4WKAA

Crystal structure of human chitotriosidase-1 catalytic domain at 0.95 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
369
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 132
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkaA01
4M1RA 4UQDA 4BQ4A 4ZXLA 3N9KA 1JG9A 1E0WA 2VO5A 2ZIDA 3AZTA 2V3EA 3WBEA 4IISA 1RH9A 5M17A 1C92A 1V0MA 3AQUA 1AVAA 3ARRA 1MXGA 1GHRA 1QW9A 2E8YA 2DDXA 1JZ6A 1V6XA 3SCTA 5A6AA 4AD1A 1LL4A 1E6XM 2YIHA 4B9YA 1XYFA 1L0PA 4PTVA 4TVDA 2DT0A 3AS0A 2OSWA 1CYGA 1GOIA 1QVBA 3LPGA 4QCFA 4W8BA 1WPCA 3I3EA 3MANA 4BQ3A 3WMBA 2Y8KA 4HZ6A 3WELA 1V3KA 3A4WA 2O9TA 1FA2A 2GFTA 1V3JA 1NWSA 1JI1A 2GSJA 2VX4A 3MUIA 3PZIA 2Z1SA 3A6OA 1KCKA 4EKJA 4TX8A 1KBKA 1XH1A 1W1YA 1EQCA 3VIJA 4PBGA 3VD9A 4HPGA 4PMDA 4UZUA 2ZWYA 2WBKA 2OWXA 4CU8A 3K8LA 5JBEA 4U33A 1ODUA 4AD4A 5A69A 3OGSA 3WIJA 1GOMA 3KL0A 1GORA 4TTGA 3VIKA 4D6EA 2XIIA 4GPNA 5IXEA 3IANA 3NDYA 1VFUA 3FY1A 1GQJA 2E4TA 3OGVA 2CIPA 1V6YA 3MV11 3GH7A 1J0JA 2V38A 1JDAA 2DIJA 3O9NA 2DPEA 3PZMA 2JEPA 5AC4A 4WSKA 2BY1A 3O6AA 3DYPA 3RO8A 5HPCA 1W32A 1HVQA 1ZL1A 4UFKA 2UY2A 1U30A 3WDRA 3PTMA 1KXHA 2YLAA 4GI9A 4PMXA 1G9HA 5FKYA 2BY3A 1PX8A 1HKMA 2JFEX 2JALA 3TTOA 1PIFA 3VD7A 1U2YA 1CGYA 1OBAA 1LWHA 3NSMA 3ALFA 1H09A 2GJRA 4NI3A 3RM9A 4DWSB 1E15A 4F8XA 3K4DA 1V6WA 1ESWA 1NM9A 2E9MA 2J7CA 1KGWA 2XTKA 3T09A 3CH9A 3U5UA 4W93A 2C7FA 1O7AA 4UFLA 3GXDA 3APGA 4MDPA 1V0NA 3ARXA 2EPOA 2PWHA 5A6KA 2BHZA 4PTMA 3VNYA 2G41A 5JH8A 4MAZA 4OKDA 4ZEPA 3VDAA 1OGSA 3WDJA 5F7UA 1Q6FA 2ZX7A 3IAPA 3L4VA 1J9YA 1JF6A 3N18A 3RILA 5CQ1A 2WVSA 5JUVA 1HJXA 3ZJ6A 2W92A 2WMIB 4BS0A 1JZ3A 3PZ9A 4S3JA 3ZM8A 1E5JA 2E8ZA 3VGGA 4EANA 2FGLA 4E8CA 1UD6A 2CYGA 4CUCA 2ZX8A 4WF7A 4RE2A 4JKKA 4W88A 1A3HA 1OINA 1S46A 5GNXA 1K9TA 2B31A 3BH4A 2J75A 1I1XA 1R7AA 1XV8A 1CGVA 1UKTA 2GJPA 1MQPA 4W85A 3VVGA 1FFRA 3OG2A 4YPJA 1UH4A 4U2ZA 2WHKA 2FHFA 1GJUA 3M46A 1UR9A 4WIWA 3OLIA 4MNLA 4LQ1A 4MJ4A 3VD4A 3K8MA 2PB1A 3ZO9A 3QOKA 1IZJA 3ZT7A 4D6JA 3CGTA 2BXZA 1SFSA 5CJ5A 5I5RA 2V3FA 2VZSA 1TVNA 7CGTA 2O9OA 3SUVA 2G3NA 4JKMA 5I6SA 3SCRA 4LYQA 1QI3A 3UR8A 2VX6A 3U5YA 3KZSA 1ISZA 1TG7A 3K1DA 1BQCA 2BVTA 2E9LA 1B31A 4MB4A 4PTWA 1BVNP 2WM0A 1V6UA 3BGAA 4WKFA 2BNJA 2EEXA 5BXSA 3MV01 4J27A 3OB8A 2BY2A 4M81A 4IPNB 3POCA 4J7RA 1CIUA 4B9ZA 3I3BA 4AMCA 4P7NA 3AROA 1Q6EA 3EMQA 2UY4A 3L4UA 2YA0A 1TMQA 5JBFA 1B3XA 1DWHM 3AIWA 2WC7A 4OIFA 4S3KA 2FHCA 1JZ4A 4Z2LA 3SUWA 3A47A 1W1PA 2CERA 4MTVA 3FHQA 1E55A 2WMFA 4OZOA 5BRPA 2CBIA 3W24A 4D6FA 4JL2A 3NCOA 3VTRA 4E8DA 1E56A 1E71M 2J4GA 2YDRA 4XUYA 1R8LA 4DWSA 2VRJA 3VIIA 1K6AA 1E6PA 1E4IA 1LJYA 1CEOA 1LLOA 2XVKA 1JI2A 3WQ4A 1DEDA 5A8MA 4UTFA 3GDBA 2ZE0A 1J0HA 2VOTA 1BYAA 1UR0A 1QBBA 3FAWA 3WH9A 5BXPA 4CCEA 2YA1A 1UWTA 2J7HA 1QNRA 1UWUA 3KE0A 3WFZA 5LA1A 1MW3A 4BQ2A 1E4MM 1XD1A 3VGDA 4CU7A 4X0NA 3SURA 3VGEA 1BG4A 1OD8A 2W66A 6TAAA 5I0DA 1DTUA 3QOMA 5CGMA 3WL1A 3UCQA 2A3AA 4PMQA 2VMFA 4JIEA 1CLVA 1KBBA 3THCA 1H1NA 1W3KA 1UR1A 3ALGA 4J3WA 1V08A 5D9MA 1V3LA 4GIAA 1JDCA 2VT0A 4ATDA 3MSGA 3AXIA 2WLZA 4A4AA 3T0BA 1MW0A 1NP2A 3U7VA 3WH5A 4D6IA 3MMDA 4J28A 5LYRA 2DSVA 1NWTA 1UR4A 1WZLA 5CLWA 4EK7A 2D0FA 3K4AA 2HVMA 1OWQA 2GDUA 3L4YA 3MUY1 3W6MA 3OBAA 2WMJA 2YJQA 1UWQA 3AIRA 4XZBA 2BVDA 5HBFA 4W89A 1J11A 1WDRA 1WKYA 7A3HA 3W25A 2A3HA 3GXMA 2V5DA 3GBDA 5AY7A 3WSUA 1UWIA 5GNZA 2JF7A 1K9EA 5FD0A 4DWSC 3T2PA 4PRWA 4X0VA 1JNDA 2O9RA 3WY1A 1VEOA 2PWFA 1XSIA 2FH6A 1CXEA 4XV0A 2J47A 2PI6A 4JCMA 2QHAA 3OGRA 1BLIA 1UD5A 3IJ8A 3K46A 3DHUA 1CLXA 3PBGA 4Z2IA 4HA4A 1TUXA 3NJ3A 1D2KA 1UKSA 2D0GA 1VB9A 1WZAA 5ABHA 1PJ9A 3AMLA 3EYPA 3MSDA 4JFVA 2EO7A 2W61A 3VIHA 3BAIA 2DIEA 3HJEA 4FF5A 2Y2WA 3TTQA 2VRKA 2WHLA 1UHVA 2WYSA 1K9DA 1QNOA 3MU7A 1OB0A 1E43A 2YDSA 3WF3A 5A6MA 3WUFA 6CGTA 3BAJA 2A3EA 1TVPA 1HIZA 1WZKA 1B3ZA 4P8XA 5DT5A 4A3YA 3M6DA 5FCZA 4H8UA 4LXFA 3VMPA 3WL0A 3VOCA 3AYSA 3TTYA 3OA5A 5CSYA 1CGXA 1HP5A 4P8VA 2ZX6A 1QI2A 3LPOA 4ATWA 4AZBA 1LG2A 1EHNA 5BRQA 1WDSA 1P6WA 4F9DA 1CNVA 4UFMA 2CITA 3LPPA 1GJWA 4QLKA 3MS8A 1GOKA 2YL9A 1CENA 1XCXA 5DT7A 1JD7A 1W3LA 4YHEA 3HMCA 1HJQA 3FXYA 2ESCA 3RIKA 1HL8A 1KXTA 3EBVA 2WPGA 3L2MA 3S2CA 1FOBA 3DHPA 5C8BB 1G1YA 3AIUA 2VZVA 2QPSA 1QNPA 2XVNA 4A3HA 1B90A 1UD2A 1PZ3A 4GI8A 3RMEA 1SYTA 2WMKA 2CHOA 1XHGA 2VCAA 4ZE4A 2EPKX 4HMDA 5E9AA 3EDJA 5E09A 4AZHA 5GNYA 1WB0A 1LQ0A 2IXUA 1W3JA 3TA9A 5A8PA 5CSUA 2J62A 1GCYA 3B9DA 2G8ZA 1E0XA 1EO5A 3D3AA 2XYLA 4BZYA 1LL6A 4WSJA 1BSIA 2J7GA 3KWXA 4M82A 5A2AA 1XGZA 2J8GA 4U5KA 5EFFA 3CMGA 2VNCA 3WNLA 3AOFA 2WC4A 1HKIA 4J3UA 1D7FA 1KGUA 1QI0A 3F4VA 4HPHA 1CZ1A 1JDDA 4AZIA 3SCPA 4FK9A 2WWCA 1E6NA 2MANA 1M04A 1EIBA 3PZOA 3AMGA 3CUHA 2WBGA 1BF2A 2G4FA 3AIBA 4DUXA 2E40A 1JZ8A 1E4LA 4OOZA 4RL3A 8A3HA 1ZBVA 4LYRA 3THDA 2RGMA 3WDPP 4CD6A 4GZJA 3QR3A 2ZUNA 4D71A 3M7SA 1XSKA 3SCWA 2EPMX 3ZJ7A 4PUEA 1Q4NX 2Y24A 1H49A 1O6IA 3CZKA 1EDQA 4JAWA 2YBUA 2CCRA 2IXVA 2WHMA 4AEFA 1J0IA 1E6ZA 3VGFA 4KGLA 2D3NA 1CGWA 1HP4A 2XIBA 3ZJKA 3MKKA 2WCGA 4QCEA 3CLWA 2VURA 5DO8A 4ML4A 3ARUA 3F5LA 1BYBA 1X6NA 3SCQA 2XFFA 2GDVA 4AD3A 1F4AA 4C7GA 2VQTA 3OLEA 4P7LA 1PEZA 3W26A 4GQRA 4PMRA 2HISA 5A6BD 1KQYA 1BPLB 1OIMA 2XUCA 3OLGA 1DWJM 4HOZA 3QGVA 2WVTA 5A2CA 3AXXA 4QAWA 1QHPA 2XFYA 2WAGA 4PUDA 3EMCA 1FHDA 2Y5EA 3F5KA 1PZ2A 1JYNA 2EXOA 3PZNA 3BAWA 2DQXA 3AHYA 3VDHA 4AC1X 2XG9A 3IK2A 4K68A 3BSHA 4J3SA 2VTFA 3WBAA 1H2JA 1GOWA 1KWGA 4AY1A 2WVVB 3VIMA 3WQWA 2UWFA 2W63A 2CPUA 4TOQA 1E6RA 5D9NA 3JUGA 4AZ6A 3TTSA 4CVUA 4AXNA 5DFAA 1R87A 5EB8A 4MB1A 4HMEA 5CGTA 1EA9C 1Z32X 1UH3A 2AAAA 1W9VA 4Y7EA 4Z2JA 4CU6A 1QNSA 2OSYA 1DWGM 1EDGA 5FIPA 3WD1A 2Y4SA 3GNOA 5LA2A 4UFHA 3ZJ8A 4UR9A 5DEZA 3AHXA 1EH9A 1VBRA 1EDTA 1QI4A 1CDGA 3RM8A 2QV4A 3CHFA 3I3DA 1A47A 1WDPA 7TAAA 1YQ2A 1W9UA 1R85A 2G3IA 3SEPA 4H8VA 1XH0A 3WN6A 1VBUA 1B1YA 4UQAA 5A6LA 4L4PA 5BCAA 5BXTA 3B9EA 1NARA 1J18A 5ABGA 1UKOA 2Z1KA 3VO0A 4HA3A 3W4RA 1V6VA 1IT0A 1UUQA 4N42A 4HOXA 1RPKA 2XSAA 1H0GA 3VIGA 5CPQA 3ARQA 1JFXA 1UD3A 1HXJA 3QHNA 3DECA 3GNPA 1PX3A 3IJ7A 4H2CA 3GNRA 3DC0A 5HOSA 4PSPA 4WK9A 1E1FA 1PIGA 3CZLA 1V03A 1EOMA 2WWDA 2CEQA 3ARYA 2X1IA 1CXFA 1XC6A 2ZXAA 2VVSA 8CGTA 3CMJA 4HA1A 1B0IA 5I3DA 4CKQA 3FW6A 3SCUA 2W5FA 4EAMA 2XFRA 2ZUVA 4HU0A 5A6BA 2D22A 2EQDA 1GZJA 1H0IA 3ZSSA 5ABFB 4PMVA 4U5IA 2WKLA 4IM4A 4V27A 1E72M 2D23A 1UQZA 2EPNA 2PWDA 3OIHA 1TZ7A 1C8YA 5I79A 3NIYA 1M7XA 2JIWA 2ZICA 2E0PA 1TE1A 2VCBA 4MNJA 3D5HA 4V2XA 1ISXA 1WE5A 2WLYA 2WCSA 4DM2A 3WH8A 4OBSA 5KEZA 1Y7VA 4IPLA 1V3IA 4B3LA 3EDEA 2WSPA 2YBTA 2J25A 4OJYA 4TVUA 2A3BA 2JEQA 2WHJA 2FDMA 1GONA 4M8UA 4U3CA 2W4XA 1RP8A 2VQUA 3L4ZA 4XZWA 2JE8A 3L4XA 2X09A 4JKLA 1MWOA 5BROA 3MMUA 3WNOA 1UG6A 4GKLA 2ZUWA 5I23A 3N1AA 2BS9A 3SCNA 1AQHA 2CETA 3CZJA 4W86A 3T2QA 3WNMA 2ZUSA 1SR0A 1B30A 5CXPA 2PWEA 4GI6A 3AMKA 4W84A 1WAWA 1GOQA 5IDIA 3AZSA 3WQ5A 1PBGA 4MB3A 3WNKA 3CUGA 4F79A 4FLRA 1H5VA 1JF5A 3OZPA 1KQZA 1J0YA 4AWEA 3BLPX 3BLKA 2WVVA 1TA3B 1ZB5A 3VD5A 1B3YA 2WVUA 2BXYA 1KGXA 2DSUA 3WQVA 4W5ZA 5I77A 5D8ZA 2J78A 2CBVA 4FLOA 4R27A 1HKJA 1KR1A 1GVIA 2VCCA 3OZOA 1W3HA 2OWCA 1LG1A 4WKHA 2JIEA 4RE4A 1UH2A 5HPOA 4CCCA 2W67A 4CVWA 3AFBA 1QHOA 5A95A 1JAKA 2WXDM 3AICA 3CO4A 1DP0A 1TCMA 2QMJA 3AI0A 5CLTA 4AIUA 2WMIA 2VX5A 4W7VA 3ARVA 3W82A 3UG5A 3S6TA 3UERA 2WK2A 3WF2A 2O92A 4TUFA 3RDKA 2CHNA 1XD0A 4W7UA 3VUPA 4NZCA 1E73M 2YL8A 5AYIA 3PTQA 4AZCB 1MQRA 5ECUA 2ZXDA 2QF8A 1NWRA 2YDQA 3UETA 1JNEA 1EOKA 2WZIA 1UR2A 4NSBA 1UD4A 1OGBA 3POHA 4HTYA 4JFSA 1RD6A 1BGGA 1QNQA 2VX7A 1MFVA 2WMHA 1HF6A 1ZS2A 4CGTA 1C90A 1H11A 5CPTA 2ZWZA 2YL6A 3N11A 5IHSA 4UOQA 5ABFA 3LMYA 1HN1A 3W81A 1EXPA 3AMDA 2WC3A 1E9LA 3PTKA 3UR7A 3FHAA 4KRUA 4AD0A 1EGZA 2GUYA 3EDKA 1E0VA 5DF0A 5FL1A 1UA3A 4WLCA 4P8WA 5CPSA 3WNPA 1HKKA 2UY5A 4C7FA 3W29A 1G5AA 3KL5A 4AYSA 1FH7A 2OYMA 1PAMA 2CKRA 2GJXB 1KXQA 4OUEA 2CNCA 4MNMA 3K8KA 4D6GA 3RPMA 1V02A 3WENA 2WCAA 2ZX5A 2DT3A 1OIFA 3TOPA 2WKGA 4X9YA 3ARPA 5D9OA 5ABEA 4FLQA 3AYRA 1E5NA 3WQ8A 3WQ6A 3BMWA 5A8QA 2CBUA 1NQ6A 3VU2A 2J7EA 2QLYA 2J79A 3ZMRA 3AXHA 4D72A 1I1WA 2ZUTA 1UZ1A 3ZR5A 3CUFA 4UCFA 4PEEA 1XH2A 3CHCA 3VIPA 5A94A 3UEQA 3WFLA 5A2BA 1HX0A 3PZVA 4MAVA 1UKPA 1ISWA 5EBAA 3CHDA 4KRTA 1LWJA 1UWSA 1BAGA 2WZHA 1B9ZA 5E0FA 4Z2HA 1NOFA 1GPFA 1D3CA 1RP9A 5FL0A 3N12A 1J12A 3VD3A 1C7SA 1BVZA 2VR5A 2BV9A 3BMVA 4J3XA 1TA3A 3DYOA 4MPKA 1GW1A 4UNIA 5LA0A 5E70A 1W9BM 4DUWA 3ARSA 3AS3A 3W37A 3WH7A 3KEHA 3WUEA 1W1VA 1VJSA 1LF1A 2J77A 2V5CA 1VFOA 1OGGA 3GH5A 5AYBA 4UOZA 4IUGA 4CD8A 3MUAA 2NSXA 2BFGA 2FH8A 3BXWA 4MJ2A 3VILA 2D24A 1FH8A 4OBRA 2DEPA 6A3HA 5A8OA 1NOWA 1EO7A 3FAXA 4OOUA 3ZT5A 2E3ZA 4AW7A 4D6HA 3AMCA 2NT1A 3WDQA 3NSXA 3WD0A 1ISVA 5A6SA 1KR0A 1MXDA 2Y8VA 1CGTA 1JGIA 5GPRA 3GM8A 4R5EA 4V28A 4AZCA 4U3AA 5A1AA 2D2OA 5A3HA 3U7BA 1XRVA 2DT2A 3SIMA 3B9AA 1NH6A 1MFUA 4GZIA 3II1A 3WUGA 1VJZA 4UQEA 1E3XA 2YLLA 2BHUA 4W7WA 1JZ7A 4U31A 4UQ9A 3IAQA 3MO4A 1B3WA 1EQPA 1FFQA 1QBAA 1J10A 3ZR6A 2YKKA 1WP6A 4M80A 5DMYA 4E4PA 4P7OA 3W28A 3B8SA 1JFHA 3SUSA 3VMNA 4Q7NA 4J3TA 3SUUA 2XWDA 1E70M 1ISYA 1KB3A 1KWKA 5EFDA 5HDRA 1CBGA 2J7FA 1QPKA 3BCDA 4KH2A 2NT0A 5BWFA 1UWRA 3VKKA 4AZGA 1MW1A 1NOUA 2PF0A 2WB5A 3AIVA 4JFUA 3GZAA 1AMYA 1HJSA 2CESA 1BGAA 5TD4A 4AEEA 4Z2GA 3VINA 2OLHA 3WF0A 1PPIA 1M01A 4PSRA 9CGTA 4XX6A 3ZIZA 1B2YA 1W2PA 4D6DA 4NRSA 2GJXA 4ACZB 2CKSA 2XVPA 5C70A 4KGJA 3WEMA 1HJWA 4HP5A 1QI5A 3NUKA 2YA2A 4JFWA 1FP9A 3ARTA 5D8WA 1HT6A 1G94A 2YL5A 3GYCA 1V0LA 1X1NA 1UD8A 4DM1A 1HJUA 3N15A 2G3JA 1DWFM 3CTTA 2D3LA 1ZJBA 3L4TA 2OWWA 4D1IA 3TONA 4U2YA 3CZGA 3VDBA 4ACYA 5JIWA 3RM4A 2OYLA 1KFWA 1CXHA 1UZ4A 3HN3A 4KWUA 4CD4A 3WDIA 5D9PA 4F66A 2OSXA 3CHEA 3DYMA 2DT1A 2YOCA 1Q6DA 2RGLA 3LPFA 2BHYA 2VUYA 3AS2A 2C8NA 4JZ5A 1E3ZA 2D1ZA 1JXKA 2ZOXA 4QP0A 1W9DM 1TFVA 3J7HA 3NYDA 4MADA 4UQBA 2VJXA 3AS1A 4LX4A 3W0KA 4WJXA 1XCWA 1MVYA 5IFPA 4JL1A 1F4HA 2J8FA 2AMGA 2GVYA 4UZSA 1IV8A 1IZKA 3WD2A 4W5UA 4H41A 4XB3A 4AD5A 4P7RA 1VIWA 1H3GA 3MUZ1 3WUBA 5FOOA 5M03A 4RE3A 1BFNA 3PZGA 2XM2A 3L4WA 1JIBA 1NP0A 2ZUUA 3VNZA 4AIOA 2WNWA 3BAKA 2VRQA 5HXMA 5I2UA 2PBOA 3MMWA 4QLLA 1V02E 3VX1A 4DWSD 1C8XA 1L8NA 5HNNA 2WZEA 1E6SM 2NW0A 3TP4A 3RJXA 1ZU8A 2VZUA 1M53A 1CWYA 3AZRA 3W53A 4FLSA 1PX4A 1ITXA 3AISA 2W62A 1E4NA 2F2HA 2JF6A 2DH2A 2VC9A 4HOWA 1JXJA 2VI0A 1WNOA 1VRXA 3T08A 4B15A 2J74A 2AOSA 4GINA 4W8AA 1ZBWA 2BY0A 2ZUMA 2W91A 1HL9A 3G6MA 3AIEA 5D4YA 1HVXA 1UKQA 1DWAM 1V3MA 4AISA 2XGIA 4PMZA 5CZKA 2ZXQA 3SCVA 5I24A 4NRRA 1GNXA 4E2OA 1XYZA 4PCSA 1AQMA 1NWUA 1BHGA 1WCGA 1MYRA 2WW5A 3NDZA 3N17A 1WZMA 4JHOA 4HMCA 3PZTA 2XWEA 3WD4A 3BAYA 1DWIM 3VGHA 3VMOA 2OYKA 4TVCA 3VIOA 3VX0A 1N82A 3GXIA 4C7DA 3EDDA 2V3GA 3OLDA 1LL7A 3EDFA 1MQQA 4PCTA 2V3DA 3WF4A 2WANA 2WMGA 3SCSA 1JYVA 4ACZA 4AZ7A 2VL4A 1XSJA 3HU7A 3VDCA 3QHOA 1ECEA 4LGXA 1CTNA 4M24A 3ZT6A 4M29A 5A8NA 3ARWA 2F8QA 1W2VA 3BAXA 4M56A 2XVGA 1OD0A 4BQ5A 1E40A 1JZ2A 4Q22A 1CGUA 4QFUA 1SMAA 4JHZA 4ZENA 4ATLA 2XHYA 1UOKA 3WNNA 1UA7A 1VF8A 3VM5A 2PBGA 3N04A 4PTXA 1V0KA 4PMOA 4PMNA 2GK1B 5E6YA 3VPLA 4BF7A 2X0YA 1VFFA 3G6LA 4F9JA 3A4XA 3GTNA 3PZQA 3BCFA 3ZOAA 3ZSTA 2TAAA 4GZEA 1AQ0A 2O9PA 3AHTA 1R86A 1JZ5A 2PC8A 3CIVA 2X05A 1JYXA 2VZTA 3WD3A 1JYWA 1ITCA 2XVLA 4BCEA 4D6CA 1V3HA 4CN6A 3VM7A 1QHZA 5BYWA 1FP8A 4JCLA 3T0AA 2EBNA 4H7VA 3AHZA 1MW2A 5E6ZA 1E6QM 3WEOA 1X6LA 1WO2A 4FMVA 4TXEA 4AIEA 2BVYA 4ZE5A 3O2LA 3GBEA 3UG4A 3CBWA 3CZ8A 4EE9A 1C8QA 3PZUA 3FNDA 2WSKA 4CN4A 4KMQA 1JL8A 2ZXBA 4PYSA 1CXLA 4UFJA 1Q6CA 2XJ7A 2CBJA 1ZJAA 1FHLA 1CECA 1KCLA 2EPLX 4UOJA 1US2A 1HJVA 1GVYA 4HU8A 3RJYA 4LYPA 1C93A 2PWGA 3CUJA 5A6JA 2F61A 3VGBA 3T2OA 4B16A 3EMZA 1H41A 1UYQA 4DUVA 2X2YA 2X0HA 1EHAA 4BA0A 4GO8A 4GO9A 4AZ5A 1US3A 1C3FA 5GQBA 1YHTA 1JAEA 1GQIA 4HZ7A 4L4OA 2J7DA 1W91A 2X8RA 3WH6A 3W27A 1UR8A 2DSZA 1BTCA 2EJ1A 4W87A 4CD7A 3A3HA 2DSKA 4ZXOA 2D0HA 1ZBKA 3ECQA 3RCNA 1J0ZA 2D20A 1BYDA 4LPCA 2Q8XA 4PMYA 4CCDA 3WDHA 1GHSA 4JFTA 1BYCA 4YN5A 2VR4A 4H04A 1VFMA 4J3VA 4W8LA 4QDMA 2XSBA 1DHKA 5IFTA 3SCOA 4ZFMA 1U33A 2FGZA 3GH4A 4TTUA 4WKAA 3WKZA 3W6LA 5C71A 4URIA 1K9FA 4TX6A 1CXKA 1SMDA 3CUIA 3WMSA 3W38A 4UQCA 4YHGA 4CD5A 1C7TA 3N13A 3PN8A 1TR1A 2E9BA 4Z2KA 4P7QA 4CN1A 1HNYA 5EMYA 3A4AA 3CPUA 3WEZA 3ZQ9A 2A3CA 4HZ8A 4MNKA 1GOOA 1QOXA 1M03A 4GXPA 1W9PA 1OT2A 1Q6GA 2IUZA 2DH3A 3GXFA 2J7BA 3IJ9A 1J01A 3U57A 1WDQA 1GQLA 1CXIA 1GUVA 3BSGA 3AIQA 1OCQA 5M3WA 3E1F1 3PHAA 4D1JA 1OM0A 2VZOA 5JBDA 1JD9A 3T0DA 5I78A 3VIFA 1UQYA 3WMCA 1VENA 5AC5A 4PMUA 4B3KA 3BC9A 2XPKA 2GK1A 5IHRA 2C0HA 1VEMA 4N0RA 4MDOA 4P8UA 2VVNA 5BXRA 3SUTA 3F5JA 1OSEA 2DGAA 3M07A 3NSNA 3L2LA 1QW8A 2XM1A 5CG0A 1I75A 3AHVA 1GQKA 4AD2A 4GQQA 4UFIA 4NF7A 1BG9A 3WF1A 2ZX9A 1CPUA 3FN9A 1G0CA 5M5DA 1ZBCA 5E0CA 4MB5A 1R7OA 3AJ7A 1W9XA 3ARZA 4QLJA 1FH9A 1VEPA 1H4PA 1C91A 1KXVA 2QMKA 2DSWA 1OT1A 2XGBA 3CZEA 3UESA 2UY3A 2G3MA 5KZ6A 1ODZA 3QHMA 4PN2A 1E1EA 1J0KA 1B3VA 1W1TA 3KL3A 1VAHA 4H8HA 2CXGA 2FHBA 2QPUA 3UG3A 1G01A 5JIPA
chains in the Genus database with same CATH superfamily
1EJXC 4M1RA 4HKPA 4UQDA 4MMWA 3CU2A 3N9KA 3W71A 3GS6A 1H7OA 4PUNA 2GQ8A 4GXWA 3B0PA 4BI5A 3AZTA 5M17A 8XIMA 2E68A 5HQMA 4LBRA 2QJIA 3O6YX 4OU1A 5FF3A 1QW9A 1KA9F 1V6XA 2W79A 4MG4A 5A6AA 2XH7A 4S2CA 2PDMA 3ITGA 2QJGA 1ZAIA 2YIHA 1NFPA 3AYVA 1YNQA 3LCWA 2DT0A 3B0UX 1GOIA 1KKRA 1QVBA 4W8BA 3I3EA 3A3WA 2OTDA 3WMBA 5DLCA 4IJRA 3ABRA 3A4WA 5DBTA 4DNHA 3PZIA 3RAOA 4EKJA 4TX8A 1EQCA 3VD9A 4PBGA 4RW3A 2XH0A 4L4LA 1UROA 4IIFA 1OFPA 5K2ZA 4ZMGA 4DI8A 3AWOA 4QG6A 1FKKA 2QDGA 3LI0A 4H9TA 3WIJA 1DIOA 1GOMA 4LH8A 3LCXA 1GVSA 4HU3A 4M19A 4PCFA 4DXVA 5IXEA 3QKZA 3NDYA 2NV1A 1VFUA 1UP3A 1BD0A 2E4TA 2HBVA 3IIOA 3VZYA 2DIJA 4F2UA 4Q4SA 3PZMA 4YWSA 1RVGA 3RO8A 1R6WA 3M0VA 5HPCA 1W32A 1ZL1A 3QR0A 3R11A 3NL6A 3CL7A 4GI9A 4PMXA 4MZ1A 1G9HA 1YMYA 5D2WA 1OADA 1WBJA 1IHIA 4V1XA 1PKYA 4HMNA 4O1CA 5FAGA 3GIYA 1PKMA 1W5NA 2P50A 3IGSA 5LIUX 4NXKA 3S5ZA 3NSMA 2OQLA 1H09A 3LK6A 1XC4A 3RM9A 2QAFA 3WLHA 4DWSB 1E15A 4F8XA 3NO1A 3CGMA 3K4DA 1V6WA 3P7YA 7PTDA 3AXMA 1EGVA 1RALA 2J7CA 3EY6A 3U5UA 4C1LA 4W93A 3WLIA 1O7AA 3APGA 3TQPA 3MSYA 4MDPA 3P8IA 2C79A 5M2FX 3BZGA 1V93A 1UPPA 1O5RA 3VNYA 3M43A 1A49A 2QUMA 4QR6A 2INFA 1XP3A 2H8XA 4I7VA 4IG2A 5F7UA 1W3TA 1Q6FA 3T6CA 3ABZA 2ZX7A 3TIMA 4HD5A 1TQJA 1FWBC 1JF6A 2NZLA 1QDSA 3QV9A 5CCZA 3B8VA 4I3GA 2REQB 2W92A 3HGRA 3N2TA 3IV3A 4DRQA 2QS8A 3F2DA 4Q33A 4S3JA 1WX0A 2JGQA 3V16A 3WX7A 3ZM8A 5DRCA 4S3GA 4E8CA 1UD6A 3PBVA 3MCOA 2FPTA 3HPAA 3S9IA 2ZX8A 1RA0A 4S3EA 1A3HA 3L5AA 1OVDA 1S46A 3GQYA 1K9TA 1VP5A 3RX3A 2J75A 1JCTA 1I1XA 2OELA 1P7TA 1XV8A 4JY9A 1CGVA 1BSLA 5BWAA 2GJPA 1MQPA 4W85A 1TV2A 3OG2A 3T4WA 1YXYA 4IX0A 2FHFA 1TIWA 4REQA 4WZHA 4WIWA 4EACA 3T0TA 3VD4A 1A4LA 4GIVA 3QOKA 4RZ5A 1KTBA 2RH9A 3ZT7A 4D6JA 4ZSUA 1O5KA 2VFFA 2BXZA 4QROA 2EKGA 5HMDA 1WOBA 1VH7A 4PMJA 2VZSA 3N3MA 4LJ3A 3SUVA 2G3NA 4IP4A 1PL9A 5DMNA 1TIMA 3KZSA 3U4AA 2V69A 3BLEA 1BQCA 1W1B1 4N4PA 4WDWA 4PTWA 1SFTA 3BDKA 3UI6A 1BVNP 3BGAA 3A12A 5SWUA 2EEXA 4ODNA 5CG7A 4J27A 3DI0A 4LS2A 2F38A 3WCZA 3OB8A 2BY2A 1IWAA 1Z48A 1F6KA 4QRNA 2PDXA 2Q3RA 3BLLA 4YTUA 3CHVA 1Q8AA 1TMQA 3EOOA 3EKZA 1JZ4A 4IXXA 3NWRA 3UF8A 4R53A 2YZRA 4HK5A 5LNRA 2WMFA 3WJSA 3L12A 5BRPA 3W24A 4JL2A 1PBKA 4OTKA 2YDRA 4AUBA 1R8LA 3VIIA 3JS3A 3KRUA 3W84A 3VNIA 4OECA 1LJYA 1CEOA 3VYLA 2YB1A 3LHWA 3U6WA 2ZE3A 1DEDA 4UTFA 3S3GA 1M7PA 2EF9A 3QW4B 2OG9A 1TWIA 1WYIA 2VOTA 2X30A 1UR0A 1UB3A 1JRCA 2YA1A 1XIMA 2GPTA 4X22A 1O5XA 5HR6A 5H8UA 1S3TC 3B3DA 1UWUA 2VGGA 5D2XA 4N9EA 3P14A 1QJWA 1RY0A 2GWNA 3G77A 5KITA 3QV8A 3ABSA 2VGBA 1MW3A 3O16A 1E4MM 1O4UA 1XD1A 2RUDA 3H9RB 3VGEA 2W66A 1BWLA 4GCXA 4C6PA 5D09A 1B54A 1SJCA 3TOYA 2H9AB 3W7NA 5CGMA 3UCQA 5REQB 2X7VA 4JIEA 4XBKA 2DZSA 5TAOA 1P4CA 2QVHA 1UR1A 4J3WA 2QCNA 1RK6A 1V08A 1V3LA 2PRMA 4A4AA 4MWAA 3W2UA 1MW0A 3OG3A 4NAEA 4DAIA 2FQIA 2VHLA 3U7VA 1HQTA 3NZGA 5CLWA 1XQLA 1XS2A 4DY1A 2GDUA 5EPDA 6REQA 3HV8A 3OBAA 4UMAA 3LCGA 1B4KA 4YVVA 3AIRA 2R1KA 1MO0A 1WKYA 1OX6A 1UMLA 4XVEA 3BZJA 3W25A 3BMXA 2A3HA 4ZQNA 1JVNA 3EWBX 3GBDA 5AY7A 5HMSA 5GNZA 4MVAA 3AC0A 4DWSC 1VPXA 4Z0JA 4ODOA 4O11A 2GQ3A 1XSIA 1TPVA 4FR6A 2BLEA 3PJUA 4DVOA 4KKXA 1KFCA 1DJQA 1GGOA 5I3KA 3K46A 3N29A 3BLDA 3NJ3A 2D0GA 1JRBA 4HNCA 5ABHA 5KZEA 4KESA 4JFVA 2EO7A 4F0LA 1Y0OA 1XBYA 3KDNA 3DIPA 4FF5A 2D73A 4DRNA 2J24A 3GTXA 2WHLA 1A0DA 3WLOA 3TDBA 3WUFA 2YYUA 1FKJA 2A3EA 1HIZA 1TR9A 1WZKA 4LB3A 3V18A 3QPZA 3M6DA 5G4WA 1W1A1 4LXFA 4U28A 4ENLA 1I2OA 1CGXA 4RNFA 1R2RA 2WNNA 1QI2A 3V7PA 2QF7A 2B7OA 4B4FA 3MCMA 3P5YA 4DZ5A 1FKRA 1CNVA 4UFMA 3CH0A 3G1XA 4LF2A 3LPPA 3LRLA 1J2BA 1XQKA 1EYEA 1VGAA 1HJQA 3S5NA 3FXYA 2AMXA 1D8WA 2ESCA 4YYCA 1HL8A 1KXTA 3EBVA 3S2CA 4HK6A 3AIUA 1FXPA 5FSEC 3VA8A 2P5NA 2Z1BA 2WZMA 2QPSA 1FCVA 4A3HA 1B90A 2FLIA 2O7SA 2M08A 1SYTA 4IIBA 1PIIA 4GIEA 5CBIA 1XHGA 4O54A 4HMDA 4JTKA 5E9AA 5E09A 3CGNA 3DHFA 2IXUA 1W3JA 3GVVA 3W9ZA 4ZGYA 4H6RA 2HZGA 3E0WA 3B9DA 3QSRA 4UTKA 2G8ZA 1E0XA 4ZOEA 1EO5A 1UZDA 5EL1A 1LL6A 2VYOA 1BSIA 3DI1A 5XIMA 3T07A 1XG3A 2R91A 3MKCA 3NL3A 3H8AA 3CMGA 2VNCA 4BFAA 4U84A 4DJFA 4MM1A 1HKIA 4J3UA 1VBJA 1ROTA 4ZZ9A 3F4VA 4LVAA 2VFDA 4HPHA 3TC3A 2QGHA 3OZYA 3OQ8A 1FKGA 2V6AA 2P4VA 1EKOA 1LRNA 4FNTA 1EIBA 4ERAA 3AMGA 1TV7A 2KAUC 3CC1A 5IDZA 4A22A 2E40A 1E4LA 2ZRUA 3OIXA 1P0DA 2N87A 3QR3A 1VFLA 2HDJA 4US5A 3M7SA 4QG8A 4C60A 3K2GA 2EPMX 4MF4A 5IBXA 3RR4A 1EDQA 1G4PA 5CZJA 2WHMA 4L9YA 2DVUA 4AEFA 3UQAA 1WQ5A 4Q8WA 5HKGA 1CGWA 1HP4A 3EA1A 4PTNA 4UTIA 4PCNA 3SCQA 5C5YA 1F4AA 3CJPA 3W7JA 3W7CA 1JCNA 4RR4A 2C18A 2TMDA 3LCHA 5CZ0A 5JH1A 1BPLB 5I3GA 1OIMA 3TN5A 3OLGA 4HOZA 3QGVA 4QAWA 1OX4A 3V0UA 1Z69A 1FWHC 3EMCA 4IZGA 4G7FA 1F3TA 1EPVA 3EXTA 2HK0A 3AHYA 1SM9A 2XG9A 3TROA 1MEHA 2O4QA 1XIEA 3L0GA 1F7BA 1VQTA 3BSHA 4ERGA 3ZVHA 4HHMA 1H2JA 1GOWA 5U7SA 5CPOA 1R9YA 3WQWA 5C9UA 3D46A 3S6DA 3GDKA 2CPUA 4EIVA 2OEKA 1E6RA 5D9NA 3JUGA 5DFAA 2VEFA 2E25A 2GWGA 2Z24A 5I3FA 2A6NA 1E44A 3IEBA 1QNSA 1DWGM 4B5TA 1GZ1A 2Y4SA 3GNOA 5LA2A 3ZJ8A 3UWVA 1JGMA 3N34A 3AHXA 4FF7A 1VBRA 1EDTA 1W1ZA 3LBCA 4AX6A 3E74A 3EXRA 1SW3A 4PR4A 1WDPA 7TAAA 1YQ2A 3SEPA 1Q1CA 2SFPA 4WXYA 1XH0A 1B1YA 2HS6A 3RNDA 2PZNA 5A6LA 5BCAA 2BASA 1EL3A 1KTNA 1RLDA 3R4IA 1NARA 5ABGA 3LNMA 4LALA 3MCNA 3C52A 1HXVA 4OFCA 3KP0A 5E93A 4O16A 3RO6A 1IT0A 4N42A 1RPKA 3W7HA 3DBPA 5LNWA 4O1DA 2ZTJA 3S1WA 4H2CA 2POZA 3CZLA 1D9EA 5LGXA 1EOMA 2CEQA 4QJ1A 2VVSA 1NF0A 1TTIA 4L5ZA 3LTPA 1ML1A 3QLLA 3EX4A 1U22A 2ZRXA 2QDDA 2EQDA 1EC9A 5ABFB 3VC5A 1OC7A 3ANVA 3QYQA 4JTHA 2WV8A 4EF9A 2EPNA 2PWDA 3OIHA 3QPYA 3VE7A 5I79A 1DTNA 1M7XA 3G24A 2ZICA 2VCBA 3D5HA 5DIUA 3PG9A 1GYLA 4BJHA 4OBSA 3NM3A 1QUMA 2GOUA 5L9FA 4B3LA 1FHUA 3WQFA 1XLKA 3EDEA 1JNSA 3MWCA 3H4WA 2WSPA 3P2VA 3LERA 1MXSA 3O1NA 2A3BA 1TV5A 4RUBA 1MRQA 1DJGA 4DRHA 2DZXA 3L4ZA 3UJ2A 3KRBA 4PODA 1J93A 5MKGA 1TRDA 2ZVIA 3TC6A 4GKLA 1LT7A 2ZUWA 1S2AA 4YIWA 3RLGA 3R25A 5B8IC 1XRFA 1MZHA 3M0YA 2MNRA 2VWSA 3LB0A 3T2QA 4W86A 2DORA 4PZVA 2IQTA 4RE0A 1B30A 2G3FA 5H8PA 3M41A 2LKNA 1U5JA 4EPDC 2FKEA 4JQAA 4JTDA 1UBPC 4F79A 1KQZA 2ICSA 3BLPX 1ZQ5A 3TFCA 3BLKA 2HRWA 3XINA 4C6QA 3VD5A 1E9IA 2VEMA 4G1KA 3G18A 3SADA 2AL1A 3C6CA 3WQVA 1A80A 4LSBA 2CBVA 4FLOA 1GVIA 4KRZA 2B5UB 1TPC1 5LNVA 2VDIA 2PTXA 1W3HA 1J4HA 2F2DA 3P67A 1NSJA 4WKHA 1YTDA 4CVWA 4HK7A 4LEQA 5HNUA 4LUIA 2C13A 5A95A 1A7XA 1JAKA 2WXDM 2ISVA 3LQGA 3AICA 4B5UA 2DG3A 4ZPVR 1NEYA 3GR7A 3S5YA 5HUPA 2VX5A 4W7VA 4E6MA 2F84A 2HE5A 3EZ4A 4AWSA 3UERA 3WK3A 2WK2A 2PDGA 3TSBA 2F21A 3KM8A 3R6IA 1UR3M 3C2RA 2YXOA 5AYIA 3VUSA 3HM7A 4DH0A 3BL3A 4AZCB 3AWNA 1V79A 3LRMA 3DFHA 2YDQA 3UETA 1JNEA 1RJQA 2WZIA 1UR2A 3MQTA 2PDKA 1W17A 1K4HA 3W7KA 4GNKB 1UD4A 1OGBA 1S5NA 1LWIA 4AVFA 1X38A 4IICA 3TYAA 1J4EA 1G4EA 1ITUA 3NEHA 4DYKA 4XO7A 1ZSXA 1H11A 2UZ9A 3TMLA 4FNUA 4GWEA 3ANUA 2PPPA 4NYUA 4AD0A 1EGZA 5G1YA 5HMEA 2XP3A 3EDKA 1E0VA 1ZAJA 2NX3A 3RXZA 4MUZA 3C3UA 5FL1A 1A50A 5CPSA 3M9YA 2OGYA 3SFWA 3GHUA 4C02B 1PAMA 1KXQA 2CNCA 4D6GA 1S2TA 3KBNA 3RPMA 4NL1A 1UP0A 3GRIA 3OHIA 1I0DA 5CAKA 3Q67A 5LSMA 1PDZA 5D9OA 3H2OA 3AYRA 3WQ8A 3M0ZA 2X42A 3TKFA 1NQ6A 1VZWA 2J7EA 3GDMA 1FKFA 3K1GA 3CV7A 3GC4A 4JQ4A 4JXCA 3W7EA 3CUFA 4GG9A 4PEEA 4ICCX 3W1RA 2Q8ZA 1XH2A 3CHCA 2PD5A 3M0LA 4LRSA 5A94A 2PCQA 3EWUA 2H8ZA 4LNYA 2FZNA 4IOTA 3W2MA 4PULA 1BRLA 3VZXA 2YGYA 1XYCA 1IXOA 4O57A 3UR5A 5E0FA 1VHCA 1RP9A 3N12A 1J12A 3VD3A 4OQVA 1DPMA 3NTYA 3E2VA 3HTWA 3FJ4A 1TA3A 4MPKA 1AL8A 3KZ7A 4QEHA 3GHTA 1K1DA 4DUWA 3ARSA 3KEHA 1FDJA 4KF1A 5HQEA 4HZMA 3O5FA 2XPBA 1UWAA 3WLJA 3TXZA 3GU1A 1Q6IA 2YZ5A 1RQHA 3GH5A 2GGJA 3LG3A 3NZRA 3KVMA 4CD8A 3MUAA 3BQ6A 3N25A 2P1FA 1P48A 2Y1HA 4IQCA 3O5EA 2A5HA 2BFGA 4DRPA 2D24A 4OBRA 1TVLA 4IG2B 2NWRA 2FTYA 4E2BA 3K30A 3ZT5A 1D6OA 1W5QA 4AW7A 2X1TA 4D6HA 4U10A 5E1QA 3WDQA 4XBSA 4EWND 1ISVA 3BOFA 1IWBA 3TYBA 5C7VA 4DJEC 5GPRA 3P84A 3TCEA 1S2UA 4Q8PA 1OC6A 2DT2A 3SIMA 2HEJA 4YXGA 1LBFA 3HF3A 1DXFA 4IGMA 2YLLA 5DY3A 3DHDA 3APTA 1WKFA 3MO4A 3W85A 3NG3A 1B3WA 3TN6A 1FFQA 2C6QA 4M3PA 2YKKA 2G50A 4M80A 3LS9A 3DKJA 4E4PA 3M47A 3W28A 3VMNA 3MDWA 2L2SA 4JPGA 1E70M 3CIXA 1KWKA 3UGRA 5EFDA 5HDRA 2J7FA 1QPKA 4Z1AA 3H54A 2NT0A 3VKKA 3KUMA 4AZGA 1RY8A 2R8WA 2PF0A 2LPVA 4I5XA 1HJSA 2CESA 2Z7KA 3GHRA 4WVXA 4NVTA 4PSRA 1JCYA 3H24A 4LUTA 3ZIZA 4ODMA 2HSAA 1LOLA 3KRZA 3BJTA 4JEQA 4ACZB 4XSMA 1TCOC 3UCDA 2CKSA 2E5BA 3D3FA 3JRKA 2CZEA 1F61A 1OZMA 3NUKA 4JFWA 3W22A 2HNEA 1PKLA 1HG3A 3ARTA 3MYPA 5H8MA 1SVDA 3ODKA 1V0LA 1HJUA 3N15A 2G3JA 1IWPA 1SR9A 3GDLA 4XO6A 1OFOA 4NZJA 1RPXA 4D1IA 1ELSA 2FZ8A 3CB3A 4GOAA 3NO3A 2OYLA 1KFWA 3C0JA 4LT9A 2XP6A 4V15A 3S0CA 4AYGA 4O1FA 2ALDA 4L64A 2A3LA 4KWUA 3B8TA 3UZJA 3E02A 3W1QA 4ZOCA 4F66A 4GIYA 4IMAA 4W4QA 1Q6DA 5CZSA 2BG5A 2YXGA 1YIXA 3VKBA 5J5DA 1YDVA 2P76A 3H7UA 3FEQA 1UC4A 1W9DM 4H9YA 3HIJA 4FZIA 4JL1A 2J8FA 2Z27A 1IZKA 4JTRA 4X2RA 3R10A 4H41A 4AD5A 1VIWA 1H3GA 2GQAA 5M03A 1D3GA 3PUDA 5FSDC 4RE3A 4HHPA 1BFNA 4Q7BA 4XAPA 2IF4A 3SIZA 1V77A 3W6YA 1JIBA 4EOUA 3WLPA 2PBOA 3MMWA 3E0LA 4CNOA 5D03A 1C8XA 5HNNA 2NWSA 4JNZA 1P0NA 3SDOA 1M53A 1DE6A 1CWYA 5G1TA 3EX6A 2DH2A 2VC9A 4ZFCA 1WUFA 4B15A 2BY0A 5FJJA 4W9OA 5D4YA 5I02A 3GG1A 4HVXA 4PMZA 4GY0A 5XINA 1YDYA 4G9PA 3QBUA 5CC3A 4KIRA 4QAIA 7REQA 3FIGA 1NWUA 4KCTA 2ATMA 2PGRA 1MYRA 4HCHA 1XW8A 2WW5A 3ABQA 3PRBA 3NDZA 1WZMA 1KM6A 3FKKA 1F5ZA 2EGZA 3LXBA 3MUXA 3W72A 3BAYA 3TDFA 4FX6M 3STEA 3VMOA 3UD6A 4WOZA 4IMFA 3VX0A 4JFMA 3OLDA 1LL7A 3N4AA 2V3DA 1U1UA 2WMGA 3SCSA 2P3ZA 3SR7A 3H7VA 1D7IA 3S9ZA 4H4IA 1KBJA 5HANA 1ECEA 4M24A 3ZT6A 1ME9A 4KT2A 2WSYA 4ZOAA 3UZXA 4M56A 2XVGA 4UWMA 1JZ2A 1TWSA 4Q22A 1SMAA 4ZENA 2XHYA 1E0TA 3WNNA 3LHYA 4E4UA 1E1CA 3BICA 2PBGA 2X1SA 4PMOA 5E6YA 3LM7A 3VPLA 1YPXA 4M6PA 4PB4A 1J2WA 2C71A 4Q7IA 1IEWA 1OCBA 4BWLA 4LS0A 3ZSTA 4GZEA 2KGJA 1UZHA 3HJZA 2PC8A 2X05A 4QGCA 3NFUA 4XZLX 3W76A 4AH7A 1JYWA 2XVLA 5I07A 3A3XA 3JZEA 5BYWA 1JNTA 1EYMA 4ZO7A 3RX4A 3T0AA 1M41A 3JU2A 4JYDA 4Y9NA 1X6LA 1WO2A 4OV9A 4ZQOA 2JKAA 4M0XA 1RVKA 3W1UA 1PE1A 1VBHA 4ZE5A 3GBEA 2E6DA 1S2VA 2XIQA 3N6HA 2WSKA 3FX4A 1XBXA 1JL8A 4LCRA 2ZXBA 4LWWA 3W1TA 1U79A 1CXLA 1L9WA 1Q6CA 1CLKA 4ODLA 1KCLA 3QY7A 4UOJA 2HJPA 1HJVA 1GVYA 4HU8A 3RJYA 4LYPA 3KBVA 3DGBA 2CLKA 4JTCA 3UZ5A 3EMZA 1H41A 5BOOA 1QMLA 4A6GA 3M44A 4K7YA 4BA0A 5EMMA 1QASA 1US3A 5GQBA 1IEIA 4G1NA 4GBUA 2GOKA 4XKYA 3NYZA 3R12A 3IACA 3W27A 1TRIA 2DSKA 3ECQA 3RCNA 2CLFA 4DBWA 1QPNA 3MYOA 4PMYA 3U9IA 4CCDA 1YADA 4GLEA 4JFTA 5EMUA 1FWSA 2VR4A 3N4EA 5H91A 5CH9A 2QXWA 4GVIA 3R43A 4K8HA 4W8LA 2F2KA 3PPFA 3URNA 4QDMA 5PTDA 2AGKA 5IFTA 3KHJA 4Z08A 1A5AA 3WKZA 3W6LA 3UGVA 2TRSA 1PZ0A 2V5KA 3F7JA 3CUIA 3WMSA 1C9HA 3W38A 4YHGA 4CD5A 1YNPA 2ABBA 4JQ3A 3EEZA 1HNYA 5EMYA 3CPUA 1JPIA 4H6KA 1W9PA 1TB3A 3T44A 1Q6GA 3APYA 3BO9A 1H7NA 3EPOA 3UY8A 3CAKA 1FWGC 3BSGA 3I6RA 4X9SA 2OOFA 3MVIA 1OM0A 2VZOA 3T9PA 4NT0A 2BWGA 5DMLA 5I78A 2X2GA 1UQYA 4US5D 4WHBA 2WJDA 2V9DA 4BI7A 5F4WA 2YFOA 3NGFA 4UNLA 5IHRA 4DO5A 2C0HA 2FDSA 2PDFA 1GVRA 3F5JA 4Q4KA 4JYFA 1OSEA 3H2AA 1R5YA 3DG7A 1G67A 1IIHA 5CG0A 1GQKA 3RR1A 1SSGA 1G7VA 1MDRA 1YE4A 1CPUA 4Z0SA 3QM3A 4DPPA 4ODRA 4DYEA 4IIHA 2IKHA 1W9XA 5U4NA 1VEPA 1H4PA 4AEOA 4KERA 4XWUA 3V36A 2LLEA 4AX7A 4G50A 2QMKA 4FXJA 4ILSA 3F4NA 3OTRA 2TPSA 5KZ6A 3O5QA 1ODZA 1GPWA 3GKFA 3QHMA 4PN2A 3EA3A 5HWMA 1W1TA 1QPLA 3ABOA 4X60A 4UTMA 2CXGA 3UG3A 1FAPA 1JUEA 1RV8A 4LAYA 3CV6A 2E6AA 1JG9A 3WK0A 3CTLA 3C2VA 4M6UA 2NVAA 2VO5A 1PHWA 3L0KA 4FPSA 2V3EA 2CWXA 1EZ2A 1MXGA 1TPWA 1K7EA 1NDVA 3WYZA 2DG9A 3SGGA 4AD1A 3EB3A 1ZCOA 3Q4DA 1W37A 4IPJA 1L0PA 4TVDA 3JW7A 2QCDA 1SW0A 1TUFA 3MANA 3CUZA 2Y8KA 3LI1A 5HA7A 2O9TA 2GFTA 4KEUA 3RFWA 1JI1A 1KCKA 4R33A 3QW3A 1KBKA 4J3ZA 5HAOA 3Q2DA 1XH1A 3TQKA 4WX2A 3F2CA 4P61A 3BW2A 4S38A 3KCLA 1PTGA 2ZWYA 2V2CA 2GVLA 2OWXA 3UFYA 4HGXA 4CU8A 3K8LA 5JBEA 4DXXA 3L5MA 4U33A 1ODUA 4AD4A 2VEIA 1MRAA 2G97A 4Y2WA 2DP3A 4XAZA 1M68A 1GORA 4TTGA 4AF0B 3VIKA 4D6EA 2XIIA 5B7YA 3NA8A 3MPGA 1REQB 4ZQMA 1VPYA 4J4KA 3VCRA 2CIPA 1EYWA 1ZJHA 2V38A 1JDAA 2PP3A 1M5YA 3LGGA 2DPEA 4YS1A 3FVMA 2JEPA 5AC4A 3P81A 2C16A 4HHHA 4WY0A 3O6AA 3MI3A 4QIUA 1V6TA 1HVQA 4RCXA 3RHGA 1U30A 2VKZG 2YLAA 4QNEA 2FFCA 3RPTA 1S2WA 5FKYA 5HJXA 4ADUA 2BY3A 5DCDA 1PX8A 3VKAA 2JFEX 1E9ZB 1NAL1 4J2MA 4QS5A 3CAVA 3TTOA 3LD5A 3UXDA 1WXZA 3CS2A 1CGYA 3DBNA 1OBAA 1LWHA 2A0NA 4NI3A 1FY6A 2QIWA 3GC2A 1X39A 3CQHA 2YB4A 4TMBA 2FPVA 1MEIA 3NQVA 5AYYA 1ESWA 2E9MA 1KGWA 1RA5A 1KRBC 2FMOA 3OP2A 4BF5A 3PBYA 5EYWA 4G7EB 4ROPA 1AQFA 1V0NA 1WXJA 5FEXA 4PTMA 2G41A 5JH8A 4MAZA 5AHFA 3LLXA 4HCDA 5DN1A 3GUGA 3PFRA 3VDAA 3M5XA 4QSHA 1OGSA 3FAPA 3QQWA 3H21A 4JN7A 1PKNA 3FV9A 4NJKA 5D2YA 1J9YA 3S47A 1TE6A 3N18A 3RILA 4JX6A 4GY1A 5JUVA 2KZHA 2XZ9A 3GKAA 1RCQA 3BMBA 1ZAHA 3HQPA 5KINA 2QCLA 4XAKA 1AJ2A 1JZ3A 1E5JA 3VGGA 2FGLA 2XISA 4JTQA 3BJSA 1F40A 4NJHA 3CNYA 4CUCA 4FEZA 3NPUA 4ZO9A 4JTEA 4JKKA 4ADSA 4XBJA 5GNXA 2NXGA 3NAVA 1DYSA 1NELA 2Z6JA 4L6DA 4US6A 2Y7DA 3VVGA 4LANA 4YPJA 3B8IA 2Y8UA 4KCUA 4NY2A 3FXGA 4NIRA 4U2ZA 4B4HA 1GJUA 2A7RA 3CWOX 4MJ4A 3IJQA 1DQWA 3T1GA 2ZA1A 1SFSA 5H2ZA 1XLEA 5BW6A 4A21A 4JN8A 3RITA 3GR4A 5KSWA 1XDLA 1H1ZA 1T41A 5I6SA 3SCRA 3FVDA 3DENA 3BV7A 3TU9A 1ISZA 4P5UA 1X6UA 4GI4A 1TG7A 3K1DA 2W3ZA 3I7SA 2BVTA 4MY8A 2E9LA 3L65A 1B31A 4IQJA 4XQ6A 1A5KC 3R94A 2DZWA 1YBQB 3JYMA 5CEWA 3C8NA 3SQSA 5BXSA 3LV6A 1UMYA 5HW6A 3JZUA 3BQ5A 1QU4A 4J7RA 3KTSA 1CIUA 4B9ZA 2G0WA 3I3BA 2EG6A 2V5BA 2E67A 3AROA 3W2NA 3EMQA 1Q2SA 4L56A 3L4UA 2R24A 3DU0A 5FESA 1FUYA 2WC7A 4S3KA 1VFSA 3GU2A 2FHCA 1BWKA 4H9MA 3SUWA 2PMQA 1W1PA 2CERA 1A4MA 3FHQA 2PDYA 2CWNA 3TR2A 1P5BA 2BX7A 4GCAA 1KRAC 2OEMA 5L6UA 3UNTA 1AW1A 3VTRA 4Q6XA 4E8DA 1BXCA 3A9IA 1E56A 1E71M 2WJEA 3KS5A 3IKGA 4DWSA 2VRJA 1K6AA 1XRSA 4HPXA 1TX2A 3A9BA 4NUWA 3WQ4A 4DELA 5A8MA 2NV9A 2ZE0A 2KI3A 5J5RA 5BXPA 3WH9A 5F4SA 4CCEA 2G5WA 2BOFX 1UWTA 1MMFA 5K9XA 2HVOA 4F2TA 3T7VA 3WLKX 2E6FA 3UWYA 3WFZA 2FZBA 5LA1A 1J79A 1Q85A 4S3BA 1BG4A 4R85A 1W3NA 1EP2A 3QOMA 1X98A 3WL1A 2V82A 5EA9A 2VEPA 3FSUA 3THCA 1YX1A 2V63A 1LDCA 2P0OA 4IGHA 2YXXA 1W3KA 3D6NA 1KV8A 3EOLA 2REQA 4RDVA 4GIAA 3O5GA 1JDCA 4ATDA 3MSGA 4R7OA 3N2XA 2Q02A 3T0BA 1FKHA 4YTQA 2EULA 3WH5A 5LYRA 2WM1A 4QBXA 4EK7A 4UTTC 3CQJA 4JS3A 1ME7A 4PFMA 1UWQA 1O95A 2ZRZA 4XZBA 5HBFA 2XN2A 5GPGA 2V5DA 3BWWA 3QV6A 1V51A 2DVTA 3B7XA 4G56A 1FWAC 3WSUA 2Y61A 1UWIA 2XFWA 3RGCA 4U86A 1K4GA 2O9RA 1TPFA 4BR1A 2FH6A 4ICMA 1CXEA 2JKEA 3UWUA 5CC7A 2QHAA 3BGJA 1BLIA 3IJ8A 3W1NA 1CLXA 4RNHA 4BEQA 4Z2IA 3SY5A 4LAXA 3WH0A 1D2KA 2IPWA 3TK7A 1WZAA 1PJ9A 3AMLA 3GXNA 3GTFA 1VC4A 2QCHA 2ATSA 3BAIA 3KAOA 3OPSA 3O3RA 1QPFA 3TTQA 1NMVA 2NQHA 2QJJA 4UR7A 3BG9A 2WYSA 1QNOA 2YDSA 3Q37A 1ICPA 1N8FA 3BAJA 1I0BA 3ERPA 4NNRA 4P8XA 3OVPA 5DT5A 4AFYA 3BLIA 5FCZA 1TELA 3WL0A 5HJYA 3UWQA 2YW4A 5AOUA 4OVXA 3ZLGA 2IQDA 3N9RA 3LPOA 3QMTA 1LG2A 1EHNA 3PJWA 3I6CA 1WDSA 1P6WA 3IS4A 3LM3A 4H19A 2CITA 3O5RA 3LENA 3ICJA 3QV7A 1GJWA 1TV3A 2ZTKA 3NVDA 4IXHA 1CENA 5T9CE 4AG0A 3HMCA 3VNDA 3E5PA 4HJWA 5AZ1A 1XXXA 1DJYA 2B7PA 3EPMA 4GQ0A 5DMMA 1FOBA 3CAWA 5C8BB 3CLMA 2VZVA 3EWYA 1YE6A 3I4KA 3M5VA 1GW9A 4GI8A 4KETA 3URAA 3RMEA 4A29A 1XCFA 4Y6GA 1P0BA 4JR5A 2H3BA 5GJMA 2P88A 3EDJA 4PUJA 2OQHA 1AFSA 1EUNA 3L9CA 5REQA 1AW2A 4JOMA 3AU6A 2J62A 2PP1A 1OFBA 3HQOA 1OC5A 2XYLA 4BZYA 2YW3A 5KTLA 2CU0A 3VAVA 3COTA 5A2AA 4WUIA 3UQIA 4R9OA 3WNLA 1KGUA 3S1VA 4ZPTR 3NPWA 2QUTA 1JDDA 5DXXA 3SCPA 1Q8JA 1E6NA 1M04A 1XIJA 2QZRA 1UBSA 1J8VA 2G4FA 2QUNA 1YW1A 4MY9A 4RL3A 3MBFA 5AVHA 1XLHA 4LYRA 2Z29A 1TWDA 2RGMA 3GG8A 4GC4A 3WDPP 4PE8A 5K9CA 4LVFA 4D71A 2VXNA 5BU6A 3SCWA 1IEQA 1VYPX 4PUEA 1RBAA 4GKTA 1O6IA 1XLFA 4ZB5A 4PH6A 4KEZA 1PB0A 1RD5A 2C0AA 2CCRA 2IXVA 4RNJA 3TE9A 4S3AA 3SM0A 3VGFA 4GE8A 2KFWA 2D3NA 3TJXA 4IIEA 1FQ0A 3GDRA 3GTIA 2XIBA 1GG1A 4NU7A 3ZJKA 4LUYA 4QCEA 3NQ7A 2HXUA 2LGOA 3EWCA 4YYFA 3ARUA 3F5LA 1X6NA 1XIFA 2GDVA 2XFFA 3P8JA 5FEPA 4C7GA 3WLQA 2PDQA 2HXTA 5FJPA 5BOFA 4PMRA 3E2SA 3M5YA 2XUCA 3T42A 2BGNE 3B0YA 1K7FA 1XLMA 1KLZA 5CBJA 2OU4A 4UB9A 1QHPA 3HBLA 1ECQA 3ABXA 3UVIA 4JYSA 2JQXA 5ECVA 4HYWA 3F5KA 1WDWA 2EXOA 3TW7A 1BKFA 4LAKA 4AC1X 3VDHA 1VFTA 4ECLA 2XU2A 3VXGA 4PRTA 1FKDA 1AG1O 3QMRA 4A8LA 2Z2AA 1RBLA 2WVVB 2H3DA 5F1VA 1EWDA 1BQGA 1R9XA 2UWFA 2W63A 1Y5WA 1B9BA 2DUXA 4DWDA 3VAWA 4HIBA 4W9PA 5BZAA 4LOCA 2PFHA 5EB8A 3N6JA 3JR2A 3SZ8A 5FIPA 1X8CA 3WD1A 1ZPTA 3TNOA 1XUZA 1IGSA 4FI4A 3KDOA 3L7RA 3UJRA 1RSCA 1DHPA 1EH9A 3BOXA 4XD3A 4PB3A 3CHFA 1FWCC 1OYCA 2Y7GA 1H62A 1W9UA 1L6WA 3QFEA 4H8VA 2H90A 3WN6A 3LYEA 4UXDA 2Z26A 4M7SA 3M0JA 3TZNA 3B9EA 3VNLA 2OOGA 3LX9A 1V6VA 3IUDA 2X1UA 4HOXA 1H0GA 2ZC8A 5CPQA 1E9YB 2ACUA 1KM3A 3I68A 3U3HA 5DQPA 3SSJA 5I09A 5DRIA 1J96A 3GNPA 1FJDA 3M7WA 4Y9OA 2J6XA 3LEPA 5HOSA 4PSPA 2P8BA 1E1FA 3RCYA 1V03A 2GL5A 2PWVA 3A4JA 4W9TA 1XC6A 8CGTA 3QXBA 2W5FA 3TEVA 2XFRA 3PSWA 3WJWA 2ANUA 3IUHA 2ZUVA 5EKYA 4GYPC 1GZJA 1H0IA 2WKLA 4V27A 1E72M 2WKJA 3R7MA 3EB4A 1TZ7A 3WBWA 4WXZA 4XIAA 4CQ8A 3R8GA 1W0MA 1NQKA 2DZPA 3KP1A 4YMZA 1YDOA 4ZS6A 2RQSA 5LIKX 3C2OA 3E0VA 3WH8A 5KEZA 1PHQA 4O13A 4O12A 1K77A 5LXEA 4NAFA 3NOEA 4O19A 1OYBA 1V3IA 1AA1B 2Z0IA 2YBTA 1JULA 4TIMA 4OJYA 3HG2A 5KZDA 2WHJA 4M8UA 1GWJA 2JKPA 4GYKA 1RP8A 4K8EA 1RQBA 4PL1A 3HURA 1YLVA 4NYYA 3CEUA 1KKOA 3N19B 4PFHA 4LAUA 4TR9A 3N1AA 2FZMA 3UI5A 3K5XA 3SCNA 1L6SA 3V1PA 4K36A 4M1BA 3VCNA 4Y8FA 2CETA 3NL2A 4DXKA 3LBOA 3HO8A 1TV8A 1SR0A 1TCDA 2PWEA 4W84A 3WQGA 1ZCNA 2QQ6A 1J6OA 5IDIA 3WQ5A 4MB3A 3CUGA 3KZPA 4D8AA 1A5SA 1CCWB 4YTRA 1ZY9A 4LFYA 1ZP3A 1SZGA 4AWEA 3A23A 4LU0A 4IL0A 1GG0A 4JTJA 1JDFA 2DSUA 2VCDA 2IKGA 5I77A 2J78A 1VLIA 4IH3A 1R0MA 1K7XA 1KR1A 4F40A 3LA4A 2RDWA 2VCCA 2R1NA 5HUAA 5EMJA 2VDHA 4FB7A 2EAWA 3SBFA 2YSWA 3NQ2A 1Q6HA 1KW1A 1KM4A 2NUYA 1QHOA 2ZRWA 1HW6A 3UPBA 3OBEA 2AGTA 2FMNA 1W5MA 5FI8A 3O05A 4K8GA 4GYJA 4GNJA 1IXNA 3W82A 4A3RA 5G5IA 3RDKA 2CHNA 1XD0A 3GW3A 2PDLA 4NZCA 1E73M 2YL8A 3LUOA 1Q6QA 1VCGA 4DB7A 3A22A 4O18A 1T96A 4GUIA 2YYTA 5D37A 1QWGA 3OW1A 5BNKA 1IR2A 3H2CA 3B06A 1OQFA 4LTSA 2OMAA 4O28A 5D05A 6PTDA 2GUBA 4HTYA 2QCDB 4XAYA 4O53A 1O68A 1XLIA 1NSGA 5C2CA 2Z2UA 1ZS2A 4CGTA 1C90A 4NI8A 2ZWZA 3H26A 2YL6A 5ABFA 3IARA 2QAPA 1EXPA 3AMDA 8XIAA 4ZO6A 2DFAA 2DUAA 4ZB0A 1DXIA 3HG4A 5G4HC 5DF0A 4ZR8A 3R0DA 1OJXA 1I2PA 4C7FA 2HBXA 1ADDA 5EU9A 5LKYA 4S3FA 7TIMA 4R0XA 1M5WA 2CKRA 4KWWA 4Y9MA 2WCAA 3ZFHA 2DT3A 3BOLA 5GJNA 4X9YA 3AXKA 1HUVA 5ABEA 1IE7C 4FLQA 1KFBA 4DJEA 3TQVA 3C5QA 4RKAA 2E09A 5F4XA 1LOQA 2CBUA 4DIPA 3ZMRA 2RDXA 4HYVA 4YWIA 1Q6LA 2ZUTA 1GEHA 4LVGA 1ZK6A 1UZ1A 3PJTA 4IJCA 4DT4A 1X1ZA 3AU2A 3BE7A 4UCFA 4MWAC 4I6KA 3UJEA 1OK6A 2BTMA 5JQ9A 4JTLA 2ASHA 4MHBA 3RRXA 3PZVA 3ME3A 1UKPA 3BUVA 1ISWA 1XIGA 5EBAA 2GGGA 2R1MA 4AIBA 4WDTA 3IPWA 1FWRA 4KRTA 1SPQA 1LWJA 1EJTC 1UWSA 4NX0A 1B9ZA 1D3CA 3MY9A 4NXSA 5FL0A 4B91A 3PP7A 3DDMA 4F0KA 2VR5A 2OJPA 1DJNA 1T11A 3QQ0A 1KFKA 3W2JA 4L65A 5LA0A 5T9BG 5E70A 1C8VA 4O4VA 4M6QA 1Y5VA 2QCFA 4X3ZA 1LF1A 2J77A 2V5CA 4LAVA 5KMYA 3GVRA 1PO9A 1SZEA 2YPIA 3GU9A 4WCJA 2C1HA 5AB3A 1JCHB 4PC8A 2NSXA 1LM1A 3BXWA 4LUJA 2DEPA 2CLLA 1EO7A 2OZ0A 4FR1A 4MYXA 4OOUA 1FWEC 4LV9A 2PODA 3AMCA 3B9NA 5HWBA 1OZQA 3NSXA 3WD0A 5A6SA 5K9DA 1KR0A 1MXDA 2Y8VA 3LSBA 3DN5A 1JGIA 3GM8A 4R5EA 4AZCA 3R0KA 3PPGA 2D2OA 3GNNA 3U7BA 2Y78A 3B9AA 4L6HA 3NZPA 4GZIA 2FVKA 3II1A 4LUSB 2DUZA 1VJZA 4FOKA 4LCQA 1OY0A 1JZ7A 3I10A 3HQNA 1QBAA 4GFSA 3B8SA 4J3TA 1AH4A 3SUUA 2XWDA 3E0IA 4XG1A 1ISYA 4GA8A 4HNTA 3KFTA 1GOXA 1KV5A 5CBBA 3R8HA 3TYEA 2RUSA 6ENLA 2INEA 1UWRA 3PF3A 1MW1A 1GVOA 1NOUA 5CPLA 4H3DA 1R9ZA 4JFUA 3D0CA 3GO2A 1WA3A 3H7RA 1BGAA 3QQ1A 3AYTA 1F9CA 2OLHA 1TKKA 3VCCA 1RLCL 4BK9A 3I6TA 1OX5A 4DYJA 3G3DA 5A8GA 3G1FA 2M2AA 4KGJA 3U0HA 1M65A 4HP5A 3O15A 1VCFA 3MZNA 4TW8A 4XZNX 1HT6A 3GYCA 4DM1A 3UU0A 3L4TA 3SQMA 2OWWA 3C56A 4MWAE 3QKEA 3NXFA 3HPZA 1R47A 1ROUA 2OODA 4DJFC 1Y5XA 3KWSA 3ZR4A 3WQCA 3DYMA 2RGLA 3LPFA 3TUUA 2VUYA 4F0SA 2ZZ5A 1SO4A 3P80A 3W1AA 3AS2A 2C19A 4R88A 4O14A 2C8NA 2BODX 3GVWA 1E3ZA 2D1ZA 4G6CA 1G4SA 3I7QA 4JD4A 4Z1BA 3NYDA 3O5PA 4MADA 4LX4A 3W0KA 4WD0A 1CX9A 3MJMA 1XCWA 3FS2A 2GLKA 2PTYA 2D2GA 1F4HA 1F07A 4UZSA 3WD2A 2XINA 3MUZ1 3WUBA 3S1XA 4I9MA 5HWCA 3VFCA 3PZGA 3UI4A 4JTIA 4ITZA 4NJGA 2ZUUA 3VNZA 3PTDA 4AIOA 3NQDA 3O06A 1NF7A 1IT8A 2ONEA 4CQAA 4N9DA 1NMWA 4QLLA 1V02E 3KCEA 3VX1A 4DWSD 1L8NA 1E6SM 4ZBCA 2NW0A 3RJXA 2ISWA 1PCWA 4O2TA 2QPXA 4FLSA 2W6RA 4DZ3A 2Y7EA 1EA0A 3H6OA 1Q45A 1SQ7A 1KM5A 2JF6A 3RLHA 4K1WA 1JXJA 3T08A 1OFEA 5CSRA 2KX9A 4DO6A 2PDNA 4Y9AA 3EOUA 4GINA 4DIAA 4HNOA 2ZUMA 3M1ZA 3IKDA 4C6LA 1HVXA 1DWAM 5CZKA 1F8MA 3SCVA 4GVGA 3CASA 2YX0A 2X16A 3O7UA 4E2OA 3GW0A 2OLAA 2B81A 1AQMA 4PBEA 1BHGA 4CQDA 1XWYA 4RDYA 4BY3A 3T4CA 4S1FA 4JHOA 1MUMA 3PZTA 2XWEA 4RXFA 1CB7B 1DWIM 3DFYA 1TYGA 1O60A 2WQDA 3C0SA 2G4JA 3VIOA 2V3GA 1PINA 4UTWA 1P0KA 5D32A 1MQQA 4PCTA 3WF4A 1SFJA 2WANA 1XGDA 3UZWA 1JYVA 4ACZA 4AZ7A 3WO8A 4Q8TA 1L1PA 3QHOA 3W23A 4M29A 1IYXA 2F8QA 4K2SA 1OD0A 4BQ5A 1E40A 3VZZA 4TX0A 1E51A 3H22A 1CGUA 1V7AA 5AC8A 4JHZA 1FVPA 3TFXA 3QF0A 3N9SA 1VF8A 3VM5A 1QR7A 3N04A 4PTXA 1V0KA 2QYGA 5CC6A 1W26A 2VGFA 3DKLA 2A1YA 2YCLA 3DG6A 4DRMA 5EMLA 4BF7A 2X0YA 3OZMA 3G6LA 3LQLA 1ALDA 2RJGA 3DG3A 1LZOA 1YEYA 4GJ1A 1JZ5A 3WJYA 1JYXA 2VZTA 3MZ2A 2XP5A 3VM7A 3ZWTA 4N9CA 4ZQPA 1FP8A 1KM0A 3IJDA 4JCLA 4H7VA 3AHZA 3STGA 4PBFA 4IJBA 1W54A 2HPIA 2E5DA 3WZ0E 3O0KA 3I4EA 3P60A 4TXEA 1TSIA 4EE9A 1C8QA 3G22A 4QQUA 2MUCA 3FNDA 4C1KA 5K7JA 4PYSA 4UFJA 4FOJA 2AQVA 4GACA 1ZJAA 2RAGA 3NZQA 2Q71A 3S2JA 1CECA 2R14A 1US2A 3GPKA 1I6NA 3SRDA 3UYCA 3GZ3A 3VGBA 2QDHA 2HE8A 4O50A 3T2OA 5BOEA 2ACRA 1XLGA 4HJFA 2X2YA 1PXGA 4GO9A 4AZ5A 2ZQ0A 2OFJA 1N55A 1JQVA 3BSMA 3E49A 1KRCC 4HZ7A 4L4OA 2X8RA 3MHUA 4GGBA 4MJMA 3TW9A 4X2PA 1UR8A 1BTCA 3GVGA 4W87A 2V5LA 1FKIA 3A3HA 1ZTVA 4J5NA 4DZAA 4MGGA 4M7TA 1RXOB 3L67A 2D20A 3ES8A 3TVAA 1QXLA 2NQ5A 2Q8XA 4LVBA 1GHSA 4YN5A 4H04A 4FX8A 2XSBA 4J1OA 1DHKA 4N02A 4O8RA 4ZFMA 4BKNA 3GH4A 1OFDA 1JCMP 3FGCB 2FJKA 3ITYA 1K9FA 2XPAA 4TX6A 2FAPA 9RUBA 1CXKA 4UQCA 1C7TA 3NZ1A 2Z28A 4H9ZA 4P7QA 4CN1A 4DLFA 4R9XA 1BXNA 2G37A 3WEZA 4HT3A 2A3CA 3AAMA 4H2HA 3W70A 1Z89A 1FWTA 4EPBC 3GUWA 2IUZA 3A5FA 2J7BA 2PP0A 4FXRA 4D2JA 4F48A 1WDQA 1CXIA 1GUVA 3VOGA 3AIQA 3TJ4A 3PHAA 4GVHA 3STFA 3THQA 4HB7A 3VKCA 3T0DA 1XFBA 4XK2A 1J6PA 2RURA 3H70A 4PMUA 3E2QA 1N7KA 4I9TA 5FJRA 1JPMA 2OEJA 4X61A 4LVDA 3RG6A 3LMZA 4MDOA 5BXRA 5LXXA 4YCPA 4FAMA 3GFZA 2DGAA 1RBOB 1QW8A 3KOXA 4V33A 4O8AA 4DBDA 3RN6A 5DCEA 1XUUA 3AHVA 3RK8A 4AD2A 4GQQA 4UFIA 1TPH1 1BG9A 2ZX9A 5M5DA 1ZGDA 4DN1A 4MB5A 3EOSA 1R7OA 4JTUA 3ARZA 1FH9A 4LY4A 3E6EA 2J9ZA 4KBXA 1KXVA 4PUKA 1EEXA 4UIOA 3EKLA 2DSWA 1A3WA 2XGBA 3IRSA 1LRQA 1K8YA 2I56A 1E1EA 2PLMA 2FB3A 4JFIA 4HBOA 5C0QA 3OHMB 1FBAA 1VAHA 3CMFA 3W7GA 4H8HA 2QPUA 1G01A 5AHMA 1R3RA 3VFLA 1S5TA 2O4MA 2Y0FA 3F4DA 3EPNA 1E0WA 1S1PA 3LCFA 3WBEA 1FHVA 1UUMA 4XZIA 1RH9A 2ZYFA 5I3JA 1KLYA 1GHRA 2E8YA 2DDXA 1QO2A 5C6MA 3SCTA 1E6XM 4B9YA 2BB0A 1XYFA 1IQ8A 4PTVA 1FXQA 4KR0B 4R34A 2OSWA 1CYGA 4QCFA 1WPCA 4XIMA 3CT7A 1V3KA 4A8NA 1EBHA 1V3JA 1NWSA 2GSJA 3M16A 4Q4OA 1X97A 3MUIA 3A6OA 1A0CA 2Q09A 3H23A 3UPMA 3L5LA 4HTBA 1W1YA 4KW2A 3C8FA 1Q7QA 2FJUB 3FDKA 3LCIA 1GVEA 1ZALA 2C91A 3D47A 4UZUA 2ACSA 3DX5A 4EXAA 4AB4A 3B0VC 1VR6A 1YPIA 2FTWA 2NX9A 3OGSA 4C1NB 1XG4A 5IM51 3HFTA 2I9UA 1XM3A 3IANA 1CT5A 4CNNA 3FY1A 1ENUA 1GQJA 3OGVA 1V6YA 4NAFB 3GH7A 1J0JA 4RPQA 4IT1A 1GYMA 1GTEA 3QMSA 1TTJA 3U8GA 3SRHA 5C9ZA 4QHRA 1M3UA 4RZ4A 1Q6UA 2W0UA 4Q8MA 3WDRA 3DFPA 2XGZA 4QISA 1KXHA 2JZVA 3ANYA 3OVGA 3R1ZA 3KXQA 1T6MA 3ITVA 4GQBA 5FEZA 2JALA 4Z17A 1HO4A 3VD7A 3CV1A 3ALFA 2GJRA 1NFGA 3GR8A 5AFDA 3G3MA 1WUEA 3PC0A 4POCA 3UP8A 1EX5A 3SN4A 4MJZA 3UG8A 2JK2A 2Z00A 2ON3A 3TN3A 3LV5A 3ZS4A 2RDUA 2C7FA 3CWHA 1BL4A 4ORIA 2TYSA 3KBJA 4QE1A 3XISA 3DFTA 2EPOA 2PWHA 2PDBA 5AHLA 5A6KA 3DAQA 1K70A 1EF2A 2XP9A 4GABA 3BCJA 5HATA 4JICA 4PUUA 1AK5A 5XIAA 4HQVA 4D8ZA 3W73A 1WXYA 3L4VA 4XZMX 3EWWA 3QVQA 4HBEA 4JGDA 5CQ1A 2J8TA 2ACQA 3R13A 1Y8BA 3ZJ6A 4BS0A 3S1GA 1ONXA 2E8ZA 4EANA 4QT2A 2DJXA 3L2IA 3WMLA 4HA0A 1SZFA 2CYGA 3UVAA 2NQLA 4RE2A 4XD6A 2Q01A 3EX2A 4W88A 1OINA 4J40A 2B31A 3BH4A 4QSFA 3CQKA 4WY0F 1G7UA 2V68A 1OG6A 3FJ6A 3WLLA 1WKEA 4HPNA 1UH4A 1RR2A 5LIWX 4N7QA 2WHKA 2XDFA 1XPGA 3CXOA 3M46A 1UR9A 4LQ1A 2PB1A 4UMBA 4BF8A 1ADSA 4GJIA 3VABA 1IZJA 3QTGA 2PDIA 3CGTA 3EB2A 5CJ5A 2WZTA 1HFBA 3VOFA 2HTMA 4PB5A 1TVNA 4PTDA 7CGTA 3S4TA 2M1IA 5TQLA 4LYQA 1QI3A 3UR8A 2VX6A 4C6CA 2OO6A 3T05A 4O15A 4IT4A 4AF0A 4WR3A 3N2MA 4QJ3B 3PS7A 1J4RA 1VPQA 4MB4A 1REQA 4GYFA 2WM0A 1V6UA 1VIZA 4WKFA 2BNJA 2AWGA 1PZ1A 3MV01 2KR7A 2HCVA 3ITOA 4M81A 3UWEA 4E0CA 4ASTA 3NR0A 3STCA 5EY5A 4HU4A 4N19A 1NJJA 3N4FA 4I9JA 4JQ2A 4P7NA 2UY4A 4UTTA 4GK8A 2YA0A 4HNNA 4OIFA 4BEUA 4H1ZA 2R9RA 3LBMA 3W7IA 4XD4A 2WOQA 3BVJA 4M51A 5ENLA 1GYNA 2C1IA 1E55A 2FZDA 4OZOA 1EQ3A 4TW6A 2NLYA 4JDBA 2CBIA 4R7WA 1H60A 4CNUA 1L2UA 4A3QA 1UC5A 3B4UA 4LV4A 5ABTA 2R1PA 1E6PA 3Q65A 1E4IA 3TW6A 4R3UA 3A64A 1I60A 1EJVC 1KNWA 3GDBA 4AWUA 2HVNA 2PN0A 1GKPA 4DJED 3IK4A 3MKVA 1O1HA 3ATYA 1QBBA 3FAWA 1OF8A 4G7EA 5AC7A 8TIMA 3HGSA 3JXVA 3UW6A 3SURA 6TAAA 1OD8A 3M0KA 5I0DA 3LOTA 1I2NA 1XBVA 2PDWA 1KBBA 2VFIA 3WBXA 3PM6A 1CW2A 3ALGA 5D9MA 4ZTYA 4ES4A 2VT0A 2QUVA 3AXIA 2WLZA 1XX1A 2Q8LA 2C3ZA 3V5CA 1TPB1 4IFKB 1X96A 3MMDA 5FACA 1WZLA 3K4AA 2HVMA 3O63A 4LAMA 4DZHA 4DJDC 2D2JA 2YJQA 2BSLA 5FEWA 4PA8A 3NQMA 4BWLC 3KTCA 3O5DA 2BVDA 1SW7A 1WDRA 3L0NA 1EGMA 2GQ9A 4O17A 4ORMA 1SJDA 5HINA 5MHBA 4JTGA 1S3HA 4FA3A 5IRPA 4Y96A 1FKBA 5FD0A 3T2PA 4PRWA 1QOQA 1JNDA 3WY1A 1VEOA 1XKYA 5AVNA 1S5MA 2J47A 2PI6A 4JCMA 2Q5AA 1UD5A 3DHUA 4FXFA 2FB2A 3NQAA 3S8HA 3PBUA 1TUXA 4IMGA 2PPNA 5I98A 4K7VA 1UKSA 1LLWA 4WSHA 1B3OA 1VB9A 2PDPA 3EYPA 3VIHA 2DIEA 3HJEA 3S5OA 1YBQA 1RAKA 2VRKA 3VI2A 4L80A 3FCPA 5J8LA 1OB0A 1MI3A 1E43A 3WF3A 4DO7A 1S2CA 5A6MA 2JGYA 5AHIA 1BWVA 1KO0A 1TVPA 7ODCA 4DNMA 4U4MA 4B5XA 1B3ZA 2BZNA 4PGLA 3G0XA 4A3YA 4AHQA 1B6CA 1I8JA 2PRLA 4B3ZA 3C3NA 2OZ8A 1AJZA 3VOCA 1Z7AA 1OCNA 3KVKA 1HP5A 4HBKA 4P8VA 2VR2A 4RJEA 1GEQA 3FFSA 4LNCA 3L68A 3FK4A 5BRQA 4KWSA 3CYVA 4KQZA 4F9DA 2Q3OA 1U1JA 5CPMA 4UR8A 2GSEA 1XDJA 3PB0A 4QLKA 3PNUA 1HTIA 1GOKA 2YL9A 2OCZA 1XCXA 2PV1A 1W3LA 5AZ0A 2VC7A 4YHEA 3H2MA 3OVQA 4O1AA 2WPGA 3TMQA 1T40A 3TQ0A 1OHLA 2I5QA 4MZYA 1ONWA 1D8CA 2CHOA 4GX8A 4ZE4A 2EPKX 2V0TA 5D30A 2WQPA 4AZHA 2ZCGA 1WB0A 1LQ0A 4QJ5B 4L61A 1FWDC 3HPSA 5CSUA 4IPXA 5IOBA 2XP4A 4KQNA 3BGGA 4WSJA 4IUOA 3KOFA 3KWXA 4M82A 4Z42C 1XGZA 3QN3A 1T0OA 1LROA 1D7FA 1QI0A 3TV8A 4NASA 5J04A 4JDYA 4FK9A 5A5WA 1VBGA 2WWCA 2MANA 8RUCA 3PZOA 1G4TA 3CUHA 3HA1A 3TTEA 2Z4GA 4H6QA 1BF2A 1TPEA 3USBA 1L6GA 3M0HA 8A3HA 4CD6A 1QT1A 4ZB2A 2ZUNA 2WJZA 1Q4NX 1ZLPA 4IL2A 4QS6A 2CLOA 3T8QA 1A53A 3CZKA 4JY8A 3QRHA 4JAWA 1J0IA 3S2NA 2HROA 3PBMA 4KGLA 3T78A 4PUMA 3NQBA 4NG3A 4L1WA 5HT1A 3MKKA 4FNPA 4RLIA 2V2DA 4BF9A 4GRSA 4C5YA 2PRHA 2BP1A 2VQTA 4AY7A 2V30A 2ZZ4A 4P7LA 3CWNA 3W26A 4G2DA 4GQRA 3NL5A 5A6BD 1KQYA 4UBPC 3UWZA 4Z1YA 1ZENA 3ITCA 4FIRA 2WVTA 3RF9A 4NILA 5HNTA 4B2DD 1XIBA 2XFYA 4AMAA 4HSHA 3LXAA 4HSNA 4PUDA 3GTYX 3ZWSA 5BRBA 2Y5EA 4O1BA 2XP7A 1RK5A 2WSQA 3QTPA 2YCLB 3PZNA 2DQXA 1A0EA 1O94A 3IK2A 4K68A 3P74A 3N73A 3PBWA 4GYPA 4IGSA 4J3SA 1XIHA 3A21A 3WBAA 1H5YA 3HOJA 4LC8A 1K03A 3QZAA 6XIMA 1KCZA 3IIXA 1CB2A 2WJFA 5I3IA 4GVFA 1Q5MA 3PWIA 2IPFA 3ZLHA 4PCPA 4AZ6A 1W8SA 3WLMA 1R87A 4MB1A 4HMEA 1SO6A 1XINA 4JNYA 3WK1A 1EA9C 1Z32X 1H51A 3TWBA 2AAAA 1W9VA 4Z2JA 4CU6A 3W7OA 4MKVA 4K38A 1EDGA 5F2GA 1EXBA 5H6HA 4UFHA 1A3XA 5DEZA 2OX4A 1X8FA 3G1RA 4JN6A 1CDGA 3RM8A 4H9XA 4EF8A 1A47A 4DEFA 1R85A 2G3IA 1EC7A 1D7JA 4S23A 1THFD 1VBUA 4NP7A 3CK5A 1RJPA 4L4PA 5LZLA 3B0XA 2GGEA 3NQEA 4NX5A 2ISDA 1J18A 1PYMA 1NFBA 4UCGA 3W7LA 3UQBA 2A7PA 2Z1KA 2OXNA 3KAIA 2XSAA 1JPHA 2F9RA 3ARQA