 1EQ3A 3CHDA 2XPAA 2ZQUA 2ZR5A 1Q1CA 1FKFA 1JNEA 4Z2GA 4Z2JA 4P8UA 2JZVA 1J4IA 3ARYA 1KT1A 3AS1A 1M5YA 4Q22A 2A3AA 1ZBCA 1JVWA 1ZK6A 1T11A 1NWSA 1UR8A 2MPHA 3AROA 4ZPVR 2PPPA 1E9LA 3WD3A 2O9OA 3KCEA 3VAWA 3IKGA 3WIJA 3G6MA 2AWGA 4J4OA 1KT0A 3O5LA 2F2DA 2G41A 2M1IA 2ZQTA 1HXVA 4DWSA 1GOIA 2MLZA 4LAYA 3RM9A 4DZ3A 1FKGA 1JNDA 4ODOA 3ARWA 2A3CA 3GPKA 4DRNA 2N87A 1NMVA 1B6CA 4MSPA 1W26A 4W9PA 3TC5A 4WJXA 1HJXA 1BKFA 3CGMA 4WIWA 2PV3A 1N1AA 2RUDA 4TX0A 4AY1A 2P4VA 1Q6HA 4P8WA 1NSGA 1FKIA 4IQ2A 4MTVA 3AS2A 4DRMA 3IKDA 5GPRA 4GGQA 1FKHA 2FKEA 1CTNA 2MLXA 4MNJA 3UI6A 1FKSA 5HT1A 4BF8A 2RQSA 2ZR6A 5HW6A 3FXYA 4DZ2A 3IHZA 2RUCA 3PA7A 1C9HA 4ODRA 4DWSB 3JYMA 4JFIA 3RM8A 3ODKA 2D9FA 1FD9A 1GPFA 1K9TA 4C02B 3KAHA 1EIBA 4URIA 1ZCNA 2M08A 4WKAA 3TCZA 2XP7A 4DWSC 2LJ4A 1LG2A 1W1PA 1WB0A 2PPOA 1E6RA 3PRDA 3ALFA 3O5KA 3B9EA 2DT2A 1TCOC 1YW5A 1EDQA 1FFQA 5HUAA 3ARTA 3WL0A 1O6IA 2PV2A 1Y0OA 1NWUA 3NI6A 1D7IA 1D7JA 5JH8A 2LPVA 4IT4A 3CH9A 1HKKA 4U85A 1ROTA 3AS0A 1GRJA 3O5GA 4LGXA 1ROUA 3KAGA 2KI3A 2RSEA 2EULA 1LG1A 3FAPA 1JNSA 1IX5A 2YBUA 2K8IA 3B9AA 1F40A 3UQBA 4O2TA 2DG4A 3ARQA 1LL4A 3O5IA 5DF0A 3WQVA 4HBOA 4DRJA 1E6NA 1ZBVA 4DWSD 3ARXA 4GIVA 3WD1A 1FKDA 2F23A 4MGVA 4IQCA 4L72B 3MDYB 1TFVA 2XPBA 4W9OA 1J6YA 1LJYA 2F21A 3JYJA 3AS3A 3CZ8A 2DSVA 1W9VA 3O5DA 1HKMA 2O92A 2WM0A 3ARPA 3KABA 3TDBA 1ZBWA 3WD4A 1E6PA 3H9RB 3PRBA 3JXVA 1NH6A 3PRAA 2MLYA 2DT1A 3ARUA 3WL1A 3WD0A 2XP5A 4LAXA 4P8XA
chains in the Genus database with same CATH topology
1HKJA 1D6OA 1FFRA 2F4EA 1W1VA 1QPLA 4R0XA 1XRVA 1SYTA 3CHFA 4ML4A 1WNOA 5DITA 3UF8A 1NMWA 2PV1A 4JFKA 2MF9A 4ZPWR 1EHNA 2QF8A 1ZL1A 2DT0A 5DO2A 4MAVA 1LL7A 1W9PA 2XP9A 4WKFA 1W1TA 1PBKA 3RMEA 2KGJA 1BL4A 3EY6A 1D2KA 1OGGA 1WAWA 2OFNA 3AQUA 4JFMA 2KFWA 4W5UA 1ITXA 2WK2A 3WKZA 1FAPA 5DIUA 4MNKA 4J4NA 5DEZA 2Y78A 4XAKA 4IT6A 3I6CA 2KE0A 4PTMA 3O5OA 4ZS6A 3PR9A 1EYMA 1E6ZA 2VCDA 4NNRA 4N19A 4L3NA 4U86A 4QIBA 4WK9A 4DIPA 4HBEA 4DRPA 3ARVA 2RUQA 1UR9A 3CGNA 3ARZA 4DT4A 3RM4A 4P8VA 2AOSA 5GPGA 3WH0A 1XHGA 3KAFA 1RD6A 4KR0B 1JNTA 4R5EA 2MNTA 3O5RA 4ODQA 1NWTA 4QT2A 1FKKA 1GUVA 5DIVA 2XP8A 2XP4A 2RURA 1FKLA 1W1YA 1YATA 4NZCA 4DRKA 1OGBA 2DSWA 4ODNA 2DT3A 4G50A 1QPFA 4LAWA 3CHEA 1HKIA 3NRKA 2B31A 5HTGA 2ZR4A 3WD2A 2PPNA 2L2SA 3O5EA 4HARA 4TW7A 5HWCA 2ZQSA 4ODPA 3W4RA 2A3BA 3OOBA 2PBCA 2XP3A 3WQWA 1H0IA 4DH0A 4ODMA 3NTPA 1H0GA 2LKNA 1LQ0A 2OLHA 1LL6A 4S3KA 1FKBA 3UI5A 4MNLA 4ODLA 2DG3A 4ZPTR 1NWRA 1SR0A 3KAIA 2FDMA 3B9DA 4Z2KA 5HW7A 4WKHA 4DRQA 3CHCA 3KACA 2ESCA 3IK8A 2XP6A 5B8IC 2PI6A 2G8ZA 4DROA 1F8AB 3ARRA 1PINA 2A3EA 4Z2IA 3KZ7A 1J4HA 1ZBKA 3O5MA 3RFWA 2DPEA 1E15A 3QOKA 4ODKA 4U84A 5GQBA 4TW6A 1FKRA 1OWQA 1ZU8A 4QZVB 4TW8A 4FAPA 4TYOA 1FKJA 2KR7A 2UZ5A 5HW8A 4MNMA 1R9HA 1FJDA 1J4RA 2IF4A 4Z2HA 4ITZA 4Z2LA 1KFWA 1X6LA 3OA5A 4JFLA 1Q6UA 2YBTA 2DSZA 2ZQVA 3O5PA 5HBFA 4IPXA 5J6EA 3B8SA 4LAVA 1D7HA 2KO7A 3UQAA 3RGCA 2ITKA 3B7XA 1Q6IA 3KADA 1HJWA 1QZ2A 5HKGA 2FAPA 2DG9A 4S3JA 1A7XA 3LUOA 3O5QA 3O5FA 5BXJA 4MPKA 3UQIA 4G2PA 4QT3A 4NSBA 3BXWA 4KQZA 1P5QA 2WLYA 4JFJA 3ARSA 2VN1A 2M2AA 1X6NA 3G6LA 1FKTA 3UI4A 4TNSA 4FN2A 1W9UA 2WLZA 3ALGA 4W9QA 1HJVA 4Q7NA 5D75A 1L1PA 4JYSA 1U79A 2LGOA 1VF8A 2IUZA 3O5JA 5HWBA 4DRHA 5I98A 4DRIA 2DSUA 3FY1A 2Q5AA 1ZB5A 1EQ3A 3CHDA 2XPAA 2ZQUA 2ZR5A 1Q1CA 1FKFA 1JNEA 4Z2GA 4Z2JA 4P8UA 2JZVA 1J4IA 3ARYA 1KT1A 3AS1A 1M5YA 4Q22A 2A3AA 1ZBCA 1JVWA 1ZK6A 1T11A 1NWSA 1UR8A 2MPHA 3AROA 4ZPVR 2PPPA 1E9LA 3WD3A 2O9OA 3KCEA 3VAWA 3IKGA 3WIJA 3G6MA 2AWGA 4J4OA 1KT0A 3O5LA 2F2DA 2G41A 2M1IA 2ZQTA 1HXVA 4DWSA 1GOIA 2MLZA 4LAYA 3RM9A 4DZ3A 1FKGA 1JNDA 4ODOA 3ARWA 2A3CA 3GPKA 4DRNA 2N87A 1NMVA 1B6CA 4MSPA 1W26A 4W9PA 3TC5A 4WJXA 1HJXA 1BKFA 3CGMA 4WIWA 2PV3A 1N1AA 2RUDA 4TX0A 4AY1A 1Q6HA 4P8WA 1NSGA 1FKIA 4IQ2A 4MTVA 3AS2A 4DRMA 3IKDA 5GPRA 4GGQA 1FKHA 2FKEA 1CTNA 2MLXA 4MNJA 3UI6A 1FKSA 5HT1A 4BF8A 2RQSA 2ZR6A 5HW6A 3FXYA 4DZ2A 3IHZA 2RUCA 3PA7A 1C9HA 4ODRA 4DWSB 3JYMA 4JFIA 3RM8A 3ODKA 2D9FA 1FD9A 1GPFA 1K9TA 4C02B 3KAHA 1EIBA 4URIA 1ZCNA 2M08A 4WKAA 3TCZA 2XP7A 4DWSC 2LJ4A 1LG2A 1W1PA 1WB0A 2PPOA 1E6RA 3PRDA 3ALFA 3O5KA 3B9EA 2DT2A 1TCOC 1YW5A 1EDQA 1FFQA 5HUAA 3ARTA 3WL0A 1O6IA 2PV2A 1Y0OA 1NWUA 3NI6A 1D7IA 1D7JA 5JH8A 2LPVA 4IT4A 3CH9A 1HKKA 4U85A 1ROTA 3AS0A 3O5GA 4LGXA 1ROUA 3KAGA 2KI3A 2RSEA 1LG1A 3FAPA 1JNSA 1IX5A 2YBUA 2K8IA 3B9AA 1F40A 3UQBA 4O2TA 2DG4A 3ARQA 1LL4A 3O5IA 5DF0A 3WQVA 4HBOA 4DRJA 1E6NA 1ZBVA 4DWSD 3ARXA 4GIVA 3WD1A 1FKDA 4MGVA 4IQCA 4L72B 3MDYB 1TFVA 2XPBA 4W9OA 1J6YA 1LJYA 2F21A 3AS3A 3JYJA 3CZ8A 2DSVA 1W9VA 3O5DA 1HKMA 2O92A 2WM0A 3ARPA 3KABA 3TDBA 1ZBWA 3WD4A 1E6PA 3H9RB 3PRBA 3JXVA 1NH6A 3PRAA 2MLYA 2DT1A 3ARUA 3WL1A 3WD0A 2XP5A 4LAXA 4P8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD9 A;  1D6O A;  2PBC A;  2XP3 A;  4C02 B;  2F4E A;  4W9Q A;  3KAH A;  1QPL A;  4R0X A;  5D75 A;  1ZCN A;  4DH0 A;  4ODM A;  2M08 A;  3NTP A;  1L1P A;  2LKN A;  5DIT A;  3UF8 A;  1NMW A;  3TCZ A;  5HWC A;  1FKB A;  4JYS A;  3UI5 A;  1U79 A;  2LGO A;  2XP7 A;  4ODL A;  2DG3 A;  2LJ4 A;  3O5J A;  2PV1 A;  4JFK A;  2MF9 A;  5HWB A;  4DRH A;  3KAI A;  5I98 A;  4DRI A;  2PPO A;  3PRD A;  5HW7 A;  2Q5A A;  3O5K A;  2XP9 A;  1EQ3 A;  1TCO C;  1YW5 A;  1PBK A;  2KGJ A;  5HUA A;  4DRQ A;  2XPA A;  2PV2 A;  3KAC A;  1Y0O A;  1BL4 A;  2ZQU A;  2ZR5 A;  1Q1C A;  3IK8 A;  2XP6 A;  5B8I C;  3NI6 A;  1FKF A;  3EY6 A;  4DRO A;  1F8A B;  1D7I A;  1PIN A;  2OFN A;  3ODK A;  2JZV A;  1D7J A;  1J4I A;  2LPV A;  4JFM A;  2KFW A;  1KT1 A;  3KZ7 A;  4U85 A;  1M5Y A;  1ROT A;  1FAP A;  1J4H A;  3O5M A;  5DIU A;  3RFW A;  1JVW A;  3O5G A;  1ZK6 A;  1T11 A;  4J4N A;  1ROU A;  2Y78 A;  3KAG A;  2KI3 A;  2RSE A;  2MPH A;  3I6C A;  2KE0 A;  2PPP A;  3KCE A;  3O5O A;  4ODK A;  3VAW A;  3IKG A;  4U84 A;  3FAP A;  1EYM A;  1JNS A;  2AWG A;  4TW6 A;  1FKR A;  4J4O A;  1KT0 A;  3O5L A;  2K8I A;  2VCD A;  2F2D A;  2M1I A;  2ZQT A;  4TW8 A;  4FAP A;  1HXV A;  4NNR A;  4TYO A;  1F40 A;  1FKJ A;  4N19 A;  4O2T A;  2DG4 A;  3UQB A;  2KR7 A;  2UZ5 A;  5HW8 A;  2MLZ A;  4LAY A;  1R9H A;  4DZ3 A;  4U86 A;  1FKG A;  4QIB A;  1FJD A;  4ODO A;  3O5I A;  4DIP A;  1J4R A;  4DRP A;  2IF4 A;  2RUQ A;  3GPK A;  4DRN A;  4ITZ A;  2N87 A;  1NMV A;  4DRJ A;  1B6C A;  3CGN A;  1W26 A;  4MSP A;  4W9P A;  4DT4 A;  4JFL A;  3TC5 A;  4GIV A;  1Q6U A;  5GPG A;  3WH0 A;  1FKD A;  4FN2 A;  1BKF A;  3CGM A;  4MGV A;  2ZQV A;  2PV3 A;  3O5P A;  3KAF A;  4IQC A;  1N1A A;  4IPX A;  2RUD A;  5J6E A;  3MDY B;  2XPB A;  4LAV A;  4W9O A;  1D7H A;  2KO7 A;  4TX0 A;  3UQA A;  1J6Y A;  3RGC A;  1JNT A;  2ITK A;  1Q6I A;  3B7X A;  3KAD A;  2MNT A;  1Q6H A;  3O5R A;  4ODQ A;  1QZ2 A;  2F21 A;  3JYJ A;  4QT2 A;  5HKG A;  2FAP A;  1FKK A;  1NSG A;  1FKI A;  2DG9 A;  3O5D A;  1A7X A;  4IQ2 A;  3LUO A;  5DIV A;  3O5Q A;  3O5F A;  2XP8 A;  2XP4 A;  3KAB A;  4DRM A;  5BXJ A;  3TDB A;  3IKD A;  3UQI A;  4G2P A;  2RUR A;  1FKL A;  4GGQ A;  1FKH A;  1YAT A;  3H9R B;  4DRK A;  4QT3 A;  2FKE A;  3PRB A;  2MLX A;  3JXV A;  3UI6 A;  1FKS A;  4ODN A;  5HT1 A;  1P5Q A;  4BF8 A;  2MLY A;  4G50 A;  2RQS A;  1QPF A;  2ZR6 A;  4JFJ A;  4LAW A;  5HW6 A;  2VN1 A;  3NRK A;  4DZ2 A;  2M2A A;  2XP5 A;  3IHZ A;  2RUC A;  3PA7 A;  5HTG A;  1C9H A;  2ZR4 A;  4ODR A;  1FKT A;  2PPN A;  2L2S A;  3O5E A;  3JYM A;  3UI4 A;  4JFI A;  4TNS A;  4TW7 A;  4LAX A;  2ZQS A;  4ODP A;  3OOB A;  2D9F A; 
#chains in the Genus database with same CATH topology
 1HKJ A;  1D6O A;  1FFR A;  2F4E A;  1W1V A;  1QPL A;  4R0X A;  1XRV A;  1SYT A;  3CHF A;  4ML4 A;  1WNO A;  5DIT A;  3UF8 A;  1NMW A;  2PV1 A;  4JFK A;  2MF9 A;  3EIP A;  4ZPW R;  1EHN A;  2QF8 A;  1ZL1 A;  2DT0 A;  5DO2 A;  4MAV A;  1LL7 A;  1W9P A;  2XP9 A;  4WKF A;  1W1T A;  1PBK A;  3RME A;  2KGJ A;  1BL4 A;  3BMB A;  3EY6 A;  1D2K A;  1OGG A;  1WAW A;  2OFN A;  3GU0 A;  3AQU A;  4JFM A;  2KFW A;  4W5U A;  1ITX A;  2WK2 A;  3WKZ A;  1FAP A;  5DIU A;  4UDM A;  4MNK A;  4J4N A;  5DEZ A;  2Y78 A;  4XAK A;  4IT6 A;  3I6C A;  2KE0 A;  4PTM A;  3O5O A;  4ZS6 A;  3PR9 A;  1EYM A;  1E6Z A;  2VCD A;  4NNR A;  4N19 A;  2PN0 A;  4L3N A;  1E44 A;  4QIB A;  4U86 A;  4WK9 A;  4DIP A;  4HBE A;  4DRP A;  3ARV A;  2RUQ A;  1UR9 A;  3CGN A;  3ARZ A;  4DT4 A;  3RM4 A;  4P8V A;  2AOS A;  5GPG A;  3WH0 A;  1XHG A;  3KAF A;  1RD6 A;  4KR0 B;  1JNT A;  4R5E A;  2MNT A;  3O5R A;  4ODQ A;  1NWT A;  4QT2 A;  1FKK A;  1GUV A;  5DIV A;  2XP8 A;  2XP4 A;  2RUR A;  1FKL A;  1W1Y A;  1YAT A;  4NZC A;  4DRK A;  1OGB A;  2DSW A;  4ODN A;  2DT3 A;  4G50 A;  1QPF A;  4LAW A;  3CHE A;  1HKI A;  3NRK A;  2B31 A;  5HTG A;  2ZR4 A;  3WD2 A;  2PPN A;  2L2S A;  3O5E A;  4HAR A;  4TW7 A;  5HWC A;  2ZQS A;  4ODP A;  3W4R A;  2A3B A;  3OOB A;  3GTY X;  2PBC A;  2XP3 A;  1JCH B;  3WQW A;  1H0I A;  4DH0 A;  4ODM A;  3NTP A;  1H0G A;  2LKN A;  1LQ0 A;  2OLH A;  1LL6 A;  4S3K A;  1FKB A;  3UI5 A;  4MNL A;  4ODL A;  2DG3 A;  4ZPT R;  1NWR A;  1SR0 A;  3KAI A;  2FDM A;  3B9D A;  4Z2K A;  5HW7 A;  4WKH A;  4DRQ A;  3CHC A;  3KAC A;  2ESC A;  3IK8 A;  2XP6 A;  5B8I C;  2PI6 A;  2G8Z A;  4DRO A;  1F8A B;  3ARR A;  1PIN A;  2A3E A;  4Z2I A;  3KZ7 A;  1J4H A;  1ZBK A;  2ETN A;  3O5M A;  3RFW A;  2DPE A;  1E15 A;  3QOK A;  4ODK A;  4U84 A;  5GQB A;  4TW6 A;  1FKR A;  1OWQ A;  1ZU8 A;  4QZV B;  4TW8 A;  4FAP A;  4TYO A;  1FKJ A;  2KR7 A;  2UZ5 A;  5HW8 A;  4MNM A;  1R9H A;  1FJD A;  1J4R A;  2IF4 A;  4Z2H A;  4ITZ A;  4Z2L A;  1KFW A;  1X6L A;  3OA5 A;  4JFL A;  1Q6U A;  2YBT A;  2DSZ A;  2ZQV A;  3O5P A;  5HBF A;  4IPX A;  5J6E A;  3B8S A;  4LAV A;  1D7H A;  2KO7 A;  3UQA A;  3RGC A;  2ITK A;  3B7X A;  1Q6I A;  3KAD A;  1HJW A;  1QZ2 A;  2B5U B;  5HKG A;  2FAP A;  2DG9 A;  4S3J A;  1A7X A;  3LUO A;  3O5Q A;  3O5F A;  5BXJ A;  4MPK A;  3UQI A;  4G2P A;  4QT3 A;  4NSB A;  3BXW A;  4KQZ A;  1P5Q A;  2WLY A;  4JFJ A;  3ARS A;  2VN1 A;  2M2A A;  1X6N A;  3G6L A;  1FKT A;  3UI4 A;  4TNS A;  4FN2 A;  1W9U A;  2WLZ A;  3ALG A;  4W9Q A;  1HJV A;  4Q7N A;  5D75 A;  1L1P A;  4JYS A;  1U79 A;  2LGO A;  1VF8 A;  2IUZ A;  3O5J A;  5HWB A;  4DRH A;  5I98 A;  4DRI A;  2DSU A;  3FY1 A;  2Q5A A;  1ZB5 A;  1EQ3 A;  3CHD A;  2XPA A;  2ZQU A;  2ZR5 A;  1Q1C A;  1FKF A;  1JNE A;  4Z2G A;  4Z2J A;  4P8U A;  2JZV A;  1J4I A;  3ARY A;  1KT1 A;  3AS1 A;  1M5Y A;  4Q22 A;  2A3A A;  1ZBC A;  1JVW A;  1ZK6 A;  1T11 A;  1NWS A;  1UR8 A;  2MPH A;  3ARO A;  4ZPV R;  2PPP A;  1E9L A;  3WD3 A;  2O9O A;  3KCE A;  3VAW A;  3IKG A;  3WIJ A;  3G6M A;  2AWG A;  4J4O A;  1KT0 A;  3O5L A;  2F2D A;  2G41 A;  2M1I A;  2ZQT A;  1HXV A;  4DWS A;  1GOI A;  2MLZ A;  4LAY A;  3RM9 A;  4DZ3 A;  1FKG A;  1JND A;  4ODO A;  3ARW A;  2A3C A;  3GPK A;  4DRN A;  2N87 A;  1NMV A;  1B6C A;  4MSP A;  1W26 A;  4W9P A;  3TC5 A;  4WJX A;  1HJX A;  1BKF A;  3CGM A;  4WIW A;  2PV3 A;  1N1A A;  2RUD A;  4TX0 A;  4AY1 A;  2P4V A;  1Q6H A;  4P8W A;  1NSG A;  1FKI A;  4IQ2 A;  4MTV A;  3AS2 A;  4DRM A;  3IKD A;  5GPR A;  4GGQ A;  1FKH A;  2FKE A;  1CTN A;  2MLX A;  4MNJ A;  3UI6 A;  1FKS A;  5HT1 A;  4BF8 A;  2RQS A;  2ZR6 A;  5HW6 A;  3FXY A;  4DZ2 A;  3IHZ A;  2RUC A;  3PA7 A;  1C9H A;  4ODR A;  4DWS B;  3JYM A;  4JFI A;  3RM8 A;  3ODK A;  2D9F A;  1FD9 A;  1GPF A;  1K9T A;  4C02 B;  3KAH A;  1EIB A;  4URI A;  1ZCN A;  2M08 A;  4WKA A;  3TCZ A;  2XP7 A;  4DWS C;  2LJ4 A;  1LG2 A;  1W1P A;  1WB0 A;  2PPO A;  1E6R A;  3PRD A;  3ALF A;  3O5K A;  3B9E A;  2DT2 A;  1TCO C;  1YW5 A;  1EDQ A;  1FFQ A;  5HUA A;  3ART A;  3WL0 A;  1O6I A;  2PV2 A;  1Y0O A;  1NWU A;  3NI6 A;  1D7I A;  1D7J A;  5JH8 A;  2LPV A;  4IT4 A;  3CH9 A;  1HKK A;  4U85 A;  1ROT A;  3AS0 A;  1GRJ A;  3O5G A;  4LGX A;  1ROU A;  3KAG A;  2KI3 A;  2RSE A;  2EUL A;  1LG1 A;  3FAP A;  1JNS A;  1IX5 A;  2YBU A;  2K8I A;  3B9A A;  1F40 A;  3UQB A;  4O2T A;  2DG4 A;  3ARQ A;  1LL4 A;  3O5I A;  5DF0 A;  3WQV A;  4HBO A;  4DRJ A;  1E6N A;  1ZBV A;  4DWS D;  3ARX A;  4GIV A;  3WD1 A;  1FKD A;  2F23 A;  4MGV A;  4IQC A;  4L72 B;  3MDY B;  1TFV A;  2XPB A;  4W9O A;  1J6Y A;  1LJY A;  2F21 A;  3JYJ A;  3AS3 A;  3CZ8 A;  2DSV A;  1W9V A;  3O5D A;  1HKM A;  2O92 A;  2WM0 A;  3ARP A;  3KAB A;  3TDB A;  1ZBW A;  3WD4 A;  1E6P A;  3H9R B;  3PRB A;  3JXV A;  1NH6 A;  3PRA A;  2MLY A;  2DT1 A;  3ARU A;  3WL1 A;  3WD0 A;  2XP5 A;  4LAX A;  4P8X A; 
#chains in the Genus database with same CATH homology
 1HKJ A;  1D6O A;  1FFR A;  2F4E A;  1W1V A;  1QPL A;  4R0X A;  1XRV A;  1SYT A;  3CHF A;  4ML4 A;  1WNO A;  5DIT A;  3UF8 A;  1NMW A;  2PV1 A;  4JFK A;  2MF9 A;  4ZPW R;  1EHN A;  2QF8 A;  1ZL1 A;  2DT0 A;  5DO2 A;  4MAV A;  1LL7 A;  1W9P A;  2XP9 A;  4WKF A;  1W1T A;  1PBK A;  3RME A;  2KGJ A;  1BL4 A;  3EY6 A;  1D2K A;  1OGG A;  1WAW A;  2OFN A;  3AQU A;  4JFM A;  2KFW A;  4W5U A;  1ITX A;  2WK2 A;  3WKZ A;  1FAP A;  5DIU A;  4MNK A;  4J4N A;  5DEZ A;  2Y78 A;  4XAK A;  4IT6 A;  3I6C A;  2KE0 A;  4PTM A;  3O5O A;  4ZS6 A;  3PR9 A;  1EYM A;  1E6Z A;  2VCD A;  4NNR A;  4N19 A;  4L3N A;  4U86 A;  4QIB A;  4WK9 A;  4DIP A;  4HBE A;  4DRP A;  3ARV A;  2RUQ A;  1UR9 A;  3CGN A;  3ARZ A;  4DT4 A;  3RM4 A;  4P8V A;  2AOS A;  5GPG A;  3WH0 A;  1XHG A;  3KAF A;  1RD6 A;  4KR0 B;  1JNT A;  4R5E A;  2MNT A;  3O5R A;  4ODQ A;  1NWT A;  4QT2 A;  1FKK A;  1GUV A;  5DIV A;  2XP8 A;  2XP4 A;  2RUR A;  1FKL A;  1W1Y A;  1YAT A;  4NZC A;  4DRK A;  1OGB A;  2DSW A;  4ODN A;  2DT3 A;  4G50 A;  1QPF A;  4LAW A;  3CHE A;  1HKI A;  3NRK A;  2B31 A;  5HTG A;  2ZR4 A;  3WD2 A;  2PPN A;  2L2S A;  3O5E A;  4HAR A;  4TW7 A;  5HWC A;  2ZQS A;  4ODP A;  3W4R A;  2A3B A;  3OOB A;  2PBC A;  2XP3 A;  3WQW A;  1H0I A;  4DH0 A;  4ODM A;  3NTP A;  1H0G A;  2LKN A;  1LQ0 A;  2OLH A;  1LL6 A;  4S3K A;  1FKB A;  3UI5 A;  4MNL A;  4ODL A;  2DG3 A;  4ZPT R;  1NWR A;  1SR0 A;  3KAI A;  2FDM A;  3B9D A;  4Z2K A;  5HW7 A;  4WKH A;  4DRQ A;  3CHC A;  3KAC A;  2ESC A;  3IK8 A;  2XP6 A;  5B8I C;  2PI6 A;  2G8Z A;  4DRO A;  1F8A B;  3ARR A;  1PIN A;  2A3E A;  4Z2I A;  3KZ7 A;  1J4H A;  1ZBK A;  3O5M A;  3RFW A;  2DPE A;  1E15 A;  3QOK A;  4ODK A;  4U84 A;  5GQB A;  4TW6 A;  1FKR A;  1OWQ A;  1ZU8 A;  4QZV B;  4TW8 A;  4FAP A;  4TYO A;  1FKJ A;  2KR7 A;  2UZ5 A;  5HW8 A;  4MNM A;  1R9H A;  1FJD A;  1J4R A;  2IF4 A;  4Z2H A;  4ITZ A;  4Z2L A;  1KFW A;  1X6L A;  3OA5 A;  4JFL A;  1Q6U A;  2YBT A;  2DSZ A;  2ZQV A;  3O5P A;  5HBF A;  4IPX A;  5J6E A;  3B8S A;  4LAV A;  1D7H A;  2KO7 A;  3UQA A;  3RGC A;  2ITK A;  3B7X A;  1Q6I A;  3KAD A;  1HJW A;  1QZ2 A;  5HKG A;  2FAP A;  2DG9 A;  4S3J A;  1A7X A;  3LUO A;  3O5Q A;  3O5F A;  5BXJ A;  4MPK A;  3UQI A;  4G2P A;  4QT3 A;  4NSB A;  3BXW A;  4KQZ A;  1P5Q A;  2WLY A;  4JFJ A;  3ARS A;  2VN1 A;  2M2A A;  1X6N A;  3G6L A;  1FKT A;  3UI4 A;  4TNS A;  4FN2 A;  1W9U A;  2WLZ A;  3ALG A;  4W9Q A;  1HJV A;  4Q7N A;  5D75 A;  1L1P A;  4JYS A;  1U79 A;  2LGO A;  1VF8 A;  2IUZ A;  3O5J A;  5HWB A;  4DRH A;  5I98 A;  4DRI A;  2DSU A;  3FY1 A;  2Q5A A;  1ZB5 A;  1EQ3 A;  3CHD A;  2XPA A;  2ZQU A;  2ZR5 A;  1Q1C A;  1FKF A;  1JNE A;  4Z2G A;  4Z2J A;  4P8U A;  2JZV A;  1J4I A;  3ARY A;  1KT1 A;  3AS1 A;  1M5Y A;  4Q22 A;  2A3A A;  1ZBC A;  1JVW A;  1ZK6 A;  1T11 A;  1NWS A;  1UR8 A;  2MPH A;  3ARO A;  4ZPV R;  2PPP A;  1E9L A;  3WD3 A;  2O9O A;  3KCE A;  3VAW A;  3IKG A;  3WIJ A;  3G6M A;  2AWG A;  4J4O A;  1KT0 A;  3O5L A;  2F2D A;  2G41 A;  2M1I A;  2ZQT A;  1HXV A;  4DWS A;  1GOI A;  2MLZ A;  4LAY A;  3RM9 A;  4DZ3 A;  1FKG A;  1JND A;  4ODO A;  3ARW A;  2A3C A;  3GPK A;  4DRN A;  2N87 A;  1NMV A;  1B6C A;  4MSP A;  1W26 A;  4W9P A;  3TC5 A;  4WJX A;  1HJX A;  1BKF A;  3CGM A;  4WIW A;  2PV3 A;  1N1A A;  2RUD A;  4TX0 A;  4AY1 A;  1Q6H A;  4P8W A;  1NSG A;  1FKI A;  4IQ2 A;  4MTV A;  3AS2 A;  4DRM A;  3IKD A;  5GPR A;  4GGQ A;  1FKH A;  2FKE A;  1CTN A;  2MLX A;  4MNJ A;  3UI6 A;  1FKS A;  5HT1 A;  4BF8 A;  2RQS A;  2ZR6 A;  5HW6 A;  3FXY A;  4DZ2 A;  3IHZ A;  2RUC A;  3PA7 A;  1C9H A;  4ODR A;  4DWS B;  3JYM A;  4JFI A;  3RM8 A;  3ODK A;  2D9F A;  1FD9 A;  1GPF A;  1K9T A;  4C02 B;  3KAH A;  1EIB A;  4URI A;  1ZCN A;  2M08 A;  4WKA A;  3TCZ A;  2XP7 A;  4DWS C;  2LJ4 A;  1LG2 A;  1W1P A;  1WB0 A;  2PPO A;  1E6R A;  3PRD A;  3ALF A;  3O5K A;  3B9E A;  2DT2 A;  1TCO C;  1YW5 A;  1EDQ A;  1FFQ A;  5HUA A;  3ART A;  3WL0 A;  1O6I A;  2PV2 A;  1Y0O A;  1NWU A;  3NI6 A;  1D7I A;  1D7J A;  5JH8 A;  2LPV A;  4IT4 A;  3CH9 A;  1HKK A;  4U85 A;  1ROT A;  3AS0 A;  3O5G A;  4LGX A;  1ROU A;  3KAG A;  2KI3 A;  2RSE A;  1LG1 A;  3FAP A;  1JNS A;  1IX5 A;  2YBU A;  2K8I A;  3B9A A;  1F40 A;  3UQB A;  4O2T A;  2DG4 A;  3ARQ A;  1LL4 A;  3O5I A;  5DF0 A;  3WQV A;  4HBO A;  4DRJ A;  1E6N A;  1ZBV A;  4DWS D;  3ARX A;  4GIV A;  3WD1 A;  1FKD A;  4MGV A;  4IQC A;  4L72 B;  3MDY B;  1TFV A;  2XPB A;  4W9O A;  1J6Y A;  1LJY A;  2F21 A;  3AS3 A;  3JYJ A;  3CZ8 A;  2DSV A;  1W9V A;  3O5D A;  1HKM A;  2O92 A;  2WM0 A;  3ARP A;  3KAB A;  3TDB A;  1ZBW A;  3WD4 A;  1E6P A;  3H9R B;  3PRB A;  3JXV A;  1NH6 A;  3PRA A;  2MLY A;  2DT1 A;  3ARU A;  3WL1 A;  3WD0 A;  2XP5 A;  4LAX A;  4P8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...