4WKAA

Crystal structure of human chitotriosidase-1 catalytic domain at 0.95 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
369
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitotriosidase-1
publication title New insights into the enzymatic mechanism of human chitotriosidase (CHIT1) catalytic domain by atomic resolution X-ray diffraction and hybrid QM/MM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 132
structure length 369
sequence length 369
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4wkaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wkaA01
1G5AA 3AXHA 1DWJM 2J79A 4MNLA 5E6ZA 1E4IA 3MUIA 1R7AA 1HP4A 4MADA 1EXPA 2XVNA 4W5UA 1RP8A 2J7FA 2VR5A 1W9BM 2G3IA 5DF0A 4W8LA 1WDSA 4QP0A 4AZBA 3TTQA 3AS0A 3O6AA 4PMXA 2XGBA 3VIHA 2EPNA 4XV0A 1FFRA 4P8WA 2BFGA 5ABHA 2WB5A 1VF8A 4E2OA 1E0XA 3CPUA 4QDMA 5A2BA 2NT0A 1V02A 5EB8A 1C93A 1U2YA 1MQRA 4FLSA 5DO8A 5HNNA 2VVSA 4PYSA 4LXFA 1JAEA 5I78A 1JZ4A 3L4XA 1UH2A 1W1YA 1CENA 2YL5A 4RL3A 3SIMA 1H0IA 1G9HA 1QI3A 4W89A 1XH0A 1GNXA 4GIAA 2WC7A 5E0CA 1E55A 3AHTA 4ZE5A 2XM1A 1OD0A 3NDYA 4D71A 3VPLA 4CD5A 2CKSA 4JFWA 4JCLA 3MANA 4HTYA 1EHNA 4U2YA 3QGVA 1BHGA 3WSUA 1V3LA 3MV11 4W84A 4L4OA 2NSXA 2WHMA 2HISA 3ARXA 3B9EA 4ATWA 3S6TA 2PWFA 1R8LA 2FHCA 4AD4A 1U30A 4DUVA 2WHJA 3ZJ6A 2AOSA 2FHBA 3ZOAA 1DWGM 1UQZA 5E9AA 5AYBA 5JBFA 1V0KA 3NJ3A 4LYRA 3BSGA 4A3YA 1B90A 3WMSA 5D9NA 4WLCA 5CPSA 5ECUA 1HXJA 5FL1A 1B31A 4PMVA 5ABEA 4ZEPA 2WCSA 4Q22A 1H5VA 1C8YA 1JF5A 1KGUA 3ZIZA 1CWYA 1ISZA 3WD2A 1WZKA 2Y5EA 2ZE0A 4XZWA 4FLRA 1XSIA 1Q6DA 3AMCA 2J7BA 2OSWA 2FHFA 2VMFA 4ATDA 3TTSA 1R86A 4AZ7A 1OINA 3VKKA 1TA3A 2VRQA 2QPUA 1WAWA 1GQLA 4CD4A 2DH3A 5D9OA 3SUTA 3RIKA 3ARQA 1E73M 4MJ2A 2BXZA 2WAGA 2DQXA 3MSGA 2GDVA 1HJSA 1RD6A 1H4PA 1QI5A 1WB0A 4J7RA 4BA0A 1JFXA 1VBUA 4Z2LA 1X6LA 4UFKA 1KFWA 1KXTA 4KMQA 4UFHA 1TE1A 2Y4SA 3B9DA 1FOBA 3W38A 3ZSSA 5I79A 2ESCA 2O9RA 4XZBA 2DSKA 1F4HA 1QW9A 4CD8A 3G6LA 4OJYA 3UEQA 1GQKA 5FD0A 4F79A 1CXKA 3OLGA 3SEPA 4WJXA 4MNKA 1MW3A 2VZUA 4WSKA 1JYWA 1BYBA 4JHZA 1ZU8A 3EDFA 4GQRA 1JYNA 4D6EA 1EO5A 3QR3A 2DSVA 1BQCA 3KZSA 4Y7EA 4CCEA 3AS1A 5E70A 2PWDA 4WKAA 1ZJBA 1B3ZA 3WQ8A 3UG3A 1CPUA 3HN3A 1VEPA 3IAQA 1JZ5A 2J7EA 5ABFA 1QBBA 4HMCA 3SCVA 4RE3A 2XYLA 1VBRA 1E1EA 1GCYA 3SUVA 3ARZA 4IISA 3W29A 2FH6A 1FP9A 2XPKA 3RILA 5C70A 1JIBA 5AC4A 2WVTA 3U5UA 5FOOA 3RDKA 1LG2A 2WMIA 2J4GA 3W28A 2ZXBA 3F5KA 1V3IA 3MUZ1 4HZ8A 3OGSA 1HJQA 2A3AA 1V0LA 1FHDA 3NIYA 3AHVA 2VQTA 1BG9A 3NSXA 4M8UA 1XSJA 2XVGA 4TTUA 1DHKA 2AAAA 4PUDA 5JBDA 2VZVA 3VGEA 4WK9A 1IZJA 5JIWA 1MYRA 5I6SA 4UR9A 2DH2A 1GOOA 2XIBA 2VZTA 2DEPA 1CECA 1BVNP 2YBTA 3MSDA 1W1VA 3MMWA 3LPOA 3BAJA 1CGVA 1MVYA 3EMCA 3AHZA 1G1YA 2VJXA 5LA0A 3B9AA 1VB9A 4AEEA 4HOXA 1XHGA 3WFZA 2ZX9A 1FH8A 1JDCA 2XFRA 3CUHA 3BAXA 1O6IA 4NI3A 2X0YA 4Z2JA 3K8LA 5A6BD 2ZUVA 3A4AA 3AQUA 4WIWA 1C3FA 3AOFA 1B3VA 3W0KA 1OM0A 3GNOA 2XVLA 1QHOA 3F5LA 1NOUA 3L4VA 2JIEA 5JUVA 1BLIA 4NRRA 1CGWA 2D23A 3ZJ7A 3OLIA 3II1A 1KXVA 5AYIA 1PAMA 3UG5A 4TVDA 3VDHA 3BXWA 2CHNA 1Q6GA 7A3HA 1UD6A 1J12A 1EA9C 8CGTA 3K8KA 5GNYA 5M17A 3VUPA 2TAAA 1WKYA 2WWDA 1R87A 2VOTA 3OGRA 4F66A 3L4WA 4XB3A 3WY1A 3ZR6A 3PN8A 1UWTA 1J0YA 4V27A 1JD7A 5KEZA 4EKJA 4MAVA 2WVUA 2F8QA 3RM9A 3VO0A 1V08A 2W63A 1G01A 3PZNA 1VFUA 2D0GA 2GJXA 1FH7A 3I3DA 4AIEA 1H41A 1OWQA 2WHKA 4FLOA 4FMVA 3WNPA 3CUFA 1KWKA 1TFVA 3AMLA 1FP8A 3NDZA 1JZ7A 2V38A 1BYCA 4KWUA 2BHUA 1J9YA 3AIVA 4V28A 3VGBA 1GONA 2EPLX 4P7LA 1TA3B 3RJXA 3CTTA 1US3A 2OSXA 7CGTA 3A3HA 3SCWA 3MV01 4M56A 4EE9A 1DWAM 3NSNA 4PSRA 3WN6A 4CVUA 1KGWA 2CCRA 3RM8A 1CNVA 5JH8A 2XWEA 2ZUWA 4BZYA 2J7GA 3W27A 3ARWA 1E6NA 2E3ZA 2BY0A 4W93A 2E8YA 1DTUA 4OBSA 4R5EA 4A3HA 5CPQA 2VZSA 5TD4A 2W62A 2JF6A 5I0DA 1NP0A 1QNSA 5CPTA 4PMRA 3ARYA 4OOZA 1IV8A 4EAMA 2YKKA 2O92A 2O9OA 4JFTA 5IXEA 1VJZA 1ODUA 2ZX8A 3ZSTA 3CUGA 1G94A 2YA2A 5EBAA 1W2PA 3TTOA 1EDTA 3ZJKA 3MMDA 4UFJA 3POHA 1BSIA 3EDEA 1B1YA 4AWEA 4DM1A 3UR7A 4AIOA 4H41A 3ARRA 3W81A 5ABFB 1PIFA 2XSBA 3T08A 3AYRA 1J0JA 3ZM8A 2WMHA 2XG9A 1C7TA 3SCNA 3CH9A 3AHXA 2G41A 3VX1A 4E4PA 2WXDM 2VCAA 1CTNA 3KL3A 1XYZA 4D6DA 4D1IA 4P7RA 1FH9A 4Z2GA 3IANA 1I1XA 4MB3A 3K1DA 5HOSA 2EBNA 2EQDA 2JFEX 1OIMA 4AW7A 3WQ6A 3UR8A 3BAWA 3CUIA 3WF4A 1CLXA 4KGLA 4AIUA 3J7HA 3RJYA 4LQ1A 4D6JA 2UY2A 1CDGA 3GH4A 1HL8A 5I23A 2YDSA 4UFLA 1WCGA 1XCWA 3GM8A 3RMEA 1CBGA 1C7SA 2CITA 3ARSA 3VILA 3VIMA 4N42A 2DPEA 3PZQA 3K46A 4DM2A 1W3LA 1G0CA 1E6PA 2PC8A 3WNOA 3VGDA 5LA1A 3AIBA 8A3HA 3O2LA 1UWIA 2OSYA 2BHYA 1C91A 1E15A 3LMYA 4UFMA 3GYCA 1PJ9A 3VM5A 4ATLA 1JYVA 2Y8KA 2GK1A 3CZLA 1Q4NX 2J25A 3CGTA 1AQ0A 5FCZA 3L4YA 3HMCA 3AMKA 2ZX7A 3VIIA 2WPGA 4ACZA 2RGMA 3VINA 1M7XA 5ABGA 3NUKA 5GNZA 3WF1A 5HDRA 1V02E 2ZUTA 1K9EA 2C7FA 2CEQA 3WDIA 3TA9A 1PZ3A 5C71A 4GI9A 4CN6A 2YA1A 1JYXA 2UY3A 3CLWA 5A6KA 1JNDA 1BVZA 1BYAA 1W3KA 3QHNA 1HKKA 2W67A 3VNYA 3VD3A 3GXFA 1KBBA 1UD2A 4JZ5A 5A8MA 4K68A 2VVNA 1NOFA 4Z2KA 3VDBA 3ZQ9A 2VURA 4GO9A 1UQYA 2J78A 2CBVA 4URIA 1J10A 3SURA 4B3KA 1MW2A 3AMDA 1LWHA 2GJXB 2WMKA 4PTXA 1KWGA 1XH1A 4UFIA 4CUCA 1FFQA 4XX6A 4P8VA 3WD1A 1GOKA 2DSUA 3UG4A 1CXEA 1V03A 1H1NA 1WZMA 4WKFA 4MJ4A 4W8BA 2WANA 3DYMA 3NCOA 5CXPA 3E1F1 2OYKA 1EHAA 4W88A 2GDUA 2C0HA 4UQBA 1GORA 1GHSA 1XV8A 4CVWA 5IHRA 1CGTA 1JXKA 4U3CA 5BROA 2NW0A 4U2ZA 1SMAA 1GUVA 1EO7A 3WMCA 1ISWA 4JKKA 1YQ2A 1V0NA 1MQPA 2VX6A 2ZOXA 1HIZA 2XIIA 3AZTA 4J27A 3W25A 2EPMX 3UESA 1V6WA 4IPNB 3WUFA 1NM9A 2ZX5A 2QMJA 3WL0A 3B8SA 1A3HA 3OIHA 1EIBA 4TVUA 1E56A 5CQ1A 3EMQA 1PX3A 1W9PA 2WZEA 3VMNA 4GXPA 3BAIA 3LPPA 4UTFA 3KL5A 3L4ZA 3ZT7A 3NYDA 3BAYA 2QV4A 3KE0A 4AD2A 4JIEA 4CKQA 1ZL1A 4AZHA 3RO8A 2GJPA 2FGZA 4M24A 4GZEA 1E70M 1OT1A 1ISVA 2G3NA 2D2OA 5IFPA 2J8FA 1DP0A 1KR1A 2E9LA 3CHDA 5I2UA 4B9YA 2W61A 3BCDA 4J3UA 3WD4A 1E6SM 4FLQA 5A6LA 1UWUA 1XC6A 5JIPA 1NWRA 2JIWA 3VIPA 4AY1A 3KEHA 1I75A 4UNIA 1J0ZA 3PZVA 1UR9A 1W91A 1D2KA 2ZXDA 1ZJAA 2VX4A 4DWSD 1LL4A 1HJVA 1HF6A 3GNPA 3VMOA 3WL1A 1LF1A 2J47A 4MNMA 1UUQA 1V6UA 2D3LA 4PMQA 3W37A 2YL8A 3IAPA 3WIJA 4QLJA 5BXSA 4UCFA 3OZPA 5A6JA 3A47A 5GQBA 4FF5A 1ITCA 1CXHA 3IK2A 4PMDA 3AYSA 4ML4A 2XM2A 4UOQA 1PEZA 5E0FA 3THCA 3PTQA 3OGVA 2E9BA 3S2CA 3WFLA 1OSEA 1UWQA 2UY4A 3SUSA 4AZIA 2PWHA 5I77A 1NP2A 2XVPA 5EFFA 2WC3A 3AFBA 5A8QA 4RE4A 1KCLA 1VEMA 1H3GA 4P8XA 3K4DA 1JGIA 4KGJA 5I3DA 1NWSA 1TMQA 4LPCA 2YJQA 1HT6A 2Y24A 1V3KA 3T0DA 3GXIA 3BCFA 2QLYA 3AS3A 5D9MA 2OWWA 4CU8A 4ACYA 1V3JA 3EBVA 2JF7A 2E8ZA 2DIJA 1C90A 2BNJA 1XD1A 4KH2A 4WKHA 1UH3A 4TOQA 1NWUA 1VIWA 1QVBA 2D0HA 5CLWA 4U33A 3F4VA 4NF7A 5HPCA 4ACZB 5CJ5A 1QNOA 4F9JA 3GBDA 1JDDA 3KL0A 2VC9A 4MAZA 2QMKA 1JL8A 3OA5A 3U57A 4EK7A 3WQ5A 1BGGA 5CZKA 4JHOA 4AD1A 2OYLA 1TUXA 4ZXOA 2BS9A 4WF7A 2J62A 1VENA 1HJXA 3WQWA 1I1WA 2Z1KA 5IHSA 3GH7A 3N18A 5A6BA 3PZOA 1KQZA 3OG2A 2OWXA 4PCTA 4E8CA 3CHEA 3M7SA 5CGMA 3N17A 4AC1X 4GI6A 4JL2A 3AIWA 2WHLA 4KRUA 3VIFA 1JAKA 3FW6A 2WMJA 4CCDA 1MWOA 3WDQA 4HOWA 4MTVA 3TTYA 1W32A 1M04A 1HKMA 4HA1A 1E4NA 4AD3A 1F4AA 2CBIA 2WLZA 1KCKA 1XRVA 1N82A 1D7FA 1UD3A 3EYPA 4B16A 1MQQA 1US2A 3CHFA 4MB4A 5E6YA 4H8VA 1UZ1A 2GVYA 5KZ6A 3DECA 4OUEA 1TVNA 1HVXA 4OIFA 4JAWA 2OLHA 1C8XA 4LYPA 1W9DM 4MB5A 1E3ZA 4H7VA 3L4TA 1YHTA 1KXHA 2QPSA 4GQQA 2J7DA 2IXVA 1FA2A 3T2PA 1W9XA 4LYQA 4UQCA 4C7GA 1X1NA 3QOMA 3EMZA 2ZX6A 1CZ1A 1B2YA 2EXOA 1GOMA 2C8NA 1ECEA 1DEDA 1B30A 2CPUA 4J3SA 1EDGA 1CGUA 1EDQA 2BY1A 3GBEA 2ZUUA 2PWGA 3ZJ8A 4JFSA 2J8GA 2ZWZA 1MXDA 1QI0A 3WEOA 1VFOA 4D1JA 3CZKA 5BWFA 2X8RA 4TTGA 1CGYA 2X1IA 2XWDA 4MDPA 1DWIM 2ZUSA 3A4XA 1R85A 1E40A 2X2YA 5I5RA 3WMBA 2WCAA 2GUYA 1J01A 4DUWA 1NOWA 2XSAA 2E0PA 4TX6A 4J3TA 2QF8A 1BGAA 3DYOA 3WBAA 2J7CA 4U5KA 1E6ZA 1WZLA 2YL6A 2A3EA 3AISA 2CXGA 3WNLA 1BAGA 2DT1A 3O9NA 1W1PA 4AZGA 4Z2IA 5DT7A 2DT3A 4ZXLA 3WDPP 2D1ZA 4B3LA 2GSJA 1HN1A 9CGTA 3A6OA 3W26A 1JD9A 3WQVA 5DMYA 4AZ5A 1LLOA 4CN4A 5AC5A 2YIHA 3ZR5A 4H04A 1HX0A 1B0IA 3K4AA 2JALA 1ZBCA 2O9PA 4GI8A 1WDQA 5BRPA 4UZUA 1K9DA 3VM7A 4HA4A 5LYRA 1UKQA 1MFUA 2CETA 4PMNA 3ZO9A 1AQHA 1DWFM 4P7NA 1VEOA 1UYQA 3T0BA 1OB0A 3RCNA 2EPOA 3WH6A 2WSPA 2VRKA 1E72M 2FGLA 3BC9A 3BLKA 1JI1A 4S3JA 4NSBA 3I3EA 1E6RA 3IJ9A 3WH9A 4B15A 3ARUA 1LWJA 2GFTA 2VCBA 2EJ1A 1AQMA 1UZ4A 3SCTA 5A6SA 3BSHA 1UD8A 3MUY1 1CLVA 3FAWA 2VX7A 5F7UA 1EOMA 3U7BA 3T0AA 3WUGA 3AMGA 4AMCA 2OYMA 4DWSC 4W85A 5BXRA 2CBJA 2PI6A 3CUJA 2XGIA 1MXGA 2D22A 2WC4A 1M53A 1GPFA 1AVAA 1L0PA 1CIUA 2BVYA 4HMDA 2OWCA 3L2LA 4U5IA 2V5CA 3GH5A 4F8XA 4PMYA 3TONA 5BYWA 2CESA 3CIVA 4J3XA 5A8OA 1E43A 5BXPA 5D4YA 3EDJA 7TAAA 3PHAA 1O7AA 1GVYA 4BQ4A 5EMYA 3ZT6A 1VJSA 3AHYA 1Z32X 1E5NA 2BVDA 4W5ZA 4HU0A 3M46A 2FDMA 3VDCA 2V3FA 2Y2WA 2WZIA 4D6GA 2WMIB 1J0IA 2G8ZA 3FHAA 3N04A 5A1AA 2Z1SA 3AIQA 1L8NA 4E8DA 4EANA 2WNWA 4UQAA 4W7UA 2PBOA 5HBFA 2G4FA 5M03A 4GINA 4HZ6A 4GO8A 4H8UA 5HPOA 5BXTA 1WDPA 1E0VA 2BXYA 3VGHA 4M81A 3MO4A 4Q7NA 4IM4A 1UH4A 2VNCA 4PMUA 1ISXA 3CBWA 1WP6A 2EO7A 3CZJA 4BQ3A 4HP5A 4UQEA 1UR4A 3VD9A 4YHEA 1PPIA 2PF0A 2EPKX 4PCSA 1ODZA 4BQ2A 2A3CA 3WNKA 2VR4A 2D24A 2YBUA 3MUAA 4OZOA 4PTWA 1UR1A 3ARTA 4D6CA 2G3MA 1QW8A 3MMUA 3LPGA 1KB3A 2UWFA 1WZAA 1XD0A 3UERA 1UKPA 2WM0A 3W6MA 4IUGA 3CHCA 3W53A 1V6YA 5GNXA 1QHPA 2GJRA 1FHLA 3WQ4A 1XCXA 3ECQA 5CSYA 4AZCA 2W66A 1UWSA 3AIUA 1KR0A 2WZHA 1SR0A 1ESWA 3WEZA 1OBAA 2J74A 3VOCA 1X6NA 3CZGA 5DEZA 1W3HA 4MDOA 3ARPA 3AXXA 3N1AA 3BH4A 1EGZA 1PIGA 1SYTA 4P8UA 1UKTA 3CMGA 2JEQA 2VO5A 2WBKA 4PTMA 4HU8A 4CN1A 1QI4A 1ZS2A 4UQDA 4V2XA 3AICA 2E4TA 1WDRA 1JDAA 1XGZA 2A3BA 3PZIA 3F5JA 5FL0A 4MPKA 2ZXQA 2F2HA 1OD8A 1JZ6A 1J0HA 1V6XA 3M07A 3PZUA 1B3YA 1AMYA 4M80A 3AZSA 3AI0A 1W2VA 1QI2A 5D8WA 2CKRA 2JEPA 2CHOA 4QFUA 3AROA 1XYFA 4OOUA 4X0NA 3VIOA 3PZ9A 2WVVA 1NARA 1C8QA 1UOKA 1JNEA 1UKOA 3PTKA 2ZIDA 4KRTA 1W9VA 1UR2A 3AIEA 2CIPA 2IUZA 2WCGA 3HU7A 1UD4A 5CLTA 4DWSA 4BQ5A 5BRQA 1UHVA 3BGAA 4H8HA 4PUEA 2MANA 1WPCA 3N9KA 4MB1A 4QLLA 2D0FA 3SCUA 1RH9A 1IZKA 1TR1A 4CCCA 4NRSA 2J77A 1Q6EA 4BCEA 2W91A 1WE5A 3K8MA 5M5DA 3DYPA 3TP4A 1E1FA 3BMWA 1H49A 3UCQA 4FK9A 3GDBA 1CEOA 1JI2A 4YHGA 1GQJA 1OGGA 3FXYA 3RM4A 1IT0A 1QOXA 3WELA 4YN5A 4JCMA 3ARVA 1QNRA 2YLAA 3G6MA 3W82A 4WSJA 4TVCA 4AEFA 3FAXA 2YDRA 1W3JA 5AY7A 1J11A 2VUYA 4LGXA 3WEMA 1NQ6A 6A3HA 1KGXA 4HMEA 5GPRA 2CYGA 1BPLB 3PBGA 2Y8VA 3DHUA 1VFFA 2WMFA 4PTVA 2DGAA 4AD0A 1R7OA 1K9TA 2V3DA 3WD3A 1ZBKA 1UA3A 2DIEA 1RP9A 3WH7A 2NT1A 3OLEA 1GOIA 3EDDA 5A6MA 3SCRA 3WF0A 3CMJA 2PB1A 4HOZA 3ZMRA 2XHYA 5FKYA 2IXUA 4D6HA 3HJEA 1OGSA 3KWXA 2XFFA 4GZIA 1E0WA 3QOKA 1PZ2A 1EOKA 1V3HA 3WH5A 4X0VA 5A2CA 3AIRA 1E3XA 4CGTA 1WO2A 4TUFA 4QAWA 2BY2A 2J7HA 5A2AA 2VX5A 2CERA 2WW5A 2PWEA 4JFUA 1JG9A 4P7OA 1ISYA 3L2MA 4OKDA 4PRWA 2ZWYA 2D20A 1J18A 4MNJA 3VIKA 5DT5A 4J3VA 1UG6A 3TOPA 3VX0A 3WF2A 1BTCA 2DDXA 4DUXA 5A6AA 4CU6A 5M3WA 2GK1B 3POCA 1QPKA 2X0HA 3BAKA 2BV9A 1E71M 3SCPA 2B31A 1JZ8A 5CG0A 3MKKA 5C8BB 4UOJA 3W6LA 1Q6FA 2DSWA 1GOQA 2X09A 4BS0A 4AZCB 4R27A 1VAHA 1EQPA 1UD5A 3AXIA 3OB8A 3WDJA 1SFSA 4W87A 2BHZA 1E6XM 4AXNA 3WNMA 3WUEA 1K9FA 2PBGA 2XUCA 2DSZA 3T2OA 4U31A 3AZRA 4CU7A 2X05A 3EDKA 2W5FA 1EQCA 1HL9A 2FH8A 2WBGA 1KXQA 1K6AA 2WWCA 4UZSA 2WVSA 3VD5A 3VGGA 2J75A 1HVQA 3OLDA 1LQ0A 2DT0A 3VDAA 3ZT5A 3N11A 1V6VA 3OZOA 1QNQA 3N12A 1MFVA 3PZGA 1QNPA 2O9TA 3WKZA 1BF2A 1UKSA 1ITXA 2YL9A 5D8ZA 3VIJA 1Q6CA 2W92A 3CZ8A 4W86A 3BMVA 2ZICA 6TAAA 5E09A 4PMOA 3VIGA 1W1TA 3CZEA 2HVMA 3GNRA 1B3WA 1B3XA 3MU7A 2WVVB 4HPGA 3SCQA 4CD7A 2WSKA 1PBGA 1TZ7A 1UA7A 2XVKA 1V3MA 3CO4A 1PX4A 1TCMA 1HKIA 3UETA 5LA2A 1W9UA 2F61A 5EFDA 2E40A 4QCEA 4DWSB 2VQUA 1BYDA 3BLPX 1ZBWA 1VRXA 4HPHA 1E5JA 5BCAA 2CBUA 1LL6A 1XH2A 3RPMA 2VRJA 3SCOA 1LJYA 1BG4A 6CGTA 3D3AA 1LL7A 4GPNA 2ZXAA 1MW0A 2DT2A 3U7VA 2VCCA 1CXFA 1JF6A 1RPKA 5I24A 1E4MM 3PZMA 1GZJA 2YLLA 1OCQA 1PX8A 2BVTA 2VTFA 3M6DA 4TX8A 4D6IA 2Q8XA 3GZAA 3VMPA 3L4UA 1E4LA 3WNNA 1GJUA 1NH6A 4JL1A 3T2QA 1B9ZA 2E9MA 3WD0A 2G3JA 1HJUA 5HXMA 1HP5A 4BF7A 1E6QM 1M03A 3GXDA 4JKMA 1U33A 4RE2A 3WDHA 4P7QA 1Y7VA 2VZOA 2YDQA 3APGA 3GXMA 2YA0A 4M82A 4C7FA 3OBAA 1UWRA 1JXJA 1S46A 4B9ZA 4M1RA 2V5DA 4ZFMA 4JFVA 1TVPA 2VL4A 4TXEA 3IJ8A 1JZ3A 5A95A 2XTKA 3W24A 1QBAA 3W4RA 4F9DA 4U3AA 1HJWA 3VVGA 4IPLA 4PMZA 5DFAA 4PSPA 4X9YA 1HKJA 1GHRA 2XFYA 4A4AA 4HA3A 1MW1A 4D6FA 3AS2A 4S3KA 1TG7A 4UOZA 1BFNA 1EH9A 3THDA 2YOCA 1H09A 3WUBA 5JBEA 3JUGA 2WK2A 1UR8A 1GW1A 1QHZA 2RGLA 4XUYA 4UQ9A 3VNZA 3T09A 1ZB5A 1J0KA 3NSMA 1ZBVA 4AISA 4NZCA 1GJWA 3SCSA 2V3GA 3WF3A 2CNCA 4M29A 3IJ7A 4ZE4A 4J28A 3VU2A 2QHAA 1H11A 1E9LA 4PBGA 4PEEA 5A94A 5D9PA 1SMDA 1OGBA 1HNYA 5IDIA 4AZ6A 4D72A 3GTNA 2WLYA 4LX4A 5A8PA 3WH8A 1M01A 1P6WA 1GQIA 3ALFA 4PN2A 1A47A 3WENA 3WBEA 3N15A 4GKLA 3LPFA 3SUUA 1V0MA 2A3HA 4H2CA 2ZUMA 1UR0A 1OIFA 3DC0A 3VD4A 3QHMA 1KBKA 3AJ7A 2D3NA 3FNDA 1KQYA 2UY5A 1CXIA 1GVIA 4W7VA 4JKLA 1VFMA 5A8NA 2WYSA 3VGFA 5CGTA 1CXLA 3WDRA 4W7WA 4C7DA 2WMGA 4QLKA 1D3CA 3DHPA 5FIPA 3SUWA 4Z2HA 3VD7A 4AYSA 3VTRA 1H0GA 1C92A 2WKLA 2W4XA 2BY3A 2VT0A 5CSUA 1CYGA 3PTMA 2XJ7A 4QCFA 4CD6A 2AMGA 2WKGA 5A69A 1JFHA 2VI0A 1XSKA 3FY1A 4L4PA 4HZ7A 3ALGA 3N13A 3PZTA 3QHOA 4GZJA 3FN9A 1WNOA 5IFTA 4ZENA 1H2JA 3MS8A 2ZUNA 1CGXA 4AD5A 3D5HA 1OT2A 4N0RA 1JZ2A 5A3HA 1LG1A 2EEXA 3A4WA 2JE8A 2V3EA 1DWHM 3I3BA 4J3WA 3FHQA 4YPJA 1GOWA 1NWTA 4OBRA 4W8AA 3U5YA
chains in the Genus database with same CATH superfamily
2JGQA 2P88A 1EBHA 3AXHA 5C5YA 1F7BA 3GFZA 1TQJA 1R7AA 1U22A 5TAOA 1HP4A 4DO4A 1ZCOA 4MADA 4LAUA 2QPXA 3PRBA 3AJXA 4N6FA 2J7FA 3OQ8A 3VOFA 1QCWA 2QXWA 1OYAA 4AZBA 3LENA 3AS0A 2NV9A 1EC8A 3L0NA 2XGBA 1OFQA 1A49A 1ZY9A 1UBSA 4REQB 4XV0A 1A0CA 1F61A 1IEIA 3ME3A 1YX1A 1C9DA 2C1GA 3RRAA 1OQFA 2VGBA 2A3LA 4WJEA 5A2BA 3FS2A 4TNSA 1M65A 1U2YA 3LGDA 4QROA 4FLSA 3IJLA 2VVSA 1W8SA 4KEUA 2QEZA 1HXVA 2WPBA 4LXFA 1MO0A 3QVQA 1EJ7L 4RXGA 2PEVA 1W1YA 1CENA 1N7KA 1DJXA 1OK4A 1H0IA 3G5EA 2PDHA 2E28A 1QI3A 1XH0A 4IH3A 3SECA 1O60A 4YVXA 6XIAA 3K5XA 1E55A 1ONWA 4MWAB 3DOPA 3SJNA 1Z48A 1OD0A 1XLKA 4D71A 1AUSL 4ODNA 2OGYA 2PGEA 2CKSA 4ASTA 4I8YA 3TLLA 3HA1A 3MANA 4HTYA 1DJHA 4A21A 2P53A 3T0CA 4KFOA 4L80A 2V5BA 1V3LA 3N6JA 4L4OA 4YIWA 4L61A 2WHMA 4GGHA 3B9EA 1YBQA 4AWSA 1R8LA 1SVDA 4WY0A 1BVWA 3LI0A 4CLMA 2YYTA 4DROA 1XLMA 2WJFA 2YCJA 4LTSA 3NJ3A 3RF9A 3U2EA 1XRTA 5D9NA 1PHWA 5FL1A 1VKFA 3EPNA 3RRXA 3M16A 4K3ZA 3S5NA 3TE9A 1EZ2A 3N4EA 1XF0A 1JCMP 3ZIZA 5BU9A 1ISZA 3WD2A 3LBCA 4ODOA 1HW6A 2ZE0A 4XSLA 4LB4A 3B04A 3UCDA 3CV7A 1XSIA 3R94A 3ELFA 1Q6DA 1FKBA 3JZUA 1EC9A 2QPUA 2VRQA 3NQFA 2DH3A 2REQB 3DESA 2DQXA 3DCPA 3MSGA 4O1CA 1RD6A 4EF9A 1H4PA 3N2MA 1QI5A 1WB0A 1DE6A 4J7RA 4BA0A 4GYKA 1WV2A 3B03A 4I6KA 3NYZA 4MM1A 3B4YA 1KFWA 1BSLA 4O8RA 1HKVA 5I79A 1HGYA 2DSKA 3G6LA 4OJYA 4ZS6A 4TW6A 3SFWA 3SSJA 1DJWA 1R0MA 5AYXA 2VCDA 1CXKA 3OLGA 5DCEA 4MNKA 4NL1A 4O0ZA 5D2YA 4WSKA 1JYWA 1BYBA 4YTQA 4WJ8A 1ZU8A 1JYNA 1DIDA 4KFNA 4NZ4A 4AY7A 1BQCA 3MKVA 4R7OA 4JD4A 1B3ZA 1P5QA 4L9ZA 1VHNA 4MY9A 3UG3A 3CU2A 3GW3A 1JRBA 1SO6A 3ONCA 4B5NA 4IL0A 2Q3RA 5HMSA 1M41A 4LJ3A 3KOWA 2IQ0A 4RE3A 1IF2A 2XYLA 1VBRA 4CCZA 1QK0A 1RK6A 2XPKA 3RILA 1K02A 1GRJA 3DKLA 4TIMA 3RDKA 3T07A 2C14A 3B3DA 2J4GA 3W28A 2CLFA 3F5KA 1FKKA 1XLDA 3MUZ1 4PCPA 4HZ8A 4BWLA 3R79A 1V0LA 2FGBA 3EKZA 4NZJA 3S83A 1PWMA 3BW4A 4M8UA 1DHKA 3QMSA 4PUDA 1F6KA 1YADA 5HW8A 5JIWA 1H50A 1HL2A 2YR1A 2H8ZA 3FKRA 2DH2A 4UTMA 4O14A 5M1TA 4RX0A 4IIBA 1BVNP 1J96A 3JW7A 3MSDA 3SQSA 3MMWA 1F3WA 2GJNA 3BAJA 3B06A 3AHZA 3CL7A 1HG3A 2XDFA 1RA0A 2VJXA 3CAWA 1VPQA 4HOXA 1YXDA 1SO4A 4QE5A 2ZX9A 1PZ1A 5TNVA 4DIAA 3E2SA 1XBYA 3QYQA 1NY1A 3BAXA 1O6IA 4UNKA 2X0YA 3MWCA 5A6BD 3A4AA 4IQLA 3DFOA 4U4MA 3IV8A 2GGGA 1NOUA 3F5LA 1BLIA 4FNPA 4WDTA 2GOKA 5G4WA 1XG3A 2D23A 1FKSA 3OLIA 1P1MA 3UG5A 3VDHA 3BXWA 1Q6GA 4RZ5A 1EA9C 5GNYA 2TAAA 4A8LA 3VFCA 3WY1A 4EXBA 1YIXA 3PN8A 1J0YA 4Y6GA 5D02A 1JD7A 1WOAA 5KEZA 4EKJA 3PA7A 5CH9A 4MAVA 2WVUA 2F8QA 4GNJA 1V08A 3KOYA 2LLEA 3H2CA 1LT7A 3TYCA 2XP4A 3ZWSA 3I3DA 4L4LA 3N2BA 2A2IA 3NO5A 2WHKA 4RW5A 3PUEA 2F21A 3AMLA 2X7VA 5K4XA 3H53A 1US0A 1J9YA 4K8HA 4V28A 3SAZA 3R8RA 4YCOA 5CCZA 3M47A 1GONA 2EPLX 3G0SA 3M1ZA 1FAPA 3RJXA 3CTTA 4S1FA 3U2CA 5D04C 3EEZA 4PUJA 3VKCA 1DWAM 3TQPA 1X1ZA 1THFD 3NSNA 3WN6A 3WLTA 4CVUA 3QGAC 5G1TA 2CCRA 2PBCA 2PUZA 4A3RA 1XKYA 1M5YA 2XWEA 1ONEA 4S3EA 2PLJA 4GWEA 4LT9A 3ARWA 1GZ1A 1ZJIA 2CC0A 1E6NA 2AMXA 2BY0A 2BVWA 3TJXA 4Q6JA 2W62A 3DFYA 5I0DA 1NP0A 2W9MA 5CSSA 4UTTC 2O92A 4JFTA 4XAPA 3LS9A 3WJZA 1DJNA 1VJZA 2PDYA 1ODUA 3ZSTA 3CUGA 3FJ6A 4QJ5B 1G94A 5EBAA 1LRTA 1Q8AA 2V5KA 4RNHA 3C3UA 1Z89A 4UFJA 2DW7A 3POHA 2EJAA 3PULA 1FXPA 3CT7A 2R94A 1YE6A 1Q1CA 4MZYA 1J0JA 3KLKA 3N2CA 1C7TA 1X39A 5EMUA 3AHXA 3FA5A 3CS2A 3PY2A 4JICA 3TR9A 1JVNA 3NOYA 1RUSA 4D6DA 2PGRA 4CQAA 4D1IA 4QJ3B 1XBZA 3IANA 1R2SA 2ITKA 3DBPA 1V5XA 1BXBA 1OX4B 2EBNA 2EQDA 3TZNA 3BAWA 3VKJA 4XZLX 3RJYA 4D6JA 3B4UA 1WX0A 4JIHA 4LRTA 3RMEA 1UZHA 3ARSA 3VILA 2ZC1A 2DPEA 3PZQA 4DM2A 1AH0A 1AG1O 4AY8A 4JXCA 1E6PA 3WNOA 4MJMA 3W7JA 1EB3A 3AIBA 4JN8A 1DQUA 1J4HA 3WQFA 3O2LA 1S1RA 1E15A 4IPIA 4PFHA 4ATLA 3D0CA 2OO0A 3UGRA 2J25A 2VDHA 4JNMA 3L4YA 3AMKA 3PFRA 1XYCA 2M1IA 1RY8A 3ANYA 3NO1A 5CZJA 3VINA 3DZ1A 3KWSA 2OZTA 3TYDA 3S1GA 1RJRA 1M68A 1V02E 2YXXA 3O5RA 1K9EA 3O5EA 3SY5A 1Y65A 3C2VA 4GXMA 2VWTA 3GX9A 2QAPA 2PSNA 3TA9A 4I6VA 4IQ2A 3S1WA 4O1BA 4HNLA 2D2JA 1JNDA 1BYAA 2QQ6A 3WX7A 4ERGA 3NG3A 1PIIA 1KBBA 1I9CB 4UDMA 1QPOA 1MNSA 2NQHA 3EB4A 4GO9A 1G7VA 2C15A 3TR2A 3LZ3A 4KF1A 3TUUA 1MW2A 3C0SA 4F0MA 3M7WA 2DSUA 3FJLA 5I3IA 3W70A 5JQ9A 2Z29A 1TV7A 5I98A 1VPXA 4L6OA 5G2IA 1T6MA 5H2ZA 2OYKA 4W88A 2GDUA 3W1TA 2PLMA 1XR2A 4UQBA 4DHGA 1XV8A 3QZEA 5FSDC 1EO7A 2C19A 4QJ4B 2OCZA 1YQ2A 2ZOXA 4YCPA 1HIZA 3JZEA 3H7RA 3S5SA 5FEZA 3N2TA 2R1PA 1V6WA 2ZX5A 3MC5A 3WL0A 2QAFA 1FRBA 2WOQA 5CPLA 2OTDA 1W9PA 4FX6M 4GXPA 4LVDA 2VDIA 1LP6A 5DMMA 2Q8ZA 3BAYA 3KE0A 4KWVA 4WOQA 2GJPA 4S3DA 1TPWA 3H2AA 1E70M 2G3NA 2Q71A 2D2OA 5IFPA 2J8FA 5T91A 4JX5A 1IX5A 3E2VA 2DP3A 1S5VA 1XLAA 3BCDA 4NNRA 4FLQA 2YDAA 4CNUA 3S2NA 2ZTJA 4AY1A 3APYA 1FKHA 2DVTA 2PPNA 4UNIA 3UXAA 3U48A 3ZR4A 1ZJAA 3LN3A 1EWDA 2VX4A 1LL4A 1HJVA 2DORA 2BLEA 4FXSA 1HF6A 1RQEA 2J47A 3L65A 3BUVA 1UUQA 4F3HA 2HROA 5DY2A 2YL8A 5A6JA 3A47A 4B90A 3LSBA 5G4HC 1CXHA 4ZO6A 2FTPA 3AYSA 4ML4A 2ZZ4A 3T9PA 2Z7GA 4C6OA 1P0KA 4JFLA 1KLYA 3WFLA 1OSEA 1UWQA 1GPWA 4AZIA 1HO1A 2Z27A 1A3XA 1GKQA 2XVPA 5I02A 3AFBA 1PSCA 1I2RA 9XIAA 3GUGA 4C60A 4F48A 4JTAA 3K4DA 3OOQA 3TCSA 2VR2A 5I3DA 2YJQA 1V3KA 3T0DA 1FKRA 1JULA 2PPPA 2OJPA 4CU8A 4NNAA 4LUSB 3EBVA 2DIJA 4GA8A 2LKNA 3H70A 4I8DA 1UH3A 1WUEA 1QVBA 1W5PA 2P3ZA 5CLWA 4U33A 1TTPA 1R46A 3F4VA 1W56A 4PL1A 4ACZB 1JDDA 3GKFA 1YPFA 2VC9A 4HK5A 2PPGA 3OA5A 1YE4A 3NPUA 2JK2A 1VR6A 1FBAA 4JHOA 3BMBA 2RUDA 3BANA 5FJPA 4AD1A 3WO8A 4FNQA 4LOCA 4GCAA 2ISWA 1QPQA 1ICPA 1HJXA 1VENA 2V2HA 4MPQA 4PCTA 3VCCA 2CXEA 3CHEA 4AC1X 2OKTA 2LJ4A 4S39A 3IGUA 4GCXA 4JTGA 1LROA 1FWRA 3VIFA 1XX1A 4MTVA 3C5QA 2FJKA 3W2UA 3TTYA 1J93A 4O11A 1Y5WA 2PV3A 4OT7A 4HA1A 4GUHA 1J6YA 2WLZA 4WEVX 1KCKA 1XRVA 4KKXA 1D7FA 3FJNA 3GTHA 1MQQA 4MB4A 5E6YA 3WLKX 3L66A 1V7YA 4OUEA 4OIFA 4WR3A 2OLHA 3BOXA 3CQIA 1W9DM 3GG0A 1E3ZA 4N9CA 1T40A 1F8AB 4Q4QA 4LYQA 3Q37A 1XYLA 1GW9A 1X1NA 5BNKA 1MRQA 3GE7A 5CPNA 3NQCA 4DPQA 2DUZA 3N2OA 3N29A 1GOMA 4O13A 1RLCL 1EJXC 3EEGA 2FPYA 1OK6A 2X0SA 3BQ6A 1EDGA 1CGUA 1FDJA 4YYCA 3UPMA 2B7OA 3CIWA 2PRLA 1FKLA 3ZJ8A 3QLLA 3AU2A 3UXKA 4ADUA 4TTGA 1CGYA 3FKKA 4GBUA 1TJ0A 5DXYA 5I5RA 3WMBA 3UWQA 2GUYA 3QYSA 3WQEA 4IMFA 5FEXA 1J01A 3V75A 3T0TA 1T41A 3A12A 4TX6A 2E0PA 1KT0A 1BGAA 4H9VA 4REQA 4LBSA 4H3DA 1E6ZA 1WZLA 2CXGA 2VENA 1F74A 1UJPA 5E93A 2BWGA 3WDPP 1EEXA 2GSJA 1T96A 1JD9A 6PTDA 3TJ4A 3W84A 1GVFA 1KBLA 5DMYA 3IPWA 4KW2A 4H04A 1XRSA 5KETA 3SJ3A 4DJFC 2FVKA 3W88A 1B0IA 1S2UA 2PD9A 3CH0A 3BCJA 5LXXA 3UZWA 1WDQA 4N02A 2GGEA 4UZUA 1K9DA 4GI4A 1NJJA 5A6TC 2GVJA 3LYEA 1UBPC 4RK8A 3RFAA 1AQHA 1DWFM 2A85A 1JRCA 2CLKA 3WLMA 1UYQA 3B8WA 1OB0A 3T0BA 1ZHAA 3ZZ1A 2EPOA 2VRKA 3BLKA 1E72M 1JI1A 4NSBA 1E6RA 1TIWA 5TF0A 1LT8A 4GQGA 1D8CA 1UZ4A 5A6SA 1VC4A 2XN1A 5LIWX 5IM51 3M0MA 4E5TA 3U2OA 4JFIA 3AMGA 3O3RA 2FAPA 3OBKA 2J8TA 4W85A 8XIMA 4GQBA 2PI6A 1MXGA 4CQ8A 4HBOA 4BHYA 1AVAA 1M7OA 4HMDA 2BZNA 4U5IA 2V5CA 3GH5A 3DFTA 4J3XA 1FHVA 1E43A 5BXPA 4IFRA 5D4YA 5HW6A 3PHAA 5BXJA 2HE5A 3QM3A 4XD4A 1XYBA 1E5NA 2BVDA 1A7XA 4WQ6A 2AKZA 4HU0A 4Q4KA 2FDMA 3VDCA 2H9AB 1NTHA 2Y2WA 3PB2A 2WMIB 3FHAA 4LEQA 5HWMA 5E5CA 2J9ZA 3AIQA 4GVFA 4L1XA 1P0EA 3MCMA 4PUWA 5AB3A 3V5FA 3RFWA 4GO8A 5HPOA 5EU9A 4DZ2A 1E0VA 4H9XA 3MO4A 4K7YA 3W07A 5HW7A 2QJJA 5IOBA 1G7UA 4PMUA 2D9FA 3CZJA 3H2EA 4UMBA 1DJGA 1UR4A 4V15A 1P0DA 3HMJG 2DUAA 1SFLA 3UVIA 4QM1A 2F9RA 3P5ZA 2VR4A 5HUPA 2D24A 4QZVB 3AWOA 3LRLA 3O5IA 4OE7A 1DQXA 1T8XA 1RV8A 1JCJA 3MP3A 2UWFA 4J2MA 1XD0A 1UKPA 1SW7A 4O54A 1O68A 3WQ4A 1IXQA 4DJDC 1UWSA 3AIUA 1YNPA 2ZR5A 3IIVA 2YCIX 3NRKA 3TV8A 3TWBA 2RKXA 2J74A 4AXKA 2ADAA 3LHYA 1PCKA 3DFHA 4WGHA 4DRNA 4M19A 1EGZA 2X2GA 4Q8VA 3CAQA 2OQHA 5HMFA 4O1AA 4RLIA 3BO9A 3O5DA 5K9DA 4LS2A 3AICA 1WDRA 1LLWA 1JDAA 1XGZA 2UZ9A 3F5JA 1OD8A 4OFCA 2Z1XA 1QOPA 3IV3A 3AI0A 2E67A 1JNTA 1ZTVA 2CKRA 2JEPA 3ZFHA 3BOFA 4AU0A 3VKBA 3CB3A 1DKWA 3C61A 2QDDA 3SRKA 4HVXA 3W02A 2YW4A 1NARA 1M7JA 4WSHA 3UZXA 1YPIA 1R3SA 3PTKA 1Y0OA 3JU2A 1F9CA 3TEVA 4XAYA 1MMFA 3O5PA 2IUZA 2WCGA 1YNQA 3HU7A 5CLTA 1QPLA 1FCVA 1ZP3A 2AQVA 4UTWC 4BQ5A 5LGZA 5BRQA 3HPXA 3GPKA 2P4VA 3BW3A 2Y7FA 4I7VA 1WPCA 3N9KA 5EYWA 4ZSTA 1VZWA 4ZMGA 4CCCA 4RNIA 2J77A 1QO2A 5HMEA 1Q6EA 2BBFA 1A0EA 3A5FA 1E1FA 1H49A 4QJ1A 4RNJA 3GDBA 1JI2A 4DRMA 4Q8TA 3R7MA 1IT0A 4O10A 4JCMA 3GRIA 3CAVA 2UZ5A 3RX2A 1S3HA 4WSJA 2Z25A 4ZZ9A 2O55A 4GX9A 3Q58A 1SU5A 1NQ6A 5GPRA 3NZ1A 2CYGA 2MNRA 1JCLA 3PBGA 4DBSA 1KD0A 4JOMA 4PTVA 1E1CB 4HCLA 4HHPA 2J88A 3B9NA 4PTNA 1RP9A 3T42A 1OFPA 3EDDA 3LZ5A 5A6MA 4IFKB 2PB1A 3WK0A 4HOZA 1ZCCA 2XHYA 4TW8A 1WKDA 5FKYA 2IXUA 3UWVA 2QKFA 4IMCA 4YTTA 4KWWA 4QITA 3KWXA 1G4TA 1E0WA 3QOKA 1RBLA 4NZ5A 4DLFA 4E3TA 4JEQA 3R6IA 4LCRA 2NLYA 5A2CA 1TIMA 2GGHA 4LS0A 2H8XA 3TCEA 1YXCA 2YCKX 5C54A 5A2AA 4JFUA 1J8VA 3NA8A 3L2MA 4B5WA 1YLVA 1J18A 4JBRA 1UG6A 3LRKA 3U8GA 2IPGA 1L1PA 5A6AA 4KQNA 4GIVA 3POCA 1QPKA 3H8AA 4DRIA 1ADSA 3Q4DA 3AYTA 3NPWA 4A3QA 2B31A 2OX1A 5C8BB 1DXIA 5JH2A 1GOQA 5KSWA 2X09A 2PDKA 5AVHA 3STFA 3W87A 1BL4A 1N1AA 3WUEA 1K9FA 2QZRA 2XUCA 1TCDA 4CU7A 5D32A 4W9OA 3EX6A 2W5FA 2WQPA 4JNZA 1HL9A 1VCVA 2WBGA 2F2KA 4HHHA 3VK5A 2J75A 1SZRA 2I7GA 2ZDRA 3IRDA 4M6UA 4DZIA 2DT0A 3VDAA 1QNQA 1SZFA 3TSMA 5I07A 4JQ3A 1EBGA 1AZ1A 1QNPA 3VNMA 3WKZA 3SGGA 5D8ZA 2PPOA 3VA8A 1EA0A 2HBXA 3W7LA 1J4RA 4Q3MA 4ZL1A 3O05A 3NQ2A 3H4XA 3GSMA 3W2NA 6TAAA 1ZJHA 3CL8A 1E44A 4DRKA 1L8PA 2HVMA 3GFXA 3MY9A 4AB4A 1FWSA 2ZRYA 3MU7A 2WVVB 3SCQA 3YPIA 2WSKA 1A5KC 4QG8A 5BMXA 1OFOA 2XVKA 1PX4A 4JFJA 1YW1A 4AHOA 1EKOA 5LA2A 2E40A 1XIDA 2ISSA 1BYDA 2VQUA 4HIBA 4AHPA 4YXGA 5BCAA 2CBUA 1NSGA 2C16A 4QEEA 1HGWA 1XKJA 3SCOA 4LNYA 3O5GA 6CGTA 3EPMA 1J6PA 1L2UA 1MW0A 4EXQA 1TPDA 1CXFA 3BLLA 1PX8A 3S6OA 2VTFA 2Q8XA 3L23A 3ICJA 1DV7A 3W23A 4LY8A 1JPMA 2R6OA 2H90A 2PDXA 3WNNA 2FZNA 4JL1A 1FWHC 1J79A 1HJUA 1HP5A 3W76A 3L0KA 5I03A 4BF7A 4X9SA 1AW5A 1M03A 2D73A 1ICQA 4B5SA 3WDHA 3BLIA 3NQMA 2H6RA 1Y7VA 2RFGA 4C7FA 3A64A 1EJUC 1LOSA 4B9ZA 4M1RA 4B4HA 4KRZA 1ECQA 4QNWA 3ITXA 1VRDA 2VL4A 2XIOA 3W24A 1S2TA 1QBAA 4F9DA 2Y5SA 2RDUA 4U3AA 1D9EA 2A7PA 4PMZA 4WY0F 4PSPA 3PF3A 2R1KA 2V67A 4A4AA 4HA3A 1POKA 4D6FA 3HG3A 3ID7A 4S3KA 4FAPA 1TG7A 3G0XA 4HBKA 3UPWA 3E5PA 3MDWA 4FPSA 3T55A 1VD6A 5JMUA 3PPHA 2DZBA 2VEIA 3QQ1A 5JBEA 3JUGA 3A3WA 3TC3A 4YTRA 2WK2A 4N4QA 5TBOA 1UR8A 1K1DA 3BURA 4XUYA 3QQ0A 3CIXA 1XBXA 5I06A 4K37A 1ZBVA 2OOGA 4NZCA 1GJWA 3WF3A 3H2NA 1EPVA 4DF1A 1O4UA 3M0VA 3IJ7A 3NZPA 3PNZA 1H11A 1NSJA 1WQ5A 4PEEA 5A94A 5HUAA 4PTDA 4MGVA 3T6CA 2GQ9A 1E51A 4N7QA 4OUIA 4D72A 2NV1A 5CZTA 4O12A 2CU0A 3SR7A 4L5ZA 3QV6A 3R5EA 3N15A 4GKLA 4JDBA 4CQ9A 5AKQA 1V0MA 4H2CA 3HB9A 1UR0A 3E02A 2BGNE 3VD4A 4NU7A 3NL5A 2ZADA 1KBKA 3AJ7A 4MYXA 4HA0A 1GVIA 1LYXA 3RU6A 1VFMA 3GNXA 3R58A 4JTIA 2XP7A 1QDSA 2P0IA 4A6GA 4ODMA 1RXOB 1X38A 4C7DA 4DO7A 3SUWA 1NMVA 3THUA 5K9CA 1C92A 4K36A 2VT0A 4NILA 3WLIA 4PRRA 4DZHA 3MYPA 4FAMA 3MDUA 3N9SA 4CD6A 5A69A 4JQAA 1DVJA 3MMTA 1XSKA 2Y5JA 3VNDA 3WQDA 3HF3A 3MJMA 3PZTA 3W3OA 1R2TA 3C86A 3OO2A 2GQ8A 1QJWA 3GB6A 2J66A 3AYVA 4WOZA 4M51A 2EEXA 3ONBA 4F4RA 4RUBA 3I7SA 1DWHM 2IPWA 3I3BA 1KM2A 3G1HA 2IW0A 2ZRWA 3GHUA 3P81A 4OBRA 3E2QA 4GVIA 4IPPA 1G5AA 2JKAA 3ABZA 1DWJM 2Z2AA 4BI7A 2D2GA 4KFPA 2CZDA 3CTLA 4O4VA 1UZDA 3MUIA 1VBHA 5XIMA 1ML1A 1EXPA 4W5UA 2V81A 3ISIX 1SQ7A 3MI6A 1KA9F 1W9BM 4JN6A 4QP0A 3ODKA 4ZODA 1DXEA 3TOYA 4PMXA 3INPA 1VQTA 4C6FA 3KRSA 3VIHA 1GEHA 1FFRA 2BFGA 5ABHA 4H8NA 3ABOA 4QDMA 5EL1A 1IR2A 3NEHA 5EB8A 1VS1A 1XLBA 2DZVA 3B97A 4F2TA 1DJQA 1Q66A 5DO8A 3RITA 1V93A 5HNNA 4PYSA 2F84A 2F23A 2FZBA 4AC7C 1JZ4A 3L4XA 3F4CA 1UROA 4DPPA 4EWND 4RL3A 1G9HA 3B8VA 5HINA 4W89A 1R5YA 5BZAA 1NDVA 4K38A 1D3GA 2WC7A 5REQA 1OFAA 4DAIA 3G1DA 2BTMA 3KBSA 1TPH1 1WXYA 3VPLA 3B0UX 1IGWA 3HGSA 4CD5A 2QIWA 4MKSA 1UUMA 4J1OA 3VE9A 3VXGA 2GVLA 4U2YA 1EHNA 4L4MA 3GKAA 3DI1A 2IS7A 5KITA 1X96A 3GIYA 4G1NA 3V0SA 3REQB 2O7QA 4W84A 1MDLA 2FHCA 4AD4A 1V79A 1K4HA 4IP5A 4U10A 1PHQA 3URAA 1XDLA 2XH4A 3ZOAA 4V33A 1S5TA 1WKEA 1BRLA 5JBFA 1W1A1 2DJLA 1DJIA 4XO6A 1FWGC 3DH7A 5EMLA 2K8IA 3FVMA 5ECUA 3P7YA 1B31A 2TRSA 5D37A 1ZPTA 1NELA 2WCSA 1M3UA 4Q22A 1H5VA 3QQWA 1OG6A 3GR8A 1CWYA 3KRUA 3NQEA 4S3GA 3N6QA 5D2VA 3SM0A 4J2PA 1Z6KA 4XTIA 4RDYA 1UMYA 1XLFA 3NTPA 4H9UA 4FLRA 4WXZA 3KAOA 3UBPC 1B57A 3TW9A 1EQ3A 2J7BA 2OSWA 1R86A 4AZ7A 1WAWA 4CD4A 4ERIA 5D9OA 4UTLA 3SUTA 4K1WA 4PB4A 2R9RA 2BXZA 3E0WA 3G3MA 2R91A 4NASA 3PJTA 1HJSA 3HPFA 3EOUA 4YJ5A 4Z2LA 3IUDA 3LBMA 2D2HA 3WJWA 1D7HA 1BXCA 4PUKA 3U4AA 1KXTA 1FWEC 4UFHA 1FOBA 3B9OA 2I14A 5JH1A 4GXWA 2CW6A 4O17A 1F4HA 4CD8A 4QXIA 7ENLA 3HV8A 1GQKA 4X63A 2OEMA 4C6BA 4F79A 4UTKA 3NXLA 4FOKA 2A21A 2VZUA 4L9YA 5TIMA 3AUJA 4GJIA 3ZWTA 4GQRA 3DKJA 1KNWA 4Y7EA 4GLEA 2Y78A 5E70A 4YMZA 1KC7A 3PBWA 3WQ8A 4YTSA 1CPUA 2B7QA 1U1JA 4HYRA 4XBKA 3TQKA 3WJYA 3VZYA 2JQXA 4RKAA 3PRDA 4M0XA 3WZ0E 2O7SA 5IRPA 4WX2A 5FI8A 2JGYA 4HMNA 3ARZA 1FWFC 3W29A 2FH6A 3W73A 3P93A 1JIBA 2WVTA 5FOOA 2H9AA 1LG2A 1PYMA 2QCDB 2XP9A 2WMIA 3UJRA 4J4KA 1V3IA 5AN7A 4JQ4A 2A3AA 4XKYA 4RPQA 3UPBA 2XFWA 3AHVA 2VQTA 3EWYA 4C90A 2XISA 1BWLA 4TTUA 4MMWA 1KKOA 1CT5A 4NIRA 2VZVA 2FKEA 4WK9A 5D2XA 3S9ZA 5AZ0A 1FWCC 2CZ5A 5FJRA 5I6SA 4GY1A 4C1LA 1GOOA 2A6NA 2VZTA 5BOOA 4QRNA 3C2RA 1CECA 1M7PA 4JR5A 3LPOA 4TMBA 1PV8A 1G1YA 3L9CA 5LA0A 1VB9A 1YW5A 3AC0A 3K30A 3TU9A 1RQBA 4MLRA 2YX0A 3C6CA 1JDCA 1ZFJA 1H7XA 4Q7BA 3CUHA 4Z2JA 3K8LA 4BI5A 1K8CA 2Y8UA 1B3VA 1OM0A 2XVLA 2JIEA 1AH3A 3ZJ7A 1YBQB 5AYIA 4WY0B 1XBVA 3T4CA 1UD6A 5C7HA 1J12A 1XIIA 1MEIA 1WKYA 1YDYA 1R87A 4J4OA 2WJEA 4XB3A 1XM3A 3C0QA 1O5RA 1UWTA 3KFTA 4HNNA 3N25A 4M7TA 2QCFA 2XPAA 3H9RB 3VO0A 3OVPA 2A7RA 3HV9A 2W63A 1O95A 5XINA 1VFUA 4YWSA 3WFAA 2GJXA 2PP3A 3L7RA 1DYSA 3MCOA 1OWQA 3O06A 3RLGA 4PZVA 1KWKA 4KCTA 3NDZA 1QT1A 4IF2A 1BYCA 2V2DA 2G37A 1IT8A 3VGBA 4Q4OA 4P7LA 3ANVA 3N3TA 4GYFA 4XUGA 4QDWA 3HZ3A 1US3A 2OSXA 6REQA 2FVMA 3O63A 3SCWA 3IRSA 4BK9A 3MV01 4M56A 2Z2BA 2AL2A 4PSRA 3NVTA 3W86A 4D8AA 5JH8A 1VIZA 1UPMB 1U1HA 1AD4A 1W5QA 3KOZA 3BLOA 4IIFA 3W27A 4CNSA 4H2HA 1L6GA 2E3ZA 4AUBA 2W3ZA 3PANA 3NZQA 1DTUA 2VC6A 4A3HA 5CPQA 1KFKA 3FYYA 5TD4A 3PJWA 1DQWA 3SN1A 3UA3A 1QNSA 2AAMA 5HJLA 3TNOA 3ARYA 5HNRA 3T4WA 3NWRA 3GC2A 1XS2A 1SJDA 4E2VA 1NDWA 2IKHA 4S3BA 3TX9A 1VBJA 2OZ0A 4LAYA 2YA2A 3TTOA 4O2TA 2ZBTA 3VOGA 3UW6A 1IIGA 1BSIA 3MHGA 1JJKA 3FDGA 2POTA 1Q3NA 4LF1A 4DM1A 2GLKA 3S47A 1IWPA 3UR7A 4AIOA 4K1GA 4H41A 4DRQA 1B5TA 2ZYFA 3EWBX 4RZBA 3ARRA 3W81A 3ERPA 3P14A 1PIFA 3H54A 3T08A 3AYRA 3FX4A 3KABA 2G41A 1E0TA 3DFNA 2ONEA 4FNSA 4IFKA 2V68A 2QCEA 1FH9A 4Z2GA 5I00A 4MB3A 3K1DA 4AW7A 1KRMA 2DVUA 3H2FA 3UR8A 8XIAA 3E74A 1DXFA 4ZTYA 3UWWA 3RNDA 3CUIA 1QPFA 3J7HA 4GIRA 4IL2A 4LQ1A 2BGSA 2UY2A 3ABSA 4ROQA 1CDGA 4XD6A 5I23A 4UFLA 3WLQA 1WCGA 1WBJA 3SN4A 1CBGA 4X3ZA 1W3LA 3KCLA 4QE4A 3W74A 1XXXA 2F4EA 3VGDA 2VD9A 5LA1A 4XK2A 1O12A 2OZ3A 1TVLA 4PA8A 3R11A 4IQCA 1UWIA 2BHYA 3O7UA 1C91A 2ZR4A 3G8RA 3LMYA 4GRSA 1FTXA 2XH0A 4UFMA 2FZDA 3VM5A 1JYVA 2GGJA 4E2DA 3GD6A 5EKYA 1AQ0A 5K9XA 3HMCA 3H2MA 4ZVJA 4KESA 4QBXA 2QDGA 1A5NC 4GH1A 2ACRA 2PLCA 4FP1A 2HTMA 1IR1A 3WDIA 3COTA 3KBMA 2A6LA 4RPPA 1GOXA 1K03A 4QG9A 4PRTA 1ITQA 4GI9A 5FEPA 3WMLA 2YA1A 2PF8A 3PBMA 5A6KA 2PGFA 1W3KA 4H00A 3VNYA 3GXFA 1A5BA 1UD2A 4LAXA 5CJNA 1AL8A 4K68A 1IGSA 2VFHA 4XWUA 4Z2KA 1H51A 4J35A 2OO6A 3LQGA 4Z08A 5G4EA 1VCGA 4XIAA 3OYZA 4B3KA 4OU1A 1LWHA 1OFDA 1ONXA 1XH1A 4MSSA 4CUCA 4WRHA 3AO0A 4GMEA 4AFYA 3WD1A 4DJED 1DOSA 1CXEA 1SJCA 4DXKA 3BG3A 4ZTXA 4WKFA 1Y0EA 3LCGA 3DYMA 1IXOA 1S39A 3UJEA 3BDKA 3IJQA 1EHAA 4NY2A 2C0HA 4NYYA 3M5YA 1CX9A 1GORA 2YXOA 2NW0A 4XAGA 4U2ZA 3WH0A 2IKGA 4KCWA 2CLHA 1EWEA 1ISWA 4GE8A 5T8GA 3NVDA 4JKKA 1V0NA 5BOEA 3W72A 3KX6A 3U9IA 2V63A 3AZTA 4GD0A 2YXGA 4J27A 3W25A 2EPMX 1JCNA 3TYEA 4UTUA 3PBVA 2QMJA 1VLWA 5HWBA 2CWXA 3ITOA 2OQLA 2GUBA 1EIBA 1OX5A 3UNTA 4TVUA 1E56A 3EMQA 3BAIA 3LPPA 1QWGA 4MSPA 3KL5A 1XIGA 2GL5A 1AA1B 2PZ0A 2QV4A 3GTYX 2XP5A 4JIEA 5C9WA 4NJIA 3SQLA 3LTPA 1OT1A 3PNUA 3HQPA 4MFDA 4KQZA 4O0QA 3HJZA 3CHDA 3UYCA 3LI1A 4J3UA 3ABQA 3P0WA 1XC6A 1NWRA 2JIWA 3QPYA 4LV4A 1SFJA 4GQ0A 1I0DA 2V5JA 4HGXA 3KEHA 7PTDA 1I75A 3ITCA 1W91A 3IGXA 2SFPA 4DWSD 3UWEA 3WL1A 3PP7A 2X7WA 2D3LA 2X30A 4PMQA 3VOHA 4UCFA 1TV2A 5GQBA 2PDBA 3ENLA 1PUDA 3KHDA 2XM2A 5CSRA 1TZZA 5E0FA 1PKYA 2HSAA 5C2XA 1ZK6A 1T0OA 2I5GA 3S2CA 4QX4A 2PWHA 5I77A 3IHZA 3CK5A 5A8QA 3OTRA 1H3GA 4P8XA 1TV8A 4K39A 4FNRA 1NWSA 1GQNA 3GXIA 2QLYA 3QY6A 4GUIA 1FKXA 1U79A 4AQLA 3NFUA 2JF7A 1C90A 4WKHA 4TX9A 4N4PA 4O1DA 1N2VA 1VIWA 3B0XA 2NV2A 1QNOA 3I65A 6TIMA 1CB2A 3MW7A 4KERA 4F9JA 3GBDA 4MAZA 4Q7IA 4CNPA 2QMKA 3GAKA 1UIPA 2INZA 3E0VA 1Z3NA 4QT3A 4EPDC 5CZKA 1EXBA 4NX5A 3UR5A 4ZXOA 3HGOA 1Z42A 5IHSA 1I1WA 2Z1KA 3S2JA 3N18A 5A6BA 5B7YA 1KQZA 4IIGA 5CGMA 3QXBA 4RV8A 3IARA 4GI6A 1NVMA 1QWKA 1YDOA 5AOUA 4F0SA 3WDQA 1Z8AA 3W7NA 2OOFA 4HOWA 3I6RA 5C2CA 3P61A 1HKMA 1E4NA 1PKMA 1YKWA 2CBIA 3FLUA 1M6JA 3EYPA 3TDBA 1US2A 3CHFA 1ADOA 4DWDA 4H8VA 1UZ1A 2GVYA 5KZ6A 3DECA 2BB0A 1TVNA 1EJWC 4LY4A 4JAWA 4TW7A 3KACA 2RDTA 4L7ZA 1DBTA 1CI1A 1HZYA 4Q4RA 2E6AA 2J7DA 5K4ZA 1OEPA 3QTPA 2NSOA 4DT4A 5H8UA 1V51A 1ICSA 2MLZA 3P8JA 4NI8A 4R88A 3GDRA 3HPZA 4OWGA 4LAKA 1B30A 2VEMA 3KXQA 3M44A 3NEVA 5D05A 2VWSA 3QC0A 4HCHA 4B2DD 1GVOA 2PWGA 3WBWA 1OVDA 3RLUA 2ZWZA 3UI4A 1A5LC 2HDJA 4D1JA 4B92A 2X1IA 2XWDA 4DXVA 3A4XA 1R85A 1YTEA 2ETNA 2F38A 3S1UA 1JCYA 4EACA 1NOWA 5DN1A 4J3TA 4DY1A 2Y7DA 4ZOBA 5DMLA 3DYOA 3WBAA 3N4FA 3VAWA 1FWIC 5C9ZA 1UR3M 2A3EA 3AISA 5FSEC 1TJ1A 3NURA 4NP7A 3TN5A 5EMJA 4AZGA 4Z2IA 3PR9A 2DT3A 3N9RA 4FXJA 2XGZA 4ZXLA 3MVIA 4FZIA 2Y85A 1IEQA 3G18A 1HN1A 3GDLA 3FGCA 9CGTA 4DUOA 3RGTA 3A6OA 4S3CA 1OCNA 4JTKA 5CC7A 3ZVIA 2LPVA 1LLOA 2YIHA 3ZR5A 4US5D 2YW3A 5F2IA 2A1YA 3VAVA 4LCQA 1K7EA 1VYRA 3E0IA 4A8IA 1O5QA 1L6YA 3ITYA 4GI8A 3SB0A 2HV5A 4ZFCA 4Q8PA 2ZQUA 4HA4A 1UKQA 1W3NA 1A5SA 4G5DA 1MFUA 3SI9A 2XP3A 1FX6A 4C65A 4MZ1A 4BF8A 3IGSA 1VEOA 2VFGA 2Z0IA 2XIQA 1T99A 2RJHA 2WSPA 4DXXA 3BC9A 1FWNA 1Q6RA 4PL2A 3CPRA 3IJ9A 4B15A 2JKEA 2XH2A 2VCBA 3QTGA 2DZWA 2CLMA 1LOQA 3BSHA 3MUY1 2IQDA 1BWKA 1H5YA 3U7BA 2OYMA 3O15A 5DRCA 5HANA 3S2MA 4ENLA 5BXRA 4HARA 1EYEA 3UZJA 4TR9A 1TREA 2Z28A 5HR7A 1M53A 3LHZA 1OY0A 4XBJA 3MYOA 1JQVA 2BVYA 2B0MA 2OWCA 3L2LA 1LQAA 3RYSA 3W2KA 5BYWA 4KEVA 3CIVA 3EDJA 4GGBA 5EMYA 3ZT6A 1W0MA 3O5JA 3KAIA 1X7IA 1Z32X 3P67A 4W5ZA 1SO3A 3HG4A 4MWAD 1UJQA 3I68A 1EF3A 4DRJA 2G8ZA 3G8EA 5AHLA 2Z1SA 2HK1A 4V1XA 4C6NA 4E8DA 4EANA 1XLLA 5M03A 1EFZA 4L65A 4HZ6A 4JTQA 2ZRXA 4QDPA 1VGAA 3H7VA 5BXTA 1K8YA 3KADA 2ZA3A 4HU4A 4M81A 4C6IA 4Q7NA 4IM4A 3O5MA 1UH4A 2VNCA 1GTEA 4BQ3A 3DI0A 4C5YA 2V6AA 4QR6A 4YHEA 4G7EA 3LCFA 3L67A 3MO7A 3WLJA 4BQ2A 3V4BA 1F8IA 3KS6A 2VFFA 5F1UA 3WCZA 3WG6A 2PCEA 3MUAA 2Y7EA 1UR1A 3OVQA 4QG6A 1GVQA 1PB0A 3UWYA 3V5CA 4NXKA 2C79A 3MMUA 2E5CA 3TVAA 1R9HA 1WZAA 3W53A 3W6MA 2QUTA 2PP0A 1KTNA 2R1LA 2XP6A 2RUSA 2GJRA 2P1FA 3UNDA 5G2HA 3WQPA 1SPQA 2QCCA 1XIEA 1KR0A 2WZHA 1SR0A 3T8LA 3FEQA 1ESWA 2CZVA 4AIBA 1RVGA 1X6NA 3PWIA 3TYZA 4MVAA 3KOXA 3N1AA 4MY1A 2KR7A 4P8UA 1QK2A 1UKTA 3DENA 3E38A 2VO5A 3GDKA 5F2MA 3O5QA 4PTMA 4HU8A 3C52A 4UQDA 1VLIA 5H8PA 4NXSA 2EAWA 3C2YA 4P61A 4Z42C 2E4TA 2ZKMX 4PCNA 2PURA 2Z1BA 2A3BA 2I9UA 4B5TA 5FL0A 3M5VA 3PSWA 2QCDA 3KCEA 2F2HA 1JZ6A 1J0HA 2MF9A 3A3XA 3CEUA 3M07A 4JHMA 4H9TA 3BMXA 1B3YA 1AMYA 5DRIA 1BTMA 1W2VA 2YYUA 3UQNA 2CHOA 3A22A 4QFUA 1TPVA 5KMYA 2CFFA 3AROA 5AHMA 1DJZA 1PCWA 4H9ZA 3TKFA 3FSUA 1XYFA 3VIOA 3HFTA 3V0TA 3LOTA 3GR7A 4JTTA 1DIEA 3KVMA 1C8QA 1R47A 3MZNA 2RJGA 2ZIDA 1OHLA 1WA3A 1UR2A 2LGOA 2OVLA 2EULA 2CIPA 1EP3A 3RO6A 4HT3A 3NAVA 3PJUA 4JEJA 4JTHA 5D2WA 2YZ5A 4ZOEA 3SIZA 4HCDA 4YLWA 4MB1A 4QLLA 1MXSA 1VFLA 1X97A 4WDXA 1TR1A 4NRSA 3U3HA 3KP0A 3K8MA 4INFA 4Y9AA 4BI6A 3CNYA 3UCQA 4AAJA 4FK9A 1FKFA 4GNVA 4QE1A 1GQJA 3FXYA 3BJSA 2HNHA 3CV6A 2PRHA 3FVDA 4Z1BA 2AQOA 4YN5A 2VGGA 3GTXA 1ROUA 1QNRA 3UY7A 3W82A 4AEFA 2QJMA 2YDRA 3BJTA 4EPBC 3I6EA 2VUYA 4LGXA 3D46A 1BPLB 2Y8VA 6ALDA 2DFAA 2WMFA 2WO5A 5KZMA 2DGAA 4H9YA 3EY6A 4K6AA 1R7OA 3TQVA 2V3DA 2EHHA 1UA3A 1U5VA 5DLCA 2AGKA 3WH7A 2I17A 1W1IE 4P2VA 1XICA 3CMJA 4JYFA 3LXAA 3DFQA 1S5MA 4D6HA 5CPOA 2X40A 4C6MA 3GNNA 3ZXWA 2D69A 1FDYA 1IIHA 2V8ZA 1PZ2A 1EOKA 3SY1A 2HVNA 1O94A 1GVRA 2G3FA 2VGFA 5DY3A 2DZSA 3W85A 1TWDA 1E3XA 1EUAA 4TUFA 4Q4PA 4ZPWR 2CERA 2Z26A 1Z7AA 2PWEA 2P3EA 5LIXX 2WSYA 3ATZA 4PRWA 1VYPX 2D20A 3KS5A 3B0VC 4F0HA 3VIKA 4J3VA 3QH2A 3LHUA 1ZGDA 3TOPA 4NAFA 3WF2A 2DDXA 1N55A 4DUXA 2A4AA 3PSVA 3WLSA 3E9AA 1RR2A 4CU6A 1P5BA 2GK1B 2OR2A 1PZ0A 1Q6OA 2R1NA 5KINA 3VE7A 1GVSA 1JZ8A 3EZ4A 3NQDA 2GSHA 4LSBA 5CG0A 4WGXA 2GPTA 3W6LA 2DSWA 2PMQA 2QUUA 4BS0A 4R27A 3UQAA 1EQPA 2XSXA 1UD5A 3UQBA 3UG8A 3OB8A 1YNYA 1JVWA 3CC1A 4MYAA 2I9EA 3VOJA 5H6HA 3SGUA 2PBGA 3LBOA 3T2OA 4NYUA 2PWUA 3QKZA 3CMFA 1XCFA 1B4KA 2X05A 3EDKA 4ZCWA 2FH8A 1A3WA 1VBGA 5HATA 1KXQA 1K6AA 3FV9A 4UZSA 2WVSA 4FX7A 3VD5A 3T05A 1HVQA 3OLDA 1A4MA 3ZT5A 1NIUA 3BV4A 3ITLA 4BR1A 1XIJA 3PZGA 1RQHA 1ITXA 2PWVA 2ZQ0A 4BF9A 3IKDA 1R3WA 3WLOA 4LALA 1GJPA 2W92A 4AVFA 3BL3A 4GJ1A 2WSQA 3RXZA 3JS3A 2ZICA 4PMOA 3HGRA 5BU6A 3VIGA 4E6MA 1A5AA 1XI3A 1AQFA 4G1KA 1B3WA 5HT1A 3M0JA 1V3MA 4ZQMA 2Z1VA 3CO4A 2XP8A 1RALA 2F61A 3BLPX 4YL2A 4HPHA 1VRXA 1E5JA 2OZ8A 4DAFA 3E3HA 1LL6A 1XH2A 3MWAA 3KBJA 1NMWA 5CKSA 3D6NA 2PDMA 3RPMA 2QVNA 4JNYA 3IIPA 1OABA 4GIEA 1LL7A 3AAMA 4GPNA 2PDUA 2DT2A 3U7VA 1DIKA 5I24A 2F6XA 3S6DA 4ZQRA 2UBPC 4IMEA 4IMGA 3PAOA 3M6DA 5XIAA 4Y8FA 3HGJA 4D6IA 3NR0A 3GZAA 1VHCA 3L4UA 5MKGB 1E4LA 3T8QA 3GAYA 1NH6A 1R9XA 4A3UA 1H7OA 1ZCNA 3L21A 2O56A 2ZVRA 3AU6A 3JR2A 2W6RA 4RDZA 2ZRUA 1E6QM 1F40A 1TR9A 3GXDA 2PV1A 1N8WA 1SSGA 3C3NA 3W7EA 4LB3A 1D3HA 4M82A 1RZMA 1XPGA 5FACA 1R3VA 3URNA 5F2LA 1UWRA 4I7WA 3FAPA 1FKDA 1YDVA 1JZ3A 5FESA 3KTSA 2HMCA 3S2LA 3H7UA 4IPLA 3RU8X 2QR6A 1UP3A 3G1VA 4X9YA 3KAHA 4RNFA 1HKJA 1GHRA 2R24A 5HQLA 4I9JA 3W83A 1BFNA 4ODRA 4N9EA 1EH9A 2WJZA 4RJEA 1OZQA 1R3YA 3QZ6A 4OV4A 4GYJA 4I5XA 4PEKA 3HG5A 1GW1A 2OT0A 2RGLA 3ITGA 4V1YA 4DN1A 2VEFA 3KVLA 3PWGA 1D6OA 2NX3A 1PE1A 4HSHA 4EWJA 4J28A 1NFPA 4C1KA 1BKFA 1OF6A 1K7XA 2OODA 5FJIA 4QTGA 2ODOA 1SSDA 4HTBA 1SMDA 5IDIA 4AZ6A 1PBKA 4Q32A 2WLYA 4JQ1A 3LMZA 4L1WA 3W7KA 1M01A 3WH8A 3ALFA 1W26A 4PN2A 4HBEA 2ZQSA 1RPXA 1ZNNA 4JGDA 4HYWA 3LPFA 3HQ1A 2A3HA 4UUIA 5PTDA 3HBLA 3G1YA 3ZS4A 2D3NA 4KETA 4TO8A 3FNDA 3EWWA 4ES4A 3B8DA 4Y2WA 3ES7A 2VP8A 2GQ3A 5CAHA 4W7VA 4JKLA 1W54A 3TK7A 1GT8A 4LEFA 5A8NA 2FB2A 2WYSA 3VGFA 1CXLA 3TCZA 3WDRA 1D3CA 3WYZA 1MZRA 4Z2HA 3VD7A 1BQGA 2ASHA 3NQ7A 3V16A 4QT2A 2HS6A 2YGYA 5CSUA 2Q02A 4QQ3A 1W6TA 1CYGA 4U86A 3P0XA 2DZTA 2WKGA 1JFHA 1A0DA 4ZOAA 3CHVA 1D7IA 1UCWA 5D33A 4KWSA 3QHOA 3K2GA 4ZENA 3MS8A 2ZUNA 5DQPA 4AD5A 5A3HA 1LG1A 1S2AA 2BXVA 2E25A 2X1SA 1L6FA 3B0YA 1JQXA 2NX1A 1GOWA 1TMLA 1NWTA 1JGMA 3EIPA 1SZEA 1PWLA 1SW3A 1V77A 3BG5A 3GW0A 3QN3A 4PULA 4MNLA 1E4IA 2FB3A 3W1QA 4Z1AA 4DYEA 1XPYA 3PR2A 2XVNA 3RCMA 2G3IA 1XUZA 4W8LA 4CEUC 4H1ZA 3S42A 3AALA 5LNSA 2W27A 3IIZA 5CEWA 1BEUA 2EPNA 3GFYA 4IT4A 3W22A 4P8WA 2WV8A 1S2WA 3SW6A 2WB5A 4P5UA 2GWGA 3WK3A 2KFWA 1E0XA 3CYJA 3CWHA 3H23A 4ALDA 4XKMA 1XG4A 2V69A 1TTIA 3H22A 2NT0A 4IHCA 1RVKA 1V02A 3QGKC 1MQRA 3W71A 4NJKA 1Q7ZA 1JAEA 4YTUA 4C6JA 1LUCB 1LBLA 1TSIA 2DV0A 2YL5A 1QUMA 1R2RA 3QF0A 1FD9A 4GIAA 1IZCA 2HEJA 4ZE5A 1TE6A 4FHAA 1IXNA 3S9YA 3BZJA 3MCNA 4O15A 1H7NA 5EA9A 1XFBA 4JFWA 5AZ1A 3QFWA 1G4SA 3O16A 3TH6A 1YXYA 3G2GA 4GYPC 1NF0A 3WSUA 4GFIA 1UASA 4TQTA 3FK4A 3WJSA 2HISA 3S6TA 2PWFA 3HO8A 1U30A 1W1ZA 4DUVA 2WHJA 1W8GA 1YTDA 2BMBA 2FHBA 3JYMA 3UCCA 1DWGM 1I2PA 1UQZA 5E9AA 1H7WA 3SFKA 5A5WA 1QXLA 4WCJA 1V0KA 3EPOA 4LYRA 4ZQNA 4L72B 4A3YA 5FJJA 2CWNA 4WLCA 5CPSA 4D9PA 3I10A 4PMVA 5ABEA 4ZEPA 1ZZMA 1P0NA 3SADA 3P62A 2OX4A 4UMAA 5EPDA 3TLQA 3BICA 1C8YA 5F4WA 1GYLA 1K77A 1WZKA 2Y5EA 1GK8A 4DQWA 3EXRA 5SWUA 2Q01A 2NVCA 3AMCA 2FHFA 4GOAA 3TTSA 3CGNA 1OINA 1TA3A 4XO7A 1GQLA 3H26A 1EUNA 4R0XA 3OP2A 1J5SA 1E73M 4MJ2A 2L2SA 2CLIA 4FN2A 1LWIA 1KO0A 3OYXA 2PD5A 5KTLA 4YYFA 3CXOA 2HPMA 1MSSA 5J5RA 2GDQA 4AWTA 2E6DA 3EOEA 1X6LA 5CG7A 3ZYZA 2VOMA 3PTDA 2P8CA 3OVGA 4KMQA 1TE1A 1Q7MA 2QCHA 3W38A 3LCXA 3TNBA 1KM1A 4H7CA 4UR7A 2O9RA 4XZBA 5HWNA 4E8GA 3UF9A 5FD0A 2KAUC 3BQ5A 3NQAA 4DB7A 4WJXA 4QS5A 5HJYA 2DUXA 5BW6A 3CLMA 3EDFA 4D6EA 2NVAA 3TAKA 5A8GA 3RAOA 3KZSA 4LH8A 2BOEX 4A05A 2PC4A 3CWNA 2DZAA 2I1OA 4WKAA 2VFDA 4WXYA 3MPGA 4ZSUA 1ZJBA 4F2BA 3BG9A 3FDKA 2I57A 1H60A 4GIYA 5CBBA 4ZOCA 3C8FA 2J7EA 3NQVA 5ABFA 2GZXA 4JIRA 3PVFA 4HMCA 3SCVA 5C2GA 3SUVA 2ZRZA 2OEJA 1G67A 3TA6A 5AC4A 3U5UA 4OQVA 4WUIA 2P50A 1F3XA 3LU2A 1GGOA 4ORMA 3GR4A 2ZXBA 3OGSA 1HJQA 3RGCA 4B5VA 1FHDA 1BG9A 2XVGA 3O1NA 5LNVA 3STCA 3VGEA 4F0LA 3IWPA 3L5MA 4HPNA 1MYRA 1F6PA 4ZPVR 3OIXA 3E12A 1K8XA 4UR9A 2XIBA 1I0BA 3Q65A 4D8ZA 3CO8A 2OT1A 1NQKA 3MI3A 1LRQA 2X1RA 3KP1A 2YBTA 1W1VA 3UY8A 3LXCA 5REQB 1CGVA 3EMCA 4M3PA 5JVLA 4PCFA 1G4EA 1QASA 3R12A 3MVTA 5E9XA 4DBUA 1B4EA 3B9AA 1KM6A 1XINA 4CQCA 2N87A 1SZGA 2QS8A 5HWJA 1I4NA 3MT1A 1PS9A 4FIRA 1P0BA 3HQNA 3AQUA 4WIWA 1C3FA 3AOFA 3GNOA 3QRHA 5JUVA 4NRRA 4H19A 1CGWA 4Q8MA 4GG9A 4UTJA 1KXVA 7A3HA 1FWDC 4Y9PA 2FZ9A 1KV5A 4TV5A 5H1WA 3K8KA 1BRLB 3KM8A 4I7UA 3OGRA 2VOTA 4F66A 4O52A 1RCOB 4DX3A 2C91A 4YVVA 4V27A 3QR0A 3GO2A 1O5KA 2D0GA 3EA2A 1OYCA 3L68A 1H41A 3U4FA 2E09A 3WNPA 1XJBA 3W2MA 1TJ2A 1TFVA 3KRBA 4S2CA 3VZXA 1JZ7A 4KWUA 1LDCA 3AIVA 5LIKX 3EKGA 3PB0A 4IZGA 4NJGA 1ELSA 3Q45A 1EJSC 4GVGA 2YB4A 1RA5A 3CT2A 4IMDA 3F1QA 4EE9A 1VP5A 3GVGA 1EX1A 3CQJA 3M43A 1PTGA 3H6OA 4JTEA 1A5CA 3M0KA 2PTXA 4LVFA 4XVEA 3GVRA 2J7GA 4Z1DA 2KGJA 2ABBA 4YNGA 3DGBA 3QV8A 2E8YA 4LUTB 4CNTA 4R5EA 4GVHA 3OJGA 2VZSA 2PDQA 5LIYX 4AVOA 1J4EA 5CPTA 2PDGA 4PMRA 4OOZA 3IK8A 2YKKA 1FKIA 1C29A 2O9OA 5IXEA 3BPWA 2ZX8A 3TMLA 4NJJA 2YB1A 3BTNA 1EDTA 1ENUA 5J6EA 1FWWA 3B05A 4M6PA 3PPCA 3UJ2A 3EDEA 4L56A 4AWEA 5B80A 1BXNA 1Q8JA 2QUNA 3LLDA 1AJZA 1JPDX 3ZM8A 2XG9A 4UXDA 1E9YB 3BLFA 5CC5A 3CH9A 3VX1A 4E4PA 2VCAA 2HBVA 5D03A 4O1FA 1DE5A 1CTNA 1Q2SA 2R14A 1XYZA 4HN8A 4FB7A 4X2PA 5I3HA 1I1XA 4NQ1A 2JFEX 1CLKA 3USZA 3SZ8A 4Y8EA 3M0LA 4XKYB 1X8FA 4XZIA 1TPC1 3RUBL 3WF4A 1F3TA 4AIUA 3S0CA 4LS1A 2PDJA 2YSWA 1HL8A 4IGNA 2CITA 3VIMA 4N42A 2DU2A 3O6YX 3K46A 1G0CA 5AHEA 2J24A 2FYMA 4HNCA 8A3HA 3OQEA 1XIHA 3E49A 5FF3A 3OHMB 1KBJA 2OSYA 1KRCC 4L64A 1JR1A 3GYCA 1PJ9A 2Y8KA 2GK1A 4N9BA 3CGTA 3RK8A 3ZLFA 2C3ZA 3W75A 5FCZA 4A8NA 3U2ZA 4A2RA 3VIIA 2WPGA 1B3OA 1VJIA 2RGMA 4LWWA 4H6QA 1M7XA 3NUKA 5GNZA 3WF1A 1GZGA 4PB5A 5HR6A 1JPKA 4EAYA 3W1LA 4BEQA 3DFSA 1EL3A 5G2WA 4DRPA 1PZ3A 2YCLA 3OU8A 2EKCA 4ZPTR 4CN6A 3CLWA 1N8IA 3C2EA 1BVZA 3QHNA 3ATYA 4C91A 1HKKA 2W67A 5HMDA 3VD3A 2ZQVA 5A8MA 4LVGA 2DG4A 3VDBA 4XZHA 3ZQ9A 3HIJA 1UQYA 1MRAA 3R0DA 1J10A 3SURA 4PFMA 3KZ7A 2GJXB 2ZE3A 2WMKA 3UJSA 1KWGA 5LIUX 5CPMA 3W7OA 4E38A 4UFIA 4ADSA 3SRFA 4NNCA 1GOKA 1ZAHA 3P74A 1L9WA 4HJFA 2H3BA 3N4AA 5DXXA 1V03A 3NGJA 1FWBC 4MF4A 1MDRA 2WANA 1GTHA 3NCOA 4KCVA 2G50A 5U7SA 6REQB 1JPIA 4L1GA 5MF5A 5DITA 2O4MA 7REQA 1GHSA 3R8HA 1A50A 3R4IA 1A5OC 4CVWA 1CB7B 4U3CA 3LEPA 5DBUA 2AL2B 4U28A 1SMAA 1GUVA 1OC6A 1YEYA 2P5NA 2VX6A 2GWNA 3VCNA 3O6DA 2QJIA 4XVDA 4IPNB 3WUFA 1FKWA 2NWSA 1ZP4A 1A3HA 3R2GA 3MQTA 3ANUA 3OIHA 2C13A 2QVHA 2E68A 4MLJA 4MIMA 4DJFD 5CQ1A 4JY9A 1PX3A 2WZEA 3R25A 1D7JA 3VMNA 2J13A 4UTFA 3L4ZA 5DANA 3NYDA 2G4JA 3H24A 4MUPA 4AD2A 3BE7A 5MKGA 3C4UA 4CKQA 2PU0A 3RO8A 1E9IA 4GZEA 2VD8A 2VC7A 3EWCA 1ISVA 3GXPA 1DP0A 2F6UA 3OOBA 1KR1A 2E9LA 3W7GA 5J04A 4B9YA 5FF2A 1E6SM 4HD5A 4I9TA 1UWUA 1F07A 3HPAA 3PK7A 4MGGA 1J0ZA 1TTQA 1UR9A 3PZVA 5HAOA 4N2YA 3T40A 1XL9A 3GNPA 1F76A 3VABA 4J9JA 1LF1A 3DUGA 4MNMA 3XISA 2ACUA 3W37A 3IAPA 4QLJA 5BXSA 4IPXA 4LANA 1P6CA 3OZPA 3NGFA 4MFEA 3PG9A 4DVOA 3T7VA 2G5WA 3LQLA 4UOQA 4EP8C 1C8