4WKAA

Crystal structure of human chitotriosidase-1 catalytic domain at 0.95 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
369
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
total genus 132
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkaA01
2WWDA 3W24A 3B8SA 4U3AA 4AD2A 3WDPP 3PZNA 3KE0A 3A3HA 1CXKA 4MB5A 5A94A 2WCAA 2XFFA 3AXXA 4PMOA 2BY1A 2X0YA 2CETA 1JDDA 4IPNB 1TCMA 1GQLA 3AHYA 5FOOA 3IJ7A 5FL1A 2WAGA 1BTCA 4KH2A 2XVPA 4JKMA 1DTUA 4FLSA 2BVTA 3WD0A 5D8ZA 1HKJA 2ZUUA 3TTQA 2XM1A 1DWFM 5BXRA 1HJWA 2WYSA 3BCFA 4JCMA 3ARVA 1UR2A 3BMWA 2WWCA 1JZ6A 1WZKA 3EDEA 1NP2A 4HZ8A 4QAWA 1BGGA 2WB5A 3CMJA 3BGAA 1K9EA 4UQCA 1E6NA 3AJ7A 7A3HA 3RCNA 3RJXA 1UKOA 3IJ8A 4BS0A 2V5CA 3PTMA 1FP8A 1W9BM 2VRKA 1GUVA 2MANA 5GPRA 1ZS2A 1DWJM 4Y7EA 3UCQA 2YL8A 3SCSA 3IAQA 4AW7A 1UA7A 3MMDA 3AHZA 1KBBA 2DH2A 3GZAA 2OWWA 4UOZA 1GW1A 4JL2A 2DGAA 1IZKA 1E73M 2J75A 3KL0A 1CIUA 1B0IA 4XX6A 2DT2A 2PBOA 1QW9A 2OSWA 1KGUA 1XD0A 4J7RA 3HN3A 3VDCA 3PZGA 2E9BA 2DSKA 1M03A 1CLXA 4AD3A 3M07A 1LQ0A 3N1AA 4AC1X 1HL8A 1GOMA 2EXOA 4V27A 4W85A 3TOPA 4YN5A 2G41A 5KEZA 2YBTA 2AMGA 1DWIM 4ATWA 2DPEA 4UFKA 1EQCA 1HF6A 1UD2A 4DWSC 3F5LA 3AISA 1CWYA 4CD5A 1W3JA 1UHVA 3WDRA 1W2PA 1V08A 4AY1A 1NOWA 4W8LA 2W63A 4PTWA 5A6MA 3WF2A 2XJ7A 2D20A 3AIRA 4M81A 2ZIDA 4KGJA 4WSJA 1M53A 4DUWA 1Q6DA 5E70A 3VIGA 3WMSA 1TE1A 2NT1A 3JUGA 5LA0A 1VEOA 2J7EA 4GO9A 3ECQA 1KGWA 1R7OA 4F66A 2V5DA 1CEOA 4QCEA 4W93A 4ACYA 1HKIA 3N12A 3W28A 4D71A 2C8NA 1K9TA 1OINA 4B3KA 4DUVA 1VFFA 4AIOA 4GZJA 2E3ZA 2WSPA 3VIJA 5M17A 1E0WA 4D6FA 2X1IA 3VKKA 4PMRA 3AHXA 4A3YA 5M03A 1ISXA 3ARSA 3U7BA 2VT0A 7CGTA 4PUEA 4F79A 3WN6A 1WB0A 5BXTA 2WHKA 4CN4A 3KL5A 2J8GA 4E2OA 4UQ9A 1OSEA 4KWUA 4HP5A 1MW2A 4TVDA 4UOQA 1J12A 4P7RA 1BYBA 2WCGA 4BA0A 1QOXA 1E5NA 2E4TA 4OUEA 4PEEA 5BXSA 1KR1A 2J4GA 2F61A 3VGFA 1MFVA 3AHVA 3CUHA 1SMDA 3WEOA 2OSYA 3CHCA 1V0LA 2D0HA 3BAXA 4N0RA 1YHTA 4ATDA 5HPOA 2A3HA 1XCWA 4MAZA 5A6LA 1B3WA 1F4AA 1B3XA 1R7AA 4D6IA 2CNCA 3FAWA 2BY0A 3L4VA 3B9EA 1VRXA 4EKJA 3ZJ8A 5CQ1A 3VMOA 7TAAA 4BQ3A 3ZOAA 3W29A 1CDGA 3SCNA 1E1EA 1OIMA 5D9MA 2YBUA 1E15A 3N15A 3MS8A 2W92A 1JFXA 5CGMA 1Y7VA 2DEPA 4PMQA 2XUCA 1KCKA 1UZ1A 2RGMA 2IXUA 3VX0A 1KWGA 1UKPA 1OD0A 3HU7A 3MO4A 3VX1A 5A2AA 4LPCA 3A6OA 4FF5A 5E0CA 1Q6GA 4OOZA 4PTMA 1J01A 2E40A 2UY5A 1V6UA 3WFZA 2W61A 4AIUA 2BHUA 3TTSA 3SCWA 5I77A 4BQ5A 3WNMA 1H0GA 1UD8A 4AIEA 1HVQA 4BQ4A 4KGLA 2W91A 3SUVA 3B9AA 3PZQA 1GJWA 4U2YA 1U30A 3SCPA 3AIWA 5A6SA 2VRQA 2WK2A 2O9RA 2NW0A 1MQQA 1E4LA 2O92A 4JHOA 2UY3A 1E6ZA 1M04A 3OLDA 4WKAA 2J7BA 4R27A 3G6MA 1WP6A 1DWGM 4QFUA 3UG3A 1NQ6A 6TAAA 3CMGA 3IK2A 5A8QA 3TA9A 2ZX8A 1WZMA 1K9DA 5LA2A 2D1ZA 1E6XM 4P8WA 1DP0A 1PX4A 3EYPA 8A3HA 5A2CA 4L4OA 1W1VA 3OBAA 1CZ1A 1V0KA 3VOCA 1H0IA 1UWIA 2YA0A 3NDZA 1HJXA 3WELA 1TFVA 1PEZA 2AOSA 4GKLA 3ALGA 3OLEA 3VDHA 2FH6A 3ZT6A 4UQDA 3RPMA 4U3CA 5IFPA 5LYRA 5ABFB 2PWFA 2YLAA 2D23A 2PC8A 3ZR5A 3BAKA 5FCZA 3LPOA 1BG9A 2VZTA 2JF7A 3FXYA 3WQ6A 1ODZA 1UQYA 3WMCA 1E6SM 1KFWA 1E4MM 2EPMX 1UWSA 2A3BA 1H1NA 4ML4A 1PJ9A 3FN9A 2Y8VA 3K8KA 5ECUA 4H04A 1BYDA 1KQYA 1MW0A 1UOKA 4UTFA 2ZX6A 5I5RA 4OOUA 4HPHA 2OWXA 1LL6A 1B9ZA 3CPUA 4H8VA 1G0CA 1FFRA 2E8YA 1QNSA 2YLLA 3ZSTA 1DHKA 4PMYA 4W7WA 3LMYA 5CG0A 1UH3A 4JAWA 4HOXA 3GXMA 4TVUA 3W38A 2XSBA 1B3YA 1C7TA 4U2ZA 3VILA 2XG9A 3K4DA 1ITCA 1JF6A 1ZJAA 2WMFA 1TVNA 3L4XA 3MUIA 1GORA 3WENA 1BHGA 2ZICA 3UETA 2WHJA 5D9NA 1PX3A 5D4YA 3T0DA 3AMLA 1ZL1A 3J7HA 3ARQA 3DYMA 3VPLA 2ZOXA 3ARZA 3TTOA 3GXDA 2G3MA 1JZ8A 1UR9A 5JBFA 2VZOA 1OM0A 2BY3A 1LG2A 3WL1A 4TX8A 1OCQA 1X6LA 3NIYA 3LPGA 5FKYA 5CSUA 1CXHA 5CJ5A 1GOKA 2J78A 4ZE5A 2J74A 1NM9A 2VVNA 2G3IA 2DT3A 1I1XA 1JI2A 3ZMRA 4MNLA 1TUXA 2XFYA 1XH0A 2YIHA 4W88A 5IHSA 5ABHA 2XIIA 3QHMA 4EAMA 1SYTA 2CKRA 1QW8A 1CTNA 1LL7A 1DEDA 3AS1A 1X1NA 2HISA 1J0ZA 2EBNA 3KL3A 2CBJA 3AICA 1RP9A 3WDHA 3AYRA 3AROA 3NDYA 2A3EA 3O9NA 4GIAA 1QNPA 2XWDA 1J0IA 1TA3B 1JXJA 3APGA 3PZVA 4S3KA 4J3SA 4PYSA 1QNOA 4CD4A 2WHMA 2J79A 1UWQA 1UD3A 1OIFA 4GZIA 1JNDA 3ZJ6A 1VAHA 4KRUA 1WZAA 2YL5A 1JZ3A 2VX4A 1WCGA 1OT1A 1AQ0A 3SIMA 4EE9A 1OD8A 4AZGA 2YL6A 1KXTA 4MADA 3ZJ7A 4D6CA 3GDBA 1EXPA 3EMCA 1ZB5A 1V02A 2VCBA 3NJ3A 4GINA 1US2A 5CPSA 4NSBA 1H11A 1NARA 3F5JA 3GTNA 2VX7A 1Q4NX 1NWSA 4MB1A 2BXYA 3RILA 4CGTA 2A3AA 3CO4A 4WK9A 4D6DA 1JYWA 3AHTA 2VZVA 1ZJBA 2XGBA 2GK1B 1MXGA 1Z32X 2PB1A 3AIBA 5CXPA 3GBEA 3GH4A 5AC4A 3KZSA 3ARWA 1GQIA 4F8XA 1L0PA 2DH3A 3GM8A 1EDGA 4JKKA 2CXGA 4D72A 5EBAA 1J0YA 1NOUA 3W37A 5M3WA 4TOQA 1EIBA 1RH9A 1HIZA 1HJQA 1KBKA 1OWQA 5DEZA 1MXDA 2CKSA 4GZEA 4BCEA 4P8UA 2Y5EA 4TTUA 3RM8A 1JFHA 4FLRA 2VURA 4CCCA 3WDIA 2X8RA 1HJVA 1HJSA 3T2QA 3OLIA 1VF8A 1CYGA 4HA4A 1N82A 3AIUA 2G4FA 3THDA 3PTKA 2CEQA 4U5IA 4OKDA 1ODUA 2WMHA 4JHZA 3RDKA 1WDSA 2QV4A 1YQ2A 4QCFA 4JKLA 2VR4A 1GHSA 3OLGA 3AIEA 4AD1A 2YKKA 3AS3A 3LPPA 2PBGA 5HBFA 1UKTA 4LYQA 2D0FA 6A3HA 4MB3A 2XGIA 3UR7A 1WPCA 3BAIA 3L2MA 1BF2A 3WD4A 5JH8A 1QI2A 4Z2HA 1TR1A 1MWOA 3F5KA 1G9HA 2JALA 4UNIA 2Q8XA 1SR0A 1W3KA 1QBBA 3PZMA 3TTYA 5I2UA 1UUQA 1MQPA 3BAJA 5GQBA 1XSKA 2CHOA 4TVCA 3MUAA 3OGRA 3KWXA 4YPJA 4C7DA 1WNOA 2WLZA 3VIHA 1E6PA 1RPKA 3W53A 1H2JA 3A47A 2VZUA 4DWSA 4CU6A 5E6YA 1EO7A 4FMVA 2GSJA 1CXIA 4PMZA 4F9JA 3VMPA 2UY2A 3VM5A 1J18A 2OSXA 4CKQA 2EPKX 3VNZA 3WH7A 1XCXA 5CLTA 3ZSSA 4JCLA 2GJPA 1G5AA 2UY4A 4J28A 1LF1A 2Y4SA 3OA5A 2W4XA 3WUBA 1R85A 3VUPA 3CUFA 6CGTA 3UG4A 5HOSA 5JIPA 2FDMA 1W9UA 1UR4A 3AIQA 1XD1A 4AZHA 1G01A 3ZO9A 3GNOA 2WZHA 1WKYA 1O7AA 1AVAA 1HJUA 1PAMA 3KEHA 1JZ7A 1OGBA 1JL8A 2WKLA 1GVYA 1W9DM 3NUKA 4MNJA 4A4AA 2YDRA 2J8FA 2EPLX 3S2CA 4PTXA 1Q6CA 2RGLA 1QPKA 2XPKA 4PTVA 4OBRA 3MUZ1 3L4TA 5C8BB 2WANA 2JFEX 4X9YA 3VIIA 1I1WA 1V6VA 1MW1A 4P8VA 1E40A 5DT5A 3K8MA 3UESA 3POHA 3VNYA 4URIA 3T0BA 1EGZA 1KCLA 1C93A 4M56A 2WC3A 1B90A 1WDPA 2EPNA 2WXDM 1J9YA 3AFBA 4QLKA 2WCSA 4XUYA 2W62A 5A6KA 2JEPA 1ZBCA 4Q7NA 1NOFA 4J3WA 1UWRA 3WNNA 4WKFA 3GBDA 2YOCA 1IV8A 2V3DA 2WZIA 1CLVA 4W7VA 3WMBA 3ZQ9A 4BF7A 3AMKA 1NP0A 5DF0A 1I75A 2WVUA 1US3A 4HOZA 5IHRA 2IXVA 1OGSA 3D3AA 5ABEA 2WZEA 2WHLA 1R86A 3EBVA 1VEMA 4IISA 2V38A 1KXQA 1D2KA 2Y8KA 4UZUA 1D3CA 1AMYA 1WZLA 1C92A 5JUVA 4J3XA 2WC4A 5A8NA 4W5ZA 1R87A 2VJXA 3VD4A 1W9VA 3N9KA 1XSJA 5FL0A 3PZIA 3VIKA 3I3DA 3T09A 3L2LA 4P7NA 3FY1A 2PF0A 3QGVA 1UR1A 3M6DA 3T2OA 4WSKA 3U5YA 1IT0A 4XZWA 1FFQA 1EH9A 2GDVA 2Y2WA 1VIWA 3DYOA 1E1FA 3IANA 4WKHA 4UFLA 3WNKA 1H09A 4FLOA 2D3LA 5DO8A 5DT7A 4GXPA 1B2YA 2J7CA 3W6MA 3ARTA 1GNXA 2FGLA 3A4WA 4U33A 4AZCB 2F8QA 2Z1KA 2DDXA 4AZBA 3UERA 4EK7A 2FHCA 1W91A 1PZ2A 3WFLA 3SUSA 1D7FA 1CPUA 2X05A 2YA2A 4ZENA 1UKSA 1E5JA 3QR3A 1JNEA 2E0PA 2WVVB 2VQTA 3WF1A 4ATLA 1GHRA 1C3FA 2A3CA 1JDAA 2QPUA 4PBGA 3VGEA 3WNPA 4D6HA 2FHBA 4FK9A 1ECEA 2X09A 2DIEA 5HDRA 2QLYA 3ARRA 1UWUA 2CHNA 1JAEA 5EB8A 3OIHA 3MU7A 4NZCA 1KXHA 3AMDA 3WDQA 2XFRA 3WQWA 2J7GA 3MSGA 3WQVA 2VC9A 1XH1A 1ISVA 2NSXA 3AZTA 3BMVA 3W6LA 1MFUA 2JIWA 2BVYA 2QPSA 5BROA 1U33A 2VZSA 2ZUTA 2EO7A 2ZWYA 1W1PA 2BHZA 4WLCA 4KRTA 1UQZA 1C7SA 2WMIA 4W5UA 2WVSA 2YJQA 4TX6A 2D3NA 3WF4A 3ZT7A 1BGAA 4PCSA 3F4VA 1OT2A 3PTQA 1W9PA 2W66A 2VNCA 4UQAA 4CVWA 1ITXA 4OIFA 2CESA 1Q6EA 1GPFA 3VM7A 2WMGA 2PI6A 1G94A 5D9PA 1UZ4A 2FHFA 3FHQA 1VEPA 2FGZA 4TUFA 4V28A 1B31A 1L8NA 3WUEA 1SMAA 2DT0A 2QMKA 1PIGA 1EDTA 3OZPA 1AQMA 3T0AA 2DT1A 5BRQA 1OGGA 3D5HA 2EQDA 1V3JA 1QVBA 4UZSA 3VTRA 1ZU8A 3RJYA 1CXEA 4J3TA 3A4XA 4B9ZA 1B1YA 2XVNA 1PZ3A 3GYCA 5AY7A 2OYKA 2OWCA 2VO5A 3WKZA 2XWEA 3VDBA 4HMEA 4GQRA 3CUGA 3WSUA 3SCOA 3VO0A 5IDIA 3WNLA 1QI4A 3CZLA 2VCCA 3BH4A 4E8CA 3GH5A 1E3ZA 3VIPA 3BXWA 1M01A 3O2LA 3WBEA 4NRRA 5E9AA 2JE8A 2J7HA 1H41A 1K6AA 4ACZA 3W0KA 4PSRA 1V02E 2JEQA 3N17A 1W1YA 1E56A 5BWFA 3ARYA 3VGBA 3WF0A 4QLLA 3G6LA 5M5DA 3RM4A 1FH8A 4OBSA 3WH5A 4UFHA 4AEFA 1BVZA 1EA9C 3AXHA 5E09A 4CCDA 1JGIA 5I6SA 2BVDA 5CZKA 2WKGA 3WD1A 2PWHA 3W27A 5AC5A 1WE5A 3FW6A 1CBGA 4BZYA 1LG1A 2F2HA 2VR5A 2PWEA 1FH7A 1MW3A 5ABFA 3QHOA 4AZIA 3RO8A 4JFTA 5BXPA 4JFSA 3WUGA 1MYRA 1V3KA 3UEQA 1FP9A 4AZ5A 3U7VA 1V03A 3NYDA 3WD2A 3VIFA 4B16A 1J0KA 4MTVA 4M80A 4HOWA 5GNXA 4M29A 1FHLA 1FHDA 5C70A 3WQ4A 4GI9A 3MKKA 2OYMA 3CTTA 4RE2A 3S6TA 5JIWA 1W2VA 2WC7A 4H2CA 1VJZA 3GXIA 4HU0A 1SFSA 1ZBVA 4EANA 3AZSA 1WO2A 4R5EA 4JL1A 3SCTA 2ZWZA 1WDQA 4F9DA 3ARPA 1EQPA 1WDRA 4B9YA 4ZEPA 2V3EA 4GQQA 1E4IA 1TZ7A 3VGGA 1JZ2A 1KGXA 1M7XA 3POCA 3UG5A 3K1DA 4HA1A 3NSMA 4MDPA 2FH8A 2Y24A 3CZGA 3OGVA 3BSGA 3E1F1 4P7QA 1EOMA 1KXVA 4ACZB 2OYLA 4PMXA 4AWEA 1UD6A 3W26A 4PN2A 1BSIA 4HMDA 3IJ9A 3CZEA 1GOOA 2XVKA 3N11A 1ISWA 1NH6A 4PUDA 4M82A 4UQEA 5I3DA 3K46A 5C71A 1W3LA 1B3VA 4LQ1A 1HP4A 2Z1SA 3N04A 2XIBA 1CECA 2ZXAA 3HMCA 3M7SA 1XRVA 5CSYA 4NF7A 2BY2A 3DECA 1HX0A 3NCOA 3ARUA 3BLKA 2QMJA 3NSXA 2D2OA 3U57A 3BC9A 5A6BD 1NWUA 1E72M 1LWHA 4D6EA 3VD7A 3AS0A 1J11A 1E4NA 1OB0A 1ZBKA 2CBVA 1A3HA 1UKQA 3WQ5A 4YHGA 3VVGA 1HP5A 2GFTA 1KR0A 3QHNA 4W86A 5F7UA 2DSUA 2YDSA 1XYFA 3WD3A 1CGVA 4U31A 5A6AA 1JYVA 1ESWA 4W7UA 4IM4A 3SUTA 5I0DA 4CCEA 3MSDA 3VD5A 2DSVA 2ZX9A 5GNZA 1H49A 1VB9A 1QHOA 2XYLA 2WMIB 4WJXA 4V2XA 3EDKA 1IZJA 2E8ZA 3WQ8A 5KZ6A 4MNMA 3MV11 1S46A 1NWTA 4UOJA 2WPGA 1QHZA 3VIOA 2GJRA 3QOMA 1F4HA 1OBAA 1XHGA 3AS2A 3L4WA 2PWDA 4Z2LA 4WF7A 4MJ2A 1V0MA 4CN6A 3MANA 1U2YA 3WNOA 3BAWA 3THCA 1UD4A 2G3JA 2WNWA 2WBKA 1GQKA 1GONA 4PMNA 4Z2KA 2VUYA 1GJUA 3CZ8A 1E3XA 3SCUA 5CGTA 1HKKA 2XHYA 4AZ7A 1A47A 1QI3A 1UYQA 2WM0A 1E0VA 5E6ZA 5A1AA 4HPGA 4HZ6A 1HNYA 2CYGA 3FNDA 2X0HA 1V3IA 1VFOA 3WF3A 3WEZA 2DSZA 4XZBA 4H41A 4CVUA 5A8OA 4Z2GA 1BPLB 2WSKA 2BNJA 1UWTA 3OGSA 1FOBA 2VRJA 4L4PA 5ABGA 2JF6A 1J0HA 1TVPA 3PHAA 4AZ6A 4S3JA 1VFUA 1O6IA 2BV9A 5BYWA 5A6JA 5FD0A 1E6RA 4CUCA 1E71M 2ZXBA 3AYSA 4OJYA 3UR8A 1UR0A 1PX8A 5D8WA 3CH9A 3BCDA 3AI0A 3ZIZA 1BQCA 2GK1A 4PRWA 3PBGA 4PMDA 3CHEA 2J62A 3GNRA 1JG9A 2WW5A 1QBAA 2W5FA 1ZBWA 3DYPA 1EDQA 3PZOA 1GZJA 4QP0A 2XVGA 1GVIA 3CIVA 1C8XA 1GQJA 2ZX7A 5GNYA 5I23A 1XV8A 4MJ4A 3CUJA 4AZCA 4MPKA 1CGUA 3O6AA 1P6WA 5CPQA 4W8BA 1C8YA 2OLHA 4GO8A 4YHEA 3T08A 3VD9A 5I78A 1W1TA 4ZE4A 1HT6A 4AXNA 5I24A 2V3FA 2GDUA 1E43A 4RL3A 1HL9A 1CNVA 2GUYA 1UH2A 2CBUA 3VD3A 2VCAA 1V6WA 2VL4A 2TAAA 1V3HA 2ZUVA 4NI3A 1TG7A 1W32A 4RE3A 3ALFA 2W67A 1HN1A 4CN1A 4MDOA 4HMCA 3SUUA 3WH9A 3WIJA 2E9LA 4UQBA 4AD0A 3DHPA 3AXIA 4E4PA 1QNRA 1JF5A 2EJ1A 3VINA 3B9DA 1BG4A 3W4RA 3VGDA 4J27A 3M46A 5EMYA 1CXLA 1E55A 3RMEA 1BVNP 2YDQA 1DWHM 3VGHA 3GNPA 5AYIA 5CPTA 1BFNA 2CIPA 4GI6A 3WL0A 3GXFA 4IUGA 3FAXA 3NSNA 5LA1A 1EO5A 2B31A 1UA3A 3CBWA 5HXMA 3BSHA 5DMYA 1QI0A 5A69A 3SCRA 4D1IA 5HPCA 1W9XA 3OB8A 2DQXA 3MV01 1CXFA 2G3NA 3EMZA 3CZKA 2J77A 4DM1A 3N18A 4UCFA 1CGXA 1HXJA 1H4PA 1VENA 4W89A 1J0JA 3W25A 2ZUMA 2NT0A 3SCQA 4OZOA 4LXFA 2CITA 4CD8A 3AMCA 3CGTA 2VVSA 4MNKA 1MVYA 2E9MA 2XSAA 3WDJA 4AD4A 3QOKA 2BS9A 4B15A 2J7DA 3GH7A 1QI5A 2ZUNA 3FHAA 1V0NA 5IFTA 2GVYA 3W81A 2JIEA 4MAVA 2VOTA 4HA3A 1LLOA 3ZT5A 9CGTA 3PZUA 1UH4A 1UR8A 1XH2A 2QHAA 4K68A 2VX6A 4W8AA 2ZX5A 1GOIA 2AAAA 3WY1A 1PBGA 4W87A 1UG6A 4HTYA 3PZTA 4JFVA 2PWGA 4N42A 5HNNA 2BFGA 4B3LA 2VTFA 1VBUA 3WH8A 2CBIA 5E0FA 3VU2A 3SURA 2J7FA 4CD7A 1RD6A 4JZ5A 5EFFA 1JAKA 5CLWA 1JDCA 4HZ7A 2GJXB 3AZRA 3K4AA 3AQUA 4ZXOA 3BLPX 3W82A 2X2YA 3AOFA 1QHPA 3PZ9A 4M1RA 1XYZA 5A3HA 3SUWA 5JBEA 1B30A 4RE4A 1H5VA 4UFIA 3CZJA 4HU8A 4Z2IA 4GPNA 1E9LA 3L4UA 5BCAA 3WEMA 3I3EA 4H7VA 1KB3A 1E6QM 1GOWA 2WMKA 3VMNA 3N13A 4LYRA 4AD5A 2O9PA 3CHFA 2BHYA 1R8LA 1ISZA 1NWRA 3CLWA 4D1JA 2EEXA 3ZM8A 2YL9A 1FH9A 4QDMA 3MUY1 3SCVA 3L4YA 4M8UA 1JD7A 1BAGA 1RP8A 1ISYA 1B3ZA 1VBRA 1LL4A 1JD9A 1JYNA 3WUFA 4BQ2A 1MQRA 4PMVA 1X6NA 5D9OA 4JFUA 4KMQA 4P7LA 2XVLA 1JI1A 4QLJA 3DHUA 5DFAA 4MB4A 5AYBA 5I79A 2VX5A 4JFWA 4TTGA 4U5KA 4DWSD 4PMUA 4X0NA 3LPFA 1VFMA 3RIKA 4AEEA 2HVMA 1JZ5A 1TMQA 3EDDA 4GI8A 5BRPA 3CUIA 4XV0A 5FIPA 4DWSB 4ZFMA 3EDJA 1J10A 1QNQA 4C7GA 2D22A 3HJEA 1C91A 5A8PA 5TD4A 4D6JA 4W84A 3VIMA 1LJYA 2CERA 4NRSA 2VI0A 2ZUSA 1CGYA 2XTKA 1GOQA 1KQZA 4LYPA 3RM9A 2WVTA 1G1YA 1PIFA 3PN8A 2WMJA 1CGWA 3I3BA 5EFDA 3ZJKA 1FA2A 4XB3A 4H8UA 2IUZA 2D24A 3OZOA 3SEPA 1JYXA 4ZXLA 3ARXA 1GCYA 3MMWA 2VMFA 1H3GA 2ZUWA 4A3HA 5IXEA 1KWKA 3DC0A 3II1A 4TXEA 2VQUA 4JIEA 2ZXDA 5A6BA 1UD5A 1JXKA 3ZR6A 1Q6FA 2XM2A 1V3MA 3U5UA 1EHNA 4D6GA 1E0XA 2ESCA 1LWJA 1TA3A 4UFJA 3A4AA 4LX4A 4UFMA 5JBDA 1WAWA 2DIJA 4P8XA 4Q22A 4M24A 4CU8A 2WBGA 1XSIA 3K8LA 1HKMA 4AYSA 1V3LA 4FLQA 3VDAA 3WBAA 3L4ZA 2J47A 2EPOA 3IAPA 4P7OA 1BYCA 4AMCA 1W3HA 2C0HA 2QF8A 4CD6A 4WIWA 4LGXA 2CPUA 2O9OA 4CU7A 2V3GA 8CGTA 5A95A 1C90A 1E70M 2UWFA 3EDFA 4AISA 3MMUA 3TONA 1CENA 4C7FA 4J3VA 1XGZA 3AIVA 1V6XA 2GJXA 4E8DA 2D0GA 2ZXQA 1PPIA 1VJSA 3OG2A 1DWAM 2C7FA 4J3UA 4PSPA 2WVVA 3WH6A 1AQHA 2ZE0A 1BLIA 4PCTA 1EHAA 2WLYA 3AMGA 3TP4A 1CGTA 3EMQA 1EOKA 4H8HA 3T2PA 1JZ4A 4UR9A 4Z2JA 5A8MA 3BAYA 4IPLA 1JIBA 2BXZA 2G8ZA 1C8QA 2DSWA 2J25A 1BYAA 1V6YA 5A2BA 2CCRA 4DM2A 4DUXA 3CHDA 1XC6A 1HVXA 1K9FA 2O9TA 4X0VA 2YA1A
chains in the Genus database with same CATH superfamily
3W24A 3B8SA 3MBFA 4NG3A 3E0VA 2GQ8A 1TV8A 1CXKA 1O4UA 5A94A 2BODX 4A2SA 1QNVA 2WPBA 4FOJA 2CETA 4BJHA 4JYSA 2VHLA 2XVPA 1DTUA 4GZ7A 2BVTA 1YNQA 3LGGA 3U2CA 2XM1A 4ZCWA 2QDDA 1U83A 1HJWA 4A8RA 4KEUA 3MUXA 2FGBA 2YX0A 4J35A 3TW6A 3MT1A 4JN8A 3CMJA 3BGAA 3JZUA 3GK0A 3RJXA 4BS0A 1WDWA 5J5DA 4NI8A 3ABQA 4ZQMA 4F0HA 2X1TA 1FP8A 1QR7A 3U48A 3T0TA 1DWJM 3LOTA 3LDVA 3SCSA 3DKLA 1UA7A 4GMEA 2GGGA 3DFNA 4A6GA 3M0YA 1XIGA 1CI1A 4C6OA 4HHLA 1QCWA 3TIMA 3T1GA 3UA4A 3TXZA 4POCA 1R3YA 3M47A 1I2OA 2J75A 2DT2A 2XH0A 2P0OA 1QW9A 2OSWA 2IKJA 2ZZ7A 4JIPA 1A3XA 3PZGA 1SU5A 5C0QA 3ONBA 4JTSA 1C29A 4QG8A 3UPBA 2IS7A 3DZ1A 3M07A 4AC1X 5EKYA 3WQFA 4V27A 5KEZA 4Z17A 3E49A 2AMGA 1DWIM 1X96A 2DPEA 3O1NA 3M5XA 1HF6A 3QBUA 4CD5A 2OU4A 4NKCA 4CEXC 3KLKA 3ZWTA 1MUWA 3CTLA 4PTWA 1NF0A 1HTIA 2D20A 4WSJA 3LG3A 3L66A 3MZ2A 4B5SA 1R7OA 3NO1A 1CEOA 4QCEA 2WQDA 4AIOA 3S5OA 2ZQVA 3C3NA 5M17A 4XD3A 4D6FA 1T41A 5I3FA 2Q8ZA 2PA6A 2A2IA 2XP6A 2Q09A 4RZ5A 3U7BA 7CGTA 1WB0A 2WHKA 4CNUA 5J5RA 2PGWA 2X40A 3B8UA 4E2OA 5AHMA 2FTYA 4LUJA 4JIRA 4NNBA 4UOQA 3LCGA 4L9XA 2PGRA 1BYBA 1E5NA 2E4TA 4OUEA 3R0DA 1QPLA 1MFVA 4PC8A 4DZ2A 1SR9A 1SMDA 3TW7A 2OSYA 5DX7A 4DXVA 1NMVA 2ISFA 3SQLA 4ERAA 2Q3OA 4L9YA 4N0RA 3CV1A 1BVWA 1YHTA 3DDMA 1Y5WA 5AOUA 3M16A 3STEA 3MP3A 2Z28A 1O5RA 2A3HA 2O0TA 4MAZA 1FCQA 1LM1A 5A6LA 4ODPA 3GIYA 1F6KA 4JFLA 4D6IA 2CNCA 3BJFA 2NUWA 3L4VA 4NL1A 4DPQA 3VMOA 1RY8A 4GVHA 4A8IA 3QLLA 4XO6A 2QZRA 4GYJA 2PFHA 3NI6A 2PPOA 5TNVA 1CDGA 4LS1A 3W73A 5HQMA 1KW1A 5AN7A 1ZCNA 1E15A 1K77A 4GWEA 3MS8A 2W92A 2O7QA 3LN3A 2P88A 4PMQA 3NQGA 2VDIA 4FAPA 1TWZA 3EWBX 4FO4A 3IKDA 5BOEA 3TR2A 2NWSA 3MO4A 3HU7A 2NQJA 5A2AA 3NEHA 5E0CA 4FF5A 2ISDA 1Q6GA 2BBFA 4PTMA 3GDRA 2H90A 3HV9A 1FWEC 4AIUA 1X7FA 5T9CE 5K9CA 4QEEA 1NMWA 4J5NA 3WNMA 2A6NA 4IHCA 1UD8A 3PANA 4Q32A 1HVQA 1IXOA 1IWPA 4M6VA 4TIMA 1EJ7L 1RALA 3SUVA 4AYGA 4QQUA 2GOUA 1OHLA 3I6RA 3PR2A 1LDCA 4XAGA 5A6SA 1AZ1A 4MZ8A 1XRTA 3GKAA 1EQ3A 3C0JA 5K9XA 4IQ2A 3EPNA 3DBPA 3PM6A 5C9ZA 1XLMA 3G6MA 1A5CA 2HSAA 4QFUA 2GZXA 5KETA 4BEQA 2PURA 3TQKA 1O95A 4GKTA 2Z7GA 1BXBA 1K9DA 1PWLA 4ORIA 3UT0A 2D1ZA 6XIAA 3VNMA 1UR3M 3CAVA 3V16A 4KCVA 2Y8UA 1GYLA 1CZ1A 4YCPA 4OTKA 4K7VA 4DN1A 5I3HA 3ITLA 1UMYA 4L64A 4CNTA 3VOCA 4QJ3B 3SFKA 2FZMA 4HU4A 1C9HA 1TV3A 3K4WA 3M0VA 1UWIA 1JDFA 3EOLA 3NDZA 1L6WA 3WELA 4XBKA 2AOSA 2PDBA 4NZFA 2OOGA 3OLEA 4C6KA 5HW8A 4RDYA 1V5XA 5K7JA 5IFPA 4C90A 4I9JA 4Q33A 2PWFA 1ZLPA 3LPOA 7TIMA 1BG9A 3WQ6A 4WJEA 2G97A 4U85A 3O5DA 2CWXA 1S2WA 3CB8A 2VP8A 2RUCA 1E0TA 1AQFA 3WLOA 4JEJA 1V7AA 4GVGA 4F2UA 1VFHA 4O1AA 5LSMA 4J3ZA 5EGRA 1V7YA 4G7FA 2ZX6A 4ZB5A 4O15A 5BNKA 3HTWA 2GJLA 2E8YA 3MCNA 1QNSA 2YLLA 4PMYA 4HYWA 1A5AA 4FN2A 3GXMA 3EA3A 2Z00A 3W38A 1P6BA 3RG6A 3IJIA 1EWEA 3UYCA 1IIHA 4OGZA 2PAJA 2OKTA 1ZJAA 1K03A 2WMFA 1TPH1 3RU6A 1TVNA 5DBUA 1XCFA 3L4XA 1GORA 1DJWA 3BQ5A 3IHZA 3NQ2A 3JYMA 1XKJA 1PX3A 4DLFA 4XBJA 3ARQA 3VPLA 1F9CA 2PDNA 3T4CA 1DV7A 3CIWA 3EOOA 1FWCC 1BD0A 4G8TA 2YCKX 2ZVIA 3WL1A 4TX8A 4IP4A 1A80A 2E5BA 2RJGA 2RURA 1YDYA 3NEVA 2OZ0A 4MPQA 4LCQA 1Z41A 5BOOA 3G1HA 5CJ5A 1ZK6A 1GOKA 2FPVA 3E02A 2VVNA 5FF4A 1XH0A 5HINA 1UOZA 2XIIA 4KWSA 1QW8A 3OVRA 2VC5A 1FXPA 1X1NA 2EBNA 4AX6A 3AICA 4QS6A 3AYRA 3NDYA 3TQ0A 2PDHA 1YKWA 1QNPA 1AUSL 1RR2A 3GRIA 4NJJA 3APGA 5C2CA 4S3KA 3N2TA 1QNOA 3KVKA 4EXBA 1L6YA 1Y5VA 1Q6LA 3ZJ6A 4WD0A 1JDEA 2YL5A 1JZ3A 2OVLA 1GT8A 4EE9A 1MI3A 3B8TA 2P3EA 2G50A 3T4WA 3ZJ7A 3B8VA 1AJ2A 4D6CA 3GDBA 3SSJA 4TU1A 1WKFA 1A5KC 1I8JA 2FLIA 4MWAD 2F9RA 3EMCA 1ZB5A 2VCBA 4DZAA 2OR2A 3NJ3A 1Q65A 1SVDA 1H11A 3O5MA 3UI5A 3O5QA 1XIEA 1XYMA 5EMLA 1KM6A 2ETNA 1Q4NX 1UZDA 4D8ZA 3L0GA 3OG3A 2BXYA 4QNWA 4L4LA 3IRSA 5C9RA 2QXWA 3CO4A 4JTIA 4ZPVR 5G4WA 4GGBA 3QZEA 1VYRA 1G7UA 4BF5A 1ZJBA 1JEZA 1Z32X 3N14A 3CV2A 4UC5A 5CXPA 3TX9A 3GBEA 1H62A 3PBYA 2OLAA 4I5RA 4MY1A 3ARWA 1GQIA 3UF9A 4Q8PA 1EX1A 4JKKA 5FSDC 3BPWA 2YXXA 3NDOA 4OBTA 2V0TA 3HFTA 1KBKA 1H60A 1J2WA 2PTDA 3V18A 2CKSA 3DGBA 4BCEA 1GVOA 5JXQA 4FLRA 1EFZA 2MLYA 1HJSA 1KFEA 3T2QA 1VF8A 3ZLGA 3AIUA 1FWTA 1RBLA 5DLCA 5C9WA 2WMHA 1BXCA 3CL6A 3TYCA 4QCFA 5E93A 3W7RA 1ZCOA 2NVCA 2X2GA 3NPVA 5I3IA 4C6CA 3LXCA 2XIJA 1L2UA 1X38A 3LPPA 4CQ9A 4LYQA 2D0FA 1S2TA 3R7MA 3FA4A 1BF2A 2W3ZA 2VC7A 2OODA 4S3FA 4RR4A 1A4LA 3ZLHA 4RX0A 5LGZA 1SR0A 1TTQA 4CQAA 3KVLA 2PU1A 1G4EA 2ZRUA 1WUFA 1K6WA 2X1RA 3GC4A 3N9RA 5I2UA 3BAJA 4Q8TA 4JTAA 2DZBA 3IJDA 3OGRA 3MW7A 1ZTVA 2WOQA 4IMCA 4F40A 4Y2WA 1RBAA 4YPJA 2ADAA 3GFZA 3EWDA 1OFRA 1RPKA 3A47A 1D7HA 4S2BA 1ALDA 1NSGA 4DWSA 4CU6A 3NPUA 3T78A 2BXVA 3WK3A 2FZNA 3N29A 4QT2A 4KF1A 4PMZA 4F9JA 2UY2A 2OSXA 1F8IA 4XKMA 3WBXA 4UTIA 3GVGA 4HPNA 2EPKX 4HBOA 3WH7A 4X22A 1VP5A 2GJPA 3GQYA 4XZLX 1DJZA 3M7WA 2W4XA 3GIPA 1R85A 3CUFA 4UMAA 5JIPA 3QGAC 4A3UA 3AIQA 1XD1A 4DVOA 4YLWA 3IKGA 1N2VA 3GNOA 5T91A 1WKYA 1O7AA 1O5KA 1JL8A 5BOFA 1A5MC 3L12A 2WKLA 3RO6A 5G1TA 1T8QA 3C52A 3EB3A 3NUKA 4MNJA 3RPDA 4A4AA 3C2FA 4XD5A 3S2CA 3R0UA 1Q6CA 4PTXA 1QPKA 2VOMA 3UVAA 3PVFA 4PTVA 4OBRA 3L4TA 3TJLA 4HPJA 1WA3A 2Q01A 4ZQCA 3DAQA 1YTEA 3R58A 4P8VA 4B2DA 4G50A 1XYCA 3POHA 2VEFA 2XFWA 4RDWA 1ZUAX 3H26A 2H8ZA 2XDFA 2C6QA 3GHUA 3R0KA 2G37A 3ZR4A 2EPNA 1J9YA 2INZA 4QLKA 4XUYA 2AQVA 3GE7A 1JRCA 1UWRA 4WKFA 2YOCA 3NPXA 4PFMA 3S46A 1ME8A 3OBEA 5U4NA 1KTNA 4INFA 1NP0A 3DCPA 3LRMA 1QU4A 2WVUA 2HE5A 1TPC1 2Z0IA 3CEUA 3THUA 3D3AA 4OQVA 3CGNA 2WZEA 3FJNA 3UZYA 3JRKA 1D2KA 4M51A 1C92A 1UBSA 1D8CA 4GX8A 4J3XA 4W5ZA 1R87A 4FALA 2QJJA 3EWUA 2HBVA 1XSJA 5FL0A 3VIKA 3I3DA 4FA3A 4P7NA 3SN4A 4O0ZA 1UR1A 3MDYB 4FXJA 3HG2A 2FMNA 4GYPA 1N7KA 1FFQA 4L9ZA 1FTXA 1EBGA 1E1FA 4NAEB 4FI4A 3WNKA 1H09A 1OYCA 3MDWA 1S5WA 4N2YA 1W1ZA 1A0EA 1CCWB 5TBOA 2J7CA 4DZIA 1TWDA 3ARTA 2FGLA 3A4WA 1QPQA 3NZ1A 2Z1KA 1W17A 2IW0A 3SW6A 3UERA 2FHCA 1W91A 1OABA 3VAVA 2E67A 1LUCA 3APTA 5F4SA 4ADUA 4KEMA 1W26A 2QDEA 4IT4A 1JNEA 2WVVB 4I5UA 3GZ3A 1VZWA 4US6A 2VFGA 3UZJA 4S38A 1GHRA 4O13A 3WNPA 3LHYA 3VGEA 4QNEA 4Y9NA 4XIMA 4FK9A 1XLLA 1UWAA 2X09A 3MWAA 5HDRA 3DFHA 3I4EA 2BP1A 3W6YA 3D46A 3LBOA 2JGQA 3R13A 5EB8A 3OIHA 4NZCA 1KXHA 3WDQA 4HTBA 3P60A 2DJXA 1E51A 2VC9A 1UJQA 2NSXA 3TVAA 4A3RA 3GNDA 2IPWA 1LLZA 3UP8A 5LNRA 4MM1A 5BROA 2ZUTA 4G1NA 3TTEA 1W1PA 1KRMA 4C65A 4WLCA 5AHIA 1K8ZA 3W88A 3GO2A 1C7SA 4MF4A 4LNCA 2IQDA 2YJQA 3ZT7A 1BGAA 1XIMA 4WDTA 2YFOA 3F4VA 3VKCA 1OT2A 1W9PA 4B4FA 3TMLA 1ITXA 4OIFA 4F0RA 4LAXA 3MY9A 5GJMA 1GPFA 3FGCA 4H00A 1A5BA 1P7TB 3ZZ1A 1UZ4A 2FHFA 1VEPA 2NLIA 2RUSA 1SMAA 4DH0A 3UWEA 1AQMA 3T0AA 3D5HA 4O1CA 4XAPA 2B5UB 3RJYA 4IG2B 4LVBA 1PZ3A 3UI6A 1I0DA 2OYKA 2GVGA 2OWCA 1F3EA 1M68A 3W7LA 1OX6A 1A0CA 4FR6A 3GWQA 4KFPA 4HMEA 3SCOA 1A4MA 5K4XA 1QI4A 4EIVA 3R12A 4DELA 1JR1A 2VCCA 3AUOA 3E6EA 4E8CA 3GH5A 1E3ZA 3BXWA 2PE4A 3KCJA 3M0LA 4TV5A 1OX4B 5E9AA 2PDPA 1AODA 1V02E 1U1HA 2H6RA 1EF2A 1W1YA 1E56A 2TYSA 4G1KA 5BW6A 5BWFA 3ARYA 3NWRA 4E38A 4QLLA 3H24A 1CLKA 3N19B 4OBSA 3MHUA 1WOBA 4UFHA 5E09A 3AXHA 4V1XA 4AEOA 2WKGA 3WD1A 3T0CA 4PODA 1WE5A 3TN5A 3FW6A 3WLSA 3Q94A 4I6VA 2I9EA 1FH7A 1MW3A 5ABFA 3QHOA 3RO8A 4JS3A 1R9ZA 1MYRA 1QPOA 1I6NA 1FP9A 4PCPA 3WD2A 3VIFA 4DO6A 2R94A 1J0KA 5C70A 6TIMA 4V15A 2XINA 1SFTA 1H50A 4RE2A 2WV8A 3STPA 4JQ4A 2WC7A 2ZR5A 4LH8A 1VJZA 2FKEA 2I5QA 4TW8A 1EUNA 3B8IA 2DQWA 4CQBA 3SCTA 1VJIA 2ZWZA 4ZQRA 4Q8OA 1WDQA 2XPAA 3ARPA 1WDRA 3LSCA 4IL2A 3TQPA 3LI1A 1NDVA 3VGGA 1JULA 1IIGA 1YW5A 4H9VA 4KFOA 2VCDA 4HA1A 3PFRA 3W02A 4MDPA 3UW6A 4HN8A 4P7QA 3B0XA 1RV8A 1EJTC 2PN0A 4RUBA 2OYLA 3DU0A 4PMXA 4AWEA 4IT6A 3GU1A 3W26A 5G4HC 1T11A 5MF5A 4RDZA 3BVJA 3GU2A 3N11A 3K1GA 1I2RA 3QFEA 4PUDA 3WQOA 4UQEA 2HNHA 3FYYA 2RDXA 4GY7A 3HZ3A 3M7SA 1YDOA 3DECA 1I2NA 3E74A 4ECLA 3BC9A 1PVNA 2PWUA 2PUZA 2TRSA 1E72M 1K8XA 4Q4MA 2WNZA 4D6EA 2XN2A 2QPXA 4MZ1A 1I2PA 3QC3A 3OJGA 2CBVA 3ANVA 3LD5A 3FK4A 5FEXA 1KR0A 1OG6A 1XQLA 3QHNA 4QRNA 3TN6A 3RX3A 3UGRA 2D2GA 1ESWA 4JTLA 3VD5A 4QJ5B 2Z6IA 4QSHA 3UBPC 2ZX9A 4HD5A 2EAWA 4C1NB 3UQBA 1OFPA 2VGBA 1TWWA 5JVLA 1HKWA 4HNCA 4DBDA 3QZAA 1S46A 3LXBA 2WPGA 1VQTA 3VIOA 2GJRA 1F4HA 1OBAA 1N8FA 2DY3A 3Q2DA 4Z2LA 2OG9A 1NFBA 3VE7A 3BAWA 1JNSA 5KMYA 3NQEA 3VFLA 3LTSA 3W72A 4BHYA 1FAPA 2V68A 3RLHA 2WNWA 4LWWA 4HJWA 1GQKA 4PBEA 1GONA 1QXLA 1UCWA 4FR1A 4Z2KA 3SCUA 2JK2A 1K3UA 2F23A 1QI3A 2HVOA 2WM0A 3PAJA 2RUDA 4HZ6A 2CYGA 4XK2A 1V3IA 1VFOA 2CW6A 3ZS4A 5A8OA 3TN4A 1H1YA 3P81A 4NX5A 2HVNA 3DHFA 3LTPA 1UWTA 5FAJA 1FOBA 2VRJA 2PMQA 3PHAA 4O1EA 3W7QA 1LZOA 4O16A 1H7WA 5A6JA 3ITVA 2PTYA 5BZAA 3FAPA 4I9MA 4DJDA 3OEXA 3W2JA 2ZC8A 3B04A 3BV4A 4WXYA 2DZWA 4Y6GA 5D8WA 3BCDA 3TDFA 3AI0A 1BQCA 1BQGA 3GPKA 2G4JA 2RUQA 3PBGA 5KITA 4EF9A 3CHEA 1EUAA 3W7NA 1VBJA 4B2DD 4RPQA 4A8LA 3V1PA 1XIDA 3PZOA 1AH4A 1Q3NA 2ALDA 3S6DA 1GVIA 4GUJA 1TQXA 4L1WA 3TFCA 1YE6A 1GQJA 5I23A 4AG0A 1FKLA 1QO2A 4MPKA 4QE5A 1ROUA 1P6WA 1PKNA 5CPQA 3LYEA 4HZMA 3P5ZA 4OV4A 1TX0A 3F1QA 4PB4A 2NQ5A 2F7FA 2F21A 4RL3A 3KZPA 4LANA 1CNVA 3VD3A 2QUTA 1RA0A 1NSJA 2RFGA 3WK0A 1GTHA 4HMCA 3WH9A 2W79A 3W1MA 4CQDA 2VM8A 3GG7A 3K30A 1JF5A 4AC7C 5GVJA 3KBNA 1WXZA 4KPLA 2ACUA 4KWVA 4OFCA 3CL8A 2MNRA 3LHZA 1FWWA 4GI6A 3GXFA 4DO5A 3OHIA 2E6DA 3VNJA 1QI0A 3NQ6A 4MWAA 1W9XA 3OB8A 2DQXA 3CZKA 2J77A 4F2TA 4XKYB 3CLMA 3WX7A 1VENA 3BZJA 3SCQA 2CITA 4CD8A 3AMCA 1LRNA 2YCIX 4MNKA 1P1MA 2E9MA 2Z2AA 2Y85A 4CNPA 3S1UA 4UMBA 4AD4A 3LTYA 2BS9A 4B15A 1K4GA 4EPEC 1QI5A 2GSEA 2PDWA 2VGIA 4EAYA 3JW7A 3HGRA 2JIEA 1J6PA 4HCHA 2V5BA 3QMRA 2Z1BA 2QHAA 2P1FA 1HKVA 2VX6A 1GOIA 3GG0A 3WY1A 1XI3A 4UBPC 1WQ5A 3PZTA 3STCA 1JCMP 5HNNA 1ECQA 1VBUA 5E0FA 3GAYA 3VU2A 2J7FA 4LAVA 4RXGA 1P5QA 2JGYA 1JDCA 1IF2A 2GJXB 4GYPC 4RPPA 1BL4A 1G7VA 1DVJA 3N4FA 2MLZA 4M1RA 2ZTJA 4KETA 3W1UA 4RE4A 1G69A 4E8GA 3PWGA 3K5XA 4Z2IA 4C02B 3GSMA 2HDJA 4A3QA 1HO4A 2EKCA 2A7RA 3WEMA 1SO3A 4H7VA 1TJ1A 2R24A 1KB3A 3OW1A 5I09A 4LNYA 1E6QM 3WLHA 4AUBA 2WMKA 3SFWA 1VYPX 5JMUA 3V3WA 4AD5A 4UR7A 2Z1XA 3CHFA 1W5NA 1ZJHA 1NWRA 4FXRA 3CLWA 3W7HA 2YL9A 2Z1WA 1FKKA 3MUY1 4QDPA 1ISYA 3I4KA 3H70A 4E3VA 1FKWA 4EWJA 2PV1A 4BQ2A 5HTGA 1MQRA 3JXVA 1T5AA 3BOFA 2XVLA 4M7TA 1JI1A 4REQA 1A5LC 3IRDA 4M5PA 5AYBA 1IZCA 2NVAA 4JQ3A 4PTNA 4FS9A 4U5KA 4DWSD 2R8WA 5HAOA 1UIOA 3GB6A 3PUOA 3NA8A 1VFMA 3IIOA 2VEMA 4GI8A 5BRPA 1RXOB 3CUIA 4LBSA 2Q8LA 3SY5A 2BGNE 3NAVA 1W1A1 1T0OA 2D22A 4TMCA 5CG7A 5ECVA 4JN6A 1XLKA 1QK0A 2ON3A 4XSLA 3VIMA 1ME9A 3ES8A 3ITXA 1E44A 3RX4A 3C0SA 1W5PA 2QCDB 3IUDA 5FF3A 2MPHA 4K38A 1PIFA 1Q63A 3C86A 3MI3A 5EFDA 2DP3A 1WX0A 4H8UA 2IUZA 2OEJA 3QQ1A 4L4MA 3SEPA 1JYXA 4ZXLA 3TEVA 3K13A 3L9CA 4PMJA 4W9OA 3FOKA 4A3HA 5IXEA 3II1A 4TXEA 2QEZA 4J4KA 4JIEA 4WHBA 2CWNA 1P0DA 3O5LA 1XC4A 4MIMA 1UD5A 1JXKA 3P2VA 2XM2A 1V3MA 1EHNA 1E0XA 4KCWA 1FDYA 2PP1A 4LB3A 1KM3A 3MKVA 2A79A 1RK6A 2DIJA 1EXBA 2O7SA 4NILA 3M0JA 4GJJA 1J79A 1XGEA 2WBGA 3MYOA 4M1BA 4Z1AA 2VFEA 3MA8A 4UR8A 3MP4A 3TC5A 4H6RA 3EKZA 4P7OA 4HK6A 3S83A 2P4VA 2YW3A 4LGXA 5CC5A 2MF9A 2QS8A 1MZRA 3ISIX 4BK9A 2UWFA 1TELA 3VKJA 2OCZA 2PRLA 4C7FA 1XGZA 3AIVA 2GJXA 2D0GA 3TE9A 3OG2A 4JEQA 3TW9A 4IIEA 2WVVA 1U5HA 1UZHA 2QCEA 3KOZA 2Y5SA 4ZL1A 1OZQA 4ICCX 1EHAA 3NNTA 2WNNA 1EYWA 1CGTA 4H8HA 4MVAA 1S2AA 2KI3A 1JZ4A 3OOBA 1ITQA 4BI7A 2Z1VA 3PG8A 3CHDA 1XRSA 2OTDA 1FRBA 4NAEA 1K1DA 1A5OC 4U3AA 3KE0A 1VGAA 4FX8A 2BTMA 4GISA 1VR6A 4ZPTR 3N73A 3Q65A 1IEXA 4YCOA 4Q4QA 4PMOA 2X0YA 4NNAA 5BMWA 1TIWA 5FL1A 1PCKA 3B4YA 3LCIA 4TO8A 2VEPA 4JKMA 1IR1A 3XISA 3BG3A 1OEPA 2ZUUA 3TTQA 2RDWA 1DWFM 2WYSA 4JCMA 2A6LA 4NQ1A 1MNZA 5HWNA 3EDEA 1NP2A 1TR9A 4RNJA 3EA2A 1K9EA 3TAOA 2DG4A 1E6NA 3RCNA 5FESA 3V0SA 2HPMA 1W9BM 5G2IA 2TMDA 2VRKA 1GUVA 4G6CA 2MANA 1ZS2A 4Y7EA 1JQXA 2ZZ4A 3AAMA 1ADOA 3IAQA 1Q7QA 4E2BA 3W7EA 3MMDA 4IGHA 4MWAC 1GW1A 3WJXA 1IZKA 3ABZA 1E73M 3KL0A 1CIUA 4XX6A 1VPYA 4J7RA 1A49A 2E9BA 4LB4A 3QSRA 1CLXA 2CLHA 1M7JA 1LQ0A 4PGLA 3SRDA 1IWAA 2CLMA 4LAMA 1X98A 4G5DA 3TOPA 4YN5A 2G41A 4HKPA 2YBTA 1M6JA 1P0EA 1YADA 3KCOA 1A5NC 4HSHA 3NG3A 3W76A 2Y5JA 1UD2A 4DWSC 3GVQA 1W3JA 1UHVA 1W2PA 1LT7A 4AY1A 1XLIA 5C9XA 1TPFA 2GVJA 2W63A 5AVHA 3UFYA 5HMEA 3S9YA 1XXXA 3GR7A 3WF2A 2DVUA 2PSNA 3MZNA 4QIUA 3AIRA 4M81A 1M53A 3APYA 2E6AA 4JYFA 1Q6DA 3VIGA 3S1XA 2HBXA 3LHVA 2ITKA 3WQEA 4KCUA 2J7EA 1XG3A 4F66A 1KGWA 1KLYA 4Q8NA 2V5DA 4W93A 1NDYA 2HV5A 3GTHA 3W28A 1IHIA 1SQ7A 2C8NA 4AX7A 1JCYA 4B3KA 4DUVA 3H23A 1PKYA 4JD4A 4GZJA 9XIAA 3SIZA 3KTSA 4AHOA 3TLLA 3SGZA 4BR1A 3C2EA 4KW2A 5I03A 2ISWA 1IEIA 3VOIA 2E5DA 3B40A 2QDHA 3N2XA 1F05A 4A3YA 2VT0A 4PUEA 4DB7A 3A64A 4F79A 1W8GA 1DQXA 1E1CB 1QJWA 3E96A 5BXTA 3LA4A 5JH1A 4HP5A 5CSRA 4WVXA 4P7RA 2HROA 5K9DA 2PDMA 4PEEA 3UZ5A 1KR1A 4DJDC 2F61A 3PG9A 3AHVA 1O1ZA 3WEOA 1ZAJA 3BANA 2XH2A 1EC8A 5CSSA 3BAXA 3BL3A 4ATDA 3JVAA 4YTUA 1UIPA 4Q7IA 1MEIA 4IX0A 1V77A 3G0XA 1OC7A 4ZOBA 3CV6A 3H2EA 3FAWA 1Q7ZA 1GWJA 1VRXA 5G2WA 3ZJ8A 3GDMA 1SUXA 2POZA 3BG9A 1A0DA 4BQ3A 3ZOAA 4DJEC 3W29A 5I06A 1TPEA 4CEUC 1TE6A 1EP2A 3W7PA 1OIMA 3MSRA 3UXLA 3PAOA 4JFJA 3DI1A 4L65A 2QR6A 2QJHA 2DEPA 4ZO6A 1TMLA 1SO6A 3VOJA 4D8LA 2VDHA 3PPFA 4DEFA 1R9XA 2PDFA 3VX0A 4RV8A 1FKBA 3W84A 4H6QA 3VX1A 3RU8X 2PLCA 1GEQA 2QJGA 4RJEA 5C5YA 4Z1BA 2UY5A 3W7IA 3WFZA 4NZ5A 3NQDA 5D32A 3HMJG 1B54A 3EKGA 1AFSA 3SCWA 1BRLA 1WDDA 5I77A 3NTYA 4AY7A 3EEGA 4XZHA 3OODA 4IPPA 1SW3A 2EG8A 3VOGA 1XL9A 4KGLA 3B9AA 4PUMA 4K37A 4Q4KA 2XZ9A 3WLIA 3AIWA 2WK2A 3G3DA 2DZTA 4NXKA 3AALA 1E4LA 4JHOA 3HPFA 3G22A 1E6ZA 3OLDA 3DIPA 1WP6A 4EXAA 1S2VA 3FYPA 1TJRA 5G4EA 3UG3A 4C6MA 4KS0A 3TA9A 2ZX8A 4QEHA 5LA2A 1LORA 1VCGA 1BKHA 4P8WA 2YCEA 4DXXA 3I7QA 1XFBA 3EYPA 1PSCA 1E1CA 5A2CA 3I6TA 3ENLA 1H0IA 4GY0A 4GUHA 2FTWA 4GX9A 3R43A 1WBHA 4ODLA 2RSEA 1TFVA 3G1AA 1P0NA 4PL2A 4GKLA 2FH6A 3ZT6A 3KFTA 5LZLA 3HQNA 3RPMA 2OX1A 1OX5A 1ZSXA 1W5MA 4YMZA 1SW7A 1ZZMA 2PDGA 1KO0A 3O5JA 2JF7A 3FXYA 3B06A 3REQA 4M19A 1ODZA 1PDYA 2ZVRA 3WMCA 1KFWA 4JY9A 4ML4A 2ZE3A 1OFOA 2QGYA 2DUXA 3FN9A 2PLJA 5GJNA 3PPHA 5ECUA 4JXCA 1BYDA 4E6MA 1MW0A 1P5BA 2PRHA 4UTFA 5I5RA 1LL6A 2WSYA 1B9ZA 3H4XA 5CGQA 4H8VA 1DHKA 3UVIA 3XINA 3LMYA 4PA8A 3VKDA 4TVUA 3DXIA 1MSSA 1B3YA 3DGRA 3P8IA 1QDSA 1AMKA 3G24A 4U2ZA 3K4DA 3E2RA 1JF6A 2NXHA 4OVXA 1KT1A 3T8QA 3NZPA 3MUIA 3WENA 1BHGA 3GD6A 1XBYA 4E5TA 2DW6A 3AMLA 3W71A 2ZOXA 3TTOA 3GXDA 5I3JA 5JBFA 1OM0A 1TCOC 1LG2A 5B7YA 1PB0A 1POJA 1LP6A 1MEWA 4WRHA 3VAWA 3NIYA 4RNFA 3LPGA 3O5IA 5FKYA 3UI4A 1IT8A 2M08A 4UIOA 1CXHA 4KBXA 3FYOA 4GGQA 4UTLA 4BF9A 3KAIA 2O55A 3CAWA 3TCSA 2J78A 1Q6RA 2J74A 4J40A 2G3IA 1I1XA 1DJGA 3ZMRA 4LBUA 2YIHA 4R53A 4X9SA 5ABHA 2HTMA 1SYTA 2CKRA 4HNNA 2NQ9A 3O6CA 4KCTA 3UJ2A 3O3RA 1J0ZA 3B8DA 3KL3A 2CBJA 3PTDA 1SO5A 3RR1A 1B5TA 2A3EA 3HPSA 3O9NA 4LUSB 3USZA 5C2GA 2QUMA 1Z44A 4ICNA 2ISSA 3RPTA 4PYSA 4CD4A 1REQB 1V51A 4ZGYA 1WZAA 2VX4A 1RD5A 3EA1A 3SIMA 1EA0A 4I9TA 5G1MA 2VFFA 1PYFA 4HNUA 4AHPA 1V02A 3RLGA 1VKFA 3OYZA 3MPGA 4NSBA 2I56A 3F5JA 3PBWA 2Q71A 4DJDD 3TU9A 1UP0A 1WKEA 1XIIA 3SAZA 4AVNA 3QY7A 3KBMA 3RILA 4CGTA 5HR7A 4WK9A 3EX6A 2ZCGA 1JYWA 4IFKB 3AHTA 3CNYA 1MXGA 3AIBA 4DJEA 1TV5A 7ENLA 2PS2A 5F4WA 3KZSA 2OQYA 5I07A 2ICSA 4F8XA 2DH3A 1OQFA 3O7UA 5EBAA 2E6YA 5FJTA 2EGZA 5M3WA 4TOQA 1EIBA 1GKPA 1HIZA 2YXGA 1OWQA 4JTUA 3C3UA 3EIPA 5DELA 4MWAE 4GZEA 4A8NA 4GUGA 2ZR4A 2PPPA 3NL5A 3COTA 1JFHA 4NP7A 2VURA 5F2IA 3WDIA 3ZWSA 1HJVA 3NQAA 1S2CA 1CYGA 1N82A 4OHQA 3O6DA 2G4FA 3B97A 2R1NA 3WJWA 4U5IA 1R2TA 1ODUA 2Y6ZA 3W7KA 3RDKA 3TYDA 4DRKA 3W70A 3EX1A 1S1RA 1YQ2A 4JKLA 3M0IA 4HBEA 1AZ2A 3JZEA 3WLNA 1MXSA 2VR4A 1FKJA 4NHVA 3OLGA 3AIEA 1JCXA 3FJ4A 3F4DA 3GW3A 3H2NA 2XGIA 3UR7A 1WPCA 3IVTA 5E9XA 4UTTC 1GVSA 3WD4A 1Z8AA 1MWOA 5J8LA 3F5KA 2IPFA 2JALA 2Y88A 4B91A 4JTFA 1W3KA 3PZMA 2I5IA 3BV7A 5K2ZA 1DE6A 1UUQA 2HMCA 2NVDA 2CHOA 1AL7A 1W3TA 3JYJA 1FX6A 1WNOA 4YVVA 3W53A 2VD8A 5TQLA 2VZUA 3DFPA 4RZBA 3S2LA 3UZXA 2PTWA 3OVPA 3ZLFA 1CXIA 1QFEA 1FKGA 4XAYA 2IKHA 5HNRA 1X8CA 2C1HA 1IGSA 3OO2A 4NU7A 2FYMA 4FX6M 4CKQA 3RNDA 4ICMA 2J9YA 4XWUA 3ZSSA 5CLTA 5MKGB 2UY4A 4J28A 3LCFA 3CJPA 4GXMA 4GQ0A 1R2RA 1OG0A 1PBKA 2GOKA 4MSPA 1W9UA 1RVGA 3R11A 3ZVHB 4JQ2A 1G01A 2YYTA 3SY8A 2WZHA 3ZFHA 4XKYA 1AVAA 1HJUA 1BWKA 1JZ7A 1S5TA 1I45A 2POTA 2YDRA 2J8FA 4PEKA 2RGLA 4HCDA 2XPKA 1ZRQA 3V4BA 3H2FA 3L2IA 2CFFA 4M6PA 3EGJA 4Y8FA 4I8DA 1J5TA 1Q7MA 3WZ0E 3IWPA 4URIA 3T0BA 4QGCA 4NJHA 3Q4DA 1IWBA 5CC6A 1KCLA 2WC3A 3EZ4A 1FKDA 5HJLA 3HIJA 2WCSA 5A6KA 4J3WA 2OO0A 4RCXA 2Q3RA 5EPDA 4E0CA 2V3DA 3E9AA 3AXMA 4N6EA 3KBWA 4IZGA 3EWWA 3WMBA 3AMKA 5KTLA 4LAKA 1X1ZA 3SBFA 1US3A 5B7ZA 1K8CA 1ZHAA 2IXVA 3KOWA 1Y5XA 1TV4A 4AWUA 1R86A 2Y8KA 3BK0A 1D3CA 1W37A 3UWQA 1W1IE 4HSNA 3OVQA 3NOYA 3N9KA 4PRRA 4BY3A 4JR5A 2L2SA 3L2LA 5L6UA 3QGVA 3P0XA 3NTPA 5HUOA 1OX4A 2WJFA 1IT0A 4JICA 2CHRA 1EIXA 5J04A 1DJIA 2GDVA 1VIWA 4JIQA 3QYQA 3B8WA 4W9QA 2E09A 2DG3A 2D3LA 5DO8A 2A7NA 5DT7A 1RZMA 3U2OA 3M1ZA 3GVRA 4IFKA 3NQCA 1GNXA 4US5A 2F8QA 4MYXA 3V5CA 3B0VC 1D7FA 1Q6QA 3HURA 3AWNA 3PSWA 2X05A 3QKEA 1FWNA 1LOLA 4ZENA 1ZAIA 3H7RA 2E0PA 2VN1A 1PO9A 3RR4A 3LX9A 1TSIA 2FHBA 3E12A 2BGQA 1R46A 3ARRA 4JQAA 1UWUA 2KAUC 2FVMA 1X1OA 2XFRA 3UD6A 1EZ2A 3LCHA 2EG7A 2J7GA 1D7KA 1NU5A 4ZODA 1R5YA 3W1XA 1SZFA 3TMQA 4DI8A 3UXDA 2ZADA 2CZEA 6REQB 3SY1A 5FEZA 2X41A 4L80A 3FXGA 1OC5A 2ZWYA 2XN1A 3QV6A 3BUVA 3M43A 4AVFA 2H9AB 4W5UA 4EP8C 3EPMA 1L9WA 1PXGA 4B4HA 1DJNA 2FAPA 3L5AA 1VBGA 1NAL1 1R0MA 4Y9MA 2XN0A 3LUTA 5CPNA 2V82A 5LXXA 5J6EA 1PUDA 4TUFA 4V28A 1KBIA 1QT1A 3HA1A 4FXFA 2I17A 3H7UA 4BWLC 2VXNA 3I7RA 5BRQA 1FWFC 1Q6HA 3CT7A 3BARA 3W75A 3V7PA 4AU0A 3E2SA 2CLFA 5F1VA 2ACSA 4TX0A 1B4KA 1F3WA 4S3GA 5AY7A 3DKJA 4FOKA 2VO5A 2JKAA 3W7GA 2WJZA 4QT3A 4WY0B 5DIVA 3WKZA 5EBUA 5H8MA 2TSYA 4JNYA 5EMMA 4GQRA 2GQ3A 3CUGA 3WSUA 3PS7A 3WNLA 2R91A 4K2SA 3CZLA 2C1IA 2Y78A 3S5SA 1V79A 1ZGDA 4BWLA 4WDXA 5HWJA 4NRRA 2JE8A 3P93A 2J7HA 4UTKA 1K6AA 5HUPA 3FCPA 4PSRA 1LQAA 3BURA 3N17A 4GLEA 3IV8A 1EJWC 3U4FA 2CLKA 3QPZA 2OXNA 5DANA 4S3BA 5M5DA 3RM4A 1B6CA 3WH5A 3C6CA 4N4QA 3O5FA 4AEFA 4CCDA 4CNSA 1J93A 2I57A 5AC5A 1N55A 4J2PA 1CBGA 4BZYA 2QKFA 8XIMA 1BWVA 1OFQA 5K3VA 1LG1A 2C3ZA 3URBA 3G1SA 1TUFA 1LWIA 3P82A 3L0NA 4OT7A 1V03A 3M5VA 1FKXA 4HOWA 4M29A 3QW4B 2KR7A 2J13A 1ONWA 4DBSA 3S6TA 3MQTA 3GXIA 4HU0A 3UQNA 1SFSA 1Z9AA 2INFA 1WO2A 1YEYA 1EJUC 2FZ9A 4JL1A 1ZPTA 4EXQA 1JNTA 3T8LA 2UZ5A 4B9YA 4DT4A 4DJFD 2V3EA 2PDKA 2JKEA 1E4IA 1VHCA 4K7YA 3RK8A 1TZ7A 4Q4PA 4WQ6A 3UG5A 3LHWA 3IGUA 1SPQA 4RNHA 3B3DA 3OGVA 3VCCA 7PTDA 1Z69A 2X1SA 1UW9A 1BSLA 1UD6A 3DBNA 1BSIA 3WQCA 4QJ4B 1ME7A 1G4SA 3CUZA 5CEWA 1W5QA 4M82A 1YXYA 4CQ8A 2QAFA 4HT3A 4LQ1A 4UXDA 2Z1SA 2DZAA 3N04A 4JX5A 1CECA 3HMCA 2QDGA 2BY2A 4QX4A 3ARUA 3BLKA 4H7CA 5A6BD 3TYBA 3F2CA 3FEQA 3GNXA 1LWHA 2X0SA 3LGDA 3M41A 1G6CA 4PCFA 1OB0A 3UF8A 1LOSA 1BTMA 3FX4A 4YHGA 3VVGA 3FGCB 3DFSA 5HR6A 1YE4A 3P74A 4PH6A 4C1LA 2YDSA 3FS2A 1JPIA 1CGVA 3MBDA 3BW2A 1FKFA 3U4AA 2DSVA 1XLJA 4TMBA 1OC6A 3LHTA 1JCLA 2WMIB 3QW3A 4GNKB 4V2XA 3IARA 3GR4A 4O52A 2E8ZA 4WGHA 3MV11 4UOJA 1NWTA 3BE7A 1XHGA 2ZC1A 3AS2A 3L4WA 3RCMA 4WXZA 1V0MA 1NELA 1BXNA 1U2YA 1XW8A 1AJZA 2J24A 4R85A 3V36A 2E1WA 1JCJA 4MKSA 3KBVA 3RITA 2Z4GA 4PMNA 3UR5A 2OELA 4JPGA 2EPHA 2I5GA 5CGTA 3G2GA 5E6ZA 4IQJA 2QCNA 4ZOAA 2X0HA 1F6YA 1OCBA 1QPFA 4XZBA 6REQA 1BPLB 2WSKA 3TSDA 3QR1A 1YPIA 4O1FA 4US5D 4HYRA 1TVPA 4AZ6A 1FKIA 4S3JA 2ISVA 3E0WA 2NXGA 5FD0A 3AYSA 5XIMA 1RLDA 4OJYA 1I9CB 3NZQA 3C5QA 5KZMA 3VFCA 4EWND 3MCOA 2GK1A 2VGFA 2VR2A 3GIQA 1S38A 4PMDA 2C1GA 1GKQA 3T55A 5D38A 2W5FA 3ITCA 3UG8A 4NYYA 4QP0A 1DJXA 2EULA 2ZQUA 3IJLA 3XIMA 1C8XA 2H9AA 3A22A 5GNYA 1XV8A 4R7WA 1JGMA 2YSWA 1S2UA 2FVLA 3H8AA 3TUUA 3P80A 1NTHA 4W8BA 2OLHA 3T08A 3VD9A 5I78A 5CZSA 4LJ3A 3T07A 3LCXA 5I24A 3A9BA 1HL9A 4DBEA 3H54A 2O4QA 2ZTKA 4IJBA 1EGMA 3DERA 3P14A 2QJMA 1XKYA 2VL4A 1V3HA 4G7EA 1PL9A 2W67A 4IMGA 1HN1A 4TW7A 3SUUA 3S0CA 1J4HA 3WIJA 4GBDA 3LERA 1DIEA 2E9LA 4UQBA 3ANUA 4J2MA 2DJLA 4B3ZA 1DTNA 4K8HA 3IACA 3W7OA 2Z24A 3O6YX 2EJ1A 1FCVA 3O5OA 1SO4A 4J27A 3EWXA 3M46A 5F2MA 4AWSA 2KGJA 3NGFA 1FKSA 3IGHX 3MJYA 4ZQOA 3GW0A 4Q8UA 3P8JA 5AYIA 5CPTA 2CIPA 2E7FA 3FAXA 4HU3A 5HATA 3CQJA 1TRDA 4DIAA 5I02A 1EO5A 3QMSA 3BSHA 3F7JA 5A69A 3SCRA 3KRBA 2TPSA 1A7XA 1I2QA 3MV01 1CXFA 2PD5A 4EPBC 1XDJA 3BCJA 3LCWA 1J2BA 4UCFA 1B9BA 1M3UA 4WOZA 1H4PA 1HW6A 4X2RA 2PDUA 1MUMA 4EPKA 1T99A 2NT0A 3LCLA 2V63A 4LXFA 1QUMA 3CGTA 2R6OA 4DZ3A 4FNRA 4U86A 2P76A 2ZUNA 3QFWA 4I5XA 4U28A 3REQB 3DUGA 3A4JA 5IFTA 3BLEA 3WJZA 3C56A 1XLAA 2VENA 2GQ9A 4MAVA 1IQ8A 1LLOA 4I3GA 3ZT5A 2B7PA 3PZUA 1FWDC 1F3XA 1UR8A 4K68A 3RX2A 2RH9A 1S5VA 4W8AA 2XIQA 1PBGA 3DFOA 5FF0A 4W87A 1UG6A 3MDUA 4JFVA 3R89A 1KRCC 3CQHA 2BFGA 2VGGA 4C6BA 2KX9A 1PHWA 2Z27A 3RF9A 5EFFA 1NIUA 4ZPWR 4LEFA 1FHUA 1O60A 4GH1A 3BLPX 3W82A 4WY0F 2IQ0A 1GVEA 4IL0A 4B5WA 3AOFA 1QHPA 3PZ9A 1XYZA 3LK6A 5A3HA 1UUMA 1B30A 4XAFA 4UFIA 2A4AA 1Y65A 1E9LA 5TAOA 4IXXA 4Z42C 5BCAA 3KHDA 3H21A 4Z0JA 4H9MA 2Y89A 3B9OA 1DPMA 3I3EA 3TNBA 3KS6A 1W3IA 3PR9A 3DESA 3G0UA 4JTKA 4U84A 1MDRA 1S5MA 4QM1A 2EG6A 4B92A 2QCLA 3ZM8A 3SGGA 3H12A 3L4YA 1UC5A 1H7XA 3ZVHA 4DRSA 2NQZA 1VBRA 1LL4A 3R25A 1JD9A 1JYNA 1DIKA 2V67A 5D9OA 4KMQA 4K3ZA 2B7QA 2AL2A 2IPGA 1WAUA 5I79A 4MYAA 4GH3A 4JFWA 5FEWA 3KZ7A 1XYLA 1OJXA 3LPFA 3RIKA 3AC0A 5EYWA 5LNVA 3EDDA 1V4YA 1F74A 4XV0A 4ZFMA 1J10A 3LV5A 1W1B1 1C91A 5IBXA 1P4CA 4Q4RA 4WR3A 4F0LA 2GGJA 1VCFA 4PR4A 3JU2A 5DMMA 4NRSA 3AO0A 3OOQA 3TC7A 4LAZA 2EHHA 1K7FA 1GOQA 1KQZA 1VFLA 3RM9A 1VYSX 3OTRA 3M6YA 5B80A 1GVQA 2XIMA 2VUNA 2ODOA 1FA2A 5HJXA 3N4EA 3ERPA 3U2EA 1WV2A 3QN3A 3P5YA 3OZOA 3ARXA 5HNTA 3AWOA 2BASA 2QW5A 5FSEC 3B05A 4Y9PA 1YDNA 4ASTA 3LI0A 1H3GA 5EU9A 3VNKA 4RK8A 1FY6A 3HOJA 3DC0A 3W87A 1XR2A 2DUAA 4MFDA 4B5XA 3BOLA 3S9ZA 3GXNA 4ODKA 2GWGA 4LTSA 5I3GA 3CQIA 5BRBA 3KACA 4KQNA 3UY7A 4D6GA 3TWAA 2PDYA 2ESCA 1U1JA 4M3PA 3C2VA 1Q8AA 1EEXA 3A4AA 4C91A 3MHFA 4QXIA 1WAWA 2R9RA 2CC0A 4H9TA 1VLWA 4IMDA 1TYGA 1IEQA 1YBQB 3WBAA 3L4ZA 4AXKA 2J47A 2X1UA 2XSXA 3LEPA 3KRSA 1BYCA 1W3HA 2ZA2A 5A6TC 1FBAA 4WIWA 2CPUA 5DCEA 8CGTA 3M64A 1C90A 5A95A 3BICA 4AISA 3MMUA 3N2MA 1Q13A 2XP8A 4LCRA 4ZO8A 1V6XA 3KUMA 4TR9A 3TC3A 4S2CA 4E8DA 2Z7KA 1PPIA 1W31A 1UP2A 1DWAM 3MP5A 4J3UA 1ZAHA 2Z2BA 3EWZA 5DCDA 4JTTA 2WLYA 3QMTA 3O8AA 4ZOCA 2REQB 3TP4A 3EMQA 2QCGA 5FEPA 1EOKA 4MKVA 4UR9A 4Z2JA 4K1GA 2HWGA 2BXZA 2DSWA 1GKRA 5A2BA 2VWTA 3B0PA 3WLJA 4DM2A 4DUXA 1XC6A 4X0VA 4DF0A 5IBXC 2PZ0A 2WWDA 3A9IA 1SZRA 3FA5A 4AD2A 3PZNA 3UPWA 4DNMA 2PCEA 1PIIA 3A3HA 1XLHA 3FJLA 3AXXA 3NL2A 2BY1A 3O0KA 2EF9A 1JDDA 4G56A 4IPNB 1EYEA 1TCMA 3CPGA 4DHGA 2BWGA 3AHYA 3NRKA 3H2CA 3IJ7A 2WAGA 1BKSA 4LEQA 3PJXA 4LRSA 4O12A 1VRDA 4FLSA 5D33A 5HWMA 5D8ZA 3RN6A 3QLDA 1HKJA 3VI2A 4XTDA 4YTQA 1L6FA 4JDYA 3KBJA 3ARVA 1UR2A 6ENLA 5CAHA 1O1HA 3BMWA 3PRDA 5HW6A 4Z1CA 3PBVA 3URNA 1X6UA 1BGGA 2AWGA 4HBKA 3CEPA 3KM8A 4UQCA 3NVDA 1SZNA 2Q6ZA 1J4IA 3IJ6A 1UKOA 3CUXA 3IJ8A 3C4UA 2V5CA 3PTMA 2FFCA 3TZNA 4GGHA 3VYLA 2XP4A 1XBVA 2YL8A 3F2DA 2J66A 5H6HA 4LCSA 4EPDC 2WNQA 5LNSA 2Y7EA 2HE8A 4FIRA 3CL7A 3I68A 2DH2A 2OWWA 3CQKA 3MB9A 4UOZA 1GYNA 4JL2A 1EC9A 2DGAA 2VFIA 1B0IA 1KT0A 4K39A 1XD0A 2W27A 3HN3A 2PEVA 3MC5A 2YDAA 2AAMA 2GDQA 3BW3A 3E2VA 4AD3A 2VEKA 3I65A 4C6IA 3EWCA 3N1AA 3R10A 1GOMA 1OCJA 2EXOA 3PRBA 2Y7FA 4W85A 1QAPA 3QGKC 3E0IA 1ZNNA 2XP3A 3QJAA 3AISA 1JUEA 3M0MA 3WDRA 1V08A 1NOWA 4H9YA 4F4RA 1N8IA 4UB9A 4W8LA 3F4CA 4OU1A 3FDGA 2RHGA 4DO4A 3C0LA 2QCFA 3CXOA 4DUWA 5E70A 4LF2A 1TE1A 1MRAA 3QPEA 2NUYA 3WYZA 3JUGA 4D8AA 4PE8A 5LA0A 3QYSA 3NGJA 1VEOA 4GO9A 3ATZA 2I9UA 3M5ZA 4O19A 1EGVA 4ACYA 1HKIA 4RZ6A 3N12A 1QOQA 1K9TA 1OINA 3VOFA 4F48A 4ES4A 1E0WA 5BWAA 1PTGA 2FZBA 2X1IA 3N9SA 3WBWA 5AZ0A 3G1XA 4ZQPA 3VKKA 6XIMA 5D2VA 4MOZA 5M03A 3GXPA 3QQWA 5CKSA 3MI6A 2MNTA 2OGYA 5AHLA 3WN6A 4HN4A 4DRNA 3OZMA 4F3HA 4QR6A 1OSEA 3H55A 1MW2A 4TVDA 3UQIA 4ZOEA 3R8RA 4MY9A 5HNUA 1CW2A 1QOXA 1TJ2A 2R1MA 5G1YA 4BA0A 1MMFA 1TPDA 1CB2A 1EKOA 1RQEA 1WBJA 2HEJA 3LENA 3GDKA 3VGFA 4NZ3A 4O0QA 2OGJA 3DHDA 3LBMA 4H9ZA 5AYZA 4I6KA 5CH9A 4ROQA 1AH0A 5HPOA 4RNIA 1FWSA 3S1WA 2ZQSA 3NYZA 1NF7A 3WFAA 1B3XA 1R7AA 4XBSA 4KKXA 2BY0A 1EEPA 3SM0A 2XIOA 2GJNA 7TAAA 4LT9A 1BRLB 4RLIA 3SCNA 3M44A 1SSDA 3QSTA 1M65A 4PCNA 5D9MA 2YBUA 2PLMA 3LGEA 1JFXA 5CGMA 3UJSA 1LT8A 2HS6A 4HJFA 4ZMGA 3KAHA 1L8PA 5AFDA 4BI6A 2XUCA 3DG7A 1KCKA 1UZ1A 2WM1A 3S8HA 3CYJA 2IXUA 5C7HA 1KWGA 1PDZA 2ZZ3A 4LPCA 3AYVA 3A6OA 4L72B 4HNVA 3LNMA 4YIWA 2E40A 1V6UA 5C55A 5CC3A 1J4RA 4DAIA 1I60A 5KINA 3TTSA 4ADSA 4IQCA 2IF4A 2C79A 2IKIA 3PF3A 1OK6A 1RA5A 4S1FA 4LVDA 3W9ZA 4AIEA 3LM3A 1JPHA 4BQ4A 2W91A 2OPJA 4DPPA 4IGNA 2ATMA 4U2YA 3C8FA 4OE7A 2O9RA 2KZHA 4FIQA 2G0WA 1MQQA 3O06A 1M04A 2J7BA 4R27A 1DWGM 5GPGA 2UZ9A 5A8QA 3TK7A 1XF0A 1Q45A 4U10A 3KDOA 2LKNA 5FJOA 2ABBA 1XS2A 3TN3A 1GG1A 3NFUA 4K8GA 4HK5A 1E6XM 1PX4A 4GQGA 5D2XA 8A3HA 1YX1A 1ZFJA 2C16A 4L4OA 1RK5A 1W1VA 3VABA 1V0KA 5IM51 2WO5A 3M9YA 1RJRA 1FKHA 3EB2A 1HJXA 1PEZA 4YTRA 2QULA 3ALGA 4MY8A 3VDHA 1NQKA 4GBUA 1OFBA 1JUBA 4FNPA 4UQDA 4YJ5A 1VFSA 5ABFB 1XISA 2PC8A 3O15A 3ZR5A 2DVXA 3BAKA 3WLLA 3NQBA 3HQOA 5FCZA 3C2YA 1S1PA 3P61A 1FDJA 1U5JA 5IDZA 2ABAA 4I7UA 4BI5A 1E6SM 1E4MM 3UY8A 1DQUA 2EPMX 2A3BA 1H1NA 4UTWC 3N2CA 3W2LA 2IMRA 4LV4A 3TKFA 3ANYA 4H04A 3UWVA 2HPIA 1KQYA 4AFYA 4OOUA 4S3AA 2OWXA 2DV0A 1G0CA 3W1LA 3GLCA 4JAWA 4HOXA 1WKDA 2XP9A 2NX1A 2QT3A 4JTCA 4YYFA 1Q8JA 2XG9A 4XD4A 2QVNA 2Y62A 3VKAA 3EWYA 3D47A 1R9HA 2K8IA 3RHGA 5D9NA 1LBMA 5D4YA 3T0DA 3J7HA 3Q67A 4IPJA 3SJNA 1AL8A 3CK5A 3N6QA 1C9DA 2G3MA 1VIZA 2R1PA 4JYDA 1AG1O 2QUNA 1XIHA 2BY3A 4YVXA 1XFCA 1OCQA 1XG4A 2FIQA 2J88A 3FVDA 4B5UA 3TOYA 4DYKA 1IE7C 3LY0A 4UTTA 2DG9A 4ZE5A 1NM9A 2DT3A 4R9XA 1JI2A 4F0SA 2REQA 3PBUA 3QHMA 5CZTA 1ZY9A 4JIIX 1H7PA 5CAKA 1W5OA 4ZO7A 3PBMA 2A3LA 1ROTA 1RP9A 3WDHA 3AROA 1NDZA 1RCOB 4GIAA 4Y9OA 3GKFA 1J0IA 1TA3B 3ICJA 4Z1YA 2VEIA 1FKRA 3PZVA 1YPXA 4J3SA 1PINA 2J79A 1UWQA 2P8CA 1OIFA 3UR2A 4KRUA 3LQLA 1ICPA 3PRAA 4QS5A 5AHEA 3IGXA 4PTDA 1WCGA 4LRTA 1OT1A 3U9IA 4LUIA 1AQ0A 4HCLA 4HB7A 4AZGA 2YL6A 4MADA 1DXIA 2I14A 1VFTA 5AYXA 4EF8A 4ZS6A 4GINA 1US2A 4NNRA 4LUTB 1NARA 2NV9A 4TNSA 2CLEA 4KQZA 4Z0SA 4WEVX 4GUFA 2ZKMX 3RFAA 1LUCB 2Z26A 4EVZA 1OCNA 4MB1A 3O5PA 3OVGA 3H9RB 2INEA 3ZYZA 4GVIA 1UJPA 1P0BA 3G1RA 3GVVA 3MTWA 1XQKA 4JX6A 5AC6A 1T7LA 2PB1A 3T81A 1US0A 4HA0A 2WSQA 3SR7A 2PU0A 3GH4A 4ZQNA 1M9HA 3PJUA 4DUOA 1L0PA 3GM8A 1J0YA 1NOUA 5CBJA 1RH9A 1XINA 1J6OA 3QKZA 1HJQA 3OIXA 1P48A 3WLKX 1B4EA 1PKMA 4GY1A 2KFWA 2PV3A 4R3UA 2Y5EA 2ZYFA 2P3ZA 3RM8A 1H7RA 1VPQA 2X8RA 3GXTA 3OLIA 4S39A 3O5EA 1J96A 4HA4A 3TSMA 1RBOB 2A7PA 3SI9A 4DZ5A 3THDA 2G96A 4M0XA 1GOXA 1RJPA 2CEQA 2PDIA 4OKDA 3RAOA 4DBUA 1OFDA 4IMFA 2O4MA 2HJPA 1QATA 1EWDA 1TMHA 5DXYA 4HMNA 1DJQA 2YB1A 5D02A 3LRLA 1PTAA 1GHSA 5FI8A 2YKKA 2RJHA 2CZVA 5DMNA 2PBGA 1UKTA 3VE9A 1HL2A 4OV9A 3KOYA 2VELA 4H1ZA 4MB3A 3UZZA 3L2MA 5JH8A 1QI2A 4Z2HA 2JKPA 1FKTA 4LS2A 4UNIA 1GVRA 2Q8XA 4XO7A 3NQVA 3TTYA 5G2HA 2YXOA 3TC6A 8RUCA 1XYAA 1H1ZA 5EMJA 5GQBA 4JGDA 4X2PA 4TVCA 2PRMA 2XP5A 2RQSA 4FOUA 3KWXA 4ZVJA 1JUKA 3W74A 5HANA 4C7DA 2WLZA 3VIHA 1E6PA 3DFQA 3G3MA 3P3BA 2DW7A 1QWKA 4JFKA 4N9DA 1QWGA 5E6YA 1EO7A 1D3GA 4O11A 2OFNA 3IEBA 5DIUA 3W00A 1KM2A 4JOMA 3SECA 2V30A 3VM5A 1Q2SA 3WCZA 3WBYA 4B5VA 2LPVA 1IXQA 4LW7A 4ZZ9A 4ORMA 1WOAA 3VNZA 1XLEA 4KIEA 2V9DA 4UMCA 1XCXA 3DFTA 2GGEA 1W3NA 1G5AA 1O94A 4PB5A 1LF1A 5FAGA 3TR9A 4AY8A 3BLOA 3C0QA 2G3FA 3WUBA 3VUPA 2XP7A 6CGTA 3UG4A 3SB0A 5HOSA 4I90A 2FDMA 4RW3A 1UR4A 4WOQA 3G1DA 2OZTA 3W23A 4O2TA 3ZO9A 3H2AA 2NUXA 4ITZA 3KEHA 4HVXA 2Z6JA 3LBCA 1OGBA 1GVYA 1W9DM 3N6HA 4FB7A 2WZMA 2EPLX 3CWNA 2A85A 1TRIA 4O14A 4GIRA 1KTCA 1VCVA 4B90A 1TPB1 5HK4A 4C6EA 3VKBA 3VIIA 4IIHA 3URQA 1MW1A 1E40A 5DT5A 1V93A 3UESA 3VNYA 3A12A 2P8BA 3T44A 4V1YA 4GIVA 3PA7A 1EGZA 3R6IA 1C93A 4M56A 2PBCA 3QVQA <