1FKIA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
total genus 25
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkiA00
3TCZA 2MNTA 4DROA 1F40A 2K8IA 2RQSA 4ODLA 3UI4A 4DRNA 3UF8A 4LAYA 2XP3A 1QPFA 4TX0A 5HWCA 2KGJA 3NRKA 4MGVA 4O2TA 4ODQA 5DITA 3TDBA 3O5GA 2ZQSA 4DT4A 2JZVA 4FAPA 1D7JA 3KADA 1TCOC 2KO7A 2MLXA 2MLZA 4JFLA 3ODKA 3KAIA 3KAGA 2FAPA 4JFIA 3KAHA 3O5OA 4TW6A 1N1AA 3OOBA 2F2DA 4U86A 3MDYB 2RURA 2KE0A 1FKBA 2ZQUA 3NI6A 2Y78A 3FAPA 3JXVA 2MPHA 3O5KA 4ITZA 4ODRA 4BF8A 4DRMA 5HW7A 2KFWA 5HKGA 2DG3A 2PV1A 3O5IA 3UI6A 3UQIA 5HWBA 1EQ3A 1YW5A 5HT1A 2PPOA 1Y0OA 2M1IA 4JYSA 1Q1CA 1FKIA 3O5EA 3O5JA 3PRBA 4JFJA 4IQ2A 1NSGA 2N87A 5DIVA 4GIVA 2XPAA 2XP9A 3RGCA 3KZ7A 2LKNA 1FKHA 3CGNA 1A7XA 1L1PA 1P5QA 1FKRA 4DH0A 4ODMA 2ZQVA 4N19A 5J6EA 2OFNA 1FKTA 2LJ4A 4LAWA 4J4OA 2ZR5A 4FN2A 4LAVA 4QIBA 1FKFA 2XP4A 2KR7A 4IQCA 3IHZA 4DRQA 4DRJA 4DIPA 5HTGA 4TW7A 4R0XA 1Q6HA 4DRIA 2VCDA 1R9HA 2RSEA 2AWGA 1B6CA 1C9HA 2ZR6A 4W9QA 4DRPA 3CGMA 3JYJA 2MF9A 1W26A 4QT3A 1D7HA 1U79A 5HUAA 2ITKA 2XP5A 2XP7A 3KCEA 4G2PA 4DZ2A 5B8IC 5BXJA 1NMVA 4TYOA 1NMWA 1ZK6A 1FKKA 1QPLA 2PBCA 2IF4A 2PV2A 3RFWA 3TC5A 4DRKA 4DZ3A 3UQAA 4TW8A 3KABA 2F4EA 3GPKA 2PV3A 4GGQA 2LGOA 4C02B 1F8AB 2RUDA 1JNTA 2D9FA 3H9RB 1Q6UA 4QT2A 5HW8A 1FJDA 1M5YA 5GPGA 4ODPA 1PBKA 5DIUA 4W9OA 4U84A 1ZCNA 2DG9A 1J4HA 2L2SA 1KT0A 3UI5A 3IKDA 4G50A 4NNRA 4ODKA 3O5LA 3IK8A 3JYMA 1FKJA 3WH0A 2PPPA 1ROUA 4JFKA 2FKEA 4J4NA 4MSPA 5I98A 1FAPA 1EYMA 3PA7A 1ROTA 1J4IA 1JVWA 4ODNA 2ZR4A 1J4RA 2F21A 2XP8A 3O5PA 2MLYA 1J6YA 2Q5AA 2RUCA 1FKSA 3I6CA 2UZ5A 1JNSA 2LPVA 4ODOA 1QZ2A 1FKDA 3KAFA 1YATA 1T11A 1FD9A 2ZQTA 3NTPA 2M08A 3KACA 3O5DA 4U85A 2KI3A 3O5MA 5D75A 3IKGA 1D6OA 1KT1A 1Q6IA 3O5QA 3PRDA 4TNSA 1HXVA 1BL4A 2VN1A 2XPBA 1PINA 3O5RA 4DRHA 4W9PA 3B7XA 3UQBA 2XP6A 5HW6A 4JFMA 3LUOA 1FKLA 1D7IA 2PPNA 3O5FA 3EY6A 3VAWA 2M2AA 2RUQA 4IPXA 4LAXA 1FKGA 2DG4A 1BKFA
chains in the Genus database with same CATH superfamily
4DROA 3UF8A 2XP3A 3WD1A 3O5GA 1D7JA 3KADA 2KO7A 1HJWA 1OWQA 3KAIA 2G8ZA 1HJVA 2B31A 2F2DA 3MDYB 2RURA 5GPRA 3JXVA 2DSWA 2DT2A 4ITZA 4Z2JA 4DRMA 4Z2GA 5HW7A 5HKGA 2O92A 1HKJA 3UQIA 1W9PA 2A3CA 2AOSA 3BXWA 4JYSA 1E6ZA 1GOIA 3PRBA 4IQ2A 5DIVA 3WD3A 4PTMA 1FKHA 3CGNA 3EIPA 2DT1A 4LAWA 4QIBA 4DRQA 3IHZA 1ZU8A 4KR0B 1B6CA 4DRPA 3JYJA 5HUAA 2XP7A 5BXJA 3WL0A 1HKIA 1OGBA 4TYOA 1WNOA 3TC5A 2PV2A 2WLZA 2IF4A 1SYTA 1OGGA 2F4EA 2PV3A 1HKMA 2LGOA 2RUDA 1Q6UA 5JH8A 4DWSA 4ODPA 4W9OA 2ETNA 1HJXA 1LQ0A 3GU0A 4ODKA 2IUZA 4KQZA 3WH0A 2PPPA 2PI6A 2WM0A 4J4NA 5I98A 1ROTA 1W1TA 2ZR4A 1NWUA 2G41A 3CHFA 3O5PA 3RM8A 2Q5AA 1FKSA 4DWSC 4IT6A 4NZCA 3WD2A 1E6NA 4ODOA 1QZ2A 1FKDA 3KAFA 1T11A 2ZQTA 3NTPA 1WAWA 4Z2LA 5D75A 3IKGA 1D6OA 1LG1A 1HXVA 2XPBA 5HW6A 1X6NA 3O5FA 2MNTA 4S3JA 4ODLA 3ARRA 1EHNA 4MNLA 4DRNA 4LAYA 3NRKA 4MGVA 4O2TA 4ZPVR 5DITA 4FAPA 2A3AA 2ZQSA 2JZVA 1TCOC 2MLXA 3RM4A 4WK9A 4QZVB 1FKBA 1HKKA 3FAPA 2MPHA 3CHDA 3O5KA 4ODRA 5GQBA 3O5IA 2PV1A 5HWBA 1YW5A 2DSVA 1E6PA 3AROA 2A3BA 3W4RA 4JFJA 1W1PA 1NSGA 4P8XA 2XP9A 1P5QA 3GTYX 2ZQVA 1E44A 3ARPA 2KR7A 4IQCA 4LGXA 4DRJA 2VCDA 3ARTA 4IT4A 3OA5A 2AWGA 1C9HA 2ZR6A 4W9QA 2MF9A 3AS2A 1JCHB 1D7HA 1LL4A 1O6IA 2XP5A 5B8IC 1FKKA 1QPLA 1LL7A 4WKAA 4TW8A 3KABA 3GPKA 4C02B 1ITXA 2YBUA 4Z2KA 2D9FA 3H9RB 4QT2A 1GUVA 1PBKA 2O9OA 1ZCNA 2DG9A 3B9AA 3IKDA 4NNRA 3IK8A 3JYMA 3ARSA 1E15A 1ROUA 4JFKA 1H0IA 4WKHA 4ZPWR 1J4IA 1D2KA 1JVWA 3BMBA 3G6LA 1E6RA 4ML4A 3WD0A 1XHGA 4MNJA 2DSZA 1FD9A 4U85A 1Q6IA 3O5QA 4MNMA 1PINA 3PR9A 1GPFA 1E9LA 3LUOA 1FKLA 1D7IA 3CH9A 2RUQA 4IPXA 4LAXA 3O5DA 1FKGA 1EIBA 3WL1A 1F40A 1ZL1A 2K8IA 2F23A 3ARQA 4TX0A 3RM9A 5HWCA 2KGJA 1FFRA 3WQVA 1LG2A 4JFLA 3QOKA 3KAGA 4JFIA 1N1AA 3CHCA 4U86A 3NI6A 2ZQUA 1W1VA 4BF8A 3UI6A 1EQ3A 5HT1A 4Q22A 2PPOA 1Y0OA 2QF8A 3O5EA 1FKIA 3O5JA 4URIA 1ZBKA 2N87A 1TFVA 3ARWA 2OLHA 4GIVA 2P4VA 2XPAA 3RGCA 3KZ7A 2LKNA 4ODMA 4N19A 5J6EA 2OFNA 2LJ4A 3PRAA 3TDBA 4J4OA 4FN2A 4LAVA 3B9EA 1FKFA 1JNDA 4TW7A 1R9HA 3FY1A 5HBFA 4WIWA 3CHEA 3CGMA 4UDMA 3WKZA 4QT3A 1U79A 3KCEA 4AY1A 1NMWA 4L72B 4DZ3A 2PBCA 3UQAA 4DRKA 4MNKA 1UR8A 2PN0A 4GGQA 4P8VA 1F8AB 1JNTA 1FJDA 1M5YA 1K9TA 1NWSA 3AS3A 5DIUA 4MPKA 4U84A 1J4HA 1FKJA 1FAPA 1EYMA 3PA7A 1SR0A 1VF8A 3ARXA 1J4RA 2XP8A 1KFWA 2MLYA 3B8SA 2UZ5A 2LPVA 3G6MA 1YATA 2M08A 1FFQA 3WQWA 3O5MA 5DEZA 1KT1A 1NH6A 4TNSA 3PRDA 4W5UA 1BL4A 3O5RA 3B7XA 1JNEA 4DWSD 4JFMA 1GRJA 3AS1A 2PPNA 4WJXA 3EY6A 3VAWA 2M2AA 3AQUA 1BKFA 2B5UB 3TCZA 2RQSA 3ALFA 3UI4A 1X6LA 1QPFA 3WD4A 5HTGA 4ODQA 4DT4A 3RMEA 2MLZA 3ODKA 4TW6A 2FAPA 3KAHA 3O5OA 3OOBA 2KE0A 1ZBVA 2Y78A 3CZ8A 2KFWA 4HBOA 2DG3A 2WK2A 4P8UA 4L3NA 4Q7NA 2M1IA 1Q1CA 3ARVA 1W1YA 4ZPTR 3B9DA 1W9UA 1NWRA 1W9VA 4HARA 2A3EA 1A7XA 1L1PA 1FKRA 4DH0A 1FKTA 2ZR5A 2XP4A 4WKFA 4DIPA 2DT0A 4R0XA 1Q6HA 4DRIA 4R5EA 2RSEA 3FXYA 1W26A 2ITKA 4DZ2A 1ZBCA 4G2PA 1NMVA 4P8WA 1ZK6A 2WLYA 5DO2A 2DT3A 2FDMA 3RFWA 1RD6A 1NWTA 4NSBA 2ESCA 3ARYA 5HW8A 4S3KA 5GPGA 3AS0A 4MTVA 4XAKA 5DF0A 2L2SA 1KT0A 3UI5A 4G50A 1H0GA 3O5LA 2YBTA 3WIJA 2FKEA 4DWSB 4MSPA 1IX5A 4ZS6A 4ODNA 4HBEA 1WB0A 3ARZA 2EULA 1XRVA 1CTNA 1LL6A 1UR9A 1ZB5A 2F21A 4Z2HA 1J6YA 2RUCA 1EDQA 3I6CA 1JNSA 4Z2IA 1ZBWA 3KACA 2KI3A 2VN1A 2DSUA 4DRHA 4W9PA 3UQBA 2XP6A 3ALGA 1LJYA 2DPEA 4MAVA 3ARUA 2DG4A
chains in the Genus database with same CATH topology
4DROA 3UF8A 2XP3A 3WD1A 3O5GA 1D7JA 3KADA 2KO7A 1HJWA 1OWQA 3KAIA 2G8ZA 1HJVA 2B31A 2F2DA 3MDYB 2RURA 5GPRA 3JXVA 2DSWA 2DT2A 4ITZA 4Z2JA 4DRMA 4Z2GA 5HW7A 5HKGA 2O92A 1HKJA 3UQIA 1W9PA 2A3CA 2AOSA 3BXWA 4JYSA 1E6ZA 1GOIA 3PRBA 4IQ2A 5DIVA 3WD3A 4PTMA 1FKHA 3CGNA 2DT1A 4LAWA 4QIBA 4DRQA 3IHZA 1ZU8A 4KR0B 1B6CA 4DRPA 3JYJA 5HUAA 2XP7A 5BXJA 3WL0A 1HKIA 1OGBA 4TYOA 1WNOA 3TC5A 2PV2A 2WLZA 2IF4A 1SYTA 1OGGA 2F4EA 2PV3A 1HKMA 2LGOA 2RUDA 1Q6UA 5JH8A 4DWSA 4ODPA 4W9OA 1HJXA 1LQ0A 4ODKA 2IUZA 4KQZA 3WH0A 2PPPA 2PI6A 2WM0A 4J4NA 5I98A 1ROTA 1W1TA 2ZR4A 1NWUA 2G41A 3CHFA 3O5PA 3RM8A 2Q5AA 1FKSA 4DWSC 4IT6A 4NZCA 3WD2A 1E6NA 4ODOA 1QZ2A 1FKDA 3KAFA 1T11A 2ZQTA 3NTPA 1WAWA 4Z2LA 5D75A 3IKGA 1D6OA 1LG1A 1HXVA 2XPBA 5HW6A 1X6NA 3O5FA 2MNTA 4S3JA 4ODLA 3ARRA 1EHNA 4MNLA 4DRNA 4LAYA 3NRKA 4MGVA 4O2TA 4ZPVR 5DITA 4FAPA 2A3AA 2ZQSA 2JZVA 1TCOC 2MLXA 3RM4A 4WK9A 4QZVB 1FKBA 1HKKA 3FAPA 2MPHA 3CHDA 3O5KA 4ODRA 5GQBA 3O5IA 2PV1A 5HWBA 1YW5A 2DSVA 1E6PA 3AROA 2A3BA 3W4RA 4JFJA 1W1PA 1NSGA 4P8XA 2XP9A 1P5QA 2ZQVA 3ARPA 2KR7A 4IQCA 4LGXA 4DRJA 2VCDA 3ARTA 4IT4A 3OA5A 2AWGA 1C9HA 2ZR6A 4W9QA 2MF9A 3AS2A 1D7HA 1LL4A 1O6IA 2XP5A 5B8IC 1FKKA 1QPLA 1LL7A 4WKAA 4TW8A 3KABA 3GPKA 4C02B 1ITXA 2YBUA 4Z2KA 2D9FA 3H9RB 4QT2A 1GUVA 1PBKA 2O9OA 1ZCNA 2DG9A 3B9AA 3IKDA 4NNRA 3IK8A 3JYMA 3ARSA 1E15A 1ROUA 4JFKA 1H0IA 4WKHA 4ZPWR 1J4IA 1D2KA 1JVWA 3G6LA 1E6RA 4ML4A 3WD0A 1XHGA 4MNJA 2DSZA 1FD9A 4U85A 1Q6IA 3O5QA 4MNMA 1PINA 3PR9A 1GPFA 1E9LA 3LUOA 1FKLA 1D7IA 3CH9A 2RUQA 4IPXA 4LAXA 3O5DA 1FKGA 1EIBA 3WL1A 1F40A 1ZL1A 2K8IA 3ARQA 4TX0A 3RM9A 5HWCA 2KGJA 1FFRA 3WQVA 1LG2A 4JFLA 3QOKA 3KAGA 4JFIA 1N1AA 3CHCA 4U86A 3NI6A 2ZQUA 1W1VA 4BF8A 3UI6A 1EQ3A 5HT1A 4Q22A 2PPOA 1Y0OA 2QF8A 3O5EA 1FKIA 3O5JA 4URIA 1ZBKA 2N87A 1TFVA 3ARWA 2OLHA 4GIVA 2XPAA 3RGCA 3KZ7A 2LKNA 4ODMA 4N19A 5J6EA 2OFNA 2LJ4A 3PRAA 3TDBA 4J4OA 4FN2A 4LAVA 3B9EA 1FKFA 1JNDA 4TW7A 1R9HA 3FY1A 5HBFA 4WIWA 3CHEA 3CGMA 3WKZA 4QT3A 1U79A 3KCEA 4AY1A 1NMWA 4L72B 4DZ3A 2PBCA 3UQAA 4DRKA 4MNKA 1UR8A 4GGQA 4P8VA 1F8AB 1JNTA 1FJDA 1M5YA 1K9TA 1NWSA 3AS3A 5DIUA 4MPKA 4U84A 1J4HA 1FKJA 1FAPA 1EYMA 3PA7A 1SR0A 1VF8A 3ARXA 1J4RA 2XP8A 1KFWA 2MLYA 3B8SA 2UZ5A 2LPVA 3G6MA 1YATA 2M08A 1FFQA 3WQWA 3O5MA 5DEZA 1KT1A 1NH6A 4TNSA 3PRDA 4W5UA 1BL4A 3O5RA 3B7XA 1JNEA 4DWSD 4JFMA 3AS1A 2PPNA 4WJXA 3EY6A 3VAWA 2M2AA 3AQUA 1BKFA 3TCZA 2RQSA 3ALFA 3UI4A 1X6LA 1QPFA 3WD4A 5HTGA 4ODQA 4DT4A 3RMEA 2MLZA 3ODKA 4TW6A 2FAPA 3KAHA 3O5OA 3OOBA 2KE0A 1ZBVA 2Y78A 3CZ8A 2KFWA 4HBOA 2DG3A 2WK2A 4P8UA 4L3NA 4Q7NA 2M1IA 1Q1CA 3ARVA 1W1YA 4ZPTR 3B9DA 1W9UA 1NWRA 1W9VA 4HARA 2A3EA 1A7XA 1L1PA 1FKRA 4DH0A 1FKTA 2ZR5A 2XP4A 4WKFA 4DIPA 2DT0A 4R0XA 1Q6HA 4DRIA 4R5EA 2RSEA 3FXYA 1W26A 2ITKA 4DZ2A 1ZBCA 4G2PA 1NMVA 4P8WA 1ZK6A 2WLYA 5DO2A 2DT3A 2FDMA 3RFWA 1RD6A 1NWTA 4NSBA 2ESCA 3ARYA 5HW8A 4S3KA 5GPGA 3AS0A 4MTVA 4XAKA 5DF0A 2L2SA 1KT0A 3UI5A 4G50A 1H0GA 3O5LA 2YBTA 3WIJA 2FKEA 4DWSB 4MSPA 1IX5A 4ZS6A 4ODNA 4HBEA 1WB0A 3ARZA 1XRVA 1CTNA 1LL6A 1UR9A 1ZB5A 2F21A 4Z2HA 1J6YA 2RUCA 1EDQA 3I6CA 1JNSA 4Z2IA 1ZBWA 3KACA 2KI3A 2VN1A 2DSUA 4DRHA 4W9PA 3UQBA 2XP6A 3ALGA 1LJYA 2DPEA 4MAVA 3ARUA 2DG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCZ A;  2MNT A;  4DRO A;  1F40 A;  2K8I A;  2RQS A;  4ODL A;  3UI4 A;  4DRN A;  3UF8 A;  4LAY A;  2XP3 A;  1QPF A;  4TX0 A;  5HWC A;  2KGJ A;  3NRK A;  4MGV A;  4O2T A;  4ODQ A;  5DIT A;  3TDB A;  3O5G A;  2ZQS A;  4DT4 A;  2JZV A;  4FAP A;  1D7J A;  3KAD A;  1TCO C;  2KO7 A;  2MLX A;  2MLZ A;  4JFL A;  3ODK A;  3KAI A;  3KAG A;  2FAP A;  4JFI A;  3KAH A;  3O5O A;  4TW6 A;  1N1A A;  3OOB A;  2F2D A;  4U86 A;  3MDY B;  2RUR A;  2KE0 A;  1FKB A;  2ZQU A;  3NI6 A;  2Y78 A;  3FAP A;  3JXV A;  2MPH A;  3O5K A;  4ITZ A;  4ODR A;  4BF8 A;  4DRM A;  5HW7 A;  2KFW A;  5HKG A;  2DG3 A;  2PV1 A;  3O5I A;  3UI6 A;  3UQI A;  5HWB A;  1EQ3 A;  1YW5 A;  5HT1 A;  2PPO A;  1Y0O A;  2M1I A;  4JYS A;  1Q1C A;  1FKI A;  3O5E A;  3O5J A;  3PRB A;  4JFJ A;  4IQ2 A;  1NSG A;  2N87 A;  5DIV A;  4GIV A;  2XPA A;  2XP9 A;  3RGC A;  3KZ7 A;  2LKN A;  1FKH A;  3CGN A;  1A7X A;  1L1P A;  1P5Q A;  1FKR A;  4DH0 A;  4ODM A;  2ZQV A;  4N19 A;  5J6E A;  2OFN A;  1FKT A;  2LJ4 A;  4LAW A;  4J4O A;  2ZR5 A;  4FN2 A;  4LAV A;  4QIB A;  1FKF A;  2XP4 A;  2KR7 A;  4IQC A;  3IHZ A;  4DRQ A;  4DRJ A;  4DIP A;  5HTG A;  4TW7 A;  4R0X A;  1Q6H A;  4DRI A;  2VCD A;  1R9H A;  2RSE A;  2AWG A;  1B6C A;  1C9H A;  2ZR6 A;  4W9Q A;  4DRP A;  3CGM A;  3JYJ A;  2MF9 A;  1W26 A;  4QT3 A;  1D7H A;  1U79 A;  5HUA A;  2ITK A;  2XP5 A;  2XP7 A;  3KCE A;  4G2P A;  4DZ2 A;  5B8I C;  5BXJ A;  1NMV A;  4TYO A;  1NMW A;  1ZK6 A;  1FKK A;  1QPL A;  2PBC A;  2IF4 A;  2PV2 A;  3RFW A;  3TC5 A;  4DRK A;  4DZ3 A;  3UQA A;  4TW8 A;  3KAB A;  2F4E A;  3GPK A;  2PV3 A;  4GGQ A;  2LGO A;  4C02 B;  1F8A B;  2RUD A;  1JNT A;  2D9F A;  3H9R B;  1Q6U A;  4QT2 A;  5HW8 A;  1FJD A;  1M5Y A;  5GPG A;  4ODP A;  1PBK A;  5DIU A;  4W9O A;  4U84 A;  1ZCN A;  2DG9 A;  1J4H A;  2L2S A;  1KT0 A;  3UI5 A;  3IKD A;  4G50 A;  4NNR A;  4ODK A;  3O5L A;  3IK8 A;  3JYM A;  1FKJ A;  3WH0 A;  2PPP A;  1ROU A;  4JFK A;  2FKE A;  4J4N A;  4MSP A;  5I98 A;  1FAP A;  1EYM A;  3PA7 A;  1ROT A;  1J4I A;  1JVW A;  4ODN A;  2ZR4 A;  1J4R A;  2F21 A;  2XP8 A;  3O5P A;  2MLY A;  1J6Y A;  2Q5A A;  2RUC A;  1FKS A;  3I6C A;  2UZ5 A;  1JNS A;  2LPV A;  4ODO A;  1QZ2 A;  1FKD A;  3KAF A;  1YAT A;  1T11 A;  1FD9 A;  2ZQT A;  3NTP A;  2M08 A;  3KAC A;  3O5D A;  4U85 A;  2KI3 A;  3O5M A;  5D75 A;  3IKG A;  1D6O A;  1KT1 A;  1Q6I A;  3O5Q A;  3PRD A;  4TNS A;  1HXV A;  1BL4 A;  2VN1 A;  2XPB A;  1PIN A;  3O5R A;  4DRH A;  4W9P A;  3B7X A;  3UQB A;  2XP6 A;  5HW6 A;  4JFM A;  3LUO A;  1FKL A;  1D7I A;  2PPN A;  3O5F A;  3EY6 A;  3VAW A;  2M2A A;  2RUQ A;  4IPX A;  4LAX A;  1FKG A;  2DG4 A;  1BKF A; 
#chains in the Genus database with same CATH topology
 4DRO A;  3UF8 A;  2XP3 A;  3WD1 A;  3O5G A;  1D7J A;  3KAD A;  2KO7 A;  1HJW A;  1OWQ A;  3KAI A;  2G8Z A;  1HJV A;  2B31 A;  2F2D A;  3MDY B;  2RUR A;  5GPR A;  3JXV A;  2DSW A;  2DT2 A;  4ITZ A;  4Z2J A;  4DRM A;  4Z2G A;  5HW7 A;  5HKG A;  2O92 A;  1HKJ A;  3UQI A;  1W9P A;  2A3C A;  2AOS A;  3BXW A;  4JYS A;  1E6Z A;  1GOI A;  3PRB A;  4IQ2 A;  5DIV A;  3WD3 A;  4PTM A;  1FKH A;  3CGN A;  3EIP A;  2DT1 A;  4LAW A;  4QIB A;  4DRQ A;  3IHZ A;  1ZU8 A;  4KR0 B;  1B6C A;  4DRP A;  3JYJ A;  5HUA A;  2XP7 A;  5BXJ A;  3WL0 A;  1HKI A;  1OGB A;  4TYO A;  1WNO A;  3TC5 A;  2PV2 A;  2WLZ A;  2IF4 A;  1SYT A;  1OGG A;  2F4E A;  2PV3 A;  1HKM A;  2LGO A;  2RUD A;  1Q6U A;  5JH8 A;  4DWS A;  4ODP A;  4W9O A;  2ETN A;  1HJX A;  1LQ0 A;  3GU0 A;  4ODK A;  2IUZ A;  4KQZ A;  3WH0 A;  2PPP A;  2PI6 A;  2WM0 A;  4J4N A;  5I98 A;  1ROT A;  1W1T A;  2ZR4 A;  1NWU A;  2G41 A;  3CHF A;  3O5P A;  3RM8 A;  2Q5A A;  1FKS A;  4DWS C;  4IT6 A;  4NZC A;  3WD2 A;  1E6N A;  4ODO A;  1QZ2 A;  1FKD A;  3KAF A;  1T11 A;  2ZQT A;  3NTP A;  1WAW A;  4Z2L A;  5D75 A;  3IKG A;  1D6O A;  1LG1 A;  1HXV A;  2XPB A;  5HW6 A;  1X6N A;  3O5F A;  2MNT A;  4S3J A;  4ODL A;  3ARR A;  1EHN A;  4MNL A;  4DRN A;  4LAY A;  3NRK A;  4MGV A;  4O2T A;  4ZPV R;  5DIT A;  4FAP A;  2A3A A;  2ZQS A;  2JZV A;  1TCO C;  2MLX A;  3RM4 A;  4WK9 A;  4QZV B;  1FKB A;  1HKK A;  3FAP A;  2MPH A;  3CHD A;  3O5K A;  4ODR A;  5GQB A;  3O5I A;  2PV1 A;  5HWB A;  1YW5 A;  2DSV A;  1E6P A;  3ARO A;  2A3B A;  3W4R A;  4JFJ A;  1W1P A;  1NSG A;  4P8X A;  2XP9 A;  1P5Q A;  3GTY X;  2ZQV A;  1E44 A;  3ARP A;  2KR7 A;  4IQC A;  4LGX A;  4DRJ A;  2VCD A;  3ART A;  4IT4 A;  3OA5 A;  2AWG A;  1C9H A;  2ZR6 A;  4W9Q A;  2MF9 A;  3AS2 A;  1JCH B;  1D7H A;  1LL4 A;  1O6I A;  2XP5 A;  5B8I C;  1FKK A;  1QPL A;  1LL7 A;  4WKA A;  4TW8 A;  3KAB A;  3GPK A;  4C02 B;  1ITX A;  2YBU A;  4Z2K A;  2D9F A;  3H9R B;  4QT2 A;  1GUV A;  1PBK A;  2O9O A;  1ZCN A;  2DG9 A;  3B9A A;  3IKD A;  4NNR A;  3IK8 A;  3JYM A;  3ARS A;  1E15 A;  1ROU A;  4JFK A;  1H0I A;  4WKH A;  4ZPW R;  1J4I A;  1D2K A;  1JVW A;  3BMB A;  3G6L A;  1E6R A;  4ML4 A;  3WD0 A;  1XHG A;  4MNJ A;  2DSZ A;  1FD9 A;  4U85 A;  1Q6I A;  3O5Q A;  4MNM A;  1PIN A;  3PR9 A;  1GPF A;  1E9L A;  3LUO A;  1FKL A;  1D7I A;  3CH9 A;  2RUQ A;  4IPX A;  4LAX A;  3O5D A;  1FKG A;  1EIB A;  3WL1 A;  1F40 A;  1ZL1 A;  2K8I A;  2F23 A;  3ARQ A;  4TX0 A;  3RM9 A;  5HWC A;  2KGJ A;  1FFR A;  3WQV A;  1LG2 A;  4JFL A;  3QOK A;  3KAG A;  4JFI A;  1N1A A;  3CHC A;  4U86 A;  3NI6 A;  2ZQU A;  1W1V A;  4BF8 A;  3UI6 A;  1EQ3 A;  5HT1 A;  4Q22 A;  2PPO A;  1Y0O A;  2QF8 A;  3O5E A;  1FKI A;  3O5J A;  4URI A;  1ZBK A;  2N87 A;  1TFV A;  3ARW A;  2OLH A;  4GIV A;  2P4V A;  2XPA A;  3RGC A;  3KZ7 A;  2LKN A;  4ODM A;  4N19 A;  5J6E A;  2OFN A;  2LJ4 A;  3PRA A;  3TDB A;  4J4O A;  4FN2 A;  4LAV A;  3B9E A;  1FKF A;  1JND A;  4TW7 A;  1R9H A;  3FY1 A;  5HBF A;  4WIW A;  3CHE A;  3CGM A;  4UDM A;  3WKZ A;  4QT3 A;  1U79 A;  3KCE A;  4AY1 A;  1NMW A;  4L72 B;  4DZ3 A;  2PBC A;  3UQA A;  4DRK A;  4MNK A;  1UR8 A;  2PN0 A;  4GGQ A;  4P8V A;  1F8A B;  1JNT A;  1FJD A;  1M5Y A;  1K9T A;  1NWS A;  3AS3 A;  5DIU A;  4MPK A;  4U84 A;  1J4H A;  1FKJ A;  1FAP A;  1EYM A;  3PA7 A;  1SR0 A;  1VF8 A;  3ARX A;  1J4R A;  2XP8 A;  1KFW A;  2MLY A;  3B8S A;  2UZ5 A;  2LPV A;  3G6M A;  1YAT A;  2M08 A;  1FFQ A;  3WQW A;  3O5M A;  5DEZ A;  1KT1 A;  1NH6 A;  4TNS A;  3PRD A;  4W5U A;  1BL4 A;  3O5R A;  3B7X A;  1JNE A;  4DWS D;  4JFM A;  1GRJ A;  3AS1 A;  2PPN A;  4WJX A;  3EY6 A;  3VAW A;  2M2A A;  3AQU A;  1BKF A;  2B5U B;  3TCZ A;  2RQS A;  3ALF A;  3UI4 A;  1X6L A;  1QPF A;  3WD4 A;  5HTG A;  4ODQ A;  4DT4 A;  3RME A;  2MLZ A;  3ODK A;  4TW6 A;  2FAP A;  3KAH A;  3O5O A;  3OOB A;  2KE0 A;  1ZBV A;  2Y78 A;  3CZ8 A;  2KFW A;  4HBO A;  2DG3 A;  2WK2 A;  4P8U A;  4L3N A;  4Q7N A;  2M1I A;  1Q1C A;  3ARV A;  1W1Y A;  4ZPT R;  3B9D A;  1W9U A;  1NWR A;  1W9V A;  4HAR A;  2A3E A;  1A7X A;  1L1P A;  1FKR A;  4DH0 A;  1FKT A;  2ZR5 A;  2XP4 A;  4WKF A;  4DIP A;  2DT0 A;  4R0X A;  1Q6H A;  4DRI A;  4R5E A;  2RSE A;  3FXY A;  1W26 A;  2ITK A;  4DZ2 A;  1ZBC A;  4G2P A;  1NMV A;  4P8W A;  1ZK6 A;  2WLY A;  5DO2 A;  2DT3 A;  2FDM A;  3RFW A;  1RD6 A;  1NWT A;  4NSB A;  2ESC A;  3ARY A;  5HW8 A;  4S3K A;  5GPG A;  3AS0 A;  4MTV A;  4XAK A;  5DF0 A;  2L2S A;  1KT0 A;  3UI5 A;  4G50 A;  1H0G A;  3O5L A;  2YBT A;  3WIJ A;  2FKE A;  4DWS B;  4MSP A;  1IX5 A;  4ZS6 A;  4ODN A;  4HBE A;  1WB0 A;  3ARZ A;  2EUL A;  1XRV A;  1CTN A;  1LL6 A;  1UR9 A;  1ZB5 A;  2F21 A;  4Z2H A;  1J6Y A;  2RUC A;  1EDQ A;  3I6C A;  1JNS A;  4Z2I A;  1ZBW A;  3KAC A;  2KI3 A;  2VN1 A;  2DSU A;  4DRH A;  4W9P A;  3UQB A;  2XP6 A;  3ALG A;  1LJY A;  2DPE A;  4MAV A;  3ARU A;  2DG4 A; 
#chains in the Genus database with same CATH homology
 4DRO A;  3UF8 A;  2XP3 A;  3WD1 A;  3O5G A;  1D7J A;  3KAD A;  2KO7 A;  1HJW A;  1OWQ A;  3KAI A;  2G8Z A;  1HJV A;  2B31 A;  2F2D A;  3MDY B;  2RUR A;  5GPR A;  3JXV A;  2DSW A;  2DT2 A;  4ITZ A;  4Z2J A;  4DRM A;  4Z2G A;  5HW7 A;  5HKG A;  2O92 A;  1HKJ A;  3UQI A;  1W9P A;  2A3C A;  2AOS A;  3BXW A;  4JYS A;  1E6Z A;  1GOI A;  3PRB A;  4IQ2 A;  5DIV A;  3WD3 A;  4PTM A;  1FKH A;  3CGN A;  2DT1 A;  4LAW A;  4QIB A;  4DRQ A;  3IHZ A;  1ZU8 A;  4KR0 B;  1B6C A;  4DRP A;  3JYJ A;  5HUA A;  2XP7 A;  5BXJ A;  3WL0 A;  1HKI A;  1OGB A;  4TYO A;  1WNO A;  3TC5 A;  2PV2 A;  2WLZ A;  2IF4 A;  1SYT A;  1OGG A;  2F4E A;  2PV3 A;  1HKM A;  2LGO A;  2RUD A;  1Q6U A;  5JH8 A;  4DWS A;  4ODP A;  4W9O A;  1HJX A;  1LQ0 A;  4ODK A;  2IUZ A;  4KQZ A;  3WH0 A;  2PPP A;  2PI6 A;  2WM0 A;  4J4N A;  5I98 A;  1ROT A;  1W1T A;  2ZR4 A;  1NWU A;  2G41 A;  3CHF A;  3O5P A;  3RM8 A;  2Q5A A;  1FKS A;  4DWS C;  4IT6 A;  4NZC A;  3WD2 A;  1E6N A;  4ODO A;  1QZ2 A;  1FKD A;  3KAF A;  1T11 A;  2ZQT A;  3NTP A;  1WAW A;  4Z2L A;  5D75 A;  3IKG A;  1D6O A;  1LG1 A;  1HXV A;  2XPB A;  5HW6 A;  1X6N A;  3O5F A;  2MNT A;  4S3J A;  4ODL A;  3ARR A;  1EHN A;  4MNL A;  4DRN A;  4LAY A;  3NRK A;  4MGV A;  4O2T A;  4ZPV R;  5DIT A;  4FAP A;  2A3A A;  2ZQS A;  2JZV A;  1TCO C;  2MLX A;  3RM4 A;  4WK9 A;  4QZV B;  1FKB A;  1HKK A;  3FAP A;  2MPH A;  3CHD A;  3O5K A;  4ODR A;  5GQB A;  3O5I A;  2PV1 A;  5HWB A;  1YW5 A;  2DSV A;  1E6P A;  3ARO A;  2A3B A;  3W4R A;  4JFJ A;  1W1P A;  1NSG A;  4P8X A;  2XP9 A;  1P5Q A;  2ZQV A;  3ARP A;  2KR7 A;  4IQC A;  4LGX A;  4DRJ A;  2VCD A;  3ART A;  4IT4 A;  3OA5 A;  2AWG A;  1C9H A;  2ZR6 A;  4W9Q A;  2MF9 A;  3AS2 A;  1D7H A;  1LL4 A;  1O6I A;  2XP5 A;  5B8I C;  1FKK A;  1QPL A;  1LL7 A;  4WKA A;  4TW8 A;  3KAB A;  3GPK A;  4C02 B;  1ITX A;  2YBU A;  4Z2K A;  2D9F A;  3H9R B;  4QT2 A;  1GUV A;  1PBK A;  2O9O A;  1ZCN A;  2DG9 A;  3B9A A;  3IKD A;  4NNR A;  3IK8 A;  3JYM A;  3ARS A;  1E15 A;  1ROU A;  4JFK A;  1H0I A;  4WKH A;  4ZPW R;  1J4I A;  1D2K A;  1JVW A;  3G6L A;  1E6R A;  4ML4 A;  3WD0 A;  1XHG A;  4MNJ A;  2DSZ A;  1FD9 A;  4U85 A;  1Q6I A;  3O5Q A;  4MNM A;  1PIN A;  3PR9 A;  1GPF A;  1E9L A;  3LUO A;  1FKL A;  1D7I A;  3CH9 A;  2RUQ A;  4IPX A;  4LAX A;  3O5D A;  1FKG A;  1EIB A;  3WL1 A;  1F40 A;  1ZL1 A;  2K8I A;  3ARQ A;  4TX0 A;  3RM9 A;  5HWC A;  2KGJ A;  1FFR A;  3WQV A;  1LG2 A;  4JFL A;  3QOK A;  3KAG A;  4JFI A;  1N1A A;  3CHC A;  4U86 A;  3NI6 A;  2ZQU A;  1W1V A;  4BF8 A;  3UI6 A;  1EQ3 A;  5HT1 A;  4Q22 A;  2PPO A;  1Y0O A;  2QF8 A;  3O5E A;  1FKI A;  3O5J A;  4URI A;  1ZBK A;  2N87 A;  1TFV A;  3ARW A;  2OLH A;  4GIV A;  2XPA A;  3RGC A;  3KZ7 A;  2LKN A;  4ODM A;  4N19 A;  5J6E A;  2OFN A;  2LJ4 A;  3PRA A;  3TDB A;  4J4O A;  4FN2 A;  4LAV A;  3B9E A;  1FKF A;  1JND A;  4TW7 A;  1R9H A;  3FY1 A;  5HBF A;  4WIW A;  3CHE A;  3CGM A;  3WKZ A;  4QT3 A;  1U79 A;  3KCE A;  4AY1 A;  1NMW A;  4L72 B;  4DZ3 A;  2PBC A;  3UQA A;  4DRK A;  4MNK A;  1UR8 A;  4GGQ A;  4P8V A;  1F8A B;  1JNT A;  1FJD A;  1M5Y A;  1K9T A;  1NWS A;  3AS3 A;  5DIU A;  4MPK A;  4U84 A;  1J4H A;  1FKJ A;  1FAP A;  1EYM A;  3PA7 A;  1SR0 A;  1VF8 A;  3ARX A;  1J4R A;  2XP8 A;  1KFW A;  2MLY A;  3B8S A;  2UZ5 A;  2LPV A;  3G6M A;  1YAT A;  2M08 A;  1FFQ A;  3WQW A;  3O5M A;  5DEZ A;  1KT1 A;  1NH6 A;  4TNS A;  3PRD A;  4W5U A;  1BL4 A;  3O5R A;  3B7X A;  1JNE A;  4DWS D;  4JFM A;  3AS1 A;  2PPN A;  4WJX A;  3EY6 A;  3VAW A;  2M2A A;  3AQU A;  1BKF A;  3TCZ A;  2RQS A;  3ALF A;  3UI4 A;  1X6L A;  1QPF A;  3WD4 A;  5HTG A;  4ODQ A;  4DT4 A;  3RME A;  2MLZ A;  3ODK A;  4TW6 A;  2FAP A;  3KAH A;  3O5O A;  3OOB A;  2KE0 A;  1ZBV A;  2Y78 A;  3CZ8 A;  2KFW A;  4HBO A;  2DG3 A;  2WK2 A;  4P8U A;  4L3N A;  4Q7N A;  2M1I A;  1Q1C A;  3ARV A;  1W1Y A;  4ZPT R;  3B9D A;  1W9U A;  1NWR A;  1W9V A;  4HAR A;  2A3E A;  1A7X A;  1L1P A;  1FKR A;  4DH0 A;  1FKT A;  2ZR5 A;  2XP4 A;  4WKF A;  4DIP A;  2DT0 A;  4R0X A;  1Q6H A;  4DRI A;  4R5E A;  2RSE A;  3FXY A;  1W26 A;  2ITK A;  4DZ2 A;  1ZBC A;  4G2P A;  1NMV A;  4P8W A;  1ZK6 A;  2WLY A;  5DO2 A;  2DT3 A;  2FDM A;  3RFW A;  1RD6 A;  1NWT A;  4NSB A;  2ESC A;  3ARY A;  5HW8 A;  4S3K A;  5GPG A;  3AS0 A;  4MTV A;  4XAK A;  5DF0 A;  2L2S A;  1KT0 A;  3UI5 A;  4G50 A;  1H0G A;  3O5L A;  2YBT A;  3WIJ A;  2FKE A;  4DWS B;  4MSP A;  1IX5 A;  4ZS6 A;  4ODN A;  4HBE A;  1WB0 A;  3ARZ A;  1XRV A;  1CTN A;  1LL6 A;  1UR9 A;  1ZB5 A;  2F21 A;  4Z2H A;  1J6Y A;  2RUC A;  1EDQ A;  3I6C A;  1JNS A;  4Z2I A;  1ZBW A;  3KAC A;  2KI3 A;  2VN1 A;  2DSU A;  4DRH A;  4W9P A;  3UQB A;  2XP6 A;  3ALG A;  1LJY A;  2DPE A;  4MAV A;  3ARU A;  2DG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...