5HUAA

Structure of c. glabrata fkbp12-fk506 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
SETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
total genus 27
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5huaA00
2PPPA 3CGNA 1D7JA 4IQCA 5HTGA 1TCOC 3RFWA 2XP8A 3NRKA 4MSPA 3O5DA 3O5KA 2DG9A 2XP4A 2OFNA 4DROA 1NMVA 4MGVA 3RGCA 3UI4A 4W9QA 3B7XA 3KAGA 3JYJA 1HXVA 2Y78A 4ODNA 4DRKA 1W26A 3O5FA 4QT3A 3TCZA 1C9HA 1R9HA 3MDYB 5HT1A 3KAIA 2XPAA 1D7HA 2XP5A 5GPGA 4DT4A 3VAWA 4TYOA 5HW8A 5HUAA 1BL4A 1FKDA 2MNTA 3ODKA 1KT1A 4DIPA 4DZ2A 1T11A 1Q6UA 2M2AA 4ODMA 2LGOA 2F2DA 4U86A 1EQ3A 3FAPA 3UF8A 1ROUA 3UQIA 1Q6IA 1Y0OA 2ZQSA 4LAYA 3JXVA 2XPBA 1QZ2A 2VN1A 4TX0A 4N19A 4TW7A 2IF4A 1FKBA 2ZR6A 3O5GA 3KADA 3TC5A 2AWGA 4C02B 5B8IC 4ODOA 2KE0A 3O5MA 3KACA 5J6EA 1FKIA 2M1IA 4ODPA 4ODLA 5DIUA 5DIVA 2ZQTA 3LUOA 1ROTA 2K8IA 2PV2A 2KO7A 2RQSA 2UZ5A 3CGMA 5HKGA 2KI3A 4IPXA 3OOBA 2Q5AA 4GGQA 2N87A 4J4NA 1J6YA 2KGJA 1J4IA 1PBKA 4TNSA 1B6CA 4FAPA 2XP9A 2D9FA 3KAFA 1A7XA 1BKFA 1D6OA 2KFWA 2KR7A 2PBCA 2RSEA 3O5OA 3O5PA 4G50A 4TW8A 3O5JA 1J4HA 4JFMA 1YW5A 2PV3A 1F40A 4DRJA 4JYSA 3GPKA 2LJ4A 4ODKA 2DG3A 2RUDA 2VCDA 1FD9A 4JFIA 1JNTA 4U85A 2PPNA 3PA7A 4JFJA 4ODQA 2JZVA 3O5IA 4U84A 5HWCA 2FKEA 2XP6A 4LAVA 1M5YA 1NSGA 4NNRA 3UI5A 2ZQVA 2ZR5A 2M08A 1QPLA 2MLZA 2PPOA 3O5RA 4DRIA 3IKGA 3IK8A 3O5LA 4LAWA 4W9OA 3TDBA 3UQBA 1PINA 3KAHA 3O5QA 1FKLA 2MLYA 3KABA 2RUCA 2ITKA 4DRPA 1FJDA 1J4RA 3JYMA 1YATA 5I98A 3IHZA 1FKKA 2RURA 2L2SA 3PRDA 4DRHA 2F21A 4W9PA 1L1PA 1FAPA 1N1AA 5BXJA 1FKRA 2DG4A 4JFKA 1QPFA 4JFLA 3KZ7A 3EY6A 5DITA 4BF8A 1FKFA 2RUQA 1Q1CA 2XP7A 3WH0A 1U79A 1FKTA 3O5EA 1D7IA 2ZR4A 1NMWA 3I6CA 2XP3A 5HW6A 1F8AB 4GIVA 3KCEA 3NI6A 3UQAA 1ZCNA 5HWBA 2MF9A 3H9RB 3UI6A 5HW7A 2F4EA 4J4OA 3IKDA 1KT0A 4IQ2A 1FKJA 2MLXA 4LAXA 4DRQA 4QT2A 1FKGA 1JVWA 2PV1A 4R0XA 4DH0A 4G2PA 4DZ3A 2ZQUA 4ODRA 4ITZA 4QIBA 3PRBA 2LKNA 3NTPA 1Q6HA 2MPHA 4O2TA 1ZK6A 5D75A 4DRNA 1FKHA 1P5QA 4FN2A 1JNSA 2FAPA 4DRMA 1EYMA 2LPVA 4TW6A 1FKSA
chains in the Genus database with same CATH superfamily
4IQCA 1TCOC 2XP8A 4Q22A 2DPEA 2OFNA 4DROA 1NMVA 1W1YA 4MGVA 3RGCA 1X6NA 4MPKA 4W9QA 3BXWA 3B7XA 3ARVA 3O5FA 4QT3A 3TCZA 1R9HA 3MDYB 1GOIA 1X6LA 2DT0A 2QF8A 3CZ8A 5GPGA 1D7HA 4DT4A 5HUAA 2FDMA 1FKDA 4DIPA 4ODMA 3UQIA 4LAYA 3JXVA 2XPBA 4TX0A 5DEZA 3TC5A 4MNLA 3KADA 3O5MA 4ODPA 1LL4A 2ZQTA 5DIVA 3LUOA 4DWSC 2K8IA 3G6LA 1NWTA 2UZ5A 5HKGA 1J6YA 2KGJA 4AY1A 1E9LA 4FAPA 1LJYA 1ZU8A 2D9FA 4ODLA 4P8WA 4DWSD 4DRJA 3CHFA 4JFIA 4U85A 1OGGA 1HJXA 4U84A 2FKEA 3RM9A 4L72B 3PR9A 2ZR5A 2F23A 2ZQVA 1QPLA 2G8ZA 5HBFA 1K9TA 1FKLA 4DRPA 3OA5A 1FJDA 4P8VA 3PRDA 4DRHA 4ZS6A 2F21A 4W9PA 5JH8A 1FAPA 1WAWA 1IX5A 4Z2IA 3KZ7A 3EY6A 5DITA 2A3CA 2RUQA 2WK2A 2ZR4A 1F8AB 3UI6A 3CH9A 2PI6A 4MAVA 4IQ2A 1FKGA 1HJVA 4Z2KA 3WQWA 4QIBA 4WJXA 2LKNA 3QOKA 1Q6HA 4DRNA 1FKHA 1P5QA 3WD1A 4DRMA 4KR0B 1EHNA 3AS3A 3CGNA 1D7JA 4HBOA 4MSPA 3O5KA 4WKFA 4ZPTR 1HKKA 4DRKA 3B8SA 4NSBA 2XPAA 2XP5A 5HW8A 1EIBA 4ZPVR 2O92A 5DO2A 2LGOA 1XRVA 1EQ3A 3FAPA 1ROUA 1LQ0A 2IF4A 1FKBA 4R5EA 4C02B 4XAKA 3WD0A 2KO7A 2KI3A 3OOBA 1H0GA 1UR9A 3ARRA 2DT1A 1J4IA 2A3BA 4DWSA 1B6CA 2XP9A 4WK9A 2KFWA 3B9EA 3O5PA 4G50A 4TW8A 1CTNA 1J4HA 1F40A 4JYSA 3GPKA 4ML4A 2LJ4A 4ODKA 2IUZA 3WL0A 2VCDA 1FD9A 1FFRA 3B9AA 3PA7A 3O5IA 4LAVA 1M5YA 3AROA 2AOSA 3UI5A 2B31A 2M08A 2MLZA 2PPOA 1XHGA 4DRIA 3WD3A 3ARTA 5GQBA 3GTYX 3IKGA 1OWQA 3TDBA 3O5QA 1ZBWA 2MLYA 2RUCA 2ITKA 2G41A 1GPFA 3AS2A 1HJWA 3CHCA 3FY1A 4MNKA 1FKKA 4ZPWR 1FKRA 1QPFA 3AS0A 4JFLA 4Z2JA 1E44A 1FKFA 1W1TA 1Q1CA 1U79A 1D7IA 3WIJA 4GIVA 3UQAA 1ZCNA 3AS1A 5HWBA 2MF9A 3H9RB 2DT3A 1EDQA 2F4EA 2DSZA 1KT0A 2ETNA 4LAXA 4QT2A 1JNEA 1JVWA 2PV1A 3BMBA 2DSWA 4DZ3A 4ODRA 1E6PA 3NTPA 4URIA 5D75A 4O2TA 3ARUA 4FN2A 4Z2LA 3EIPA 1O6IA 5HTGA 3RFWA 3WKZA 1SYTA 2XP4A 4S3KA 3KAGA 1HXVA 2Y78A 2PN0A 4NZCA 1C9HA 4L3NA 4TYOA 2MNTA 3ODKA 1T11A 1Q6UA 2M2AA 1HKMA 1H0IA 4U86A 2DSVA 1GRJA 3UF8A 1OGBA 1Q6IA 1HKIA 1VF8A 1QZ2A 2VN1A 1TFVA 4TW7A 2ZR6A 1LG1A 2B5UB 2DT2A 4ODOA 5B8IC 3KACA 5J6EA 2M1IA 1ZB5A 1JCHB 5DIUA 1E15A 1NH6A 4UDMA 1KFWA 3ARXA 4Z2HA 2RQSA 4IPXA 2Q5AA 4GGQA 2N87A 4J4NA 1NWRA 4TNSA 1A7XA 1D6OA 1W9VA 4P8UA 2DG3A 2A3EA 2RUDA 1JNTA 4ODQA 4WKAA 5HWCA 2XP6A 4NNRA 3ARWA 1SR0A 3O5RA 4HBEA 2P4VA 1NWUA 4W9OA 3UQBA 1PINA 3KABA 3JYMA 1YATA 1N1AA 5BXJA 2DG4A 4JFKA 2YBUA 3WH0A 3WD2A 4LGXA 3O5EA 1NMWA 5HW6A 2XP3A 5DF0A 1LG2A 3NI6A 2ESCA 1W1VA 3WD4A 2DSUA 3WQVA 2WM0A 4DH0A 4MNMA 2ZQUA 4W5UA 4IT4A 4ITZA 3RM4A 3PRAA 2MPHA 1ZK6A 1ZBCA 3W4RA 1JNSA 3WL1A 1E6NA 1W9PA 3CHEA 1FKSA 2PPPA 4IT6A 1W1PA 1WNOA 3NRKA 3O5DA 2DG9A 3UI4A 3JYJA 4ODNA 1W26A 5HT1A 3KAIA 3VAWA 1BL4A 2O9OA 1KT1A 2OLHA 4DZ2A 4Q7NA 1WB0A 2F2DA 2ZQSA 1Y0OA 3B9DA 4PTMA 1HKJA 4N19A 3O5GA 2AWGA 4S3JA 1ITXA 2KE0A 1FKIA 1FFQA 1NWSA 3AQUA 2EULA 1ROTA 4MNJA 2PV2A 3CGMA 4WKHA 5GPRA 1PBKA 3ARYA 3KAFA 1BKFA 2KR7A 2RSEA 3O5OA 2PBCA 3O5JA 4JFMA 1YW5A 2PV3A 1ZL1A 1LL7A 1UR8A 2WLYA 2PPNA 4JFJA 2JZVA 1ZBKA 1NSGA 2WLZA 1E6RA 4WIWA 2YBTA 3IK8A 3O5LA 4LAWA 3KAHA 3G6MA 4QZVB 1J4RA 4Z2GA 1D2KA 3ARZA 5I98A 3IHZA 2RURA 4KQZA 2L2SA 1L1PA 3ARSA 4HARA 3CHDA 2XP7A 3ALGA 4BF8A 1GUVA 4MTVA 1FKTA 1W9UA 3I6CA 3KCEA 5HW7A 4P8XA 1RD6A 1JNDA 3FXYA 4J4OA 3IKDA 1FKJA 2MLXA 4DRQA 4DWSB 1LL6A 1ZBVA 3GU0A 3RMEA 4R0XA 4G2PA 2A3AA 3PRBA 3RM8A 3ARPA 3ARQA 2FAPA 1EYMA 1E6ZA 2LPVA 4TW6A 3ALFA
chains in the Genus database with same CATH topology
4IQCA 1TCOC 2XP8A 4Q22A 2DPEA 2OFNA 4DROA 1NMVA 1W1YA 4MGVA 3RGCA 1X6NA 4MPKA 4W9QA 3BXWA 3B7XA 3ARVA 3O5FA 4QT3A 3TCZA 1R9HA 3MDYB 1GOIA 1X6LA 2DT0A 2QF8A 3CZ8A 5GPGA 1D7HA 4DT4A 5HUAA 2FDMA 1FKDA 4DIPA 4ODMA 3UQIA 4LAYA 3JXVA 2XPBA 4TX0A 5DEZA 3TC5A 4MNLA 3KADA 3O5MA 4ODPA 1LL4A 2ZQTA 5DIVA 3LUOA 4DWSC 2K8IA 3G6LA 1NWTA 2UZ5A 5HKGA 1J6YA 2KGJA 4AY1A 1E9LA 4FAPA 1LJYA 1ZU8A 2D9FA 4ODLA 4P8WA 4DWSD 4DRJA 3CHFA 4JFIA 4U85A 1OGGA 1HJXA 4U84A 2FKEA 3RM9A 4L72B 3PR9A 2ZQVA 2ZR5A 1QPLA 2G8ZA 5HBFA 1K9TA 1FKLA 4DRPA 3OA5A 1FJDA 4P8VA 3PRDA 4DRHA 4ZS6A 2F21A 4W9PA 5JH8A 1FAPA 1WAWA 1IX5A 4Z2IA 3KZ7A 3EY6A 5DITA 2A3CA 2RUQA 2WK2A 2ZR4A 1F8AB 3UI6A 3CH9A 2PI6A 4MAVA 4IQ2A 1FKGA 1HJVA 4Z2KA 3WQWA 4QIBA 4WJXA 2LKNA 3QOKA 1Q6HA 4DRNA 1FKHA 1P5QA 3WD1A 4DRMA 4KR0B 1EHNA 3AS3A 3CGNA 1D7JA 4HBOA 4MSPA 3O5KA 4WKFA 4ZPTR 1HKKA 4DRKA 3B8SA 4NSBA 2XPAA 2XP5A 5HW8A 1EIBA 4ZPVR 2O92A 5DO2A 2LGOA 1XRVA 1EQ3A 3FAPA 1ROUA 1LQ0A 2IF4A 1FKBA 4R5EA 4C02B 4XAKA 3WD0A 2KO7A 2KI3A 3OOBA 1H0GA 1UR9A 3ARRA 2DT1A 1J4IA 2A3BA 4DWSA 1B6CA 2XP9A 4WK9A 2KFWA 3B9EA 3O5PA 4G50A 4TW8A 1CTNA 1J4HA 1F40A 4JYSA 3GPKA 4ML4A 2LJ4A 4ODKA 2IUZA 3WL0A 2VCDA 1FD9A 1FFRA 3B9AA 3PA7A 3O5IA 4LAVA 1M5YA 3AROA 2AOSA 3UI5A 2B31A 2M08A 2MLZA 2PPOA 1XHGA 4DRIA 3WD3A 3ARTA 5GQBA 3IKGA 1OWQA 3TDBA 3O5QA 1ZBWA 2MLYA 2RUCA 2ITKA 2G41A 1GPFA 3AS2A 1HJWA 3CHCA 3FY1A 4MNKA 1FKKA 4ZPWR 1FKRA 1QPFA 3AS0A 4JFLA 4Z2JA 1FKFA 1W1TA 1Q1CA 1U79A 1D7IA 3WIJA 4GIVA 3UQAA 1ZCNA 3AS1A 5HWBA 2MF9A 3H9RB 2DT3A 1EDQA 2F4EA 2DSZA 1KT0A 4LAXA 4QT2A 1JNEA 1JVWA 2PV1A 2DSWA 4DZ3A 4ODRA 1E6PA 3NTPA 4URIA 5D75A 4O2TA 3ARUA 4FN2A 4Z2LA 1O6IA 5HTGA 3RFWA 3WKZA 1SYTA 2XP4A 4S3KA 3KAGA 1HXVA 2Y78A 4NZCA 1C9HA 4L3NA 4TYOA 2MNTA 3ODKA 1T11A 1Q6UA 2M2AA 1HKMA 1H0IA 4U86A 2DSVA 3UF8A 1OGBA 1Q6IA 1HKIA 1VF8A 1QZ2A 2VN1A 1TFVA 4TW7A 2ZR6A 1LG1A 2DT2A 4ODOA 5B8IC 3KACA 5J6EA 2M1IA 1ZB5A 5DIUA 1E15A 1NH6A 1KFWA 3ARXA 4Z2HA 2RQSA 4IPXA 2Q5AA 4GGQA 2N87A 4J4NA 1NWRA 4TNSA 1A7XA 1D6OA 1W9VA 4P8UA 2DG3A 2A3EA 2RUDA 1JNTA 4ODQA 4WKAA 5HWCA 2XP6A 4NNRA 3ARWA 1SR0A 3O5RA 4HBEA 1NWUA 4W9OA 3UQBA 1PINA 3KABA 3JYMA 1YATA 1N1AA 5BXJA 2DG4A 4JFKA 2YBUA 3WH0A 3WD2A 4LGXA 3O5EA 1NMWA 5HW6A 2XP3A 5DF0A 1LG2A 3NI6A 2ESCA 1W1VA 3WD4A 2DSUA 3WQVA 2WM0A 4DH0A 4MNMA 2ZQUA 4W5UA 4IT4A 4ITZA 3RM4A 3PRAA 2MPHA 1ZK6A 1ZBCA 3W4RA 1JNSA 3WL1A 1E6NA 1W9PA 3CHEA 1FKSA 2PPPA 4IT6A 1W1PA 1WNOA 3NRKA 3O5DA 2DG9A 3UI4A 3JYJA 4ODNA 1W26A 5HT1A 3KAIA 3VAWA 1BL4A 2O9OA 1KT1A 2OLHA 4DZ2A 4Q7NA 1WB0A 2F2DA 2ZQSA 1Y0OA 3B9DA 4PTMA 1HKJA 4N19A 3O5GA 2AWGA 4S3JA 1ITXA 2KE0A 1FKIA 1FFQA 1NWSA 3AQUA 1ROTA 4MNJA 2PV2A 3CGMA 4WKHA 5GPRA 1PBKA 3ARYA 3KAFA 1BKFA 2KR7A 2RSEA 3O5OA 2PBCA 3O5JA 4JFMA 1YW5A 2PV3A 1ZL1A 1LL7A 1UR8A 2WLYA 2PPNA 4JFJA 2JZVA 1ZBKA 1NSGA 2WLZA 1E6RA 4WIWA 2YBTA 3IK8A 3O5LA 4LAWA 3KAHA 3G6MA 4QZVB 1J4RA 4Z2GA 1D2KA 3ARZA 5I98A 3IHZA 2RURA 4KQZA 2L2SA 1L1PA 3ARSA 4HARA 3CHDA 2XP7A 3ALGA 4BF8A 1GUVA 4MTVA 1FKTA 1W9UA 3I6CA 3KCEA 5HW7A 4P8XA 1RD6A 1JNDA 3FXYA 4J4OA 3IKDA 1FKJA 2MLXA 4DRQA 4DWSB 1LL6A 1ZBVA 3RMEA 4R0XA 4G2PA 2A3AA 3PRBA 3RM8A 3ARPA 3ARQA 2FAPA 1EYMA 1E6ZA 2LPVA 4TW6A 3ALFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPP A;  3CGN A;  1D7J A;  4IQC A;  5HTG A;  1TCO C;  3RFW A;  2XP8 A;  3NRK A;  4MSP A;  3O5D A;  3O5K A;  2DG9 A;  2XP4 A;  2OFN A;  4DRO A;  1NMV A;  4MGV A;  3RGC A;  3UI4 A;  4W9Q A;  3B7X A;  3KAG A;  3JYJ A;  1HXV A;  2Y78 A;  4ODN A;  4DRK A;  1W26 A;  3O5F A;  4QT3 A;  3TCZ A;  1C9H A;  1R9H A;  3MDY B;  5HT1 A;  3KAI A;  2XPA A;  1D7H A;  2XP5 A;  5GPG A;  4DT4 A;  3VAW A;  4TYO A;  5HW8 A;  5HUA A;  1BL4 A;  1FKD A;  2MNT A;  3ODK A;  1KT1 A;  4DIP A;  4DZ2 A;  1T11 A;  1Q6U A;  2M2A A;  4ODM A;  2LGO A;  2F2D A;  4U86 A;  1EQ3 A;  3FAP A;  3UF8 A;  1ROU A;  3UQI A;  1Q6I A;  1Y0O A;  2ZQS A;  4LAY A;  3JXV A;  2XPB A;  1QZ2 A;  2VN1 A;  4TX0 A;  4N19 A;  4TW7 A;  2IF4 A;  1FKB A;  2ZR6 A;  3O5G A;  3KAD A;  3TC5 A;  2AWG A;  4C02 B;  5B8I C;  4ODO A;  2KE0 A;  3O5M A;  3KAC A;  5J6E A;  1FKI A;  2M1I A;  4ODP A;  4ODL A;  5DIU A;  5DIV A;  2ZQT A;  3LUO A;  1ROT A;  2K8I A;  2PV2 A;  2KO7 A;  2RQS A;  2UZ5 A;  3CGM A;  5HKG A;  2KI3 A;  4IPX A;  3OOB A;  2Q5A A;  4GGQ A;  2N87 A;  4J4N A;  1J6Y A;  2KGJ A;  1J4I A;  1PBK A;  4TNS A;  1B6C A;  4FAP A;  2XP9 A;  2D9F A;  3KAF A;  1A7X A;  1BKF A;  1D6O A;  2KFW A;  2KR7 A;  2PBC A;  2RSE A;  3O5O A;  3O5P A;  4G50 A;  4TW8 A;  3O5J A;  1J4H A;  4JFM A;  1YW5 A;  2PV3 A;  1F40 A;  4DRJ A;  4JYS A;  3GPK A;  2LJ4 A;  4ODK A;  2DG3 A;  2RUD A;  2VCD A;  1FD9 A;  4JFI A;  1JNT A;  4U85 A;  2PPN A;  3PA7 A;  4JFJ A;  4ODQ A;  2JZV A;  3O5I A;  4U84 A;  5HWC A;  2FKE A;  2XP6 A;  4LAV A;  1M5Y A;  1NSG A;  4NNR A;  3UI5 A;  2ZQV A;  2ZR5 A;  2M08 A;  1QPL A;  2MLZ A;  2PPO A;  3O5R A;  4DRI A;  3IKG A;  3IK8 A;  3O5L A;  4LAW A;  4W9O A;  3TDB A;  3UQB A;  1PIN A;  3KAH A;  3O5Q A;  1FKL A;  2MLY A;  3KAB A;  2RUC A;  2ITK A;  4DRP A;  1FJD A;  1J4R A;  3JYM A;  1YAT A;  5I98 A;  3IHZ A;  1FKK A;  2RUR A;  2L2S A;  3PRD A;  4DRH A;  2F21 A;  4W9P A;  1L1P A;  1FAP A;  1N1A A;  5BXJ A;  1FKR A;  2DG4 A;  4JFK A;  1QPF A;  4JFL A;  3KZ7 A;  3EY6 A;  5DIT A;  4BF8 A;  1FKF A;  2RUQ A;  1Q1C A;  2XP7 A;  3WH0 A;  1U79 A;  1FKT A;  3O5E A;  1D7I A;  2ZR4 A;  1NMW A;  3I6C A;  2XP3 A;  5HW6 A;  1F8A B;  4GIV A;  3KCE A;  3NI6 A;  3UQA A;  1ZCN A;  5HWB A;  2MF9 A;  3H9R B;  3UI6 A;  5HW7 A;  2F4E A;  4J4O A;  3IKD A;  1KT0 A;  4IQ2 A;  1FKJ A;  2MLX A;  4LAX A;  4DRQ A;  4QT2 A;  1FKG A;  1JVW A;  2PV1 A;  4R0X A;  4DH0 A;  4G2P A;  4DZ3 A;  2ZQU A;  4ODR A;  4ITZ A;  4QIB A;  3PRB A;  2LKN A;  3NTP A;  1Q6H A;  2MPH A;  4O2T A;  1ZK6 A;  5D75 A;  4DRN A;  1FKH A;  1P5Q A;  4FN2 A;  1JNS A;  2FAP A;  4DRM A;  1EYM A;  2LPV A;  4TW6 A;  1FKS A; 
#chains in the Genus database with same CATH topology
 4IQC A;  1TCO C;  2XP8 A;  4Q22 A;  2DPE A;  2OFN A;  4DRO A;  1NMV A;  1W1Y A;  4MGV A;  3RGC A;  1X6N A;  4MPK A;  4W9Q A;  3BXW A;  3B7X A;  3ARV A;  3O5F A;  4QT3 A;  3TCZ A;  1R9H A;  3MDY B;  1GOI A;  1X6L A;  2DT0 A;  2QF8 A;  3CZ8 A;  5GPG A;  1D7H A;  4DT4 A;  5HUA A;  2FDM A;  1FKD A;  4DIP A;  4ODM A;  3UQI A;  4LAY A;  3JXV A;  2XPB A;  4TX0 A;  5DEZ A;  3TC5 A;  4MNL A;  3KAD A;  3O5M A;  4ODP A;  1LL4 A;  2ZQT A;  5DIV A;  3LUO A;  4DWS C;  2K8I A;  3G6L A;  1NWT A;  2UZ5 A;  5HKG A;  1J6Y A;  2KGJ A;  4AY1 A;  1E9L A;  4FAP A;  1LJY A;  1ZU8 A;  2D9F A;  4ODL A;  4P8W A;  4DWS D;  4DRJ A;  3CHF A;  4JFI A;  4U85 A;  1OGG A;  1HJX A;  4U84 A;  2FKE A;  3RM9 A;  4L72 B;  3PR9 A;  2ZR5 A;  2F23 A;  2ZQV A;  1QPL A;  2G8Z A;  5HBF A;  1K9T A;  1FKL A;  4DRP A;  3OA5 A;  1FJD A;  4P8V A;  3PRD A;  4DRH A;  4ZS6 A;  2F21 A;  4W9P A;  5JH8 A;  1FAP A;  1WAW A;  1IX5 A;  4Z2I A;  3KZ7 A;  3EY6 A;  5DIT A;  2A3C A;  2RUQ A;  2WK2 A;  2ZR4 A;  1F8A B;  3UI6 A;  3CH9 A;  2PI6 A;  4MAV A;  4IQ2 A;  1FKG A;  1HJV A;  4Z2K A;  3WQW A;  4QIB A;  4WJX A;  2LKN A;  3QOK A;  1Q6H A;  4DRN A;  1FKH A;  1P5Q A;  3WD1 A;  4DRM A;  4KR0 B;  1EHN A;  3AS3 A;  3CGN A;  1D7J A;  4HBO A;  4MSP A;  3O5K A;  4WKF A;  4ZPT R;  1HKK A;  4DRK A;  3B8S A;  4NSB A;  2XPA A;  2XP5 A;  5HW8 A;  1EIB A;  4ZPV R;  2O92 A;  5DO2 A;  2LGO A;  1XRV A;  1EQ3 A;  3FAP A;  1ROU A;  1LQ0 A;  2IF4 A;  1FKB A;  4R5E A;  4C02 B;  4XAK A;  3WD0 A;  2KO7 A;  2KI3 A;  3OOB A;  1H0G A;  1UR9 A;  3ARR A;  2DT1 A;  1J4I A;  2A3B A;  4DWS A;  1B6C A;  2XP9 A;  4WK9 A;  2KFW A;  3B9E A;  3O5P A;  4G50 A;  4TW8 A;  1CTN A;  1J4H A;  1F40 A;  4JYS A;  3GPK A;  4ML4 A;  2LJ4 A;  4ODK A;  2IUZ A;  3WL0 A;  2VCD A;  1FD9 A;  1FFR A;  3B9A A;  3PA7 A;  3O5I A;  4LAV A;  1M5Y A;  3ARO A;  2AOS A;  3UI5 A;  2B31 A;  2M08 A;  2MLZ A;  2PPO A;  1XHG A;  4DRI A;  3WD3 A;  3ART A;  5GQB A;  3GTY X;  3IKG A;  1OWQ A;  3TDB A;  3O5Q A;  1ZBW A;  2MLY A;  2RUC A;  2ITK A;  2G41 A;  1GPF A;  3AS2 A;  1HJW A;  3CHC A;  3FY1 A;  4MNK A;  1FKK A;  4ZPW R;  1FKR A;  1QPF A;  3AS0 A;  4JFL A;  4Z2J A;  1E44 A;  1FKF A;  1W1T A;  1Q1C A;  1U79 A;  1D7I A;  3WIJ A;  4GIV A;  3UQA A;  1ZCN A;  3AS1 A;  5HWB A;  2MF9 A;  3H9R B;  2DT3 A;  1EDQ A;  2F4E A;  2DSZ A;  1KT0 A;  2ETN A;  4LAX A;  4QT2 A;  1JNE A;  1JVW A;  2PV1 A;  3BMB A;  2DSW A;  4DZ3 A;  4ODR A;  1E6P A;  3NTP A;  4URI A;  5D75 A;  4O2T A;  3ARU A;  4FN2 A;  4Z2L A;  3EIP A;  1O6I A;  5HTG A;  3RFW A;  3WKZ A;  1SYT A;  2XP4 A;  4S3K A;  3KAG A;  1HXV A;  2Y78 A;  2PN0 A;  4NZC A;  1C9H A;  4L3N A;  4TYO A;  2MNT A;  3ODK A;  1T11 A;  1Q6U A;  2M2A A;  1HKM A;  1H0I A;  4U86 A;  2DSV A;  1GRJ A;  3UF8 A;  1OGB A;  1Q6I A;  1HKI A;  1VF8 A;  1QZ2 A;  2VN1 A;  1TFV A;  4TW7 A;  2ZR6 A;  1LG1 A;  2B5U B;  2DT2 A;  4ODO A;  5B8I C;  3KAC A;  5J6E A;  2M1I A;  1ZB5 A;  1JCH B;  5DIU A;  1E15 A;  1NH6 A;  4UDM A;  1KFW A;  3ARX A;  4Z2H A;  2RQS A;  4IPX A;  2Q5A A;  4GGQ A;  2N87 A;  4J4N A;  1NWR A;  4TNS A;  1A7X A;  1D6O A;  1W9V A;  4P8U A;  2DG3 A;  2A3E A;  2RUD A;  1JNT A;  4ODQ A;  4WKA A;  5HWC A;  2XP6 A;  4NNR A;  3ARW A;  1SR0 A;  3O5R A;  4HBE A;  2P4V A;  1NWU A;  4W9O A;  3UQB A;  1PIN A;  3KAB A;  3JYM A;  1YAT A;  1N1A A;  5BXJ A;  2DG4 A;  4JFK A;  2YBU A;  3WH0 A;  3WD2 A;  4LGX A;  3O5E A;  1NMW A;  5HW6 A;  2XP3 A;  5DF0 A;  1LG2 A;  3NI6 A;  2ESC A;  1W1V A;  3WD4 A;  2DSU A;  3WQV A;  2WM0 A;  4DH0 A;  4MNM A;  2ZQU A;  4W5U A;  4IT4 A;  4ITZ A;  3RM4 A;  3PRA A;  2MPH A;  1ZK6 A;  1ZBC A;  3W4R A;  1JNS A;  3WL1 A;  1E6N A;  1W9P A;  3CHE A;  1FKS A;  2PPP A;  4IT6 A;  1W1P A;  1WNO A;  3NRK A;  3O5D A;  2DG9 A;  3UI4 A;  3JYJ A;  4ODN A;  1W26 A;  5HT1 A;  3KAI A;  3VAW A;  1BL4 A;  2O9O A;  1KT1 A;  2OLH A;  4DZ2 A;  4Q7N A;  1WB0 A;  2F2D A;  2ZQS A;  1Y0O A;  3B9D A;  4PTM A;  1HKJ A;  4N19 A;  3O5G A;  2AWG A;  4S3J A;  1ITX A;  2KE0 A;  1FKI A;  1FFQ A;  1NWS A;  3AQU A;  2EUL A;  1ROT A;  4MNJ A;  2PV2 A;  3CGM A;  4WKH A;  5GPR A;  1PBK A;  3ARY A;  3KAF A;  1BKF A;  2KR7 A;  2RSE A;  3O5O A;  2PBC A;  3O5J A;  4JFM A;  1YW5 A;  2PV3 A;  1ZL1 A;  1LL7 A;  1UR8 A;  2WLY A;  2PPN A;  4JFJ A;  2JZV A;  1ZBK A;  1NSG A;  2WLZ A;  1E6R A;  4WIW A;  2YBT A;  3IK8 A;  3O5L A;  4LAW A;  3KAH A;  3G6M A;  4QZV B;  1J4R A;  4Z2G A;  1D2K A;  3ARZ A;  5I98 A;  3IHZ A;  2RUR A;  4KQZ A;  2L2S A;  1L1P A;  3ARS A;  4HAR A;  3CHD A;  2XP7 A;  3ALG A;  4BF8 A;  1GUV A;  4MTV A;  1FKT A;  1W9U A;  3I6C A;  3KCE A;  5HW7 A;  4P8X A;  1RD6 A;  1JND A;  3FXY A;  4J4O A;  3IKD A;  1FKJ A;  2MLX A;  4DRQ A;  4DWS B;  1LL6 A;  1ZBV A;  3GU0 A;  3RME A;  4R0X A;  4G2P A;  2A3A A;  3PRB A;  3RM8 A;  3ARP A;  3ARQ A;  2FAP A;  1EYM A;  1E6Z A;  2LPV A;  4TW6 A;  3ALF A; 
#chains in the Genus database with same CATH homology
 4IQC A;  1TCO C;  2XP8 A;  4Q22 A;  2DPE A;  2OFN A;  4DRO A;  1NMV A;  1W1Y A;  4MGV A;  3RGC A;  1X6N A;  4MPK A;  4W9Q A;  3BXW A;  3B7X A;  3ARV A;  3O5F A;  4QT3 A;  3TCZ A;  1R9H A;  3MDY B;  1GOI A;  1X6L A;  2DT0 A;  2QF8 A;  3CZ8 A;  5GPG A;  1D7H A;  4DT4 A;  5HUA A;  2FDM A;  1FKD A;  4DIP A;  4ODM A;  3UQI A;  4LAY A;  3JXV A;  2XPB A;  4TX0 A;  5DEZ A;  3TC5 A;  4MNL A;  3KAD A;  3O5M A;  4ODP A;  1LL4 A;  2ZQT A;  5DIV A;  3LUO A;  4DWS C;  2K8I A;  3G6L A;  1NWT A;  2UZ5 A;  5HKG A;  1J6Y A;  2KGJ A;  4AY1 A;  1E9L A;  4FAP A;  1LJY A;  1ZU8 A;  2D9F A;  4ODL A;  4P8W A;  4DWS D;  4DRJ A;  3CHF A;  4JFI A;  4U85 A;  1OGG A;  1HJX A;  4U84 A;  2FKE A;  3RM9 A;  4L72 B;  3PR9 A;  2ZQV A;  2ZR5 A;  1QPL A;  2G8Z A;  5HBF A;  1K9T A;  1FKL A;  4DRP A;  3OA5 A;  1FJD A;  4P8V A;  3PRD A;  4DRH A;  4ZS6 A;  2F21 A;  4W9P A;  5JH8 A;  1FAP A;  1WAW A;  1IX5 A;  4Z2I A;  3KZ7 A;  3EY6 A;  5DIT A;  2A3C A;  2RUQ A;  2WK2 A;  2ZR4 A;  1F8A B;  3UI6 A;  3CH9 A;  2PI6 A;  4MAV A;  4IQ2 A;  1FKG A;  1HJV A;  4Z2K A;  3WQW A;  4QIB A;  4WJX A;  2LKN A;  3QOK A;  1Q6H A;  4DRN A;  1FKH A;  1P5Q A;  3WD1 A;  4DRM A;  4KR0 B;  1EHN A;  3AS3 A;  3CGN A;  1D7J A;  4HBO A;  4MSP A;  3O5K A;  4WKF A;  4ZPT R;  1HKK A;  4DRK A;  3B8S A;  4NSB A;  2XPA A;  2XP5 A;  5HW8 A;  1EIB A;  4ZPV R;  2O92 A;  5DO2 A;  2LGO A;  1XRV A;  1EQ3 A;  3FAP A;  1ROU A;  1LQ0 A;  2IF4 A;  1FKB A;  4R5E A;  4C02 B;  4XAK A;  3WD0 A;  2KO7 A;  2KI3 A;  3OOB A;  1H0G A;  1UR9 A;  3ARR A;  2DT1 A;  1J4I A;  2A3B A;  4DWS A;  1B6C A;  2XP9 A;  4WK9 A;  2KFW A;  3B9E A;  3O5P A;  4G50 A;  4TW8 A;  1CTN A;  1J4H A;  1F40 A;  4JYS A;  3GPK A;  4ML4 A;  2LJ4 A;  4ODK A;  2IUZ A;  3WL0 A;  2VCD A;  1FD9 A;  1FFR A;  3B9A A;  3PA7 A;  3O5I A;  4LAV A;  1M5Y A;  3ARO A;  2AOS A;  3UI5 A;  2B31 A;  2M08 A;  2MLZ A;  2PPO A;  1XHG A;  4DRI A;  3WD3 A;  3ART A;  5GQB A;  3IKG A;  1OWQ A;  3TDB A;  3O5Q A;  1ZBW A;  2MLY A;  2RUC A;  2ITK A;  2G41 A;  1GPF A;  3AS2 A;  1HJW A;  3CHC A;  3FY1 A;  4MNK A;  1FKK A;  4ZPW R;  1FKR A;  1QPF A;  3AS0 A;  4JFL A;  4Z2J A;  1FKF A;  1W1T A;  1Q1C A;  1U79 A;  1D7I A;  3WIJ A;  4GIV A;  3UQA A;  1ZCN A;  3AS1 A;  5HWB A;  2MF9 A;  3H9R B;  2DT3 A;  1EDQ A;  2F4E A;  2DSZ A;  1KT0 A;  4LAX A;  4QT2 A;  1JNE A;  1JVW A;  2PV1 A;  2DSW A;  4DZ3 A;  4ODR A;  1E6P A;  3NTP A;  4URI A;  5D75 A;  4O2T A;  3ARU A;  4FN2 A;  4Z2L A;  1O6I A;  5HTG A;  3RFW A;  3WKZ A;  1SYT A;  2XP4 A;  4S3K A;  3KAG A;  1HXV A;  2Y78 A;  4NZC A;  1C9H A;  4L3N A;  4TYO A;  2MNT A;  3ODK A;  1T11 A;  1Q6U A;  2M2A A;  1HKM A;  1H0I A;  4U86 A;  2DSV A;  3UF8 A;  1OGB A;  1Q6I A;  1HKI A;  1VF8 A;  1QZ2 A;  2VN1 A;  1TFV A;  4TW7 A;  2ZR6 A;  1LG1 A;  2DT2 A;  4ODO A;  5B8I C;  3KAC A;  5J6E A;  2M1I A;  1ZB5 A;  5DIU A;  1E15 A;  1NH6 A;  1KFW A;  3ARX A;  4Z2H A;  2RQS A;  4IPX A;  2Q5A A;  4GGQ A;  2N87 A;  4J4N A;  1NWR A;  4TNS A;  1A7X A;  1D6O A;  1W9V A;  4P8U A;  2DG3 A;  2A3E A;  2RUD A;  1JNT A;  4ODQ A;  4WKA A;  5HWC A;  2XP6 A;  4NNR A;  3ARW A;  1SR0 A;  3O5R A;  4HBE A;  1NWU A;  4W9O A;  3UQB A;  1PIN A;  3KAB A;  3JYM A;  1YAT A;  1N1A A;  5BXJ A;  2DG4 A;  4JFK A;  2YBU A;  3WH0 A;  3WD2 A;  4LGX A;  3O5E A;  1NMW A;  5HW6 A;  2XP3 A;  5DF0 A;  1LG2 A;  3NI6 A;  2ESC A;  1W1V A;  3WD4 A;  2DSU A;  3WQV A;  2WM0 A;  4DH0 A;  4MNM A;  2ZQU A;  4W5U A;  4IT4 A;  4ITZ A;  3RM4 A;  3PRA A;  2MPH A;  1ZK6 A;  1ZBC A;  3W4R A;  1JNS A;  3WL1 A;  1E6N A;  1W9P A;  3CHE A;  1FKS A;  2PPP A;  4IT6 A;  1W1P A;  1WNO A;  3NRK A;  3O5D A;  2DG9 A;  3UI4 A;  3JYJ A;  4ODN A;  1W26 A;  5HT1 A;  3KAI A;  3VAW A;  1BL4 A;  2O9O A;  1KT1 A;  2OLH A;  4DZ2 A;  4Q7N A;  1WB0 A;  2F2D A;  2ZQS A;  1Y0O A;  3B9D A;  4PTM A;  1HKJ A;  4N19 A;  3O5G A;  2AWG A;  4S3J A;  1ITX A;  2KE0 A;  1FKI A;  1FFQ A;  1NWS A;  3AQU A;  1ROT A;  4MNJ A;  2PV2 A;  3CGM A;  4WKH A;  5GPR A;  1PBK A;  3ARY A;  3KAF A;  1BKF A;  2KR7 A;  2RSE A;  3O5O A;  2PBC A;  3O5J A;  4JFM A;  1YW5 A;  2PV3 A;  1ZL1 A;  1LL7 A;  1UR8 A;  2WLY A;  2PPN A;  4JFJ A;  2JZV A;  1ZBK A;  1NSG A;  2WLZ A;  1E6R A;  4WIW A;  2YBT A;  3IK8 A;  3O5L A;  4LAW A;  3KAH A;  3G6M A;  4QZV B;  1J4R A;  4Z2G A;  1D2K A;  3ARZ A;  5I98 A;  3IHZ A;  2RUR A;  4KQZ A;  2L2S A;  1L1P A;  3ARS A;  4HAR A;  3CHD A;  2XP7 A;  3ALG A;  4BF8 A;  1GUV A;  4MTV A;  1FKT A;  1W9U A;  3I6C A;  3KCE A;  5HW7 A;  4P8X A;  1RD6 A;  1JND A;  3FXY A;  4J4O A;  3IKD A;  1FKJ A;  2MLX A;  4DRQ A;  4DWS B;  1LL6 A;  1ZBV A;  3RME A;  4R0X A;  4G2P A;  2A3A A;  3PRB A;  3RM8 A;  3ARP A;  3ARQ A;  2FAP A;  1EYM A;  1E6Z A;  2LPV A;  4TW6 A;  3ALF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...