5HUAA

Structure of c. glabrata fkbp12-fk506 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
SETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 27
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5huaA00
4ODQA 1FAPA 1FKDA 1ROTA 1D6OA 4DRQA 3TC5A 4FN2A 2KGJA 1Q6UA 2RUCA 3O5KA 3O5EA 5GPGA 4DRMA 3PRBA 5HWBA 4MGVA 1D7HA 3UQIA 2XP9A 2DG4A 4ODRA 2XPBA 2K8IA 4GGQA 2PV2A 5HW7A 4DT4A 4JFMA 4JFIA 3KAGA 2JZVA 2XP7A 3IKGA 2ZR6A 3NI6A 2XP3A 3O5MA 2VN1A 1R9HA 1J4HA 5B8IC 1FKGA 3FAPA 1J6YA 3H9RB 4N19A 1B6CA 4J4NA 4G2PA 4TW6A 2PV1A 2PBCA 2Y78A 5HT1A 4W9OA 1FKIA 1NMVA 2MPHA 2MLYA 3B7XA 1N1AA 4ODOA 2Q5AA 1PBKA 4JFLA 2M08A 1W26A 2DG3A 2RSEA 4ODPA 3KAHA 4U84A 3RGCA 4DZ3A 1C9HA 2PPPA 1QPFA 4DH0A 1FKKA 4DRHA 1EQ3A 2F2DA 2LJ4A 2ITKA 2KO7A 2MLZA 1KT0A 3VAWA 2MNTA 2IF4A 1J4RA 3GPKA 5HKGA 3MDYB 3O5PA 3LUOA 4DRIA 4J4OA 2LKNA 1L1PA 1M5YA 3NRKA 3UQAA 2KI3A 1FKBA 2LPVA 3UI5A 2OFNA 2AWGA 2FAPA 3JXVA 1ZK6A 1U79A 1F8AB 2VCDA 5I98A 3KZ7A 2KFWA 4U85A 3ODKA 4DRPA 4DRKA 3IHZA 5J6EA 1Y0OA 4R0XA 2XP6A 1F40A 4QIBA 3KCEA 4TW8A 4TYOA 5DIUA 3PA7A 1T11A 3IK8A 4JFKA 3UI4A 2PPNA 3KADA 3O5DA 4LAWA 2RUDA 3JYMA 2DG9A 2ZR5A 5D75A 1NSGA 2XPAA 2ZQVA 2N87A 4ODKA 4ODLA 1P5QA 1TCOC 4W9QA 1FKHA 1FKFA 1JNTA 2XP4A 1FKRA 3IKDA 4GIVA 2L2SA 2FKEA 4O2TA 3KAFA 4U86A 4TNSA 1D7JA 3TDBA 3O5OA 3O5JA 4G50A 1JNSA 1YW5A 2RQSA 5HW8A 1EYMA 1Q6HA 2XP8A 1BKFA 3KACA 5HUAA 2PPOA 4ODNA 3O5QA 3OOBA 4DZ2A 1JVWA 4BF8A 1NMWA 4ITZA 4DROA 1QPLA 2KE0A 2MF9A 3CGMA 4JFJA 2M2AA 4JYSA 1BL4A 3UI6A 5HWCA 1HXVA 1FKJA 2ZQUA 3TCZA 3UQBA 1YATA 1ROUA 2XP5A 1ZCNA 4LAYA 4TW7A 5DIVA 2ZQSA 2UZ5A 2PV3A 4MSPA 3WH0A 5HW6A 1FJDA 1Q6IA 4LAXA 1QZ2A 5DITA 4TX0A 3UF8A 3RFWA 3KAIA 3JYJA 3O5GA 2ZR4A 4QT2A 4DRJA 5HTGA 1FKSA 3CGNA 1FKLA 2F4EA 3I6CA 3O5LA 1A7XA 1J4IA 4DRNA 1D7IA 4IQ2A 4LAVA 2ZQTA 2RURA 1Q1CA 2LGOA 2F21A 4QT3A 4W9PA 5BXJA 1PINA 4IPXA 4FAPA 2RUQA 2M1IA 4IQCA 3O5RA 3EY6A 3O5IA 3PRDA 1FKTA 3O5FA 3KABA 3NTPA 4ODMA 1KT1A 1FD9A 2KR7A 2MLXA 4DIPA 4NNRA 2D9FA 4C02B
chains in the Genus database with same CATH superfamily
4WIWA 1Q6UA 5HWBA 3AS3A 5GPGA 4ODRA 2PV2A 1UR8A 4JFMA 2JZVA 1LL6A 1R9HA 1J4HA 1J6YA 3ARTA 4J4NA 4TW6A 2PBCA 1ZL1A 3WD0A 1PBKA 2RSEA 4DZ3A 1E6PA 4DH0A 1FKKA 1EQ3A 4S3KA 2MNTA 1FFRA 1GUVA 2FDMA 2DSUA 4J4OA 1L1PA 4P8WA 1FKBA 3UI5A 2VCDA 4U85A 4DRPA 2A3EA 3RM4A 3B9EA 3G6LA 1Y0OA 2XP6A 3G6MA 3BXWA 4TW8A 4TYOA 1W9VA 4ZPTR 1HKMA 4MAVA 4W9QA 1FKHA 1FKFA 2XP4A 1E44A 2L2SA 3WQVA 3O5OA 1WNOA 4G50A 1YW5A 2RQSA 1ZB5A 4Q7NA 1ZU8A 3ALFA 2MF9A 5HWCA 4JFJA 1E6NA 3UI6A 3BMBA 1YATA 1HJVA 4TW7A 2AOSA 2A3AA 3B8SA 1EHNA 1Q6IA 1HKKA 3RFWA 3KAIA 2ZR4A 4QT2A 4XAKA 5DO2A 1FKLA 2DT1A 3ARWA 1LJYA 4IPXA 3RM9A 5DEZA 1WAWA 4IQCA 4NSBA 3ARXA 4MPKA 3GU0A 2QF8A 4DIPA 2F23A 1FKDA 4DRQA 4ZS6A 2RUCA 4DRMA 4MGVA 4P8VA 1KFWA 3UQIA 4NZCA 2DG4A 4GGQA 4DT4A 2B5UB 1NWRA 3NI6A 3O5MA 2VN1A 3FAPA 2A3BA 3ARVA 3ARYA 4MNLA 4DWSA 4W9OA 1NMVA 2MPHA 3ARRA 3B7XA 5DF0A 1X6LA 3CZ8A 2ESCA 4WK9A 4JFLA 4UDMA 1K9TA 1W26A 2DG3A 2PN0A 3KAHA 4U84A 1C9HA 2PPPA 4DRHA 4WKHA 1JNDA 1W9PA 3VAWA 4L72B 4IT6A 2P4VA 2DSZA 1IX5A 4DRIA 1M5YA 1LL7A 1W9UA 1H0GA 2AWGA 5I98A 3ODKA 3IHZA 4R0XA 3KCEA 5DIUA 3PA7A 3IK8A 3UI4A 1ZBKA 4LAWA 1NSGA 4ODKA 1JNTA 2WK2A 1FKRA 3AROA 4P8XA 1ZBVA 2FKEA 4O2TA 4U86A 1X6NA 4TNSA 3TDBA 1Q6HA 3KACA 2PPOA 4DZ2A 2YBTA 1E15A 4AY1A 3WIJA 1RD6A 3WD4A 2ZQUA 5HBFA 4Z2KA 1ROUA 5DIVA 2ZQSA 1FJDA 4KQZA 4R5EA 3JYJA 4DRJA 1GOIA 5HTGA 4WKFA 1W1TA 3CGNA 3O5LA 4DRNA 1D7IA 4DWSC 2O9OA 4W9PA 1EDQA 4ZPVR 2WM0A 1HJXA 2M1IA 3O5RA 2DT2A 3ARPA 1W1VA 3PRDA 3KABA 2KR7A 4NNRA 2B31A 4C02B 1LL4A 1D2KA 4ODQA 1JNEA 1ROTA 4MTVA 4FN2A 2KGJA 3O5KA 3CH9A 3O5EA 1LG2A 4Z2IA 2XP9A 1GPFA 1SR0A 1CTNA 2XPBA 4JFIA 1WB0A 3IKGA 2ZR6A 2XP3A 1FKGA 3AQUA 1SYTA 3QOKA 4URIA 4HBEA 1UR9A 2IUZA 1LG1A 1FKIA 1N1AA 2Q5AA 3CHCA 4ODPA 2M08A 4HBOA 3RGCA 1W1PA 1QPFA 1ZBCA 2F2DA 2LJ4A 2O92A 4Z2GA 2ITKA 2KO7A 1KT0A 4S3JA 2ETNA 1J4RA 3MDYB 3WKZA 3LUOA 2DSWA 2A3CA 3WL0A 4PTMA 3NRKA 2KI3A 2OFNA 1O6IA 4DWSB 2FAPA 3JXVA 1ZK6A 4Z2JA 1F8AB 2KFWA 4DRKA 5J6EA 2DPEA 1F40A 4QIBA 1T11A 2PPNA 4IT4A 3JYMA 2DG9A 2ZR5A 2ZQVA 4MNKA 4GIVA 3OA5A 1OGBA 3WL1A 3KAFA 4HARA 1XRVA 5HW8A 3PRAA 5HUAA 4ODNA 3O5QA 4BF8A 2DSVA 3PR9A 3WD1A 2M2AA 1BL4A 1NWUA 3B9AA 3TCZA 3UQBA 2XP5A 4LAYA 3ARSA 1HKIA 2UZ5A 3FY1A 3WD2A 2PV3A 4WJXA 4DWSD 1ZBWA 3WH0A 4Z2HA 4W5UA 4TX0A 2PI6A 4LGXA 1FKSA 3ARQA 3ARZA 2EULA 2F4EA 1J4IA 1XHGA 1ITXA 5GPRA 1Q1CA 4QT3A 5BXJA 4FAPA 4ZPWR 1OWQA 3EY6A 3O5FA 3NTPA 1KT1A 2WLYA 3WD3A 4Q22A 1FAPA 4KR0B 1D6OA 3TC5A 1H0IA 3PRBA 2WLZA 1D7HA 3AS2A 5GQBA 5HW7A 2K8IA 1GRJA 2YBUA 1W1YA 3KAGA 2XP7A 1E6RA 5B8IC 3H9RB 4N19A 1TFVA 1B6CA 4G2PA 2PV1A 4L3NA 1HKJA 2Y78A 5HT1A 2MLYA 2DT3A 4ODOA 1E6ZA 2MLZA 3EIPA 4ML4A 2IF4A 3GPKA 3AS1A 5HKGA 3O5PA 1HJWA 2LKNA 3UQAA 2LPVA 1U79A 1NWTA 1FFQA 3RM8A 3KZ7A 3FXYA 1OGGA 4JFKA 4QZVB 3KADA 3O5DA 2RUDA 1LQ0A 5D75A 2XPAA 3CHFA 2N87A 4ODLA 1P5QA 1TCOC 3IKDA 4MNJA 4WKAA 4MNMA 1D7JA 3O5JA 4Z2LA 2OLHA 4P8UA 1JNSA 1EYMA 3CHEA 2XP8A 1BKFA 3OOBA 1JVWA 3WQWA 1NMWA 4ITZA 3RMEA 4DROA 1QPLA 2KE0A 3ARUA 3CGMA 4JYSA 1HXVA 1FKJA 3W4RA 1ZCNA 3CHDA 2DT0A 1NH6A 3ALGA 4MSPA 5HW6A 4LAXA 1QZ2A 5DITA 3UF8A 2G8ZA 3O5GA 5JH8A 1EIBA 1JCHB 3I6CA 3GTYX 1A7XA 1NWSA 4IQ2A 4LAVA 2ZQTA 2RURA 2LGOA 2F21A 1E9LA 1PINA 2G41A 3B9DA 2RUQA 3AS0A 3O5IA 1FKTA 4ODMA 1FD9A 2MLXA 2D9FA 1VF8A
chains in the Genus database with same CATH topology
4WIWA 1Q6UA 5HWBA 3AS3A 5GPGA 4ODRA 2PV2A 1UR8A 4JFMA 2JZVA 1LL6A 1R9HA 1J4HA 1J6YA 3ARTA 4J4NA 4TW6A 2PBCA 1ZL1A 3WD0A 1PBKA 2RSEA 4DZ3A 1E6PA 4DH0A 1FKKA 1EQ3A 4S3KA 2MNTA 1FFRA 1GUVA 2FDMA 2DSUA 4J4OA 1L1PA 4P8WA 1FKBA 3UI5A 2VCDA 4U85A 4DRPA 2A3EA 3RM4A 3B9EA 3G6LA 1Y0OA 2XP6A 3G6MA 3BXWA 4TW8A 4TYOA 1W9VA 4ZPTR 1HKMA 4MAVA 4W9QA 1FKHA 1FKFA 2XP4A 2L2SA 3WQVA 3O5OA 1WNOA 4G50A 1YW5A 2RQSA 1ZB5A 4Q7NA 1ZU8A 3ALFA 2MF9A 5HWCA 4JFJA 1E6NA 3UI6A 1YATA 1HJVA 4TW7A 2AOSA 2A3AA 3B8SA 1EHNA 1Q6IA 1HKKA 3RFWA 3KAIA 2ZR4A 4QT2A 4XAKA 5DO2A 1FKLA 2DT1A 3ARWA 1LJYA 4IPXA 3RM9A 5DEZA 1WAWA 4IQCA 4NSBA 3ARXA 4MPKA 2QF8A 4DIPA 1FKDA 4DRQA 4ZS6A 2RUCA 4DRMA 4MGVA 4P8VA 1KFWA 3UQIA 4NZCA 2DG4A 4GGQA 4DT4A 1NWRA 3NI6A 3O5MA 2VN1A 3FAPA 2A3BA 3ARVA 3ARYA 4MNLA 4DWSA 4W9OA 1NMVA 2MPHA 3ARRA 3B7XA 5DF0A 1X6LA 3CZ8A 2ESCA 4WK9A 4JFLA 1K9TA 1W26A 2DG3A 3KAHA 4U84A 1C9HA 2PPPA 4DRHA 4WKHA 1JNDA 1W9PA 3VAWA 4L72B 4IT6A 2DSZA 1IX5A 4DRIA 1M5YA 1LL7A 1W9UA 1H0GA 2AWGA 5I98A 3ODKA 3IHZA 4R0XA 3KCEA 5DIUA 3PA7A 3IK8A 3UI4A 1ZBKA 4LAWA 1NSGA 4ODKA 1JNTA 2WK2A 1FKRA 3AROA 4P8XA 1ZBVA 2FKEA 4O2TA 4U86A 1X6NA 4TNSA 3TDBA 1Q6HA 3KACA 2PPOA 4DZ2A 2YBTA 1E15A 4AY1A 3WIJA 1RD6A 3WD4A 2ZQUA 5HBFA 4Z2KA 1ROUA 5DIVA 2ZQSA 1FJDA 4KQZA 4R5EA 3JYJA 4DRJA 1GOIA 5HTGA 4WKFA 1W1TA 3CGNA 3O5LA 4DRNA 1D7IA 4DWSC 2O9OA 4W9PA 1EDQA 4ZPVR 2WM0A 1HJXA 2M1IA 3O5RA 2DT2A 3ARPA 1W1VA 3PRDA 3KABA 2KR7A 4NNRA 2B31A 4C02B 1LL4A 1D2KA 4ODQA 1JNEA 1ROTA 4MTVA 4FN2A 2KGJA 3O5KA 3CH9A 3O5EA 1LG2A 4Z2IA 2XP9A 1GPFA 1SR0A 1CTNA 2XPBA 4JFIA 1WB0A 3IKGA 2ZR6A 2XP3A 1FKGA 3AQUA 1SYTA 3QOKA 4URIA 4HBEA 1UR9A 2IUZA 1LG1A 1FKIA 1N1AA 2Q5AA 3CHCA 4ODPA 2M08A 4HBOA 3RGCA 1W1PA 1QPFA 1ZBCA 2F2DA 2LJ4A 2O92A 4Z2GA 2ITKA 2KO7A 1KT0A 4S3JA 1J4RA 3MDYB 3WKZA 3LUOA 2DSWA 2A3CA 3WL0A 4PTMA 3NRKA 2KI3A 2OFNA 1O6IA 4DWSB 2FAPA 3JXVA 1ZK6A 4Z2JA 1F8AB 2KFWA 4DRKA 5J6EA 2DPEA 1F40A 4QIBA 1T11A 2PPNA 4IT4A 3JYMA 2DG9A 2ZR5A 2ZQVA 4MNKA 4GIVA 3OA5A 1OGBA 3WL1A 3KAFA 4HARA 1XRVA 5HW8A 3PRAA 5HUAA 4ODNA 3O5QA 4BF8A 2DSVA 3PR9A 3WD1A 2M2AA 1BL4A 1NWUA 3B9AA 3TCZA 3UQBA 2XP5A 4LAYA 3ARSA 1HKIA 2UZ5A 3FY1A 3WD2A 2PV3A 4WJXA 4DWSD 1ZBWA 3WH0A 4Z2HA 4W5UA 4TX0A 2PI6A 4LGXA 1FKSA 3ARQA 3ARZA 2F4EA 1J4IA 1XHGA 1ITXA 5GPRA 1Q1CA 4QT3A 5BXJA 4FAPA 4ZPWR 1OWQA 3EY6A 3O5FA 3NTPA 1KT1A 2WLYA 3WD3A 4Q22A 1FAPA 4KR0B 1D6OA 3TC5A 1H0IA 3PRBA 2WLZA 1D7HA 3AS2A 5GQBA 5HW7A 2K8IA 2YBUA 1W1YA 3KAGA 2XP7A 1E6RA 5B8IC 3H9RB 4N19A 1TFVA 1B6CA 4G2PA 2PV1A 4L3NA 1HKJA 2Y78A 5HT1A 2MLYA 2DT3A 4ODOA 1E6ZA 2MLZA 4ML4A 2IF4A 3GPKA 3AS1A 5HKGA 3O5PA 1HJWA 2LKNA 3UQAA 2LPVA 1U79A 1NWTA 1FFQA 3RM8A 3KZ7A 3FXYA 1OGGA 4JFKA 4QZVB 3KADA 3O5DA 2RUDA 1LQ0A 5D75A 2XPAA 3CHFA 2N87A 4ODLA 1P5QA 1TCOC 3IKDA 4MNJA 4WKAA 4MNMA 1D7JA 3O5JA 4Z2LA 2OLHA 4P8UA 1JNSA 1EYMA 3CHEA 2XP8A 1BKFA 3OOBA 1JVWA 3WQWA 1NMWA 4ITZA 3RMEA 4DROA 1QPLA 2KE0A 3ARUA 3CGMA 4JYSA 1HXVA 1FKJA 3W4RA 1ZCNA 3CHDA 2DT0A 1NH6A 3ALGA 4MSPA 5HW6A 4LAXA 1QZ2A 5DITA 3UF8A 2G8ZA 3O5GA 5JH8A 1EIBA 3I6CA 1A7XA 1NWSA 4IQ2A 4LAVA 2ZQTA 2RURA 2LGOA 2F21A 1E9LA 1PINA 2G41A 3B9DA 2RUQA 3AS0A 3O5IA 1FKTA 4ODMA 1FD9A 2MLXA 2D9FA 1VF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODQ A;  1FAP A;  1FKD A;  1ROT A;  1D6O A;  4DRQ A;  3TC5 A;  4FN2 A;  2KGJ A;  1Q6U A;  2RUC A;  3O5K A;  3O5E A;  5GPG A;  4DRM A;  3PRB A;  5HWB A;  4MGV A;  1D7H A;  3UQI A;  2XP9 A;  2DG4 A;  4ODR A;  2XPB A;  2K8I A;  4GGQ A;  2PV2 A;  5HW7 A;  4DT4 A;  4JFM A;  4JFI A;  3KAG A;  2JZV A;  2XP7 A;  3IKG A;  2ZR6 A;  3NI6 A;  2XP3 A;  3O5M A;  2VN1 A;  1R9H A;  1J4H A;  5B8I C;  1FKG A;  3FAP A;  1J6Y A;  3H9R B;  4N19 A;  1B6C A;  4J4N A;  4G2P A;  4TW6 A;  2PV1 A;  2PBC A;  2Y78 A;  5HT1 A;  4W9O A;  1FKI A;  1NMV A;  2MPH A;  2MLY A;  3B7X A;  1N1A A;  4ODO A;  2Q5A A;  1PBK A;  4JFL A;  2M08 A;  1W26 A;  2DG3 A;  2RSE A;  4ODP A;  3KAH A;  4U84 A;  3RGC A;  4DZ3 A;  1C9H A;  2PPP A;  1QPF A;  4DH0 A;  1FKK A;  4DRH A;  1EQ3 A;  2F2D A;  2LJ4 A;  2ITK A;  2KO7 A;  2MLZ A;  1KT0 A;  3VAW A;  2MNT A;  2IF4 A;  1J4R A;  3GPK A;  5HKG A;  3MDY B;  3O5P A;  3LUO A;  4DRI A;  4J4O A;  2LKN A;  1L1P A;  1M5Y A;  3NRK A;  3UQA A;  2KI3 A;  1FKB A;  2LPV A;  3UI5 A;  2OFN A;  2AWG A;  2FAP A;  3JXV A;  1ZK6 A;  1U79 A;  1F8A B;  2VCD A;  5I98 A;  3KZ7 A;  2KFW A;  4U85 A;  3ODK A;  4DRP A;  4DRK A;  3IHZ A;  5J6E A;  1Y0O A;  4R0X A;  2XP6 A;  1F40 A;  4QIB A;  3KCE A;  4TW8 A;  4TYO A;  5DIU A;  3PA7 A;  1T11 A;  3IK8 A;  4JFK A;  3UI4 A;  2PPN A;  3KAD A;  3O5D A;  4LAW A;  2RUD A;  3JYM A;  2DG9 A;  2ZR5 A;  5D75 A;  1NSG A;  2XPA A;  2ZQV A;  2N87 A;  4ODK A;  4ODL A;  1P5Q A;  1TCO C;  4W9Q A;  1FKH A;  1FKF A;  1JNT A;  2XP4 A;  1FKR A;  3IKD A;  4GIV A;  2L2S A;  2FKE A;  4O2T A;  3KAF A;  4U86 A;  4TNS A;  1D7J A;  3TDB A;  3O5O A;  3O5J A;  4G50 A;  1JNS A;  1YW5 A;  2RQS A;  5HW8 A;  1EYM A;  1Q6H A;  2XP8 A;  1BKF A;  3KAC A;  5HUA A;  2PPO A;  4ODN A;  3O5Q A;  3OOB A;  4DZ2 A;  1JVW A;  4BF8 A;  1NMW A;  4ITZ A;  4DRO A;  1QPL A;  2KE0 A;  2MF9 A;  3CGM A;  4JFJ A;  2M2A A;  4JYS A;  1BL4 A;  3UI6 A;  5HWC A;  1HXV A;  1FKJ A;  2ZQU A;  3TCZ A;  3UQB A;  1YAT A;  1ROU A;  2XP5 A;  1ZCN A;  4LAY A;  4TW7 A;  5DIV A;  2ZQS A;  2UZ5 A;  2PV3 A;  4MSP A;  3WH0 A;  5HW6 A;  1FJD A;  1Q6I A;  4LAX A;  1QZ2 A;  5DIT A;  4TX0 A;  3UF8 A;  3RFW A;  3KAI A;  3JYJ A;  3O5G A;  2ZR4 A;  4QT2 A;  4DRJ A;  5HTG A;  1FKS A;  3CGN A;  1FKL A;  2F4E A;  3I6C A;  3O5L A;  1A7X A;  1J4I A;  4DRN A;  1D7I A;  4IQ2 A;  4LAV A;  2ZQT A;  2RUR A;  1Q1C A;  2LGO A;  2F21 A;  4QT3 A;  4W9P A;  5BXJ A;  1PIN A;  4IPX A;  4FAP A;  2RUQ A;  2M1I A;  4IQC A;  3O5R A;  3EY6 A;  3O5I A;  3PRD A;  1FKT A;  3O5F A;  3KAB A;  3NTP A;  4ODM A;  1KT1 A;  1FD9 A;  2KR7 A;  2MLX A;  4DIP A;  4NNR A;  2D9F A;  4C02 B; 
#chains in the Genus database with same CATH topology
 4WIW A;  1Q6U A;  5HWB A;  3AS3 A;  5GPG A;  4ODR A;  2PV2 A;  1UR8 A;  4JFM A;  2JZV A;  1LL6 A;  1R9H A;  1J4H A;  1J6Y A;  3ART A;  4J4N A;  4TW6 A;  2PBC A;  1ZL1 A;  3WD0 A;  1PBK A;  2RSE A;  4DZ3 A;  1E6P A;  4DH0 A;  1FKK A;  1EQ3 A;  4S3K A;  2MNT A;  1FFR A;  1GUV A;  2FDM A;  2DSU A;  4J4O A;  1L1P A;  4P8W A;  1FKB A;  3UI5 A;  2VCD A;  4U85 A;  4DRP A;  2A3E A;  3RM4 A;  3B9E A;  3G6L A;  1Y0O A;  2XP6 A;  3G6M A;  3BXW A;  4TW8 A;  4TYO A;  1W9V A;  4ZPT R;  1HKM A;  4MAV A;  4W9Q A;  1FKH A;  1FKF A;  2XP4 A;  1E44 A;  2L2S A;  3WQV A;  3O5O A;  1WNO A;  4G50 A;  1YW5 A;  2RQS A;  1ZB5 A;  4Q7N A;  1ZU8 A;  3ALF A;  2MF9 A;  5HWC A;  4JFJ A;  1E6N A;  3UI6 A;  3BMB A;  1YAT A;  1HJV A;  4TW7 A;  2AOS A;  2A3A A;  3B8S A;  1EHN A;  1Q6I A;  1HKK A;  3RFW A;  3KAI A;  2ZR4 A;  4QT2 A;  4XAK A;  5DO2 A;  1FKL A;  2DT1 A;  3ARW A;  1LJY A;  4IPX A;  3RM9 A;  5DEZ A;  1WAW A;  4IQC A;  4NSB A;  3ARX A;  4MPK A;  3GU0 A;  2QF8 A;  4DIP A;  2F23 A;  1FKD A;  4DRQ A;  4ZS6 A;  2RUC A;  4DRM A;  4MGV A;  4P8V A;  1KFW A;  3UQI A;  4NZC A;  2DG4 A;  4GGQ A;  4DT4 A;  2B5U B;  1NWR A;  3NI6 A;  3O5M A;  2VN1 A;  3FAP A;  2A3B A;  3ARV A;  3ARY A;  4MNL A;  4DWS A;  4W9O A;  1NMV A;  2MPH A;  3ARR A;  3B7X A;  5DF0 A;  1X6L A;  3CZ8 A;  2ESC A;  4WK9 A;  4JFL A;  4UDM A;  1K9T A;  1W26 A;  2DG3 A;  2PN0 A;  3KAH A;  4U84 A;  1C9H A;  2PPP A;  4DRH A;  4WKH A;  1JND A;  1W9P A;  3VAW A;  4L72 B;  4IT6 A;  2P4V A;  2DSZ A;  1IX5 A;  4DRI A;  1M5Y A;  1LL7 A;  1W9U A;  1H0G A;  2AWG A;  5I98 A;  3ODK A;  3IHZ A;  4R0X A;  3KCE A;  5DIU A;  3PA7 A;  3IK8 A;  3UI4 A;  1ZBK A;  4LAW A;  1NSG A;  4ODK A;  1JNT A;  2WK2 A;  1FKR A;  3ARO A;  4P8X A;  1ZBV A;  2FKE A;  4O2T A;  4U86 A;  1X6N A;  4TNS A;  3TDB A;  1Q6H A;  3KAC A;  2PPO A;  4DZ2 A;  2YBT A;  1E15 A;  4AY1 A;  3WIJ A;  1RD6 A;  3WD4 A;  2ZQU A;  5HBF A;  4Z2K A;  1ROU A;  5DIV A;  2ZQS A;  1FJD A;  4KQZ A;  4R5E A;  3JYJ A;  4DRJ A;  1GOI A;  5HTG A;  4WKF A;  1W1T A;  3CGN A;  3O5L A;  4DRN A;  1D7I A;  4DWS C;  2O9O A;  4W9P A;  1EDQ A;  4ZPV R;  2WM0 A;  1HJX A;  2M1I A;  3O5R A;  2DT2 A;  3ARP A;  1W1V A;  3PRD A;  3KAB A;  2KR7 A;  4NNR A;  2B31 A;  4C02 B;  1LL4 A;  1D2K A;  4ODQ A;  1JNE A;  1ROT A;  4MTV A;  4FN2 A;  2KGJ A;  3O5K A;  3CH9 A;  3O5E A;  1LG2 A;  4Z2I A;  2XP9 A;  1GPF A;  1SR0 A;  1CTN A;  2XPB A;  4JFI A;  1WB0 A;  3IKG A;  2ZR6 A;  2XP3 A;  1FKG A;  3AQU A;  1SYT A;  3QOK A;  4URI A;  4HBE A;  1UR9 A;  2IUZ A;  1LG1 A;  1FKI A;  1N1A A;  2Q5A A;  3CHC A;  4ODP A;  2M08 A;  4HBO A;  3RGC A;  1W1P A;  1QPF A;  1ZBC A;  2F2D A;  2LJ4 A;  2O92 A;  4Z2G A;  2ITK A;  2KO7 A;  1KT0 A;  4S3J A;  2ETN A;  1J4R A;  3MDY B;  3WKZ A;  3LUO A;  2DSW A;  2A3C A;  3WL0 A;  4PTM A;  3NRK A;  2KI3 A;  2OFN A;  1O6I A;  4DWS B;  2FAP A;  3JXV A;  1ZK6 A;  4Z2J A;  1F8A B;  2KFW A;  4DRK A;  5J6E A;  2DPE A;  1F40 A;  4QIB A;  1T11 A;  2PPN A;  4IT4 A;  3JYM A;  2DG9 A;  2ZR5 A;  2ZQV A;  4MNK A;  4GIV A;  3OA5 A;  1OGB A;  3WL1 A;  3KAF A;  4HAR A;  1XRV A;  5HW8 A;  3PRA A;  5HUA A;  4ODN A;  3O5Q A;  4BF8 A;  2DSV A;  3PR9 A;  3WD1 A;  2M2A A;  1BL4 A;  1NWU A;  3B9A A;  3TCZ A;  3UQB A;  2XP5 A;  4LAY A;  3ARS A;  1HKI A;  2UZ5 A;  3FY1 A;  3WD2 A;  2PV3 A;  4WJX A;  4DWS D;  1ZBW A;  3WH0 A;  4Z2H A;  4W5U A;  4TX0 A;  2PI6 A;  4LGX A;  1FKS A;  3ARQ A;  3ARZ A;  2EUL A;  2F4E A;  1J4I A;  1XHG A;  1ITX A;  5GPR A;  1Q1C A;  4QT3 A;  5BXJ A;  4FAP A;  4ZPW R;  1OWQ A;  3EY6 A;  3O5F A;  3NTP A;  1KT1 A;  2WLY A;  3WD3 A;  4Q22 A;  1FAP A;  4KR0 B;  1D6O A;  3TC5 A;  1H0I A;  3PRB A;  2WLZ A;  1D7H A;  3AS2 A;  5GQB A;  5HW7 A;  2K8I A;  1GRJ A;  2YBU A;  1W1Y A;  3KAG A;  2XP7 A;  1E6R A;  5B8I C;  3H9R B;  4N19 A;  1TFV A;  1B6C A;  4G2P A;  2PV1 A;  4L3N A;  1HKJ A;  2Y78 A;  5HT1 A;  2MLY A;  2DT3 A;  4ODO A;  1E6Z A;  2MLZ A;  3EIP A;  4ML4 A;  2IF4 A;  3GPK A;  3AS1 A;  5HKG A;  3O5P A;  1HJW A;  2LKN A;  3UQA A;  2LPV A;  1U79 A;  1NWT A;  1FFQ A;  3RM8 A;  3KZ7 A;  3FXY A;  1OGG A;  4JFK A;  4QZV B;  3KAD A;  3O5D A;  2RUD A;  1LQ0 A;  5D75 A;  2XPA A;  3CHF A;  2N87 A;  4ODL A;  1P5Q A;  1TCO C;  3IKD A;  4MNJ A;  4WKA A;  4MNM A;  1D7J A;  3O5J A;  4Z2L A;  2OLH A;  4P8U A;  1JNS A;  1EYM A;  3CHE A;  2XP8 A;  1BKF A;  3OOB A;  1JVW A;  3WQW A;  1NMW A;  4ITZ A;  3RME A;  4DRO A;  1QPL A;  2KE0 A;  3ARU A;  3CGM A;  4JYS A;  1HXV A;  1FKJ A;  3W4R A;  1ZCN A;  3CHD A;  2DT0 A;  1NH6 A;  3ALG A;  4MSP A;  5HW6 A;  4LAX A;  1QZ2 A;  5DIT A;  3UF8 A;  2G8Z A;  3O5G A;  5JH8 A;  1EIB A;  1JCH B;  3I6C A;  3GTY X;  1A7X A;  1NWS A;  4IQ2 A;  4LAV A;  2ZQT A;  2RUR A;  2LGO A;  2F21 A;  1E9L A;  1PIN A;  2G41 A;  3B9D A;  2RUQ A;  3AS0 A;  3O5I A;  1FKT A;  4ODM A;  1FD9 A;  2MLX A;  2D9F A;  1VF8 A; 
#chains in the Genus database with same CATH homology
 4WIW A;  1Q6U A;  5HWB A;  3AS3 A;  5GPG A;  4ODR A;  2PV2 A;  1UR8 A;  4JFM A;  2JZV A;  1LL6 A;  1R9H A;  1J4H A;  1J6Y A;  3ART A;  4J4N A;  4TW6 A;  2PBC A;  1ZL1 A;  3WD0 A;  1PBK A;  2RSE A;  4DZ3 A;  1E6P A;  4DH0 A;  1FKK A;  1EQ3 A;  4S3K A;  2MNT A;  1FFR A;  1GUV A;  2FDM A;  2DSU A;  4J4O A;  1L1P A;  4P8W A;  1FKB A;  3UI5 A;  2VCD A;  4U85 A;  4DRP A;  2A3E A;  3RM4 A;  3B9E A;  3G6L A;  1Y0O A;  2XP6 A;  3G6M A;  3BXW A;  4TW8 A;  4TYO A;  1W9V A;  4ZPT R;  1HKM A;  4MAV A;  4W9Q A;  1FKH A;  1FKF A;  2XP4 A;  2L2S A;  3WQV A;  3O5O A;  1WNO A;  4G50 A;  1YW5 A;  2RQS A;  1ZB5 A;  4Q7N A;  1ZU8 A;  3ALF A;  2MF9 A;  5HWC A;  4JFJ A;  1E6N A;  3UI6 A;  1YAT A;  1HJV A;  4TW7 A;  2AOS A;  2A3A A;  3B8S A;  1EHN A;  1Q6I A;  1HKK A;  3RFW A;  3KAI A;  2ZR4 A;  4QT2 A;  4XAK A;  5DO2 A;  1FKL A;  2DT1 A;  3ARW A;  1LJY A;  4IPX A;  3RM9 A;  5DEZ A;  1WAW A;  4IQC A;  4NSB A;  3ARX A;  4MPK A;  2QF8 A;  4DIP A;  1FKD A;  4DRQ A;  4ZS6 A;  2RUC A;  4DRM A;  4MGV A;  4P8V A;  1KFW A;  3UQI A;  4NZC A;  2DG4 A;  4GGQ A;  4DT4 A;  1NWR A;  3NI6 A;  3O5M A;  2VN1 A;  3FAP A;  2A3B A;  3ARV A;  3ARY A;  4MNL A;  4DWS A;  4W9O A;  1NMV A;  2MPH A;  3ARR A;  3B7X A;  5DF0 A;  1X6L A;  3CZ8 A;  2ESC A;  4WK9 A;  4JFL A;  1K9T A;  1W26 A;  2DG3 A;  3KAH A;  4U84 A;  1C9H A;  2PPP A;  4DRH A;  4WKH A;  1JND A;  1W9P A;  3VAW A;  4L72 B;  4IT6 A;  2DSZ A;  1IX5 A;  4DRI A;  1M5Y A;  1LL7 A;  1W9U A;  1H0G A;  2AWG A;  5I98 A;  3ODK A;  3IHZ A;  4R0X A;  3KCE A;  5DIU A;  3PA7 A;  3IK8 A;  3UI4 A;  1ZBK A;  4LAW A;  1NSG A;  4ODK A;  1JNT A;  2WK2 A;  1FKR A;  3ARO A;  4P8X A;  1ZBV A;  2FKE A;  4O2T A;  4U86 A;  1X6N A;  4TNS A;  3TDB A;  1Q6H A;  3KAC A;  2PPO A;  4DZ2 A;  2YBT A;  1E15 A;  4AY1 A;  3WIJ A;  1RD6 A;  3WD4 A;  2ZQU A;  5HBF A;  4Z2K A;  1ROU A;  5DIV A;  2ZQS A;  1FJD A;  4KQZ A;  4R5E A;  3JYJ A;  4DRJ A;  1GOI A;  5HTG A;  4WKF A;  1W1T A;  3CGN A;  3O5L A;  4DRN A;  1D7I A;  4DWS C;  2O9O A;  4W9P A;  1EDQ A;  4ZPV R;  2WM0 A;  1HJX A;  2M1I A;  3O5R A;  2DT2 A;  3ARP A;  1W1V A;  3PRD A;  3KAB A;  2KR7 A;  4NNR A;  2B31 A;  4C02 B;  1LL4 A;  1D2K A;  4ODQ A;  1JNE A;  1ROT A;  4MTV A;  4FN2 A;  2KGJ A;  3O5K A;  3CH9 A;  3O5E A;  1LG2 A;  4Z2I A;  2XP9 A;  1GPF A;  1SR0 A;  1CTN A;  2XPB A;  4JFI A;  1WB0 A;  3IKG A;  2ZR6 A;  2XP3 A;  1FKG A;  3AQU A;  1SYT A;  3QOK A;  4URI A;  4HBE A;  1UR9 A;  2IUZ A;  1LG1 A;  1FKI A;  1N1A A;  2Q5A A;  3CHC A;  4ODP A;  2M08 A;  4HBO A;  3RGC A;  1W1P A;  1QPF A;  1ZBC A;  2F2D A;  2LJ4 A;  2O92 A;  4Z2G A;  2ITK A;  2KO7 A;  1KT0 A;  4S3J A;  1J4R A;  3MDY B;  3WKZ A;  3LUO A;  2DSW A;  2A3C A;  3WL0 A;  4PTM A;  3NRK A;  2KI3 A;  2OFN A;  1O6I A;  4DWS B;  2FAP A;  3JXV A;  1ZK6 A;  4Z2J A;  1F8A B;  2KFW A;  4DRK A;  5J6E A;  2DPE A;  1F40 A;  4QIB A;  1T11 A;  2PPN A;  4IT4 A;  3JYM A;  2DG9 A;  2ZR5 A;  2ZQV A;  4MNK A;  4GIV A;  3OA5 A;  1OGB A;  3WL1 A;  3KAF A;  4HAR A;  1XRV A;  5HW8 A;  3PRA A;  5HUA A;  4ODN A;  3O5Q A;  4BF8 A;  2DSV A;  3PR9 A;  3WD1 A;  2M2A A;  1BL4 A;  1NWU A;  3B9A A;  3TCZ A;  3UQB A;  2XP5 A;  4LAY A;  3ARS A;  1HKI A;  2UZ5 A;  3FY1 A;  3WD2 A;  2PV3 A;  4WJX A;  4DWS D;  1ZBW A;  3WH0 A;  4Z2H A;  4W5U A;  4TX0 A;  2PI6 A;  4LGX A;  1FKS A;  3ARQ A;  3ARZ A;  2F4E A;  1J4I A;  1XHG A;  1ITX A;  5GPR A;  1Q1C A;  4QT3 A;  5BXJ A;  4FAP A;  4ZPW R;  1OWQ A;  3EY6 A;  3O5F A;  3NTP A;  1KT1 A;  2WLY A;  3WD3 A;  4Q22 A;  1FAP A;  4KR0 B;  1D6O A;  3TC5 A;  1H0I A;  3PRB A;  2WLZ A;  1D7H A;  3AS2 A;  5GQB A;  5HW7 A;  2K8I A;  2YBU A;  1W1Y A;  3KAG A;  2XP7 A;  1E6R A;  5B8I C;  3H9R B;  4N19 A;  1TFV A;  1B6C A;  4G2P A;  2PV1 A;  4L3N A;  1HKJ A;  2Y78 A;  5HT1 A;  2MLY A;  2DT3 A;  4ODO A;  1E6Z A;  2MLZ A;  4ML4 A;  2IF4 A;  3GPK A;  3AS1 A;  5HKG A;  3O5P A;  1HJW A;  2LKN A;  3UQA A;  2LPV A;  1U79 A;  1NWT A;  1FFQ A;  3RM8 A;  3KZ7 A;  3FXY A;  1OGG A;  4JFK A;  4QZV B;  3KAD A;  3O5D A;  2RUD A;  1LQ0 A;  5D75 A;  2XPA A;  3CHF A;  2N87 A;  4ODL A;  1P5Q A;  1TCO C;  3IKD A;  4MNJ A;  4WKA A;  4MNM A;  1D7J A;  3O5J A;  4Z2L A;  2OLH A;  4P8U A;  1JNS A;  1EYM A;  3CHE A;  2XP8 A;  1BKF A;  3OOB A;  1JVW A;  3WQW A;  1NMW A;  4ITZ A;  3RME A;  4DRO A;  1QPL A;  2KE0 A;  3ARU A;  3CGM A;  4JYS A;  1HXV A;  1FKJ A;  3W4R A;  1ZCN A;  3CHD A;  2DT0 A;  1NH6 A;  3ALG A;  4MSP A;  5HW6 A;  4LAX A;  1QZ2 A;  5DIT A;  3UF8 A;  2G8Z A;  3O5G A;  5JH8 A;  1EIB A;  3I6C A;  1A7X A;  1NWS A;  4IQ2 A;  4LAV A;  2ZQT A;  2RUR A;  2LGO A;  2F21 A;  1E9L A;  1PIN A;  2G41 A;  3B9D A;  2RUQ A;  3AS0 A;  3O5I A;  1FKT A;  4ODM A;  1FD9 A;  2MLX A;  2D9F A;  1VF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...