1YATA

Improved calcineurin inhibition by yeast fkbp12-drug complexes. crystallographic and functional analysis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
b'SEVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title Improved calcineurin inhibition by yeast FKBP12-drug complexes. Crystallographic and functional analysis.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Binding protein
total genus 29
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yatA00
1D7IA 2XP6A 3UF8A 4ODNA 1Q6UA 3O5FA 5J6EA 1ROTA 4ODMA 2N87A 3PRDA 2KI3A 1JVWA 3FAPA 1F8AB 1FKBA 2MF9A 3IK8A 3NTPA 2PPPA 3NI6A 4J4OA 4TW6A 4DIPA 2PV2A 2DG3A 1F40A 1Y0OA 1W26A 4JFMA 4NNRA 2AWGA 1FJDA 1M5YA 4DRNA 4DT4A 3H9RB 1BKFA 4ODLA 1FKLA 4IPXA 2ZQTA 3IKGA 1D7HA 1NMVA 2K8IA 2LPVA 1Q1CA 2DG4A 1FKJA 3RFWA 4DRIA 2ZR6A 2ZQUA 1B6CA 1EQ3A 1L1PA 3TC5A 5DIUA 3NRKA 5HWBA 2XP7A 4ODQA 1FKHA 1QPLA 4JYSA 1FKFA 2LKNA 5HW8A 4DRPA 2RUCA 4GGQA 1U79A 3TDBA 2VN1A 3UQBA 3PRBA 2UZ5A 1ZK6A 2ZR4A 3CGMA 2PV1A 4QT2A 2RSEA 3UI6A 4DH0A 3JXVA 4QIBA 1EYMA 4JFLA 1J4IA 1Q6HA 3UQAA 3KAIA 4TW7A 4O2TA 1C9HA 1JNTA 3KZ7A 4J4NA 2VCDA 3IKDA 1JNSA 1D7JA 1FKSA 4DZ3A 2ZR5A 2L2SA 2MPHA 3O5OA 4JFIA 5B8IC 3O5PA 3O5GA 2OFNA 2JZVA 2PBCA 4DZ2A 3UI4A 5HTGA 4MGVA 2XP5A 2ZQSA 3O5LA 4LAYA 2PV3A 1HXVA 1NSGA 3O5QA 4BF8A 1PINA 2MLYA 2RUQA 5HW6A 4DRMA 5GPGA 2XP8A 4DRKA 3O5DA 2IF4A 2Y78A 3I6CA 2XPBA 5DITA 2XP4A 2M08A 3KAFA 4JFKA 4LAVA 4QT3A 5HKGA 1Q6IA 3O5KA 5DIVA 3VAWA 1YATA 4DRQA 4DRHA 3B7XA 4U86A 4JFJA 4C02B 4ODPA 3GPKA 5D75A 3RGCA 1J4HA 3ODKA 2F4EA 1J4RA 3O5RA 4ODKA 1QPFA 4W9PA 2FAPA 1FKKA 1A7XA 4TX0A 5HWCA 3PA7A 4DROA 3MDYB 1PBKA 2LJ4A 2KFWA 4ITZA 1FD9A 2RURA 1R9HA 2KO7A 2MLXA 3CGNA 3KACA 4G2PA 1FKDA 4FN2A 2KGJA 1FKTA 1N1AA 3KAHA 2D9FA 2ITKA 1FKIA 3O5MA 3JYMA 3O5EA 4TYOA 4ODOA 4W9OA 2KR7A 5HUAA 4LAXA 5I98A 5HT1A 3TCZA 4FAPA 3O5IA 1YW5A 5HW7A 2MNTA 2F21A 1ROUA 1BL4A 2M1IA 3WH0A 4R0XA 4TNSA 1FKGA 4N19A 3UQIA 1TCOC 1KT0A 2XP3A 4MSPA 2PPOA 3EY6A 4IQCA 1ZCNA 1QZ2A 3O5JA 3IHZA 2XPAA 1P5QA 3KADA 2FKEA 2ZQVA 4G50A 1T11A 2DG9A 2M2AA 2F2DA 4ODRA 1FKRA 2KE0A 3UI5A 4DRJA 2PPNA 2Q5AA 3LUOA 1KT1A 1J6YA 3KAGA 1NMWA 1FAPA 4U84A 4TW8A 3KCEA 1D6OA 4IQ2A 3KABA 2MLZA 2RUDA 4GIVA 2LGOA 4LAWA 2RQSA 5BXJA 3JYJA 2XP9A 3OOBA 4U85A 4W9QA
chains in the Genus database with same CATH superfamily
3UF8A 1Q6UA 2F23A 1JVWA 1JNEA 4TW6A 1F40A 3NI6A 2PV2A 1D2KA 4JFMA 4NNRA 1FJDA 4ODLA 1FKLA 1OGBA 2DSVA 4HARA 1D7HA 2K8IA 2DG4A 3RFWA 3WQWA 2ZQUA 1EQ3A 1L1PA 2DPEA 2ESCA 1ZBWA 1FKHA 5HW8A 4GGQA 1U79A 2DSWA 1HJXA 2ZR4A 3CGMA 2FDMA 4JFLA 1J4IA 3KAIA 1WNOA 1W1TA 3AS1A 2L2SA 4JFIA 3O5PA 2OLHA 2JZVA 4DZ2A 4Z2IA 2IUZA 3UI4A 4WJXA 1HXVA 3ARUA 1UR9A 2WLYA 2WM0A 5GPGA 1HKJA 4UDMA 1SYTA 2Y78A 3I6CA 4MAVA 3O5KA 4Z2HA 4ODPA 3RGCA 1E6PA 3TCZA 1ZBCA 4TX0A 5HWCA 3MDYB 3AROA 1FD9A 2QF8A 2KO7A 3O5EA 3ARTA 4MTVA 4ODOA 4W9OA 1ZB5A 1E6RA 5I98A 5DO2A 1W1YA 1RD6A 1XRVA 4N19A 3WKZA 1HJVA 1KT0A 2XP3A 4WKFA 1FFRA 1GPFA 1NH6A 4IQCA 3FXYA 2F2DA 3AQUA 1FKRA 3WD3A 3UI5A 4DRJA 4WIWA 3BMBA 4MNJA 4MNMA 4L72B 3KAGA 1NMWA 3ARYA 3CHCA 3KCEA 1D6OA 4DWSB 3KABA 1WB0A 1W1VA 2LGOA 1GUVA 2XP9A 4DRPA 2A3EA 1D7IA 1ROTA 1VF8A 3PRDA 1X6LA 2KI3A 5JH8A 3ALGA 1NWTA 2MF9A 1WAWA 1CTNA 2DG3A 1Y0OA 1ZBKA 1W26A 1HKMA 3ARVA 4DT4A 3H9RB 4KR0B 4IPXA 2DT1A 2LPVA 1Q1CA 4QZVB 3TC5A 4Z2JA 4ODQA 4WKAA 1FKFA 1EHNA 2RUCA 1LJYA 3TDBA 1EDQA 3PRBA 1GOIA 4ZPTR 3WL0A 3WQVA 2RSEA 3UI6A 4DH0A 3JXVA 4QIBA 1O6IA 4P8VA 3RM9A 4HBOA 1NWSA 3IKDA 4Q22A 1JNSA 1D7JA 1FKSA 3ARXA 1IX5A 2ZR5A 3O5GA 2PBCA 4MGVA 5GPRA 3WD0A 4BF8A 4P8WA 4WKHA 4DRMA 2XP8A 5HW6A 1W9PA 3O5DA 2XP4A 2M08A 4JFKA 1Q6IA 4MNLA 1YATA 3RM4A 4DRHA 1J4HA 2F4EA 3O5RA 3PA7A 4DROA 4NSBA 3QOKA 4ZPWR 4L3NA 3BXWA 4FN2A 2KGJA 1N1AA 3KAHA 2B31A 2KR7A 2YBUA 4LAXA 3O5IA 1ROUA 4R0XA 4TNSA 4P8UA 5DF0A 2PPOA 2PI6A 2PN0A 3EY6A 2DT0A 1H0GA 2XPAA 4G50A 2A3AA 2DG9A 4ODRA 2PPNA 4PTMA 2Q5AA 2AOSA 2EULA 3ARPA 4NZCA 1FAPA 2RQSA 4IQ2A 1LL6A 2XP6A 2ETNA 1TFVA 3O5FA 4ODMA 1H0IA 2O9OA 3FAPA 5DIUA 4J4OA 4DIPA 3IK8A 2PPPA 3EIPA 4HBEA 3ARZA 1LQ0A 2AWGA 1M5YA 4DRNA 4Q7NA 1BKFA 3CHDA 1ZBVA 3ARWA 4MNKA 3IKGA 1NMVA 3B9DA 4DRIA 2XP7A 3CHFA 1HJWA 4JYSA 4W5UA 3GTYX 2VN1A 3UQBA 2UZ5A 3B9AA 1ZK6A 2PV1A 4QT2A 4R5EA 1HKKA 3OA5A 4O2TA 1C9HA 4J4NA 3KZ7A 2DT3A 2VCDA 4ZS6A 4ZPVR 4DZ3A 3ARQA 2MPHA 5B8IC 1W9UA 1K9TA 1E44A 2XP5A 2ZQSA 3O5LA 2PV3A 1NSGA 4DWSA 4XAKA 3GU0A 2RUQA 4MPKA 4Z2GA 5DITA 4LAVA 1JCHB 3CZ8A 5HKGA 3VAWA 3B8SA 4DRQA 4U86A 4JFJA 3UQIA 1J4RA 1QPFA 1FKKA 1LG1A 2LJ4A 2KFWA 4ITZA 2P4VA 2DT2A 2MLXA 3CGNA 3KACA 4IT4A 1FKDA 2WK2A 4IT6A 1FKIA 3O5MA 4TYOA 4WK9A 3AS3A 3WD4A 4KQZA 1YW5A 2MNTA 2F21A 2M1IA 3WH0A 1E15A 1FKGA 3ARRA 4MSPA 1E6NA 3O5JA 4S3JA 1P5QA 3KADA 2ZQVA 1T11A 4DWSC 5GQBA 3ALFA 3WIJA 4AY1A 4TW8A 4GIVA 3RM8A 2A3CA 3OOBA 1LG2A 4U85A 1E9LA 3W4RA 4ODNA 5J6EA 1EIBA 2N87A 3PRAA 4LGXA 4Z2KA 3NTPA 1F8AB 1FKBA 1W1PA 3B9EA 2G41A 2B5UB 2YBTA 3CH9A 2ZQTA 1NWUA 3G6LA 4ML4A 1FKJA 2ZR6A 1B6CA 1LL7A 4URIA 5HWBA 1HKIA 3NRKA 1QPLA 1LL4A 2LKNA 5DEZA 3G6MA 3CHEA 2DSZA 3WL1A 4P8XA 1SR0A 3UQAA 1EYMA 1Q6HA 2G8ZA 4TW7A 1JNTA 3AS0A 2DSUA 3WD1A 1GRJA 3O5OA 2OFNA 1OWQA 5HTGA 4LAYA 3O5QA 3WD2A 1PINA 2MLYA 4DRKA 2IF4A 2A3BA 1ZU8A 4Z2LA 2XPBA 3KAFA 4QT3A 5DIVA 3AS2A 3B7XA 4C02B 5D75A 1E6ZA 3GPKA 3ODKA 1W9VA 3ARSA 4ODKA 4W9PA 2FAPA 1A7XA 1PBKA 1JNDA 2RURA 1R9HA 4G2PA 1FKTA 2D9FA 2ITKA 1NWRA 3JYMA 1ITXA 5HUAA 4S3KA 5HT1A 4FAPA 5HW7A 3RMEA 1BL4A 1ZL1A 1KFWA 1UR8A 2WLZA 4DWSD 1TCOC 1OGGA 1ZCNA 1QZ2A 3IHZA 2FKEA 3FY1A 2O92A 2M2AA 2KE0A 1XHGA 3PR9A 1X6NA 1FFQA 5HBFA 3LUOA 1KT1A 1J6YA 4U84A 2MLZA 2RUDA 4LAWA 5BXJA 3JYJA 4W9QA
chains in the Genus database with same CATH topology
3UF8A 1Q6UA 1JVWA 1JNEA 4TW6A 1F40A 3NI6A 2PV2A 1D2KA 4JFMA 4NNRA 1FJDA 4ODLA 1FKLA 1OGBA 2DSVA 4HARA 1D7HA 2K8IA 2DG4A 3RFWA 3WQWA 2ZQUA 1EQ3A 1L1PA 2DPEA 2ESCA 1ZBWA 1FKHA 5HW8A 4GGQA 1U79A 2DSWA 1HJXA 2ZR4A 3CGMA 2FDMA 4JFLA 1J4IA 3KAIA 1WNOA 1W1TA 3AS1A 2L2SA 4JFIA 3O5PA 2OLHA 2JZVA 4DZ2A 4Z2IA 2IUZA 3UI4A 4WJXA 1HXVA 3ARUA 1UR9A 2WLYA 2WM0A 5GPGA 1HKJA 1SYTA 2Y78A 3I6CA 4MAVA 3O5KA 4Z2HA 4ODPA 3RGCA 1E6PA 3TCZA 1ZBCA 4TX0A 5HWCA 3MDYB 3AROA 1FD9A 2QF8A 2KO7A 3O5EA 3ARTA 4MTVA 4ODOA 4W9OA 1ZB5A 1E6RA 5I98A 5DO2A 1W1YA 1RD6A 1XRVA 4N19A 3WKZA 1HJVA 1KT0A 2XP3A 4WKFA 1FFRA 1GPFA 1NH6A 4IQCA 3FXYA 2F2DA 3AQUA 1FKRA 3WD3A 3UI5A 4DRJA 4WIWA 4MNJA 4MNMA 4L72B 3KAGA 1NMWA 3ARYA 3CHCA 3KCEA 1D6OA 4DWSB 3KABA 1WB0A 1W1VA 2LGOA 1GUVA 2XP9A 4DRPA 2A3EA 1D7IA 1ROTA 1VF8A 3PRDA 1X6LA 2KI3A 5JH8A 3ALGA 1NWTA 2MF9A 1WAWA 1CTNA 2DG3A 1Y0OA 1ZBKA 1W26A 1HKMA 3ARVA 4DT4A 3H9RB 4KR0B 4IPXA 2DT1A 2LPVA 1Q1CA 4QZVB 3TC5A 4Z2JA 4ODQA 4WKAA 1FKFA 1EHNA 2RUCA 1LJYA 3TDBA 1EDQA 3PRBA 1GOIA 4ZPTR 3WL0A 3WQVA 2RSEA 3UI6A 4DH0A 3JXVA 4QIBA 1O6IA 4P8VA 3RM9A 4HBOA 1NWSA 3IKDA 4Q22A 1JNSA 1D7JA 1FKSA 3ARXA 1IX5A 2ZR5A 3O5GA 2PBCA 4MGVA 5GPRA 3WD0A 4BF8A 4P8WA 4WKHA 4DRMA 2XP8A 5HW6A 3O5DA 1W9PA 2XP4A 2M08A 4JFKA 1Q6IA 4MNLA 1YATA 3RM4A 4DRHA 1J4HA 2F4EA 3O5RA 3PA7A 4DROA 4NSBA 3QOKA 4ZPWR 4L3NA 3BXWA 4FN2A 2KGJA 1N1AA 3KAHA 2B31A 2KR7A 2YBUA 4LAXA 3O5IA 1ROUA 4R0XA 4TNSA 4P8UA 5DF0A 2PPOA 2PI6A 3EY6A 2DT0A 1H0GA 2XPAA 4G50A 2A3AA 2DG9A 4ODRA 2PPNA 4PTMA 2Q5AA 2AOSA 3ARPA 4NZCA 1FAPA 2RQSA 4IQ2A 1LL6A 2XP6A 1TFVA 3O5FA 4ODMA 1H0IA 2O9OA 3FAPA 5DIUA 4J4OA 4DIPA 3IK8A 2PPPA 4HBEA 3ARZA 1LQ0A 2AWGA 1M5YA 4DRNA 4Q7NA 1BKFA 3CHDA 1ZBVA 3ARWA 4MNKA 3IKGA 1NMVA 3B9DA 4DRIA 2XP7A 3CHFA 1HJWA 4JYSA 4W5UA 2VN1A 3UQBA 2UZ5A 3B9AA 1ZK6A 2PV1A 4QT2A 4R5EA 1HKKA 3OA5A 4O2TA 1C9HA 4J4NA 3KZ7A 2DT3A 2VCDA 4ZS6A 4ZPVR 4DZ3A 3ARQA 2MPHA 5B8IC 1W9UA 1K9TA 2XP5A 2ZQSA 3O5LA 2PV3A 1NSGA 4DWSA 4XAKA 2RUQA 4MPKA 4Z2GA 5DITA 4LAVA 3CZ8A 5HKGA 3VAWA 3B8SA 4DRQA 4U86A 4JFJA 3UQIA 1J4RA 1QPFA 1FKKA 1LG1A 2LJ4A 2KFWA 4ITZA 2DT2A 2MLXA 3CGNA 3KACA 4IT4A 1FKDA 2WK2A 4IT6A 1FKIA 3O5MA 4TYOA 4WK9A 3AS3A 3WD4A 4KQZA 1YW5A 2MNTA 2F21A 2M1IA 3WH0A 1E15A 1FKGA 3ARRA 4MSPA 1E6NA 3O5JA 4S3JA 1P5QA 3KADA 2ZQVA 1T11A 4DWSC 5GQBA 3ALFA 3WIJA 4AY1A 4TW8A 4GIVA 3RM8A 2A3CA 3OOBA 1LG2A 4U85A 1E9LA 3W4RA 4ODNA 5J6EA 1EIBA 2N87A 3PRAA 4LGXA 4Z2KA 3NTPA 1F8AB 1FKBA 1W1PA 3B9EA 2G41A 2YBTA 3CH9A 2ZQTA 1NWUA 3G6LA 4ML4A 1FKJA 2ZR6A 1B6CA 1LL7A 4URIA 5HWBA 1HKIA 3NRKA 1QPLA 1LL4A 2LKNA 5DEZA 3G6MA 3CHEA 2DSZA 3WL1A 4P8XA 1SR0A 3UQAA 1EYMA 1Q6HA 2G8ZA 4TW7A 1JNTA 3AS0A 2DSUA 3WD1A 3O5OA 2OFNA 1OWQA 5HTGA 4LAYA 3O5QA 3WD2A 1PINA 2MLYA 4DRKA 2IF4A 2A3BA 1ZU8A 4Z2LA 2XPBA 3KAFA 4QT3A 5DIVA 3AS2A 3B7XA 4C02B 5D75A 1E6ZA 3GPKA 3ODKA 1W9VA 3ARSA 4ODKA 4W9PA 2FAPA 1A7XA 1PBKA 1JNDA 2RURA 1R9HA 4G2PA 1FKTA 2D9FA 2ITKA 1NWRA 3JYMA 1ITXA 5HUAA 4S3KA 5HT1A 4FAPA 5HW7A 3RMEA 1BL4A 1ZL1A 1KFWA 1UR8A 2WLZA 4DWSD 1TCOC 1OGGA 1ZCNA 1QZ2A 3IHZA 2FKEA 3FY1A 2O92A 2M2AA 2KE0A 1XHGA 3PR9A 1X6NA 1FFQA 5HBFA 3LUOA 1KT1A 1J6YA 4U84A 2MLZA 2RUDA 4LAWA 5BXJA 3JYJA 4W9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7I A;  2XP6 A;  3UF8 A;  4ODN A;  1Q6U A;  3O5F A;  5J6E A;  1ROT A;  4ODM A;  2N87 A;  3PRD A;  2KI3 A;  1JVW A;  3FAP A;  1F8A B;  1FKB A;  2MF9 A;  3IK8 A;  3NTP A;  2PPP A;  3NI6 A;  4J4O A;  4TW6 A;  4DIP A;  2PV2 A;  2DG3 A;  1F40 A;  1Y0O A;  1W26 A;  4JFM A;  4NNR A;  2AWG A;  1FJD A;  1M5Y A;  4DRN A;  4DT4 A;  3H9R B;  1BKF A;  4ODL A;  1FKL A;  4IPX A;  2ZQT A;  3IKG A;  1D7H A;  1NMV A;  2K8I A;  2LPV A;  1Q1C A;  2DG4 A;  1FKJ A;  3RFW A;  4DRI A;  2ZR6 A;  2ZQU A;  1B6C A;  1EQ3 A;  1L1P A;  3TC5 A;  5DIU A;  3NRK A;  5HWB A;  2XP7 A;  4ODQ A;  1FKH A;  1QPL A;  4JYS A;  1FKF A;  2LKN A;  5HW8 A;  4DRP A;  2RUC A;  4GGQ A;  1U79 A;  3TDB A;  2VN1 A;  3UQB A;  3PRB A;  2UZ5 A;  1ZK6 A;  2ZR4 A;  3CGM A;  2PV1 A;  4QT2 A;  2RSE A;  3UI6 A;  4DH0 A;  3JXV A;  4QIB A;  1EYM A;  4JFL A;  1J4I A;  1Q6H A;  3UQA A;  3KAI A;  4TW7 A;  4O2T A;  1C9H A;  1JNT A;  3KZ7 A;  4J4N A;  2VCD A;  3IKD A;  1JNS A;  1D7J A;  1FKS A;  4DZ3 A;  2ZR5 A;  2L2S A;  2MPH A;  3O5O A;  4JFI A;  5B8I C;  3O5P A;  3O5G A;  2OFN A;  2JZV A;  2PBC A;  4DZ2 A;  3UI4 A;  5HTG A;  4MGV A;  2XP5 A;  2ZQS A;  3O5L A;  4LAY A;  2PV3 A;  1HXV A;  1NSG A;  3O5Q A;  4BF8 A;  1PIN A;  2MLY A;  2RUQ A;  5HW6 A;  4DRM A;  5GPG A;  2XP8 A;  4DRK A;  3O5D A;  2IF4 A;  2Y78 A;  3I6C A;  2XPB A;  5DIT A;  2XP4 A;  2M08 A;  3KAF A;  4JFK A;  4LAV A;  4QT3 A;  5HKG A;  1Q6I A;  3O5K A;  5DIV A;  3VAW A;  1YAT A;  4DRQ A;  4DRH A;  3B7X A;  4U86 A;  4JFJ A;  4C02 B;  4ODP A;  3GPK A;  5D75 A;  3RGC A;  1J4H A;  3ODK A;  2F4E A;  1J4R A;  3O5R A;  4ODK A;  1QPF A;  4W9P A;  2FAP A;  1FKK A;  1A7X A;  4TX0 A;  5HWC A;  3PA7 A;  4DRO A;  3MDY B;  1PBK A;  2LJ4 A;  2KFW A;  4ITZ A;  1FD9 A;  2RUR A;  1R9H A;  2KO7 A;  2MLX A;  3CGN A;  3KAC A;  4G2P A;  1FKD A;  4FN2 A;  2KGJ A;  1FKT A;  1N1A A;  3KAH A;  2D9F A;  2ITK A;  1FKI A;  3O5M A;  3JYM A;  3O5E A;  4TYO A;  4ODO A;  4W9O A;  2KR7 A;  5HUA A;  4LAX A;  5I98 A;  5HT1 A;  3TCZ A;  4FAP A;  3O5I A;  1YW5 A;  5HW7 A;  2MNT A;  2F21 A;  1ROU A;  1BL4 A;  2M1I A;  3WH0 A;  4R0X A;  4TNS A;  1FKG A;  4N19 A;  3UQI A;  1TCO C;  1KT0 A;  2XP3 A;  4MSP A;  2PPO A;  3EY6 A;  4IQC A;  1ZCN A;  1QZ2 A;  3O5J A;  3IHZ A;  2XPA A;  1P5Q A;  3KAD A;  2FKE A;  2ZQV A;  4G50 A;  1T11 A;  2DG9 A;  2M2A A;  2F2D A;  4ODR A;  1FKR A;  2KE0 A;  3UI5 A;  4DRJ A;  2PPN A;  2Q5A A;  3LUO A;  1KT1 A;  1J6Y A;  3KAG A;  1NMW A;  1FAP A;  4U84 A;  4TW8 A;  3KCE A;  1D6O A;  4IQ2 A;  3KAB A;  2MLZ A;  2RUD A;  4GIV A;  2LGO A;  4LAW A;  2RQS A;  5BXJ A;  3JYJ A;  2XP9 A;  3OOB A;  4U85 A;  4W9Q A; 
#chains in the Genus database with same CATH topology
 3UF8 A;  1Q6U A;  2F23 A;  1JVW A;  1JNE A;  4TW6 A;  1F40 A;  3NI6 A;  2PV2 A;  1D2K A;  4JFM A;  4NNR A;  1FJD A;  4ODL A;  1FKL A;  1OGB A;  2DSV A;  4HAR A;  1D7H A;  2K8I A;  2DG4 A;  3RFW A;  3WQW A;  2ZQU A;  1EQ3 A;  1L1P A;  2DPE A;  2ESC A;  1ZBW A;  1FKH A;  5HW8 A;  4GGQ A;  1U79 A;  2DSW A;  1HJX A;  2ZR4 A;  3CGM A;  2FDM A;  4JFL A;  1J4I A;  3KAI A;  1WNO A;  1W1T A;  3AS1 A;  2L2S A;  4JFI A;  3O5P A;  2OLH A;  2JZV A;  4DZ2 A;  4Z2I A;  2IUZ A;  3UI4 A;  4WJX A;  1HXV A;  3ARU A;  1UR9 A;  2WLY A;  2WM0 A;  5GPG A;  1HKJ A;  4UDM A;  1SYT A;  2Y78 A;  3I6C A;  4MAV A;  3O5K A;  4Z2H A;  4ODP A;  3RGC A;  1E6P A;  3TCZ A;  1ZBC A;  4TX0 A;  5HWC A;  3MDY B;  3ARO A;  1FD9 A;  2QF8 A;  2KO7 A;  3O5E A;  3ART A;  4MTV A;  4ODO A;  4W9O A;  1ZB5 A;  1E6R A;  5I98 A;  5DO2 A;  1W1Y A;  1RD6 A;  1XRV A;  4N19 A;  3WKZ A;  1HJV A;  1KT0 A;  2XP3 A;  4WKF A;  1FFR A;  1GPF A;  1NH6 A;  4IQC A;  3FXY A;  2F2D A;  3AQU A;  1FKR A;  3WD3 A;  3UI5 A;  4DRJ A;  4WIW A;  3BMB A;  4MNJ A;  4MNM A;  4L72 B;  3KAG A;  1NMW A;  3ARY A;  3CHC A;  3KCE A;  1D6O A;  4DWS B;  3KAB A;  1WB0 A;  1W1V A;  2LGO A;  1GUV A;  2XP9 A;  4DRP A;  2A3E A;  1D7I A;  1ROT A;  1VF8 A;  3PRD A;  1X6L A;  2KI3 A;  5JH8 A;  3ALG A;  1NWT A;  2MF9 A;  1WAW A;  1CTN A;  2DG3 A;  1Y0O A;  1ZBK A;  1W26 A;  1HKM A;  3ARV A;  4DT4 A;  3H9R B;  4KR0 B;  4IPX A;  2DT1 A;  2LPV A;  1Q1C A;  4QZV B;  3TC5 A;  4Z2J A;  4ODQ A;  4WKA A;  1FKF A;  1EHN A;  2RUC A;  1LJY A;  3TDB A;  1EDQ A;  3PRB A;  1GOI A;  4ZPT R;  3WL0 A;  3WQV A;  2RSE A;  3UI6 A;  4DH0 A;  3JXV A;  4QIB A;  1O6I A;  4P8V A;  3RM9 A;  4HBO A;  1NWS A;  3IKD A;  4Q22 A;  1JNS A;  1D7J A;  1FKS A;  3ARX A;  1IX5 A;  2ZR5 A;  3O5G A;  2PBC A;  4MGV A;  5GPR A;  3WD0 A;  4BF8 A;  4P8W A;  4WKH A;  4DRM A;  2XP8 A;  5HW6 A;  1W9P A;  3O5D A;  2XP4 A;  2M08 A;  4JFK A;  1Q6I A;  4MNL A;  1YAT A;  3RM4 A;  4DRH A;  1J4H A;  2F4E A;  3O5R A;  3PA7 A;  4DRO A;  4NSB A;  3QOK A;  4ZPW R;  4L3N A;  3BXW A;  4FN2 A;  2KGJ A;  1N1A A;  3KAH A;  2B31 A;  2KR7 A;  2YBU A;  4LAX A;  3O5I A;  1ROU A;  4R0X A;  4TNS A;  4P8U A;  5DF0 A;  2PPO A;  2PI6 A;  2PN0 A;  3EY6 A;  2DT0 A;  1H0G A;  2XPA A;  4G50 A;  2A3A A;  2DG9 A;  4ODR A;  2PPN A;  4PTM A;  2Q5A A;  2AOS A;  2EUL A;  3ARP A;  4NZC A;  1FAP A;  2RQS A;  4IQ2 A;  1LL6 A;  2XP6 A;  2ETN A;  1TFV A;  3O5F A;  4ODM A;  1H0I A;  2O9O A;  3FAP A;  5DIU A;  4J4O A;  4DIP A;  3IK8 A;  2PPP A;  3EIP A;  4HBE A;  3ARZ A;  1LQ0 A;  2AWG A;  1M5Y A;  4DRN A;  4Q7N A;  1BKF A;  3CHD A;  1ZBV A;  3ARW A;  4MNK A;  3IKG A;  1NMV A;  3B9D A;  4DRI A;  2XP7 A;  3CHF A;  1HJW A;  4JYS A;  4W5U A;  3GTY X;  2VN1 A;  3UQB A;  2UZ5 A;  3B9A A;  1ZK6 A;  2PV1 A;  4QT2 A;  4R5E A;  1HKK A;  3OA5 A;  4O2T A;  1C9H A;  4J4N A;  3KZ7 A;  2DT3 A;  2VCD A;  4ZS6 A;  4ZPV R;  4DZ3 A;  3ARQ A;  2MPH A;  5B8I C;  1W9U A;  1K9T A;  1E44 A;  2XP5 A;  2ZQS A;  3O5L A;  2PV3 A;  1NSG A;  4DWS A;  4XAK A;  3GU0 A;  2RUQ A;  4MPK A;  4Z2G A;  5DIT A;  4LAV A;  1JCH B;  3CZ8 A;  5HKG A;  3VAW A;  3B8S A;  4DRQ A;  4U86 A;  4JFJ A;  3UQI A;  1J4R A;  1QPF A;  1FKK A;  1LG1 A;  2LJ4 A;  2KFW A;  4ITZ A;  2P4V A;  2DT2 A;  2MLX A;  3CGN A;  3KAC A;  4IT4 A;  1FKD A;  2WK2 A;  4IT6 A;  1FKI A;  3O5M A;  4TYO A;  4WK9 A;  3AS3 A;  3WD4 A;  4KQZ A;  1YW5 A;  2MNT A;  2F21 A;  2M1I A;  3WH0 A;  1E15 A;  1FKG A;  3ARR A;  4MSP A;  1E6N A;  3O5J A;  4S3J A;  1P5Q A;  3KAD A;  2ZQV A;  1T11 A;  4DWS C;  5GQB A;  3ALF A;  3WIJ A;  4AY1 A;  4TW8 A;  4GIV A;  3RM8 A;  2A3C A;  3OOB A;  1LG2 A;  4U85 A;  1E9L A;  3W4R A;  4ODN A;  5J6E A;  1EIB A;  2N87 A;  3PRA A;  4LGX A;  4Z2K A;  3NTP A;  1F8A B;  1FKB A;  1W1P A;  3B9E A;  2G41 A;  2B5U B;  2YBT A;  3CH9 A;  2ZQT A;  1NWU A;  3G6L A;  4ML4 A;  1FKJ A;  2ZR6 A;  1B6C A;  1LL7 A;  4URI A;  5HWB A;  1HKI A;  3NRK A;  1QPL A;  1LL4 A;  2LKN A;  5DEZ A;  3G6M A;  3CHE A;  2DSZ A;  3WL1 A;  4P8X A;  1SR0 A;  3UQA A;  1EYM A;  1Q6H A;  2G8Z A;  4TW7 A;  1JNT A;  3AS0 A;  2DSU A;  3WD1 A;  1GRJ A;  3O5O A;  2OFN A;  1OWQ A;  5HTG A;  4LAY A;  3O5Q A;  3WD2 A;  1PIN A;  2MLY A;  4DRK A;  2IF4 A;  2A3B A;  1ZU8 A;  4Z2L A;  2XPB A;  3KAF A;  4QT3 A;  5DIV A;  3AS2 A;  3B7X A;  4C02 B;  5D75 A;  1E6Z A;  3GPK A;  3ODK A;  1W9V A;  3ARS A;  4ODK A;  4W9P A;  2FAP A;  1A7X A;  1PBK A;  1JND A;  2RUR A;  1R9H A;  4G2P A;  1FKT A;  2D9F A;  2ITK A;  1NWR A;  3JYM A;  1ITX A;  5HUA A;  4S3K A;  5HT1 A;  4FAP A;  5HW7 A;  3RME A;  1BL4 A;  1ZL1 A;  1KFW A;  1UR8 A;  2WLZ A;  4DWS D;  1TCO C;  1OGG A;  1ZCN A;  1QZ2 A;  3IHZ A;  2FKE A;  3FY1 A;  2O92 A;  2M2A A;  2KE0 A;  1XHG A;  3PR9 A;  1X6N A;  1FFQ A;  5HBF A;  3LUO A;  1KT1 A;  1J6Y A;  4U84 A;  2MLZ A;  2RUD A;  4LAW A;  5BXJ A;  3JYJ A;  4W9Q A; 
#chains in the Genus database with same CATH homology
 3UF8 A;  1Q6U A;  1JVW A;  1JNE A;  4TW6 A;  1F40 A;  3NI6 A;  2PV2 A;  1D2K A;  4JFM A;  4NNR A;  1FJD A;  4ODL A;  1FKL A;  1OGB A;  2DSV A;  4HAR A;  1D7H A;  2K8I A;  2DG4 A;  3RFW A;  3WQW A;  2ZQU A;  1EQ3 A;  1L1P A;  2DPE A;  2ESC A;  1ZBW A;  1FKH A;  5HW8 A;  4GGQ A;  1U79 A;  2DSW A;  1HJX A;  2ZR4 A;  3CGM A;  2FDM A;  4JFL A;  1J4I A;  3KAI A;  1WNO A;  1W1T A;  3AS1 A;  2L2S A;  4JFI A;  3O5P A;  2OLH A;  2JZV A;  4DZ2 A;  4Z2I A;  2IUZ A;  3UI4 A;  4WJX A;  1HXV A;  3ARU A;  1UR9 A;  2WLY A;  2WM0 A;  5GPG A;  1HKJ A;  1SYT A;  2Y78 A;  3I6C A;  4MAV A;  3O5K A;  4Z2H A;  4ODP A;  3RGC A;  1E6P A;  3TCZ A;  1ZBC A;  4TX0 A;  5HWC A;  3MDY B;  3ARO A;  1FD9 A;  2QF8 A;  2KO7 A;  3O5E A;  3ART A;  4MTV A;  4ODO A;  4W9O A;  1ZB5 A;  1E6R A;  5I98 A;  5DO2 A;  1W1Y A;  1RD6 A;  1XRV A;  4N19 A;  3WKZ A;  1HJV A;  1KT0 A;  2XP3 A;  4WKF A;  1FFR A;  1GPF A;  1NH6 A;  4IQC A;  3FXY A;  2F2D A;  3AQU A;  1FKR A;  3WD3 A;  3UI5 A;  4DRJ A;  4WIW A;  4MNJ A;  4MNM A;  4L72 B;  3KAG A;  1NMW A;  3ARY A;  3CHC A;  3KCE A;  1D6O A;  4DWS B;  3KAB A;  1WB0 A;  1W1V A;  2LGO A;  1GUV A;  2XP9 A;  4DRP A;  2A3E A;  1D7I A;  1ROT A;  1VF8 A;  3PRD A;  1X6L A;  2KI3 A;  5JH8 A;  3ALG A;  1NWT A;  2MF9 A;  1WAW A;  1CTN A;  2DG3 A;  1Y0O A;  1ZBK A;  1W26 A;  1HKM A;  3ARV A;  4DT4 A;  3H9R B;  4KR0 B;  4IPX A;  2DT1 A;  2LPV A;  1Q1C A;  4QZV B;  3TC5 A;  4Z2J A;  4ODQ A;  4WKA A;  1FKF A;  1EHN A;  2RUC A;  1LJY A;  3TDB A;  1EDQ A;  3PRB A;  1GOI A;  4ZPT R;  3WL0 A;  3WQV A;  2RSE A;  3UI6 A;  4DH0 A;  3JXV A;  4QIB A;  1O6I A;  4P8V A;  3RM9 A;  4HBO A;  1NWS A;  3IKD A;  4Q22 A;  1JNS A;  1D7J A;  1FKS A;  3ARX A;  1IX5 A;  2ZR5 A;  3O5G A;  2PBC A;  4MGV A;  5GPR A;  3WD0 A;  4BF8 A;  4P8W A;  4WKH A;  4DRM A;  2XP8 A;  5HW6 A;  3O5D A;  1W9P A;  2XP4 A;  2M08 A;  4JFK A;  1Q6I A;  4MNL A;  1YAT A;  3RM4 A;  4DRH A;  1J4H A;  2F4E A;  3O5R A;  3PA7 A;  4DRO A;  4NSB A;  3QOK A;  4ZPW R;  4L3N A;  3BXW A;  4FN2 A;  2KGJ A;  1N1A A;  3KAH A;  2B31 A;  2KR7 A;  2YBU A;  4LAX A;  3O5I A;  1ROU A;  4R0X A;  4TNS A;  4P8U A;  5DF0 A;  2PPO A;  2PI6 A;  3EY6 A;  2DT0 A;  1H0G A;  2XPA A;  4G50 A;  2A3A A;  2DG9 A;  4ODR A;  2PPN A;  4PTM A;  2Q5A A;  2AOS A;  3ARP A;  4NZC A;  1FAP A;  2RQS A;  4IQ2 A;  1LL6 A;  2XP6 A;  1TFV A;  3O5F A;  4ODM A;  1H0I A;  2O9O A;  3FAP A;  5DIU A;  4J4O A;  4DIP A;  3IK8 A;  2PPP A;  4HBE A;  3ARZ A;  1LQ0 A;  2AWG A;  1M5Y A;  4DRN A;  4Q7N A;  1BKF A;  3CHD A;  1ZBV A;  3ARW A;  4MNK A;  3IKG A;  1NMV A;  3B9D A;  4DRI A;  2XP7 A;  3CHF A;  1HJW A;  4JYS A;  4W5U A;  2VN1 A;  3UQB A;  2UZ5 A;  3B9A A;  1ZK6 A;  2PV1 A;  4QT2 A;  4R5E A;  1HKK A;  3OA5 A;  4O2T A;  1C9H A;  4J4N A;  3KZ7 A;  2DT3 A;  2VCD A;  4ZS6 A;  4ZPV R;  4DZ3 A;  3ARQ A;  2MPH A;  5B8I C;  1W9U A;  1K9T A;  2XP5 A;  2ZQS A;  3O5L A;  2PV3 A;  1NSG A;  4DWS A;  4XAK A;  2RUQ A;  4MPK A;  4Z2G A;  5DIT A;  4LAV A;  3CZ8 A;  5HKG A;  3VAW A;  3B8S A;  4DRQ A;  4U86 A;  4JFJ A;  3UQI A;  1J4R A;  1QPF A;  1FKK A;  1LG1 A;  2LJ4 A;  2KFW A;  4ITZ A;  2DT2 A;  2MLX A;  3CGN A;  3KAC A;  4IT4 A;  1FKD A;  2WK2 A;  4IT6 A;  1FKI A;  3O5M A;  4TYO A;  4WK9 A;  3AS3 A;  3WD4 A;  4KQZ A;  1YW5 A;  2MNT A;  2F21 A;  2M1I A;  3WH0 A;  1E15 A;  1FKG A;  3ARR A;  4MSP A;  1E6N A;  3O5J A;  4S3J A;  1P5Q A;  3KAD A;  2ZQV A;  1T11 A;  4DWS C;  5GQB A;  3ALF A;  3WIJ A;  4AY1 A;  4TW8 A;  4GIV A;  3RM8 A;  2A3C A;  3OOB A;  1LG2 A;  4U85 A;  1E9L A;  3W4R A;  4ODN A;  5J6E A;  1EIB A;  2N87 A;  3PRA A;  4LGX A;  4Z2K A;  3NTP A;  1F8A B;  1FKB A;  1W1P A;  3B9E A;  2G41 A;  2YBT A;  3CH9 A;  2ZQT A;  1NWU A;  3G6L A;  4ML4 A;  1FKJ A;  2ZR6 A;  1B6C A;  1LL7 A;  4URI A;  5HWB A;  1HKI A;  3NRK A;  1QPL A;  1LL4 A;  2LKN A;  5DEZ A;  3G6M A;  3CHE A;  2DSZ A;  3WL1 A;  4P8X A;  1SR0 A;  3UQA A;  1EYM A;  1Q6H A;  2G8Z A;  4TW7 A;  1JNT A;  3AS0 A;  2DSU A;  3WD1 A;  3O5O A;  2OFN A;  1OWQ A;  5HTG A;  4LAY A;  3O5Q A;  3WD2 A;  1PIN A;  2MLY A;  4DRK A;  2IF4 A;  2A3B A;  1ZU8 A;  4Z2L A;  2XPB A;  3KAF A;  4QT3 A;  5DIV A;  3AS2 A;  3B7X A;  4C02 B;  5D75 A;  1E6Z A;  3GPK A;  3ODK A;  1W9V A;  3ARS A;  4ODK A;  4W9P A;  2FAP A;  1A7X A;  1PBK A;  1JND A;  2RUR A;  1R9H A;  4G2P A;  1FKT A;  2D9F A;  2ITK A;  1NWR A;  3JYM A;  1ITX A;  5HUA A;  4S3K A;  5HT1 A;  4FAP A;  5HW7 A;  3RME A;  1BL4 A;  1ZL1 A;  1KFW A;  1UR8 A;  2WLZ A;  4DWS D;  1TCO C;  1OGG A;  1ZCN A;  1QZ2 A;  3IHZ A;  2FKE A;  3FY1 A;  2O92 A;  2M2A A;  2KE0 A;  1XHG A;  3PR9 A;  1X6N A;  1FFQ A;  5HBF A;  3LUO A;  1KT1 A;  1J6Y A;  4U84 A;  2MLZ A;  2RUD A;  4LAW A;  5BXJ A;  3JYJ A;  4W9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...