5HUAA

Structure of c. glabrata fkbp12-fk506 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
SETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
total genus 27
structure length 113
sequence length 113
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5huaA00
1YW5A 5HW6A 3O5LA 1YATA 4N19A 3FAPA 2ZR4A 3KAGA 5DIVA 3UQIA 1J4IA 4W9PA 2MNTA 4ODMA 1JNSA 4ODPA 2XP5A 2RUQA 2MLZA 3JYJA 1Q6HA 2FAPA 3LUOA 3ODKA 2KFWA 2F21A 1KT1A 3H9RB 3KCEA 4TW6A 2PV3A 4DZ3A 3UQBA 2M1IA 2DG3A 1C9HA 5DIUA 3OOBA 2MLXA 4IQ2A 4QT3A 1ROTA 1FKDA 2XP9A 1FD9A 3TC5A 1N1AA 2F2DA 2AWGA 1R9HA 3NRKA 3VAWA 3TDBA 3IKGA 4ODOA 1B6CA 2RUCA 4ODNA 2PPPA 3NTPA 4DT4A 1FKFA 4JFJA 4TNSA 4DRPA 3KACA 5HKGA 5J6EA 3O5DA 1J6YA 2PPNA 1NMWA 3WH0A 3I6CA 1A7XA 5HTGA 1J4HA 4J4OA 4DROA 4DRJA 4DRKA 2DG9A 1TCOC 1T11A 5HWCA 1JVWA 4W9OA 3O5PA 2K8IA 4ODKA 4C02B 4G50A 1KT0A 1NSGA 2DG4A 4TX0A 3RGCA 2FKEA 3O5JA 3UI6A 2PV1A 3UI5A 3UF8A 1Q6IA 1F40A 1BKFA 2ZQUA 4TYOA 5HUAA 2Y78A 3O5GA 1EQ3A 1ZK6A 2PV2A 2L2SA 3UQAA 1ROUA 4DRHA 5D75A 4DRMA 3KAIA 4ODLA 1Y0OA 2D9FA 2RSEA 3KAHA 4U86A 2ITKA 4DRNA 5HWBA 2ZQVA 4R0XA 1P5QA 3IKDA 2MLYA 3CGNA 3EY6A 5DITA 1L1PA 1FAPA 1Q6UA 3UI4A 3MDYB 1Q1CA 5BXJA 4W9QA 3RFWA 3TCZA 1FKKA 4U84A 1ZCNA 4J4NA 4DRIA 4JFIA 2RURA 2LPVA 4JFMA 5I98A 2KR7A 2VCDA 2OFNA 3KAFA 1U79A 4NNRA 1FKSA 4DIPA 2RQSA 1QPLA 4JFKA 4LAXA 1QPFA 3O5QA 3IHZA 3IK8A 4MGVA 2PPOA 1FKIA 3O5IA 2PBCA 1EYMA 3B7XA 4IQCA 4FN2A 2LGOA 1W26A 1NMVA 2JZVA 3PA7A 3PRDA 1FKLA 1M5YA 4MSPA 1J4RA 4DH0A 5HW7A 1D7HA 1PINA 3JYMA 2F4EA 2M2AA 1PBKA 2XPAA 2XP6A 3PRBA 3KABA 4ODQA 2MF9A 1FKBA 3JXVA 4QIBA 4G2PA 1FKHA 4GIVA 3O5EA 2XP3A 2XP4A 1QZ2A 2ZQSA 2XPBA 2KO7A 3O5RA 3O5MA 2Q5AA 3CGMA 2KE0A 2N87A 2ZQTA 4IPXA 5GPGA 2ZR6A 4BF8A 1HXVA 2M08A 1D7JA 1JNTA 2LJ4A 2XP8A 4FAPA 4TW7A 1FKJA 2VN1A 4GGQA 4LAYA 5B8IC 3GPKA 3O5KA 2IF4A 3NI6A 4ODRA 2LKNA 1FKTA 2MPHA 5HT1A 1BL4A 3O5OA 1D6OA 4JFLA 2XP7A 1D7IA 3KZ7A 4O2TA 1FJDA 2UZ5A 2KI3A 1FKGA 3KADA 1FKRA 4JYSA 4LAWA 3O5FA 2KGJA 2ZR5A 4ITZA 4U85A 5HW8A 1F8AB 4DRQA 4TW8A 4LAVA 4QT2A 4DZ2A 2RUDA
chains in the Genus database with same CATH superfamily
4N19A 4WKHA 3UQIA 4W9PA 4ODMA 2XP5A 3JYJA 1LL6A 3ARVA 5DF0A 1LL7A 2DG3A 5DIUA 3FXYA 4QT3A 2MLXA 1E6PA 4IQ2A 1ROTA 1FKDA 2XP9A 4S3KA 3NRKA 3TDBA 4L3NA 3NTPA 3ARUA 1E9LA 2PPNA 2DPEA 3ARYA 1VF8A 1KFWA 3CZ8A 3ARPA 1JVWA 4W9OA 4C02B 2DG4A 3GTYX 2G8ZA 1CTNA 1BKFA 3EIPA 3O5GA 4ML4A 4UDMA 1OGGA 4ZPWR 4ZS6A 1Y0OA 1E15A 2D9FA 3KAHA 2ZQVA 4R0XA 2MLYA 3CGNA 3AS3A 1H0IA 5DITA 4HBEA 3MDYB 1Q1CA 5BXJA 1FKKA 3ARXA 1ZCNA 1LJYA 4J4NA 4DRIA 2A3BA 2RURA 4P8WA 2KR7A 2OFNA 3KAFA 4DIPA 4JFKA 1QPFA 3IK8A 4P8VA 1FKIA 4Z2JA 3B7XA 3PR9A 3PRDA 1LG1A 2YBTA 3PA7A 3CHCA 4MNJA 1J4RA 3CHFA 3AS1A 3ALGA 2WK2A 3RM8A 1NWSA 2WLZA 2XP6A 5GPRA 2MF9A 3JXVA 1ZL1A 4GIVA 1HJVA 1QZ2A 1SR0A 4MAVA 3CGMA 4WKFA 4P8XA 5GPGA 2ZR6A 2QF8A 2PN0A 5B8IC 2IF4A 1NWRA 2LKNA 1FKTA 4AY1A 4HARA 1D7IA 4WKAA 3WKZA 3WD3A 2KI3A 4WJXA 3O5FA 2B5UB 2ESCA 1F8AB 1ZBVA 4KR0B 3B8SA 4DRQA 4LAVA 4DZ2A 4IT4A 3O5LA 3FAPA 1OGBA 5DO2A 4ODPA 2DSUA 3H9RB 1KT1A 1E6ZA 4DZ3A 3UQBA 2M1IA 3TC5A 1W9PA 1HKMA 3VAWA 1EIBA 1FKFA 3AQUA 1LG2A 5HTGA 2DSZA 4J4OA 3PRAA 3CHDA 5HWCA 3O5PA 1NSGA 3UF8A 1Q6IA 5JH8A 4TYOA 1GRJA 2Y78A 3B9DA 1ZK6A 1ROUA 5D75A 4DRMA 3B9AA 2RSEA 4U86A 5HWBA 2ITKA 3ARRA 1P5QA 3IKDA 4R5EA 1FAPA 2DT3A 2DT1A 3RM4A 2A3CA 4W9QA 3RFWA 2LPVA 4JFMA 3W4RA 5I98A 2VCDA 2RQSA 4MGVA 3RGCA 1H0GA 1W9VA 3O5IA 1WB0A 4IQCA 4Z2IA 1F40A 1W26A 1W1VA 2JZVA 4MSPA 1HJXA 1D7HA 1PINA 3RM9A 1HKIA 4MPKA 2M2AA 3BXWA 3KABA 1FKBA 4QIBA 2XP4A 4DWSA 3O5RA 2Q5AA 3OA5A 3GU0A 2M08A 1JNTA 4S3JA 2VN1A 4GGQA 4LAYA 2WM0A 2DSVA 4ZPTR 3NI6A 4ODRA 2MPHA 1D6OA 1FFRA 4O2TA 1FJDA 1JCHB 2UZ5A 1HKJA 2ETNA 4DWSC 4U85A 2KGJA 4ITZA 3AROA 4TW8A 1K9TA 4QT2A 1W9UA 3O5MA 1YW5A 5HW6A 1W1TA 5DIVA 3KAGA 1J4IA 3WQWA 2MNTA 1JNSA 2RUQA 2FAPA 2KFWA 3KCEA 1X6NA 4MNLA 4TW6A 2PV3A 1E44A 1C9HA 1HKKA 3OOBA 1FD9A 1EHNA 2F2DA 1NWTA 2RUCA 1LQ0A 1GPFA 2PPPA 4JFJA 4TNSA 4DRPA 3KACA 5J6EA 3O5DA 2A3EA 1NMWA 3WH0A 1A7XA 1J4HA 4DROA 4HBOA 1WNOA 3WD2A 4DRJA 4DRKA 2DSWA 1W1YA 1JNEA 2DT2A 3B9EA 2O9OA 3ALFA 1E6NA 1XRVA 2FKEA 2P4VA 3O5JA 3WL0A 3WD0A 4QZVB 2ZQUA 5HUAA 3FY1A 2G41A 1HJWA 4DWSD 2PV2A 1WAWA 4L72B 3KAIA 4ODLA 4DRNA 4MNMA 3CHEA 3EY6A 1L1PA 1UR8A 3WD1A 3TCZA 1ZBCA 1O6IA 4JFIA 3RMEA 1NWUA 4NNRA 5GQBA 1QPLA 1UR9A 1LL4A 2EULA 2PBCA 1EYMA 2LGOA 1NMVA 2B31A 1FKLA 4DH0A 1ZB5A 3JYMA 1PBKA 2XPAA 4ODQA 5DEZA 4WIWA 4Z2HA 3O5EA 3WQVA 2F23A 2IUZA 2XPBA 2KE0A 2N87A 4IPXA 2LJ4A 1SYTA 4TW7A 5HT1A 4KQZA 4JFLA 4Q7NA 2XP7A 1OWQA 1FKRA 5HW8A 2RUDA 1GOIA 1YATA 2ZR4A 2O92A 4XAKA 1JNDA 1XHGA 2MLZA 1Q6HA 3LUOA 3ODKA 2F21A 1X6LA 1GUVA 1N1AA 2AWGA 1R9HA 4MNKA 4WK9A 3IKGA 4ODOA 1B6CA 4ODNA 4DT4A 5HKGA 1J6YA 2WLYA 3QOKA 1FFQA 2DT0A 5HBFA 3I6CA 4PTMA 2DG9A 3ARWA 1TCOC 1T11A 2K8IA 4ODKA 4G50A 1KT0A 4TX0A 3UI5A 3UI6A 2PV1A 4ZPVR 4Z2LA 3WL1A 4IT6A 1W1PA 4Q22A 2PI6A 1EQ3A 2L2SA 1ZBWA 3UQAA 3ARSA 4DRHA 1RD6A 3G6LA 4LGXA 4DWSB 4Z2GA 4NSBA 1Q6UA 3UI4A 4W5UA 2FDMA 3ARTA 3CH9A 4U84A 3WIJA 1EDQA 3WD4A 4MTVA 1U79A 1FKSA 4LAXA 3O5QA 3IHZA 3BMBA 2PPOA 4P8UA 4FN2A 5HW7A 1M5YA 2OLHA 3ARZA 2AOSA 1E6RA 1D2KA 1ZBKA 2F4EA 3PRBA 4Z2KA 4G2PA 1FKHA 2XP3A 2ZQSA 2KO7A 1TFVA 2ZQTA 4BF8A 1HXVA 2XP8A 1ITXA 1D7JA 3G6MA 4FAPA 4NZCA 1IX5A 3AS0A 1FKJA 2A3AA 4URIA 3GPKA 3O5KA 1BL4A 2YBUA 3O5OA 3KZ7A 3AS2A 1FKGA 1NH6A 3KADA 4JYSA 4LAWA 2ZR5A 1ZU8A 3ARQA
chains in the Genus database with same CATH topology
4N19A 4WKHA 3UQIA 4W9PA 4ODMA 2XP5A 3JYJA 1LL6A 3ARVA 5DF0A 1LL7A 2DG3A 5DIUA 3FXYA 4QT3A 2MLXA 1E6PA 4IQ2A 1ROTA 1FKDA 2XP9A 4S3KA 3NRKA 3TDBA 4L3NA 3NTPA 3ARUA 1E9LA 2PPNA 2DPEA 3ARYA 1VF8A 1KFWA 3CZ8A 3ARPA 1JVWA 4W9OA 4C02B 2DG4A 2G8ZA 1CTNA 1BKFA 3O5GA 4ML4A 1OGGA 4ZPWR 4ZS6A 1Y0OA 1E15A 2D9FA 3KAHA 2ZQVA 4R0XA 2MLYA 3CGNA 3AS3A 1H0IA 5DITA 4HBEA 3MDYB 1Q1CA 5BXJA 1FKKA 3ARXA 1ZCNA 1LJYA 4J4NA 4DRIA 2A3BA 2RURA 4P8WA 2KR7A 2OFNA 3KAFA 4DIPA 4JFKA 1QPFA 3IK8A 4P8VA 1FKIA 4Z2JA 3B7XA 3PR9A 3PRDA 1LG1A 2YBTA 3PA7A 3CHCA 4MNJA 1J4RA 3CHFA 3AS1A 3ALGA 2WK2A 3RM8A 1NWSA 2WLZA 2XP6A 5GPRA 2MF9A 3JXVA 1ZL1A 4GIVA 1HJVA 1QZ2A 1SR0A 4MAVA 3CGMA 4WKFA 4P8XA 5GPGA 2ZR6A 2QF8A 5B8IC 2IF4A 1NWRA 2LKNA 1FKTA 4AY1A 4HARA 1D7IA 4WKAA 3WKZA 3WD3A 2KI3A 4WJXA 3O5FA 2ESCA 1F8AB 1ZBVA 4KR0B 3B8SA 4DRQA 4LAVA 4DZ2A 4IT4A 3O5LA 3FAPA 1OGBA 5DO2A 4ODPA 2DSUA 3H9RB 1KT1A 1E6ZA 4DZ3A 3UQBA 2M1IA 3TC5A 1W9PA 1HKMA 3VAWA 1EIBA 1FKFA 3AQUA 1LG2A 5HTGA 2DSZA 4J4OA 3PRAA 3CHDA 5HWCA 3O5PA 1NSGA 3UF8A 1Q6IA 5JH8A 4TYOA 2Y78A 3B9DA 1ZK6A 1ROUA 5D75A 4DRMA 3B9AA 2RSEA 4U86A 5HWBA 2ITKA 3ARRA 1P5QA 3IKDA 4R5EA 1FAPA 2DT3A 2DT1A 3RM4A 2A3CA 4W9QA 3RFWA 2LPVA 4JFMA 3W4RA 5I98A 2VCDA 2RQSA 4MGVA 3RGCA 1H0GA 1W9VA 3O5IA 1WB0A 4IQCA 4Z2IA 1F40A 1W26A 1W1VA 2JZVA 4MSPA 1HJXA 1D7HA 1PINA 3RM9A 1HKIA 4MPKA 2M2AA 3BXWA 3KABA 1FKBA 4QIBA 2XP4A 4DWSA 3O5RA 2Q5AA 3OA5A 2M08A 1JNTA 4S3JA 2VN1A 4GGQA 4LAYA 2WM0A 2DSVA 4ZPTR 3NI6A 4ODRA 2MPHA 1D6OA 1FFRA 4O2TA 1FJDA 2UZ5A 1HKJA 4DWSC 4U85A 2KGJA 4ITZA 3AROA 4TW8A 1K9TA 4QT2A 1W9UA 3O5MA 1YW5A 5HW6A 1W1TA 5DIVA 3KAGA 1J4IA 3WQWA 2MNTA 1JNSA 2RUQA 2FAPA 2KFWA 3KCEA 1X6NA 4MNLA 4TW6A 2PV3A 1C9HA 1HKKA 3OOBA 1FD9A 1EHNA 2F2DA 1NWTA 2RUCA 1LQ0A 1GPFA 2PPPA 4JFJA 4TNSA 4DRPA 3KACA 5J6EA 3O5DA 2A3EA 1NMWA 3WH0A 1A7XA 1J4HA 4DROA 4HBOA 1WNOA 3WD2A 4DRJA 4DRKA 2DSWA 1W1YA 1JNEA 2DT2A 3B9EA 2O9OA 3ALFA 1E6NA 1XRVA 2FKEA 3O5JA 3WL0A 3WD0A 4QZVB 2ZQUA 5HUAA 3FY1A 2G41A 1HJWA 4DWSD 2PV2A 1WAWA 4L72B 3KAIA 4ODLA 4DRNA 4MNMA 3CHEA 3EY6A 1L1PA 1UR8A 3WD1A 3TCZA 1ZBCA 1O6IA 4JFIA 3RMEA 1NWUA 4NNRA 5GQBA 1QPLA 1UR9A 1LL4A 2PBCA 1EYMA 2LGOA 1NMVA 2B31A 1FKLA 4DH0A 1ZB5A 3JYMA 1PBKA 2XPAA 4ODQA 5DEZA 4WIWA 4Z2HA 3O5EA 3WQVA 2IUZA 2XPBA 2KE0A 2N87A 4IPXA 2LJ4A 1SYTA 4TW7A 5HT1A 4KQZA 4JFLA 4Q7NA 2XP7A 1OWQA 1FKRA 5HW8A 2RUDA 1GOIA 1YATA 2ZR4A 2O92A 4XAKA 1JNDA 1XHGA 2MLZA 1Q6HA 3LUOA 3ODKA 2F21A 1X6LA 1GUVA 1N1AA 2AWGA 1R9HA 4MNKA 4WK9A 3IKGA 4ODOA 1B6CA 4ODNA 4DT4A 5HKGA 1J6YA 2WLYA 3QOKA 1FFQA 2DT0A 5HBFA 3I6CA 4PTMA 2DG9A 3ARWA 1TCOC 1T11A 2K8IA 4ODKA 4G50A 1KT0A 4TX0A 3UI5A 3UI6A 2PV1A 4ZPVR 4Z2LA 3WL1A 4IT6A 1W1PA 4Q22A 2PI6A 1EQ3A 2L2SA 1ZBWA 3UQAA 3ARSA 4DRHA 1RD6A 3G6LA 4LGXA 4DWSB 4Z2GA 4NSBA 1Q6UA 3UI4A 4W5UA 2FDMA 3ARTA 3CH9A 4U84A 3WIJA 1EDQA 3WD4A 4MTVA 1U79A 1FKSA 4LAXA 3O5QA 3IHZA 2PPOA 4P8UA 4FN2A 5HW7A 1M5YA 2OLHA 3ARZA 2AOSA 1E6RA 1D2KA 1ZBKA 2F4EA 3PRBA 4Z2KA 4G2PA 1FKHA 2XP3A 2ZQSA 2KO7A 1TFVA 2ZQTA 4BF8A 1HXVA 2XP8A 1ITXA 1D7JA 3G6MA 4FAPA 4NZCA 1IX5A 3AS0A 1FKJA 2A3AA 4URIA 3GPKA 3O5KA 1BL4A 2YBUA 3O5OA 3KZ7A 3AS2A 1FKGA 1NH6A 3KADA 4JYSA 4LAWA 2ZR5A 1ZU8A 3ARQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW5 A;  5HW6 A;  3O5L A;  1YAT A;  4N19 A;  3FAP A;  2ZR4 A;  3KAG A;  5DIV A;  3UQI A;  1J4I A;  4W9P A;  2MNT A;  4ODM A;  1JNS A;  4ODP A;  2XP5 A;  2RUQ A;  2MLZ A;  3JYJ A;  1Q6H A;  2FAP A;  3LUO A;  3ODK A;  2KFW A;  2F21 A;  1KT1 A;  3H9R B;  3KCE A;  4TW6 A;  2PV3 A;  4DZ3 A;  3UQB A;  2M1I A;  2DG3 A;  1C9H A;  5DIU A;  3OOB A;  2MLX A;  4IQ2 A;  4QT3 A;  1ROT A;  1FKD A;  2XP9 A;  1FD9 A;  3TC5 A;  1N1A A;  2F2D A;  2AWG A;  1R9H A;  3NRK A;  3VAW A;  3TDB A;  3IKG A;  4ODO A;  1B6C A;  2RUC A;  4ODN A;  2PPP A;  3NTP A;  4DT4 A;  1FKF A;  4JFJ A;  4TNS A;  4DRP A;  3KAC A;  5HKG A;  5J6E A;  3O5D A;  1J6Y A;  2PPN A;  1NMW A;  3WH0 A;  3I6C A;  1A7X A;  5HTG A;  1J4H A;  4J4O A;  4DRO A;  4DRJ A;  4DRK A;  2DG9 A;  1TCO C;  1T11 A;  5HWC A;  1JVW A;  4W9O A;  3O5P A;  2K8I A;  4ODK A;  4C02 B;  4G50 A;  1KT0 A;  1NSG A;  2DG4 A;  4TX0 A;  3RGC A;  2FKE A;  3O5J A;  3UI6 A;  2PV1 A;  3UI5 A;  3UF8 A;  1Q6I A;  1F40 A;  1BKF A;  2ZQU A;  4TYO A;  5HUA A;  2Y78 A;  3O5G A;  1EQ3 A;  1ZK6 A;  2PV2 A;  2L2S A;  3UQA A;  1ROU A;  4DRH A;  5D75 A;  4DRM A;  3KAI A;  4ODL A;  1Y0O A;  2D9F A;  2RSE A;  3KAH A;  4U86 A;  2ITK A;  4DRN A;  5HWB A;  2ZQV A;  4R0X A;  1P5Q A;  3IKD A;  2MLY A;  3CGN A;  3EY6 A;  5DIT A;  1L1P A;  1FAP A;  1Q6U A;  3UI4 A;  3MDY B;  1Q1C A;  5BXJ A;  4W9Q A;  3RFW A;  3TCZ A;  1FKK A;  4U84 A;  1ZCN A;  4J4N A;  4DRI A;  4JFI A;  2RUR A;  2LPV A;  4JFM A;  5I98 A;  2KR7 A;  2VCD A;  2OFN A;  3KAF A;  1U79 A;  4NNR A;  1FKS A;  4DIP A;  2RQS A;  1QPL A;  4JFK A;  4LAX A;  1QPF A;  3O5Q A;  3IHZ A;  3IK8 A;  4MGV A;  2PPO A;  1FKI A;  3O5I A;  2PBC A;  1EYM A;  3B7X A;  4IQC A;  4FN2 A;  2LGO A;  1W26 A;  1NMV A;  2JZV A;  3PA7 A;  3PRD A;  1FKL A;  1M5Y A;  4MSP A;  1J4R A;  4DH0 A;  5HW7 A;  1D7H A;  1PIN A;  3JYM A;  2F4E A;  2M2A A;  1PBK A;  2XPA A;  2XP6 A;  3PRB A;  3KAB A;  4ODQ A;  2MF9 A;  1FKB A;  3JXV A;  4QIB A;  4G2P A;  1FKH A;  4GIV A;  3O5E A;  2XP3 A;  2XP4 A;  1QZ2 A;  2ZQS A;  2XPB A;  2KO7 A;  3O5R A;  3O5M A;  2Q5A A;  3CGM A;  2KE0 A;  2N87 A;  2ZQT A;  4IPX A;  5GPG A;  2ZR6 A;  4BF8 A;  1HXV A;  2M08 A;  1D7J A;  1JNT A;  2LJ4 A;  2XP8 A;  4FAP A;  4TW7 A;  1FKJ A;  2VN1 A;  4GGQ A;  4LAY A;  5B8I C;  3GPK A;  3O5K A;  2IF4 A;  3NI6 A;  4ODR A;  2LKN A;  1FKT A;  2MPH A;  5HT1 A;  1BL4 A;  3O5O A;  1D6O A;  4JFL A;  2XP7 A;  1D7I A;  3KZ7 A;  4O2T A;  1FJD A;  2UZ5 A;  2KI3 A;  1FKG A;  3KAD A;  1FKR A;  4JYS A;  4LAW A;  3O5F A;  2KGJ A;  2ZR5 A;  4ITZ A;  4U85 A;  5HW8 A;  1F8A B;  4DRQ A;  4TW8 A;  4LAV A;  4QT2 A;  4DZ2 A;  2RUD A; 
#chains in the Genus database with same CATH topology
 4N19 A;  4WKH A;  3UQI A;  4W9P A;  4ODM A;  2XP5 A;  3JYJ A;  1LL6 A;  3ARV A;  5DF0 A;  1LL7 A;  2DG3 A;  5DIU A;  3FXY A;  4QT3 A;  2MLX A;  1E6P A;  4IQ2 A;  1ROT A;  1FKD A;  2XP9 A;  4S3K A;  3NRK A;  3TDB A;  4L3N A;  3NTP A;  3ARU A;  1E9L A;  2PPN A;  2DPE A;  3ARY A;  1VF8 A;  1KFW A;  3CZ8 A;  3ARP A;  1JVW A;  4W9O A;  4C02 B;  2DG4 A;  3GTY X;  2G8Z A;  1CTN A;  1BKF A;  3EIP A;  3O5G A;  4ML4 A;  4UDM A;  1OGG A;  4ZPW R;  4ZS6 A;  1Y0O A;  1E15 A;  2D9F A;  3KAH A;  2ZQV A;  4R0X A;  2MLY A;  3CGN A;  3AS3 A;  1H0I A;  5DIT A;  4HBE A;  3MDY B;  1Q1C A;  5BXJ A;  1FKK A;  3ARX A;  1ZCN A;  1LJY A;  4J4N A;  4DRI A;  2A3B A;  2RUR A;  4P8W A;  2KR7 A;  2OFN A;  3KAF A;  4DIP A;  4JFK A;  1QPF A;  3IK8 A;  4P8V A;  1FKI A;  4Z2J A;  3B7X A;  3PR9 A;  3PRD A;  1LG1 A;  2YBT A;  3PA7 A;  3CHC A;  4MNJ A;  1J4R A;  3CHF A;  3AS1 A;  3ALG A;  2WK2 A;  3RM8 A;  1NWS A;  2WLZ A;  2XP6 A;  5GPR A;  2MF9 A;  3JXV A;  1ZL1 A;  4GIV A;  1HJV A;  1QZ2 A;  1SR0 A;  4MAV A;  3CGM A;  4WKF A;  4P8X A;  5GPG A;  2ZR6 A;  2QF8 A;  2PN0 A;  5B8I C;  2IF4 A;  1NWR A;  2LKN A;  1FKT A;  4AY1 A;  4HAR A;  1D7I A;  4WKA A;  3WKZ A;  3WD3 A;  2KI3 A;  4WJX A;  3O5F A;  2B5U B;  2ESC A;  1F8A B;  1ZBV A;  4KR0 B;  3B8S A;  4DRQ A;  4LAV A;  4DZ2 A;  4IT4 A;  3O5L A;  3FAP A;  1OGB A;  5DO2 A;  4ODP A;  2DSU A;  3H9R B;  1KT1 A;  1E6Z A;  4DZ3 A;  3UQB A;  2M1I A;  3TC5 A;  1W9P A;  1HKM A;  3VAW A;  1EIB A;  1FKF A;  3AQU A;  1LG2 A;  5HTG A;  2DSZ A;  4J4O A;  3PRA A;  3CHD A;  5HWC A;  3O5P A;  1NSG A;  3UF8 A;  1Q6I A;  5JH8 A;  4TYO A;  1GRJ A;  2Y78 A;  3B9D A;  1ZK6 A;  1ROU A;  5D75 A;  4DRM A;  3B9A A;  2RSE A;  4U86 A;  5HWB A;  2ITK A;  3ARR A;  1P5Q A;  3IKD A;  4R5E A;  1FAP A;  2DT3 A;  2DT1 A;  3RM4 A;  2A3C A;  4W9Q A;  3RFW A;  2LPV A;  4JFM A;  3W4R A;  5I98 A;  2VCD A;  2RQS A;  4MGV A;  3RGC A;  1H0G A;  1W9V A;  3O5I A;  1WB0 A;  4IQC A;  4Z2I A;  1F40 A;  1W26 A;  1W1V A;  2JZV A;  4MSP A;  1HJX A;  1D7H A;  1PIN A;  3RM9 A;  1HKI A;  4MPK A;  2M2A A;  3BXW A;  3KAB A;  1FKB A;  4QIB A;  2XP4 A;  4DWS A;  3O5R A;  2Q5A A;  3OA5 A;  3GU0 A;  2M08 A;  1JNT A;  4S3J A;  2VN1 A;  4GGQ A;  4LAY A;  2WM0 A;  2DSV A;  4ZPT R;  3NI6 A;  4ODR A;  2MPH A;  1D6O A;  1FFR A;  4O2T A;  1FJD A;  1JCH B;  2UZ5 A;  1HKJ A;  2ETN A;  4DWS C;  4U85 A;  2KGJ A;  4ITZ A;  3ARO A;  4TW8 A;  1K9T A;  4QT2 A;  1W9U A;  3O5M A;  1YW5 A;  5HW6 A;  1W1T A;  5DIV A;  3KAG A;  1J4I A;  3WQW A;  2MNT A;  1JNS A;  2RUQ A;  2FAP A;  2KFW A;  3KCE A;  1X6N A;  4MNL A;  4TW6 A;  2PV3 A;  1E44 A;  1C9H A;  1HKK A;  3OOB A;  1FD9 A;  1EHN A;  2F2D A;  1NWT A;  2RUC A;  1LQ0 A;  1GPF A;  2PPP A;  4JFJ A;  4TNS A;  4DRP A;  3KAC A;  5J6E A;  3O5D A;  2A3E A;  1NMW A;  3WH0 A;  1A7X A;  1J4H A;  4DRO A;  4HBO A;  1WNO A;  3WD2 A;  4DRJ A;  4DRK A;  2DSW A;  1W1Y A;  1JNE A;  2DT2 A;  3B9E A;  2O9O A;  3ALF A;  1E6N A;  1XRV A;  2FKE A;  2P4V A;  3O5J A;  3WL0 A;  3WD0 A;  4QZV B;  2ZQU A;  5HUA A;  3FY1 A;  2G41 A;  1HJW A;  4DWS D;  2PV2 A;  1WAW A;  4L72 B;  3KAI A;  4ODL A;  4DRN A;  4MNM A;  3CHE A;  3EY6 A;  1L1P A;  1UR8 A;  3WD1 A;  3TCZ A;  1ZBC A;  1O6I A;  4JFI A;  3RME A;  1NWU A;  4NNR A;  5GQB A;  1QPL A;  1UR9 A;  1LL4 A;  2EUL A;  2PBC A;  1EYM A;  2LGO A;  1NMV A;  2B31 A;  1FKL A;  4DH0 A;  1ZB5 A;  3JYM A;  1PBK A;  2XPA A;  4ODQ A;  5DEZ A;  4WIW A;  4Z2H A;  3O5E A;  3WQV A;  2F23 A;  2IUZ A;  2XPB A;  2KE0 A;  2N87 A;  4IPX A;  2LJ4 A;  1SYT A;  4TW7 A;  5HT1 A;  4KQZ A;  4JFL A;  4Q7N A;  2XP7 A;  1OWQ A;  1FKR A;  5HW8 A;  2RUD A;  1GOI A;  1YAT A;  2ZR4 A;  2O92 A;  4XAK A;  1JND A;  1XHG A;  2MLZ A;  1Q6H A;  3LUO A;  3ODK A;  2F21 A;  1X6L A;  1GUV A;  1N1A A;  2AWG A;  1R9H A;  4MNK A;  4WK9 A;  3IKG A;  4ODO A;  1B6C A;  4ODN A;  4DT4 A;  5HKG A;  1J6Y A;  2WLY A;  3QOK A;  1FFQ A;  2DT0 A;  5HBF A;  3I6C A;  4PTM A;  2DG9 A;  3ARW A;  1TCO C;  1T11 A;  2K8I A;  4ODK A;  4G50 A;  1KT0 A;  4TX0 A;  3UI5 A;  3UI6 A;  2PV1 A;  4ZPV R;  4Z2L A;  3WL1 A;  4IT6 A;  1W1P A;  4Q22 A;  2PI6 A;  1EQ3 A;  2L2S A;  1ZBW A;  3UQA A;  3ARS A;  4DRH A;  1RD6 A;  3G6L A;  4LGX A;  4DWS B;  4Z2G A;  4NSB A;  1Q6U A;  3UI4 A;  4W5U A;  2FDM A;  3ART A;  3CH9 A;  4U84 A;  3WIJ A;  1EDQ A;  3WD4 A;  4MTV A;  1U79 A;  1FKS A;  4LAX A;  3O5Q A;  3IHZ A;  3BMB A;  2PPO A;  4P8U A;  4FN2 A;  5HW7 A;  1M5Y A;  2OLH A;  3ARZ A;  2AOS A;  1E6R A;  1D2K A;  1ZBK A;  2F4E A;  3PRB A;  4Z2K A;  4G2P A;  1FKH A;  2XP3 A;  2ZQS A;  2KO7 A;  1TFV A;  2ZQT A;  4BF8 A;  1HXV A;  2XP8 A;  1ITX A;  1D7J A;  3G6M A;  4FAP A;  4NZC A;  1IX5 A;  3AS0 A;  1FKJ A;  2A3A A;  4URI A;  3GPK A;  3O5K A;  1BL4 A;  2YBU A;  3O5O A;  3KZ7 A;  3AS2 A;  1FKG A;  1NH6 A;  3KAD A;  4JYS A;  4LAW A;  2ZR5 A;  1ZU8 A;  3ARQ A; 
#chains in the Genus database with same CATH homology
 4N19 A;  4WKH A;  3UQI A;  4W9P A;  4ODM A;  2XP5 A;  3JYJ A;  1LL6 A;  3ARV A;  5DF0 A;  1LL7 A;  2DG3 A;  5DIU A;  3FXY A;  4QT3 A;  2MLX A;  1E6P A;  4IQ2 A;  1ROT A;  1FKD A;  2XP9 A;  4S3K A;  3NRK A;  3TDB A;  4L3N A;  3NTP A;  3ARU A;  1E9L A;  2PPN A;  2DPE A;  3ARY A;  1VF8 A;  1KFW A;  3CZ8 A;  3ARP A;  1JVW A;  4W9O A;  4C02 B;  2DG4 A;  2G8Z A;  1CTN A;  1BKF A;  3O5G A;  4ML4 A;  1OGG A;  4ZPW R;  4ZS6 A;  1Y0O A;  1E15 A;  2D9F A;  3KAH A;  2ZQV A;  4R0X A;  2MLY A;  3CGN A;  3AS3 A;  1H0I A;  5DIT A;  4HBE A;  3MDY B;  1Q1C A;  5BXJ A;  1FKK A;  3ARX A;  1ZCN A;  1LJY A;  4J4N A;  4DRI A;  2A3B A;  2RUR A;  4P8W A;  2KR7 A;  2OFN A;  3KAF A;  4DIP A;  4JFK A;  1QPF A;  3IK8 A;  4P8V A;  1FKI A;  4Z2J A;  3B7X A;  3PR9 A;  3PRD A;  1LG1 A;  2YBT A;  3PA7 A;  3CHC A;  4MNJ A;  1J4R A;  3CHF A;  3AS1 A;  3ALG A;  2WK2 A;  3RM8 A;  1NWS A;  2WLZ A;  2XP6 A;  5GPR A;  2MF9 A;  3JXV A;  1ZL1 A;  4GIV A;  1HJV A;  1QZ2 A;  1SR0 A;  4MAV A;  3CGM A;  4WKF A;  4P8X A;  5GPG A;  2ZR6 A;  2QF8 A;  5B8I C;  2IF4 A;  1NWR A;  2LKN A;  1FKT A;  4AY1 A;  4HAR A;  1D7I A;  4WKA A;  3WKZ A;  3WD3 A;  2KI3 A;  4WJX A;  3O5F A;  2ESC A;  1F8A B;  1ZBV A;  4KR0 B;  3B8S A;  4DRQ A;  4LAV A;  4DZ2 A;  4IT4 A;  3O5L A;  3FAP A;  1OGB A;  5DO2 A;  4ODP A;  2DSU A;  3H9R B;  1KT1 A;  1E6Z A;  4DZ3 A;  3UQB A;  2M1I A;  3TC5 A;  1W9P A;  1HKM A;  3VAW A;  1EIB A;  1FKF A;  3AQU A;  1LG2 A;  5HTG A;  2DSZ A;  4J4O A;  3PRA A;  3CHD A;  5HWC A;  3O5P A;  1NSG A;  3UF8 A;  1Q6I A;  5JH8 A;  4TYO A;  2Y78 A;  3B9D A;  1ZK6 A;  1ROU A;  5D75 A;  4DRM A;  3B9A A;  2RSE A;  4U86 A;  5HWB A;  2ITK A;  3ARR A;  1P5Q A;  3IKD A;  4R5E A;  1FAP A;  2DT3 A;  2DT1 A;  3RM4 A;  2A3C A;  4W9Q A;  3RFW A;  2LPV A;  4JFM A;  3W4R A;  5I98 A;  2VCD A;  2RQS A;  4MGV A;  3RGC A;  1H0G A;  1W9V A;  3O5I A;  1WB0 A;  4IQC A;  4Z2I A;  1F40 A;  1W26 A;  1W1V A;  2JZV A;  4MSP A;  1HJX A;  1D7H A;  1PIN A;  3RM9 A;  1HKI A;  4MPK A;  2M2A A;  3BXW A;  3KAB A;  1FKB A;  4QIB A;  2XP4 A;  4DWS A;  3O5R A;  2Q5A A;  3OA5 A;  2M08 A;  1JNT A;  4S3J A;  2VN1 A;  4GGQ A;  4LAY A;  2WM0 A;  2DSV A;  4ZPT R;  3NI6 A;  4ODR A;  2MPH A;  1D6O A;  1FFR A;  4O2T A;  1FJD A;  2UZ5 A;  1HKJ A;  4DWS C;  4U85 A;  2KGJ A;  4ITZ A;  3ARO A;  4TW8 A;  1K9T A;  4QT2 A;  1W9U A;  3O5M A;  1YW5 A;  5HW6 A;  1W1T A;  5DIV A;  3KAG A;  1J4I A;  3WQW A;  2MNT A;  1JNS A;  2RUQ A;  2FAP A;  2KFW A;  3KCE A;  1X6N A;  4MNL A;  4TW6 A;  2PV3 A;  1C9H A;  1HKK A;  3OOB A;  1FD9 A;  1EHN A;  2F2D A;  1NWT A;  2RUC A;  1LQ0 A;  1GPF A;  2PPP A;  4JFJ A;  4TNS A;  4DRP A;  3KAC A;  5J6E A;  3O5D A;  2A3E A;  1NMW A;  3WH0 A;  1A7X A;  1J4H A;  4DRO A;  4HBO A;  1WNO A;  3WD2 A;  4DRJ A;  4DRK A;  2DSW A;  1W1Y A;  1JNE A;  2DT2 A;  3B9E A;  2O9O A;  3ALF A;  1E6N A;  1XRV A;  2FKE A;  3O5J A;  3WL0 A;  3WD0 A;  4QZV B;  2ZQU A;  5HUA A;  3FY1 A;  2G41 A;  1HJW A;  4DWS D;  2PV2 A;  1WAW A;  4L72 B;  3KAI A;  4ODL A;  4DRN A;  4MNM A;  3CHE A;  3EY6 A;  1L1P A;  1UR8 A;  3WD1 A;  3TCZ A;  1ZBC A;  1O6I A;  4JFI A;  3RME A;  1NWU A;  4NNR A;  5GQB A;  1QPL A;  1UR9 A;  1LL4 A;  2PBC A;  1EYM A;  2LGO A;  1NMV A;  2B31 A;  1FKL A;  4DH0 A;  1ZB5 A;  3JYM A;  1PBK A;  2XPA A;  4ODQ A;  5DEZ A;  4WIW A;  4Z2H A;  3O5E A;  3WQV A;  2IUZ A;  2XPB A;  2KE0 A;  2N87 A;  4IPX A;  2LJ4 A;  1SYT A;  4TW7 A;  5HT1 A;  4KQZ A;  4JFL A;  4Q7N A;  2XP7 A;  1OWQ A;  1FKR A;  5HW8 A;  2RUD A;  1GOI A;  1YAT A;  2ZR4 A;  2O92 A;  4XAK A;  1JND A;  1XHG A;  2MLZ A;  1Q6H A;  3LUO A;  3ODK A;  2F21 A;  1X6L A;  1GUV A;  1N1A A;  2AWG A;  1R9H A;  4MNK A;  4WK9 A;  3IKG A;  4ODO A;  1B6C A;  4ODN A;  4DT4 A;  5HKG A;  1J6Y A;  2WLY A;  3QOK A;  1FFQ A;  2DT0 A;  5HBF A;  3I6C A;  4PTM A;  2DG9 A;  3ARW A;  1TCO C;  1T11 A;  2K8I A;  4ODK A;  4G50 A;  1KT0 A;  4TX0 A;  3UI5 A;  3UI6 A;  2PV1 A;  4ZPV R;  4Z2L A;  3WL1 A;  4IT6 A;  1W1P A;  4Q22 A;  2PI6 A;  1EQ3 A;  2L2S A;  1ZBW A;  3UQA A;  3ARS A;  4DRH A;  1RD6 A;  3G6L A;  4LGX A;  4DWS B;  4Z2G A;  4NSB A;  1Q6U A;  3UI4 A;  4W5U A;  2FDM A;  3ART A;  3CH9 A;  4U84 A;  3WIJ A;  1EDQ A;  3WD4 A;  4MTV A;  1U79 A;  1FKS A;  4LAX A;  3O5Q A;  3IHZ A;  2PPO A;  4P8U A;  4FN2 A;  5HW7 A;  1M5Y A;  2OLH A;  3ARZ A;  2AOS A;  1E6R A;  1D2K A;  1ZBK A;  2F4E A;  3PRB A;  4Z2K A;  4G2P A;  1FKH A;  2XP3 A;  2ZQS A;  2KO7 A;  1TFV A;  2ZQT A;  4BF8 A;  1HXV A;  2XP8 A;  1ITX A;  1D7J A;  3G6M A;  4FAP A;  4NZC A;  1IX5 A;  3AS0 A;  1FKJ A;  2A3A A;  4URI A;  3GPK A;  3O5K A;  1BL4 A;  2YBU A;  3O5O A;  3KZ7 A;  3AS2 A;  1FKG A;  1NH6 A;  3KAD A;  4JYS A;  4LAW A;  2ZR5 A;  1ZU8 A;  3ARQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...