5HUAA

Structure of c. glabrata fkbp12-fk506 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'SETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
total genus 27
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5huaA00
3TC5A 4ODRA 2ZQUA 2PPPA 2MLYA 2LKNA 4TX0A 4DRNA 2F21A 4JYSA 2AWGA 5B8IC 3O5DA 2ZQTA 5HT1A 5HKGA 4DZ3A 3O5MA 3NTPA 4ODMA 3UQAA 2IF4A 4J4OA 1FKTA 4JFIA 1Y0OA 1FKBA 1EQ3A 2M2AA 2ZR4A 4DRQA 2K8IA 1YW5A 1T11A 2JZVA 4DH0A 2PV1A 1TCOC 1D7HA 2LJ4A 2MPHA 2VN1A 3CGMA 4FN2A 2Q5AA 3KCEA 4G2PA 5HTGA 3PRDA 4LAWA 4TYOA 4MSPA 5J6EA 3KAIA 4ITZA 3UI6A 1ROTA 2RUDA 1D6OA 4IQCA 1BL4A 3IKDA 3KABA 1FAPA 3RFWA 5HW6A 4JFKA 2RUCA 2RUQA 4JFLA 2PPOA 3RGCA 3EY6A 3PA7A 2LPVA 4DROA 4DRHA 2KI3A 3JXVA 4ODNA 2FKEA 2XP7A 1L1PA 2N87A 2XPBA 4QT3A 4GGQA 1P5QA 5BXJA 4DZ2A 2ZR6A 3B7XA 2F2DA 5DITA 2M1IA 3O5FA 1Q1CA 3KAFA 3NRKA 2UZ5A 2Y78A 4G50A 1J4IA 1Q6IA 2KE0A 4W9QA 1D7IA 2KFWA 5DIVA 3O5IA 1PBKA 1JNSA 2XP9A 3UI4A 2VCDA 2XP8A 1C9HA 2XP6A 2ZR5A 4ODQA 1FKGA 3IHZA 3KAHA 3KZ7A 3NI6A 4ODKA 3WH0A 1F8AB 3KACA 3O5JA 1B6CA 1A7XA 4IQ2A 2KO7A 3KADA 4DRJA 3MDYB 3FAPA 3O5OA 4N19A 4TNSA 1NSGA 2F4EA 1BKFA 3O5GA 4J4NA 4O2TA 1FKIA 2MNTA 1J6YA 2RURA 2DG9A 3O5LA 4GIVA 4JFMA 4LAXA 3GPKA 4TW6A 2OFNA 3JYMA 2DG4A 3UI5A 1QPFA 4DIPA 1FKHA 1FKSA 4ODLA 4BF8A 4DRIA 1FJDA 3O5QA 1W26A 3O5RA 2ZQSA 1Q6UA 1R9HA 5HW7A 2M08A 1NMWA 3I6CA 1U79A 2KGJA 2XP5A 1FKDA 2XPAA 4IPXA 3UQIA 1M5YA 3O5PA 4DT4A 3CGNA 2XP4A 4NNRA 5HUAA 3PRBA 1FKLA 4U86A 1ZK6A 1ZCNA 3ODKA 1JNTA 4JFJA 2DG3A 4LAYA 2D9FA 3KAGA 1J4HA 1N1AA 3O5EA 4ODPA 3LUOA 2ZQVA 2RSEA 4LAVA 2FAPA 4QIBA 2RQSA 1NMVA 1Q6HA 2PV2A 1KT1A 5HWCA 1D7JA 4DRKA 1FKRA 4DRMA 1FKKA 1FD9A 4QT2A 2PPNA 1ROUA 2XP3A 5HWBA 3UQBA 2PV3A 1J4RA 1KT0A 1YATA 4U85A 2MF9A 1HXVA 4TW8A 4U84A 4MGVA 1FKFA 3VAWA 2MLXA 2L2SA 4FAPA 3O5KA 1FKJA 3OOBA 4R0XA 1JVWA 1QZ2A 2KR7A 2PBCA 3H9RB 3IK8A 1EYMA 4TW7A 4DRPA 1QPLA 1F40A 3TCZA 2ITKA 3UF8A 4C02B 5I98A 3TDBA 2LGOA 3IKGA 4ODOA 2MLZA 5D75A 4W9OA 5GPGA 5DIUA 5HW8A 4W9PA 3JYJA 1PINA
chains in the Genus database with same CATH superfamily
5HBFA 3TC5A 3ARWA 2PPPA 1ZB5A 4Q7NA 4TX0A 3WD2A 1SR0A 3BXWA 2ZQTA 4DZ3A 1E6RA 4DWSC 1RD6A 1HKMA 1FKBA 2M2AA 2ZR4A 3B9DA 4S3KA 1E6ZA 2K8IA 1YW5A 1T11A 3CHEA 4KR0B 4HBEA 5GPRA 1E6PA 3CHCA 2Q5AA 1WB0A 3UI6A 3AS2A 2RUDA 2DT2A 4HBOA 2DSUA 1FAPA 4KQZA 4JFKA 3PRAA 2RUQA 4JFLA 2A3CA 3EY6A 3PA7A 2FKEA 2N87A 1P5QA 2DT3A 2G8ZA 1SYTA 2ZR6A 2F2DA 1W9VA 3NRKA 3GU0A 1EDQA 4ZPTR 2KFWA 3O5IA 1PBKA 1ZBKA 2XP8A 4QZVB 4HARA 3KAHA 3IHZA 4Z2GA 3WH0A 3KACA 3O5JA 1B6CA 1A7XA 4IQ2A 2KO7A 3MDYB 3FAPA 3O5OA 2DSVA 4ZPWR 1W1PA 2F4EA 4J4NA 2MNTA 4WIWA 4GIVA 4TW6A 4L72B 3GPKA 2OFNA 4MNKA 2DG4A 4DRIA 1QPFA 3WKZA 1W26A 2ZQSA 1Q6UA 4URIA 1HJXA 2KGJA 4IPXA 3G6MA 4DT4A 3ARRA 4Z2KA 1E15A 1JNTA 1HKIA 5JH8A 2RQSA 1NMVA 2PI6A 2PV2A 4DRKA 4DRMA 1ZBCA 1FD9A 1J4RA 2PN0A 2MF9A 4MGVA 2MLXA 2B5UB 3O5KA 1FKJA 1QZ2A 2PBCA 3ARTA 1QPLA 1JCHB 3ARUA 1X6LA 2LGOA 5D75A 1LQ0A 1O6IA 4NZCA 2MLYA 3WQVA 2F21A 3CHFA 2AWGA 3AQUA 3O5DA 3O5MA 3RM4A 4MAVA 2A3EA 4ODMA 2DSWA 5DF0A 1FKTA 1JNEA 1ZU8A 3W4RA 3B8SA 4IT4A 2JZVA 4DH0A 2PV1A 1IX5A 1D7HA 2MPHA 2VN1A 3CH9A 3KCEA 4WKHA 2OLHA 4TYOA 4MSPA 3G6LA 5J6EA 2IUZA 1ROTA 1BL4A 3IKDA 4P8WA 4Z2JA 1LG1A 5HW6A 2PPOA 2LPVA 3JXVA 2XPBA 3ARQA 3FY1A 3ARPA 1TFVA 5DITA 3O5FA 3KAFA 3WD0A 3ARVA 1Q6IA 1NWTA 4W9QA 1OGBA 4ZS6A 2ZR5A 3CZ8A 1FKGA 4P8VA 1WAWA 1NWSA 1LL4A 4DRJA 1UR9A 4WKFA 4TNSA 1NSGA 4WJXA 4O2TA 2RURA 1E9LA 2YBTA 1JNSA 3UI5A 4DIPA 1FJDA 4ODLA 4BF8A 3O5QA 5HW7A 4LGXA 1NMWA 2XP5A 1FKDA 3CGNA 3RM9A 2EULA 4NNRA 2A3BA 3PRBA 3WL0A 1ZCNA 3ODKA 3ALGA 3WD3A 4LAYA 4ODPA 3O5EA 1ZBVA 3LUOA 4LAVA 2RSEA 4QIBA 2ETNA 3WIJA 3FXYA 3AS1A 4R5EA 1FKRA 1FKKA 2PPNA 1ROUA 2XP3A 3UQBA 1YATA 1HXVA 4U84A 2L2SA 4FAPA 4R0XA 3WD4A 1HKKA 4Q22A 3IK8A 1EYMA 1F40A 1HKJA 2ITKA 3UF8A 5I98A 4ODOA 3IKGA 1LJYA 4W9OA 1H0IA 5HW8A 3B9AA 4W9PA 1PINA 1W1TA 4ODRA 2LKNA 4DRNA 5B8IC 3NTPA 3UQAA 4J4OA 4W5UA 1Y0OA 1EQ3A 1TCOC 1LG2A 2LJ4A 2DSZA 4G2PA 5HTGA 1D2KA 1UR8A 1HJWA 2G41A 3PRDA 4ITZA 1E6NA 1D6OA 3WQWA 1NWUA 3KABA 4P8UA 1EHNA 3RFWA 4ZPVR 4DROA 4DRHA 4ODNA 2XP7A 3ALFA 4DZ2A 3AS0A 1WNOA 2M1IA 1GPFA 2DPEA 2UZ5A 2QF8A 4G50A 2KE0A 3EIPA 3RM8A 2XP9A 3UI4A 4WK9A 4ODQA 3KZ7A 4MNMA 1F8AB 1NWRA 3ARZA 3KADA 1ITXA 3CHDA 1W9UA 1BKFA 3O5GA 1OGGA 4ML4A 1J6YA 4UDMA 1HJVA 2DG9A 1FFQA 4LAXA 1L1PA 3JYMA 1XHGA 1FKHA 3O5RA 3AS3A 1U79A 4MNLA 3UQIA 5HUAA 1X6NA 4Z2IA 1FKLA 4JFJA 1K9TA 2ZQVA 2WLYA 2FAPA 5DEZA 2AOSA 1Q6HA 1W9PA 3WL1A 5HWCA 1D7JA 1FFRA 4QT2A 3ARSA 5HWBA 2PV3A 4U85A 4TW8A 3VAWA 1FKFA 2WK2A 3OOBA 2ESCA 1JVWA 4TW7A 3GTYX 4DRPA 3WD1A 3TCZA 4C02B 1NH6A 3TDBA 2MLZA 4Z2LA 5GPGA 3JYJA 4L3NA 2DT1A 4P8XA 2ZQUA 4JYSA 5HT1A 5HKGA 2A3AA 2IF4A 4S3JA 4JFIA 4IT6A 4AY1A 4DRQA 3ARYA 2FDMA 3CGMA 4FN2A 4LAWA 4MTVA 2P4VA 3KAIA 1E44A 4XAKA 4IQCA 1KFWA 2RUCA 1OWQA 4DWSD 3RGCA 2KI3A 1VF8A 4QT3A 4GGQA 5BXJA 3B7XA 1EIBA 1Q1CA 2Y78A 1ZBWA 1J4IA 1D7IA 1W1VA 5DIVA 1JNDA 2YBUA 4PTMA 1GRJA 2VCDA 1C9HA 2XP6A 3NI6A 3RMEA 4ODKA 1XRVA 4N19A 1FKIA 4DWSB 3O5LA 4JFMA 5DO2A 1FKSA 3BMBA 1R9HA 2M08A 3B9EA 3I6CA 3ARXA 2XPAA 3OA5A 1M5YA 3O5PA 1ZL1A 2XP4A 4MNJA 4U86A 1ZK6A 4WKAA 2B31A 2DG3A 2D9FA 3KAGA 1H0GA 1N1AA 1J4HA 1LL6A 1GUVA 1KT1A 3AROA 2O9OA 4NSBA 1KT0A 1CTNA 1GOIA 3QOKA 4MPKA 3H9RB 2KR7A 1LL7A 2DT0A 5GQBA 4DWSA 4Z2HA 2F23A 2O92A 2WM0A 2WLZA 5DIUA 1W1YA 3PR9A
chains in the Genus database with same CATH topology
5HBFA 3TC5A 3ARWA 2PPPA 1ZB5A 4Q7NA 4TX0A 3WD2A 1SR0A 3BXWA 2ZQTA 4DZ3A 1E6RA 4DWSC 1RD6A 1HKMA 1FKBA 2M2AA 2ZR4A 3B9DA 4S3KA 1E6ZA 2K8IA 1YW5A 1T11A 3CHEA 4KR0B 4HBEA 5GPRA 1E6PA 3CHCA 2Q5AA 1WB0A 3UI6A 3AS2A 2RUDA 2DT2A 4HBOA 2DSUA 1FAPA 4KQZA 4JFKA 3PRAA 2RUQA 4JFLA 2A3CA 3EY6A 3PA7A 2FKEA 2N87A 1P5QA 2DT3A 2G8ZA 1SYTA 2ZR6A 2F2DA 1W9VA 3NRKA 1EDQA 4ZPTR 2KFWA 3O5IA 1PBKA 1ZBKA 2XP8A 4QZVB 4HARA 3KAHA 3IHZA 4Z2GA 3WH0A 3KACA 3O5JA 1B6CA 1A7XA 4IQ2A 2KO7A 3MDYB 3FAPA 3O5OA 2DSVA 4ZPWR 1W1PA 2F4EA 4J4NA 2MNTA 4WIWA 4GIVA 4TW6A 4L72B 3GPKA 2OFNA 4MNKA 2DG4A 4DRIA 1QPFA 3WKZA 1W26A 2ZQSA 1Q6UA 4URIA 1HJXA 2KGJA 4IPXA 3G6MA 4DT4A 3ARRA 4Z2KA 1E15A 1JNTA 1HKIA 5JH8A 2RQSA 1NMVA 2PI6A 2PV2A 4DRKA 4DRMA 1ZBCA 1FD9A 1J4RA 2MF9A 4MGVA 2MLXA 3O5KA 1FKJA 1QZ2A 2PBCA 3ARTA 1QPLA 3ARUA 1X6LA 2LGOA 5D75A 1LQ0A 1O6IA 4NZCA 2MLYA 3WQVA 2F21A 3CHFA 2AWGA 3AQUA 3O5DA 3O5MA 3RM4A 4MAVA 2A3EA 4ODMA 2DSWA 5DF0A 1FKTA 1JNEA 1ZU8A 3W4RA 3B8SA 4IT4A 2JZVA 4DH0A 2PV1A 1IX5A 1D7HA 2MPHA 2VN1A 3CH9A 3KCEA 4WKHA 2OLHA 4TYOA 4MSPA 3G6LA 5J6EA 2IUZA 1ROTA 1BL4A 3IKDA 4P8WA 4Z2JA 1LG1A 5HW6A 2PPOA 2LPVA 3JXVA 2XPBA 3ARQA 3FY1A 3ARPA 1TFVA 5DITA 3O5FA 3KAFA 3WD0A 3ARVA 1Q6IA 1NWTA 4W9QA 1OGBA 4ZS6A 2ZR5A 3CZ8A 1FKGA 4P8VA 1WAWA 1NWSA 1LL4A 4DRJA 1UR9A 4WKFA 4TNSA 1NSGA 4WJXA 4O2TA 2RURA 1E9LA 2YBTA 1JNSA 3UI5A 4DIPA 1FJDA 4ODLA 4BF8A 3O5QA 5HW7A 4LGXA 1NMWA 2XP5A 1FKDA 3CGNA 3RM9A 4NNRA 2A3BA 3PRBA 3WL0A 1ZCNA 3ODKA 3ALGA 3WD3A 4LAYA 4ODPA 3O5EA 1ZBVA 3LUOA 4LAVA 2RSEA 4QIBA 3WIJA 3FXYA 3AS1A 4R5EA 1FKRA 1FKKA 2PPNA 1ROUA 2XP3A 3UQBA 1YATA 1HXVA 4U84A 2L2SA 4FAPA 4R0XA 3WD4A 1HKKA 4Q22A 3IK8A 1EYMA 1F40A 1HKJA 2ITKA 3UF8A 5I98A 4ODOA 3IKGA 1LJYA 4W9OA 1H0IA 5HW8A 3B9AA 4W9PA 1PINA 1W1TA 4ODRA 2LKNA 4DRNA 5B8IC 3NTPA 3UQAA 4J4OA 4W5UA 1Y0OA 1EQ3A 1TCOC 1LG2A 2LJ4A 2DSZA 4G2PA 5HTGA 1D2KA 1UR8A 1HJWA 2G41A 3PRDA 4ITZA 1E6NA 1D6OA 3WQWA 1NWUA 3KABA 4P8UA 1EHNA 3RFWA 4ZPVR 4DROA 4DRHA 4ODNA 2XP7A 3ALFA 4DZ2A 3AS0A 1WNOA 2M1IA 1GPFA 2DPEA 2UZ5A 2QF8A 4G50A 2KE0A 3RM8A 2XP9A 3UI4A 4WK9A 4ODQA 3KZ7A 4MNMA 1F8AB 1NWRA 3ARZA 3KADA 1ITXA 3CHDA 1W9UA 1BKFA 3O5GA 1OGGA 4ML4A 1J6YA 1HJVA 2DG9A 1FFQA 4LAXA 1L1PA 3JYMA 1XHGA 1FKHA 3O5RA 3AS3A 1U79A 4MNLA 3UQIA 5HUAA 1X6NA 4Z2IA 1FKLA 4JFJA 1K9TA 2ZQVA 2WLYA 2FAPA 5DEZA 2AOSA 1Q6HA 1W9PA 3WL1A 5HWCA 1D7JA 1FFRA 4QT2A 3ARSA 5HWBA 2PV3A 4U85A 4TW8A 3VAWA 1FKFA 2WK2A 3OOBA 2ESCA 1JVWA 4TW7A 4DRPA 3WD1A 3TCZA 4C02B 1NH6A 3TDBA 2MLZA 4Z2LA 5GPGA 3JYJA 4L3NA 2DT1A 4P8XA 2ZQUA 4JYSA 5HT1A 5HKGA 2A3AA 2IF4A 4S3JA 4JFIA 4IT6A 4AY1A 4DRQA 3ARYA 2FDMA 3CGMA 4FN2A 4LAWA 4MTVA 3KAIA 4XAKA 4IQCA 1KFWA 2RUCA 1OWQA 4DWSD 3RGCA 2KI3A 1VF8A 4QT3A 4GGQA 5BXJA 3B7XA 1EIBA 1Q1CA 2Y78A 1ZBWA 1J4IA 1D7IA 1W1VA 5DIVA 1JNDA 2YBUA 4PTMA 2VCDA 1C9HA 2XP6A 3NI6A 3RMEA 4ODKA 1XRVA 4N19A 1FKIA 4DWSB 3O5LA 4JFMA 5DO2A 1FKSA 1R9HA 2M08A 3B9EA 3I6CA 3ARXA 2XPAA 3OA5A 1M5YA 3O5PA 1ZL1A 2XP4A 4MNJA 4U86A 1ZK6A 4WKAA 2B31A 2DG3A 2D9FA 3KAGA 1H0GA 1N1AA 1J4HA 1LL6A 1GUVA 1KT1A 3AROA 2O9OA 4NSBA 1KT0A 1CTNA 1GOIA 3QOKA 4MPKA 3H9RB 2KR7A 1LL7A 2DT0A 5GQBA 4DWSA 4Z2HA 2O92A 2WM0A 2WLZA 5DIUA 1W1YA 3PR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC5 A;  4ODR A;  2ZQU A;  2PPP A;  2MLY A;  2LKN A;  4TX0 A;  4DRN A;  2F21 A;  4JYS A;  2AWG A;  5B8I C;  3O5D A;  2ZQT A;  5HT1 A;  5HKG A;  4DZ3 A;  3O5M A;  3NTP A;  4ODM A;  3UQA A;  2IF4 A;  4J4O A;  1FKT A;  4JFI A;  1Y0O A;  1FKB A;  1EQ3 A;  2M2A A;  2ZR4 A;  4DRQ A;  2K8I A;  1YW5 A;  1T11 A;  2JZV A;  4DH0 A;  2PV1 A;  1TCO C;  1D7H A;  2LJ4 A;  2MPH A;  2VN1 A;  3CGM A;  4FN2 A;  2Q5A A;  3KCE A;  4G2P A;  5HTG A;  3PRD A;  4LAW A;  4TYO A;  4MSP A;  5J6E A;  3KAI A;  4ITZ A;  3UI6 A;  1ROT A;  2RUD A;  1D6O A;  4IQC A;  1BL4 A;  3IKD A;  3KAB A;  1FAP A;  3RFW A;  5HW6 A;  4JFK A;  2RUC A;  2RUQ A;  4JFL A;  2PPO A;  3RGC A;  3EY6 A;  3PA7 A;  2LPV A;  4DRO A;  4DRH A;  2KI3 A;  3JXV A;  4ODN A;  2FKE A;  2XP7 A;  1L1P A;  2N87 A;  2XPB A;  4QT3 A;  4GGQ A;  1P5Q A;  5BXJ A;  4DZ2 A;  2ZR6 A;  3B7X A;  2F2D A;  5DIT A;  2M1I A;  3O5F A;  1Q1C A;  3KAF A;  3NRK A;  2UZ5 A;  2Y78 A;  4G50 A;  1J4I A;  1Q6I A;  2KE0 A;  4W9Q A;  1D7I A;  2KFW A;  5DIV A;  3O5I A;  1PBK A;  1JNS A;  2XP9 A;  3UI4 A;  2VCD A;  2XP8 A;  1C9H A;  2XP6 A;  2ZR5 A;  4ODQ A;  1FKG A;  3IHZ A;  3KAH A;  3KZ7 A;  3NI6 A;  4ODK A;  3WH0 A;  1F8A B;  3KAC A;  3O5J A;  1B6C A;  1A7X A;  4IQ2 A;  2KO7 A;  3KAD A;  4DRJ A;  3MDY B;  3FAP A;  3O5O A;  4N19 A;  4TNS A;  1NSG A;  2F4E A;  1BKF A;  3O5G A;  4J4N A;  4O2T A;  1FKI A;  2MNT A;  1J6Y A;  2RUR A;  2DG9 A;  3O5L A;  4GIV A;  4JFM A;  4LAX A;  3GPK A;  4TW6 A;  2OFN A;  3JYM A;  2DG4 A;  3UI5 A;  1QPF A;  4DIP A;  1FKH A;  1FKS A;  4ODL A;  4BF8 A;  4DRI A;  1FJD A;  3O5Q A;  1W26 A;  3O5R A;  2ZQS A;  1Q6U A;  1R9H A;  5HW7 A;  2M08 A;  1NMW A;  3I6C A;  1U79 A;  2KGJ A;  2XP5 A;  1FKD A;  2XPA A;  4IPX A;  3UQI A;  1M5Y A;  3O5P A;  4DT4 A;  3CGN A;  2XP4 A;  4NNR A;  5HUA A;  3PRB A;  1FKL A;  4U86 A;  1ZK6 A;  1ZCN A;  3ODK A;  1JNT A;  4JFJ A;  2DG3 A;  4LAY A;  2D9F A;  3KAG A;  1J4H A;  1N1A A;  3O5E A;  4ODP A;  3LUO A;  2ZQV A;  2RSE A;  4LAV A;  2FAP A;  4QIB A;  2RQS A;  1NMV A;  1Q6H A;  2PV2 A;  1KT1 A;  5HWC A;  1D7J A;  4DRK A;  1FKR A;  4DRM A;  1FKK A;  1FD9 A;  4QT2 A;  2PPN A;  1ROU A;  2XP3 A;  5HWB A;  3UQB A;  2PV3 A;  1J4R A;  1KT0 A;  1YAT A;  4U85 A;  2MF9 A;  1HXV A;  4TW8 A;  4U84 A;  4MGV A;  1FKF A;  3VAW A;  2MLX A;  2L2S A;  4FAP A;  3O5K A;  1FKJ A;  3OOB A;  4R0X A;  1JVW A;  1QZ2 A;  2KR7 A;  2PBC A;  3H9R B;  3IK8 A;  1EYM A;  4TW7 A;  4DRP A;  1QPL A;  1F40 A;  3TCZ A;  2ITK A;  3UF8 A;  4C02 B;  5I98 A;  3TDB A;  2LGO A;  3IKG A;  4ODO A;  2MLZ A;  5D75 A;  4W9O A;  5GPG A;  5DIU A;  5HW8 A;  4W9P A;  3JYJ A;  1PIN A; 
#chains in the Genus database with same CATH topology
 5HBF A;  3TC5 A;  3ARW A;  2PPP A;  1ZB5 A;  4Q7N A;  4TX0 A;  3WD2 A;  1SR0 A;  3BXW A;  2ZQT A;  4DZ3 A;  1E6R A;  4DWS C;  1RD6 A;  1HKM A;  1FKB A;  2M2A A;  2ZR4 A;  3B9D A;  4S3K A;  1E6Z A;  2K8I A;  1YW5 A;  1T11 A;  3CHE A;  4KR0 B;  4HBE A;  5GPR A;  1E6P A;  3CHC A;  2Q5A A;  1WB0 A;  3UI6 A;  3AS2 A;  2RUD A;  2DT2 A;  4HBO A;  2DSU A;  1FAP A;  4KQZ A;  4JFK A;  3PRA A;  2RUQ A;  4JFL A;  2A3C A;  3EY6 A;  3PA7 A;  2FKE A;  2N87 A;  1P5Q A;  2DT3 A;  2G8Z A;  1SYT A;  2ZR6 A;  2F2D A;  1W9V A;  3NRK A;  3GU0 A;  1EDQ A;  4ZPT R;  2KFW A;  3O5I A;  1PBK A;  1ZBK A;  2XP8 A;  4QZV B;  4HAR A;  3KAH A;  3IHZ A;  4Z2G A;  3WH0 A;  3KAC A;  3O5J A;  1B6C A;  1A7X A;  4IQ2 A;  2KO7 A;  3MDY B;  3FAP A;  3O5O A;  2DSV A;  4ZPW R;  1W1P A;  2F4E A;  4J4N A;  2MNT A;  4WIW A;  4GIV A;  4TW6 A;  4L72 B;  3GPK A;  2OFN A;  4MNK A;  2DG4 A;  4DRI A;  1QPF A;  3WKZ A;  1W26 A;  2ZQS A;  1Q6U A;  4URI A;  1HJX A;  2KGJ A;  4IPX A;  3G6M A;  4DT4 A;  3ARR A;  4Z2K A;  1E15 A;  1JNT A;  1HKI A;  5JH8 A;  2RQS A;  1NMV A;  2PI6 A;  2PV2 A;  4DRK A;  4DRM A;  1ZBC A;  1FD9 A;  1J4R A;  2PN0 A;  2MF9 A;  4MGV A;  2MLX A;  2B5U B;  3O5K A;  1FKJ A;  1QZ2 A;  2PBC A;  3ART A;  1QPL A;  1JCH B;  3ARU A;  1X6L A;  2LGO A;  5D75 A;  1LQ0 A;  1O6I A;  4NZC A;  2MLY A;  3WQV A;  2F21 A;  3CHF A;  2AWG A;  3AQU A;  3O5D A;  3O5M A;  3RM4 A;  4MAV A;  2A3E A;  4ODM A;  2DSW A;  5DF0 A;  1FKT A;  1JNE A;  1ZU8 A;  3W4R A;  3B8S A;  4IT4 A;  2JZV A;  4DH0 A;  2PV1 A;  1IX5 A;  1D7H A;  2MPH A;  2VN1 A;  3CH9 A;  3KCE A;  4WKH A;  2OLH A;  4TYO A;  4MSP A;  3G6L A;  5J6E A;  2IUZ A;  1ROT A;  1BL4 A;  3IKD A;  4P8W A;  4Z2J A;  1LG1 A;  5HW6 A;  2PPO A;  2LPV A;  3JXV A;  2XPB A;  3ARQ A;  3FY1 A;  3ARP A;  1TFV A;  5DIT A;  3O5F A;  3KAF A;  3WD0 A;  3ARV A;  1Q6I A;  1NWT A;  4W9Q A;  1OGB A;  4ZS6 A;  2ZR5 A;  3CZ8 A;  1FKG A;  4P8V A;  1WAW A;  1NWS A;  1LL4 A;  4DRJ A;  1UR9 A;  4WKF A;  4TNS A;  1NSG A;  4WJX A;  4O2T A;  2RUR A;  1E9L A;  2YBT A;  1JNS A;  3UI5 A;  4DIP A;  1FJD A;  4ODL A;  4BF8 A;  3O5Q A;  5HW7 A;  4LGX A;  1NMW A;  2XP5 A;  1FKD A;  3CGN A;  3RM9 A;  2EUL A;  4NNR A;  2A3B A;  3PRB A;  3WL0 A;  1ZCN A;  3ODK A;  3ALG A;  3WD3 A;  4LAY A;  4ODP A;  3O5E A;  1ZBV A;  3LUO A;  4LAV A;  2RSE A;  4QIB A;  2ETN A;  3WIJ A;  3FXY A;  3AS1 A;  4R5E A;  1FKR A;  1FKK A;  2PPN A;  1ROU A;  2XP3 A;  3UQB A;  1YAT A;  1HXV A;  4U84 A;  2L2S A;  4FAP A;  4R0X A;  3WD4 A;  1HKK A;  4Q22 A;  3IK8 A;  1EYM A;  1F40 A;  1HKJ A;  2ITK A;  3UF8 A;  5I98 A;  4ODO A;  3IKG A;  1LJY A;  4W9O A;  1H0I A;  5HW8 A;  3B9A A;  4W9P A;  1PIN A;  1W1T A;  4ODR A;  2LKN A;  4DRN A;  5B8I C;  3NTP A;  3UQA A;  4J4O A;  4W5U A;  1Y0O A;  1EQ3 A;  1TCO C;  1LG2 A;  2LJ4 A;  2DSZ A;  4G2P A;  5HTG A;  1D2K A;  1UR8 A;  1HJW A;  2G41 A;  3PRD A;  4ITZ A;  1E6N A;  1D6O A;  3WQW A;  1NWU A;  3KAB A;  4P8U A;  1EHN A;  3RFW A;  4ZPV R;  4DRO A;  4DRH A;  4ODN A;  2XP7 A;  3ALF A;  4DZ2 A;  3AS0 A;  1WNO A;  2M1I A;  1GPF A;  2DPE A;  2UZ5 A;  2QF8 A;  4G50 A;  2KE0 A;  3EIP A;  3RM8 A;  2XP9 A;  3UI4 A;  4WK9 A;  4ODQ A;  3KZ7 A;  4MNM A;  1F8A B;  1NWR A;  3ARZ A;  3KAD A;  1ITX A;  3CHD A;  1W9U A;  1BKF A;  3O5G A;  1OGG A;  4ML4 A;  1J6Y A;  4UDM A;  1HJV A;  2DG9 A;  1FFQ A;  4LAX A;  1L1P A;  3JYM A;  1XHG A;  1FKH A;  3O5R A;  3AS3 A;  1U79 A;  4MNL A;  3UQI A;  5HUA A;  1X6N A;  4Z2I A;  1FKL A;  4JFJ A;  1K9T A;  2ZQV A;  2WLY A;  2FAP A;  5DEZ A;  2AOS A;  1Q6H A;  1W9P A;  3WL1 A;  5HWC A;  1D7J A;  1FFR A;  4QT2 A;  3ARS A;  5HWB A;  2PV3 A;  4U85 A;  4TW8 A;  3VAW A;  1FKF A;  2WK2 A;  3OOB A;  2ESC A;  1JVW A;  4TW7 A;  3GTY X;  4DRP A;  3WD1 A;  3TCZ A;  4C02 B;  1NH6 A;  3TDB A;  2MLZ A;  4Z2L A;  5GPG A;  3JYJ A;  4L3N A;  2DT1 A;  4P8X A;  2ZQU A;  4JYS A;  5HT1 A;  5HKG A;  2A3A A;  2IF4 A;  4S3J A;  4JFI A;  4IT6 A;  4AY1 A;  4DRQ A;  3ARY A;  2FDM A;  3CGM A;  4FN2 A;  4LAW A;  4MTV A;  2P4V A;  3KAI A;  1E44 A;  4XAK A;  4IQC A;  1KFW A;  2RUC A;  1OWQ A;  4DWS D;  3RGC A;  2KI3 A;  1VF8 A;  4QT3 A;  4GGQ A;  5BXJ A;  3B7X A;  1EIB A;  1Q1C A;  2Y78 A;  1ZBW A;  1J4I A;  1D7I A;  1W1V A;  5DIV A;  1JND A;  2YBU A;  4PTM A;  1GRJ A;  2VCD A;  1C9H A;  2XP6 A;  3NI6 A;  3RME A;  4ODK A;  1XRV A;  4N19 A;  1FKI A;  4DWS B;  3O5L A;  4JFM A;  5DO2 A;  1FKS A;  3BMB A;  1R9H A;  2M08 A;  3B9E A;  3I6C A;  3ARX A;  2XPA A;  3OA5 A;  1M5Y A;  3O5P A;  1ZL1 A;  2XP4 A;  4MNJ A;  4U86 A;  1ZK6 A;  4WKA A;  2B31 A;  2DG3 A;  2D9F A;  3KAG A;  1H0G A;  1N1A A;  1J4H A;  1LL6 A;  1GUV A;  1KT1 A;  3ARO A;  2O9O A;  4NSB A;  1KT0 A;  1CTN A;  1GOI A;  3QOK A;  4MPK A;  3H9R B;  2KR7 A;  1LL7 A;  2DT0 A;  5GQB A;  4DWS A;  4Z2H A;  2F23 A;  2O92 A;  2WM0 A;  2WLZ A;  5DIU A;  1W1Y A;  3PR9 A; 
#chains in the Genus database with same CATH homology
 5HBF A;  3TC5 A;  3ARW A;  2PPP A;  1ZB5 A;  4Q7N A;  4TX0 A;  3WD2 A;  1SR0 A;  3BXW A;  2ZQT A;  4DZ3 A;  1E6R A;  4DWS C;  1RD6 A;  1HKM A;  1FKB A;  2M2A A;  2ZR4 A;  3B9D A;  4S3K A;  1E6Z A;  2K8I A;  1YW5 A;  1T11 A;  3CHE A;  4KR0 B;  4HBE A;  5GPR A;  1E6P A;  3CHC A;  2Q5A A;  1WB0 A;  3UI6 A;  3AS2 A;  2RUD A;  2DT2 A;  4HBO A;  2DSU A;  1FAP A;  4KQZ A;  4JFK A;  3PRA A;  2RUQ A;  4JFL A;  2A3C A;  3EY6 A;  3PA7 A;  2FKE A;  2N87 A;  1P5Q A;  2DT3 A;  2G8Z A;  1SYT A;  2ZR6 A;  2F2D A;  1W9V A;  3NRK A;  1EDQ A;  4ZPT R;  2KFW A;  3O5I A;  1PBK A;  1ZBK A;  2XP8 A;  4QZV B;  4HAR A;  3KAH A;  3IHZ A;  4Z2G A;  3WH0 A;  3KAC A;  3O5J A;  1B6C A;  1A7X A;  4IQ2 A;  2KO7 A;  3MDY B;  3FAP A;  3O5O A;  2DSV A;  4ZPW R;  1W1P A;  2F4E A;  4J4N A;  2MNT A;  4WIW A;  4GIV A;  4TW6 A;  4L72 B;  3GPK A;  2OFN A;  4MNK A;  2DG4 A;  4DRI A;  1QPF A;  3WKZ A;  1W26 A;  2ZQS A;  1Q6U A;  4URI A;  1HJX A;  2KGJ A;  4IPX A;  3G6M A;  4DT4 A;  3ARR A;  4Z2K A;  1E15 A;  1JNT A;  1HKI A;  5JH8 A;  2RQS A;  1NMV A;  2PI6 A;  2PV2 A;  4DRK A;  4DRM A;  1ZBC A;  1FD9 A;  1J4R A;  2MF9 A;  4MGV A;  2MLX A;  3O5K A;  1FKJ A;  1QZ2 A;  2PBC A;  3ART A;  1QPL A;  3ARU A;  1X6L A;  2LGO A;  5D75 A;  1LQ0 A;  1O6I A;  4NZC A;  2MLY A;  3WQV A;  2F21 A;  3CHF A;  2AWG A;  3AQU A;  3O5D A;  3O5M A;  3RM4 A;  4MAV A;  2A3E A;  4ODM A;  2DSW A;  5DF0 A;  1FKT A;  1JNE A;  1ZU8 A;  3W4R A;  3B8S A;  4IT4 A;  2JZV A;  4DH0 A;  2PV1 A;  1IX5 A;  1D7H A;  2MPH A;  2VN1 A;  3CH9 A;  3KCE A;  4WKH A;  2OLH A;  4TYO A;  4MSP A;  3G6L A;  5J6E A;  2IUZ A;  1ROT A;  1BL4 A;  3IKD A;  4P8W A;  4Z2J A;  1LG1 A;  5HW6 A;  2PPO A;  2LPV A;  3JXV A;  2XPB A;  3ARQ A;  3FY1 A;  3ARP A;  1TFV A;  5DIT A;  3O5F A;  3KAF A;  3WD0 A;  3ARV A;  1Q6I A;  1NWT A;  4W9Q A;  1OGB A;  4ZS6 A;  2ZR5 A;  3CZ8 A;  1FKG A;  4P8V A;  1WAW A;  1NWS A;  1LL4 A;  4DRJ A;  1UR9 A;  4WKF A;  4TNS A;  1NSG A;  4WJX A;  4O2T A;  2RUR A;  1E9L A;  2YBT A;  1JNS A;  3UI5 A;  4DIP A;  1FJD A;  4ODL A;  4BF8 A;  3O5Q A;  5HW7 A;  4LGX A;  1NMW A;  2XP5 A;  1FKD A;  3CGN A;  3RM9 A;  4NNR A;  2A3B A;  3PRB A;  3WL0 A;  1ZCN A;  3ODK A;  3ALG A;  3WD3 A;  4LAY A;  4ODP A;  3O5E A;  1ZBV A;  3LUO A;  4LAV A;  2RSE A;  4QIB A;  3WIJ A;  3FXY A;  3AS1 A;  4R5E A;  1FKR A;  1FKK A;  2PPN A;  1ROU A;  2XP3 A;  3UQB A;  1YAT A;  1HXV A;  4U84 A;  2L2S A;  4FAP A;  4R0X A;  3WD4 A;  1HKK A;  4Q22 A;  3IK8 A;  1EYM A;  1F40 A;  1HKJ A;  2ITK A;  3UF8 A;  5I98 A;  4ODO A;  3IKG A;  1LJY A;  4W9O A;  1H0I A;  5HW8 A;  3B9A A;  4W9P A;  1PIN A;  1W1T A;  4ODR A;  2LKN A;  4DRN A;  5B8I C;  3NTP A;  3UQA A;  4J4O A;  4W5U A;  1Y0O A;  1EQ3 A;  1TCO C;  1LG2 A;  2LJ4 A;  2DSZ A;  4G2P A;  5HTG A;  1D2K A;  1UR8 A;  1HJW A;  2G41 A;  3PRD A;  4ITZ A;  1E6N A;  1D6O A;  3WQW A;  1NWU A;  3KAB A;  4P8U A;  1EHN A;  3RFW A;  4ZPV R;  4DRO A;  4DRH A;  4ODN A;  2XP7 A;  3ALF A;  4DZ2 A;  3AS0 A;  1WNO A;  2M1I A;  1GPF A;  2DPE A;  2UZ5 A;  2QF8 A;  4G50 A;  2KE0 A;  3RM8 A;  2XP9 A;  3UI4 A;  4WK9 A;  4ODQ A;  3KZ7 A;  4MNM A;  1F8A B;  1NWR A;  3ARZ A;  3KAD A;  1ITX A;  3CHD A;  1W9U A;  1BKF A;  3O5G A;  1OGG A;  4ML4 A;  1J6Y A;  1HJV A;  2DG9 A;  1FFQ A;  4LAX A;  1L1P A;  3JYM A;  1XHG A;  1FKH A;  3O5R A;  3AS3 A;  1U79 A;  4MNL A;  3UQI A;  5HUA A;  1X6N A;  4Z2I A;  1FKL A;  4JFJ A;  1K9T A;  2ZQV A;  2WLY A;  2FAP A;  5DEZ A;  2AOS A;  1Q6H A;  1W9P A;  3WL1 A;  5HWC A;  1D7J A;  1FFR A;  4QT2 A;  3ARS A;  5HWB A;  2PV3 A;  4U85 A;  4TW8 A;  3VAW A;  1FKF A;  2WK2 A;  3OOB A;  2ESC A;  1JVW A;  4TW7 A;  4DRP A;  3WD1 A;  3TCZ A;  4C02 B;  1NH6 A;  3TDB A;  2MLZ A;  4Z2L A;  5GPG A;  3JYJ A;  4L3N A;  2DT1 A;  4P8X A;  2ZQU A;  4JYS A;  5HT1 A;  5HKG A;  2A3A A;  2IF4 A;  4S3J A;  4JFI A;  4IT6 A;  4AY1 A;  4DRQ A;  3ARY A;  2FDM A;  3CGM A;  4FN2 A;  4LAW A;  4MTV A;  3KAI A;  4XAK A;  4IQC A;  1KFW A;  2RUC A;  1OWQ A;  4DWS D;  3RGC A;  2KI3 A;  1VF8 A;  4QT3 A;  4GGQ A;  5BXJ A;  3B7X A;  1EIB A;  1Q1C A;  2Y78 A;  1ZBW A;  1J4I A;  1D7I A;  1W1V A;  5DIV A;  1JND A;  2YBU A;  4PTM A;  2VCD A;  1C9H A;  2XP6 A;  3NI6 A;  3RME A;  4ODK A;  1XRV A;  4N19 A;  1FKI A;  4DWS B;  3O5L A;  4JFM A;  5DO2 A;  1FKS A;  1R9H A;  2M08 A;  3B9E A;  3I6C A;  3ARX A;  2XPA A;  3OA5 A;  1M5Y A;  3O5P A;  1ZL1 A;  2XP4 A;  4MNJ A;  4U86 A;  1ZK6 A;  4WKA A;  2B31 A;  2DG3 A;  2D9F A;  3KAG A;  1H0G A;  1N1A A;  1J4H A;  1LL6 A;  1GUV A;  1KT1 A;  3ARO A;  2O9O A;  4NSB A;  1KT0 A;  1CTN A;  1GOI A;  3QOK A;  4MPK A;  3H9R B;  2KR7 A;  1LL7 A;  2DT0 A;  5GQB A;  4DWS A;  4Z2H A;  2O92 A;  2WM0 A;  2WLZ A;  5DIU A;  1W1Y A;  3PR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...