5HUAA

Structure of c. glabrata fkbp12-fk506 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
SETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 27
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5huaA00
1FKLA 1J4HA 5J6EA 4NNRA 3UQAA 4U85A 2F2DA 3PRDA 3O5GA 1J4IA 1Q6UA 2LPVA 2Q5AA 1FD9A 3JYMA 3O5MA 3TCZA 3KAIA 3KZ7A 3VAWA 4DROA 3LUOA 2D9FA 3O5PA 2PPOA 3KAHA 2MLXA 4BF8A 3IK8A 1FKGA 1C9HA 1ROUA 2VN1A 1D6OA 2N87A 2ZQTA 3PRBA 4G2PA 4IQ2A 4O2TA 2F4EA 3TDBA 5HKGA 1J4RA 4LAWA 2ITKA 2PV3A 1FKHA 3O5DA 1HXVA 2OFNA 1D7JA 1P5QA 1QZ2A 2RURA 2KFWA 4ITZA 4ODKA 3I6CA 4DRNA 3UQBA 1B6CA 2XP3A 2KR7A 2LJ4A 4ODMA 2FKEA 2LGOA 2DG4A 4MSPA 3RGCA 2JZVA 4DRIA 4MGVA 5HTGA 4TYOA 2ZQSA 4QT3A 1BKFA 3O5FA 3UF8A 3UI5A 2XPAA 3CGMA 1FKSA 4ODLA 3KAGA 1FAPA 4W9OA 1FKIA 2L2SA 4LAXA 2XP7A 1Q1CA 1W26A 4ODPA 2PPPA 3O5EA 4DIPA 4W9QA 4R0XA 2LKNA 1FKJA 1ZCNA 2XP8A 3H9RB 1J6YA 3O5KA 1QPFA 1D7HA 1FJDA 5HW8A 5DIUA 1QPLA 3CGNA 1BL4A 2UZ5A 3WH0A 2MPHA 1N1AA 3JYJA 3UQIA 4J4OA 2RUCA 4G50A 3UI6A 2RUQA 3PA7A 2ZR5A 2MNTA 1PINA 3IKGA 1KT1A 2PBCA 3KACA 3GPKA 5GPGA 4DRPA 1EYMA 3O5OA 4GIVA 4ODOA 3B7XA 1U79A 4QIBA 2PV1A 2M08A 2AWGA 2VCDA 4JFMA 4TW6A 4DRJA 2KI3A 2M1IA 4JYSA 5DIVA 5BXJA 2F21A 4TX0A 2PV2A 5HUAA 2DG9A 2KE0A 3KCEA 2XP5A 1FKRA 3FAPA 3O5LA 1JNTA 5HWCA 4FN2A 4JFKA 4QT2A 1YW5A 2ZQVA 5HW6A 1L1PA 2DG3A 2ZR6A 5HW7A 1PBKA 1Q6HA 3IKDA 3MDYB 1Q6IA 1T11A 2K8IA 2RUDA 2XP6A 2KGJA 3O5QA 4J4NA 4LAYA 4U86A 4DRQA 4DZ2A 5I98A 3OOBA 1D7IA 1NMVA 2RQSA 1A7XA 3ODKA 1F8AB 4TW8A 3O5IA 3O5JA 4N19A 2ZR4A 1TCOC 1Y0OA 2PPNA 4JFLA 4LAVA 4DT4A 2ZQUA 1FKBA 1F40A 4C02B 5HT1A 1ROTA 5B8IC 3TC5A 2MF9A 3NTPA 3JXVA 4JFJA 3KABA 1ZK6A 3NI6A 1FKTA 2Y78A 1FKDA 3IHZA 5DITA 4DRKA 5HWBA 1NSGA 2MLYA 3KADA 4GGQA 2FAPA 2XP4A 1KT0A 4DRMA 1JVWA 4TNSA 4DH0A 4U84A 4TW7A 4DRHA 1YATA 2RSEA 1FKKA 4ODRA 4IPXA 4DZ3A 4FAPA 2MLZA 3O5RA 2M2AA 2KO7A 4W9PA 4JFIA 5D75A 1JNSA 2XPBA 4ODNA 3NRKA 4ODQA 1R9HA 1M5YA 2IF4A 3KAFA 1EQ3A 1FKFA 2XP9A 3UI4A 4IQCA 1NMWA 3EY6A 3RFWA
chains in the Genus database with same CATH superfamily
1XRVA 1J4HA 1LG2A 3UQAA 2F2DA 4ZPTR 2DT0A 1X6NA 3TCZA 4WKAA 2MLXA 1FKGA 3WD1A 3ALFA 2VN1A 4G2PA 3PRBA 2O92A 3ALGA 5HKGA 2F4EA 1HXVA 1D7JA 4ITZA 3GU0A 3B9AA 4DRNA 4ODMA 4P8UA 2FKEA 2JZVA 4ZPVR 4MGVA 4DRIA 1BKFA 1OGBA 1FKSA 4ODLA 4W9OA 2XP7A 2DT2A 1Q1CA 4S3KA 4R0XA 4KR0B 3O5KA 2DSVA 1VF8A 1BL4A 2MPHA 1W1YA 3UQIA 2QF8A 2RUQA 3PA7A 1ZBVA 1KT1A 4IT6A 1XHGA 3GPKA 4GIVA 1U79A 4AY1A 2PV1A 2M08A 4JFMA 2WLZA 1NWSA 4DRJA 2M1IA 2ETNA 1UR8A 2PV2A 2XP5A 3CHEA 2DSUA 1JNEA 3MDYB 3IKDA 1W9VA 3G6MA 2K8IA 4QZVB 4DRQA 2XP6A 2KGJA 5I98A 4DZ2A 3OOBA 3AS3A 2IUZA 2DPEA 4LGXA 2PPNA 3FXYA 1D2KA 1ZK6A 1FKTA 5DITA 3RM8A 5HWBA 2MLYA 4GGQA 2PN0A 1RD6A 4DRHA 1FKKA 4UDMA 2MLZA 2KO7A 1JNSA 1LL4A 3KAFA 3WD3A 1NMWA 3EY6A 1OWQA 4MAVA 1GRJA 1E44A 4NNRA 3ARYA 1J4IA 1Q6UA 3O5MA 2Q5AA 3JYMA 4L72B 4DROA 3RM9A 5HW6A 2D9FA 3O5PA 4BF8A 1E9LA 2DSZA 4MNLA 4O2TA 1HKKA 4IQ2A 1D6OA 2ZQTA 3WQVA 2YBUA 1OGGA 3ARTA 4DWSA 3ARPA 2ITKA 1QZ2A 4Q7NA 3UQBA 2KR7A 4Z2LA 4PTMA 1EDQA 2XPAA 1WNOA 1UR9A 1NWUA 3KAGA 1H0IA 1W26A 2A3CA 1W1TA 5HBFA 4DIPA 1ZBWA 2LKNA 2XP8A 3H9RB 1E6NA 4MNMA 4Z2IA 5HW8A 1GUVA 2UZ5A 3WH0A 1W9PA 1HJWA 5DF0A 4J4OA 3WD2A 4G50A 1NWRA 1ZL1A 3QOKA 3B7XA 4TW6A 1NWTA 2KI3A 5DIVA 2F21A 1CTNA 1JNDA 3ARQA 3FAPA 4IT4A 4WJXA 4JFKA 3RMEA 4WKFA 1PBKA 1Q6IA 3O5QA 1K9TA 4P8XA 1NH6A 2EULA 2B31A 3ARRA 1SYTA 3O5JA 4N19A 2ZR4A 1TCOC 1Y0OA 2O9OA 4HBOA 4JFLA 1F40A 1HJXA 4C02B 5HT1A 1O6IA 1W1VA 3JXVA 3KABA 3NI6A 1ZU8A 3CHDA 2Y78A 4P8WA 1ZBKA 1NSGA 3AS1A 3KADA 2XP4A 4TNSA 1EIBA 3CZ8A 4U84A 5DEZA 2M2AA 4W9PA 3ARZA 4KQZA 1KFWA 1R9HA 2FDMA 2XP9A 1L1PA 4L3NA 2PI6A 3WKZA 5J6EA 1H0GA 3PRDA 2DT3A 4MTVA 4Z2KA 3VAWA 5BXJA 1FD9A 2DT1A 3KAIA 3KZ7A 3GTYX 4Q22A 3KAHA 2A3BA 3IK8A 5JH8A 1ROUA 5GQBA 2P4VA 3OA5A 1LJYA 4LAWA 1JCHB 3G6LA 4ML4A 2OFNA 3WIJA 4ODKA 2KFWA 1LG1A 3I6CA 1B6CA 3ARXA 3ARWA 4URIA 3AS2A 2AOSA 4MSPA 2DG4A 1X6LA 4TYOA 3UF8A 3UI5A 1FAPA 2L2SA 4WKHA 4LAXA 3CHCA 3O5EA 3WL1A 5GPRA 1FKJA 1ZCNA 1J6YA 3ARUA 3AROA 1QPFA 1LQ0A 4MPKA 1FJDA 4WK9A 3CGNA 4Z2JA 1N1AA 4MNKA 3JYJA 2RUCA 2YBTA 1IX5A 3EIPA 2ZR5A 3IKGA 2PBCA 2F23A 5GPGA 4DRPA 1EYMA 4ODOA 3AS0A 4DWSB 2VCDA 1SR0A 3PRAA 4JYSA 5HUAA 4P8VA 2KE0A 3KCEA 1FFQA 1HJVA 1FKRA 1JNTA 4FN2A 4ZPWR 1YW5A 2ZQVA 4ZS6A 4W5UA 5HW7A 1Q6HA 3BXWA 1E6PA 4J4NA 4NSBA 4U86A 2RUDA 3FY1A 4LAYA 3B9EA 1GPFA 1WAWA 3WQWA 1NMVA 2RQSA 1A7XA 1ZB5A 4TW8A 3O5IA 4DT4A 4LAVA 3W4RA 1FKBA 4JFJA 2G8ZA 3IHZA 3WD0A 1E15A 3B9DA 4DRMA 1JVWA 4DH0A 1YATA 4IPXA 3O5RA 2ESCA 4NZCA 1W9UA 4JFIA 3WD4A 4XAKA 3NRKA 4ODQA 3UI4A 1ZBCA 4IQCA 3RFWA 1FKLA 1ITXA 4U85A 3O5GA 1FFRA 1LL7A 2LPVA 3ARSA 2A3EA 3LUOA 1LL6A 2PPOA 1TFVA 1C9HA 5DIUA 3TDBA 2N87A 3CH9A 1J4RA 2WM0A 4DWSC 2PV3A 1FKHA 3O5DA 1P5QA 2RURA 3B8SA 2XP3A 3PR9A 4HARA 2LJ4A 2LGOA 3RGCA 5HTGA 2ZQSA 4QT3A 3O5FA 1HKIA 3CGMA 4R5EA 3BMBA 1FKIA 3CHFA 1E6RA 3WL0A 2DSWA 4ODPA 2PPPA 4W9QA 2WK2A 2A3AA 1D7HA 3AQUA 1QPLA 4Z2GA 1HKMA 3UI6A 2MNTA 1PINA 3KACA 3O5OA 4QIBA 2AWGA 1GOIA 3RM4A 1WB0A 4S3JA 4TX0A 2DG9A 3O5LA 1HKJA 5HWCA 4QT2A 4MNJA 3ARVA 2DG3A 2ZR6A 5DO2A 5D75A 1W1PA 1T11A 2G41A 1E6ZA 1D7IA 2OLHA 3ODKA 1F8AB 4WIWA 2ZQUA 1ROTA 5B8IC 3TC5A 2MF9A 3NTPA 2B5UB 4DRKA 1FKDA 1EHNA 4HBEA 2FAPA 1KT0A 2WLYA 4TW7A 2RSEA 4ODRA 4DZ3A 4FAPA 2XPBA 4ODNA 4DWSD 1M5YA 2IF4A 1EQ3A 1FKFA 4Z2HA
chains in the Genus database with same CATH topology
1XRVA 1J4HA 1LG2A 3UQAA 2F2DA 4ZPTR 2DT0A 1X6NA 3TCZA 4WKAA 2MLXA 1FKGA 3WD1A 3ALFA 2VN1A 4G2PA 3PRBA 2O92A 3ALGA 5HKGA 2F4EA 1HXVA 1D7JA 4ITZA 3B9AA 4DRNA 4ODMA 4P8UA 2FKEA 2JZVA 4ZPVR 4MGVA 4DRIA 1BKFA 1OGBA 1FKSA 4ODLA 4W9OA 2XP7A 2DT2A 1Q1CA 4S3KA 4R0XA 4KR0B 3O5KA 2DSVA 1VF8A 1BL4A 2MPHA 1W1YA 3UQIA 2QF8A 2RUQA 3PA7A 1ZBVA 1KT1A 4IT6A 1XHGA 3GPKA 4GIVA 1U79A 4AY1A 2PV1A 2M08A 4JFMA 2WLZA 1NWSA 4DRJA 2M1IA 1UR8A 2PV2A 2XP5A 3CHEA 2DSUA 1JNEA 3MDYB 3IKDA 1W9VA 3G6MA 2K8IA 4QZVB 4DRQA 2XP6A 2KGJA 5I98A 4DZ2A 3OOBA 3AS3A 2IUZA 2DPEA 4LGXA 2PPNA 3FXYA 1D2KA 1ZK6A 1FKTA 5DITA 3RM8A 5HWBA 2MLYA 4GGQA 1RD6A 4DRHA 1FKKA 2MLZA 2KO7A 1JNSA 1LL4A 3KAFA 3WD3A 1NMWA 3EY6A 1OWQA 4MAVA 4NNRA 3ARYA 1J4IA 1Q6UA 3O5MA 2Q5AA 3JYMA 4L72B 4DROA 3RM9A 5HW6A 2D9FA 3O5PA 4BF8A 1E9LA 2DSZA 4MNLA 4O2TA 1HKKA 4IQ2A 1D6OA 2ZQTA 3WQVA 2YBUA 1OGGA 3ARTA 4DWSA 3ARPA 2ITKA 1QZ2A 4Q7NA 3UQBA 2KR7A 4Z2LA 4PTMA 1EDQA 2XPAA 1WNOA 1UR9A 1NWUA 3KAGA 1H0IA 1W26A 2A3CA 1W1TA 5HBFA 4DIPA 1ZBWA 2LKNA 2XP8A 3H9RB 1E6NA 4MNMA 4Z2IA 5HW8A 1GUVA 2UZ5A 3WH0A 1W9PA 1HJWA 5DF0A 4J4OA 3WD2A 4G50A 1NWRA 1ZL1A 3QOKA 3B7XA 4TW6A 1NWTA 2KI3A 5DIVA 2F21A 1CTNA 1JNDA 3ARQA 3FAPA 4IT4A 4WJXA 4JFKA 3RMEA 4WKFA 1PBKA 1Q6IA 3O5QA 1K9TA 4P8XA 1NH6A 2B31A 3ARRA 1SYTA 3O5JA 4N19A 2ZR4A 1TCOC 1Y0OA 2O9OA 4HBOA 4JFLA 1F40A 1HJXA 4C02B 5HT1A 1O6IA 1W1VA 3JXVA 3KABA 3NI6A 1ZU8A 3CHDA 2Y78A 4P8WA 1ZBKA 1NSGA 3AS1A 3KADA 2XP4A 4TNSA 1EIBA 3CZ8A 4U84A 5DEZA 2M2AA 4W9PA 3ARZA 4KQZA 1KFWA 1R9HA 2FDMA 2XP9A 1L1PA 4L3NA 2PI6A 3WKZA 5J6EA 1H0GA 3PRDA 2DT3A 4MTVA 4Z2KA 3VAWA 5BXJA 1FD9A 2DT1A 3KAIA 3KZ7A 4Q22A 3KAHA 2A3BA 3IK8A 5JH8A 1ROUA 5GQBA 3OA5A 1LJYA 4LAWA 3G6LA 4ML4A 2OFNA 3WIJA 4ODKA 2KFWA 1LG1A 3I6CA 1B6CA 3ARXA 3ARWA 4URIA 3AS2A 2AOSA 4MSPA 2DG4A 1X6LA 4TYOA 3UF8A 3UI5A 1FAPA 2L2SA 4WKHA 4LAXA 3CHCA 3O5EA 3WL1A 5GPRA 1FKJA 1ZCNA 1J6YA 3ARUA 3AROA 1QPFA 1LQ0A 4MPKA 1FJDA 4WK9A 3CGNA 4Z2JA 1N1AA 4MNKA 3JYJA 2RUCA 2YBTA 1IX5A 2ZR5A 3IKGA 2PBCA 5GPGA 4DRPA 1EYMA 4ODOA 3AS0A 4DWSB 2VCDA 1SR0A 3PRAA 4JYSA 5HUAA 4P8VA 2KE0A 3KCEA 1FFQA 1HJVA 1FKRA 1JNTA 4FN2A 4ZPWR 1YW5A 2ZQVA 4ZS6A 4W5UA 5HW7A 1Q6HA 3BXWA 1E6PA 4J4NA 4NSBA 4U86A 2RUDA 3FY1A 4LAYA 3B9EA 1GPFA 1WAWA 3WQWA 1NMVA 2RQSA 1A7XA 1ZB5A 4TW8A 3O5IA 4DT4A 4LAVA 3W4RA 1FKBA 4JFJA 2G8ZA 3IHZA 3WD0A 1E15A 3B9DA 4DRMA 1JVWA 4DH0A 1YATA 4IPXA 3O5RA 2ESCA 4NZCA 1W9UA 4JFIA 3WD4A 4XAKA 3NRKA 4ODQA 3UI4A 1ZBCA 4IQCA 3RFWA 1FKLA 1ITXA 4U85A 3O5GA 1FFRA 1LL7A 2LPVA 3ARSA 2A3EA 3LUOA 1LL6A 2PPOA 1TFVA 1C9HA 5DIUA 3TDBA 2N87A 3CH9A 1J4RA 2WM0A 4DWSC 2PV3A 1FKHA 3O5DA 1P5QA 2RURA 3B8SA 2XP3A 3PR9A 4HARA 2LJ4A 2LGOA 3RGCA 5HTGA 2ZQSA 4QT3A 3O5FA 1HKIA 3CGMA 4R5EA 1FKIA 3CHFA 1E6RA 3WL0A 2DSWA 4ODPA 2PPPA 4W9QA 2WK2A 2A3AA 1D7HA 3AQUA 1QPLA 4Z2GA 1HKMA 3UI6A 2MNTA 1PINA 3KACA 3O5OA 4QIBA 2AWGA 1GOIA 3RM4A 1WB0A 4S3JA 4TX0A 2DG9A 3O5LA 1HKJA 5HWCA 4QT2A 4MNJA 3ARVA 2DG3A 2ZR6A 5DO2A 5D75A 1W1PA 1T11A 2G41A 1E6ZA 1D7IA 2OLHA 3ODKA 1F8AB 4WIWA 2ZQUA 1ROTA 5B8IC 3TC5A 2MF9A 3NTPA 4DRKA 1FKDA 1EHNA 4HBEA 2FAPA 1KT0A 2WLYA 4TW7A 2RSEA 4ODRA 4DZ3A 4FAPA 2XPBA 4ODNA 4DWSD 1M5YA 2IF4A 1EQ3A 1FKFA 4Z2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKL A;  1J4H A;  5J6E A;  4NNR A;  3UQA A;  4U85 A;  2F2D A;  3PRD A;  3O5G A;  1J4I A;  1Q6U A;  2LPV A;  2Q5A A;  1FD9 A;  3JYM A;  3O5M A;  3TCZ A;  3KAI A;  3KZ7 A;  3VAW A;  4DRO A;  3LUO A;  2D9F A;  3O5P A;  2PPO A;  3KAH A;  2MLX A;  4BF8 A;  3IK8 A;  1FKG A;  1C9H A;  1ROU A;  2VN1 A;  1D6O A;  2N87 A;  2ZQT A;  3PRB A;  4G2P A;  4IQ2 A;  4O2T A;  2F4E A;  3TDB A;  5HKG A;  1J4R A;  4LAW A;  2ITK A;  2PV3 A;  1FKH A;  3O5D A;  1HXV A;  2OFN A;  1D7J A;  1P5Q A;  1QZ2 A;  2RUR A;  2KFW A;  4ITZ A;  4ODK A;  3I6C A;  4DRN A;  3UQB A;  1B6C A;  2XP3 A;  2KR7 A;  2LJ4 A;  4ODM A;  2FKE A;  2LGO A;  2DG4 A;  4MSP A;  3RGC A;  2JZV A;  4DRI A;  4MGV A;  5HTG A;  4TYO A;  2ZQS A;  4QT3 A;  1BKF A;  3O5F A;  3UF8 A;  3UI5 A;  2XPA A;  3CGM A;  1FKS A;  4ODL A;  3KAG A;  1FAP A;  4W9O A;  1FKI A;  2L2S A;  4LAX A;  2XP7 A;  1Q1C A;  1W26 A;  4ODP A;  2PPP A;  3O5E A;  4DIP A;  4W9Q A;  4R0X A;  2LKN A;  1FKJ A;  1ZCN A;  2XP8 A;  3H9R B;  1J6Y A;  3O5K A;  1QPF A;  1D7H A;  1FJD A;  5HW8 A;  5DIU A;  1QPL A;  3CGN A;  1BL4 A;  2UZ5 A;  3WH0 A;  2MPH A;  1N1A A;  3JYJ A;  3UQI A;  4J4O A;  2RUC A;  4G50 A;  3UI6 A;  2RUQ A;  3PA7 A;  2ZR5 A;  2MNT A;  1PIN A;  3IKG A;  1KT1 A;  2PBC A;  3KAC A;  3GPK A;  5GPG A;  4DRP A;  1EYM A;  3O5O A;  4GIV A;  4ODO A;  3B7X A;  1U79 A;  4QIB A;  2PV1 A;  2M08 A;  2AWG A;  2VCD A;  4JFM A;  4TW6 A;  4DRJ A;  2KI3 A;  2M1I A;  4JYS A;  5DIV A;  5BXJ A;  2F21 A;  4TX0 A;  2PV2 A;  5HUA A;  2DG9 A;  2KE0 A;  3KCE A;  2XP5 A;  1FKR A;  3FAP A;  3O5L A;  1JNT A;  5HWC A;  4FN2 A;  4JFK A;  4QT2 A;  1YW5 A;  2ZQV A;  5HW6 A;  1L1P A;  2DG3 A;  2ZR6 A;  5HW7 A;  1PBK A;  1Q6H A;  3IKD A;  3MDY B;  1Q6I A;  1T11 A;  2K8I A;  2RUD A;  2XP6 A;  2KGJ A;  3O5Q A;  4J4N A;  4LAY A;  4U86 A;  4DRQ A;  4DZ2 A;  5I98 A;  3OOB A;  1D7I A;  1NMV A;  2RQS A;  1A7X A;  3ODK A;  1F8A B;  4TW8 A;  3O5I A;  3O5J A;  4N19 A;  2ZR4 A;  1TCO C;  1Y0O A;  2PPN A;  4JFL A;  4LAV A;  4DT4 A;  2ZQU A;  1FKB A;  1F40 A;  4C02 B;  5HT1 A;  1ROT A;  5B8I C;  3TC5 A;  2MF9 A;  3NTP A;  3JXV A;  4JFJ A;  3KAB A;  1ZK6 A;  3NI6 A;  1FKT A;  2Y78 A;  1FKD A;  3IHZ A;  5DIT A;  4DRK A;  5HWB A;  1NSG A;  2MLY A;  3KAD A;  4GGQ A;  2FAP A;  2XP4 A;  1KT0 A;  4DRM A;  1JVW A;  4TNS A;  4DH0 A;  4U84 A;  4TW7 A;  4DRH A;  1YAT A;  2RSE A;  1FKK A;  4ODR A;  4IPX A;  4DZ3 A;  4FAP A;  2MLZ A;  3O5R A;  2M2A A;  2KO7 A;  4W9P A;  4JFI A;  5D75 A;  1JNS A;  2XPB A;  4ODN A;  3NRK A;  4ODQ A;  1R9H A;  1M5Y A;  2IF4 A;  3KAF A;  1EQ3 A;  1FKF A;  2XP9 A;  3UI4 A;  4IQC A;  1NMW A;  3EY6 A;  3RFW A; 
#chains in the Genus database with same CATH topology
 1XRV A;  1J4H A;  1LG2 A;  3UQA A;  2F2D A;  4ZPT R;  2DT0 A;  1X6N A;  3TCZ A;  4WKA A;  2MLX A;  1FKG A;  3WD1 A;  3ALF A;  2VN1 A;  4G2P A;  3PRB A;  2O92 A;  3ALG A;  5HKG A;  2F4E A;  1HXV A;  1D7J A;  4ITZ A;  3GU0 A;  3B9A A;  4DRN A;  4ODM A;  4P8U A;  2FKE A;  2JZV A;  4ZPV R;  4MGV A;  4DRI A;  1BKF A;  1OGB A;  1FKS A;  4ODL A;  4W9O A;  2XP7 A;  2DT2 A;  1Q1C A;  4S3K A;  4R0X A;  4KR0 B;  3O5K A;  2DSV A;  1VF8 A;  1BL4 A;  2MPH A;  1W1Y A;  3UQI A;  2QF8 A;  2RUQ A;  3PA7 A;  1ZBV A;  1KT1 A;  4IT6 A;  1XHG A;  3GPK A;  4GIV A;  1U79 A;  4AY1 A;  2PV1 A;  2M08 A;  4JFM A;  2WLZ A;  1NWS A;  4DRJ A;  2M1I A;  2ETN A;  1UR8 A;  2PV2 A;  2XP5 A;  3CHE A;  2DSU A;  1JNE A;  3MDY B;  3IKD A;  1W9V A;  3G6M A;  2K8I A;  4QZV B;  4DRQ A;  2XP6 A;  2KGJ A;  5I98 A;  4DZ2 A;  3OOB A;  3AS3 A;  2IUZ A;  2DPE A;  4LGX A;  2PPN A;  3FXY A;  1D2K A;  1ZK6 A;  1FKT A;  5DIT A;  3RM8 A;  5HWB A;  2MLY A;  4GGQ A;  2PN0 A;  1RD6 A;  4DRH A;  1FKK A;  4UDM A;  2MLZ A;  2KO7 A;  1JNS A;  1LL4 A;  3KAF A;  3WD3 A;  1NMW A;  3EY6 A;  1OWQ A;  4MAV A;  1GRJ A;  1E44 A;  4NNR A;  3ARY A;  1J4I A;  1Q6U A;  3O5M A;  2Q5A A;  3JYM A;  4L72 B;  4DRO A;  3RM9 A;  5HW6 A;  2D9F A;  3O5P A;  4BF8 A;  1E9L A;  2DSZ A;  4MNL A;  4O2T A;  1HKK A;  4IQ2 A;  1D6O A;  2ZQT A;  3WQV A;  2YBU A;  1OGG A;  3ART A;  4DWS A;  3ARP A;  2ITK A;  1QZ2 A;  4Q7N A;  3UQB A;  2KR7 A;  4Z2L A;  4PTM A;  1EDQ A;  2XPA A;  1WNO A;  1UR9 A;  1NWU A;  3KAG A;  1H0I A;  1W26 A;  2A3C A;  1W1T A;  5HBF A;  4DIP A;  1ZBW A;  2LKN A;  2XP8 A;  3H9R B;  1E6N A;  4MNM A;  4Z2I A;  5HW8 A;  1GUV A;  2UZ5 A;  3WH0 A;  1W9P A;  1HJW A;  5DF0 A;  4J4O A;  3WD2 A;  4G50 A;  1NWR A;  1ZL1 A;  3QOK A;  3B7X A;  4TW6 A;  1NWT A;  2KI3 A;  5DIV A;  2F21 A;  1CTN A;  1JND A;  3ARQ A;  3FAP A;  4IT4 A;  4WJX A;  4JFK A;  3RME A;  4WKF A;  1PBK A;  1Q6I A;  3O5Q A;  1K9T A;  4P8X A;  1NH6 A;  2EUL A;  2B31 A;  3ARR A;  1SYT A;  3O5J A;  4N19 A;  2ZR4 A;  1TCO C;  1Y0O A;  2O9O A;  4HBO A;  4JFL A;  1F40 A;  1HJX A;  4C02 B;  5HT1 A;  1O6I A;  1W1V A;  3JXV A;  3KAB A;  3NI6 A;  1ZU8 A;  3CHD A;  2Y78 A;  4P8W A;  1ZBK A;  1NSG A;  3AS1 A;  3KAD A;  2XP4 A;  4TNS A;  1EIB A;  3CZ8 A;  4U84 A;  5DEZ A;  2M2A A;  4W9P A;  3ARZ A;  4KQZ A;  1KFW A;  1R9H A;  2FDM A;  2XP9 A;  1L1P A;  4L3N A;  2PI6 A;  3WKZ A;  5J6E A;  1H0G A;  3PRD A;  2DT3 A;  4MTV A;  4Z2K A;  3VAW A;  5BXJ A;  1FD9 A;  2DT1 A;  3KAI A;  3KZ7 A;  3GTY X;  4Q22 A;  3KAH A;  2A3B A;  3IK8 A;  5JH8 A;  1ROU A;  5GQB A;  2P4V A;  3OA5 A;  1LJY A;  4LAW A;  1JCH B;  3G6L A;  4ML4 A;  2OFN A;  3WIJ A;  4ODK A;  2KFW A;  1LG1 A;  3I6C A;  1B6C A;  3ARX A;  3ARW A;  4URI A;  3AS2 A;  2AOS A;  4MSP A;  2DG4 A;  1X6L A;  4TYO A;  3UF8 A;  3UI5 A;  1FAP A;  2L2S A;  4WKH A;  4LAX A;  3CHC A;  3O5E A;  3WL1 A;  5GPR A;  1FKJ A;  1ZCN A;  1J6Y A;  3ARU A;  3ARO A;  1QPF A;  1LQ0 A;  4MPK A;  1FJD A;  4WK9 A;  3CGN A;  4Z2J A;  1N1A A;  4MNK A;  3JYJ A;  2RUC A;  2YBT A;  1IX5 A;  3EIP A;  2ZR5 A;  3IKG A;  2PBC A;  2F23 A;  5GPG A;  4DRP A;  1EYM A;  4ODO A;  3AS0 A;  4DWS B;  2VCD A;  1SR0 A;  3PRA A;  4JYS A;  5HUA A;  4P8V A;  2KE0 A;  3KCE A;  1FFQ A;  1HJV A;  1FKR A;  1JNT A;  4FN2 A;  4ZPW R;  1YW5 A;  2ZQV A;  4ZS6 A;  4W5U A;  5HW7 A;  1Q6H A;  3BXW A;  1E6P A;  4J4N A;  4NSB A;  4U86 A;  2RUD A;  3FY1 A;  4LAY A;  3B9E A;  1GPF A;  1WAW A;  3WQW A;  1NMV A;  2RQS A;  1A7X A;  1ZB5 A;  4TW8 A;  3O5I A;  4DT4 A;  4LAV A;  3W4R A;  1FKB A;  4JFJ A;  2G8Z A;  3IHZ A;  3WD0 A;  1E15 A;  3B9D A;  4DRM A;  1JVW A;  4DH0 A;  1YAT A;  4IPX A;  3O5R A;  2ESC A;  4NZC A;  1W9U A;  4JFI A;  3WD4 A;  4XAK A;  3NRK A;  4ODQ A;  3UI4 A;  1ZBC A;  4IQC A;  3RFW A;  1FKL A;  1ITX A;  4U85 A;  3O5G A;  1FFR A;  1LL7 A;  2LPV A;  3ARS A;  2A3E A;  3LUO A;  1LL6 A;  2PPO A;  1TFV A;  1C9H A;  5DIU A;  3TDB A;  2N87 A;  3CH9 A;  1J4R A;  2WM0 A;  4DWS C;  2PV3 A;  1FKH A;  3O5D A;  1P5Q A;  2RUR A;  3B8S A;  2XP3 A;  3PR9 A;  4HAR A;  2LJ4 A;  2LGO A;  3RGC A;  5HTG A;  2ZQS A;  4QT3 A;  3O5F A;  1HKI A;  3CGM A;  4R5E A;  3BMB A;  1FKI A;  3CHF A;  1E6R A;  3WL0 A;  2DSW A;  4ODP A;  2PPP A;  4W9Q A;  2WK2 A;  2A3A A;  1D7H A;  3AQU A;  1QPL A;  4Z2G A;  1HKM A;  3UI6 A;  2MNT A;  1PIN A;  3KAC A;  3O5O A;  4QIB A;  2AWG A;  1GOI A;  3RM4 A;  1WB0 A;  4S3J A;  4TX0 A;  2DG9 A;  3O5L A;  1HKJ A;  5HWC A;  4QT2 A;  4MNJ A;  3ARV A;  2DG3 A;  2ZR6 A;  5DO2 A;  5D75 A;  1W1P A;  1T11 A;  2G41 A;  1E6Z A;  1D7I A;  2OLH A;  3ODK A;  1F8A B;  4WIW A;  2ZQU A;  1ROT A;  5B8I C;  3TC5 A;  2MF9 A;  3NTP A;  2B5U B;  4DRK A;  1FKD A;  1EHN A;  4HBE A;  2FAP A;  1KT0 A;  2WLY A;  4TW7 A;  2RSE A;  4ODR A;  4DZ3 A;  4FAP A;  2XPB A;  4ODN A;  4DWS D;  1M5Y A;  2IF4 A;  1EQ3 A;  1FKF A;  4Z2H A; 
#chains in the Genus database with same CATH homology
 1XRV A;  1J4H A;  1LG2 A;  3UQA A;  2F2D A;  4ZPT R;  2DT0 A;  1X6N A;  3TCZ A;  4WKA A;  2MLX A;  1FKG A;  3WD1 A;  3ALF A;  2VN1 A;  4G2P A;  3PRB A;  2O92 A;  3ALG A;  5HKG A;  2F4E A;  1HXV A;  1D7J A;  4ITZ A;  3B9A A;  4DRN A;  4ODM A;  4P8U A;  2FKE A;  2JZV A;  4ZPV R;  4MGV A;  4DRI A;  1BKF A;  1OGB A;  1FKS A;  4ODL A;  4W9O A;  2XP7 A;  2DT2 A;  1Q1C A;  4S3K A;  4R0X A;  4KR0 B;  3O5K A;  2DSV A;  1VF8 A;  1BL4 A;  2MPH A;  1W1Y A;  3UQI A;  2QF8 A;  2RUQ A;  3PA7 A;  1ZBV A;  1KT1 A;  4IT6 A;  1XHG A;  3GPK A;  4GIV A;  1U79 A;  4AY1 A;  2PV1 A;  2M08 A;  4JFM A;  2WLZ A;  1NWS A;  4DRJ A;  2M1I A;  1UR8 A;  2PV2 A;  2XP5 A;  3CHE A;  2DSU A;  1JNE A;  3MDY B;  3IKD A;  1W9V A;  3G6M A;  2K8I A;  4QZV B;  4DRQ A;  2XP6 A;  2KGJ A;  5I98 A;  4DZ2 A;  3OOB A;  3AS3 A;  2IUZ A;  2DPE A;  4LGX A;  2PPN A;  3FXY A;  1D2K A;  1ZK6 A;  1FKT A;  5DIT A;  3RM8 A;  5HWB A;  2MLY A;  4GGQ A;  1RD6 A;  4DRH A;  1FKK A;  2MLZ A;  2KO7 A;  1JNS A;  1LL4 A;  3KAF A;  3WD3 A;  1NMW A;  3EY6 A;  1OWQ A;  4MAV A;  4NNR A;  3ARY A;  1J4I A;  1Q6U A;  3O5M A;  2Q5A A;  3JYM A;  4L72 B;  4DRO A;  3RM9 A;  5HW6 A;  2D9F A;  3O5P A;  4BF8 A;  1E9L A;  2DSZ A;  4MNL A;  4O2T A;  1HKK A;  4IQ2 A;  1D6O A;  2ZQT A;  3WQV A;  2YBU A;  1OGG A;  3ART A;  4DWS A;  3ARP A;  2ITK A;  1QZ2 A;  4Q7N A;  3UQB A;  2KR7 A;  4Z2L A;  4PTM A;  1EDQ A;  2XPA A;  1WNO A;  1UR9 A;  1NWU A;  3KAG A;  1H0I A;  1W26 A;  2A3C A;  1W1T A;  5HBF A;  4DIP A;  1ZBW A;  2LKN A;  2XP8 A;  3H9R B;  1E6N A;  4MNM A;  4Z2I A;  5HW8 A;  1GUV A;  2UZ5 A;  3WH0 A;  1W9P A;  1HJW A;  5DF0 A;  4J4O A;  3WD2 A;  4G50 A;  1NWR A;  1ZL1 A;  3QOK A;  3B7X A;  4TW6 A;  1NWT A;  2KI3 A;  5DIV A;  2F21 A;  1CTN A;  1JND A;  3ARQ A;  3FAP A;  4IT4 A;  4WJX A;  4JFK A;  3RME A;  4WKF A;  1PBK A;  1Q6I A;  3O5Q A;  1K9T A;  4P8X A;  1NH6 A;  2B31 A;  3ARR A;  1SYT A;  3O5J A;  4N19 A;  2ZR4 A;  1TCO C;  1Y0O A;  2O9O A;  4HBO A;  4JFL A;  1F40 A;  1HJX A;  4C02 B;  5HT1 A;  1O6I A;  1W1V A;  3JXV A;  3KAB A;  3NI6 A;  1ZU8 A;  3CHD A;  2Y78 A;  4P8W A;  1ZBK A;  1NSG A;  3AS1 A;  3KAD A;  2XP4 A;  4TNS A;  1EIB A;  3CZ8 A;  4U84 A;  5DEZ A;  2M2A A;  4W9P A;  3ARZ A;  4KQZ A;  1KFW A;  1R9H A;  2FDM A;  2XP9 A;  1L1P A;  4L3N A;  2PI6 A;  3WKZ A;  5J6E A;  1H0G A;  3PRD A;  2DT3 A;  4MTV A;  4Z2K A;  3VAW A;  5BXJ A;  1FD9 A;  2DT1 A;  3KAI A;  3KZ7 A;  4Q22 A;  3KAH A;  2A3B A;  3IK8 A;  5JH8 A;  1ROU A;  5GQB A;  3OA5 A;  1LJY A;  4LAW A;  3G6L A;  4ML4 A;  2OFN A;  3WIJ A;  4ODK A;  2KFW A;  1LG1 A;  3I6C A;  1B6C A;  3ARX A;  3ARW A;  4URI A;  3AS2 A;  2AOS A;  4MSP A;  2DG4 A;  1X6L A;  4TYO A;  3UF8 A;  3UI5 A;  1FAP A;  2L2S A;  4WKH A;  4LAX A;  3CHC A;  3O5E A;  3WL1 A;  5GPR A;  1FKJ A;  1ZCN A;  1J6Y A;  3ARU A;  3ARO A;  1QPF A;  1LQ0 A;  4MPK A;  1FJD A;  4WK9 A;  3CGN A;  4Z2J A;  1N1A A;  4MNK A;  3JYJ A;  2RUC A;  2YBT A;  1IX5 A;  2ZR5 A;  3IKG A;  2PBC A;  5GPG A;  4DRP A;  1EYM A;  4ODO A;  3AS0 A;  4DWS B;  2VCD A;  1SR0 A;  3PRA A;  4JYS A;  5HUA A;  4P8V A;  2KE0 A;  3KCE A;  1FFQ A;  1HJV A;  1FKR A;  1JNT A;  4FN2 A;  4ZPW R;  1YW5 A;  2ZQV A;  4ZS6 A;  4W5U A;  5HW7 A;  1Q6H A;  3BXW A;  1E6P A;  4J4N A;  4NSB A;  4U86 A;  2RUD A;  3FY1 A;  4LAY A;  3B9E A;  1GPF A;  1WAW A;  3WQW A;  1NMV A;  2RQS A;  1A7X A;  1ZB5 A;  4TW8 A;  3O5I A;  4DT4 A;  4LAV A;  3W4R A;  1FKB A;  4JFJ A;  2G8Z A;  3IHZ A;  3WD0 A;  1E15 A;  3B9D A;  4DRM A;  1JVW A;  4DH0 A;  1YAT A;  4IPX A;  3O5R A;  2ESC A;  4NZC A;  1W9U A;  4JFI A;  3WD4 A;  4XAK A;  3NRK A;  4ODQ A;  3UI4 A;  1ZBC A;  4IQC A;  3RFW A;  1FKL A;  1ITX A;  4U85 A;  3O5G A;  1FFR A;  1LL7 A;  2LPV A;  3ARS A;  2A3E A;  3LUO A;  1LL6 A;  2PPO A;  1TFV A;  1C9H A;  5DIU A;  3TDB A;  2N87 A;  3CH9 A;  1J4R A;  2WM0 A;  4DWS C;  2PV3 A;  1FKH A;  3O5D A;  1P5Q A;  2RUR A;  3B8S A;  2XP3 A;  3PR9 A;  4HAR A;  2LJ4 A;  2LGO A;  3RGC A;  5HTG A;  2ZQS A;  4QT3 A;  3O5F A;  1HKI A;  3CGM A;  4R5E A;  1FKI A;  3CHF A;  1E6R A;  3WL0 A;  2DSW A;  4ODP A;  2PPP A;  4W9Q A;  2WK2 A;  2A3A A;  1D7H A;  3AQU A;  1QPL A;  4Z2G A;  1HKM A;  3UI6 A;  2MNT A;  1PIN A;  3KAC A;  3O5O A;  4QIB A;  2AWG A;  1GOI A;  3RM4 A;  1WB0 A;  4S3J A;  4TX0 A;  2DG9 A;  3O5L A;  1HKJ A;  5HWC A;  4QT2 A;  4MNJ A;  3ARV A;  2DG3 A;  2ZR6 A;  5DO2 A;  5D75 A;  1W1P A;  1T11 A;  2G41 A;  1E6Z A;  1D7I A;  2OLH A;  3ODK A;  1F8A B;  4WIW A;  2ZQU A;  1ROT A;  5B8I C;  3TC5 A;  2MF9 A;  3NTP A;  4DRK A;  1FKD A;  1EHN A;  4HBE A;  2FAP A;  1KT0 A;  2WLY A;  4TW7 A;  2RSE A;  4ODR A;  4DZ3 A;  4FAP A;  2XPB A;  4ODN A;  4DWS D;  1M5Y A;  2IF4 A;  1EQ3 A;  1FKF A;  4Z2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...