1FKIA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 25
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkiA00
1P5QA 1FKKA 4MSPA 4U86A 4U85A 4W9QA 4ODLA 3UQIA 3B7XA 3H9RB 3UI5A 4DRMA 4U84A 4ODRA 3LUOA 4IPXA 1FD9A 3NI6A 4LAVA 3KZ7A 1FKSA 1EYMA 4DRPA 2KE0A 2MPHA 2ZR5A 4DRNA 1NMVA 3IKDA 3GPKA 3KAFA 2RUCA 4TW6A 4NNRA 2DG9A 2N87A 2XP7A 1W26A 3O5IA 4ODMA 4TYOA 3NRKA 1M5YA 4FN2A 5HTGA 2DG4A 4TW7A 4TX0A 1QZ2A 1J4IA 2L2SA 2MF9A 2PBCA 4TNSA 2LJ4A 1C9HA 2MLYA 1ROUA 1NSGA 2XP6A 3KAIA 2D9FA 2F21A 2KFWA 2LGOA 2PV3A 2XP8A 3O5EA 4ODPA 4R0XA 4DRIA 4C02B 2ZQTA 3O5PA 1TCOC 1PBKA 5D75A 2XP3A 5DIVA 2PPPA 4G50A 5I98A 2RSEA 2ZQUA 4DRKA 3O5GA 3PRBA 2KGJA 4ODQA 2PPOA 5HT1A 3KACA 2XP5A 1FKLA 1YATA 2XP9A 4TW8A 1BKFA 3IK8A 3FAPA 4JFIA 3TC5A 4DRHA 4FAPA 3O5QA 1ROTA 1Y0OA 2PV2A 4DZ3A 1D6OA 2LKNA 4QIBA 5GPGA 3MDYB 3O5KA 4JFLA 1BL4A 2AWGA 3CGNA 3O5LA 4J4OA 5HWCA 1FKRA 1D7IA 2FKEA 3KAHA 1YW5A 3NTPA 3PRDA 2RURA 4G2PA 3KADA 3O5DA 1J4HA 5HWBA 2FAPA 1FKJA 3IKGA 4JFJA 4ODNA 2PPNA 4DZ2A 3JYJA 5HW8A 1JVWA 3UQAA 1JNTA 1A7XA 2KO7A 1D7JA 1FKGA 1FKTA 3O5FA 3EY6A 4IQ2A 4GIVA 4DH0A 4DRJA 1ZCNA 3KCEA 4LAXA 5HUAA 2RQSA 1FAPA 1Q6UA 2MNTA 2ZQVA 3RGCA 1QPFA 3JXVA 3UF8A 1L1PA 2LPVA 1EQ3A 3O5JA 2MLXA 5DIUA 4QT3A 3VAWA 4W9OA 1FKHA 2ZR4A 2OFNA 1JNSA 1KT1A 1FKDA 5DITA 1Q6HA 1PINA 2M08A 4W9PA 4MGVA 1Q1CA 2XPBA 2F2DA 2M2AA 2XPAA 4ITZA 4LAYA 2ITKA 2VCDA 4JYSA 2DG3A 4N19A 2Q5AA 3WH0A 3PA7A 4J4NA 2IF4A 4JFMA 2Y78A 3CGMA 3UI4A 1B6CA 4DIPA 2UZ5A 5HW6A 1HXVA 3RFWA 3UI6A 2F4EA 4O2TA 4GGQA 1NMWA 3IHZA 4BF8A 4LAWA 2RUDA 1FKFA 1T11A 3JYMA 2RUQA 1J6YA 2ZR6A 2KI3A 5J6EA 5HKGA 1R9HA 2JZVA 3TDBA 4QT2A 1Q6IA 4DRQA 3O5RA 1U79A 2ZQSA 2M1IA 2XP4A 3KABA 5B8IC 1KT0A 4DT4A 3UQBA 1FJDA 1QPLA 4JFKA 3ODKA 1F40A 4DROA 1FKBA 3TCZA 4IQCA 5HW7A 1D7HA 2PV1A 2VN1A 1F8AB 3O5OA 4ODOA 4ODKA 5BXJA 1FKIA 2K8IA 3I6CA 1J4RA 3O5MA 1N1AA 3OOBA 1ZK6A 3KAGA 2MLZA 2KR7A
chains in the Genus database with same CATH superfamily
3ARUA 4ODLA 4DRMA 1W1PA 4HARA 3NI6A 4PTMA 1EHNA 1LL4A 4ML4A 1LQ0A 1NMVA 3ARSA 3GPKA 3PRAA 2DG9A 1W26A 1M5YA 4P8VA 1QZ2A 1XRVA 1J4IA 2L2SA 1W1TA 3PR9A 4Z2LA 4TNSA 4QZVB 1ZBVA 3CHEA 4ODPA 2XP8A 3B9AA 3ARQA 1TCOC 1E6NA 4DWSA 1LL7A 2PPPA 4L72B 4NZCA 1X6LA 3KACA 3IK8A 2YBTA 3WD3A 3TC5A 1LJYA 1JCHB 2A3EA 4DZ3A 5GPGA 3MDYB 4MAVA 2FKEA 1HKKA 1YW5A 1LG1A 3KADA 2DT2A 4ODNA 4P8XA 1GOIA 4IT6A 1SR0A 3ALGA 1W1YA 3JYJA 5DEZA 1E6PA 1RD6A 1A7XA 2WLYA 4IQ2A 1H0IA 2A3BA 3RGCA 1QPFA 4MNMA 3VAWA 4W9OA 1JNSA 1NH6A 5DITA 1GUVA 1Q6HA 2DSWA 4MGVA 2F2DA 4JYSA 4DWSB 2DG3A 4N19A 2IF4A 4KR0B 4W5UA 2A3AA 2Y78A 1H0GA 4DIPA 4Z2HA 1NWRA 2F4EA 1W9PA 1J6YA 5J6EA 1R9HA 2ZQSA 4S3JA 5B8IC 2DPEA 2WLZA 4Z2JA 1JNEA 1FJDA 4S3KA 3ODKA 3CHDA 4DROA 5DF0A 3AQUA 1OGGA 4MNKA 1ZBWA 5BXJA 1W9VA 3WL1A 3ARRA 3OOBA 1ZK6A 1WB0A 4R5EA 4QT3A 3UQIA 2B5UB 3LUOA 4XAKA 3KZ7A 1HJWA 4DRPA 1NWTA 2DSVA 4WKAA 3KAFA 4TW6A 4NNRA 3O5IA 2DT0A 3AROA 4Z2KA 4MTVA 1C9HA 4WKFA 1NSGA 3KAIA 2D9FA 4C02B 2OLHA 5DIVA 2RSEA 2ZQUA 4DRKA 3O5GA 3BMBA 1K9TA 2KGJA 3PRBA 2G41A 2XP9A 4DWSD 1BKFA 3FAPA 3ARZA 4DRHA 1HJXA 3CZ8A 2O9OA 5HWCA 4J4OA 2PN0A 3KAHA 3PRDA 4G2PA 3O5DA 5DO2A 1HKJA 1KFWA 2FAPA 3RM8A 1JVWA 3UQAA 1JNTA 3AS0A 1D7JA 1FKTA 3WIJA 4DRJA 4GIVA 2FDMA 1ZCNA 5HUAA 1IX5A 2ZQVA 3ARTA 4Z2GA 3UF8A 2LPVA 3O5JA 5DIUA 4MPKA 1FKHA 2ZR4A 2OFNA 1KT1A 1WNOA 3ALFA 3G6MA 1PINA 3B9DA 2M2AA 2Q5AA 3WH0A 3PA7A 4JFMA 3WL0A 1WAWA 5HW6A 1HXVA 3UI6A 3IHZA 3WQWA 2RUQA 2ZR6A 2JZVA 4Q22A 2M1IA 2XP4A 3AS2A 3UQBA 4JFKA 4IQCA 3CHFA 1D2KA 4HBOA 4ODKA 1ZL1A 3GU0A 1E6ZA 1P5QA 4U85A 3H9RB 3UI5A 4U84A 4MNJA 1FD9A 1EYMA 2ETNA 2A3CA 2N87A 4ODMA 1ZBCA 4FN2A 2B31A 5HTGA 4UDMA 2DG4A 1LL6A 4TX0A 2LJ4A 2MLYA 3O5EA 4R0XA 2ZQTA 1X6NA 5D75A 2WK2A 2XP3A 4L3NA 1E15A 2YBUA 4ODQA 4URIA 1FFQA 2ESCA 1FKLA 4FAPA 3QOKA 1D6OA 2LKNA 1UR8A 3ARPA 1BL4A 3O5LA 1FKRA 3CHCA 2RURA 2DSZA 1J4HA 4WKHA 1ZBKA 3ARWA 1FKJA 2IUZA 4JFJA 2G8ZA 4DZ2A 4ZPVR 5HW8A 3RM4A 2DT1A 4DH0A 3EY6A 3OA5A 2RQSA 1ITXA 3JXVA 1EDQA 1FKDA 3ARYA 2M08A 4W9PA 4Z2IA 3BXWA 1Q1CA 2XPBA 3RM9A 4DWSC 3FXYA 1B6CA 2UZ5A 3RFWA 2WM0A 3RMEA 4O2TA 1ZB5A 4ZPWR 4BF8A 2DT3A 1T11A 3JYMA 1VF8A 3AS1A 5HKGA 1E9LA 4IT4A 1Q6IA 4DRQA 5GPRA 1CTNA 3WD1A 3G6LA 3WKZA 4DT4A 4WK9A 1QPLA 1F40A 2EULA 1D7HA 2VN1A 1F8AB 1FKIA 2K8IA 3I6CA 4WJXA 1J4RA 3O5MA 1N1AA 4U86A 3KAGA 2MLZA 2KR7A 3GTYX 1FKKA 4MSPA 4W9QA 1OWQA 3ARVA 3WQVA 1FFRA 3CH9A 3B7XA 1SYTA 4ODRA 4IPXA 1E6RA 4LAVA 1FKSA 4ZPTR 2KE0A 2MPHA 2ZR5A 1ZU8A 4DRNA 3IKDA 2RUCA 2XP7A 4TYOA 3NRKA 2O92A 4TW7A 2MF9A 2PBCA 1W1VA 3WD4A 2XP6A 1ROUA 5HW7A 2F21A 2KFWA 2LGOA 2PV3A 4DRIA 1XHGA 1E44A 3O5PA 3B9EA 1PBKA 1NWUA 1HKMA 4G50A 5I98A 1TFVA 2PPOA 5HT1A 2XP5A 1YATA 4TW8A 3EIPA 4JFIA 4LGXA 1GPFA 3O5QA 1UR9A 1ROTA 1Y0OA 2PV2A 4MNLA 4QIBA 3O5KA 3AS3A 4JFLA 2AWGA 1NWSA 3CGNA 1D7IA 2DSUA 3NTPA 5HWBA 4ZS6A 3IKGA 1OGBA 4WIWA 1GRJA 2PPNA 2AOSA 3FY1A 2KO7A 1FKGA 3O5FA 3KCEA 4LAXA 1EIBA 1FAPA 1Q6UA 2MNTA 1L1PA 1EQ3A 1JNDA 2MLXA 5HBFA 2PI6A 5JH8A 1HJVA 2XPAA 4ITZA 4LAYA 4P8WA 2ITKA 2VCDA 1LG2A 4J4NA 3CGMA 4NSBA 2F23A 5GQBA 3UI4A 4GGQA 1NMWA 3WD0A 4LAWA 2RUDA 1FKFA 2KI3A 3TDBA 4QT2A 3O5RA 1U79A 2P4VA 3KABA 1W9UA 4KQZA 4HBEA 1KT0A 1O6IA 1FKBA 3B8SA 4AY1A 3TCZA 4Q7NA 2PV1A 3O5OA 2QF8A 4ODOA 4P8UA 3WD2A 3W4RA 3ARXA 1HKIA
chains in the Genus database with same CATH topology
3ARUA 4ODLA 4DRMA 1W1PA 4HARA 3NI6A 4PTMA 1EHNA 1LL4A 4ML4A 1LQ0A 1NMVA 3ARSA 3GPKA 3PRAA 2DG9A 1W26A 1M5YA 4P8VA 1QZ2A 1XRVA 1J4IA 2L2SA 1W1TA 3PR9A 4Z2LA 4TNSA 4QZVB 1ZBVA 3CHEA 4ODPA 2XP8A 3B9AA 3ARQA 1TCOC 1E6NA 4DWSA 1LL7A 2PPPA 4L72B 4NZCA 1X6LA 3KACA 3IK8A 2YBTA 3WD3A 3TC5A 1LJYA 2A3EA 4DZ3A 5GPGA 3MDYB 4MAVA 2FKEA 1HKKA 1YW5A 1LG1A 3KADA 2DT2A 4ODNA 4P8XA 1GOIA 4IT6A 1SR0A 3ALGA 1W1YA 3JYJA 5DEZA 1E6PA 1RD6A 1A7XA 2WLYA 4IQ2A 1H0IA 2A3BA 3RGCA 1QPFA 4MNMA 3VAWA 4W9OA 1JNSA 1NH6A 5DITA 1GUVA 1Q6HA 2DSWA 4MGVA 2F2DA 4JYSA 4DWSB 2DG3A 4N19A 2IF4A 4KR0B 4W5UA 2A3AA 2Y78A 1H0GA 4DIPA 4Z2HA 1NWRA 2F4EA 1W9PA 1J6YA 5J6EA 1R9HA 2ZQSA 4S3JA 5B8IC 2DPEA 2WLZA 4Z2JA 1JNEA 1FJDA 4S3KA 3ODKA 3CHDA 4DROA 5DF0A 3AQUA 1OGGA 4MNKA 1ZBWA 5BXJA 1W9VA 3WL1A 3ARRA 3OOBA 1ZK6A 1WB0A 4R5EA 4QT3A 3UQIA 3LUOA 4XAKA 3KZ7A 1HJWA 4DRPA 1NWTA 2DSVA 4WKAA 3KAFA 4TW6A 4NNRA 3O5IA 2DT0A 3AROA 4Z2KA 4MTVA 1C9HA 4WKFA 1NSGA 3KAIA 2D9FA 4C02B 2OLHA 5DIVA 2RSEA 2ZQUA 4DRKA 3O5GA 3PRBA 1K9TA 2KGJA 2G41A 2XP9A 4DWSD 1BKFA 3FAPA 3ARZA 4DRHA 1HJXA 3CZ8A 2O9OA 5HWCA 4J4OA 3KAHA 3PRDA 4G2PA 3O5DA 5DO2A 1HKJA 1KFWA 2FAPA 3RM8A 1JVWA 3UQAA 1JNTA 3AS0A 1D7JA 1FKTA 3WIJA 4DRJA 4GIVA 2FDMA 1ZCNA 5HUAA 1IX5A 2ZQVA 3ARTA 4Z2GA 3UF8A 2LPVA 3O5JA 5DIUA 4MPKA 1FKHA 2ZR4A 2OFNA 1KT1A 1WNOA 3ALFA 3G6MA 1PINA 3B9DA 2M2AA 2Q5AA 3WH0A 3PA7A 4JFMA 3WL0A 1WAWA 5HW6A 1HXVA 3UI6A 3IHZA 3WQWA 2RUQA 2ZR6A 2JZVA 4Q22A 2M1IA 2XP4A 3AS2A 3UQBA 4JFKA 4IQCA 3CHFA 1D2KA 4HBOA 4ODKA 1ZL1A 1E6ZA 1P5QA 4U85A 3H9RB 3UI5A 4U84A 4MNJA 1FD9A 1EYMA 2A3CA 2N87A 4ODMA 1ZBCA 4FN2A 2B31A 5HTGA 2DG4A 1LL6A 4TX0A 2LJ4A 2MLYA 3O5EA 4R0XA 2ZQTA 1X6NA 5D75A 2WK2A 2XP3A 4L3NA 1E15A 2YBUA 4ODQA 4URIA 1FFQA 2ESCA 1FKLA 4FAPA 3QOKA 1D6OA 2LKNA 1UR8A 3ARPA 1BL4A 3O5LA 1FKRA 3CHCA 2RURA 2DSZA 1J4HA 4WKHA 1ZBKA 3ARWA 1FKJA 2IUZA 4JFJA 2G8ZA 4DZ2A 4ZPVR 5HW8A 3RM4A 2DT1A 4DH0A 3EY6A 3OA5A 2RQSA 1ITXA 3JXVA 1EDQA 1FKDA 3ARYA 2M08A 4W9PA 4Z2IA 3BXWA 1Q1CA 2XPBA 3RM9A 4DWSC 3FXYA 1B6CA 2UZ5A 3RFWA 2WM0A 3RMEA 4O2TA 1ZB5A 4ZPWR 4BF8A 2DT3A 1T11A 3JYMA 1VF8A 3AS1A 5HKGA 1E9LA 4IT4A 1Q6IA 4DRQA 5GPRA 1CTNA 3WD1A 3G6LA 3WKZA 4DT4A 4WK9A 1QPLA 1F40A 1D7HA 2VN1A 1F8AB 1FKIA 2K8IA 3I6CA 4WJXA 1J4RA 3O5MA 1N1AA 4U86A 3KAGA 2MLZA 2KR7A 1FKKA 4MSPA 4W9QA 1OWQA 3ARVA 3WQVA 1FFRA 3CH9A 3B7XA 1SYTA 4ODRA 4IPXA 1E6RA 4LAVA 1FKSA 4ZPTR 2KE0A 2MPHA 2ZR5A 1ZU8A 4DRNA 3IKDA 2RUCA 2XP7A 4TYOA 3NRKA 2O92A 4TW7A 2MF9A 2PBCA 1W1VA 3WD4A 2XP6A 1ROUA 5HW7A 2F21A 2KFWA 2LGOA 2PV3A 4DRIA 1XHGA 3O5PA 3B9EA 1PBKA 1NWUA 1HKMA 4G50A 5I98A 1TFVA 2PPOA 5HT1A 2XP5A 1YATA 4TW8A 4JFIA 4LGXA 1GPFA 3O5QA 1UR9A 1ROTA 1Y0OA 2PV2A 4MNLA 4QIBA 3O5KA 3AS3A 4JFLA 2AWGA 1NWSA 3CGNA 1D7IA 2DSUA 3NTPA 5HWBA 4ZS6A 3IKGA 1OGBA 4WIWA 2PPNA 2AOSA 3FY1A 2KO7A 1FKGA 3O5FA 3KCEA 4LAXA 1EIBA 1FAPA 1Q6UA 2MNTA 1L1PA 1EQ3A 1JNDA 2MLXA 5HBFA 2PI6A 5JH8A 1HJVA 2XPAA 4ITZA 4LAYA 4P8WA 2ITKA 2VCDA 1LG2A 4J4NA 3CGMA 4NSBA 5GQBA 3UI4A 4GGQA 1NMWA 3WD0A 4LAWA 2RUDA 1FKFA 2KI3A 3TDBA 4QT2A 3O5RA 1U79A 3KABA 1W9UA 4KQZA 4HBEA 1KT0A 1O6IA 1FKBA 3B8SA 4AY1A 3TCZA 4Q7NA 2PV1A 3O5OA 2QF8A 4ODOA 4P8UA 3WD2A 3W4RA 3ARXA 1HKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P5Q A;  1FKK A;  4MSP A;  4U86 A;  4U85 A;  4W9Q A;  4ODL A;  3UQI A;  3B7X A;  3H9R B;  3UI5 A;  4DRM A;  4U84 A;  4ODR A;  3LUO A;  4IPX A;  1FD9 A;  3NI6 A;  4LAV A;  3KZ7 A;  1FKS A;  1EYM A;  4DRP A;  2KE0 A;  2MPH A;  2ZR5 A;  4DRN A;  1NMV A;  3IKD A;  3GPK A;  3KAF A;  2RUC A;  4TW6 A;  4NNR A;  2DG9 A;  2N87 A;  2XP7 A;  1W26 A;  3O5I A;  4ODM A;  4TYO A;  3NRK A;  1M5Y A;  4FN2 A;  5HTG A;  2DG4 A;  4TW7 A;  4TX0 A;  1QZ2 A;  1J4I A;  2L2S A;  2MF9 A;  2PBC A;  4TNS A;  2LJ4 A;  1C9H A;  2MLY A;  1ROU A;  1NSG A;  2XP6 A;  3KAI A;  2D9F A;  2F21 A;  2KFW A;  2LGO A;  2PV3 A;  2XP8 A;  3O5E A;  4ODP A;  4R0X A;  4DRI A;  4C02 B;  2ZQT A;  3O5P A;  1TCO C;  1PBK A;  5D75 A;  2XP3 A;  5DIV A;  2PPP A;  4G50 A;  5I98 A;  2RSE A;  2ZQU A;  4DRK A;  3O5G A;  3PRB A;  2KGJ A;  4ODQ A;  2PPO A;  5HT1 A;  3KAC A;  2XP5 A;  1FKL A;  1YAT A;  2XP9 A;  4TW8 A;  1BKF A;  3IK8 A;  3FAP A;  4JFI A;  3TC5 A;  4DRH A;  4FAP A;  3O5Q A;  1ROT A;  1Y0O A;  2PV2 A;  4DZ3 A;  1D6O A;  2LKN A;  4QIB A;  5GPG A;  3MDY B;  3O5K A;  4JFL A;  1BL4 A;  2AWG A;  3CGN A;  3O5L A;  4J4O A;  5HWC A;  1FKR A;  1D7I A;  2FKE A;  3KAH A;  1YW5 A;  3NTP A;  3PRD A;  2RUR A;  4G2P A;  3KAD A;  3O5D A;  1J4H A;  5HWB A;  2FAP A;  1FKJ A;  3IKG A;  4JFJ A;  4ODN A;  2PPN A;  4DZ2 A;  3JYJ A;  5HW8 A;  1JVW A;  3UQA A;  1JNT A;  1A7X A;  2KO7 A;  1D7J A;  1FKG A;  1FKT A;  3O5F A;  3EY6 A;  4IQ2 A;  4GIV A;  4DH0 A;  4DRJ A;  1ZCN A;  3KCE A;  4LAX A;  5HUA A;  2RQS A;  1FAP A;  1Q6U A;  2MNT A;  2ZQV A;  3RGC A;  1QPF A;  3JXV A;  3UF8 A;  1L1P A;  2LPV A;  1EQ3 A;  3O5J A;  2MLX A;  5DIU A;  4QT3 A;  3VAW A;  4W9O A;  1FKH A;  2ZR4 A;  2OFN A;  1JNS A;  1KT1 A;  1FKD A;  5DIT A;  1Q6H A;  1PIN A;  2M08 A;  4W9P A;  4MGV A;  1Q1C A;  2XPB A;  2F2D A;  2M2A A;  2XPA A;  4ITZ A;  4LAY A;  2ITK A;  2VCD A;  4JYS A;  2DG3 A;  4N19 A;  2Q5A A;  3WH0 A;  3PA7 A;  4J4N A;  2IF4 A;  4JFM A;  2Y78 A;  3CGM A;  3UI4 A;  1B6C A;  4DIP A;  2UZ5 A;  5HW6 A;  1HXV A;  3RFW A;  3UI6 A;  2F4E A;  4O2T A;  4GGQ A;  1NMW A;  3IHZ A;  4BF8 A;  4LAW A;  2RUD A;  1FKF A;  1T11 A;  3JYM A;  2RUQ A;  1J6Y A;  2ZR6 A;  2KI3 A;  5J6E A;  5HKG A;  1R9H A;  2JZV A;  3TDB A;  4QT2 A;  1Q6I A;  4DRQ A;  3O5R A;  1U79 A;  2ZQS A;  2M1I A;  2XP4 A;  3KAB A;  5B8I C;  1KT0 A;  4DT4 A;  3UQB A;  1FJD A;  1QPL A;  4JFK A;  3ODK A;  1F40 A;  4DRO A;  1FKB A;  3TCZ A;  4IQC A;  5HW7 A;  1D7H A;  2PV1 A;  2VN1 A;  1F8A B;  3O5O A;  4ODO A;  4ODK A;  5BXJ A;  1FKI A;  2K8I A;  3I6C A;  1J4R A;  3O5M A;  1N1A A;  3OOB A;  1ZK6 A;  3KAG A;  2MLZ A;  2KR7 A; 
#chains in the Genus database with same CATH topology
 3ARU A;  4ODL A;  4DRM A;  1W1P A;  4HAR A;  3NI6 A;  4PTM A;  1EHN A;  1LL4 A;  4ML4 A;  1LQ0 A;  1NMV A;  3ARS A;  3GPK A;  3PRA A;  2DG9 A;  1W26 A;  1M5Y A;  4P8V A;  1QZ2 A;  1XRV A;  1J4I A;  2L2S A;  1W1T A;  3PR9 A;  4Z2L A;  4TNS A;  4QZV B;  1ZBV A;  3CHE A;  4ODP A;  2XP8 A;  3B9A A;  3ARQ A;  1TCO C;  1E6N A;  4DWS A;  1LL7 A;  2PPP A;  4L72 B;  4NZC A;  1X6L A;  3KAC A;  3IK8 A;  2YBT A;  3WD3 A;  3TC5 A;  1LJY A;  1JCH B;  2A3E A;  4DZ3 A;  5GPG A;  3MDY B;  4MAV A;  2FKE A;  1HKK A;  1YW5 A;  1LG1 A;  3KAD A;  2DT2 A;  4ODN A;  4P8X A;  1GOI A;  4IT6 A;  1SR0 A;  3ALG A;  1W1Y A;  3JYJ A;  5DEZ A;  1E6P A;  1RD6 A;  1A7X A;  2WLY A;  4IQ2 A;  1H0I A;  2A3B A;  3RGC A;  1QPF A;  4MNM A;  3VAW A;  4W9O A;  1JNS A;  1NH6 A;  5DIT A;  1GUV A;  1Q6H A;  2DSW A;  4MGV A;  2F2D A;  4JYS A;  4DWS B;  2DG3 A;  4N19 A;  2IF4 A;  4KR0 B;  4W5U A;  2A3A A;  2Y78 A;  1H0G A;  4DIP A;  4Z2H A;  1NWR A;  2F4E A;  1W9P A;  1J6Y A;  5J6E A;  1R9H A;  2ZQS A;  4S3J A;  5B8I C;  2DPE A;  2WLZ A;  4Z2J A;  1JNE A;  1FJD A;  4S3K A;  3ODK A;  3CHD A;  4DRO A;  5DF0 A;  3AQU A;  1OGG A;  4MNK A;  1ZBW A;  5BXJ A;  1W9V A;  3WL1 A;  3ARR A;  3OOB A;  1ZK6 A;  1WB0 A;  4R5E A;  4QT3 A;  3UQI A;  2B5U B;  3LUO A;  4XAK A;  3KZ7 A;  1HJW A;  4DRP A;  1NWT A;  2DSV A;  4WKA A;  3KAF A;  4TW6 A;  4NNR A;  3O5I A;  2DT0 A;  3ARO A;  4Z2K A;  4MTV A;  1C9H A;  4WKF A;  1NSG A;  3KAI A;  2D9F A;  4C02 B;  2OLH A;  5DIV A;  2RSE A;  2ZQU A;  4DRK A;  3O5G A;  3BMB A;  1K9T A;  2KGJ A;  3PRB A;  2G41 A;  2XP9 A;  4DWS D;  1BKF A;  3FAP A;  3ARZ A;  4DRH A;  1HJX A;  3CZ8 A;  2O9O A;  5HWC A;  4J4O A;  2PN0 A;  3KAH A;  3PRD A;  4G2P A;  3O5D A;  5DO2 A;  1HKJ A;  1KFW A;  2FAP A;  3RM8 A;  1JVW A;  3UQA A;  1JNT A;  3AS0 A;  1D7J A;  1FKT A;  3WIJ A;  4DRJ A;  4GIV A;  2FDM A;  1ZCN A;  5HUA A;  1IX5 A;  2ZQV A;  3ART A;  4Z2G A;  3UF8 A;  2LPV A;  3O5J A;  5DIU A;  4MPK A;  1FKH A;  2ZR4 A;  2OFN A;  1KT1 A;  1WNO A;  3ALF A;  3G6M A;  1PIN A;  3B9D A;  2M2A A;  2Q5A A;  3WH0 A;  3PA7 A;  4JFM A;  3WL0 A;  1WAW A;  5HW6 A;  1HXV A;  3UI6 A;  3IHZ A;  3WQW A;  2RUQ A;  2ZR6 A;  2JZV A;  4Q22 A;  2M1I A;  2XP4 A;  3AS2 A;  3UQB A;  4JFK A;  4IQC A;  3CHF A;  1D2K A;  4HBO A;  4ODK A;  1ZL1 A;  3GU0 A;  1E6Z A;  1P5Q A;  4U85 A;  3H9R B;  3UI5 A;  4U84 A;  4MNJ A;  1FD9 A;  1EYM A;  2ETN A;  2A3C A;  2N87 A;  4ODM A;  1ZBC A;  4FN2 A;  2B31 A;  5HTG A;  4UDM A;  2DG4 A;  1LL6 A;  4TX0 A;  2LJ4 A;  2MLY A;  3O5E A;  4R0X A;  2ZQT A;  1X6N A;  5D75 A;  2WK2 A;  2XP3 A;  4L3N A;  1E15 A;  2YBU A;  4ODQ A;  4URI A;  1FFQ A;  2ESC A;  1FKL A;  4FAP A;  3QOK A;  1D6O A;  2LKN A;  1UR8 A;  3ARP A;  1BL4 A;  3O5L A;  1FKR A;  3CHC A;  2RUR A;  2DSZ A;  1J4H A;  4WKH A;  1ZBK A;  3ARW A;  1FKJ A;  2IUZ A;  4JFJ A;  2G8Z A;  4DZ2 A;  4ZPV R;  5HW8 A;  3RM4 A;  2DT1 A;  4DH0 A;  3EY6 A;  3OA5 A;  2RQS A;  1ITX A;  3JXV A;  1EDQ A;  1FKD A;  3ARY A;  2M08 A;  4W9P A;  4Z2I A;  3BXW A;  1Q1C A;  2XPB A;  3RM9 A;  4DWS C;  3FXY A;  1B6C A;  2UZ5 A;  3RFW A;  2WM0 A;  3RME A;  4O2T A;  1ZB5 A;  4ZPW R;  4BF8 A;  2DT3 A;  1T11 A;  3JYM A;  1VF8 A;  3AS1 A;  5HKG A;  1E9L A;  4IT4 A;  1Q6I A;  4DRQ A;  5GPR A;  1CTN A;  3WD1 A;  3G6L A;  3WKZ A;  4DT4 A;  4WK9 A;  1QPL A;  1F40 A;  2EUL A;  1D7H A;  2VN1 A;  1F8A B;  1FKI A;  2K8I A;  3I6C A;  4WJX A;  1J4R A;  3O5M A;  1N1A A;  4U86 A;  3KAG A;  2MLZ A;  2KR7 A;  3GTY X;  1FKK A;  4MSP A;  4W9Q A;  1OWQ A;  3ARV A;  3WQV A;  1FFR A;  3CH9 A;  3B7X A;  1SYT A;  4ODR A;  4IPX A;  1E6R A;  4LAV A;  1FKS A;  4ZPT R;  2KE0 A;  2MPH A;  2ZR5 A;  1ZU8 A;  4DRN A;  3IKD A;  2RUC A;  2XP7 A;  4TYO A;  3NRK A;  2O92 A;  4TW7 A;  2MF9 A;  2PBC A;  1W1V A;  3WD4 A;  2XP6 A;  1ROU A;  5HW7 A;  2F21 A;  2KFW A;  2LGO A;  2PV3 A;  4DRI A;  1XHG A;  1E44 A;  3O5P A;  3B9E A;  1PBK A;  1NWU A;  1HKM A;  4G50 A;  5I98 A;  1TFV A;  2PPO A;  5HT1 A;  2XP5 A;  1YAT A;  4TW8 A;  3EIP A;  4JFI A;  4LGX A;  1GPF A;  3O5Q A;  1UR9 A;  1ROT A;  1Y0O A;  2PV2 A;  4MNL A;  4QIB A;  3O5K A;  3AS3 A;  4JFL A;  2AWG A;  1NWS A;  3CGN A;  1D7I A;  2DSU A;  3NTP A;  5HWB A;  4ZS6 A;  3IKG A;  1OGB A;  4WIW A;  1GRJ A;  2PPN A;  2AOS A;  3FY1 A;  2KO7 A;  1FKG A;  3O5F A;  3KCE A;  4LAX A;  1EIB A;  1FAP A;  1Q6U A;  2MNT A;  1L1P A;  1EQ3 A;  1JND A;  2MLX A;  5HBF A;  2PI6 A;  5JH8 A;  1HJV A;  2XPA A;  4ITZ A;  4LAY A;  4P8W A;  2ITK A;  2VCD A;  1LG2 A;  4J4N A;  3CGM A;  4NSB A;  2F23 A;  5GQB A;  3UI4 A;  4GGQ A;  1NMW A;  3WD0 A;  4LAW A;  2RUD A;  1FKF A;  2KI3 A;  3TDB A;  4QT2 A;  3O5R A;  1U79 A;  2P4V A;  3KAB A;  1W9U A;  4KQZ A;  4HBE A;  1KT0 A;  1O6I A;  1FKB A;  3B8S A;  4AY1 A;  3TCZ A;  4Q7N A;  2PV1 A;  3O5O A;  2QF8 A;  4ODO A;  4P8U A;  3WD2 A;  3W4R A;  3ARX A;  1HKI A; 
#chains in the Genus database with same CATH homology
 3ARU A;  4ODL A;  4DRM A;  1W1P A;  4HAR A;  3NI6 A;  4PTM A;  1EHN A;  1LL4 A;  4ML4 A;  1LQ0 A;  1NMV A;  3ARS A;  3GPK A;  3PRA A;  2DG9 A;  1W26 A;  1M5Y A;  4P8V A;  1QZ2 A;  1XRV A;  1J4I A;  2L2S A;  1W1T A;  3PR9 A;  4Z2L A;  4TNS A;  4QZV B;  1ZBV A;  3CHE A;  4ODP A;  2XP8 A;  3B9A A;  3ARQ A;  1TCO C;  1E6N A;  4DWS A;  1LL7 A;  2PPP A;  4L72 B;  4NZC A;  1X6L A;  3KAC A;  3IK8 A;  2YBT A;  3WD3 A;  3TC5 A;  1LJY A;  2A3E A;  4DZ3 A;  5GPG A;  3MDY B;  4MAV A;  2FKE A;  1HKK A;  1YW5 A;  1LG1 A;  3KAD A;  2DT2 A;  4ODN A;  4P8X A;  1GOI A;  4IT6 A;  1SR0 A;  3ALG A;  1W1Y A;  3JYJ A;  5DEZ A;  1E6P A;  1RD6 A;  1A7X A;  2WLY A;  4IQ2 A;  1H0I A;  2A3B A;  3RGC A;  1QPF A;  4MNM A;  3VAW A;  4W9O A;  1JNS A;  1NH6 A;  5DIT A;  1GUV A;  1Q6H A;  2DSW A;  4MGV A;  2F2D A;  4JYS A;  4DWS B;  2DG3 A;  4N19 A;  2IF4 A;  4KR0 B;  4W5U A;  2A3A A;  2Y78 A;  1H0G A;  4DIP A;  4Z2H A;  1NWR A;  2F4E A;  1W9P A;  1J6Y A;  5J6E A;  1R9H A;  2ZQS A;  4S3J A;  5B8I C;  2DPE A;  2WLZ A;  4Z2J A;  1JNE A;  1FJD A;  4S3K A;  3ODK A;  3CHD A;  4DRO A;  5DF0 A;  3AQU A;  1OGG A;  4MNK A;  1ZBW A;  5BXJ A;  1W9V A;  3WL1 A;  3ARR A;  3OOB A;  1ZK6 A;  1WB0 A;  4R5E A;  4QT3 A;  3UQI A;  3LUO A;  4XAK A;  3KZ7 A;  1HJW A;  4DRP A;  1NWT A;  2DSV A;  4WKA A;  3KAF A;  4TW6 A;  4NNR A;  3O5I A;  2DT0 A;  3ARO A;  4Z2K A;  4MTV A;  1C9H A;  4WKF A;  1NSG A;  3KAI A;  2D9F A;  4C02 B;  2OLH A;  5DIV A;  2RSE A;  2ZQU A;  4DRK A;  3O5G A;  3PRB A;  1K9T A;  2KGJ A;  2G41 A;  2XP9 A;  4DWS D;  1BKF A;  3FAP A;  3ARZ A;  4DRH A;  1HJX A;  3CZ8 A;  2O9O A;  5HWC A;  4J4O A;  3KAH A;  3PRD A;  4G2P A;  3O5D A;  5DO2 A;  1HKJ A;  1KFW A;  2FAP A;  3RM8 A;  1JVW A;  3UQA A;  1JNT A;  3AS0 A;  1D7J A;  1FKT A;  3WIJ A;  4DRJ A;  4GIV A;  2FDM A;  1ZCN A;  5HUA A;  1IX5 A;  2ZQV A;  3ART A;  4Z2G A;  3UF8 A;  2LPV A;  3O5J A;  5DIU A;  4MPK A;  1FKH A;  2ZR4 A;  2OFN A;  1KT1 A;  1WNO A;  3ALF A;  3G6M A;  1PIN A;  3B9D A;  2M2A A;  2Q5A A;  3WH0 A;  3PA7 A;  4JFM A;  3WL0 A;  1WAW A;  5HW6 A;  1HXV A;  3UI6 A;  3IHZ A;  3WQW A;  2RUQ A;  2ZR6 A;  2JZV A;  4Q22 A;  2M1I A;  2XP4 A;  3AS2 A;  3UQB A;  4JFK A;  4IQC A;  3CHF A;  1D2K A;  4HBO A;  4ODK A;  1ZL1 A;  1E6Z A;  1P5Q A;  4U85 A;  3H9R B;  3UI5 A;  4U84 A;  4MNJ A;  1FD9 A;  1EYM A;  2A3C A;  2N87 A;  4ODM A;  1ZBC A;  4FN2 A;  2B31 A;  5HTG A;  2DG4 A;  1LL6 A;  4TX0 A;  2LJ4 A;  2MLY A;  3O5E A;  4R0X A;  2ZQT A;  1X6N A;  5D75 A;  2WK2 A;  2XP3 A;  4L3N A;  1E15 A;  2YBU A;  4ODQ A;  4URI A;  1FFQ A;  2ESC A;  1FKL A;  4FAP A;  3QOK A;  1D6O A;  2LKN A;  1UR8 A;  3ARP A;  1BL4 A;  3O5L A;  1FKR A;  3CHC A;  2RUR A;  2DSZ A;  1J4H A;  4WKH A;  1ZBK A;  3ARW A;  1FKJ A;  2IUZ A;  4JFJ A;  2G8Z A;  4DZ2 A;  4ZPV R;  5HW8 A;  3RM4 A;  2DT1 A;  4DH0 A;  3EY6 A;  3OA5 A;  2RQS A;  1ITX A;  3JXV A;  1EDQ A;  1FKD A;  3ARY A;  2M08 A;  4W9P A;  4Z2I A;  3BXW A;  1Q1C A;  2XPB A;  3RM9 A;  4DWS C;  3FXY A;  1B6C A;  2UZ5 A;  3RFW A;  2WM0 A;  3RME A;  4O2T A;  1ZB5 A;  4ZPW R;  4BF8 A;  2DT3 A;  1T11 A;  3JYM A;  1VF8 A;  3AS1 A;  5HKG A;  1E9L A;  4IT4 A;  1Q6I A;  4DRQ A;  5GPR A;  1CTN A;  3WD1 A;  3G6L A;  3WKZ A;  4DT4 A;  4WK9 A;  1QPL A;  1F40 A;  1D7H A;  2VN1 A;  1F8A B;  1FKI A;  2K8I A;  3I6C A;  4WJX A;  1J4R A;  3O5M A;  1N1A A;  4U86 A;  3KAG A;  2MLZ A;  2KR7 A;  1FKK A;  4MSP A;  4W9Q A;  1OWQ A;  3ARV A;  3WQV A;  1FFR A;  3CH9 A;  3B7X A;  1SYT A;  4ODR A;  4IPX A;  1E6R A;  4LAV A;  1FKS A;  4ZPT R;  2KE0 A;  2MPH A;  2ZR5 A;  1ZU8 A;  4DRN A;  3IKD A;  2RUC A;  2XP7 A;  4TYO A;  3NRK A;  2O92 A;  4TW7 A;  2MF9 A;  2PBC A;  1W1V A;  3WD4 A;  2XP6 A;  1ROU A;  5HW7 A;  2F21 A;  2KFW A;  2LGO A;  2PV3 A;  4DRI A;  1XHG A;  3O5P A;  3B9E A;  1PBK A;  1NWU A;  1HKM A;  4G50 A;  5I98 A;  1TFV A;  2PPO A;  5HT1 A;  2XP5 A;  1YAT A;  4TW8 A;  4JFI A;  4LGX A;  1GPF A;  3O5Q A;  1UR9 A;  1ROT A;  1Y0O A;  2PV2 A;  4MNL A;  4QIB A;  3O5K A;  3AS3 A;  4JFL A;  2AWG A;  1NWS A;  3CGN A;  1D7I A;  2DSU A;  3NTP A;  5HWB A;  4ZS6 A;  3IKG A;  1OGB A;  4WIW A;  2PPN A;  2AOS A;  3FY1 A;  2KO7 A;  1FKG A;  3O5F A;  3KCE A;  4LAX A;  1EIB A;  1FAP A;  1Q6U A;  2MNT A;  1L1P A;  1EQ3 A;  1JND A;  2MLX A;  5HBF A;  2PI6 A;  5JH8 A;  1HJV A;  2XPA A;  4ITZ A;  4LAY A;  4P8W A;  2ITK A;  2VCD A;  1LG2 A;  4J4N A;  3CGM A;  4NSB A;  5GQB A;  3UI4 A;  4GGQ A;  1NMW A;  3WD0 A;  4LAW A;  2RUD A;  1FKF A;  2KI3 A;  3TDB A;  4QT2 A;  3O5R A;  1U79 A;  3KAB A;  1W9U A;  4KQZ A;  4HBE A;  1KT0 A;  1O6I A;  1FKB A;  3B8S A;  4AY1 A;  3TCZ A;  4Q7N A;  2PV1 A;  3O5O A;  2QF8 A;  4ODO A;  4P8U A;  3WD2 A;  3W4R A;  3ARX A;  1HKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...