4WKAA

Crystal structure of human chitotriosidase-1 catalytic domain at 0.95 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
369
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 132
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkaA01
2WWCA 1UR4A 3CUIA 3K46A 2UY4A 4PMYA 2VT0A 3SUUA 3LPGA 3VDBA 2EQDA 4JFVA 1PX3A 1CWYA 2VC9A 2J75A 2J8FA 3TTOA 4HMEA 4MNKA 2ESCA 1WZAA 2YBTA 1F4HA 2WPGA 3QR3A 2UY2A 4R27A 4L4OA 2ZXQA 5EMYA 1OGGA 1KQZA 5JBDA 2UY5A 3WH8A 3WH6A 4MNLA 2FH8A 2VOTA 1BYCA 5FL0A 1UA7A 1H49A 5JUVA 1UR1A 1RPKA 1DWGM 3W26A 2BXZA 3PZOA 3RO8A 3IJ9A 3W25A 4NRSA 2G3NA 2YIHA 1JNEA 2Z1KA 4AEFA 3CO4A 5A6KA 1CPUA 4PYSA 4W93A 1VFFA 3TTYA 1EOMA 2GDVA 5BCAA 1FH7A 3BAJA 4B9YA 4P7QA 4UQBA 3RDKA 1LL6A 4Q22A 1US3A 4JFUA 3GZAA 4WF7A 3AHVA 4FLSA 3AMLA 3VIOA 4M56A 1HNYA 2X2YA 4W8AA 3ALGA 4P8VA 4JKMA 5A8PA 4B16A 4E8DA 2YBUA 2DT1A 4UQCA 3BSGA 5I23A 3W24A 2WC7A 3FXYA 3SCUA 2BFGA 1US2A 1XSIA 5M3WA 1GOKA 4GQQA 3HN3A 3KZSA 4KWUA 2VZTA 1V08A 5EB8A 1BYAA 4W87A 3DHPA 2ZWYA 4PN2A 3AS3A 2ZUMA 4P8XA 4DM2A 5CSYA 4JKLA 1GQIA 1R86A 4DWSD 3CHCA 2XWDA 4B3LA 1U30A 2VX6A 1ISZA 3BGAA 1ISXA 4AIUA 2XM2A 1KGUA 2DT2A 3GNOA 1FH9A 2A3HA 1VB9A 2ZX9A 2D2OA 4BA0A 1CEOA 2XGBA 2XGIA 3AHTA 1QHPA 3N13A 2WM0A 3WSUA 3L4XA 3T0AA 4D6IA 2ZOXA 4WKFA 1LL4A 2Y4SA 3BCDA 4HPGA 3BAKA 1MXDA 4BZYA 1GVIA 1RP9A 2ZWZA 2VX7A 3EDEA 2V5DA 4MTVA 3FY1A 2PWGA 3DYPA 5I24A 4E4PA 3CUHA 1OB0A 3WBAA 2F8QA 4TX6A 4GIAA 2ZUVA 4OIFA 3L4YA 1CGWA 4D71A 4AD0A 3EDFA 4OKDA 3MSGA 5TD4A 4CD8A 1XHGA 1W91A 3L4UA 4M82A 3WEOA 1SMDA 2DPEA 1ECEA 1UZ1A 2VVSA 2F61A 1BQCA 4QLJA 4N42A 1GORA 2YLAA 1NP0A 1ESWA 5CSUA 4A3HA 3BMVA 5ABGA 1R7AA 3DC0A 3SEPA 1FFRA 3GM8A 2QPUA 1XC6A 4EKJA 3QOKA 1MFUA 3LPOA 3RJXA 4W88A 4WKHA 4JAWA 1TVNA 1JZ3A 1E0XA 4UOZA 4OZOA 7A3HA 5A1AA 4JL1A 1BAGA 2G4FA 1QI3A 1VFOA 1KGWA 4FK9A 1TG7A 4GO8A 1C8YA 2WCSA 1VENA 1NWRA 3VNYA 4UQ9A 1LG1A 3WH5A 3KL0A 3W0KA 3SCTA 5IFTA 5ECUA 1R7OA 3VKKA 3T0BA 3ARRA 4WJXA 4TTGA 1G01A 3GH7A 1ISVA 4TXEA 1HN1A 5CJ5A 1RD6A 1QVBA 3WD0A 2DEPA 3AIUA 3EDDA 4M24A 2AAAA 1JYVA 3VTRA 2BY0A 3A3HA 4BCEA 4L4PA 5FOOA 1TA3A 1UH3A 1TA3B 1QHOA 1DTUA 1W1YA 2XSBA 4AZCA 3RM9A 4AZCB 2TAAA 1HJQA 4PMOA 3KEHA 1MVYA 2RGLA 4JCMA 1ZBKA 1E15A 3UG3A 2GK1A 1J0IA 3QGVA 5I77A 3ARPA 4WK9A 4W7WA 5AC4A 1J01A 3EMCA 4Z2LA 3GH5A 5JIWA 1OM0A 1GQJA 3OIHA 3VIKA 1OD0A 2YL6A 4HP5A 1TZ7A 2W91A 1W9XA 2X1IA 3CH9A 5A6LA 5I5RA 4X9YA 2DH3A 1KCLA 5HOSA 1VEMA 3NCOA 3N11A 1G0CA 2YA2A 3WDJA 5A95A 1V6YA 4ACYA 3WF1A 3WY1A 4LPCA 5BRPA 4HA3A 1Q6GA 4PBGA 2O9PA 3RIKA 3CZEA 4D72A 2WHMA 1PPIA 4MB1A 1HKKA 3GH4A 5M5DA 3A4WA 4KH2A 4YPJA 2YL9A 4DUVA 1WPCA 4OBSA 4LX4A 3MS8A 4UFIA 4U33A 5HNNA 3W37A 2VVNA 1V3IA 3L4TA 1GVYA 4FLOA 2XVPA 3SCRA 1HKMA 1B0IA 3SIMA 2WZHA 1B3VA 4D6CA 2NT0A 2BHUA 2V38A 2BHYA 3M7SA 3T2OA 1V0KA 2WBKA 3EMQA 4UZUA 2QHAA 4PMQA 1J0YA 1BG4A 3OG2A 4OJYA 3A6OA 1E43A 2D0GA 1JIBA 2GJXA 2VUYA 2GJXB 3HMCA 2FH6A 4PTVA 1BYDA 1OGSA 1CLXA 4TX8A 4D6JA 1AQ0A 3OLEA 3SCVA 2GJPA 4NSBA 1UG6A 2BS9A 2IXUA 1UWUA 3ZJ7A 4N0RA 4ZENA 3HJEA 1FA2A 3SUWA 2YKKA 1E6RA 1C93A 5BYWA 1YQ2A 3CIVA 3PZGA 1CXKA 4KRUA 1C7SA 2OLHA 4HMCA 1M7XA 2VO5A 1NWTA 2BY3A 4AD5A 3PBGA 4CN4A 4U2ZA 4TVCA 2D24A 2G3JA 2J7EA 3NYDA 1C3FA 3WL0A 2XVNA 4J3XA 1MW1A 4Q7NA 3WF3A 1HJWA 3L4ZA 1GPFA 1XH0A 1GONA 1ZBCA 1E0WA 2NSXA 3VIIA 2WMIB 3W38A 3TTSA 3VD7A 4CN6A 4CN1A 3MV11 4E8CA 2X0YA 4PCTA 5GQBA 5BXPA 4ZFMA 5JIPA 1I75A 2J7BA 5A2AA 1PIGA 3KL3A 2PWEA 5KEZA 2OSXA 2X05A 8CGTA 4CCCA 5JBFA 3CGTA 3NSXA 5IDIA 1C8XA 3SCNA 2WANA 4ATWA 4IPNB 2X09A 3NIYA 5A6BD 2JEPA 5BRQA 1NQ6A 3WDHA 4MPKA 3NDYA 3O9NA 1QOXA 1HIZA 1LF1A 3UESA 1UYQA 2Y8KA 5E6ZA 4PMZA 1VAHA 3RILA 1CGTA 3WF0A 3WQVA 4BQ3A 4PUDA 3TA9A 4D6DA 1E71M 3UCQA 3J7HA 3SUSA 5DEZA 2VNCA 1ZBVA 4X0VA 1K6AA 1ODZA 4ATLA 4J27A 3GYCA 1QNSA 4GZIA 3ARZA 3LMYA 1QI4A 1E6XM 1WB0A 4DWSC 3OGSA 3W82A 1EOKA 2XSAA 1JYWA 3ARYA 2WW5A 1X6NA 2PI6A 2CIPA 5D9OA 1GUVA 4URIA 2DIEA 3WDRA 3WD1A 3AQUA 4PMUA 2YA0A 3W29A 3DHUA 1W1VA 3WELA 1LG2A 4ZXLA 6A3HA 2Y24A 1W1TA 4JFTA 4OOUA 4GINA 1LLOA 5A6JA 1H1NA 4J3UA 2QF8A 1NWUA 1CGXA 2JFEX 2ZUUA 1E0VA 2WBGA 2EPNA 2VCCA 3K8KA 2E9LA 2E0PA 3CUJA 3ARWA 4Z2GA 3VVGA 5FIPA 4H2CA 1C7TA 2CCRA 4IPLA 4CKQA 2V3DA 4GKLA 4J3WA 4QCFA 3NSMA 5A6BA 4AZIA 2WMGA 1FP9A 1SFSA 2V3FA 3APGA 1ZB5A 1E5JA 2J8GA 2ZXBA 5D9MA 3ZR5A 1KFWA 2DSVA 3VIPA 4F79A 1EXPA 4BQ2A 1ITXA 1V0NA 3K4AA 2YOCA 1OIMA 1V6UA 3AIRA 3N1AA 5E0FA 3IAQA 4FLQA 1UR9A 2CPUA 4JZ5A 1E3ZA 1V3MA 3VX0A 1HP5A 1JGIA 2OSYA 2WHLA 3AISA 1E1FA 3VMPA 2A3BA 2FHCA 3AZSA 1UD4A 1MQPA 3DECA 4UOJA 4F9JA 4JHOA 5A8MA 5I0DA 4UR9A 1QBAA 1EGZA 1AQHA 1CBGA 4LQ1A 1WZLA 2GFTA 1GJWA 1W32A 5A8OA 1LJYA 1U33A 3EBVA 1B2YA 2G3IA 4U3AA 1GOQA 4CD5A 1MFVA 4WLCA 2OYKA 3B9DA 1K9FA 3ARTA 4AD3A 5CGTA 4BF7A 2DIJA 4FF5A 1UD2A 4FMVA 4QAWA 3G6LA 3AIWA 1D7FA 1PJ9A 3MSDA 3BLPX 1W9VA 1UWQA 4AZBA 1CECA 2VMFA 5F7UA 2YL8A 1XYZA 1DWFM 3ZJKA 1WDPA 4GI6A 3SUVA 5I6SA 1V02A 1UWTA 4D6FA 1FP8A 2EPOA 4DUXA 4NI3A 5M17A 4RE3A 1OT2A 1NOFA 5AY7A 3ZOAA 3RM4A 1HKJA 1J0ZA 7CGTA 1VBUA 4U3CA 2VZSA 1K9EA 2D23A 4P7LA 2C8NA 3ZJ6A 1JAEA 4H7VA 4F8XA 5C70A 2WLYA 4PMXA 1JXKA 6TAAA 3CTTA 4ACZA 1VFMA 3VILA 4ACZB 3IANA 1KWGA 5AC5A 1OT1A 1E4IA 1B3YA 1DWJM 4U5IA 2WMHA 1QI2A 1QW9A 1VBRA 2VJXA 4AZGA 1JZ7A 2XIBA 2VI0A 3BAYA 2DSUA 2J7HA 5AYIA 2CNCA 3O2LA 3OBAA 3FHQA 1GQKA 3CMJA 1JYXA 5IHRA 1MW0A 1GW1A 1B1YA 1G94A 3VD3A 1CTNA 3QHMA 2VZOA 2NW0A 1UQYA 2CKSA 2Q8XA 4GO9A 3AMGA 1C8QA 3PHAA 4OBRA 2WK2A 3CHEA 1H09A 4HTYA 5JH8A 3VDCA 2GVYA 2DSKA 1KBKA 1GZJA 2X8RA 1J0HA 4AIOA 4TUFA 1V3JA 2JF6A 3MMWA 2EO7A 4HZ6A 4AZHA 3WH9A 1NOUA 2FHBA 5D8ZA 4LYRA 4HU8A 3W81A 3MUZ1 4HOWA 1RH9A 4AEEA 4DUWA 1W2PA 4YN5A 3K8LA 3AFBA 3G6MA 2WVVA 4IUGA 2W67A 3CUGA 4ATDA 1DWAM 1UZ4A 2VRKA 2W62A 1BLIA 5D9NA 2F2HA 1E1EA 4W7VA 3IK2A 3BC9A 4C7GA 1V3KA 1E9LA 2ZIDA 4DWSA 5FD0A 4FLRA 4DWSB 4TVDA 4ZE5A 4D6HA 3WMBA 4U31A 5IXEA 3WENA 4XZBA 4EANA 3GDBA 1JI1A 4CU6A 2QV4A 3K8MA 2EEXA 3AROA 3WFLA 1GOWA 2J47A 3SCSA 2UWFA 3VD9A 3VMOA 1W9UA 5D9PA 3OA5A 2PWFA 3AHYA 2ZX7A 1PX8A 3WQ8A 4PTXA 4GQRA 2Y5EA 2OYMA 1J0JA 1TFVA 4UQDA 4KGJA 1PZ3A 4M80A 1GHRA 1QNRA 1JZ6A 3IAPA 1U2YA 2W92A 2ZUWA 2XIIA 2WCGA 4YHEA 2Y8VA 4R5EA 3K1DA 2YJQA 3ARQA 4HPHA 1TE1A 3PZTA 3PZNA 5BWFA 1D2KA 1I1XA 2WMFA 1KR1A 1TVPA 5KZ6A 3RJYA 1UD5A 2GK1B 1WDRA 2E3ZA 3ZT6A 3W27A 2O9OA 1HF6A 3VIGA 1J11A 8A3HA 1Z32X 4EE9A 3I3DA 4ZEPA 2CERA 1XSKA 1JD7A 5IFPA 3AYSA 1WDQA 1WKYA 1VFUA 2W61A 3WEZA 3WQ6A 1C92A 2WLZA 2XVGA 2QMJA 3FHAA 3ZT5A 2YDSA 7TAAA 2QLYA 5LA2A 1XV8A 1QNOA 4AZ6A 1ZBWA 3N17A 1TCMA 3VGFA 3MV01 5A94A 1JF6A 3A4AA 1OSEA 4JL2A 3NUKA 3SCOA 3WNLA 1HJSA 1VEPA 4C7DA 3MUY1 3WKZA 1ISWA 2BHZA 4GI8A 1MW3A 5A2BA 5DT5A 1NOWA 5GNXA 5CPTA 5DFAA 5ABFA 1X6LA 2D3NA 1OCQA 2PBGA 2A3CA 3AXXA 1OBAA 9CGTA 3ZSSA 1H2JA 2Y2WA 1NWSA 3VO0A 3WD3A 3WDPP 1W3HA 3FN9A 1EHAA 4U5KA 1S46A 1OWQA 4H8VA 1V6VA 2D22A 2HISA 3VDHA 4CVWA 3OZOA 1OD8A 2E40A 1E56A 1H4PA 1ISYA 3VDAA 3W53A 1DP0A 1JYNA 1K9DA 5CZKA 3EDKA 2O9RA 4F9DA 1CLVA 1KQYA 3AHZA 3IJ7A 5I2UA 4AY1A 1E73M 1G5AA 1ZS2A 1GHSA 3PTMA 3ZQ9A 3CZKA 1GOMA 4J7RA 4P7RA 2XHYA 4PCSA 2D1ZA 1Q6EA 3BLKA 3ARXA 1FOBA 2JE8A 2BY2A 4Z2JA 2JALA 2OYLA 3MKKA 3THCA 1GJUA 4D1IA 1UA3A 2YLLA 4CUCA 4ZE4A 3AS2A 1J9YA 3KL5A 2J79A 1LL7A 1FH8A 1NM9A 1QNPA 1ZJAA 5A6AA 1B90A 3GXDA 3WUEA 4AW7A 1JFXA 3AIEA 3T08A 1E40A 1RP8A 5E70A 1EO5A 4CCDA 3FNDA 1JZ4A 2ZX6A 3BMWA 2X0HA 3SCWA 4GZEA 2WWDA 3CMGA 1ODUA 3WUGA 3WMCA 1E4MM 1TR1A 2GJRA 2OWCA 4V27A 1H0IA 1CGYA 1UH4A 1XRVA 3QHOA 4Y7EA 1BVNP 1E4NA 3PZUA 4AZ5A 4GI9A 2CHOA 1CGUA 3B9EA 2VRJA 1EDGA 2WKGA 1BG9A 1W9DM 5M03A 5HDRA 4P8UA 4AZ7A 3PZ9A 1DEDA 2PF0A 3VD5A 1UD6A 2G3MA 2WYSA 4X0NA 1BPLB 3POHA 1UWSA 4J3TA 2W4XA 3MO4A 2FHFA 4JIEA 3VGEA 1IT0A 1O6IA 1VRXA 1NH6A 1QI5A 4PMRA 1XYFA 1LWHA 1BTCA 3VD4A 3AS0A 1B9ZA 1KR0A 2Z1SA 1B3WA 1JFHA 4E2OA 3WMSA 4J3SA 3U7VA 1TUXA 1V3HA 2DSWA 1ITCA 3WDIA 4MAVA 3VMNA 4CCEA 2VR5A 3AZTA 4WSKA 4Z2IA 1G1YA 1KXTA 3TP4A 4UQAA 4PSPA 3VOCA 3N12A 1JZ8A 2B31A 3FW6A 3AXHA 1UD8A 1Q6DA 4CVUA 4NF7A 1XH1A 3GXIA 3I3EA 2ZXAA 5BXTA 3LPFA 3T2PA 1MYRA 3L2LA 1UKSA 5CXPA 4B15A 3D3AA 4PTWA 2BXYA 5DO8A 1DWIM 1E55A 4W8LA 1XH2A 3UG4A 1DHKA 1AQMA 1B31A 3S6TA 1PEZA 4CU8A 5I78A 4UFJA 1E3XA 2XJ7A 4MJ4A 4P8WA 1HX0A 5FCZA 4J3VA 1E72M 1UOKA 3OLDA 3UR7A 1MQRA 1UQZA 3WFZA 5CGMA 4LGXA 1QHZA 3B9AA 2BY1A 4AWEA 5A2CA 4J28A 4IM4A 3W4RA 2YA1A 1PZ2A 2QMKA 4QLLA 3OZPA 3CZLA 3GBDA 1SYTA 3E1F1 1G9HA 4EK7A 3GBEA 5CLTA 1EHNA 3PTQA 1E6NA 5CPQA 1O7AA 5A3HA 4D6GA 4M81A 2DQXA 2ZXDA 3BH4A 3GNPA 5EFFA 1BF2A 1JZ5A 5A8NA 1VEOA 3VM5A 1UKQA 5GPRA 5A6SA 5FL1A 3UG5A 5BXRA 4UFHA 3WNNA 3VUPA 5E6YA 2WNWA 1W3KA 1W1PA 1CZ1A 4S3KA 4JFSA 4A4AA 1BVZA 4D1JA 1HL8A 2WZIA 4IISA 1H3GA 2J4GA 4UZSA 1R87A 2OSWA 2IUZA 2CEQA 3W28A 1VJSA 2W5FA 5HPCA 1UKTA 2BV9A 3ARSA 2CYGA 4BQ4A 3WIJA 3AMDA 1UH2A 2XTKA 2AOSA 1SR0A 2ZUNA 4HOXA 1KXVA 4AIEA 4W5UA 1V02E 3WQ4A 1H0GA 2YDRA 5E09A 2WVTA 1E6ZA 1UR8A 2RGMA 1M01A 2ZX5A 2A3AA 1GOIA 2IXVA 1IZKA 2GUYA 3WNMA 3CHFA 1PX4A 1LWJA 2JIEA 3WBEA 1TMQA 3VX1A 1KB3A 3EMZA 3RMEA 1EA9C 1JF5A 1R8LA 3CBWA 4UQEA 4H8UA 1WNOA 2J7CA 3VIHA 5A8QA 4ML4A 4XZWA 3OGRA 3N04A 1E70M 4PMDA 1H11A 4A3YA 4UFMA 1UWIA 2XM1A 2XVKA 3LPPA 1OGBA 1J10A 3T09A 3WNOA 2WSKA 3KE0A 2EPMX 1E6QM 3WUFA 2CBVA 2WB5A 1L0PA 2WVSA 1HVXA 4KGLA 1BHGA 3OLIA 1Q6CA 4RE4A 5HXMA 4OOZA 1MXGA 4QDMA 3VU2A 4DM1A 1UUQA 3F5KA 3GXFA 4AXNA 1CENA 3MANA 5HPOA 1HJVA 3JUGA 2J74A 6CGTA 1HXJA 3RM8A 1EH9A 1WZMA 1SMAA 2C7FA 4AD1A 3T2QA 3ARUA 1CXEA 4K68A 1LQ0A 1V0LA 1XGZA 2WZEA 3GTNA 3PZQA 4MDOA 4HU0A 1WCGA 3AIVA 2EJ1A 1XD0A 2HVMA 3ZMRA 2DGAA 2YL5A 2J7FA 2FDMA 3F4VA 3ALFA 1XD1A 5C8BB 2GSJA 3PN8A 4MB4A 3WD4A 4CD7A 5EBAA 1UR0A 2DDXA 2VZUA 1CIUA 3WL1A 3WF2A 1B3ZA 5CLWA 1UKPA 1W9BM 2EBNA 4WIWA 5FKYA 2JEQA 2E9BA 1WZKA 4V2XA 3ZJ8A 5CQ1A 1ZU8A 5C71A 2A3EA 3NSNA 2OWXA 1PBGA 4MJ2A 3U57A 2XYLA 2CBIA 3M46A 2V3EA 2ZUSA 2J7GA 4P7NA 2CITA 2WVVB 1OIFA 2XVLA 2CBJA 4MDPA 3N18A 2WMKA 1EIBA 1JDDA 4H04A 2VURA 1IZJA 1UR2A 5DF0A 1V0MA 3ZO9A 3AMCA 3BAIA 3ZIZA 3FAWA 4GXPA 4CD6A 3ECQA 5IHSA 3ZT7A 2D0HA 1CDGA 1W3LA 5D8WA 2PBOA 1JD9A 5GNYA 2XPKA 1UWRA 2VCBA 2PWHA 1R85A 2D3LA 3PZVA 3UEQA 4UNIA 3T0DA 3POCA 4LYPA 2CBUA 3DYOA 5CPSA 2CXGA 1JXJA 3UR8A 5ABEA 4W5ZA 4PEEA 2FGLA 3VIJA 1KWKA 4TOQA 2NT1A 3RCNA 1D3CA 3MU7A 4JHZA 2WXDM 3WQWA 2E8ZA 4CGTA 4UOQA 1V6WA 5E9AA 3A4XA 4WKAA 3BSHA 4H41A 4KMQA 1BGAA 4W84A 4M29A 2WC3A 3BCFA 1E6PA 3EDJA 2CESA 2VL4A 2ZUTA 1KXQA 3AICA 2CHNA 1KBBA 2O92A 3QOMA 3U5UA 4MADA 2PB1A 4PMNA 4PSRA 1QBBA 3ZR6A 3S2CA 4M8UA 3ZSTA 3BXWA 1WAWA 3VIMA 3BAWA 1CXLA 1B3XA 3WDQA 1MW2A 3N9KA 3OB8A 3KWXA 2VRQA 3CLWA 4D6EA 3AS1A 1W2VA 1AMYA 2CKRA 2WSPA 4GZJA 1CXHA 4TVUA 3DYMA 3OLGA 2W63A 1P6WA 1C90A 1W9PA 3PZIA 3GXMA 1I1WA 3HU7A 5JBEA 2E9MA 1L8NA 3WH7A 3F5JA 4W86A 1CXFA 2BVYA 1V03A 1HKIA 3U5YA 2BVTA 3AIQA 5BROA 2OWWA 2DT3A 3WD2A 1JAKA 4PUEA 4JCLA 1AVAA 2VZVA 4XUYA 3NJ3A 4TTUA 3O6AA 5I3DA 3BAXA 3AZRA 5DT7A 1EQPA 1V6XA 4EAMA 3AYRA 4HZ7A 1BGGA 3AJ7A 4JFWA 4UFLA 3VGHA 2BNJA 4HA1A 3AXIA 4W89A 2AMGA 5ABFB 4H8HA 4UFKA 4MAZA 2E4TA 3MMDA 2XG9A 1EQCA 3MUIA 1HVQA 1FHLA 3VGBA 5A6MA 1JDCA 2QPSA 3L2MA 3W6LA 3THDA 2CETA 2BVDA 3UETA 2VX5A 2WCAA 4LXFA 3NDZA 4P7OA 4AD4A 3A47A 1DWHM 1EO7A 1JDAA 4B9ZA 2YDQA 4YHGA 4BQ5A 1PIFA 3SCPA 4AMCA 3N15A 2XUCA 3ARVA 4MNJA 1CNVA 3SURA 5CG0A 5ABHA 4QP0A 1VJZA 1Q6FA 1QI0A 1JI2A 3PZMA 3UERA 3VGGA 5EFDA 1HT6A 5D4YA 2E8YA 3ZM8A 5AYBA 1VIWA 1QW8A 1XSJA 5A69A 3F5LA 3VPLA 3IJ8A 1ZJBA 3AHXA 4LYQA 1GOOA 2V3GA 2EPLX 4M1RA 3AOFA 1UKOA 4AC1X 1M04A 3VIFA 1KCKA 1NARA 1CGVA 1X1NA 2FGZA 2WAGA 5I79A 4ZXOA 2WVUA 3CZGA 1E4LA 4GPNA 1CXIA 2ZX8A 3WUBA 3OGVA 1BYBA 5BXSA 1Y7VA 3MUAA 1FFQA 3WN6A 4NRRA 3AI0A 4HOZA 4Z2HA 1EDQA 2XFYA 4MB3A 2WHKA 1EDTA 4QFUA 2WKLA 3CPUA 3WQ5A 5E0CA 2J77A 3PTKA 3WNKA 2J7DA 1HJXA 4PRWA 1GCYA 1W3JA 3U7BA 5DMYA 1YHTA 1ZL1A 4Z2KA 4W7UA 4AYSA 4UTFA 2D20A 3CHDA 2GDUA 4QLKA 1H5VA 2PC8A 1VF8A 3M07A 2XFFA 2G41A 3TTQA 1H41A 1E5NA 3II1A 2PWDA 3M6DA 3RPMA 3D5HA 4U2YA 2D0FA 2G8ZA 1QPKA 2VQUA 1WP6A 2VTFA 3AMKA 3QHNA 3WNPA 1FHDA 1JG9A 4CU7A 2WMIA 1B30A 1JZ2A 2O9TA 1BFNA 4XB3A 4RL3A 2J78A 1J0KA 5LA0A 2VQTA 3TOPA 4HA4A 5LYRA 1A47A 1A3HA 1J18A 4C7FA 4F66A 4JKKA 4XX6A 2XFRA 4BS0A 2VR4A 4CD4A 2XWEA 2WHJA 3VM7A 3AIBA 2V5CA 4UCFA 3MMUA 1XCWA 2J62A 1HP4A 3L4WA 1OINA 1JL8A 1BSIA 1GQLA 3EYPA 1V3LA 2JIWA 3SCQA 3VGDA 4OUEA 2VCAA 1MQQA 1WO2A 4RE2A 2ZICA 2ZE0A 2DH2A 1UHVA 4KRTA 1F4AA 1M03A 2DSZA 3L4VA 3WEMA 4B3KA 1WE5A 1N82A 2JF7A 4QCEA 4MNMA 3SUTA 3I3BA 3VINA 3WF4A 4HZ8A 1HL9A 1XCXA 1CYGA 2UY3A 1Q4NX 4HMDA 1PAMA 1NP2A 1WDSA 4W8BA 2J25A 3FAXA 2MANA 1J12A 3GNRA 1E6SM 1UD3A 3TONA 2WMJA 4PTMA 1HJUA 4NZCA 2EXOA 4W85A 4XV0A 3VNZA 1KGXA 4PMVA 3B8SA 1JNDA 5LA1A 2VX4A 1QNQA 2DT0A 1KXHA 4MB5A 4AD2A 3W6MA 2W66A 1MWOA 2EPKX 3K4DA 4AISA 4V28A 5HBFA 2WC4A 1K9TA 4S3JA 1M53A 1C91A 2C0HA 4WSJA 3CZJA 5GNZA 1IV8A 1GNXA 3CZ8A 3CUFA
chains in the Genus database with same CATH superfamily
1KFJA 3LTSA 1UR4A 5F1UA 3CUIA 2O55A 4K8HA 3K46A 2A85A 1OEPA 2QT3A 2C1GA 1E44A 4Y96A 4JPGA 1CWYA 2J75A 4HMEA 2ESCA 2J6XA 4NILA 3SIZA 3PM6A 3NZ1A 4Q6XA 1V5XA 4F40A 1KKRA 5EMYA 1AH3A 1KQZA 5JBDA 4LJ3A 3WH6A 4MNLA 1UA7A 1H49A 1UR1A 1RPKA 1P7TA 2R1PA 3PPFA 2L2SA 3IJ9A 1XGEA 5MHBA 1A50A 2Y1HA 1KFLA 2YIHA 3BURA 3M4HA 1FHUA 4AEFA 1SR9A 1KLZA 2R91A 4C6CA 1CPUA 3T0TA 1FH7A 1K8ZA 4LAMA 1N8FA 4UQBA 5J6EA 1B6CA 3PJWA 1LL6A 1SJAA 1Q6LA 4LV4A 4Q22A 2CWXA 4JFUA 3RNDA 4WF7A 1HNYA 3MKCA 4B5SA 4JKMA 4ZQNA 1YE6A 1I9CB 1M65A 4C6OA 4AIBA 3DZ1A 4M51A 4DH0A 3U0HA 3CO8A 2DT1A 1XKYA 3M0XA 3BSGA 1IYXA 1XBZA 2VFHA 4V15A 1KM3A 3TN3A 3VKCA 1T8QA 3DDMA 3IGXA 1LQ2A 4GX9A 3EXSA 3KZSA 4KWUA 1V08A 3PVFA 3CK5A 4G56A 4UTKA 3IV3A 3DHPA 2ZWYA 3DH7A 2V5KA 5CSYA 3FOKA 4IXXA 3UP8A 3QW4B 1ISZA 4QT3A 2G4JA 3DI0A 2DT2A 3DIPA 4JTFA 3AHTA 1QHPA 2VD9A 3N13A 2PN0A 3T8QA 3WSUA 3CUXA 3GU9A 4LNCA 3TCSA 3WQDA 3S1VA 1GVIA 4HBKA 3LNPA 3C2EA 4AYGA 1LLWA 2P10A 1R2RA 4PB3A 3VNMA 1W1IE 3DYPA 2FZMA 3UF8A 3U48A 1OB0A 4DO6A 1YDOA 4GIAA 1H7NA 2ZUVA 2PZ0A 3EDFA 2NX1A 4CD8A 5LHEA 7XIMA 4CQBA 4RXGA 1S3HA 3XISA 1PTGA 2E67A 4C65A 3TC6A 2VVSA 3W72A 1BQCA 2A7PA 1CB2A 1OX4A 1U5JA 5AVNA 1R38A 2I14A 2MLXA 3LDVA 1DQUA 2ALDA 2QEZA 5ABGA 3OEXA 3DC0A 3KTSA 3GM8A 4PBEA 2HDJA 4EKJA 4QJ4B 5CC6A 4DXVA 4WKHA 4JAWA 4HZMA 2M1IA 4JL1A 2G4FA 4L4MA 1L6FA 1KGWA 1C8YA 3NQCA 4GVIA 4GJIA 4MUZA 4EPEC 1RVGA 3WH5A 1TVLA 1X1ZA 2OG9A 3EXTA 3LX9A 5IFTA 5ECUA 1R7OA 3HGOA 3G8EA 3SRFA 2VN1A 3NVDA 2HNEA 4IQCA 3TJIA 3STCA 3QPYA 3SSZA 1RD6A 3VK5A 3EDDA 4M24A 2AAAA 2BY0A 4D2JA 3A3HA 1S3TC 3SSJA 1K8XA 1UH3A 1DTUA 3SB0A 4QTGA 3RM9A 1BL4A 1HJQA 2I56A 1QASA 5ECVA 3KEHA 2C6QA 1RQHA 1FD9A 3B40A 1H61A 5DLCA 1ZBKA 3UT0A 1Q6RA 3UG3A 2OELA 3BW4A 2CWNA 3ITYA 3ARPA 4J5NA 2OKOA 4N19A 4YVPA 3V4BA 4XZLX 1XDLA 4ZO8A 1OM0A 2POTA 1YIXA 1QPQA 3JXVA 3NRKA 2Z2BA 3HA1A 1SW7A 3IKDA 1Z48A 4JBRA 4B5WA 5T8GA 4LUJA 3O5PA 3O8AA 2PMQA 3W71A 2DH3A 3DFHA 2CW6A 3NCOA 2Z7GA 3BICA 3WDJA 7TIMA 3D3FA 4HK7A 4ACYA 4HYWA 1D9EA 3WF1A 1Q13A 1GQNA 1SFJA 4EX4A 4ICNA 2O9PA 3RIKA 4D72A 1OZMA 1TWZA 2VEMA 5M5DA 4RDYA 3TLLA 2IW0A 4NXSA 3A4WA 3Q58A 4C6BA 2JKPA 2Z1BA 4PRTA 2Z29A 4US5D 4LUIA 4Q7IA 1E1CA 1FKHA 1WPCA 3LXAA 1TPEA 4LX4A 3MS8A 4K8GA 3VKJA 2R1KA 4GHRA 3LCLA 2VVNA 3NO1A 1GVYA 4FLOA 3GX9A 1B0IA 1B3VA 3RFWA 2BHUA 2GWNA 2ZTJA 3UZJA 3WJWA 3E5BA 5CAKA 4IQ2A 1E51A 3N6HA 4PMQA 2YYTA 3KHDA 1HXVA 4OJYA 5HUPA 3NO3A 1F3EA 2D0GA 1JIBA 2GJXB 4IT1A 2D73A 5TF0A 3W86A 3RX3A 1CLXA 1LTDA 3APTA 2HS8A 4D6JA 3RMJA 1AQ0A 3SCVA 3GFXA 2OB3A 4AY8A 2IXUA 4I7VA 5CPNA 4TR9A 3W7PA 3HJEA 3PBUA 2YKKA 1C93A 4NNRA 3A4JA 1CXKA 1GZGA 3KACA 2W9MA 3WX7A 1NDVA 1Q7MA 1NWTA 1QPOA 2WO5A 5EA9A 4CN4A 4DXXA 4RUBA 5DBTA 4A8IA 3NYDA 1KFEA 2EGZA 3GC5A 3TROA 4O8RA 1MW1A 2GYIA 1A5BA 1HJWA 3KOFA 2FIQA 4G5DA 1GONA 4UTIA 5FF7A 3NEVA 1TJRA 2WMIB 3TTSA 3UYCA 2PGEA 3VD7A 3CWNA 3MV11 4E8CA 5GQBA 4CNNA 1KFBA 2O0TA 2KZHA 5KEZA 4BWLC 2GUBA 1HL2A 4CCCA 1YW1A 1RA0A 3CGTA 1C8XA 3VDGA 3SCNA 5LNRA 4DJED 3LY0A 4ATWA 3G22A 4IPNB 3TCZA 1K03A 3M9YA 1ZJIA 3KADA 3O9NA 4DF0A 1HIZA 1LF1A 1YPXA 3MUCA 3RILA 1CGTA 4L1XA 3WF0A 3KAFA 3WQVA 3SAZA 2WJFA 5FJOA 4M1BA 3OPSA 1Z42A 3K4WA 2A79A 3W00A 2VNCA 3LLXA 1A5SA 3CB8A 2QCDB 3KRBA 3I7RA 4IMCA 5T91A 2DG3A 2VCDA 4D8AA 3INPA 1HTIA 2FMOA 1WB0A 5K4XA 3LZ3A 3VE9A 3ARYA 3V5FA 4NZ3A 4MY9A 1FKDA 2CIPA 1GUVA 5D9OA 3WD1A 4QROA 3QC3A 4FXRA 3W29A 4E38A 4L9ZA 4O4VA 3GWQA 3VC5A 2QV5A 6A3HA 1LLOA 3GY1A 3N2OA 2P5NA 3UZ5A 5A6JA 4I5XA 2GGIA 4LS2A 1CGXA 1FXPA 4AHQA 2JFEX 2ZUUA 3CQJA 2WBGA 5DCEA 2GQ8A 3ARWA 3IUDA 4IPLA 4DJEA 1SZFA 4GKLA 4KETA 2VENA 4OTKA 4XAGA 3HB9A 4QCFA 3G0XA 1CLKA 1FP9A 2V3FA 1EJWC 3TEVA 4DNMA 1X7IA 3ZR5A 3VIPA 4A8LA 4JNMA 4QBXA 3LV6A 4JTIA 1V0NA 3F2CA 1KFCA 3FV9A 5AHLA 4WDUA 3AIRA 5F2LA 1XX1A 4CQAA 2YDAA 4UTWA 1HP5A 4AVNA 1SZEA 3L0NA 1TV4A 3N73A 1XIIA 1E1FA 1GKQA 2FHCA 3W75A 3M47A 3B0YA 5HR6A 4UOJA 2Y62A 1CBGA 3SGGA 4DI9A 5BMWA 1GEQA 5A8OA 2G3IA 2EHHA 1GOQA 2OGJA 4NAEB 1NQKA 2OYKA 1Z69A 3CAKA 2E6FA 3PP7A 4WRHA 4JY8A 1OG0A 3DENA 3ID7A 1NDYA 3AIWA 3WK0A 3FVMA 4LEQA 3BLPX 7PTDA 2VFIA 2VMFA 2YL8A 1DWFM 1U1UA 3GK0A 5KSWA 4MZ1A 3VCNA 1V02A 1UWTA 2ZZ5A 4WDTA 2EPOA 1OT2A 3RM4A 1J0ZA 4GG9A 1SVDA 4C6KA 1UUMA 2PGWA 4HVXA 1JAEA 3MTWA 4MG4A 3BG9A 1RXOB 4FSAA 6TAAA 1SO3A 3MHGA 4LAUA 5FI8A 5AC5A 3BJFA 4F2BA 3R8GA 3DKLA 2V30A 4Z1BA 4U5IA 1QI2A 1QW9A 4FNSA 3E5PA 4L4LA 1VBRA 2BXVA 4AZGA 4WXZA 2YCLA 5ABTA 2J66A 2IKHA 2AL2B 3BAYA 4X60A 4IG2B 3LCHA 1A5LC 1NDWA 1GQKA 4UMAA 3CU2A 1ICSA 1G94A 3NGFA 4AXKA 3SDOA 1Q6UA 4KF1A 1KT0A 4QZVB 3EWZA 2P88A 3NO5A 4MGGA 4LW7A 4JEQA 3PR2A 4IJBA 2C19A 4QR6A 4UC5A 3BUVA 3QY8A 3VDCA 2NX9A 2HROA 3WH9A 1SQ7A 5D8ZA 2LJ4A 3JR2A 1YDNA 2H90A 1RBLA 3GR4A 3RHGA 4YN5A 1QMLA 3K8LA 4GIVA 3K30A 1R46A 4P61A 3CGNA 1P5QA 3B0UX 2A0NA 4ASTA 3HG2A 3IK2A 3DXIA 4C7GA 2ZIDA 4DWSA 4FLRA 2BVWA 4TVDA 4ZE5A 1ZP3A 5IXEA 1QATA 4LBUA 4CU6A 2QV4A 1TCDA 1GWJA 3K8MA 3UZXA 3TWAA 2QDEA 4DRHA 4XO7A 4IIFA 1G4SA 3CAVA 1GOWA 3HIJA 2JGQA 3STFA 2C79A 5FA5A 3QY7A 3AHYA 2ZX7A 3PULA 2E6DA 3KOYA 3R94A 3C2OA 2OYMA 5EMLA 4KGJA 1AMKA 3QVQA 5BU9A 1GHRA 1VD6A 1JZ6A 1XLDA 4JDYA 1U22A 4FXFA 2WCGA 1J5TA 1D7KA 4R5EA 2HMCA 4YCPA 2VGGA 4BF9A 5BWFA 3IVTA 2NWRA 4DELA 3C8FA 3JU2A 3S5ZA 1KR1A 3NQGA 4IICA 4HNUA 4MYAA 2GK1B 2XP6A 3MVIA 1WDRA 1O4UA 4QHRA 1ME8A 3Q65A 3GDLA 2OT0A 3W7KA 2Y5SA 2Q3RA 3VIGA 2QR6A 4EE9A 3I3DA 1C8VA 4ZEPA 4L72B 2CERA 1XSKA 2EG7A 1IT8A 2PPPA 2VR2A 1JD7A 1YE4A 2Y78A 1SO6A 1WKYA 4ADSA 1VFUA 3WQ6A 4R7JA 3W7LA 3B9NA 1ECQA 4WY0B 4AZ6A 3FAPA 3WK1A 4S23A 5A94A 3A4AA 3ANVA 4NAFB 4C7DA 2ACSA 4L6DA 3MUY1 1MW3A 3UWWA 2PDJA 5GNXA 1NOWA 1KRAC 5CPTA 1SJBA 1FTXA 3P5YA 4GUIA 1K6WA 2PBGA 4DBEA 1GVFA 2PEVA 3N4AA 1M5WA 3TW9A 9CGTA 4JQ2A 4F2UA 4Z42C 5HW8A 4U5KA 3QLLA 1OWQA 5H8UA 1UIOA 3B03A 3ABRA 4ZPVR 4CVWA 3OZOA 1OD8A 2E40A 4UXDA 4GGBA 1J4IA 2NXIA 3KS5A 1EPVA 1IXPA 1TTPA 3W53A 1K9DA 1CLVA 5HR7A 5EY5A 3RXZA 3AHZA 4EXAA 2X1RA 1HGWA 3GC4A 2NXHA 1JRBA 1VHNA 3BGGA 3BLDA 3G3MA 4E4FA 1DBTA 3BLKA 2E6YA 3ARXA 2JE8A 4ZO7A 2JALA 1OQFA 3A23A 4NJHA 3IJIA 3A24A 4ZE4A 2QCFA 3KW3A 2J79A 1LL7A 4XVDA 1ZJAA 4QE4A 1R5YA 1FKJA 4DRMA 4GIRA 3AIEA 1E40A 3R0DA 1D3GA 3O05A 1R30A 3DG7A 2GQAA 2ZX6A 5FEWA 4M6PA 4IP7A 4FNUA 3WUGA 4K2SA 3WMCA 3EIPA 4W9QA 3IV8A 1E4MM 2OWCA 3UCCA 4GACA 1CGYA 1UH4A 1KCXA 4XBKA 4UTTC 1K7FA 3PZUA 2PRHA 2VRJA 1EDGA 1JRCA 5HDRA 4P8UA 3HG3A 1DEDA 2PA6A 1UD6A 4AAJA 2WYSA 2F84A 1R3WA 3FS2A 4ITZA 3CV6A 4J3TA 2W4XA 3MO4A 2O4MA 1RR2A 1O6IA 1VRXA 3I68A 4GVGA 1NH6A 1XIBA 3ANYA 1XYFA 3M0KA 2H9AB 4TU1A 3AS0A 2PDPA 1WA3A 2IQTA 3R43A 1B9ZA 1B3WA 3UZWA 1TQXA 2G3FA 2VKZG 1KBJA 1WOBA 3DHDA 3SFWA 4GUHA 1XLGA 3AO0A 5IBXC 3LTYA 3ZR4A 1V3HA 2VFFA 4MAVA 1OCNA 2VR5A 4WSKA 4Z2IA 1G1YA 3M43A 2B0MA 1IZCA 4R85A 3LG3A 1JZ8A 5HWBA 3FW6A 3AXHA 1X97A 4DRIA 4WJ8A 1FY6A 2O4QA 3HGRA 4XZNX 2ZXAA 5BXTA 2DG4A 4JTLA 4FR6A 4I3GA 2F2DA 3M1ZA 3L2LA 2D69A 3PJUA 3UZYA 2E77A 5KZEA 1DWIM 4A3QA 3FYOA 1XH2A 2Q09A 3UG4A 5C9XA 4CU8A 4UFJA 1E3XA 2BB0A 2XJ7A 4JYSA 4Z08A 3OLDA 4Z0JA 4NY2A 2BODX 3WFZA 5CGMA 3DFYA 1FVPA 3PJTA 1JQXA 2B81A 3HBLA 4IM4A 3BQ5A 2NQZA 1PZ2A 2QJHA 2QMKA 2PPNA 3KBWA 7ODCA 4GH3A 2BG5A 4B2DA 3TYEA 4H7ZA 4D6GA 3LSCA 2ZXDA 4K6AA 3DFPA 1FWWA 2XU2A 5I02A 2WQPA 1RPXA 3UXAA 3VM5A 3UG5A 2RUCA 5DIVA 1W1PA 4A4AA 2VEGA 4Y6GA 5FF4A 1RCOB 5MF5A 1TJ2A 3IJQA 1R87A 4HCHA 3MBDA 2OSWA 2IUZA 3EKLA 1H7WA 1VJSA 5HPCA 3E49A 1WKFA 4OBTA 1A3WA 1UH2A 3UWVA 4ODRA 2XTKA 2ZUNA 3JVAA 4PH6A 4W5UA 3WQ4A 5E09A 4LVBA 1G6CA 2NUXA 5FJIA 1DXFA 1MNZA 1YEYA 2OT1A 2ZX5A 4YJ5A 2G37A 4JQAA 4C6PA 3I10A 3GTFA 2R9RA 1SPQA 3MJMA 1PSCA 3WNMA 2GUYA 2IS7A 3VX1A 4PC8A 3EMZA 3E0WA 3PA7A 2B7NA 4LFYA 1JCNA 3W3OA 1F9CA 4CNPA 4N2YA 5A8QA 1A5MC 1E70M 4DF2A 4PMDA 3NI6A 1LOLA 1LORA 1UWIA 2QAPA 3P3BA 1THFD 1A5UA 4PTNA 1XLIA 4IGMA 1J6OA 2ZR6A 1E6QM 3QZ6A 5HWNA 3MW7A 4Q4SA 3SRDA 1L0PA 4PUKA 4M6QA 3OLIA 1VFHA 3UJRA 4RE4A 4R34A 2GQ3A 4DM1A 4DHGA 4U28A 3F5KA 4DBSA 4TW8A 1CENA 5LNVA 4HK6A 3H26A 3JUGA 4CLMA 4C1KA 3RM8A 5D37A 1PS9A 1OC5A 3M5ZA 1SMAA 2C7FA 2ZRWA 4K68A 4GC3A 3LGEA 3PZQA 4MDOA 4HU0A 3AIVA 5LSMA 1IEQA 1K4HA 1XD0A 4H9YA 3HGSA 3EA2A 2DGAA 3S47A 2FDMA 3A22A 3F4VA 2GSJA 3CT2A 3PN8A 4DIPA 4WQ6A 3RUBL 4CD7A 5EBAA 1UR0A 2E5CA 2VZUA 3WL1A 4HSHA 1ZZMA 2H6RA 1LQAA 3RCMA 3UD6A 2QDHA 5FKYA 2E9BA 3QMRA 5U7SA 3HM7A 3V16A 3P93A 3U57A 5JXQA 2W6RA 1XXXA 3W83A 2CBIA 2ZUSA 2WSRA 4QG9A 1BTMA 2XVLA 1NIUA 4KEUA 2WMKA 3TMQA 3GB6A 2DZVA 2VURA 4RPQA 1UR2A 1U83A 1GVEA 5D38A 1KD0A 1H7PA 7REQA 3ZO9A 4GXPA 1SSDA 1CDGA 5D8WA 2PBOA 3UXIA 1JD9A 3GDRA 4CEXC 3ENLA 3IIZA 3W7DA 2VCBA 2PWHA 3H2OA 1RLDA 1R85A 4S3GA 1DL3A 1XS2A 4K3ZA 3UEQA 4UNIA 4OU1A 4LYPA 2CBUA 3DYOA 5CPSA 1EUNA 1GW9A 4W9TA 4F0SA 1JXJA 3P61A 4W5ZA 3TUUA 4PEEA 3VIJA 3PG9A 3RCNA 2YXGA 1ZAHA 4JHZA 2OQYA 4NZ4A 2E8ZA 1NELA 3CT7A 5E9AA 3A4XA 4GGHA 1Q1CA 2OZ8A 2NQJA 3DEQA 3AYTA 4M29A 2WC3A 3BCFA 4L56A 1IXOA 2CESA 1ZK6A 4HCDA 2CHNA 1KBBA 2O92A 4RJEA 1J6YA 2PDIA 4WHBA 4YMZA 3WYZA 3ZR6A 2J27A 5G2HA 1FWTA 1P0NA 4N6EA 1S5MA 1NAL1 4KW2A 3O1NA 2XPBA 1TB3A 3T40A 2CZEA 4O1FA 3CPRA 3EY6A 2FYMA 3EA1A 1RY0A 5AECA 2VRQA 2CKRA 1AMYA 4GQGA 4Q4MA 4JTKA 2W63A 3E2SA 1Y5WA 3PBMA 2VEKA 1S2TA 3UW6A 3HU7A 1XUUA 4FAMA 1WQ5A 2Z26A 3WH7A 3F5JA 5IDZA 2Z7KA 4J4NA 5HANA 1ZAIA 2NV9A 5C2XA 4PUEA 4PCNA 2P3ZA 3GNXA 3BAXA 4RLIA 3D6NA 5HQLA 3NPUA 4EAMA 4DO7A 1TJ0A 5IM51 2BNJA 4W89A 5AOUA 5ABFB 4G50A 5C9ZA 1W5PA 1LM1A 3MMDA 3MUIA 2P3EA 1FHLA 2VXNA 3W6LA 1DOSA 5B7ZA 1EL3A 5FF3A 2VX5A 1VRDA 1J2BA 4P7OA 3VKAA 3DAQA 2R6OA 2PGFA 1JDAA 1VGAA 2PTZA 2YDQA 2QNEA 3UQBA 1EP3A 3BOFA 4MNJA 1QR7A 1CNVA 2JBMA 4XQ6A 1JPKA 1QZ2A 4QP0A 4OVXA 1QI0A 4JTEA 2P8CA 1VIWA 4O11A 5A69A 1TPDA 4HHPA 4LYQA 1GOOA 1T99A 2PD9A 1EJRC 3W73A 3WFAA 5M2FX 5M1TA 4S2BA 4LU0A 1TV8A 3NR0A 2WVUA 2G50A 4PB5A 1UC4A 2ZX8A 4WGXA 3MUAA 3WN6A 4NRRA 1D8CA 3AI0A 4HOZA 3NTYA 4MB3A 3LHTA 4AX6A 1XRTA 2WHKA 2WKLA 1Q6IA 4NUWA 3WQ5A 1IWPA 3WNKA 1JGMA 5IOBA 2VFEA 3SY5A 4ADUA 3MHUA 4PRWA 4S1FA 3JZEA 1RUSA 4W7UA 4C6IA 4UTFA 3CHDA 2GDUA 2HEJA 4H6KA 2I16A 5AVHA 3UJ2A 1VF8A 2ZFAA 2AKZA 4DJDA 2PTYA 1J4EA 1TRDA 2DZSA 3QLDA 3II1A 3M6DA 4U2YA 1ONEA 1QPKA 3NOYA 1S5TA 1WP6A 1GVSA 1FHDA 4F2TA 1JG9A 2WMIA 3JZUA 4GYPA 1JZ2A 4CQ8A 2J78A 4RZBA 4PA8A 2VQTA 3TMLA 3I4EA 3B8UA 4LUTB 2F38A 1GTHA 4F66A 3L5LA 1F40A 1SW3A 3VM7A 3U2OA 4DRQA 3MMUA 2X1UA 4UUIA 2XDFA 3I4KA 3L4WA 5REQA 3NA8A 1OINA 5D2WA 1BSIA 1XM3A 3F03K 2BSLA 3G2GA 3VNKA 1O5XA 2EKGA 4JNZA 3SQMA 3LHYA 3SCQA 4OUEA 5D30A 2ZICA 2ZE0A 3BVJA 1FRBA 3KLLA 4KRTA 2DSZA 8XIAA 4QT2A 4J9JA 3T78A 1N82A 3WMLA 3KAIA 2CZ5A 4QSFA 4XZ9A 3UVIA 3WF4A 4K37A 3PBWA 3WJZA 2CU0A 1CYGA 4O18A 4DX3A 1Q4NX 1FCVA 4YYCA 1KNWA 3SBFA 3LHZA 3QQ0A 2AQVA 3KP1A 1UP2A 1UD3A 4DUOA 3TONA 1V7AA 2X16A 1HJUA 5B8IC 3UGRA 4NZCA 2EXOA 4PULA 3BTNA 4PMVA 3B8SA 3OIXA 4WY0F 2W27A 3WBWA 3IJDA 4M6VA 3MWAA 3UI4A 5I06A 1W8GA 3W6MA 4IIBA 3ODKA 1MWOA 3K4DA 3FKRA 5BOOA 5HT1A 3SFKA 4PL1A 2FZ9A 3A9BA 2ISFA 2F6XA 3R0KA 1IV8A 3CZ8A 3CUFA 3PWIA 3BG3A 3ZWTA 4WZHA 1F8MA 3LPGA 3KBSA 1Z8AA 1P0DA 2ON3A 3VDBA 4NL1A 2EQDA 3W87A 4UTMA 3UWYA 2RUDA 2J8FA 2VC9A 2OO0A 4MNKA 3FFSA 1F4HA 2HBVA 2OKTA 2WPGA 3OQ8A 1POKA 4K36A 5XIMA 3GTIA 2LLEA 4JTHA 1YBQA 3W1RA 3KHJA 1ROTA 3JS3A 2DW7A 1OFEA 1HG3A 2C3ZA 2FH8A 2RAGA 2VOTA 3OVGA 4Y9OA 2BXZA 3TK7A 1JCTA 3PRDA 3PZOA 3ZYZA 4AMAA 3PFMA 1QU4A 4QQUA 4NRSA 2Z1KA 4ONVA 3WQOA 3OZYA 3B9OA 1GYMA 1VFFA 5ENLA 1EOMA 3PAJA 2KGJA 1LRTA 1D3HA 3BAJA 4JTCA 4DRJA 4ODMA 5LIUX 3RDKA 1W37A 4ICCX 2ZRYA 4KS0A 4M56A 2GPTA 4LAXA 1L2QA 1MEIA 3E2QA 4P8VA 4RNHA 3NL3A 1A4MA 5A8PA 1FKTA 2RSEA 3W76A 2YW4A 2GUUA 5DANA 3UA3A 4C1NA 3W24A 3FXYA 4GQQA 2BASA 2Z6IA 1EFZA 3EX2A 4Q6JA 3W70A 1KTNA 1OK6A 1F6PA 1XKJA 3K13A 2ZUMA 4P8XA 2RUSA 4DM2A 3CL8A 4PBFA 3CHCA 2XWDA 4M6UA 4JYDA 2VX6A 2XM2A 1KGUA 5HJYA 3GNOA 2A3HA 2D2OA 1XYCA 4BA0A 5K4ZA 4E2BA 2XGIA 5G2WA 4Q8QA 2BLEA 2I5IA 4D6IA 3T0AA 3M5VA 4WKFA 1LL4A 2OFNA 3NWRA 3N19B 4IMGA 3BAKA 2FZBA 4MSSA 4Z1AA 1MXDA 1RP9A 4YCOA 2QUVA 4G2PA 4QEEA 5JH2A 3H9RB 2V5DA 3CQHA 2ABBA 5LXXA 2V67A 3B7XA 2V0TA 3IIOA 3CUHA 3WBAA 2G95A 4TX6A 3BGJA 1CGWA 3PJXA 4F0HA 1FCQA 3EWUA 5TD4A 1HZYA 3L4UA 4LRSA 3E38A 4M82A 3WEOA 1SMDA 2F23A 2DPEA 4TYOA 3CL7A 2IPWA 3DHFA 3W85A 4F0LA 1GORA 2YLAA 1OX4B 1PZ1A 1ESWA 3SEPA 3BO9A 3MYPA 3OA3A 3O5JA 5L6UA 1SZRA 2YX0A 3WQFA 1JZ3A 2GGEA 4UOZA 7A3HA 4OFCA 4GZ7A 5A1AA 1QI3A 3N2CA 1I4NA 4FK9A 1TG7A 3PF3A 4K7YA 3H54A 1LG1A 2NZLA 1YDYA 2H3BA 3ITTA 3W0KA 3SCTA 4Q4OA 1VC4A 2XP8A 2DUXA 3ARRA 1AL8A 2I17A 1XIHA 4OHQA 4IWWA 1G01A 1DV7A 3GH7A 4TXEA 2B5UB 1HN1A 1KRMA 2Z2AA 3LUOA 3NFUA 3D46A 8TIMA 5CJ5A 3WD0A 3H2CA 3WLOA 5TBOA 3VAVA 4ZSTA 3VTRA 2JKAA 3EPNA 2E6AA 1TA3A 2Q71A 1QHOA 1Q3NA 1L6GA 1PUDA 4AZCA 4UTJA 2TAAA 3VOJA 2I9UA 3A9IA 1MVYA 4JCMA 3M0JA 3TX9A 1AJ0A 2DZWA 4IMEA 3T81A 1H63A 2GK1A 2XH4A 2BBFA 3QMSA 1YPIA 5I77A 3GVRA 4M19A 3EMCA 1VHCA 4Z2LA 1P6CA 4B4HA 3OIHA 2YL6A 5CG7A 3F1QA 4HP5A 1TX2A 5CGQA 1TZ7A 4DJEC 1RQBA 4I5UA 2X1IA 4REQB 1G7VA 3CH9A 1F6YA 4JIRA 5A6LA 1TPH1 1KCLA 3LU2A 3UI6A 2CLIA 1JCJA 2OU4A 5D2VA 2ZZ7A 4I9TA 1VEMA 3WLSA 5AYYA 3GZ3A 4O1DA 1K8CA 5A95A 1V6YA 3T44A 2C1HA 2C71A 1ROUA 5CJMA 4LPCA 4NT0A 3TV8A 5FACA 4LH8A 2AL1A 4PBGA 3W1LA 4UTWC 2V82A 2ZC1A 2EAWA 3GH4A 5LXEA 3UNDA 4AVOA 1PKMA 1IR2A 4A22A 4YPJA 1EZWA 3V18A 3H2AA 4ZTXA 1E1CB 4R3UA 4UFIA 2WNQA 5HNNA 3W37A 2FMNA 3O5FA 3W2KA 2VP8A 3PTDA 3CV2A 4KIRA 3KOZA 1ZCNA 4PUJA 2AQWA 1HKMA 3UGVA 2Q02A 4D6CA 4MFEA 3T2OA 3AYVA 5CBIA 3EMQA 1IF2A 2PAJA 3H4WA 1BG4A 1KM0A 4NJGA 2ZQTA 3A6OA 3HMCA 1DKWA 2FH6A 3ICJA 4TX8A 1Q7QA 1XI3A 2GJPA 5HQMA 4O53A 3W7NA 2BS9A 3ZJ7A 4N0RA 3LRLA 3XINA 3SUWA 4Z1YA 2EG8A 1YQ2A 1S2VA 1JNTA 3PANA 4KRUA 4GY7A 1C7SA 3PFRA 4HMCA 4ODNA 1YX1A 2BY3A 1YNYA 2ZQ0A 3CH0A 4AD5A 1MUMA 1VBHA 4PFHA 4QNEA 3DFQA 1C3FA 3MDUA 8RUCA 2ODOA 4J3XA 2OX4A 4E3VA 3N9SA 4Y9PA 1XH0A 2HS6A 1ZBCA 2NSXA 3VIIA 5HWMA 4EPDC 1E0UA 2PE4A 4A21A 4CN6A 2C0AA 3MP3A 5JIPA 3W1UA 1FBAA 3BQ6A 1I75A 1BKHA 2J7BA 5FJUA 2P0IA 3RR4A 3LGGA 1PIGA 2REQB 1IXQA 3AU2A 3BZJA 4QS5A 5IDIA 3PY2A 2HCVA 3NIYA 4ZVJA 3IEBA 3KUMA 5BRQA 3M5YA 3WDHA 2H9AA 2MPHA 5DITA 1EC8A 5AN7A 4Q4RA 1MO0A 1VAHA 1OC6A 5PTDA 4OGZA 4PUDA 3NQ6A 3UCQA 3J7HA 2ATMA 5DEZA 3R4IA 1XCFA 3MCOA 1ZBVA 2PU1A 3B0VC 1H5YA 3ZVIA 1K6AA 1NY1A 3N9RA 4J27A 3QRHA 1QNSA 5HMDA 1Q2SA 1QT1A 3DG3A 3LCFA 1LUCB 1MUWA 4DWSC 2I57A 1GVQA 5H8PA 3R8HA 1HKVA 2V2DA 1JYWA 3PSWA 2OLAA 1S5VA 2PI6A 3WDRA 1XBVA 2DIEA 4PMUA 4AFYA 2YA0A 1A5NC 2Y85A 1W1VA 3WELA 1LG2A 1RBOB 3W23A 4JFTA 4RXFA 3T07A 4DY1A 1ZLPA 4F0KA 2EPHA 4J3UA 1NWUA 1MI3A 3EX3A 3W7RA 4QSHA 1OYAA 3DERA 1U79A 2EPNA 2QJIA 3K8KA 3RCYA 2E0PA 3NQEA 3CUJA 3VVGA 5FIPA 2Q3OA 3KTCA 3H21A 4LVGA 4H9VA 4QNWA 1OF6A 4LNYA 5F2GA 5HK4A 4S39A 3HZ3A 3GVWA 2TSYA 3HF3A 2WMGA 1SFSA 3DFNA 5DELA 1R3TA 2XIJA 2ZXBA 2DSVA 3PB2A 4F79A 3XIMA 4O12A 1ITXA 3HTWA 3HOJA 2V5LA 4JICA 1OIMA 4NNAA 1XRSA 1IEXA 3IAQA 1O68A 1V3MA 2ZZ3A 1M7JA 4IGHA 3QV6A 3ATZA 1Q45A 1TMHA 1QPFA 3AZSA 4GQ0A 3IVUA 1UD4A 3QKZA 3OP2A 1UR3M 1BXBA 4JHOA 5A8MA 5I0DA 2ACUA 2DG9A 3FSTA 4GBDA 2Z28A 3S2MA 4JTGA 4A2RA 4ERGA 1W32A 1LJYA 1S2AA 1U33A 4Y90A 3OOQA 4U3AA 1FKKA 2BWGA 3ARTA 1RK5A 4AD3A 1AQFA 2DIJA 3RRXA 3A5VA 3G1FA 4L65A 1UD2A 4Y9MA 3G6LA 3V3WA 1D7FA 5K9CA 3R12A 4NI8A 1W9VA 1SFTA 4AZBA 1CECA 1XYZA 2B7QA 3ZJKA 4GI6A 4FB7A 4JTAA 4JQ4A 3CL6A 3KOWA 3E74A 3UY7A 5DCBA 1NOFA 4TIMA 5AY7A 1HKJA 4S2CA 4ZQMA 1XLLA 2GJNA 2VZSA 1K9EA 3NQMA 1DXEA 2C8NA 4H7VA 4IJRA 2M2AA 5C70A 3AWNA 4Q32A 1W1A1 4ACZA 1VFMA 4MLJA 3IANA 1KWGA 1ZENA 3L66A 4MKVA 4O8AA 1UBSA 4YIWA 2V5BA 3CM4A 1DWJM 3THAA 5C7VA 2WMHA 1I0DA 5CBBA 2VJXA 2YCLB 3OYZA 2VI0A 2DSUA 4BKNA 5AYIA 2CNCA 3O2LA 3H53A 4IIDA 5IHRA 4HARA 1W31A 1MW0A 2TYSA 2UZ5A 1B1YA 4FX8A 3VD3A 1V51A 1GJPA 1AJZA 1KKOA 3P0WA 1G4TA 1UQYA 3AMGA 3PHAA 4OWGA 4GH1A 3S1UA 2WK2A 4O13A 3CHEA 2OMAA 1H09A 3F4DA 4HTYA 5JH8A 4GUFA 1FAPA 3EPOA 6TIMA 3THUA 2JF6A 4JX4A 3LZ5A 4AZHA 2J6VA 4LYRA 3N3TA 3W81A 1A5OC 4MYXA 4IL2A 4HJFA 4GRSA 4DUWA 2FZNA 3R1ZA 3KCOA 2DV0A 3G6MA 3AFBA 4E0CA 1V79A 3VNDA 2W67A 3SRKA 1S38A 3CUGA 1JULA 1GYLA 4LC6A 1UZ4A 1PINA 4GA8A 2VRKA 1BLIA 1J79A 1LBFA 5D9NA 2F2HA 3FX4A 4W7VA 3BC9A 2GQ9A 4DWSB 4D6HA 4TX0A 1R6WA 2OPJA 4U31A 3S9IA 1GVOA 2QCNA 3GDBA 1LOQA 1ADOA 3HGJA 1EC9A 2G96A 3SCSA 5CC3A 3VMOA 3ATYA 4XWUA 1W9UA 1ZGDA 1O5KA 1W8SA 4LS0A 3TU9A 4FXJA 4ALDA 4GQRA 4O10A 2XIQA 1RBAA 3W1QA 3H7UA 4WCJA 2QGHA 1UW9A 2PCEA 3IAPA 1L6SA 1U2YA 2ZUWA 4LB3A 1RZMA 2Y8VA 3NQ8A 3K1DA 3LENA 3L23A 3RFAA 3PZNA 4O14A 2FKEA 4NNCA 4R7OA 2CZDA 3T7VA 1CW2A 3AALA 3TW7A 3QXBA 1UD5A 4ODKA 5KZMA 4I6VA 2NSOA 4DVOA 3BZGA 5G4WA 4ZOAA 4G9PA 4OT7A 5DXYA 5LGXA 1OK4A 4DRNA 3G8RA 4TO8A 3LB0A 1WDQA 3CAWA 4JIIX 4EVZA 1NEYA 3WEZA 2WLZA 3GPKA 2XVGA 4ZPWR 2QMJA 3U8GA 1G7UA 3G24A 2DVXA 3WZ0E 3GR7A 1XV8A 1QNOA 1ZBWA 1TCMA 4DYJA 3MV01 2HSAA 1BXCA 1X6UA 3NUKA 3WNLA 1HJSA 4H83A 5F4WA 2PDXA 2BHZA 4GI8A 2DZBA 5MKGB 2TPSA 5AHNA 5ABFA 1J4RA 1EQ3A 1X6LA 2D3NA 3UYIA 2A3CA 5A8GA 4ILSA 2J9ZA 1Z7AA 4FHAA 3HPFA 3CIWA 1EKOA 2Y2WA 1BD0A 4DZ2A 4RCXA 2J9YA 3FN9A 4Q8NA 4RPPA 1M3UA 1S46A 3HMJG 1V6VA 2O56A 1GK8A 3VDHA 3W84A 3HO8A 3H4XA 3I6TA 1E56A 1PHWA 3ZZ1A 5E9XA 1ISYA 1VS1A 1JYNA 3GQYA 1OFDA 5CZKA 3B0PA 3UZZA 3JYJA 3UQIA 2R1LA 3H12A 1RV8A 1KQYA 3C86A 5I2UA 3IJ7A 1KM5A 4AY1A 3F7JA 3CB3A 3V36A 4HSOA 4LEFA 3MHFA 4WUIA 1EC7A 3LQLA 1OF8A 2PDBA 4PCSA 3RU8X 1DJQA 3URBA 3OVRA 1Q6EA 2QDDA 1B5TA 1OFOA 3NG3A 4ORMA 1VIZA 2ISSA 4MKSA 3LBOA 3COTA 2WOQA 1F05A 3KL5A 1DIKA 1NM9A 5A6AA 4BF5A 1OY0A 3B4UA 3S6OA 3T08A 2ZRZA 4KFPA 4AY7A 3CMFA 1MXSA 1PCWA 4J1OA 4QQ3A 4Z0SA 4DZ5A 1D8WA 4NNBA 3KXQA 2VOMA 3GFZA 3BMWA 2X0HA 1QJWA 4EP8C 4IFRA 1XIDA 4MIMA 3S5SA 4AHOA 4GZEA 2PP3A 1ODUA 4NX0A 3W7IA 4NZJA 5E1QA 3GXPA 2GJRA 4V27A 1XW8A 1XRVA 5XIAA 2N87A 5BOEA 3MBFA 4YNGA 3MO7A 2CHOA 4D9PA 2YCKX 4GYKA 2OR2A 1EX1A 4XKYA 3IIVA 2QCGA 2G3MA 4AHPA 2QJJA 1OYCA 1LROA 2FHFA 4JIEA 3DC8A 1W56A 4N9CA 2CLPA 1QI5A 2ZZ2A 4I90A 3VD4A 5U4NA 3UWZA 3SJ3A 1RCQA 4IQDA 3S42A 4E2OA 3LHVA 4IIGA 2VWSA 1M7PA 2DSWA 1ITCA 1ZRQA 3AZTA 3O16A 2X0SA 4K38A 3O5IA 4PSPA 1UPPA 1UD8A 2VD8A 1ITUA 3GFYA 1XLBA 3GW3A 3SR7A 3GXIA 3TCEA 3MB9A 4F4RA 4HPXA 4L6OA 3T2PA 1MYRA 3S46A 1UKSA 2YFNA 5LNUA 1XFBA 4PTWA 1FKBA 1IEVA 4LY4A 1E55A 4UNKA 3Q45A 2ALRA 3NXLA 1B31A 3S6TA 1I0BA 3N6JA 2EG6A 3C2FA 5FCZA 4J3VA 1UOKA 2KI3A 4W9OA 3CYJA 1WBJA 3B9AA 3QM3A 1E9ZB 1JPDX 4NASA 3G3DA 4AWEA 5EYWA 5A2CA 2YA1A 4DZIA 4QLLA 2DZAA 3GBDA 3CHVA 1VCVA 1G9HA 3W7GA 5CLTA 4E3TA 1QAPA 1R9ZA 1EYEA 5AZ1A 2DJXA 2DQXA 3KOXA 4V1YA 1SGJA 3KDOA 1V93A 2XN2A 3GNPA 2PF8A 1UKQA 5GPRA 3TR2A 5BXRA 1OJXA 1KT1A 1EP2A 3VUPA 2NWSA 3K2GA 3C52A 4JFSA 1HL8A 4IISA 2FLIA 1A4LA 3H70A 4UZSA 1XYMA 2BGNE 2ZVIA 2HZGA 3SZ8A 3W28A 2NVDA 1P6BA 1UKTA 1SR0A 2X2GA 4AIEA 2E5DA 2DZTA 2YDRA 3M5XA 4JTUA 2WVTA 1E6ZA 1AD1A 3SRHA 2YB1A 3GU1A 4NG3A 2A3AA 2L5HA 2ACQA 1GOIA 1ITQA 1J93A 2NV2A 4HJWA 1IZKA 2AQOA 2SFPA 3CHFA 4KCVA 1PZ0A 3WBEA 3DCPA 1KB3A 4UTLA 1X1OA 3W02A 1EA9C 4IIEA 4H8UA 2J7CA 1PWMA 1MZRA 5CZJA 3VIHA 2R1NA 4ML4A 1FKXA 1E0TA 3OGRA 3N04A 1XQKA 1UUOA 4GABA 1JEZA 4UFMA 4E4UA 2XM1A 1OGBA 1J10A 3T09A 3GAKA 3KE0A 3RK8A 1FWCC 4L80A 1ONWA 4ZOBA 1SFLA 1EF3A 1LOSA 5B80A 3W1MA 2INZA 1LYXA 4PZVA 1IHIA 3G1RA 4OOZA 3VU2A 3IIXA 1P1MA 1TPUA 3TSBA 4W9PA 5HPOA 1FWIC 1HXJA 3EB4A 1BWVA 3W07A 1EH9A 1TZZA 1M5YA 1NTHA 2Z1VA 4WOQA 1REQA 3T2QA 1CXEA 1LQ0A 4QG8A 2YZ5A 3GTNA 4JTQA 1IQ8A 1TPB1 5I03A 2QUNA 3W1PA 4MLRA 2EJ1A 3ZMRA 2W3ZA 1QDSA 2J7FA 3TAKA 2FB3A 3ALFA 1W54A 2PS2A 1AA1B 1ZQ5A 3WD4A 3W88A 3ABZA 1VQTA 1KBLA 1XLFA 2PC4A 3O5KA 1FJDA 1AG1O 3CNYA 4WIWA 2E1DA 5C2CA 4V2XA 4UR8A 2CZFA 3NGJA 1NSJA 3TFXA 1X96A 1PBGA 4MJ2A 4DJDC 5BU6A 1F2JA 4C91A 3IRDA 3M46A 4YTSA 4WOZA 2CHRA 2WVVB 5BXJA 2HJPA 4UIOA 3W7MA 4GYPC 1K7XA 3RRAA 3IUIA 3B06A 3S5NA 1IZJA 7REQB 1QPLA 1TPFA 3BAIA 4CEUC 3FAWA 4E5TA 1JVNA 5IHSA 1W3LA 4HIBA 3EEGA 2DY3A 2XPKA 4EWND 2OEMA 3WLIA 4DT4A 3NQVA 4C6DA 2D3LA 2XFWA 1F5ZA 1PHQA 3KABA 5XINA 4Q8VA 1IXNA 5I3IA 1YTEA 2FGLA 5EMUA 4TOQA 2KX9A 2WKJA 3MU7A 1F3XA 4DB7A 4ZBCA 1M68A 2WXDM 2UV8G 3WQWA 4H6QA 4Y8EA 2OJPA 1V6WA 2OEKA 4X9SA 4CNOA 3FEQA 3BSHA 4V33A 5AC8A 1RAKA 4ROPA 4H4IA 1O95A 2VL4A 2PLCA 3KX6A 3MSRA 1J6PA 1V7YA 1KXQA 3AICA 3NXFA 1NU5A 4FX6M 4OQVA 3U5UA 4MADA 3STEA 5H2ZA 3MVTA 2PPOA 4A35A 3HPAA 2LGOA 3ZSTA 2I5GA 3VIMA 1W1B1 4N9EA 3OG3A 3N9KA 1W0MA 3OB8A 5J8LA 3GC2A 4M3PA 4D6EA 3DYMA 3LM3A 1P6WA 2I1OA 1KTCA 1I1WA 4IHCA 1L8NA 3ONCA 4H1ZA 3V7PA 2BVYA 1UMYA 3WQPA 1F3TA 2C15A 3AIQA 1EX5A 1AVAA 4LUYA 2HVOA 4XUYA 5I3HA 4UMCA 4TTUA 2FVKA 1RJQA 1QCWA 4AEOA 1EQPA 3AYRA 4REQA 1BGGA 2ITKA 4JFWA 4UFLA 3TC3A 3AXIA 3FEMA 2AMGA 5GJMA 3NL2A 1EQCA 3IKGA 2ADAA 2QVNA 5F2MA 1KRBC 4X61A 4FNQA 1JJKA 3THDA 5F4SA 1A5AA 2CETA 3UETA 2WCAA 3PSVA 1Q8JA 3UQAA 1Q8AA 1YXDA 3DBPA 1QO2A 1QPNA 1DWHM 2QUTA 3UXLA 3OJGA 3KZPA 4B5TA 1ONRA 4O28A 4P5UA 1W26A 4MGVA 3LCWA 3P7YA 4YHGA 4BQ5A 4BHYA 4C5YA 3ARVA 2DP3A 2C14A 1M6JA 4O54A 3BE7A 4ADTA 3G0SA 3UERA 3PZMA 4Q3MA 1HT6A 3QTGA 2E8YA 3MPGA 2RHGA 1KM2A 1QW8A 3UQNA 5EGRA 3F5LA 1XISA 3WBXA 3QQWA 1ZJBA 2F7FA 2V3GA 5J5RA 3MP5A 3GIQA 1DIDA 1AW1A 4NZFA 4GPNA 1CXIA 1JR1A 1FKGA 2FPYA 2QZRA 1EP1A 3ZWSA 2ABAA 3S1WA 4OE7A 1EDQA 4RX0A 3DU0A 5E0CA 5A6TC 1NF7A 3A21A 3PTKA 2XIMA 1KM6A 2YGYA 1FWGC 5C2GA 2P53A 2X41A 4IP5A 3ITCA 2H8XA 3GHTA 3S3GA 3C61A 3M07A 2XFFA 2G41A 2Y7GA 4KQZA 2BX7A 4WJEA 1ELSA 4KCWA 2QGYA 5HJXA 3HQOA 2PP0A 4QM1A 4GIYA 2VQUA 3SQSA 4AC7C 4JD4A 4CU7A 1B30A 3WLHA 3LSBA 4RL3A 4XB3A 1UC5A 1FWAC 2KAUC 2NQ5A 1J0KA 2FFIA 3OHIA 3TOPA 4HA4A 5LYRA 1A47A 1A3HA 1Y5VA 2REQA 4JKKA 4LOCA 4KWOA 2XFRA 4CD4A 1YATA 1T0OA 4C6JA 4B5NA 5C55A 3GS6A 1XCWA 3CQIA 5EKYA 1TWWA 1KO0A 1SUXA 2DVUA 4P2VA 1TREA 4HGXA 1M1BA 5REQB 3E2RA 2XZ9A 1TR9A 3HJZA 1JL8A 4JTTA 1BKSA 5I3KA 1P1XA 1EWEA 1MQQA 4FXSA 1F4AA 3WQCA 1M03A 9XIMA 3L4VA 1W17A 4B3KA 4TNSA 1WE5A 2XGZA 4QCEA 4MNMA 1U5HA 3TYUA 3EKZA 1Q7ZA 3U2CA 2ACRA 1HL9A 5BNKA 5FAJA 4HMDA 2P1FA 4GK8A 1LUCA 2J25A 3TKFA 2VGFA 3FAXA 4RNIA 1J12A 3KBNA 3OOBA 3H55A 3DOPA 1E6SM 1DHPA 1DQWA 2WMJA 1XLMA 3T9PA 1M7OA 1B57A 3QF0A 3ITOA 3PRBA 3MI6A 4GOAA 4AF0B 1FCUA 1JNDA 3B3DA 3AU6A 5LA1A 1XPGA 2VX4A 5FAGA 2YBVA 4C6QA 2DU2A 3TW6A 2F9RA 1S2WA 1QNQA 2DT0A 4MB5A 2HQAA 4AD2A 4OECA 3E2VA 2OX1A 4WGHA 3I7SA 2PDQA 3BJTA 4MWAE 3PRAA 4H2HA 4V28A 2GVEA 2PRLA 2YYUA 4RNFA 4S3JA 4KFOA 1ONXA 3CZJA 5HJLA 5GNZA 3MUXA 3TNOA 1Q85A 4UBPC 2KR7A 2UY4A 4R7WA 2G97A 1A0EA 2VT0A 3NM1A 3SUUA 5D2YA 4JFVA 4DO4A 1PX3A 2PCQA 4GUGA 4EF9A 4TMCA 3GVGA 1FXQA 3TTOA 1JUKA 1X39A 1TV5A 3QBUA 2R82A 4LVDA 2YBTA 2YXOA 3QR3A 4R27A 4MWAB 4L4OA 1TWIA 4QJ1A 5LNSA 2A7RA 1IGSA 2ZXQA 1YBQB 1TPWA 3MYOA 1LBMA 1JCXA 2UY5A 3G1SA 4G2DA 1BYCA 4QITA 5FL0A 2OVLA 3W26A 4FN2A 1J8VA 1RSCA 1P5BA 2BDQA 3I65A 3RO8A 3RLHA 3REQA 2GL5A 3W25A 3ZFHA 1JNEA 4ODQA 4XBJA 1UP0A 1ZFJA 3CO4A 5A6KA 4J3ZA 1D7IA 2GDVA 5BCAA 1OFAA 4I8DA 4B9YA 4P7QA 2C18A 3OVQA 1TTJA 2ZZ6A 5JMUA 3ZLFA 3TJXA 2A3LA 5FEZA 1US3A 2P8BA 3AHVA 4N9BA 4FLSA 3AMLA 3E0VA 4PCFA 3O5RA 2R24A 4JN7A 1DJIA 2VHLA 4E8DA 1RCXB 4LY8A 1GKPA 1PE1A 3W7OA 4C1NB 3NZRA 5I23A 5LIYX 3ISIX 2BFGA 1XSIA 1XWYA 4O0QA 2ZQUA 2DZPA 2C16A 4GI4A 4Q8OA 4IZGA 4AU0A 3OBEA 4B3ZA 2XISA 3AS3A 3O5GA 3BOXA 5HW6A 1OFQA 4I7WA 4JKLA 1SZNA 2PDMA 3VZXA 4DWSD 3N6QA 3S2LA 4B3LA 1U30A 4ZR8A 3BLLA 1WOAA 3BGAA 1ISXA 3H7RA 4ORIA 1FH9A 1S5NA 1CEOA 1EF2A 2XGBA 3BW3A 3TYBA 3I6EA 4B5XA 1PYMA 1Y0EA 2ZOXA 1F6KA 4IP4A 2Y4SA 3BCDA 3IJ6A 3KVMA 5C5YA 1AL7A 3UPWA 2HK1A 2ZWZA 2D2JA 3GUGA 4FX7A 3EDEA 3UJSA 3MI2A 1L6WA 2Y0FA 4DEFA 4Z1CA 4NX5A 4LC8A 4HYVA 4E4PA 4DLMA 2F8QA 4D71A 5T9BG 4AD0A 3TWBA 4CQ9A 4OKDA 3AUOA 1RLCL 3L12A 3AXKA 4I5RA 4PMJA 1ECEA 2OOFA 1F74A 1PWLA 4E2DA 1IR1A 1UZ1A 2NXGA 4DBUA 2F61A 2ZA3A 4MZYA 4QLJA 5E93A 3HURA 1L8PA 4JR5A 4QIBA 4FZIA 4K1GA 1T11A 1ADSA 4YVVA 4L61A 4A3HA 3BMVA 2WSQA 4HPNA 1VBGA 1F3WA 4A8NA 2AWGA 4HA0A 1NFGA 3V1HA 3QOKA 4L1WA 4XD5A 3LPOA 2HNHA 2E7FA 1GG1A 1EA0A 4O57A 5BWAA 4OZOA 1BAGA 4A3UA 1AW5A 1VFOA 1RVKA 1TQJA 3V75A 5CH9A 1C9HA 1VENA 1NWRA 3DFSA 4UQ9A 2NLIA 1WAUA 4GD0A 3PC0A 3ELFA 3T0BA 4WJXA 1I2OA 4L6HA 4TV5A 4LUSB 3IUHA 1PTAA 4F0RA 3IARA 1QVBA 4GX8A 2DEPA 1ZJHA 4NYYA 3CUZA 4S3FA 4GXMA 5GJNA 3RYSA 1L6YA 1H7OA 4DBDA 3CYVA 4PTDA 4KEMA 4BCEA 3DG6A 4L4PA 4LWWA 4QAIA 1AZ1A 3FJ4A 1TA3B 3VKDA 1W1YA 2XSBA 3TDFA 4AZCB 2B4GA 4RNJA 4PMOA 5FEPA 4L3NA 4LYKA 1OADA 2NVAA 1VFSA 3CWHA 4GGQA 1DTNA 4JIPA 5AHFA 4MKNA 4WK9A 5JIWA 4HN8A 3VIKA 4I9JA 2FQIA 1XBXA 3IGHX 4HBEA 2VC7A 2W91A 4JOMA 4HU4A 2LPVA 4YTQA 3FXGA 4ES4A 3DI1A 5C54A 2HXUA 2OZ0A 5DMMA 4RZ5A 3UJEA 2YA2A 1HQTA 4XK2A 3WY1A 5MKGA 5BRPA 4HA3A 1WV2A 2CLFA 4HKPA 2XP3A 1OC7A 4U4MA 5GVJA 4MB1A 3TQVA 6ENLA 4U10A 3GTYX 3ME3A 4IJCA 1R3VA 3NAVA 1XGDA 2G0WA 2X42A 3LYEA 1SZGA 3LBCA 4IIHA 4UTUA 2FTWA 4ZQCA 3QV9A 1EWDA 1QUMA 4OBSA 3O5EA 4IT4A 3GTHA 1F8IA 5CSRA 3N2TA 1V3IA 3U2ZA 3H24A 3BCJA 3SCRA 1OFBA 3G1VA 2NT0A 2OCZA 2BHYA 4GUJA 3FJNA 5I07A 6PTDA 4GWEA 9XIAA 3EX6A 2QHAA 3OG2A 4PCPA 1GOXA 1E43A 2VUYA 2JK2A 1BYDA 1OGSA 2DFAA 4XBSA 3QKEA 4FOKA 3OLEA 4NSBA 3C56A 1UG6A 5I3JA 1UWUA 3KAGA 4JS3A 2ZQVA 1E6RA 2VM8A 3NQFA 1WUFA 5BYWA 2DZXA 1D6OA 4HCLA 2GGJA 3LHWA 2Z00A 2OLHA 2CC0A 4BI5A 1M7XA 2VELA 2VO5A 2XP9A 2D24A 2J7EA 3LEPA 5HTGA 3WL0A 1DPMA 5GJPA 3S8HA 1YW5A 4Q7NA 3LD5A 1TV7A 1E0WA 3HPXA 3W38A 3TOYA 4KCUA 1YPFA 4DO5A 2AMXA 4B5VA 5HKGA 4O17A 1J96A 1Z89A 4LTSA 3KL3A 2RFGA 2ISDA 2ZA1A 5LIKX 2X05A 8CGTA 5JBFA 1YLVA 3IVSA 2GWGA 2WANA 4FA3A 1A53A 1R0MA 4GYJA 3ANUA 4IH3A 4Y8FA 5A6BD 2JEPA 1EJ7L 4IF2A 4JDBA 3NDYA 4B2DD 2OFJA 3CQKA 1S1PA 2PTWA 3UESA 2Y8KA 3NTPA 2A6NA 4XD6A 2X30A 3U3HA 3VOFA 4GVHA 4JX6A 1Y0OA 5CC7A 3L0KA 3VZYA 4BQ3A 1O1HA 3TA9A 3PBYA 3RLGA 3TH6A 4G6CA 4X2PA 1LRQA 4NU7A 2RDTA 2E28A 1QNVA 1XIMA 1ODZA 4GZIA 3VOGA 3JYMA 3H2NA 1QI4A 2HK0A 3OGSA 2P0OA 4ZL1A 3WK3A 1SU5A 5TNVA 3VOIA 3DBNA 3T4WA 4URIA 3M44A 3AQUA 1TELA 3L9CA 2J88A 3DHUA 5AHIA 3B97A 1XRFA 1KLYA 1E9IA 1R9XA 1TCOC 3L21A 4OOUA 4GINA 2C91A 3GLCA 3M0YA 1IEIA 3TC7A 2QF8A 2ZQSA 5HINA 1CX9A 1OYBA 3TE9A 3P6LA 4ZSUA 4NJIA 3U2EA 3FYPA 4ZCWA 2VCCA 1UZDA 2GJLA 1AD4A 1FDZA 1XLKA 2E9LA 4RZ6A 3VOHA 2PDKA 3OU8A 3KVLA 4Z2GA 5K3VA 1C7TA 2CCRA 1JDEA 1JPHA 3NSMA 5A6BA 4AZIA 3EX4A 1E5JA 4AQLA 2J8GA 4H00A 1FWRA 3USZA 1BXNA 3K4AA 3C5QA 1QOPA 2YOCA 3HQNA 3KM8A 1VP5A 3NURA 3HPZA 1LLZA 3N1AA 4FF7A 4R9XA 2Q5AA 4FLQA 1UR9A 1E3ZA 3VX0A 5DO2A 3SECA 2WZMA 4G1NA 4KPLA 2OSYA 2WHLA 2NQ9A 3L2IA 3AISA 2A3BA 5TQLA 3T0CA 3DECA 2ZA2A 4S3AA 3QZEA 4FIQA 4HNVA 6REQA 4US6A 4UR9A 1SO4A 1PKLA 3W1XA 1EIXA 4ZB5A 1P0EA 3T55A 4LQ1A 2GFTA 3QPZA 5CSSA 3EBVA 3UWQA 3D47A 1B2YA 3R11A 4A8RA 4CD5A 4GXWA 1MFVA 4WLCA 3B9DA 1K9FA 3LLFA 3H7VA 4FF5A 3NEHA 4FMVA 1LZOA 3L68A 4QAWA 1J5SA 4JIQA 1L2UA 1PJ9A 3MSDA 1GZ1A 5I3GA 2PDHA 1P48A 3KDNA 5F7UA 4FEZA 4R9OA 1WDPA 3V35A 3R25A 3SUVA 1TZ9A 4FPSA 2PBCA 3MKVA 4DUXA 5C6MA 2QVHA 5M17A 5TAOA 1ADDA 1A80A 3QC0A 1UIPA 1VBUA 2NUYA 2QDGA 2D23A 3MQTA 1XLHA 4N4QA 6XIMA 2YZRA 2WLYA 5B7YA 3WLRA 1JXKA 3F4NA 4ACZB 1MEWA 1MMFA 5FESA 1EUAA 1OT1A 2VWTA 1B3YA 4RW3A 2DUZA 5F2IA 1DXIA 5DX7A 1YKWA 2PV3A 1BWKA 3TIMA 2HRWA 3O5QA 5D33A 1JZ7A 5LNWA 2XIBA 1SSGA 3OBAA 1OFPA 4DRKA 3FHQA 3U6WA 1JYXA 4H9TA 2ZR4A 2C13A 1GW1A 3GKAA 1I60A 4KWVA 4YTRA 4GY0A 3QHMA 3FGCB 2VZOA 1G69A 2JKEA 3CIXA 2Q8XA 3E02A 1C8QA 4OBRA 4DROA 4YS1A 2DSKA 5DXXA 1KBKA 1GZJA 1J0HA 4AIOA 1V3JA 3A3WA 4Q8MA 4HZ6A 3V0UA 1NOUA 1YXCA 2FHBA 4DZAA 3FK4A 4N6FA 2IPFA 3MUZ1 3ES7A 4OUIA 4IFKB 3FA4A 3VZZA 3R6IA 3OYXA 3GIPA 4QE1A 3WJXA 2WVVA 1BRLA 4BI7A 4ATDA 1KRCC 2W62A 5BOFA 1GTEA 2VGBA 1E1EA 1TWSA 1E9LA 1EPXA 1A3XA 3TZNA 2QYGA 2AAMA 1EJTC 4XZBA 4EANA 1JI1A 4FR1A 1I45A 3WFLA 4XO6A 2FJKA 4A2SA 1YNPA 2J47A 3VD9A 2PWFA 1PX8A 4PTXA 3GYEA 3BMXA 1TFVA 4UQ