1FKIA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 BINDING PROTEIN
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
molecule tags Cis-trans isomerase
total genus 25
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkiA00
2KGJA 1D7HA 4TW6A 4JYSA 4ODQA 1D7JA 4N19A 4ODKA 2F21A 4JFLA 2XP4A 4DRNA 3UQAA 2ZR4A 2MPHA 4U86A 1ROTA 2KO7A 4J4OA 4G2PA 3O5KA 4ODPA 2D9FA 2KI3A 3O5IA 3B7XA 1HXVA 4G50A 1J6YA 1B6CA 2PBCA 2ZR5A 4DRHA 1U79A 1JVWA 4MGVA 4DRQA 1EYMA 3JXVA 3FAPA 3KAIA 3LUOA 2N87A 2VCDA 2ZQUA 4ODOA 3JYMA 1EQ3A 3UI6A 1L1PA 4IQ2A 4W9QA 4R0XA 1T11A 1BL4A 5DIUA 1NMVA 2RURA 4C02B 5HW8A 2LKNA 1PBKA 1W26A 2Q5AA 3H9RB 4IQCA 1N1AA 2FAPA 2XPAA 2F4EA 4DRKA 2VN1A 3CGNA 4LAVA 2F2DA 1FKHA 3O5PA 4W9PA 3VAWA 1FKTA 4DROA 4TX0A 1KT0A 4FN2A 3RGCA 1Q6HA 2JZVA 4FAPA 5HWBA 2ZQVA 3KCEA 2PPPA 2PV1A 3KAFA 1NSGA 3IKDA 3NTPA 3O5FA 4MSPA 4QIBA 4BF8A 2PV3A 2DG9A 1F40A 4DH0A 1P5QA 3KACA 4DZ2A 4LAYA 1JNTA 3PRBA 1FKSA 1J4RA 1M5YA 1Y0OA 2XP9A 4LAWA 1FJDA 1Q1CA 2K8IA 2L2SA 3PRDA 4JFMA 1FKFA 4TW8A 4JFKA 1QPFA 1FD9A 1ROUA 3MDYB 3O5QA 3UI4A 3EY6A 2XP3A 2IF4A 3NI6A 1FKGA 2KE0A 3O5JA 3JYJA 5HKGA 4ODRA 2M2AA 4DRMA 3TDBA 4LAXA 4ODLA 4DRJA 5DITA 1D7IA 3IK8A 5BXJA 4DRPA 1QZ2A 5J6EA 1Q6IA 5D75A 1YATA 2DG4A 2XP7A 3KABA 2AWGA 2MLYA 3KAGA 2RQSA 3TCZA 1KT1A 5B8IC 2ZQTA 5HW6A 5HWCA 4J4NA 2PV2A 3O5RA 3GPKA 3PA7A 3O5OA 2LJ4A 2KFWA 1ZCNA 3OOBA 4NNRA 4TYOA 1D6OA 4TNSA 3IHZA 5DIVA 2ZQSA 3O5LA 4JFIA 4ODNA 2ITKA 2RUDA 2LPVA 1C9HA 3I6CA 1J4HA 2DG3A 3TC5A 4GIVA 2M1IA 2OFNA 1JNSA 3O5DA 1NMWA 3O5MA 4ODMA 2RUCA 2MLZA 4U85A 5I98A 1YW5A 2M08A 3UQBA 2RSEA 4QT3A 1F8AB 2LGOA 2MF9A 1FKDA 2PPOA 3KAHA 1FKRA 1FKJA 1J4IA 4TW7A 2ZR6A 4QT2A 3UQIA 1TCOC 1BKFA 1A7XA 3KZ7A 2UZ5A 4W9OA 5HT1A 1FAPA 4U84A 5GPGA 3RFWA 3UF8A 4DIPA 4DRIA 4IPXA 3UI5A 2Y78A 2FKEA 4O2TA 3ODKA 4DZ3A 2KR7A 2XP8A 2RUQA 1QPLA 5HW7A 1FKIA 3CGMA 2MNTA 1FKKA 2MLXA 1FKBA 1ZK6A 2PPNA 3KADA 5HTGA 2XPBA 2XP5A 3O5GA 1Q6UA 4GGQA 4JFJA 5HUAA 1PINA 3WH0A 1R9HA 1FKLA 3O5EA 2XP6A 4ITZA 3IKGA 4DT4A 3NRKA
chains in the Genus database with same CATH superfamily
3ARWA 4TW6A 4ODQA 4P8UA 2ZR4A 4DWSC 3ALGA 5GPRA 2KO7A 3B7XA 2DSUA 1HXVA 1U79A 3JXVA 3FAPA 2N87A 2VCDA 1UR8A 4IQ2A 1E44A 2ESCA 4MPKA 4R0XA 2ETNA 3H9RB 4DRKA 4LAVA 3EIPA 4DROA 5HBFA 1ZB5A 1KT0A 1ZU8A 2JZVA 3ARQA 4ZPWR 3KAFA 3CZ8A 3O5FA 4QIBA 1F40A 1P5QA 4DZ2A 1E6PA 4LAYA 1FKSA 1M5YA 3WQVA 4LAWA 2L2SA 1QPFA 1FFQA 1ROUA 3MDYB 3UI4A 1W9UA 2QF8A 1FKGA 5HKGA 1LG2A 4WKHA 1D7IA 1QZ2A 4URIA 2DG4A 2AWGA 2MLYA 5B8IC 3WD4A 1KT1A 3FY1A 1E15A 1W1TA 1ZCNA 3OOBA 4NNRA 4TNSA 5DIVA 3O5LA 4W5UA 2LPVA 1J4HA 1HKMA 2DG3A 2OFNA 2DSVA 1NH6A 4HBOA 2MLZA 3G6MA 2B31A 3WD3A 1FKRA 1J4IA 4Q22A 4TW7A 4HARA 2WM0A 1A7XA 1NWRA 4KQZA 4W9OA 3RFWA 4DRIA 1W9PA 2KR7A 2B5UB 4HBEA 3WD1A 2DSWA 3FXYA 3CHDA 2MLXA 4P8WA 3ARYA 1WNOA 1XRVA 2XPBA 5HUAA 1PINA 1K9TA 2A3EA 3WH0A 1R9HA 1FKLA 3IKGA 2OLHA 4JYSA 1W1YA 4N19A 4DRNA 3ARSA 2MPHA 4U86A 1ROTA 2PN0A 4G2PA 3O5KA 3PRAA 4ODPA 3GTYX 1JVWA 1WB0A 3ARZA 3WL0A 3BXWA 2ZQUA 1SR0A 3JYMA 4DWSB 3AQUA 1T11A 1IX5A 4Z2KA 4C02B 4Q7NA 4ZPVR 2LKNA 2Q5AA 5HW8A 2FAPA 3RM8A 3VAWA 1FKHA 3O5PA 1SYTA 4FN2A 2P4VA 2ZQVA 2PV1A 1NSGA 3IKDA 4DH0A 3KACA 4QZVB 3PRBA 2G8ZA 1J4RA 2K8IA 2O9OA 4TW8A 4JFKA 1OWQA 2DT1A 1FD9A 3O5QA 3EY6A 2IF4A 1HJWA 3O5JA 2PI6A 4LAXA 4ODLA 4DRJA 1LL6A 5J6EA 1E6ZA 4DRPA 2XP7A 3KAGA 3TCZA 5DEZA 2ZQTA 2PV2A 3CHCA 3O5RA 4MAVA 2KFWA 1D6OA 4ZPTR 2ZQSA 5DO2A 4XAKA 1ZBVA 3I6CA 2WLZA 1GOIA 4DWSA 1ZBWA 4Z2GA 2IUZA 2M08A 3UQBA 3B9EA 3KAHA 4PTMA 2YBTA 1EHNA 1LL4A 4QT2A 4S3JA 3UQIA 1TCOC 1BKFA 1W1VA 3WIJA 1HKKA 1FAPA 4U84A 3UF8A 1FFRA 5JH8A 4O2TA 3AS0A 4DZ3A 3WL1A 3AS1A 2DT3A 4KR0B 1FKBA 5HTGA 3KADA 4GGQA 3WD0A 4MNLA 2XP6A 4MNKA 1OGBA 3ARUA 3G6LA 1GRJA 4P8VA 2KGJA 1NWUA 1D7JA 4Z2JA 1GUVA 2D9FA 3O5IA 1J6YA 3B9AA 3KAIA 5GQBA 3UI6A 4WJXA 3RM9A 1BL4A 4IT6A 5DIUA 1NMVA 4WK9A 3GU0A 1PBKA 1W9VA 4IQCA 1N1AA 2DT0A 4LGXA 4W9PA 2F2DA 1FKTA 3ARVA 4NSBA 4TX0A 3CH9A 3RGCA 5HWBA 3KCEA 2PPPA 1OGGA 4BF8A 4MSPA 1LQ0A 1JNTA 3BMBA 1Y0OA 1FJDA 1FKFA 1ZBCA 1HJVA 1KFWA 2DT2A 1UR9A 3ALFA 2A3BA 3TDBA 5DITA 3AS2A 3IK8A 5BXJA 1Q6IA 1YATA 1X6LA 3KABA 4UDMA 4WKAA 2RQSA 1D2KA 4J4NA 3WQWA 3PA7A 3O5OA 4S3KA 2LJ4A 1WAWA 4TYOA 1EDQA 4IT4A 1JNEA 4ODNA 2F23A 2ITKA 2RUDA 1C9HA 4AY1A 2G41A 4MNJA 3TC5A 3AS3A 3O5DA 3O5MA 2RUCA 1O6IA 4U85A 5I98A 1RD6A 1CTNA 1YW5A 2RSEA 1HKJA 2LGOA 1FKDA 2PPOA 3ARTA 1FKJA 1X6NA 4NZCA 5GPGA 4DIPA 1LL7A 4IPXA 3UI5A 2Y78A 1H0IA 3B8SA 4MNMA 2A3AA 2RUQA 4L72B 1QPLA 3CHEA 2MNTA 1FKKA 1ZK6A 3O5GA 2AOSA 3O5EA 1ZL1A 1JNDA 1D7HA 4ODKA 2WLYA 2F21A 4JFLA 2XP4A 4Z2LA 3UQAA 3B9DA 4J4OA 2KI3A 3WKZA 3WD2A 4G50A 1W1PA 1B6CA 2PBCA 2ZR5A 4DRHA 2YBUA 4MGVA 4DRQA 1EYMA 4DWSD 3LUOA 2DSZA 4ODOA 1EQ3A 1L1PA 1GPFA 3CHFA 3AROA 4W9QA 4Z2HA 1H0GA 2RURA 4R5EA 1NWSA 1W26A 4P8XA 3ARXA 2XPAA 2F4EA 2VN1A 3CGNA 1EIBA 4MTVA 3RMEA 1HKIA 1Q6HA 4L3NA 1HJXA 4FAPA 1ITXA 3NTPA 2PV3A 2DG9A 3OA5A 2XP9A 2WK2A 1Q1CA 3PRDA 4JFMA 1JCHB 2O92A 2XP3A 3NI6A 2KE0A 1LG1A 3JYJA 4ODRA 2M2AA 4DRMA 3RM4A 4Z2IA 5D75A 2FDMA 5HW6A 5HWCA 3GPKA 1NWTA 3IHZA 4JFIA 2DPEA 4WKFA 1ZBKA 4GIVA 2M1IA 4ZS6A 1JNSA 3PR9A 1NMWA 4ODMA 4QT3A 1F8AB 2MF9A 1LJYA 1E9LA 2EULA 2ZR6A 3ARPA 3ARRA 3KZ7A 1E6RA 2UZ5A 5HT1A 2A3CA 2FKEA 1E6NA 3ODKA 2XP8A 3W4RA 4WIWA 5HW7A 1FKIA 3CGMA 1VF8A 2PPNA 1XHGA 4ML4A 2XP5A 5DF0A 1Q6UA 3QOKA 4JFJA 4ITZA 1TFVA 4DT4A 3NRKA
chains in the Genus database with same CATH topology
3ARWA 4TW6A 4ODQA 4P8UA 2ZR4A 4DWSC 3ALGA 5GPRA 2KO7A 3B7XA 2DSUA 1HXVA 1U79A 3JXVA 3FAPA 2N87A 2VCDA 1UR8A 4IQ2A 2ESCA 4MPKA 4R0XA 3H9RB 4DRKA 4LAVA 4DROA 5HBFA 1ZB5A 1KT0A 1ZU8A 2JZVA 3ARQA 4ZPWR 3KAFA 3CZ8A 3O5FA 4QIBA 1F40A 1P5QA 4DZ2A 1E6PA 4LAYA 1FKSA 1M5YA 3WQVA 4LAWA 2L2SA 1QPFA 1FFQA 1ROUA 3MDYB 3UI4A 1W9UA 2QF8A 1FKGA 5HKGA 1LG2A 4WKHA 1D7IA 1QZ2A 4URIA 2DG4A 2AWGA 2MLYA 5B8IC 3WD4A 1KT1A 3FY1A 1E15A 1W1TA 1ZCNA 3OOBA 4NNRA 4TNSA 5DIVA 3O5LA 4W5UA 2LPVA 1J4HA 1HKMA 2DG3A 2OFNA 2DSVA 1NH6A 4HBOA 2MLZA 3G6MA 2B31A 3WD3A 1FKRA 1J4IA 4Q22A 4TW7A 4HARA 2WM0A 1A7XA 1NWRA 4KQZA 4W9OA 3RFWA 4DRIA 1W9PA 2KR7A 4HBEA 3WD1A 2DSWA 3FXYA 3CHDA 2MLXA 4P8WA 3ARYA 1WNOA 1XRVA 2XPBA 5HUAA 1PINA 1K9TA 2A3EA 3WH0A 1R9HA 1FKLA 3IKGA 2OLHA 4JYSA 1W1YA 4N19A 4DRNA 3ARSA 2MPHA 4U86A 1ROTA 4G2PA 3O5KA 3PRAA 4ODPA 1JVWA 1WB0A 3ARZA 3WL0A 3BXWA 2ZQUA 1SR0A 3JYMA 4DWSB 3AQUA 1T11A 1IX5A 4Z2KA 4C02B 4Q7NA 4ZPVR 2LKNA 2Q5AA 5HW8A 2FAPA 3RM8A 3VAWA 1FKHA 3O5PA 1SYTA 4FN2A 2ZQVA 2PV1A 1NSGA 3IKDA 4DH0A 3KACA 4QZVB 3PRBA 2G8ZA 1J4RA 2K8IA 2O9OA 4TW8A 4JFKA 1OWQA 2DT1A 1FD9A 3O5QA 3EY6A 2IF4A 1HJWA 3O5JA 2PI6A 4LAXA 4ODLA 4DRJA 1LL6A 5J6EA 1E6ZA 4DRPA 2XP7A 3KAGA 3TCZA 5DEZA 2ZQTA 2PV2A 3CHCA 3O5RA 4MAVA 2KFWA 1D6OA 4ZPTR 2ZQSA 5DO2A 4XAKA 1ZBVA 3I6CA 2WLZA 1GOIA 4DWSA 1ZBWA 4Z2GA 2IUZA 2M08A 3UQBA 3B9EA 3KAHA 4PTMA 2YBTA 1EHNA 1LL4A 4QT2A 4S3JA 3UQIA 1TCOC 1BKFA 1W1VA 3WIJA 1HKKA 1FAPA 4U84A 3UF8A 1FFRA 5JH8A 4O2TA 3AS0A 4DZ3A 3WL1A 3AS1A 2DT3A 4KR0B 1FKBA 5HTGA 3KADA 4GGQA 3WD0A 4MNLA 2XP6A 4MNKA 1OGBA 3ARUA 3G6LA 4P8VA 2KGJA 1NWUA 1D7JA 4Z2JA 1GUVA 2D9FA 3O5IA 1J6YA 3B9AA 3KAIA 5GQBA 3UI6A 4WJXA 3RM9A 1BL4A 4IT6A 5DIUA 1NMVA 4WK9A 1PBKA 1W9VA 4IQCA 1N1AA 2DT0A 4LGXA 4W9PA 2F2DA 1FKTA 3ARVA 4NSBA 4TX0A 3CH9A 3RGCA 5HWBA 3KCEA 2PPPA 1OGGA 4BF8A 4MSPA 1LQ0A 1JNTA 1Y0OA 1FJDA 1FKFA 1ZBCA 1HJVA 1KFWA 2DT2A 1UR9A 3ALFA 2A3BA 3TDBA 5DITA 3AS2A 3IK8A 5BXJA 1Q6IA 1YATA 1X6LA 3KABA 4WKAA 2RQSA 1D2KA 4J4NA 3WQWA 3PA7A 3O5OA 4S3KA 2LJ4A 1WAWA 4TYOA 1EDQA 4IT4A 1JNEA 4ODNA 2ITKA 2RUDA 1C9HA 4AY1A 2G41A 4MNJA 3TC5A 3AS3A 3O5DA 3O5MA 2RUCA 1O6IA 4U85A 5I98A 1RD6A 1CTNA 1YW5A 2RSEA 1HKJA 2LGOA 1FKDA 2PPOA 3ARTA 1FKJA 1X6NA 4NZCA 5GPGA 4DIPA 1LL7A 4IPXA 3UI5A 2Y78A 1H0IA 3B8SA 4MNMA 2A3AA 2RUQA 4L72B 1QPLA 3CHEA 2MNTA 1FKKA 1ZK6A 3O5GA 2AOSA 3O5EA 1ZL1A 1JNDA 1D7HA 4ODKA 2WLYA 2F21A 4JFLA 2XP4A 4Z2LA 3UQAA 3B9DA 4J4OA 2KI3A 3WKZA 3WD2A 4G50A 1W1PA 1B6CA 2PBCA 2ZR5A 4DRHA 2YBUA 4MGVA 4DRQA 1EYMA 4DWSD 3LUOA 2DSZA 4ODOA 1EQ3A 1L1PA 1GPFA 3CHFA 3AROA 4W9QA 4Z2HA 1H0GA 2RURA 4R5EA 1NWSA 1W26A 4P8XA 3ARXA 2XPAA 2F4EA 2VN1A 3CGNA 1EIBA 4MTVA 3RMEA 1HKIA 1Q6HA 4L3NA 1HJXA 4FAPA 1ITXA 3NTPA 2PV3A 2DG9A 3OA5A 2XP9A 2WK2A 1Q1CA 3PRDA 4JFMA 2O92A 2XP3A 3NI6A 2KE0A 1LG1A 3JYJA 4ODRA 2M2AA 4DRMA 3RM4A 4Z2IA 5D75A 2FDMA 5HW6A 5HWCA 3GPKA 1NWTA 3IHZA 4JFIA 2DPEA 4WKFA 1ZBKA 4GIVA 2M1IA 4ZS6A 1JNSA 3PR9A 1NMWA 4ODMA 4QT3A 1F8AB 2MF9A 1LJYA 1E9LA 2ZR6A 3ARPA 3ARRA 3KZ7A 1E6RA 2UZ5A 5HT1A 2A3CA 2FKEA 1E6NA 3ODKA 2XP8A 3W4RA 4WIWA 5HW7A 1FKIA 3CGMA 1VF8A 2PPNA 1XHGA 4ML4A 2XP5A 5DF0A 1Q6UA 3QOKA 4JFJA 4ITZA 1TFVA 4DT4A 3NRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGJ A;  1D7H A;  4TW6 A;  4JYS A;  4ODQ A;  1D7J A;  4N19 A;  4ODK A;  2F21 A;  4JFL A;  2XP4 A;  4DRN A;  3UQA A;  2ZR4 A;  2MPH A;  4U86 A;  1ROT A;  2KO7 A;  4J4O A;  4G2P A;  3O5K A;  4ODP A;  2D9F A;  2KI3 A;  3O5I A;  3B7X A;  1HXV A;  4G50 A;  1J6Y A;  1B6C A;  2PBC A;  2ZR5 A;  4DRH A;  1U79 A;  1JVW A;  4MGV A;  4DRQ A;  1EYM A;  3JXV A;  3FAP A;  3KAI A;  3LUO A;  2N87 A;  2VCD A;  2ZQU A;  4ODO A;  3JYM A;  1EQ3 A;  3UI6 A;  1L1P A;  4IQ2 A;  4W9Q A;  4R0X A;  1T11 A;  1BL4 A;  5DIU A;  1NMV A;  2RUR A;  4C02 B;  5HW8 A;  2LKN A;  1PBK A;  1W26 A;  2Q5A A;  3H9R B;  4IQC A;  1N1A A;  2FAP A;  2XPA A;  2F4E A;  4DRK A;  2VN1 A;  3CGN A;  4LAV A;  2F2D A;  1FKH A;  3O5P A;  4W9P A;  3VAW A;  1FKT A;  4DRO A;  4TX0 A;  1KT0 A;  4FN2 A;  3RGC A;  1Q6H A;  2JZV A;  4FAP A;  5HWB A;  2ZQV A;  3KCE A;  2PPP A;  2PV1 A;  3KAF A;  1NSG A;  3IKD A;  3NTP A;  3O5F A;  4MSP A;  4QIB A;  4BF8 A;  2PV3 A;  2DG9 A;  1F40 A;  4DH0 A;  1P5Q A;  3KAC A;  4DZ2 A;  4LAY A;  1JNT A;  3PRB A;  1FKS A;  1J4R A;  1M5Y A;  1Y0O A;  2XP9 A;  4LAW A;  1FJD A;  1Q1C A;  2K8I A;  2L2S A;  3PRD A;  4JFM A;  1FKF A;  4TW8 A;  4JFK A;  1QPF A;  1FD9 A;  1ROU A;  3MDY B;  3O5Q A;  3UI4 A;  3EY6 A;  2XP3 A;  2IF4 A;  3NI6 A;  1FKG A;  2KE0 A;  3O5J A;  3JYJ A;  5HKG A;  4ODR A;  2M2A A;  4DRM A;  3TDB A;  4LAX A;  4ODL A;  4DRJ A;  5DIT A;  1D7I A;  3IK8 A;  5BXJ A;  4DRP A;  1QZ2 A;  5J6E A;  1Q6I A;  5D75 A;  1YAT A;  2DG4 A;  2XP7 A;  3KAB A;  2AWG A;  2MLY A;  3KAG A;  2RQS A;  3TCZ A;  1KT1 A;  5B8I C;  2ZQT A;  5HW6 A;  5HWC A;  4J4N A;  2PV2 A;  3O5R A;  3GPK A;  3PA7 A;  3O5O A;  2LJ4 A;  2KFW A;  1ZCN A;  3OOB A;  4NNR A;  4TYO A;  1D6O A;  4TNS A;  3IHZ A;  5DIV A;  2ZQS A;  3O5L A;  4JFI A;  4ODN A;  2ITK A;  2RUD A;  2LPV A;  1C9H A;  3I6C A;  1J4H A;  2DG3 A;  3TC5 A;  4GIV A;  2M1I A;  2OFN A;  1JNS A;  3O5D A;  1NMW A;  3O5M A;  4ODM A;  2RUC A;  2MLZ A;  4U85 A;  5I98 A;  1YW5 A;  2M08 A;  3UQB A;  2RSE A;  4QT3 A;  1F8A B;  2LGO A;  2MF9 A;  1FKD A;  2PPO A;  3KAH A;  1FKR A;  1FKJ A;  1J4I A;  4TW7 A;  2ZR6 A;  4QT2 A;  3UQI A;  1TCO C;  1BKF A;  1A7X A;  3KZ7 A;  2UZ5 A;  4W9O A;  5HT1 A;  1FAP A;  4U84 A;  5GPG A;  3RFW A;  3UF8 A;  4DIP A;  4DRI A;  4IPX A;  3UI5 A;  2Y78 A;  2FKE A;  4O2T A;  3ODK A;  4DZ3 A;  2KR7 A;  2XP8 A;  2RUQ A;  1QPL A;  5HW7 A;  1FKI A;  3CGM A;  2MNT A;  1FKK A;  2MLX A;  1FKB A;  1ZK6 A;  2PPN A;  3KAD A;  5HTG A;  2XPB A;  2XP5 A;  3O5G A;  1Q6U A;  4GGQ A;  4JFJ A;  5HUA A;  1PIN A;  3WH0 A;  1R9H A;  1FKL A;  3O5E A;  2XP6 A;  4ITZ A;  3IKG A;  4DT4 A;  3NRK A; 
#chains in the Genus database with same CATH topology
 3ARW A;  4TW6 A;  4ODQ A;  4P8U A;  2ZR4 A;  4DWS C;  3ALG A;  5GPR A;  2KO7 A;  3B7X A;  2DSU A;  1HXV A;  1U79 A;  3JXV A;  3FAP A;  2N87 A;  2VCD A;  1UR8 A;  4IQ2 A;  1E44 A;  2ESC A;  4MPK A;  4R0X A;  2ETN A;  3H9R B;  4DRK A;  4LAV A;  3EIP A;  4DRO A;  5HBF A;  1ZB5 A;  1KT0 A;  1ZU8 A;  2JZV A;  3ARQ A;  4ZPW R;  3KAF A;  3CZ8 A;  3O5F A;  4QIB A;  1F40 A;  1P5Q A;  4DZ2 A;  1E6P A;  4LAY A;  1FKS A;  1M5Y A;  3WQV A;  4LAW A;  2L2S A;  1QPF A;  1FFQ A;  1ROU A;  3MDY B;  3UI4 A;  1W9U A;  2QF8 A;  1FKG A;  5HKG A;  1LG2 A;  4WKH A;  1D7I A;  1QZ2 A;  4URI A;  2DG4 A;  2AWG A;  2MLY A;  5B8I C;  3WD4 A;  1KT1 A;  3FY1 A;  1E15 A;  1W1T A;  1ZCN A;  3OOB A;  4NNR A;  4TNS A;  5DIV A;  3O5L A;  4W5U A;  2LPV A;  1J4H A;  1HKM A;  2DG3 A;  2OFN A;  2DSV A;  1NH6 A;  4HBO A;  2MLZ A;  3G6M A;  2B31 A;  3WD3 A;  1FKR A;  1J4I A;  4Q22 A;  4TW7 A;  4HAR A;  2WM0 A;  1A7X A;  1NWR A;  4KQZ A;  4W9O A;  3RFW A;  4DRI A;  1W9P A;  2KR7 A;  2B5U B;  4HBE A;  3WD1 A;  2DSW A;  3FXY A;  3CHD A;  2MLX A;  4P8W A;  3ARY A;  1WNO A;  1XRV A;  2XPB A;  5HUA A;  1PIN A;  1K9T A;  2A3E A;  3WH0 A;  1R9H A;  1FKL A;  3IKG A;  2OLH A;  4JYS A;  1W1Y A;  4N19 A;  4DRN A;  3ARS A;  2MPH A;  4U86 A;  1ROT A;  2PN0 A;  4G2P A;  3O5K A;  3PRA A;  4ODP A;  3GTY X;  1JVW A;  1WB0 A;  3ARZ A;  3WL0 A;  3BXW A;  2ZQU A;  1SR0 A;  3JYM A;  4DWS B;  3AQU A;  1T11 A;  1IX5 A;  4Z2K A;  4C02 B;  4Q7N A;  4ZPV R;  2LKN A;  2Q5A A;  5HW8 A;  2FAP A;  3RM8 A;  3VAW A;  1FKH A;  3O5P A;  1SYT A;  4FN2 A;  2P4V A;  2ZQV A;  2PV1 A;  1NSG A;  3IKD A;  4DH0 A;  3KAC A;  4QZV B;  3PRB A;  2G8Z A;  1J4R A;  2K8I A;  2O9O A;  4TW8 A;  4JFK A;  1OWQ A;  2DT1 A;  1FD9 A;  3O5Q A;  3EY6 A;  2IF4 A;  1HJW A;  3O5J A;  2PI6 A;  4LAX A;  4ODL A;  4DRJ A;  1LL6 A;  5J6E A;  1E6Z A;  4DRP A;  2XP7 A;  3KAG A;  3TCZ A;  5DEZ A;  2ZQT A;  2PV2 A;  3CHC A;  3O5R A;  4MAV A;  2KFW A;  1D6O A;  4ZPT R;  2ZQS A;  5DO2 A;  4XAK A;  1ZBV A;  3I6C A;  2WLZ A;  1GOI A;  4DWS A;  1ZBW A;  4Z2G A;  2IUZ A;  2M08 A;  3UQB A;  3B9E A;  3KAH A;  4PTM A;  2YBT A;  1EHN A;  1LL4 A;  4QT2 A;  4S3J A;  3UQI A;  1TCO C;  1BKF A;  1W1V A;  3WIJ A;  1HKK A;  1FAP A;  4U84 A;  3UF8 A;  1FFR A;  5JH8 A;  4O2T A;  3AS0 A;  4DZ3 A;  3WL1 A;  3AS1 A;  2DT3 A;  4KR0 B;  1FKB A;  5HTG A;  3KAD A;  4GGQ A;  3WD0 A;  4MNL A;  2XP6 A;  4MNK A;  1OGB A;  3ARU A;  3G6L A;  1GRJ A;  4P8V A;  2KGJ A;  1NWU A;  1D7J A;  4Z2J A;  1GUV A;  2D9F A;  3O5I A;  1J6Y A;  3B9A A;  3KAI A;  5GQB A;  3UI6 A;  4WJX A;  3RM9 A;  1BL4 A;  4IT6 A;  5DIU A;  1NMV A;  4WK9 A;  3GU0 A;  1PBK A;  1W9V A;  4IQC A;  1N1A A;  2DT0 A;  4LGX A;  4W9P A;  2F2D A;  1FKT A;  3ARV A;  4NSB A;  4TX0 A;  3CH9 A;  3RGC A;  5HWB A;  3KCE A;  2PPP A;  1OGG A;  4BF8 A;  4MSP A;  1LQ0 A;  1JNT A;  3BMB A;  1Y0O A;  1FJD A;  1FKF A;  1ZBC A;  1HJV A;  1KFW A;  2DT2 A;  1UR9 A;  3ALF A;  2A3B A;  3TDB A;  5DIT A;  3AS2 A;  3IK8 A;  5BXJ A;  1Q6I A;  1YAT A;  1X6L A;  3KAB A;  4UDM A;  4WKA A;  2RQS A;  1D2K A;  4J4N A;  3WQW A;  3PA7 A;  3O5O A;  4S3K A;  2LJ4 A;  1WAW A;  4TYO A;  1EDQ A;  4IT4 A;  1JNE A;  4ODN A;  2F23 A;  2ITK A;  2RUD A;  1C9H A;  4AY1 A;  2G41 A;  4MNJ A;  3TC5 A;  3AS3 A;  3O5D A;  3O5M A;  2RUC A;  1O6I A;  4U85 A;  5I98 A;  1RD6 A;  1CTN A;  1YW5 A;  2RSE A;  1HKJ A;  2LGO A;  1FKD A;  2PPO A;  3ART A;  1FKJ A;  1X6N A;  4NZC A;  5GPG A;  4DIP A;  1LL7 A;  4IPX A;  3UI5 A;  2Y78 A;  1H0I A;  3B8S A;  4MNM A;  2A3A A;  2RUQ A;  4L72 B;  1QPL A;  3CHE A;  2MNT A;  1FKK A;  1ZK6 A;  3O5G A;  2AOS A;  3O5E A;  1ZL1 A;  1JND A;  1D7H A;  4ODK A;  2WLY A;  2F21 A;  4JFL A;  2XP4 A;  4Z2L A;  3UQA A;  3B9D A;  4J4O A;  2KI3 A;  3WKZ A;  3WD2 A;  4G50 A;  1W1P A;  1B6C A;  2PBC A;  2ZR5 A;  4DRH A;  2YBU A;  4MGV A;  4DRQ A;  1EYM A;  4DWS D;  3LUO A;  2DSZ A;  4ODO A;  1EQ3 A;  1L1P A;  1GPF A;  3CHF A;  3ARO A;  4W9Q A;  4Z2H A;  1H0G A;  2RUR A;  4R5E A;  1NWS A;  1W26 A;  4P8X A;  3ARX A;  2XPA A;  2F4E A;  2VN1 A;  3CGN A;  1EIB A;  4MTV A;  3RME A;  1HKI A;  1Q6H A;  4L3N A;  1HJX A;  4FAP A;  1ITX A;  3NTP A;  2PV3 A;  2DG9 A;  3OA5 A;  2XP9 A;  2WK2 A;  1Q1C A;  3PRD A;  4JFM A;  1JCH B;  2O92 A;  2XP3 A;  3NI6 A;  2KE0 A;  1LG1 A;  3JYJ A;  4ODR A;  2M2A A;  4DRM A;  3RM4 A;  4Z2I A;  5D75 A;  2FDM A;  5HW6 A;  5HWC A;  3GPK A;  1NWT A;  3IHZ A;  4JFI A;  2DPE A;  4WKF A;  1ZBK A;  4GIV A;  2M1I A;  4ZS6 A;  1JNS A;  3PR9 A;  1NMW A;  4ODM A;  4QT3 A;  1F8A B;  2MF9 A;  1LJY A;  1E9L A;  2EUL A;  2ZR6 A;  3ARP A;  3ARR A;  3KZ7 A;  1E6R A;  2UZ5 A;  5HT1 A;  2A3C A;  2FKE A;  1E6N A;  3ODK A;  2XP8 A;  3W4R A;  4WIW A;  5HW7 A;  1FKI A;  3CGM A;  1VF8 A;  2PPN A;  1XHG A;  4ML4 A;  2XP5 A;  5DF0 A;  1Q6U A;  3QOK A;  4JFJ A;  4ITZ A;  1TFV A;  4DT4 A;  3NRK A; 
#chains in the Genus database with same CATH homology
 3ARW A;  4TW6 A;  4ODQ A;  4P8U A;  2ZR4 A;  4DWS C;  3ALG A;  5GPR A;  2KO7 A;  3B7X A;  2DSU A;  1HXV A;  1U79 A;  3JXV A;  3FAP A;  2N87 A;  2VCD A;  1UR8 A;  4IQ2 A;  2ESC A;  4MPK A;  4R0X A;  3H9R B;  4DRK A;  4LAV A;  4DRO A;  5HBF A;  1ZB5 A;  1KT0 A;  1ZU8 A;  2JZV A;  3ARQ A;  4ZPW R;  3KAF A;  3CZ8 A;  3O5F A;  4QIB A;  1F40 A;  1P5Q A;  4DZ2 A;  1E6P A;  4LAY A;  1FKS A;  1M5Y A;  3WQV A;  4LAW A;  2L2S A;  1QPF A;  1FFQ A;  1ROU A;  3MDY B;  3UI4 A;  1W9U A;  2QF8 A;  1FKG A;  5HKG A;  1LG2 A;  4WKH A;  1D7I A;  1QZ2 A;  4URI A;  2DG4 A;  2AWG A;  2MLY A;  5B8I C;  3WD4 A;  1KT1 A;  3FY1 A;  1E15 A;  1W1T A;  1ZCN A;  3OOB A;  4NNR A;  4TNS A;  5DIV A;  3O5L A;  4W5U A;  2LPV A;  1J4H A;  1HKM A;  2DG3 A;  2OFN A;  2DSV A;  1NH6 A;  4HBO A;  2MLZ A;  3G6M A;  2B31 A;  3WD3 A;  1FKR A;  1J4I A;  4Q22 A;  4TW7 A;  4HAR A;  2WM0 A;  1A7X A;  1NWR A;  4KQZ A;  4W9O A;  3RFW A;  4DRI A;  1W9P A;  2KR7 A;  4HBE A;  3WD1 A;  2DSW A;  3FXY A;  3CHD A;  2MLX A;  4P8W A;  3ARY A;  1WNO A;  1XRV A;  2XPB A;  5HUA A;  1PIN A;  1K9T A;  2A3E A;  3WH0 A;  1R9H A;  1FKL A;  3IKG A;  2OLH A;  4JYS A;  1W1Y A;  4N19 A;  4DRN A;  3ARS A;  2MPH A;  4U86 A;  1ROT A;  4G2P A;  3O5K A;  3PRA A;  4ODP A;  1JVW A;  1WB0 A;  3ARZ A;  3WL0 A;  3BXW A;  2ZQU A;  1SR0 A;  3JYM A;  4DWS B;  3AQU A;  1T11 A;  1IX5 A;  4Z2K A;  4C02 B;  4Q7N A;  4ZPV R;  2LKN A;  2Q5A A;  5HW8 A;  2FAP A;  3RM8 A;  3VAW A;  1FKH A;  3O5P A;  1SYT A;  4FN2 A;  2ZQV A;  2PV1 A;  1NSG A;  3IKD A;  4DH0 A;  3KAC A;  4QZV B;  3PRB A;  2G8Z A;  1J4R A;  2K8I A;  2O9O A;  4TW8 A;  4JFK A;  1OWQ A;  2DT1 A;  1FD9 A;  3O5Q A;  3EY6 A;  2IF4 A;  1HJW A;  3O5J A;  2PI6 A;  4LAX A;  4ODL A;  4DRJ A;  1LL6 A;  5J6E A;  1E6Z A;  4DRP A;  2XP7 A;  3KAG A;  3TCZ A;  5DEZ A;  2ZQT A;  2PV2 A;  3CHC A;  3O5R A;  4MAV A;  2KFW A;  1D6O A;  4ZPT R;  2ZQS A;  5DO2 A;  4XAK A;  1ZBV A;  3I6C A;  2WLZ A;  1GOI A;  4DWS A;  1ZBW A;  4Z2G A;  2IUZ A;  2M08 A;  3UQB A;  3B9E A;  3KAH A;  4PTM A;  2YBT A;  1EHN A;  1LL4 A;  4QT2 A;  4S3J A;  3UQI A;  1TCO C;  1BKF A;  1W1V A;  3WIJ A;  1HKK A;  1FAP A;  4U84 A;  3UF8 A;  1FFR A;  5JH8 A;  4O2T A;  3AS0 A;  4DZ3 A;  3WL1 A;  3AS1 A;  2DT3 A;  4KR0 B;  1FKB A;  5HTG A;  3KAD A;  4GGQ A;  3WD0 A;  4MNL A;  2XP6 A;  4MNK A;  1OGB A;  3ARU A;  3G6L A;  4P8V A;  2KGJ A;  1NWU A;  1D7J A;  4Z2J A;  1GUV A;  2D9F A;  3O5I A;  1J6Y A;  3B9A A;  3KAI A;  5GQB A;  3UI6 A;  4WJX A;  3RM9 A;  1BL4 A;  4IT6 A;  5DIU A;  1NMV A;  4WK9 A;  1PBK A;  1W9V A;  4IQC A;  1N1A A;  2DT0 A;  4LGX A;  4W9P A;  2F2D A;  1FKT A;  3ARV A;  4NSB A;  4TX0 A;  3CH9 A;  3RGC A;  5HWB A;  3KCE A;  2PPP A;  1OGG A;  4BF8 A;  4MSP A;  1LQ0 A;  1JNT A;  1Y0O A;  1FJD A;  1FKF A;  1ZBC A;  1HJV A;  1KFW A;  2DT2 A;  1UR9 A;  3ALF A;  2A3B A;  3TDB A;  5DIT A;  3AS2 A;  3IK8 A;  5BXJ A;  1Q6I A;  1YAT A;  1X6L A;  3KAB A;  4WKA A;  2RQS A;  1D2K A;  4J4N A;  3WQW A;  3PA7 A;  3O5O A;  4S3K A;  2LJ4 A;  1WAW A;  4TYO A;  1EDQ A;  4IT4 A;  1JNE A;  4ODN A;  2ITK A;  2RUD A;  1C9H A;  4AY1 A;  2G41 A;  4MNJ A;  3TC5 A;  3AS3 A;  3O5D A;  3O5M A;  2RUC A;  1O6I A;  4U85 A;  5I98 A;  1RD6 A;  1CTN A;  1YW5 A;  2RSE A;  1HKJ A;  2LGO A;  1FKD A;  2PPO A;  3ART A;  1FKJ A;  1X6N A;  4NZC A;  5GPG A;  4DIP A;  1LL7 A;  4IPX A;  3UI5 A;  2Y78 A;  1H0I A;  3B8S A;  4MNM A;  2A3A A;  2RUQ A;  4L72 B;  1QPL A;  3CHE A;  2MNT A;  1FKK A;  1ZK6 A;  3O5G A;  2AOS A;  3O5E A;  1ZL1 A;  1JND A;  1D7H A;  4ODK A;  2WLY A;  2F21 A;  4JFL A;  2XP4 A;  4Z2L A;  3UQA A;  3B9D A;  4J4O A;  2KI3 A;  3WKZ A;  3WD2 A;  4G50 A;  1W1P A;  1B6C A;  2PBC A;  2ZR5 A;  4DRH A;  2YBU A;  4MGV A;  4DRQ A;  1EYM A;  4DWS D;  3LUO A;  2DSZ A;  4ODO A;  1EQ3 A;  1L1P A;  1GPF A;  3CHF A;  3ARO A;  4W9Q A;  4Z2H A;  1H0G A;  2RUR A;  4R5E A;  1NWS A;  1W26 A;  4P8X A;  3ARX A;  2XPA A;  2F4E A;  2VN1 A;  3CGN A;  1EIB A;  4MTV A;  3RME A;  1HKI A;  1Q6H A;  4L3N A;  1HJX A;  4FAP A;  1ITX A;  3NTP A;  2PV3 A;  2DG9 A;  3OA5 A;  2XP9 A;  2WK2 A;  1Q1C A;  3PRD A;  4JFM A;  2O92 A;  2XP3 A;  3NI6 A;  2KE0 A;  1LG1 A;  3JYJ A;  4ODR A;  2M2A A;  4DRM A;  3RM4 A;  4Z2I A;  5D75 A;  2FDM A;  5HW6 A;  5HWC A;  3GPK A;  1NWT A;  3IHZ A;  4JFI A;  2DPE A;  4WKF A;  1ZBK A;  4GIV A;  2M1I A;  4ZS6 A;  1JNS A;  3PR9 A;  1NMW A;  4ODM A;  4QT3 A;  1F8A B;  2MF9 A;  1LJY A;  1E9L A;  2ZR6 A;  3ARP A;  3ARR A;  3KZ7 A;  1E6R A;  2UZ5 A;  5HT1 A;  2A3C A;  2FKE A;  1E6N A;  3ODK A;  2XP8 A;  3W4R A;  4WIW A;  5HW7 A;  1FKI A;  3CGM A;  1VF8 A;  2PPN A;  1XHG A;  4ML4 A;  2XP5 A;  5DF0 A;  1Q6U A;  3QOK A;  4JFJ A;  4ITZ A;  1TFV A;  4DT4 A;  3NRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...