4WKAA

Crystal structure of human chitotriosidase-1 catalytic domain at 0.95 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
369
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
total genus 132
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkaA01
4F9JA 1E73M 1QBAA 4W5ZA 2W5FA 2VX6A 4E8CA 1PBGA 3L4ZA 4QCFA 2WWDA 1VEPA 1QBBA 3FY1A 3DYMA 3TTQA 4W5UA 2BHYA 1WB0A 1W9XA 4HA1A 3W38A 5FKYA 2EPNA 2GVYA 4OOZA 3WQVA 1J0HA 1FP9A 3T2PA 4AD0A 3ARUA 2OSWA 1WZAA 3RJXA 1GHSA 1I1XA 5CZKA 3W24A 4UTFA 1ZBWA 5KEZA 2OWCA 1E6QM 2MANA 4D1IA 3VILA 1KCKA 3EMZA 1TA3A 1DWGM 4CGTA 2EPMX 1G1YA 2Z1SA 5JBDA 3VOCA 3AIWA 1RD6A 3BCDA 2J77A 1OCQA 5E0FA 5FOOA 1JYXA 3CTTA 5A6MA 4AD4A 1CIUA 4MB3A 3SIMA 3THDA 1J12A 5IHSA 2UY3A 3PN8A 2YL6A 2X2YA 2DSKA 2DSVA 1H4PA 2UY5A 4MPKA 3CO4A 4PBGA 4AZGA 4PMRA 2ZX9A 1PIFA 4AZCB 4CU8A 5CG0A 1UD2A 1OSEA 1BVZA 2V5DA 3RIKA 2AAAA 3WNKA 2W66A 2DSUA 3WDQA 3VDBA 2VI0A 3AMLA 3IJ7A 5E9AA 1K9FA 2YKKA 1BAGA 2F2HA 3WDRA 3WIJA 1V03A 1C3FA 3CZGA 4PMXA 1JF6A 3A6OA 3VKKA 3MSDA 4MNLA 2BY1A 2WNWA 4MNJA 4XB3A 3PZGA 4UQAA 4AMCA 1M03A 1H2JA 4AY1A 3AMCA 3VU2A 2J8GA 2ZX5A 2XVLA 1ZS2A 4P8WA 3W6MA 2WC3A 2W67A 3VINA 1WP6A 2CNCA 2G8ZA 2J47A 5FCZA 3LPGA 3VMPA 2DIJA 3WH9A 3WBAA 4Q22A 1BF2A 4W88A 5I5RA 3CHEA 4X0NA 1UD6A 1DP0A 2GK1B 1TG7A 3WFLA 1UWQA 4W7UA 2VX7A 1E4IA 4J28A 2WSPA 5JBEA 4UCFA 1C92A 2YLAA 1JFXA 1C8YA 3HMCA 4J3VA 2J78A 3GNOA 1V6UA 3VIOA 1H41A 3KL5A 3EDDA 1EHAA 1W2VA 1ITXA 1WDQA 1WE5A 5A8PA 3CGTA 4TVDA 1RP8A 1BSIA 4GXPA 4CD7A 1ZJAA 3W81A 2XFYA 3LPFA 3WEOA 2W91A 1U33A 2FGLA 1B90A 2WC4A 4PMDA 1LWHA 1V6WA 2CBUA 1R86A 2RGLA 2E9MA 1ECEA 5M03A 1VFUA 3MMWA 2OWXA 1EH9A 3VIGA 1AQMA 1ISYA 1Q4NX 1XCWA 4NRSA 3ZJ8A 2V3EA 4OBSA 4GZEA 3CUGA 2QLYA 2GJPA 3AOFA 2Z1KA 1SFSA 3CHFA 5CPSA 1MW2A 4NRRA 1FFRA 1B31A 1HP4A 2XSAA 3CLWA 1JXJA 1CXIA 2ZUSA 3SUUA 3WH6A 3MV01 4DUVA 1J0YA 2ZUWA 1C91A 4AIOA 4UZSA 3VD9A 4EAMA 3VD4A 3ECQA 5D8ZA 3GZAA 4J3UA 2DSWA 1IZKA 3AROA 3ZIZA 1OD8A 1W1PA 3FXYA 4CCCA 3VGHA 7CGTA 1LQ0A 4U3CA 5ABFA 2GJXA 3KE0A 3WUGA 1ISXA 4D6JA 3MS8A 1K6AA 3GXMA 4W85A 3N9KA 1UR1A 4A4AA 3OLEA 4U5KA 3WD2A 1FH9A 5DF0A 2J7DA 5GPRA 1KXHA 3BSGA 1C8QA 4NZCA 1TVNA 3GBEA 3OBAA 2YIHA 1WDSA 2WZIA 4MJ4A 3B9EA 4ACZB 3KWXA 4P8VA 2GUYA 1VBRA 4OUEA 3SCTA 3BAYA 3VGDA 1KXTA 1CLVA 1UQYA 4UNIA 3GDBA 1RH9A 4WIWA 4AD1A 2O9OA 2BVYA 4MTVA 3SEPA 3FHAA 3T0DA 4HPHA 2WVUA 2G3MA 3PZOA 4B3LA 3WD4A 5D4YA 4D6FA 4DWSD 1U30A 1GNXA 4Z2HA 4GQQA 4NI3A 4PMZA 3W29A 3A4XA 2XM2A 3AHZA 5BXPA 3ZT7A 4AYSA 4MB4A 3AXIA 2ZOXA 3KL0A 1ESWA 4AD2A 1K9EA 3EMCA 5IHRA 4PTVA 3WELA 1H1NA 4AZ6A 3VD5A 1VB9A 3CHDA 4S3KA 4H8UA 4DM1A 5EB8A 4LYQA 4PRWA 3N04A 3AIEA 2VNCA 5GNZA 3SCOA 5CQ1A 5LYRA 3W6LA 2XYLA 1EO5A 2V3FA 5IFPA 4AC1X 3L4XA 1BHGA 3DC0A 2WB5A 2VQUA 5CXPA 4GKLA 4QP0A 4Z2GA 1XV8A 3DYOA 4IUGA 1UZ1A 1V6YA 1L0PA 2XFRA 2XVKA 4UOZA 1W1VA 2EXOA 2CKRA 1GHRA 4ZXLA 2J74A 1V6VA 2NT1A 4Z2KA 1G5AA 1B3ZA 5ABEA 2F61A 1CECA 2ESCA 1WO2A 3WF2A 1UA7A 1I1WA 1B9ZA 3L2MA 1SMDA 3TTYA 4IPLA 2DT3A 2D22A 1E0XA 5E6YA 3U57A 3CZ8A 1V02E 4UR9A 1W3JA 1JNEA 1V3IA 3AHVA 3BLKA 3BAKA 2ZWYA 4GI8A 3K8KA 2GJRA 1M7XA 2YDQA 3DYPA 1QI0A 4FK9A 1JDAA 3SCWA 1E6SM 2V3GA 4B9YA 1ODZA 4XZWA 4R27A 1KR0A 1LJYA 2W92A 4J3WA 4KRUA 2VZVA 2WXDM 2ZUMA 2JALA 5M5DA 3GH7A 1OGBA 3W4RA 1QVBA 2XM1A 1EDGA 1L8NA 4KGJA 3BXWA 2XVGA 3AMDA 4PSRA 4TTUA 1DTUA 1FHLA 1Q6DA 4HTYA 5BWFA 2WM0A 4PYSA 5FL0A 4D6CA 2BNJA 2WMGA 1PPIA 3B8SA 3U5YA 1VAHA 2ZX6A 5HNNA 2DH3A 2ZXDA 4AISA 4URIA 1E4LA 3SCVA 3HU7A 1EIBA 1UWUA 2XWDA 1OB0A 1I75A 1JFHA 1MQRA 1NQ6A 1W3LA 1B1YA 2VZUA 4FLRA 2WCGA 1UKOA 1UD8A 4UOQA 3ZQ9A 4YN5A 1JYVA 2DT1A 5HXMA 1FA2A 2D24A 3IAPA 2BHZA 3VGGA 1HL9A 2D0GA 2ZXBA 4QDMA 4LQ1A 3RMEA 2WC7A 1XSKA 4K68A 3MU7A 2ZWZA 2CERA 2XVNA 1ZU8A 1CWYA 1MQQA 2XGIA 5A8OA 3RJYA 3AZTA 3TONA 1D3CA 3WNNA 4HU0A 3W28A 5AYBA 4ZFMA 2WWCA 3VDCA 2X1IA 3NSNA 3AS1A 4UFMA 4Z2LA 4ZE5A 2VO5A 1BYDA 2BV9A 1CXKA 2WHMA 3BC9A 1UH2A 3WEZA 5BYWA 2QPSA 3SURA 2O9RA 4PN2A 3OLGA 4MAZA 3OA5A 1OM0A 2E9LA 2J7FA 5IFTA 3AIQA 4AZ5A 1OIFA 4YPJA 1LWJA 3VD3A 3QOKA 4XZBA 5DMYA 4PTMA 1CENA 1ZJBA 1MXGA 3OGRA 4HMDA 1PX8A 4LX4A 1EOMA 3TA9A 3WFZA 4P7OA 1QOXA 4OZOA 4C7DA 2GSJA 9CGTA 1EHNA 1B3XA 4JCLA 1CEOA 3CUJA 2CBIA 1BQCA 1V0KA 3TOPA 3SCUA 4F66A 1C8XA 1B3YA 2D3LA 2E9BA 1OWQA 1GONA 1V3JA 4GPNA 2X8RA 3ARPA 3SUTA 1GW1A 3AHYA 3NSXA 2XG9A 3IK2A 3LMYA 4AD3A 1JL8A 2FGZA 4CU6A 1JYNA 2DPEA 2CEQA 4W8BA 1HIZA 3WQ5A 3SUVA 1D7FA 2WCAA 4A3HA 4N42A 3LPOA 3VGEA 4CD5A 1LL6A 2JIWA 1QI2A 2D0HA 4TOQA 3PZQA 4LXFA 3BH4A 1UKPA 3QHMA 4MNMA 2CPUA 5F7UA 4F8XA 1IV8A 1W9DM 2PBOA 1SR0A 2J7GA 2E40A 4AZIA 1C90A 5AY7A 1JYWA 3WF0A 3ZO9A 1BLIA 3A4WA 1E6NA 1ODUA 3TTOA 1O7AA 2PWGA 2WSKA 5I3DA 1PEZA 3OGVA 3S6TA 2WHLA 2D20A 4AIUA 1US3A 4AIEA 4JHZA 2A3AA 2CKSA 3M46A 3AIVA 3AICA 1Q6EA 2XSBA 5A8NA 1EXPA 1UA3A 3E1F1 3WN6A 2BY0A 3T09A 2DT2A 2VRKA 1UHVA 1TA3B 3KEHA 5BXTA 1KCLA 1W9UA 2FHBA 3VDHA 2C7FA 1ZBVA 1HN1A 4NF7A 5E70A 3WQ8A 3WF3A 4J27A 4MAVA 4R5EA 1GOWA 3QHNA 4QLLA 2QF8A 3B9AA 4B15A 2V5CA 1HP5A 1NP0A 1VFOA 1R8LA 1V0LA 1UR0A 1JD7A 3FAXA 3K4AA 5CGMA 4TX6A 3VM7A 2B31A 1VJSA 1DWAM 1LLOA 2WVVA 3VNYA 4HA3A 4GI6A 4CVUA 4UFHA 4D6EA 4DWSA 2YA2A 1Q6CA 4AW7A 3FAWA 4LYPA 1BG4A 3ZMRA 5IDIA 2XHYA 4D1JA 3K8MA 5D9OA 3CZEA 1S46A 5DEZA 3HJEA 1K9DA 1FOBA 3AFBA 2VRJA 2YA0A 4U33A 2WMKA 3QR3A 4OBRA 1GCYA 1E6ZA 1HKJA 2W62A 5BRPA 2X09A 3UETA 4DUWA 4UQ9A 1NOUA 1YHTA 5IXEA 2O92A 3ZOAA 2AOSA 2YBUA 1V0NA 1H09A 1MW1A 1ZBKA 1N82A 4V27A 4E2OA 1XD0A 3D3AA 3M7SA 4UQCA 1OT2A 3GH4A 1GOOA 6CGTA 2VQTA 1UD3A 1V02A 4RE3A 1Y7VA 2PBGA 2BHUA 3BMWA 3RO8A 1H11A 3GXDA 1W3KA 2ZUVA 2YLLA 1FH7A 1TE1A 5CLWA 1A3HA 5A6SA 2PWEA 5JBFA 4BCEA 1PAMA 1VFMA 4JFUA 1FHDA 2RGMA 4QFUA 2IXUA 4ATWA 1JZ3A 3VNZA 3O9NA 4GZIA 4F9DA 3AZRA 3BLPX 4JKMA 2GDVA 5CPTA 5FIPA 1X6LA 3OLIA 1WDPA 2FH6A 1QW8A 2BVDA 2WLZA 5ECUA 2JFEX 1WPCA 3BMVA 3ZT5A 3RPMA 3WDJA 1DHKA 1XCXA 4AWEA 3VX0A 1B3WA 1UR2A 3ZM8A 4CD6A 5D9MA 1LL7A 3ZJKA 4HMCA 4UZUA 1XGZA 3VMOA 2OLHA 5C8BB 4JFWA 1MW3A 1XC6A 4HOWA 2DDXA 2J4GA 2GFTA 1VIWA 3O6AA 1F4AA 3N13A 1WKYA 5D9PA 2VZSA 1VEMA 4PMQA 1R85A 3WNMA 1DWFM 4MDPA 4HMEA 4WSKA 1SYTA 1MWOA 2VCBA 3SCPA 3WD3A 2VJXA 1LL4A 5D9NA 3N1AA 2GJXB 3EYPA 5HPCA 1AMYA 3POHA 4M29A 1NOWA 1VBUA 3ARRA 1P6WA 3VIIA 1UYQA 1J10A 3PTKA 1G01A 2D23A 2BY3A 1QW9A 4JCMA 2J75A 3T2QA 4V28A 5KZ6A 1JAEA 1E56A 1TCMA 2X0YA 3NSMA 3I3EA 3OLDA 3K1DA 3MUAA 4H8VA 2E3ZA 4W8AA 4WF7A 2CXGA 4F79A 2VZOA 5A94A 4DWSC 1E43A 1AVAA 3U5UA 1JD9A 4UFLA 3GTNA 4C7GA 2HVMA 3PTMA 1B0IA 1G0CA 1E5NA 1E6RA 3N18A 1MXDA 4BQ2A 4JKKA 4D71A 2CBJA 2GDUA 3CPUA 2WMIA 2XFFA 2D1ZA 3MMDA 4GO9A 1UH3A 3AIUA 3CH9A 1JZ5A 2TAAA 1GOIA 1J11A 2EBNA 5GQBA 2CIPA 3K8LA 1GORA 5DT5A 3ALFA 2VC9A 4TUFA 1VEOA 2WZHA 1E1EA 5HOSA 3UG5A 3AYRA 3VIJA 3SCSA 1OT1A 4FMVA 1JIBA 3APGA 3NYDA 4J3XA 4Y7EA 4V2XA 4EKJA 4U5IA 3CBWA 5E09A 3T2OA 4W87A 2DQXA 4AZ7A 4PMOA 5HDRA 2EJ1A 4E8DA 1PX3A 4ZE4A 3W82A 3W27A 3W25A 5A6AA 3IJ9A 4PSPA 3WDHA 3WMSA 4X0VA 2E4TA 3AHXA 3SUSA 5LA1A 4HU8A 1CGXA 1Q6FA 4B16A 3GNRA 1E15A 1KQZA 2QHAA 5I77A 2PWHA 4CCDA 1QNRA 1CXLA 4JHOA 2C0HA 4H2CA 4AXNA 3MKKA 1KR1A 1MYRA 3OGSA 5JIPA 2WKGA 1JI2A 3VIHA 2VUYA 5I78A 3ARWA 3NJ3A 1X1NA 1ISVA 1GOMA 2D3NA 2PF0A 4KMQA 2DH2A 4BA0A 3CUFA 4N0RA 4P8XA 1C7TA 3DECA 3HN3A 1QHPA 4JFSA 1OGSA 4M1RA 4GQRA 2BVTA 1HKIA 5I0DA 4W86A 1WDRA 3A4AA 4WKAA 2DIEA 5EFFA 4U2ZA 2BFGA 3II1A 4JAWA 3GH5A 3VGFA 1WZMA 5A6BD 1B30A 3CZLA 2WMJA 3PBGA 2VVNA 5A8QA 4BZYA 4HOZA 3TP4A 1CGTA 1G94A 2VURA 1D2KA 4PUEA 5I23A 1KQYA 2EPKX 3POCA 3BAJA 1PIGA 1R87A 5A6KA 1QNPA 2XUCA 1JDDA 5AC5A 1XH0A 1ZL1A 3F5KA 5M3WA 1QI4A 4W8LA 1JGIA 3AJ7A 3WBEA 1XYZA 1ISWA 2WAGA 4FLSA 1UD5A 4KGLA 3CMJA 2OSYA 1JZ8A 2IXVA 3MUIA 5AC4A 1BGGA 3OZOA 1V6XA 6A3HA 4MB1A 1NOFA 1TUXA 2E8ZA 1CBGA 5CLTA 1RPKA 3FHQA 3FW6A 5JUVA 3VDAA 4PMYA 1M53A 8A3HA 4FLQA 4WKFA 2ZUUA 2ZICA 4EANA 1G9HA 4L4OA 5A8MA 1WAWA 2A3BA 4CN6A 5A2CA 5AYIA 1JZ7A 4M24A 3T0AA 1V3KA 2NW0A 2VCAA 3PZ9A 4JKLA 3WF4A 4J3TA 3G6MA 3THCA 2WCSA 1QNQA 4XUYA 4J3SA 3PHAA 3AYSA 1CPUA 4CD4A 1GOKA 1EOKA 1H0GA 1V3LA 1XD1A 3ARYA 1E70M 4P7RA 1LG1A 4BS0A 4AEFA 2NSXA 2YOCA 2XVPA 4FF5A 4UQDA 4PMUA 6TAAA 2CITA 3SCRA 1GQLA 3CMGA 4TX8A 3SUWA 3T08A 3D5HA 1UKSA 2W63A 4WSJA 3L4YA 1QI3A 4UFKA 3N17A 4RE4A 3WNPA 2VTFA 3OB8A 1MW0A 4M8UA 3PZTA 3AMKA 1CLXA 3M07A 3L4UA 2CHOA 4TVCA 4QCEA 1NARA 1E4MM 4C7FA 1JZ6A 1OGGA 4W89A 4PCTA 3MUY1 4ZEPA 3UESA 3WH5A 1UOKA 2J25A 3MO4A 4GZJA 2O9PA 2ZX8A 3BCFA 1OINA 1EA9C 2Y5EA 3VIKA 1XH1A 3WEMA 1JZ4A 3VGBA 3VUPA 4GINA 1KWGA 1VFFA 3B9DA 1NWRA 1E3ZA 2WZEA 3F5LA 1R7AA 4WKHA 2Y8KA 4M56A 1NWTA 4Z2JA 2VR5A 3WENA 1EDQA 2V38A 1J0ZA 2ZXAA 2YBTA 1RP9A 3ARVA 1PZ3A 3L4VA 3BSHA 1KXVA 4D6GA 4CVWA 3MANA 2FHFA 1NM9A 1KBKA 3EDJA 3AIBA 4A3YA 2JIEA 5D8WA 3A47A 4BQ4A 1VRXA 4ZXOA 4XV0A 3WUBA 1BYCA 1GVIA 3RDKA 2WANA 1TFVA 2Y2WA 2UWFA 3A3HA 1HJSA 4IM4A 2V3DA 4LYRA 3F5JA 1AQ0A 4PCSA 7TAAA 2J8FA 1R7OA 4XX6A 1E72M 3EDEA 3AS3A 1W32A 3VO0A 1KFWA 1E0VA 2E8YA 2WW5A 5M17A 2G3IA 5CPQA 8CGTA 2ZIDA 3RM4A 3CUHA 3ALGA 2J7BA 3VX1A 1JZ2A 2VCCA 4M82A 1HKMA 1JI1A 4NSBA 1BGAA 4LPCA 4ATDA 3GNPA 3VM5A 1V08A 1XYFA 2EO7A 1TMQA 2CYGA 1PZ2A 1M01A 4WJXA 4WLCA 1JG9A 4AZCA 2ZXQA 1E55A 2DGAA 4W84A 4JL1A 1J18A 3ARSA 5LA2A 2VRQA 2ZE0A 1EQCA 1KXQA 4UFJA 3BAXA 1GUVA 4OJYA 1OBAA 3L4TA 3RM9A 4ACYA 5CSUA 1KBBA 1WZLA 2UY2A 5I6SA 3ZJ6A 2VX4A 5A1AA 3KL3A 2BXYA 2WVVB 1J0IA 3K46A 5A3HA 1E1FA 1E6XM 3UR7A 4ATLA 1KB3A 1QPKA 1H3GA 1MFVA 2WHKA 4DWSB 1CYGA 3F4VA 5LA0A 1QHOA 4HPGA 1E9LA 1KGUA 3N12A 2VX5A 3N15A 3WD1A 1Q6GA 2YL8A 5A2BA 2GK1A 4CU7A 4M80A 4IISA 4P7QA 1JDCA 5GNYA 3DHUA 3PZMA 1BTCA 1A47A 1K9TA 1CXFA 2YDSA 4W93A 1E3XA 1HXJA 1DWHM 1UZ4A 1WCGA 2VMFA 1GVYA 5DT7A 3QOMA 4AZBA 4D6DA 3ZSTA 1MQPA 3GBDA 2VVSA 1UR8A 3IJ8A 3AXHA 2YL5A 4PEEA 3ARQA 1BG9A 2J79A 4QLKA 4D6IA 1E40A 2WHJA 4JFVA 4W7WA 3VTRA 4HA4A 4B9ZA 4AD5A 3VIPA 2ZUNA 1DEDA 5BCAA 4M81A 3WSUA 3UERA 5A6JA 2XIBA 2WBKA 3WKZA 5TD4A 1CNVA 2A3CA 4CN4A 3WDIA 2X0HA 2XPKA 5I24A 3GYCA 1IZJA 2OYMA 2XWEA 2D2OA 5A6BA 2CCRA 1VENA 1NH6A 1KGWA 3FNDA 5ABGA 3NIYA 1YQ2A 3ARZA 1W91A 3UG3A 4GI9A 3AIRA 3VIFA 5EMYA 5BRQA 5DO8A 1TZ7A 1LG2A 2FDMA 4EK7A 2FHCA 1E6PA 4MADA 4PUDA 3PZIA 1OIMA 1GZJA 3ARTA 5EBAA 4PMNA 1J9YA 4ZENA 5A69A 1EDTA 1US2A 3WUEA 3G6LA 5ABFB 1CZ1A 1H49A 4RE2A 3MUZ1 2NT0A 1QNSA 3SCQA 2Y4SA 2DT0A 3AS2A 4U2YA 3WL0A 7A3HA 2VR4A 3ZSSA 3ZJ7A 1UR4A 4ACZA 2WMHA 2QMJA 2ZUTA 1GOQA 1HX0A 3WNOA 2A3EA 4TVUA 5HPOA 4W7VA 2CBVA 5A2AA 3ZR5A 1HJUA 1AQHA 1E4NA 1WZKA 4HZ6A 3ZT6A 1B3VA 4JIEA 1ISZA 2WBGA 5DFAA 4BQ3A 1VF8A 1J0JA 5HBFA 3WNLA 2QMKA 2JF7A 2VL4A 4HZ8A 4CN1A 1JXKA 3BGAA 1UR9A 3FN9A 2J7EA 4P7LA 4HZ7A 1UWSA 4L4PA 3WDPP 3NUKA 1XSIA 2YDRA 1UD4A 2BS9A 2Q8XA 1IT0A 4TXEA 2X05A 4DUXA 1PJ9A 1JAKA 2DEPA 3ARXA 4CCEA 1CDGA 3PZUA 4X9YA 3RILA 2Y8VA 4CKQA 2OYLA 2QV4A 2WMIB 3GXFA 4PTXA 1UWRA 4GO8A 2YA1A 1GQIA 4EE9A 1UUQA 3WMCA 3PZVA 1C93A 3BAIA 4YHGA 2PWDA 1GQJA 1W9PA 2J7CA 4MB5A 1GQKA 3WH7A 3JUGA 2XTKA 3LPPA 3N11A 3CIVA 2WYSA 1VJZA 4Z2IA 4UQEA 5CJ5A 3MMUA 2EEXA 1DWJM 3ZR6A 3SCNA 4P8UA 4PTWA 1QHZA 3WUFA 1HF6A 1CGUA 4MNKA 4JFTA 1CTNA 4OIFA 1V3MA 3MV11 2AMGA 1BPLB 1GPFA 2EQDA 4H04A 1UWIA 3J7HA 4J7RA 5I79A 4KRTA 4E4PA 3EDFA 1MFUA 5EFDA 2IUZA 3EBVA 5BXRA 4HP5A 3WD0A 1NWUA 3WF1A 4IPNB 2G41A 1BVNP 1HL8A 1QI5A 1U2YA 1DWIM 3CZJA 1FFQA 2Y24A 3KZSA 5ABHA 2O9TA 1XH2A 5E0CA 4KWUA 2VZTA 2XIIA 3NCOA 3NDYA 3MSGA 3OG2A 3GXIA 1XRVA 5I2UA 1EQPA 2EPLX 3UEQA 5JH8A 3OIHA 1CXHA 1B2YA 1OD0A 3K4DA 2YJQA 5JIWA 1O6IA 2JEQA 1NWSA 4FLOA 1ZB5A 1TR1A 1E5JA 1GJWA 3QGVA 2CETA 2WPGA 2W61A 2JF6A 1CXEA 3QHOA 2CHNA 1X6NA 2W4XA 4D6HA 1HJWA 1UQZA 1E0WA 2FH8A 5A95A 4ML4A 2CESA 4PMVA 4OKDA 1Z32X 1GJUA 3S2CA 3EDKA 2PWFA 3L4WA 1H0IA 2OWWA 2G4FA 3I3BA 3WQ4A 1NP2A 1UKTA 2OYKA 1QNOA 1XHGA 3M6DA 1PX4A 1J01A 1UKQA 3O2LA 1KWKA 2YL9A 4U31A 2BY2A 3WL1A 3W0KA 4CD8A 1UWTA 5BROA 1V3HA 1HVXA 1LF1A 1H5VA 4QAWA 3U7VA 1ITCA 1W3HA 1V0MA 2WMFA 1F4HA 4CUCA 3AS0A 2JEPA 1W9BM 3PZNA 3VPLA 4MDOA 4H8HA 2PI6A 1E71M 5A6LA 2G3JA 3CZKA 2WK2A 4MJ2A 1HJXA 5C70A 3VIMA 3T0BA 4H7VA 1XSJA 2DSZA 3AI0A 1W1YA 5FD0A 4GIAA 4OOUA 5CGTA 4UQBA 4H41A 2EPOA 3BAWA 2PB1A 2WVTA 1KGXA 3VMNA 1BYAA 2HISA 1EGZA 3GM8A 3VVGA 1TVPA 3U7BA 4D72A 2XJ7A 4KH2A 4BF7A 1HNYA 4Q7NA 1FP8A 3OZPA 3DHPA 2XGBA 2WVSA 1HJVA 2J62A 5BXSA 2OSXA 3WQWA 3I3DA 1C7SA 1UG6A 1CGVA 4AEEA 4JL2A 4DM2A 3EMQA 3CUIA 2A3HA 1HKKA 5GNXA 3W53A 3TTSA 3WY1A 3WH8A 2WLYA 1EO7A 1UH4A 1FH8A 3WQ6A 3CHCA 2UY4A 1HVQA 2D0FA 1WNOA 4JZ5A 3AMGA 4P7NA 5C71A 2VT0A 2F8QA 1M04A 4AZHA 4UFIA 3WMBA 3AISA 2QPUA 4U3AA 1W2PA 3AQUA 4QLJA 3UG4A 2WKLA 3AXXA 2JE8A 4BQ5A 4LGXA 5E6ZA 3RCNA 3UCQA 1JNDA 1HT6A 1ZBCA 3NDZA 2VOTA 4S3JA 3W37A 4TTGA 1CGYA 1SMAA 3UR8A 2PC8A 5CSYA 4B3KA 4YHEA 1J0KA 2E0PA 2G3NA 3VD7A 4HOXA 1W1TA 3RM8A 2BXZA 1W9VA 1HJQA 1JF5A 4RL3A 4UOJA 2ZX7A 1MVYA 3IAQA 2J7HA 1CGWA 3IANA 3AHTA 2C8NA 4WK9A 5FL1A 3PTQA 1BYBA 1BFNA 3L2LA 3W26A 3AZSA
chains in the Genus database with same CATH superfamily
3S3GA 2W5FA 4DN1A 4YTRA 1R2TA 4AWSA 2WWDA 2O4MA 1DVJA 3N6QA 4W5UA 1WB0A 1W9XA 4HT3A 5FKYA 2EPNA 3HTWA 3CH0A 4O52A 2EG8A 3VZZA 1DJHA 3QFWA 3B8TA 3WLLA 3ARUA 3M5VA 4O16A 5CZKA 3QSRA 3IJQA 4H9XA 1ZBWA 5KEZA 4OU1A 2MANA 4LAYA 1W5MA 1RPXA 1TWWA 2Z1VA 4XK2A 3QJAA 2JKEA 3AIWA 5IRPA 3EPMA 2DZUA 3BCDA 2HROA 1WOBA 5FEPA 1K77A 3LLDA 2J77A 3P6LA 5E0FA 3V0UA 3GNNA 3F03K 4EWJA 2UY3A 4GCAA 3QV7A 2YL6A 2BOFX 1HXVA 2VGFA 2DSKA 2A0NA 4N2YA 3CO4A 4AZGA 2A3LA 4AZCB 3NL3A 1OSEA 2RJGA 3WNKA 2QCEA 3VDBA 2VI0A 2ZA2A 1K9FA 1BAGA 3CQJA 4DROA 3DC8A 1LT8A 1C3FA 1FWGC 3A6OA 3GPKA 3N9RA 4XB3A 4MNJA 3GU1A 4D8AA 1OK4A 4O12A 3V1PA 3VU2A 2V5JA 2J8GA 3FV9A 3W1UA 5D09A 3UWEA 2WC3A 4GJ1A 2Y63A 1LOSA 2J47A 4MYAA 3HQOA 2DIJA 3WH9A 1JCMP 2BZNA 3WBAA 4Q22A 4INFA 4GBUA 4JTFA 4YYCA 2IKIA 4W9OA 4YVVA 1J4IA 3XIMA 2Y0FA 1V79A 3CPRA 1EJRC 4MLRA 4JTTA 4C02B 3P84A 1GVOA 1PB0A 3CEUA 2HQAA 1XIIA 1C8YA 4I6VA 3HMCA 1FHVA 5CPLA 3U0HA 3NNTA 1FKFA 5HWNA 1H41A 3HGOA 4IWWA 1WDQA 4HHHA 5A8PA 3W83A 3CGTA 1XYBA 4TVDA 4W4QA 3D0CA 4LCQA 4CD7A 1VR6A 1R5YA 3W81A 3LPFA 1A5BA 3WEOA 2VEKA 1R9ZA 5K3VA 2WC4A 3MA8A 2Z0IA 1YBQB 3N14A 1GYLA 1EUNA 3UBPC 4BI6A 3M43A 3VIGA 3ERPA 4C90A 3ABQA 1QASA 6PTDA 4N9BA 1ZP4A 3TR9A 3CUGA 3NGFA 2QLYA 1Q7ZA 2V8ZA 3URBA 3KVJA 3SY8A 1SFSA 3CHFA 5AHIA 4HKPA 3KX6A 1B31A 2DZPA 3QTPA 1JXJA 4E2BA 2ZUSA 5CBJA 3WH6A 1XLJA 4DUVA 3R0DA 1J0YA 4PFHA 4PODA 2ZUWA 1KFLA 4UZSA 4MMWA 4IIEA 2AWGA 1R3RA 3PUEA 1OD8A 1W1PA 3FFSA 4XO7A 4U3CA 3VNMA 3KE0A 1F61A 4PTDA 1L6SA 4ONVA 4JICA 4F0LA 2ACUA 1UR1A 4U5KA 4B5SA 4DF2A 3GFYA 3U4FA 1C8QA 4NZCA 4RCXA 2Y1HA 3MCMA 4PB5A 3DUGA 5D04C 1ZAJA 4ACZB 2ZC8A 2YCEA 3E0VA 1EFZA 4LVDA 1VBRA 3R13A 4Z42C 2CXEA 3RN6A 1UBSA 3T1GA 3PPCA 1YDVA 3R2GA 4AD1A 3GKAA 2VDGA 4DXKA 2HBXA 4PA8A 3WD4A 4XISA 5CKSA 3EA3A 4D6FA 3FEQA 1BWLA 1U30A 3KCLA 5AZ1A 3EPOA 5CH9A 4AYSA 3AXIA 1P6BA 1ESWA 3WQCA 1J4HA 5FACA 4NJHA 3O05A 3WX7A 3M6YA 4DYEA 1XKYA 1K9EA 4E3VA 2AMXA 1VB9A 1I6NA 3CHDA 1RHCA 1L6FA 4DM1A 1OFRA 4CEUC 1XWYA 4JTQA 5CQ1A 2M1IA 3P8IA 4JTAA 3LUOA 2NLIA 4Z0SA 3F7JA 3K30A 5AFDA 2V3FA 1TRDA 3VCRA 3RGCA 4TMCA 3MKCA 4J4OA 1HW6A 2VQUA 2VP8A 1TB3A 5KZEA 1FWEC 4J9JA 5XIAA 2ZKMX 4Z2GA 3MVTA 4QSFA 3ZLHA 1V6YA 3O7UA 3A3WA 1U79A 3C5QA 3VA8A 3A12A 1P0EA 4LS2A 2YFOA 2EXOA 1ROTA 1JCYA 1GHRA 3ITOA 3NQMA 5HWMA 4Z2KA 1G5AA 5ABEA 1WO2A 3TH6A 3WF2A 1EYEA 1I1WA 1B9ZA 5KZMA 1E0TA 1SMDA 1T7LA 5E6YA 4DX3A 3W1RA 3O15A 1V02E 1W3JA 4JPGA 4KKXA 1V3IA 4NX5A 3K8KA 3V7PA 2O7SA 4YS1A 3SI9A 2YDQA 2I14A 3TMLA 2G3FA 3SCWA 3PS7A 4B9YA 4XIMA 4XZWA 3NM1A 3BL3A 4R27A 3VKAA 1KR0A 4IQJA 2W92A 2QJGA 3G1XA 3U48A 2F2DA 4J2MA 5E93A 1OGBA 3HPSA 2ZADA 3BXWA 3AMDA 4PSRA 3T8QA 2F9RA 3C6CA 1FHLA 1Q6DA 4H19A 4R7WA 5JH1A 2WM0A 2M2AA 5MKGB 5D75A 1X7FA 3KCOA 5F4WA 4D6CA 1BD0A 3ORWA 3VYLA 1M65A 1YE6A 4HHMA 1E4LA 4D8LA 4XZNX 4JQAA 2XWDA 1MQRA 1TPDA 3CV1A 4JTJA 5FEXA 1W3LA 3U8GA 2IQ0A 3T8LA 1F8MA 1REQB 2VZUA 4FLRA 4GK8A 2WCGA 2EAWA 4YN5A 2DT1A 3IAPA 4DJDD 4QDMA 2X1RA 1EKOA 1QPFA 3FVDA 2XVNA 1ZU8A 4K1WA 3W07A 1W5NA 2FZNA 3TONA 3F1QA 3W28A 2WWCA 3OOQA 4ZE5A 2WHMA 5FSEC 4YTTA 2DQWA 3BQ5A 1FWAC 4QJ3B 3W85A 2QPSA 3HGSA 4Z08A 3OLGA 4MAZA 5IFTA 2OEJA 1AL8A 3NQDA 3O16A 3C2RA 4FXSA 3REQA 3OVGA 2JKAA 5TAOA 1FQ0A 3VD3A 5DMYA 1CENA 1ZJBA 4XKYB 3TA9A 4LX4A 3WFZA 1F3WA 1QOXA 2OO0A 4NZ1A 1EYMA 3QH2A 9CGTA 2CBIA 2E6AA 3UI5A 1V4YA 1US0A 2D3LA 2ON3A 1OWQA 1GONA 1V3JA 3QBUA 3W2MA 1ZCOA 4S3EA 3SUTA 1W3NA 1EF3A 5BWAA 3GYEA 4FOUA 1N7KA 2ZBTA 3HIJA 3UXDA 1S5TA 1JYNA 3W7EA 2DPEA 2F23A 4B90A 3WQ5A 4REQA 3R8HA 4Y9MA 3LPOA 4TX0A 1LL6A 4TOQA 1IE7C 3UXIA 2NWSA 4F8XA 4TV6A 1XG4A 3IS4A 1SR0A 3RX2A 2DG4A 2E40A 3T4WA 3B0PA 4WR3A 2XISA 4YXGA 1L8PA 2ZRWA 1TCDA 5D02A 1C90A 3SFKA 2JQXA 3GTHA 1V5XA 3AC0A 3W7HA 5AY7A 3WBYA 3DN5A 4JR5A 3WF0A 3TJLA 3G0SA 3A4WA 3RYSA 1O7AA 3GFXA 1T41A 3OGVA 3ISIX 1OABA 4L65A 4K2SA 2Z25A 2E7FA 3TQ0A 3S6TA 3HV9A 5JU6A 2D20A 1H1YA 1US3A 3BG3A 1NTHA 4AIEA 3KCJA 2PP1A 2A3AA 3KBMA 1XLFA 3AO0A 3IIZA 3S1GA 1VPQA 4IJRA 1UA3A 3WN6A 2PTZA 1KFKA 1TA3B 3UXLA 3KEHA 1RSCA 3KFTA 3K5XA 1HN1A 4NF7A 4AVNA 3LM3A 4R88A 2KE0A 4J27A 3E74A 2ZRXA 4MAVA 4IFKB 1DL3A 1KLYA 2WO5A 1NP0A 1GOXA 1XRTA 4O1EA 1Q4WA 4HNNA 1R8LA 2X7VA 4FF7A 1UR0A 1JD7A 4QNWA 3VM7A 4FXRA 3WK0A 3PY2A 3ABZA 4AXKA 8XIAA 1LLOA 2WVVA 3ABXA 4CVUA 4Q7BA 3BLDA 4UFHA 4DYKA 1DQWA 1Q6CA 4Q4QA 5HMFA 2V2HA 1SGJA 4O15A 4MKVA 4WCJA 4DRIA 2PRMA 3QR0A 4AIBA 5IDIA 2Y78A 4MZ8A 3GO2A 1S46A 4Q32A 1K9DA 2XIMA 3AFBA 4S2CA 4OBRA 4Q4PA 3TA6A 5BRPA 4ZO9A 4HCLA 4K38A 4LBUA 4DUWA 3G1SA 1NOUA 3CWNA 5IXEA 1Q6OA 4NNCA 3WK2A 5DY2A 2PSNA 1PCWA 1H09A 2DZAA 1ZBKA 2BGNE 2HPIA 4A3UA 4E2OA 3MVIA 1GOOA 1UD3A 3AALA 1V02A 2NLYA 4RE3A 1W56A 3DFNA 1BF6A 1NU5A 2FPYA 1GG1A 2ZUVA 2I1OA 2EPHA 1QRQA 3GX9A 3QSTA 1OQFA 3KAGA 3MI2A 5I3IA 4QJ4B 4UC5A 5A6SA 3WZ0E 4C6LA 2YPIA 2J9ZA 1PHQA 3H21A 2IXUA 2V9DA 4FX7A 5KITA 1W5QA 4F9DA 3AZRA 5D32A 3VKCA 3EWYA 3HQPA 5XIMA 1ZLPA 1X6LA 2BVDA 4FIQA 1R3QA 3R8GA 4EACA 3R0UA 1JPKA 4FA3A 2OGYA 4MUPA 4O0ZA 4IFOA 4JX6A 3NEVA 3RPMA 3WDJA 5AECA 1KKOA 4PZVA 4JD4A 4N9EA 1E9IA 4PCFA 4LVGA 1J2WA 5C9ZA 1GVFA 4H83A 3RPDA 5LXXA 3ATYA 1MW3A 3EWWA 1KW1A 3DESA 4HOWA 3NVTA 4QS5A 3TWBA 1HTIA 2DDXA 2J4GA 2GFTA 1TX0A 1XIEA 2CW6A 1IXQA 2OQLA 5D9PA 4ZSTA 3GR8A 2FZBA 3E0IA 5PTDA 2C15A 3SCPA 2NQHA 4G2PA 2RKXA 3ITXA 2I7GA 4JTSA 1W8SA 2YDAA 4C6DA 3N1AA 3NO3A 2GJXB 2I57A 1AMYA 1XFCA 3Q45A 3WLHA 1NOWA 4HVXA 2X0SA 1F07A 1P6WA 3RX4A 3VIIA 4DB7A 1G01A 5ENLA 4LF2A 2BGQA 2BY3A 3LCFA 3TN5A 3NQCA 2J75A 4JIQA 4JTHA 4O53A 2X16A 3DFHA 3L0KA 5KZ6A 1E56A 1TCMA 2C79A 2X0YA 3OLDA 2MUCA 1TJ0A 3K1DA 4HNOA 3G1YA 4DO7A 5C9UA 4W8AA 2VZOA 3U5UA 2DIKA 1DJXA 2HVMA 1TTJA 1G0CA 1E5NA 3N18A 4AWUA 4BQ2A 4ZQMA 4ZFCA 2CBJA 2G5WA 2QCNA 2WMIA 4DIAA 4WY0A 2D1ZA 1F40A 2ADAA 3FA3A 4XKMA 1KBJA 4A6GA 3GU0A 1GOIA 4ZO7A 2K8IA 4YTQA 1WV2A 3FYOA 4K6AA 3GB6A 1Q13A 1VFHA 2WZHA 1W17A 1EJWC 1E1EA 4LU0A 4AHPA 3IRSA 1LCOA 2PD5A 3APGA 3FJLA 3NYDA 3IIVA 3GW0A 5AB3A 4CQCA 2KI3A 3S2JA 2DQXA 4AZ7A 3W82A 1RAKA 5DRCA 1EF2A 4MFEA 2PCQA 1S38A 3GNRA 2PWHA 4CCDA 2GGEA 4JHOA 2V5LA 2B7QA 1QZ2A 1KR1A 1OF6A 3OGSA 2WKGA 2YFNA 1XW8A 3FA5A 3NJ3A 5HNUA 1EXBA 1X1NA 1GOMA 2DZTA 4Y9AA 3PUDA 4N6FA 5KZDA 1FBAA 4JFSA 4XZMX 3PTDA 1HKIA 5I0DA 1WDRA 4GHRA 4LBRA 3QFEA 4KWSA 1W37A 5J8LA 3N3MA 3VGFA 3E49A 3GSMA 4WDXA 3PBGA 5A8QA 1C9DA 4BZYA 5AC8A 3TP4A 3W1LA 1G94A 1D2KA 4PUEA 5I23A 1VRDA 2L2SA 4HPXA 5CSRA 1O5QA 4LEQA 3WFAA 3LU2A 3VABA 3DI1A 1M5YA 2Y6ZA 4OHQA 5A6KA 1YW1A 2OR2A 3BZGA 2VELA 1ZL1A 3ITTA 3F5KA 4EAYA 3QZEA 3KOXA 1QI4A 1BTMA 1JGIA 4E38A 1XYZA 4HARA 3CMJA 3N2CA 3C61A 1BGGA 1QW7A 1TUXA 3M1ZA 5FF3A 4JDBA 1HKWA 2FPVA 1SZFA 3IWPA 4K7VA 3O06A 8A3HA 3L0GA 4WKFA 3FJ6A 3QW3A 4B2DA 4NT0A 3AWOA 1Y65A 3CTLA 2PV3A 5DLCA 2A3BA 2HNHA 1LDCA 5A2CA 1JZ7A 1KNWA 3EXRA 4M24A 4O1AA 3ZR4A 1M3UA 1A0EA 1V3KA 3FSTA 4I7UA 2NW0A 1YMYA 3WF4A 4DJFA 1V6TA 2E68A 1UWAA 1OJXA 3A23A 2XZ9A 3PWIA 4NNAA 2J88A 1BSLA 4LT9A 2NXGA 2QDDA 1CPUA 4CD4A 4ZQRA 4E5TA 1V3LA 1XD1A 3ARYA 1DQUA 3P2VA 2VGBA 2XN2A 2NSXA 4EVZA 1CB7B 4UQDA 2RUSA 4MSPA 3F4WA 4TX8A 2VFHA 4WDUA 3XINA 2PV2A 2Q02A 3THQA 4NQ1A 3QPZA 4RE4A 3WNPA 5C55A 4MG4A 5EBUA 3OB8A 3B0VC 4RXGA 2V5KA 2X7WA 3GUWA 1T40A 3PZTA 5L9FA 2P53A 3SSZA 3AMKA 3L4UA 2PDXA 3SQSA 4JN8A 3R79A 4HN4A 4QQUA 4O8RA 1SO3A 4ZR8A 5FI8A 2J27A 2M08A 4C5YA 4C7FA 3ITYA 4LV9A 1ZNNA 2Z27A 3RG6A 1OGGA 4W89A 3MUY1 3FA4A 1EA9C 3S9YA 4YU1A 3M47A 1JZ4A 3VUPA 2EKCA 3W7QA 2CZDA 1NFGA 3AYVA 3S6OA 1FKWA 3OQ8A 3UXKA 1G4EA 2VM8A 1NWRA 1E3ZA 2WZEA 1GKRA 4WKHA 3FS2A 3H26A 2VR5A 4JQ3A 3M44A 1Z8AA 2Y7EA 2F21A 2V38A 2A85A 2ZXAA 4QM1A 4ZMGA 8XIMA 1FWWA 3L4VA 3RR4A 2FHFA 1T8XA 1WXYA 1K3UA 4N9CA 1TPC1 1KKRA 2JIEA 1P0BA 3EEZA 3IIXA 1EQ3A 3TW6A 3WUBA 1BYCA 4NNRA 2YXOA 4I90A 1TFVA 5M2FX 2Y2WA 2UWFA 2FTPA 3L9CA 4J2PA 5EKYA 3F5JA 3TYDA 2J9YA 2X1TA 2ETNA 3EDEA 3AS3A 2QV5A 5CGQA 3FYYA 2Y85A 4ODKA 5CPQA 3QGAC 1K8YA 8CGTA 3EPNA 2J7BA 2PLKA 1JZ2A 1IWPA 2I5GA 1HKMA 1LRNA 1VKFA 4PUKA 1M41A 4DJFC 4LPCA 5IM51 4GH3A 3VM5A 4GACA 1XYFA 1PZ2A 4ZOBA 1JG9A 3ID7A 3KS6A 2PC4A 1OF8A 4DYJA 1EQCA 5G1MA 3PRDA 3KUMA 1Q85A 9XIAA 1WZLA 5A1AA 1F6KA 2BXYA 1OFPA 4MOZA 1E1FA 1E6XM 4ATLA 5H1WA 1VFTA 1H3GA 1AH0A 4FR1A 1QHOA 1KGUA 3N12A 3MMTA 2NUWA 5LZLA 2B0MA 3BPWA 3WD1A 2BBFA 2YL8A 4PUMA 4K36A 3U2CA 2GK1A 1BKFA 4L6HA 1X7IA 1R3SA 5GNYA 3ZXWA 1TWSA 3EWZA 4FI4A 1M1BA 3GWQA 1NJJA 3PZMA 5C7VA 1B57A 2PLCA 1E3XA 3STEA 2HTMA 2VMFA 4PL1A 3QOMA 2W6RA 3RFWA 4D6DA 2GZXA 1MQPA 3AXHA 2GL5A 4GJJA 4MWAB 5JMUA 4PEEA 1U5HA 4HBOA 2NQ9A 1BG9A 2KZHA 3COTA 3H2NA 2Z7KA 3VTRA 3HOJA 2H8ZA 2J8TA 3TYCA 4AD5A 4JQ1A 4E6MA 2DZSA 3HZ3A 2QJHA 4DRMA 4L4LA 1EC8A 1KT0A 2QCGA 2P0IA 1CNVA 2DUXA 2A3CA 4CQDA 1A5CA 1FWIC 1ZGDA 2V69A 3PPFA 3QQWA 4PUNA 2D2OA 1OFEA 1ZQ5A 1SJAA 4GWEA 5A6BA 4IMGA 3HG2A 3GVVA 4KEMA 2GDQA 1ECQA 2C16A 3UG3A 4ZCWA 1RZMA 3AIRA 4TQTA 1EPXA 2WQDA 2NV9A 1E6PA 3GVGA 2VC7A 4ODPA 4IQCA 1OIMA 3LGDA 1EDTA 3G6LA 5ABFB 1PL9A 1H49A 4EPEC 3MUZ1 3FJ4A 1I60A 1I0BA 2Y4SA 2J24A 5MHBA 2FLIA 4NZ3A 1UR4A 2WMHA 2AQWA 4KCWA 5LHEA 4F0SA 2C19A 2A3EA 1PKYA 1J5TA 3L0NA 1E51A 4GFIA 4YTUA 2GQAA 3NGJA 3S46A 1R30A 1HJUA 3MY9A 4RJEA 1GK8A 1B3VA 4JIEA 1ISZA 3YPIA 4DBEA 2WBGA 5DFAA 1VF8A 2UV8G 4L56A 4G56A 3W1XA 1R9HA 4XAPA 1FKGA 2JF7A 4IP7A 4BI7A 3MHUA 1Q8AA 4S39A 2BX7A 1KRBC 3RUBL 1JXKA 1KRCC 3BGAA 1UR9A 4P7LA 2PLMA 2ABAA 4HCDA 4L4PA 3UT0A 1XSIA 1UD4A 5EA9A 2IQDA 1IT0A 3JYMA 2Y61A 4ERGA 3OP2A 1CDGA 3PZUA 1SZEA 1XG3A 2PODA 3BZJA 3GXFA 4PTXA 3STGA 3FKKA 3WMCA 4UTKA 1C93A 3WLOA 1MNZA 4Y2WA 4GKTA 1N8FA 1GQJA 2GJNA 4YWSA 3O5EA 3MYPA 2IPJA 3C2VA 1EP2A 4MB5A 4FB7A 1XR2A 3JUGA 2Z7GA 3N11A 3P81A 2R14A 2WYSA 1S2CA 1VJZA 1CT5A 4C6FA 2DVXA 4A05A 1Z48A 3MMUA 3PSVA 4ADSA 4P8UA 2TSYA 4PTWA 5HAOA 2PRLA 3PRBA 4MNKA 4HMNA 1YKWA 1V3MA 3MV11 3CNYA 1BPLB 1PZ1A 2EQDA 3PJXA 3CQ0A 1X1ZA 2PTDA 3J7HA 5I79A 4KRTA 1EZWA 2G37A 1MFUA 5BXRA 2IUZA 3EBVA 5DCEA 4HP5A 3TU9A 3WD0A 2R6OA 3CAKA 3OHIA 2V81A 1SPQA 1AH3A 1P7TB 1DWIM 1FFQA 3VNJA 3ZS4A 1LT7A 5E0CA 5BOOA 3O5JA 5CAHA 3NDYA 4US5A 3MSGA 3PUGA 2GJLA 2HMCA 5JH8A 1I2OA 5TF0A 2CLFA 5CZTA 2ZQUA 4O11A 4LFYA 3M0KA 3P5YA 1LQAA 4JTGA 3W75A 5E9XA 2PTWA 4MWAE 1GJWA 1FCQA 3KBNA 2JF6A 1CXEA 4DLMA 5T91A 2CHNA 3HM7A 1GVSA 4IJCA 1PTDA 1QXLA 4Y8FA 4C1NA 1HJWA 1UQZA 1A50A 3H7VA 3WBWA 1LUCB 3TAKA 3O1NA 2VGGA 3G2GA 2VC5A 4OKDA 3QY8A 4YMZA 1XS2A 4JTRA 1H7PA 4G2DA 3S2CA 4GXWA 3L4WA 2ATMA 1NP2A 5EMJA 2RUQA 4XSLA 1QNOA 1J01A 2GQ3A 3QPEA 4MJZA 4O54A 2P10A 2BY2A 3WL1A 3CWOX 3CASA 4NJGA 1IZCA 4HZMA 1V3HA 1HVXA 2YW3A 4U10A 4CUCA 4E4FA 1RV8A 1W9BM 1F3TA 4MDOA 2PI6A 1E71M 2IW0A 4XD5A 1YW5A 1Z7AA 4EOUA 3CGNA 2HZGA 1WXJA 5C70A 3VIMA 5FD0A 1JPDX 5TIMA 1I2QA 3IIPA 3VMNA 3EWBX 1DJIA 5D30A 1UW9A 1TVPA 1DJNA 3GQYA 4PB3A 4O1FA 4PL2A 4F2TA 2XGBA 3O6DA 3TCZA 3W84A 3BW2A 3I3DA 1NAL1 3M64A 4AEEA 1J4EA 3EMQA 3CUIA 2A3HA 4G6CA 5GNXA 3LX9A 3V1HA 2HK0A 3F4NA 3WY1A 1IIGA 1EO7A 1UPPA 4ZS6A 4N6EA 2YYTA 1EX5A 4KFPA 3PPGA 2RQSA 1FWNA 3P67A 5K9DA 1SUXA 3LTPA 4NYUA 3IJDA 4UFIA 1TV2A 4U3AA 2QPUA 4UNKA 4G7EB 1E9ZB 3E02A 2NV1A 3HGRA 4XD3A 3P80A 2CLEA 4BQ5A 1DXIA 2QVHA 2QCDA 3QMTA 3T55A 1CCWB 1ZBCA 1FY6A 4S3JA 1Z44A 1SMAA 3UR8A 4L1XA 4YHEA 4FAMA 4MKNA 1VFLA 3MTWA 4HOXA 1HJQA 4RL3A 2ZX7A 4LVAA 2G97A 2OJPA 3Q4DA 4PUWA 3AHTA 4WK9A 2OT0A 3PTQA 3L2LA 3W26A 3AZSA 2GQ9A 4DRQA 4MGGA 1D7KA 4F9JA 3W01A 3HV8A 4FNSA 3FXGA 4OVXA 4E8CA 2DG9A 2WQPA 1JPHA 3KRUA 1QBBA 3FY1A 3DYMA 4LUYA 5AHNA 3EY6A 1LP6A 1TRIA 2A21A 4LRSA 1S39A 3LDVA 3IV8A 2OKTA 3G0UA 5D2TA 1JVNA 3JZEA 3MZNA 1I1XA 4UTFA 1MNSA 4R3UA 3E6EA 1ITQA 2OWCA 1EJUC 2NX9A 2DU2A 3CEPA 1E6QM 4QITA 4D1IA 3EMZA 3SW6A 3FDGA 2EPMX 1JVWA 4A22A 1A5UA 1IIHA 3I10A 3NQVA 1FCVA 1T8QA 1LLZA 1OCNA 3KLLA 5FOOA 3WJXA 4B2DD 3CTTA 2YXGA 3KOYA 5A6MA 4AD4A 1E44A 1CIUA 5BOFA 1XKJA 4HNVA 2X2YA 1Y0EA 4K8HA 2DSVA 1JJKA 3W6YA 3E5PA 1PIFA 4O0KA 1UD2A 2V5DA 2GUBA 1ZPTA 3BO9A 2ZA1A 2AAAA 2GVLA 4PBEA 3WDQA 3IJ7A 1M5WA 3WDRA 4EF8A 3PJTA 5E0KA 3UWUA 3MWAA 2OXNA 1V03A 4Q4RA 1Q6UA 4PMXA 4WZHA 3VKKA 3MSDA 2BY1A 3PZGA 4UQAA 2H8XA 1UIOA 1M03A 4ZA0A 1H2JA 4M6QA 4AY1A 1Q5MA 1XPGA 4BFAA 4Q8QA 4JIIX 3OPSA 1R9YA 4QX4A 2E28A 2G8ZA 5F2IA 2FFCA 3QY7A 4X0NA 1TPH1 1UD6A 1DP0A 3CU2A 3FCPA 1VPXA 3WFLA 5BOEA 2AGTA 2HS6A 5AYXA 3G0XA 1NIUA 2VX7A 1OEPA 3E3HA 1K03A 3MP5A 1S5NA 4IPPA 3UPMA 4AUBA 2WSPA 5JBEA 4GISA 5HW7A 4S2BA 4C6PA 1C92A 1KBIA 2YLAA 2EKGA 1G4TA 1V6UA 4N4QA 3EDDA 1F6PA 1WQ5A 2DUAA 2PDLA 1P6CA 5AYZA 1EP1A 2RDTA 4DXXA 4DRJA 1WE5A 4HD5A 1RP8A 2XP8A 3E2RA 1BSIA 5FJJA 2RHGA 1PSCA 4F2BA 2Z28A 2XFYA 2E6FA 5LIWX 4UTWA 2FGLA 1B90A 1V6WA 1R86A 2RGLA 3I7SA 2PEVA 3INPA 4FSAA 4HIBA 7REQB 2HV5A 2B7NA 4WRHA 2OWXA 1V93A 4O10A 4NRSA 2V3EA 2Y70A 2HE8A 1VHNA 3S8HA 2WJEA 5A8GA 3PBUA 4LVFA 1FFRA 3CLWA 4OV9A 2OZ8A 1UC5A 3SUUA 3MPGA 3MV01 3TJIA 1C91A 3CJPA 3VD9A 3VD4A 1YDNA 4KRZA 3C4UA 3TR2A 4B4HA 1RUSA 1RXOB 4O1CA 5D8ZA 2VFFA 3GZAA 4CLMA 3ZIZA 3W3OA 1FKLA 3T81A 3FXYA 1F3EA 3VGHA 4CCCA 3CK5A 7CGTA 1JPIA 1RVGA 4F48A 2YGYA 3NVDA 1TJ1A 5ABFA 3WUGA 1XQLA 3MS8A 3TIMA 3OG3A 3A5VA 3OLEA 3PPHA 5GPRA 1ONWA 4H7ZA 2ZQVA 4F0HA 1TVNA 3OBAA 4BR1A 1W1ZA 1WDSA 2WZIA 5G4EA 3B9EA 4M7SA 4XVEA 5D2VA 3AU2A 4OUEA 3SCTA 3BAYA 3AUOA 5AC7A 3CLMA 4HCHA 1ZP3A 3MI6A 6ENLA 2P8BA 4ODLA 4MTVA 4NIRA 5I3GA 4HPHA 4KETA 3TYBA 3OBEA 3E2QA 3G3MA 1ONEA 2G3MA 3GDKA 4F40A 1L2QA 3LLXA 4Z0JA 4HNUA 1MEIA 2OGJA 1SZNA 3QQ1A 2CZEA 4HGXA 4DWSD 4KWVA 4NY2A 2ISVA 3AHZA 3STPA 2IKJA 1PIIA 1MDLA 1SJDA 1FKJA 3UR2A 1IEVA 3G24A 3V0SA 3EMCA 4RDWA 4PTVA 3ME3A 1H7NA 1U1JA 2X42A 1EWEA 3MWCA 1EZ2A 5HR6A 3VOJA 5EB8A 3FLUA 4LYQA 5J5DA 3W7IA 1BRLB 4UDMA 3N04A 5XINA 2ZRZA 3SCOA 5AN7A 3HPZA 3W6LA 3QY6A 2FVLA 2B81A 2PDYA 4MGVA 1EO5A 1YNYA 1HO4A 3DC0A 4MUZA 2Z2AA 4WX2A 4GKLA 1OC7A 4KIEA 3T42A 5DXXA 2C14A 6REQB 1FWHC 4KCTA 4IUGA 2NUYA 2XFRA 4GGQA 4UTWC 2XVKA 2ZZ7A 4UOZA 1W1VA 3NYZA 4N02A 4HYVA 3KCEA 2WNQA 5FF4A 1V6VA 4RX0A 1KD0A 3LA4A 2ESCA 1UUMA 3B0UX 4L1WA 4IPLA 1J2BA 4LB4A 2O0TA 3GRIA 4IXXA 3JZUA 1LTDA 2XDFA 3CZ8A 4IICA 3CMFA 3AHVA 3BLKA 3L65A 3PULA 1RJQA 2ZWYA 4D8ZA 2Z00A 3LTYA 2GJRA 2ZDRA 3DYPA 4FK9A 3BW4A 1ODZA 4HB7A 2AQOA 2ALDA 5DO2A 4K8GA 3O5MA 1LUCA 2TMDA 3M4HA 1HQTA 3TFCA 2WXDM 1EJ7L 3MKVA 3GH7A 4RV3A 2XM1A 1L8NA 3CYVA 2E5DA 4JTLA 3A5FA 3LXBA 4GC3A 4HTYA 4LNYA 2YW4A 3DDMA 3UW6A 4PYSA 5FL0A 1PPIA 1VAHA 3EOOA 2ZX6A 3SFWA 1DIKA 2ZXDA 4CNUA 4ZGYA 1FXQA 1UCWA 3WJWA 3O5DA 1EIBA 2OZ0A 4MVAA 4LTSA 4NAFB 1NQ6A 1FDZA 3UGVA 2WOQA 3VOGA 2G4JA 2WKJA 4IQEA 3UQBA 5HXMA 3OZYA 1FA2A 3LMZA 1HL9A 2D0GA 2ZXBA 3RMEA 4ODOA 1C8VA 4L61A 5HWJA 3S1UA 3MU7A 2ZWZA 2Z1WA 4HNTA 3A4JA 1HGWA 1M6JA 1D7HA 3MSYA 2FTYA 1JRCA 1D3CA 4DBUA 3PFRA 3GTFA 4PGLA 1BKSA 2QCHA 5AYBA 4ZFMA 3VDCA 3AS1A 4Z2LA 2QULA 1VBHA 1CXKA 1IX5A 5EYWA 2CZ5A 3BC9A 4ML9A 4U84A 1FWRA 4HK7A 3H22A 3NTPA 1TTIA 2VFIA 3NR0A 1TV7A 3EWXA 4PN2A 1OC6A 2ONEA 2VD9A 1IEXA 1XIGA 1ZALA 1U5JA 2GWGA 1JPMA 4AZ5A 1OIFA 3T05A 3LB0A 3AXKA 2NX3A 4BJHA 3OOBA 4XZBA 1EC9A 4G1KA 2GVGA 1ZZMA 4TIMA 3E0LA 3PAOA 3OGRA 4HMDA 1PX8A 1EOMA 4XBJA 3OEXA 3OZMA 4RW3A 4C7DA 4G7FA 4JXCA 1EPVA 3UG8A 5C7HA 1WKDA 3C0SA 1OX5A 6XIAA 1CEOA 1LORA 1V0KA 3SCUA 5B7ZA 1C8XA 1RA5A 3A64A 2AL1A 2LGOA 1VZWA 4QE5A 2A7RA 1B4EA 1O5KA 1R3TA 2Q3RA 1GW1A 1PE1A 4FEZA 4XVDA 3AHYA 3ZVHB 4BWLA 5KINA 3W7NA 1JL8A 4CU6A 4GGBA 3WLTA 2CEQA 1D7FA 1TYGA 5AKQA 4US5D 1KLZA 4RNIA 2JIWA 5CAKA 3PZQA 3BH4A 1UKPA 1Y8BA 2CPUA 4C6EA 1IT8A 1TQJA 1TE6A 4BI5A 1H7WA 1IV8A 3NQ2A 2PBOA 1RCQA 3EKZA 4QAIA 4AZIA 4LC6A 2V5BA 3ABOA 3TDBA 3CGMA 3GLCA 3LYEA 3NQFA 1KO0A 4MHBA 4H7CA 3W70A 1VCVA 2PWGA 3P0WA 5I3DA 1PEZA 3CO8A 2C71A 2PPNA 2BP1A 4HQVA 2PZ0A 2WHLA 4YJ5A 1IEWA 3R1ZA 1AG1O 2CKSA 3AIVA 3AICA 1KFBA 2XSBA 1OCJA 3B40A 2TYSA 2BY0A 3T09A 3UI4A 1UC4A 4H1ZA 3QTGA 3DBNA 4DO4A 1PCKA 2C7FA 4QZVB 3WQ8A 3UWZA 3AWNA 4R5EA 3QHNA 2FJUB 3B9AA 3OYZA 2PAJA 2V5CA 3AUJA 2PGFA 3DGRA 3LRKA 4IQ2A 4CCZA 3CQKA 3ELFA 4QJ5B 5KETA 3N25A 3STFA 3B0XA 2E5BA 4OECA 4LYPA 2FPTA 5DMNA 2CHRA 2ICSA 3O5RA 3ZMRA 1GTHA 1JCHB 3UYIA 3MI3A 4I5UA 3GC2A 3UZZA 2XHYA 3MDYB 4D1JA 3K8MA 2RDUA 5D9OA 1DXFA 2VRJA 2YA0A 4U33A 3S5SA 3QR3A 3LUTA 1E6ZA 2W62A 3I7RA 3GIPA 5H2ZA 4UXDA 4AX6A 2Z26A 2AOSA 1V0NA 2VOMA 4LEFA 1N82A 3NRKA 4V27A 4TW8A 4FN2A 4MYXA 3HFYA 4M0XA 4QSHA 2VQTA 5DIVA 4S3CA 4BEQA 1X97A 4IX0A 1PTGA 2BHUA 4LUTA 3RO8A 3HQ1A 1H11A 3GXDA 2NQLA 1EUAA 5I00A 1FH7A 5CLWA 4L9ZA 3TE9A 1DIEA 3BV7A 1X1OA 1PAMA 2CU0A 4JFUA 3VC6A 4E2DA 3UP8A 3WBXA 2ZTJA 4ATWA 1JZ3A 3L12A 4AF0A 1XDJA 5K4XA 1V7AA 3W1NA 2WLZA 4HYWA 4JY8A 4RZBA 1B3WA 1UR2A 3CPGA 1U1UA 4CD6A 2X30A 3UWQA 3F2BA 5D9MA 2A7NA 1LL7A 3LN3A 3URNA 4PUUA 4QG6A 1UPMB 4UZUA 3C52A 1XGZA 5KTLA 3B9OA 5C8BB 3OJGA 1OX4A 2FMNA 1DQXA 4Q8TA 3C8FA 3O6AA 1F4AA 2ZZ4A 2QQ6A 2RURA 1C9HA 4PMQA 2GSEA 5LIUX 2VFDA 4HMEA 3SGZA 1EJTC 4X2PA 1DIDA 3LNMA 3UWVA 3LHTA 5D9NA 3EYPA 5HW8A 4DNMA 3POHA 3U2ZA 1J5SA 1ML1A 2NVAA 1D7IA 4MF4A 4ZQNA 3B7XA 3O5KA 1FCBA 2D23A 3S9IA 1EGVA 4QIBA 1GYMA 2QUVA 5BRBA 3R4IA 1YTDA 3UWWA 1UP0A 1GG0A 3S5ZA 4IG2B 3PVFA 1HG3A 3S42A 4DJDA 3E5BA 3CWHA 1NFPA 4EXQA 4WF7A 4L80A 4F79A 1JD9A 2OEMA 3GTNA 3N29A 4AQLA 5FJOA 2MNRA 3PTMA 4US6A 1E6RA 3EGJA 4JKKA 4N4PA 4D71A 4AHOA 1LQ2A 3CPUA 3MMDA 3MB9A 1UH3A 2TODA 4W9TA 4DIPA 4GVFA 1JZ5A 1QPRA 2EBNA 5GQBA 3EB4A 3T9PA 3V4BA 5DT5A 2AKZA 4O17A 2VC9A 2ZR5A 3IVSA 5HOSA 1SU5A 2IMRA 3GC4A 5AYYA 3IIOA 1JIBA 3UVAA 4J3XA 3I4KA 1N8IA 3CBWA 2ZR6A 1ZENA 5HANA 7TIMA 4GD0A 1PX3A 3W25A 4PSPA 3U3HA 1ADSA 3RAOA 1BXNA 1Z6KA 3AHXA 3RITA 3SUSA 3CV6A 2PU1A 4UMCA 1E15A 1KQZA 3I68A 3NOEA 1QNRA 3BOFA 4AXNA 3MKKA 5FF7A 3A3XA 3JXVA 1JI2A 2VUYA 5I78A 3WLRA 3FK4A 2PUZA 4BA0A 5I07A 3BLLA 1QHPA 3E2SA 2I9UA 3RHGA 2KFWA 3BSMA 3JYJA 5EFFA 5T26A 4U2ZA 1LZOA 2BFGA 1TV4A 3II1A 2NQ5A 2O56A 4RW5A 4FX6M 3CZLA 2QAPA 3WK1A 4GLEA 1BXBA 2WMJA 2RSEA 2G95A 2B7OA 4HOZA 4Q8UA 1CGTA 5CC5A 1IGSA 2HWGA 2EPKX 3POCA 5IBXA 2IS7A 2JGQA 1AUSL 1JDDA 5AC5A 2HS8A 2WAGA 1ISWA 1UD5A 2IPGA 3WLSA 2OSYA 1OVDA 1H50A 3IGXA 1NOFA 2OOFA 2E8ZA 2W3ZA 5CLTA 1RPKA 3FHQA 2VENA 3UQIA 2V30A 5JUVA 1TZZA 3UJSA 3B0YA 4MKSA 2R82A 4QBXA 4DJDC 4EANA 1O60A 1G9HA 5A8MA 5IDZA 4CN6A 1TUFA 9RUBA 1BEUA 4JKLA 1G6CA 4B4FA 2PDBA 3THCA 1K6WA 3C3UA 1Q6IA 1VIZA 4J3SA 4HSHA 3PHAA 3AYSA 3W1TA 4DPQA 3EA1A 4P7RA 1XISA 1E1CB 2G96A 4DY1A 4AEFA 2YOCA 2XVPA 3UYCA 4ASTA 5J5RA 1JQVA 5EMMA 5CPOA 2VEFA 3NURA 2CZVA 3SCRA 3CMGA 1XL9A 2PDUA 2XN0A 1D7JA 2W63A 4DI8A 4FIRA 1S5WA 1TMHA 4UFKA 1GT8A 1O94A 2QGHA 2OQHA 1VLWA 1FWTA 3RFAA 4LUJA 4PH6A 2Y7GA 3M07A 2CHOA 5DELA 4BKNA 1Z42A 3TQKA 3F4CA 4JYDA 4TVCA 2J6XA 1IEIA 3H7RA 2QCMA 3LRLA 4A8LA 1UJQA 3REQB 3M5ZA 1E4MM 3LHZA 1DJGA 5I06A 3UVIA 3UESA 3WH5A 1UOKA 3URAA 2P0OA 2O9PA 4GXMA 2V2CA 1KM2A 2ZX8A 3BCFA 4XZHA 1OINA 2Y5EA 1W0MA 3WEMA 1SSGA 3VGBA 3IPWA 3WQPA 2KX9A 4FPSA 1K7EA 3DBPA 2IKHA 3Q58A 4OQVA 3L5MA 3TYUA 1FCUA 3DKJA 3B9DA 5EY5A 1R7AA 4M5PA 2Y8KA 4M56A 4Z2JA 3W71A 1BVWA 4UR8A 4QEEA 1A53A 4R7JA 2OFJA 4BK9A 5DRIA 1EJXC 3DG3A 3B8VA 5LHFA 4IMFA 2I9EA 1PZ3A 5IBXC 3BSHA 1KXVA 1OY0A 4R9OA 4D6GA 4CVWA 1NM9A 3G18A 5HUPA 2PV1A 3SN1A 3O8AA 4BQ4A 3I6EA 4DZHA 4ZXOA 3SRFA 2VYOA 1KM4A 1ALDA 1GVIA 2WANA 3L66A 4IM4A 4JTCA 1XUZA 1K4GA 1EJSC 3H9RB 2J8FA 1R7OA 3VO0A 1KFWA 2E8YA 1J93A 3B03A 2HPMA 5A6TC 1XIMA 3O5OA 4ORIA 2ZIDA 3RM4A 3VX1A 3ITLA 3CT7A 4C6NA 1E9YB 4IMCA 3PC0A 3LM7A 2EO7A 4J40A 3LG3A 3RU6A 5HJYA 1P1XA 3LZ5A 4GIYA 4WJXA 1OFBA 4WLCA 1FDJA 4S3AA 3TSDA 2VXNA 3LCLA 3O5FA 2PURA 2DGAA 4W84A 4JL1A 4JTIA 3CC1A 5I3FA 4B5UA 3BLFA 1S1PA 1VS1A 4ZPTR 2ZRYA 3PG8A 4OBTA 2FTWA 3C8NA 3LEPA 1HL2A 1OBAA 5CSUA 5D33A 3O5QA 1I2NA 1KBBA 2HCVA 1QR7A 3BJFA 2VX4A 2WVVB 2QIIA 4Q4KA 2VX5A 2FVMA 2PDKA 4RR4A 3VZYA 1KFJA 4MFDA 1F74A 1Q6GA 1GEQA 1PDYA 4V33A 4CU7A 4NVTA 2C0AA 4O57A 3RF9A 3BK0A 3BDKA 1N2VA 1BTCA 4W93A 4I9MA 3UWYA 2P8CA 1A5AA 1UZ4A 1WCGA 1W8GA 5DT7A 1EL3A 3AU6A 4Q7IA 1XLAA 2VVSA 3DG6A 4C6CA 4JNZA 2BSLA 3ARQA 1TQXA 2J79A 4QLKA 4D6IA 2DV0A 1E40A 3WK3A 4W7WA 2ZCGA 3TLLA 2E5CA 3B9NA 1ZSXA 4CNTA 4M81A 5BCAA 3QZ6A 5LNVA 4AC7C 4CQBA 4O4WA 1UZHA 1XIHA 3WKZA 3D46A 4XD4A 3UR5A 5TD4A 5ECVA 3SM0A 5C9WA 4ZPWR 4LYKA 2X0HA 2XPKA 3BGGA 4LF1A 3B8DA 1QTWA 2EG7A 2CLMA 2XWEA 3LCGA 1OFAA 1KBLA 3MC5A 2C13A 5TNVA 1X6UA 5CC3A 1WUFA 3VDGA 3LI0A 2PDPA 5EMYA 5BRQA 1TZ7A 3T40A 3HURA 3NPVA 2FHCA 4HPNA 4PUDA 3O5PA 5EBAA 2XIJA 1J9YA 1JCJA 5A69A 3HB9A 2P4VA 1B6CA 3FSUA 1CZ1A 3T6CA 1W3IA 1UUOA 2Q71A 1PINA 1RALA 2FZDA 5CZ0A 1RLDA 3WL0A 7A3HA 2VR4A 3ZJ7A 5U7SA 5U4NA 2QMJA 2ZUTA 1GOQA 1HX0A 4DF0A 3WNOA 2CBVA 3QYSA 5A2AA 3N19B 4E3TA 4I9JA 2DZWA 4LH8A 2PMQA 4IG2A 4XO6A 4PTNA 1KT1A 2HXUA 1X8CA 3N2BA 4QJ1A 4ODNA 2FFIA 3FYPA 3WNLA 4CNPA 4C6QA 4HZ8A 4GIRA 2PZNA 5HK4A 5CCZA 4AVOA 1ZJIA 2AL2A 3KBSA 4HZ7A 3RXZA 3SJNA 1UWSA 4KS0A 3NUKA 2YDRA 4L7ZA 4DUXA 2X05A 2OCZA 4CCEA 2VKZG 2AKMA 2OYLA 2QV4A 1S5MA 2WMIB 4WY0B 1UWRA 3IUIA 4GO8A 2YA1A 2E77A 2J6VA 3PB2A 3PZVA 2PWDA 1AJZA 1W9PA 4IXHA 1GQKA 3WH7A 3EOLA 1PWLA 2XTKA 3LPPA 4GE8A 4HBKA 1H5YA 5CJ5A 4ECLA 2BMBA 3HBLA 4UR7A 1I9CB 3WUFA 3PWGA 4OIFA 4C6KA 2OMAA 1GPFA 2XH2A 4J7RA 3DIPA 5EFDA 3N2TA 3MT1A 8TIMA 5D2YA 4IPNB 4RZ6A 5C9XA 1U2YA 1Q6RA 3S5YA 1T0OA 2Y24A 5ABHA 3NOYA 2ZFAA 4ZB2A 3NCOA 3OG2A 3FJNA 1XRVA 4PBFA 2MLXA 3BUVA 3UEQA 2NXHA 3TC3A 1JNTA 4RDVA 2H3BA 4HNLA 4L9XA 3W02A 1D3GA 1FHUA 1MXSA 2JEQA 1ZB5A 3TXZA 4R0XA 2ASHA 5HJLA 3QGVA 3MW7A 1J4RA 3P74A 3T0TA 3EB3A 4GNVA 3R12A 1FKDA 1J6YA 2FH8A 1XI3A 4MPQA 4XG1A 3DHFA 1S2UA 3BJSA 1UP2A 1F76A 5F1VA 3EDKA 2OU4A 3E12A 2PWFA 4ITZA 3EAUA 1DBTA 2OWWA 2G4FA 5JH2A 1CI1A 1IXNA 3RMJA 4QIUA 2TPSA 5G2HA 2PDJA 2Z24A 2FB3A 3VI2A 4NAEA 1UKQA 3O2LA 3NXFA 2JK2A 1NF7A 4AH7A 4ALDA 5B7YA 3B4YA 3W0KA 3MSRA 5FJIA 3T0CA 2Q6ZA 3GHUA 1H5VA 3M9YA 1ICSA 4ICCX 3W72A 3U7VA 4TW6A 1MEWA 1ITCA 1W3HA 3EZ4A 3PNUA 4HK6A 3M0YA 4J3ZA 2W9MA 2JEPA 3PZNA 1XYAA 3VPLA 3WH0A 4H8HA 1C9WA 1DYSA 4MJ2A 2WK2A 1W54A 2WNZA 2DSZA 3BOXA 3S83A 3UF9A 5CC7A 4OOUA 3L2IA 4H41A 3R0KA 4XBSA 5LXEA 1EGZA 1E1CA 3GM8A 4IIHA 4PB4A 4KH2A 3DXIA 2IF4A 1B3OA 4HU4A 1WDWA 3OZPA 3DHPA 5BXSA 4AVFA 3BG9A 4LS0A 1UG6A 2RDWA 4JL2A 3W53A 4PR4A 4Q4OA 3WH8A 1R2RA 4KBXA 3FGCA 2OOGA 3GHRA 1YXYA 1X8FA 1FH8A 4F4RA 3CHCA 4DO5A 5G5IA 4DZ3A 5HR7A 2XH0A 1WXZA 1WNOA 4P7NA 1Q2SA 3NZGA 4Q8VA 2GVEA 1TVLA 1UMLA 4EIVA 4QLJA 1FTXA 1Q6HA 3VAWA 4UIOA 2WKLA 3AXXA 2HRWA 4A2RA 3RLHA 3CQHA 2PDMA 3CL6A 4KCVA 3RCNA 4IMEA 3P93A 2VOTA 4TTGA 1J0KA 4N9DA 3SBFA 3R10A 2PDIA 2PDGA 1YEYA 3VD7A 3APYA 1KFCA 4MZ1A 3DFSA 2BXZA 1W9VA 2YBVA 3RNDA 3KRBA 4UOJA 1H61A 1MVYA 3IAQA 5FAJA 3IANA 4V1YA 2MLZA 1JULA 1D8WA 3BMBA 2QDGA 3IGHX 3OO2A 1TMLA 2I5IA 1FAPA 1QBAA 1G67A 4QEHA 2VX6A 1PBGA 4QCFA 3SZ8A 4HA1A 2CLLA 2GGGA 1YPIA 3DFOA 4R7OA 2LKNA 2GVYA 3WQVA 1FP9A 3T2PA 4AD0A 4IFRA 2GQ8A 3K1GA 3RJXA 2OODA 3W24A 4DRHA 5H6HA 3KACA 2GVJA 2HJPA 1KCKA 1Q2RA 4CGTA 2XINA 3TXVA 3VOCA 2Z2UA 1GGOA 2G50A 1RD6A 3KHDA 3ZLGA 1JCLA 3QZAA 3IHZA 1IHIA 5FEWA 1JYXA 1HO1A 3VOIA 1VJIA 3BLOA 1LBLA 4JDYA 3UQAA 4MB3A 1J12A 5GPGA 3NQAA 3BLIA 1H4PA 2UY5A 4WDWA 4PMRA 2ZX9A 2HVOA 5CG0A 3RCYA 3RIKA 1FKHA 5LNRA 4HJFA 3LRMA 5FA5A 4ZQOA 4DELA 3AMLA 1WAUA 1F5ZA 5E9AA 1OFDA 4JTKA 1JF6A 3URQA 1XLLA 3W2LA 3L5LA 2IPFA 2FQIA 4MNLA 1ZAIA 4NNBA 1DXEA 2GGHA 4O14A 3GR4A 1RBLA 4AB4A 3AMCA 4OGZA 2EG6A 1O95A 4M6VA 1H51A 1YNPA 2XVLA 3W6MA 4P8WA 1GRJA 4E8GA 2W67A 1A5LC 4RV8A 5FCZA 2FAPA 3LPGA 4ZB0A 4KCUA 1K8XA 3WMLA 3GAKA 4W88A 3O6YX 4ADUA 2GK1B 1XBXA 1A5NC 3FAPA 1EBGA 4W7UA 1E4IA 4J28A 3OHMB 2ODOA 4FO4A 3NG3A 3PJWA 2FJKA 3IKGA 1JFXA 2YZ5A 2GGIA 1MSSA 1QFEA 4QDPA 2C1GA 3GNOA 3VIOA 3KL5A 3GIYA 4GY0A 3EX1A 1EHAA 1P0DA 1W2VA 3V75A 1ITXA 5DY3A 5CBBA 2E67A 1ZJAA 3LQLA 3WQGA 2W91A 3OW1A 1XLHA 3H2OA 3CIWA 4YIWA 4I3GA 4GVIA 3NAVA 2E9MA 4ZQPA 1VFUA 1PXGA 1EH9A 1AQMA 1XCWA 1FKXA 3THUA 2Z1KA 2UBPC 3AJXA 3AXMA 2XP4A 1MW2A 4NZ4A 4NRRA 5G1TA 4AYGA 3KW3A 3C3NA 4I7VA 4LAXA 1OYAA 4B5TA 3NL2A 1M68A 5C6MA 4AIOA 3WCZA 1DE6A 3KAHA 4ES4A 1QT1A 5JVLA 2A6LA 4GA8A 4LAWA 3P60A 3ECQA 4H3DA 4J3UA 2DSWA 3TCSA 4S3DA 1IZKA 3AROA 4RXFA 1QO5A 1XDMA 1T99A 1A5SA 1LQ0A 3M0JA 3GTYX 1K8CA 4JYSA 1K6AA 2R91A 3GXMA 3PK7A 2PTXA 4W85A 3N9KA 2PDQA 2VFEA 4KERA 4A4AA 2OLSA 1NQKA 1KXHA 3SQLA 3G5EA 1NDWA 2PDHA 2YIHA 1R2SA 3MP4A 3PANA 4N7QA 1AZ1A 3HFTA 1ONXA 1VP5A 2GUYA 4JEJA 3G1VA 1CLVA 4UNIA 1S3HA 3GDBA 1T96A 3VAVA 1RH9A 1PUDA 2DP3A 4MY8A 4X2RA 5LIKX 3NPXA 3W7OA 3W1AA 3SEPA 3FHAA 3W7CA 3T0DA 4HN8A 3W74A 3PBMA 5D4YA 2X2GA 5B8IC 1KTCA 1ZCCA 1GNXA 4K37A 4Z2HA 4GQQA 4PMZA 3A4XA 4GYPA 2AQVA 5BXPA 4MB4A 3LY0A 2ZOXA 3KL0A 2PU0A 2CLPA 4AD2A 2WSYA 1R9XA 4UCGA 2FYMA 3VD5A 2IPWA 4RZ5A 4S3KA 2OG9A 4H8UA 3O0KA 3MO7A 4RKAA 2F38A 5C2GA 2ZTKA 3G3DA 3LK6A 4ODRA 1AJ0A 5BMWA 2VNCA 3HF3A 3KBWA 4OV4A 3LD5A 5LYRA 1IGWA 2Z4GA 2XYLA 3KHJA 3KXQA 3QC3A 3W1QA 2PGEA 4P61A 2ISDA 3KM8A 3IJLA 3L4XA 4JIPA 2REQA 2POTA 2VC6A 2PTYA 5T9CE 3ATZA 3DYOA 1OFOA 3NEHA 2H9AA 3RRXA 1Q8JA 4LAZA 3I6CA 1Z89A 3HQNA 4L9YA 1U22A 4GNKB 3CHVA 2NT1A 2Q8LA 1B3ZA 1CECA 2ZYFA 4LB3A 3VCCA 1UA7A 3L2MA 5HWBA 2X1SA 3DGBA 4JY9A 2DT3A 4GVGA 3TQVA 4GCXA 3PP7A 4XZ9A 3U57A 2H6RA 4UR9A 1J6PA 1VD6A 2QR6A 1QNVA 4GI8A 4EWND 4K8EA 3UNTA 4IL2A 1LLWA 1QI0A 3RGTA 1JDAA 3W7DA 2E6DA 3G1FA 4LY8A 1LJYA 5G2WA 4J3WA 1X38A 4K39A 4KRUA 4QE4A 4ZSUA 1W31A 2ZUMA 2JALA 2R1KA 5M5DA 3W4RA 3B97A 4C1NB 5CPNA 1EDGA 2EULA 4WOZA 4KGJA 3QVQA 4TTUA 3R94A 1DTUA 1JUKA 2QUMA 2C1HA 4Z1CA 1F3XA 4KQNA 3JW7A 3B8SA 3GDRA 3U5YA 2R1NA 1IT7A 2DH3A 4UTUA 5C0QA 2YCLA 3SCVA 3HU7A 4WGHA 1UWUA 3TMQA 3VCNA 1I75A 1JFHA 1DKWA 2ZC1A 3RPTA 3LNPA 1FWCC 3GDLA 3QMSA 2HNEA 3OU8A 1PYFA 1UKOA 4GIEA 1JYVA 2QUTA 1ZRQA 1RJPA 2BHZA 1FVPA 3QRHA 4F0KA 4LQ1A 5CJMA 4B5VA 2WC7A 1XSKA 1SJBA 4GYJA 1W1A1 5CJNA 3N9SA 4GYPC 4HTBA 2DVUA 2CERA 1CWYA 3M0VA 4MJMA 2XGIA 4X61A 1FUYA 3AZTA 1W1B1 1C29A 4HU0A 2Q09A 3BV4A 2ISFA 2X1IA 5K4ZA 1BYDA 4LUSA 2RUCA 3QV6A 3C0QA 3Q67A 4QROA 3SECA 3ANUA 3I6RA 4E4UA 5BYWA 3W7RA 1AW1A 1OM0A 2E9LA 2J7FA 4C91A 3IGSA 3N2OA 4AFYA 4U85A 4AY7A 3AIQA 5T8GA 2WJZA 3ANYA 2QUNA 4GY7A 2R1PA 3QOKA 3BICA 4NI8A 4POCA 4Q6XA 1OHLA 3R89A 3VKDA 4IMDA 1TPWA 1TV5A 3SSJA 3W2JA 4JCLA 4JIRA 3CUJA 1BQCA 5G1YA 1BWVA 2QCCA 1XLEA 2HBVA 5K7JA 3ARPA 1GZ1A 4WJ8A 4GVHA 2BXVA 1JCTA 4N19A 2QCDB 3NSXA 4GUJA 2NVDA 3W87A 3IK2A 4O13A 4DZIA 5EL1A 4RNFA 4G9PA 4W8BA 1HIZA 4GBDA 2WCAA 4A3HA 4N42A 4DZAA 4OE7A 3VGEA 2D0HA 4A35A 4LXFA 3QHMA 4MNMA 4I5XA 3QLLA 5F7UA 3HJZA 1S2AA 1W9DM 2ZRUA 2J7GA 4LCSA 5H8UA 4IQLA 3DG7A 3UCDA 5RUBA 5LIYX 2BTMA 1S2WA 5D38A 2LJ4A 1JYWA 4G5DA 1Z9AA 3ZO9A 1BLIA 1ODUA 3TJXA 4D9PA 2WSKA 1XBZA 3GTXA 3CV2A 4AIUA 1PO9A 4JHZA 1Q6EA 3ES8A 5A8NA 4Q4SA 4PRRA 1EXPA 3E1F1 3UXAA 4KQZA 2VRKA 1UHVA 5BXTA 3PBVA 1KCLA 1W9UA 1ZBVA 1IXOA 5E70A 3WF3A 1GOWA 1U5VA 4LAKA 4LWWA 2VUNA 3LHWA 4TYOA 1HP5A 4I6KA 4JIHA 1FWBC 1VFOA 2DORA 2PWUA 2Y7DA 1V0LA 3L67A 3AAMA 2B31A 1JRBA 1VJSA 3WLPA 1DWAM 2DW6A 3NQGA 4O28A 2I17A 4HA3A 1KCZA 3ES7A 2C1IA 3W7MA 4DWSA 1ZUAX 2YA2A 4DHGA 1BG4A 3B04A 2KR7A 3NXLA 3DAQA 1XLKA 5HULA 3TLQA 1OYCA 1TJPA 4NG3A 5DEZA 3HJEA 3PF3A 1A80A 4QT2A 2FMOA 1EEPA 1OK6A 4LW7A 4PE8A 1HKJA 2X09A 2DJXA 5GJPA 3UETA 1YHTA 2QGYA 4IX2A 4L1GA 2YBUA 2P76A 1MW1A 3D3AA 5TBOA 4UQCA 1OT2A 3GH4A 3PAJA 3SIZA 1AD1A 2OPJA 1GVEA 1TJRA 3NQBA 1Y7VA 1TPB1 1YTEA 3L7RA 1W3KA 4JFKA 3FOKA 1TE1A 1F9CA 2CZFA 3LGGA 3PR2A 1A3HA 3NI6A 3NO1A 2FZMA 4RPQA 1T5AA 1VFMA 1F2JA 5CEWA 1FHDA 5AHMA 4QFUA 2Y5SA 1OCBA 1D3HA 3UFYA 2V6AA 1XUUA 3VOFA 4I7WA 3GNXA 3H4XA 1BQGA 3BLPX 1UBPC 2V0TA 3RLUA 1FX6A 4TNSA 2PF8A 1IF2A 5G4HC 2FH6A 1QPQA 4FNQA 1JNSA 4UTTA 4RZ4A 3O5GA 4H2HA 1WPCA 3BMVA 4JFLA 5C5YA 1A5KC 5REQA 3ZYZA 1XCXA 4AWEA 1WBHA 3BG5A 3ZM8A 5DMLA 3TUUA 4PCPA 3ZJKA 2WSQA 3NDOA 4MZYA 2Y7FA 4B5WA 1XC6A 1U83A 1VCGA 3OTRA 2KO7A 1VIWA 3DERA 1NMVA 3R25A 2ATSA 4DF1A 1WKYA 2PGRA 1KM6A 5AC6A 4ZBCA 1R85A