1FKIA

Design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cis-trans isomerase
molecule keywords FK506 BINDING PROTEIN
publication title DESIGN, SYNTHESIS, AND KINETIC EVALUATION OF HIGH-AFFINITY FKBP LIGANDS AND THE X-RAY CRYSTAL-STRUCTURES OF THEIR COMPLEXES WITH FKBP12.
pubmed rcsb
source organism Homo sapiens
total genus 25
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1993-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1fkiA00
4IQ2A 1D7JA 1FD9A 3PRDA 2VN1A 3JYJA 4G50A 2OFNA 3IKDA 4ODOA 2F21A 2LJ4A 4GGQA 4R0XA 1F40A 4JFLA 5D75A 2RSEA 3JYMA 3WH0A 2KE0A 3H9RB 1C9HA 4DT4A 2KI3A 5J6EA 1L1PA 2PV2A 3O5IA 4ODQA 2KFWA 3RFWA 1ROUA 3TC5A 4MSPA 4IPXA 2ITKA 2KR7A 3TDBA 3UF8A 1U79A 1Q6IA 4O2TA 4JFIA 4W9QA 3KAHA 4U84A 3GPKA 2LGOA 1W26A 3NRKA 4W9PA 4ODRA 4DIPA 3OOBA 4DH0A 4NNRA 1Y0OA 4ODKA 1FKGA 2Y78A 3CGNA 5BXJA 4DROA 5HWBA 1FKKA 1Q1CA 5GPGA 4IQCA 1NMVA 5HTGA 1F8AB 3KAIA 3O5LA 3KADA 3O5GA 1D7IA 2F4EA 1FKTA 2PPOA 4MGVA 2KGJA 2XPBA 4TW7A 1FAPA 3FAPA 2N87A 1FKSA 2XP5A 1ROTA 4ODMA 3O5DA 1FKDA 4ITZA 5DIVA 4DRJA 1J4HA 2KO7A 4LAXA 2RUDA 2MPHA 2ZR5A 3KZ7A 3LUOA 3O5KA 1FKIA 4QT2A 4N19A 4W9OA 2ZQVA 1NMWA 1PBKA 2FKEA 2DG9A 2F2DA 4JYSA 1JVWA 3MDYB 2PPNA 1YATA 1QPFA 2XP7A 1T11A 1FKFA 4QT3A 1D7HA 1ZCNA 3NI6A 1FKLA 2XP6A 5HW7A 2M08A 3B7XA 1NSGA 4DRIA 2PPPA 1EQ3A 2RUCA 2PV1A 3PRBA 3O5EA 3EY6A 4U85A 1N1AA 3UI6A 3O5QA 4FAPA 2JZVA 1B6CA 1M5YA 2FAPA 2K8IA 3KCEA 4G2PA 4LAVA 4C02B 1J4RA 3IK8A 3O5JA 5DIUA 5HWCA 2XP3A 5HW8A 5I98A 1P5QA 4U86A 1FKHA 1A7XA 5HT1A 2DG3A 2M2AA 2MLYA 2Q5AA 4DRNA 4DRQA 3CGMA 1FKRA 3UQAA 3O5MA 2XP4A 4JFMA 4ODNA 3O5PA 2XP8A 4ODPA 3RGCA 4DRKA 1KT1A 4DZ3A 2L2SA 3IHZA 1QZ2A 2DG4A 5DITA 4DZ2A 3PA7A 1JNTA 1PINA 1JNSA 4ODLA 2M1IA 2IF4A 4QIBA 2RQSA 1R9HA 2MLZA 2ZR4A 4LAYA 3UI4A 1Q6UA 2PV3A 1YW5A 5HUAA 1FKBA 2MNTA 1FKJA 4FN2A 3UI5A 4GIVA 2ZQSA 1ZK6A 2ZR6A 4TNSA 3UQBA 4J4NA 2PBCA 2LKNA 1D6OA 4DRHA 3ODKA 3TCZA 1J6YA 3KAGA 3O5OA 4TW8A 1BKFA 3KACA 2VCDA 3IKGA 3O5FA 4BF8A 3KAFA 3VAWA 1HXVA 4J4OA 1FJDA 2XP9A 4JFJA 4DRPA 4DRMA 2ZQTA 2XPAA 3NTPA 3O5RA 4LAWA 3I6CA 3UQIA 1J4IA 4JFKA 5HW6A 3KABA 4TX0A 5HKGA 1EYMA 2MLXA 1KT0A 2LPVA 1BL4A 1QPLA 2MF9A 1TCOC 4TW6A 2RURA 2AWGA 4TYOA 2ZQUA 2D9FA 2RUQA 2UZ5A 3JXVA 5B8IC 1Q6HA
chains in the Genus database with same CATH superfamily
1D7JA 4WKHA 3PRDA 2VN1A 2OFNA 2F21A 3ALGA 3WD0A 3JYMA 3WH0A 5DO2A 1C9HA 4DT4A 4DWSA 4Q7NA 1TFVA 2PV2A 1HKMA 2KFWA 3RFWA 1ROUA 3TC5A 3RM9A 3UF8A 1CTNA 3KAHA 3GPKA 4DH0A 1GOIA 3WD1A 1LG2A 2DT0A 1NMVA 3ALFA 2B31A 3KAIA 3KADA 4MNJA 2F4EA 2WM0A 4PTMA 2KGJA 2XPBA 3G6LA 4MAVA 4Z2HA 1X6NA 3KZ7A 2MPHA 3O5KA 4N19A 2ZQVA 1E15A 1E6ZA 2A3AA 2F2DA 2DSVA 3CHFA 3MDYB 4AY1A 1YATA 1QPFA 3BMBA 5HW7A 3NI6A 2RUCA 3PRBA 3UI6A 2PN0A 3ARPA 4U85A 4KR0B 2K8IA 4XAKA 4C02B 4LAVA 1J4RA 4S3KA 5HW8A 4DWSC 2Q5AA 3CHCA 1FKRA 4JFMA 4ODNA 3O5PA 4KQZA 4DRKA 4DZ3A 3PA7A 1JNTA 1PINA 1WB0A 2M1IA 4QIBA 4HBOA 4LAYA 1GPFA 3ARRA 1FKBA 2G41A 4S3JA 4HARA 2DSZA 2ZQSA 1ZK6A 4MPKA 3AS1A 3TCZA 4Z2IA 2WLYA 4TW8A 1BKFA 4BF8A 1HXVA 2XP9A 3NTPA 2XPAA 4LGXA 1WAWA 1J4IA 1LL4A 5HKGA 2IUZA 1VF8A 3WQVA 1QPLA 3ARUA 3GTYX 2D9FA 2RUQA 2UZ5A 3RM8A 2WLZA 2ESCA 3CZ8A 1FD9A 4G50A 1JNEA 2OLHA 4WKAA 1F40A 2LJ4A 4IT4A 4JFLA 4L3NA 2A3EA 2RSEA 5D75A 2KE0A 3AS0A 3H9RB 3PR9A 1LL6A 4ML4A 4MSPA 2QF8A 1E6NA 4IPXA 4O2TA 4W9QA 3NRKA 4NNRA 2Y78A 5BXJA 5GPGA 1O6IA 1F8AB 3ARSA 3O5LA 1D7IA 4TW7A 1FAPA 1E44A 1NWSA 3FY1A 1W9VA 1LQ0A 4ITZA 2EULA 4LAXA 2DT1A 2RUDA 2ZR5A 1X6LA 4HBEA 1W1TA 4W9OA 2A3CA 1PBKA 2FKEA 2O9OA 5DEZA 3WL0A 2ETNA 2XP7A 4QT3A 1D7HA 1FKLA 1SR0A 3B7XA 2PPPA 1N1AA 2YBUA 2JZVA 3KCEA 4G2PA 1FFRA 5DIUA 3O5JA 4IT6A 4P8UA 1W1YA 2WK2A 4U86A 4WK9A 5HT1A 2DG3A 2MLYA 1EHNA 3UQAA 3O5MA 2DT2A 4Z2LA 1XRVA 4UDMA 2L2SA 4WJXA 1EIBA 1LL7A 4MNLA 2MLZA 2PV3A 4DWSD 5HBFA 3CHEA 3UI5A 3UQBA 4J4NA 4ZPWR 4DRHA 3ODKA 3KAGA 3EIPA 3KAFA 3VAWA 1K9TA 1FJDA 2G8ZA 2ZQTA 4MTVA 2MLXA 2LPVA 1BL4A 4R5EA 3AS2A 1NH6A 2RURA 2AWGA 2DPEA 4TYOA 2ZQUA 4ZS6A 5B8IC 4IQ2A 2FDMA 3IKDA 4ODOA 4GGQA 1SYTA 3WQWA 1HKIA 5J6EA 1L1PA 4ODQA 3ARZA 2ITKA 2KR7A 2O92A 3TDBA 1Q6IA 1JNDA 4JFIA 1OWQA 4U84A 4WIWA 1W26A 4ODRA 4NZCA 3OOBA 1Y0OA 1E9LA 4DROA 3RMEA 4DWSB 4Z2JA 1E6PA 5HTGA 1XHGA 1FFQA 3O5GA 2PPOA 3B9DA 3FAPA 2N87A 1FKSA 2XP5A 1ROTA 4ODMA 3O5DA 1FKDA 5DIVA 2A3BA 1ZBKA 4QT2A 4P8VA 2PI6A 2DG9A 1H0GA 3WKZA 1JVWA 1KFWA 1HKJA 2PPNA 1T11A 1FKFA 3WD4A 2M08A 3B9EA 1NSGA 1ZBWA 1EDQA 2AOSA 3WL1A 3EY6A 4L72B 3WD3A 1IX5A 3ARYA 1M5YA 1W1VA 1HJVA 3CH9A 2XP3A 1W9PA 3CHDA 3BXWA 4NSBA 2M2AA 4ZPVR 4DRQA 3OA5A 1HJXA 1WNOA 2B5UB 4Z2KA 4ODPA 1GUVA 3IHZA 2DG4A 1JNSA 1H0IA 2IF4A 1R9HA 2ZR4A 3UI4A 1NWUA 4MNKA 5HUAA 1FKJA 4GIVA 3RM4A 2ZR6A 3QOKA 4TNSA 1D6OA 5GQBA 1J6YA 3O5OA 3KACA 1GRJA 2VCDA 3IKGA 3O5FA 3B8SA 4P8XA 4J4OA 4DRPA 5HWBA 4LAWA 1OGGA 4JFKA 5HW6A 3ARVA 4TX0A 1EYMA 1KT0A 1ZBCA 2MF9A 1TCOC 3WD2A 1Q6HA 5DITA 3G6MA 3JYJA 2DSUA 3PRAA 4R0XA 3WIJA 1ZU8A 1E6RA 3ARQA 1RD6A 2KI3A 3O5IA 5DF0A 3FXYA 1UR8A 1U79A 2LGOA 4W9PA 4DIPA 3ARTA 4ODKA 4P8WA 1FKGA 3B9AA 1UR9A 3CGNA 4ZPTR 5GPRA 1FKKA 1Q1CA 4IQCA 1ZBVA 4Z2GA 2YBTA 1FKTA 4MGVA 3ARWA 2F23A 3ARXA 4DRJA 1J4HA 1JCHB 2KO7A 4QZVB 3LUOA 1FKIA 1NMWA 4JYSA 3W4RA 1ZCNA 2XP6A 4DRIA 1EQ3A 2PV1A 3O5EA 4FAPA 3O5QA 1OGBA 1LJYA 1B6CA 2FAPA 1LG1A 3IK8A 5HWCA 5I98A 1P5QA 1FKHA 1A7XA 4DRNA 2DT3A 3CGMA 1ZL1A 2XP4A 1D2KA 3AS3A 3RGCA 2XP8A 1KT1A 4URIA 1QZ2A 4DZ2A 4ODLA 1W9UA 4WKFA 2RQSA 1HJWA 1Q6UA 3AROA 1W1PA 1YW5A 2MNTA 4FN2A 1NWTA 2PBCA 2LKNA 4W5UA 1NWRA 3GU0A 4Q22A 2P4VA 5JH8A 2DSWA 1ZB5A 4MNMA 4JFJA 4DRMA 3UQIA 3O5RA 3I6CA 1HKKA 3KABA 3AQUA 4TW6A 3JXVA 1ITXA
chains in the Genus database with same CATH topology
1D7JA 4WKHA 3PRDA 2VN1A 2OFNA 2F21A 3ALGA 3WD0A 3JYMA 3WH0A 5DO2A 1C9HA 4DT4A 4DWSA 4Q7NA 1TFVA 2PV2A 1HKMA 2KFWA 3RFWA 1ROUA 3TC5A 3RM9A 3UF8A 1CTNA 3KAHA 3GPKA 4DH0A 1GOIA 3WD1A 1LG2A 2DT0A 1NMVA 3ALFA 2B31A 3KAIA 3KADA 4MNJA 2F4EA 2WM0A 4PTMA 2KGJA 2XPBA 3G6LA 4MAVA 4Z2HA 1X6NA 3KZ7A 2MPHA 3O5KA 4N19A 2ZQVA 1E15A 1E6ZA 2A3AA 2F2DA 2DSVA 3CHFA 3MDYB 4AY1A 1YATA 1QPFA 5HW7A 3NI6A 2RUCA 3PRBA 3UI6A 3ARPA 4U85A 4KR0B 2K8IA 4XAKA 4C02B 4LAVA 1J4RA 4S3KA 5HW8A 4DWSC 2Q5AA 3CHCA 1FKRA 4JFMA 4ODNA 3O5PA 4KQZA 4DRKA 4DZ3A 3PA7A 1JNTA 1PINA 1WB0A 2M1IA 4QIBA 4HBOA 4LAYA 1GPFA 3ARRA 1FKBA 2G41A 4S3JA 4HARA 2DSZA 2ZQSA 1ZK6A 4MPKA 3AS1A 3TCZA 4Z2IA 2WLYA 4TW8A 1BKFA 4BF8A 1HXVA 2XP9A 3NTPA 2XPAA 4LGXA 1WAWA 1J4IA 1LL4A 5HKGA 2IUZA 1VF8A 3WQVA 1QPLA 3ARUA 2D9FA 2RUQA 2UZ5A 3RM8A 2WLZA 2ESCA 3CZ8A 1FD9A 4G50A 1JNEA 2OLHA 4WKAA 1F40A 2LJ4A 4IT4A 4JFLA 4L3NA 2A3EA 2RSEA 5D75A 2KE0A 3AS0A 3H9RB 3PR9A 1LL6A 4ML4A 4MSPA 2QF8A 1E6NA 4IPXA 4O2TA 4W9QA 3NRKA 4NNRA 2Y78A 5BXJA 5GPGA 1O6IA 1F8AB 3ARSA 3O5LA 1D7IA 4TW7A 1FAPA 1NWSA 3FY1A 1W9VA 1LQ0A 4ITZA 4LAXA 2DT1A 2RUDA 2ZR5A 1X6LA 4HBEA 1W1TA 4W9OA 2A3CA 1PBKA 2FKEA 2O9OA 5DEZA 3WL0A 2XP7A 4QT3A 1D7HA 1FKLA 1SR0A 3B7XA 2PPPA 1N1AA 2YBUA 2JZVA 3KCEA 4G2PA 1FFRA 5DIUA 3O5JA 4IT6A 4P8UA 1W1YA 2WK2A 4U86A 4WK9A 5HT1A 2DG3A 2MLYA 1EHNA 3UQAA 3O5MA 2DT2A 4Z2LA 1XRVA 2L2SA 4WJXA 1EIBA 1LL7A 4MNLA 2MLZA 2PV3A 4DWSD 5HBFA 3CHEA 3UI5A 3UQBA 4J4NA 4ZPWR 4DRHA 3ODKA 3KAGA 3KAFA 3VAWA 1K9TA 1FJDA 2G8ZA 2ZQTA 4MTVA 2MLXA 2LPVA 1BL4A 4R5EA 3AS2A 1NH6A 2RURA 2AWGA 2DPEA 4TYOA 2ZQUA 4ZS6A 5B8IC 4IQ2A 2FDMA 3IKDA 4ODOA 4GGQA 1SYTA 3WQWA 1HKIA 5J6EA 1L1PA 4ODQA 3ARZA 2ITKA 2KR7A 2O92A 3TDBA 1Q6IA 1JNDA 4JFIA 1OWQA 4U84A 4WIWA 1W26A 4ODRA 4NZCA 3OOBA 1Y0OA 1E9LA 4DROA 3RMEA 4DWSB 4Z2JA 1E6PA 5HTGA 1XHGA 1FFQA 3O5GA 2PPOA 3B9DA 3FAPA 2N87A 1FKSA 2XP5A 1ROTA 4ODMA 3O5DA 1FKDA 5DIVA 2A3BA 1ZBKA 4QT2A 4P8VA 2PI6A 2DG9A 1H0GA 3WKZA 1JVWA 1KFWA 1HKJA 2PPNA 1T11A 1FKFA 3WD4A 2M08A 3B9EA 1NSGA 1ZBWA 1EDQA 2AOSA 3WL1A 3EY6A 4L72B 3WD3A 1IX5A 3ARYA 1M5YA 1W1VA 1HJVA 3CH9A 2XP3A 1W9PA 3CHDA 3BXWA 4NSBA 2M2AA 4ZPVR 4DRQA 3OA5A 1HJXA 1WNOA 4Z2KA 4ODPA 1GUVA 3IHZA 2DG4A 1JNSA 1H0IA 2IF4A 1R9HA 2ZR4A 3UI4A 1NWUA 4MNKA 5HUAA 1FKJA 4GIVA 3RM4A 2ZR6A 3QOKA 4TNSA 1D6OA 5GQBA 1J6YA 3O5OA 3KACA 2VCDA 3IKGA 3O5FA 3B8SA 4P8XA 4J4OA 4DRPA 5HWBA 4LAWA 1OGGA 4JFKA 5HW6A 3ARVA 4TX0A 1EYMA 1KT0A 1ZBCA 2MF9A 1TCOC 3WD2A 1Q6HA 5DITA 3G6MA 3JYJA 2DSUA 3PRAA 4R0XA 3WIJA 1ZU8A 1E6RA 3ARQA 1RD6A 2KI3A 3O5IA 5DF0A 3FXYA 1UR8A 1U79A 2LGOA 4W9PA 4DIPA 3ARTA 4ODKA 4P8WA 1FKGA 3B9AA 1UR9A 3CGNA 4ZPTR 5GPRA 1FKKA 1Q1CA 4IQCA 1ZBVA 4Z2GA 2YBTA 1FKTA 4MGVA 3ARWA 4DRJA 3ARXA 1J4HA 2KO7A 4QZVB 3LUOA 1FKIA 1NMWA 4JYSA 3W4RA 1ZCNA 2XP6A 4DRIA 1EQ3A 2PV1A 3O5EA 4FAPA 3O5QA 1OGBA 1LJYA 1B6CA 2FAPA 1LG1A 3IK8A 5HWCA 5I98A 1P5QA 1FKHA 1A7XA 4DRNA 2DT3A 3CGMA 1ZL1A 2XP4A 1D2KA 3AS3A 3RGCA 2XP8A 1KT1A 4URIA 1QZ2A 4DZ2A 4ODLA 1W9UA 4WKFA 2RQSA 1HJWA 1Q6UA 3AROA 1W1PA 1YW5A 2MNTA 4FN2A 1NWTA 2PBCA 2LKNA 4W5UA 1NWRA 4Q22A 5JH8A 2DSWA 1ZB5A 4MNMA 4JFJA 4DRMA 3UQIA 3O5RA 3I6CA 1HKKA 3KABA 3AQUA 4TW6A 3JXVA 1ITXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQ2 A;  1D7J A;  1FD9 A;  3PRD A;  2VN1 A;  3JYJ A;  4G50 A;  2OFN A;  3IKD A;  4ODO A;  2F21 A;  2LJ4 A;  4GGQ A;  4R0X A;  1F40 A;  4JFL A;  5D75 A;  2RSE A;  3JYM A;  3WH0 A;  2KE0 A;  3H9R B;  1C9H A;  4DT4 A;  2KI3 A;  5J6E A;  1L1P A;  2PV2 A;  3O5I A;  4ODQ A;  2KFW A;  3RFW A;  1ROU A;  3TC5 A;  4MSP A;  4IPX A;  2ITK A;  2KR7 A;  3TDB A;  3UF8 A;  1U79 A;  1Q6I A;  4O2T A;  4JFI A;  4W9Q A;  3KAH A;  4U84 A;  3GPK A;  2LGO A;  1W26 A;  3NRK A;  4W9P A;  4ODR A;  4DIP A;  3OOB A;  4DH0 A;  4NNR A;  1Y0O A;  4ODK A;  1FKG A;  2Y78 A;  3CGN A;  5BXJ A;  4DRO A;  5HWB A;  1FKK A;  1Q1C A;  5GPG A;  4IQC A;  1NMV A;  5HTG A;  1F8A B;  3KAI A;  3O5L A;  3KAD A;  3O5G A;  1D7I A;  2F4E A;  1FKT A;  2PPO A;  4MGV A;  2KGJ A;  2XPB A;  4TW7 A;  1FAP A;  3FAP A;  2N87 A;  1FKS A;  2XP5 A;  1ROT A;  4ODM A;  3O5D A;  1FKD A;  4ITZ A;  5DIV A;  4DRJ A;  1J4H A;  2KO7 A;  4LAX A;  2RUD A;  2MPH A;  2ZR5 A;  3KZ7 A;  3LUO A;  3O5K A;  1FKI A;  4QT2 A;  4N19 A;  4W9O A;  2ZQV A;  1NMW A;  1PBK A;  2FKE A;  2DG9 A;  2F2D A;  4JYS A;  1JVW A;  3MDY B;  2PPN A;  1YAT A;  1QPF A;  2XP7 A;  1T11 A;  1FKF A;  4QT3 A;  1D7H A;  1ZCN A;  3NI6 A;  1FKL A;  2XP6 A;  5HW7 A;  2M08 A;  3B7X A;  1NSG A;  4DRI A;  2PPP A;  1EQ3 A;  2RUC A;  2PV1 A;  3PRB A;  3O5E A;  3EY6 A;  4U85 A;  1N1A A;  3UI6 A;  3O5Q A;  4FAP A;  2JZV A;  1B6C A;  1M5Y A;  2FAP A;  2K8I A;  3KCE A;  4G2P A;  4LAV A;  4C02 B;  1J4R A;  3IK8 A;  3O5J A;  5DIU A;  5HWC A;  2XP3 A;  5HW8 A;  5I98 A;  1P5Q A;  4U86 A;  1FKH A;  1A7X A;  5HT1 A;  2DG3 A;  2M2A A;  2MLY A;  2Q5A A;  4DRN A;  4DRQ A;  3CGM A;  1FKR A;  3UQA A;  3O5M A;  2XP4 A;  4JFM A;  4ODN A;  3O5P A;  2XP8 A;  4ODP A;  3RGC A;  4DRK A;  1KT1 A;  4DZ3 A;  2L2S A;  3IHZ A;  1QZ2 A;  2DG4 A;  5DIT A;  4DZ2 A;  3PA7 A;  1JNT A;  1PIN A;  1JNS A;  4ODL A;  2M1I A;  2IF4 A;  4QIB A;  2RQS A;  1R9H A;  2MLZ A;  2ZR4 A;  4LAY A;  3UI4 A;  1Q6U A;  2PV3 A;  1YW5 A;  5HUA A;  1FKB A;  2MNT A;  1FKJ A;  4FN2 A;  3UI5 A;  4GIV A;  2ZQS A;  1ZK6 A;  2ZR6 A;  4TNS A;  3UQB A;  4J4N A;  2PBC A;  2LKN A;  1D6O A;  4DRH A;  3ODK A;  3TCZ A;  1J6Y A;  3KAG A;  3O5O A;  4TW8 A;  1BKF A;  3KAC A;  2VCD A;  3IKG A;  3O5F A;  4BF8 A;  3KAF A;  3VAW A;  1HXV A;  4J4O A;  1FJD A;  2XP9 A;  4JFJ A;  4DRP A;  4DRM A;  2ZQT A;  2XPA A;  3NTP A;  3O5R A;  4LAW A;  3I6C A;  3UQI A;  1J4I A;  4JFK A;  5HW6 A;  3KAB A;  4TX0 A;  5HKG A;  1EYM A;  2MLX A;  1KT0 A;  2LPV A;  1BL4 A;  1QPL A;  2MF9 A;  1TCO C;  4TW6 A;  2RUR A;  2AWG A;  4TYO A;  2ZQU A;  2D9F A;  2RUQ A;  2UZ5 A;  3JXV A;  5B8I C;  1Q6H A; 
#chains in the Genus database with same CATH topology
 1D7J A;  4WKH A;  3PRD A;  2VN1 A;  2OFN A;  2F21 A;  3ALG A;  3WD0 A;  3JYM A;  3WH0 A;  5DO2 A;  1C9H A;  4DT4 A;  4DWS A;  4Q7N A;  1TFV A;  2PV2 A;  1HKM A;  2KFW A;  3RFW A;  1ROU A;  3TC5 A;  3RM9 A;  3UF8 A;  1CTN A;  3KAH A;  3GPK A;  4DH0 A;  1GOI A;  3WD1 A;  1LG2 A;  2DT0 A;  1NMV A;  3ALF A;  2B31 A;  3KAI A;  3KAD A;  4MNJ A;  2F4E A;  2WM0 A;  4PTM A;  2KGJ A;  2XPB A;  3G6L A;  4MAV A;  4Z2H A;  1X6N A;  3KZ7 A;  2MPH A;  3O5K A;  4N19 A;  2ZQV A;  1E15 A;  1E6Z A;  2A3A A;  2F2D A;  2DSV A;  3CHF A;  3MDY B;  4AY1 A;  1YAT A;  1QPF A;  3BMB A;  5HW7 A;  3NI6 A;  2RUC A;  3PRB A;  3UI6 A;  2PN0 A;  3ARP A;  4U85 A;  4KR0 B;  2K8I A;  4XAK A;  4C02 B;  4LAV A;  1J4R A;  4S3K A;  5HW8 A;  4DWS C;  2Q5A A;  3CHC A;  1FKR A;  4JFM A;  4ODN A;  3O5P A;  4KQZ A;  4DRK A;  4DZ3 A;  3PA7 A;  1JNT A;  1PIN A;  1WB0 A;  2M1I A;  4QIB A;  4HBO A;  4LAY A;  1GPF A;  3ARR A;  1FKB A;  2G41 A;  4S3J A;  4HAR A;  2DSZ A;  2ZQS A;  1ZK6 A;  4MPK A;  3AS1 A;  3TCZ A;  4Z2I A;  2WLY A;  4TW8 A;  1BKF A;  4BF8 A;  1HXV A;  2XP9 A;  3NTP A;  2XPA A;  4LGX A;  1WAW A;  1J4I A;  1LL4 A;  5HKG A;  2IUZ A;  1VF8 A;  3WQV A;  1QPL A;  3ARU A;  3GTY X;  2D9F A;  2RUQ A;  2UZ5 A;  3RM8 A;  2WLZ A;  2ESC A;  3CZ8 A;  1FD9 A;  4G50 A;  1JNE A;  2OLH A;  4WKA A;  1F40 A;  2LJ4 A;  4IT4 A;  4JFL A;  4L3N A;  2A3E A;  2RSE A;  5D75 A;  2KE0 A;  3AS0 A;  3H9R B;  3PR9 A;  1LL6 A;  4ML4 A;  4MSP A;  2QF8 A;  1E6N A;  4IPX A;  4O2T A;  4W9Q A;  3NRK A;  4NNR A;  2Y78 A;  5BXJ A;  5GPG A;  1O6I A;  1F8A B;  3ARS A;  3O5L A;  1D7I A;  4TW7 A;  1FAP A;  1E44 A;  1NWS A;  3FY1 A;  1W9V A;  1LQ0 A;  4ITZ A;  2EUL A;  4LAX A;  2DT1 A;  2RUD A;  2ZR5 A;  1X6L A;  4HBE A;  1W1T A;  4W9O A;  2A3C A;  1PBK A;  2FKE A;  2O9O A;  5DEZ A;  3WL0 A;  2ETN A;  2XP7 A;  4QT3 A;  1D7H A;  1FKL A;  1SR0 A;  3B7X A;  2PPP A;  1N1A A;  2YBU A;  2JZV A;  3KCE A;  4G2P A;  1FFR A;  5DIU A;  3O5J A;  4IT6 A;  4P8U A;  1W1Y A;  2WK2 A;  4U86 A;  4WK9 A;  5HT1 A;  2DG3 A;  2MLY A;  1EHN A;  3UQA A;  3O5M A;  2DT2 A;  4Z2L A;  1XRV A;  4UDM A;  2L2S A;  4WJX A;  1EIB A;  1LL7 A;  4MNL A;  2MLZ A;  2PV3 A;  4DWS D;  5HBF A;  3CHE A;  3UI5 A;  3UQB A;  4J4N A;  4ZPW R;  4DRH A;  3ODK A;  3KAG A;  3EIP A;  3KAF A;  3VAW A;  1K9T A;  1FJD A;  2G8Z A;  2ZQT A;  4MTV A;  2MLX A;  2LPV A;  1BL4 A;  4R5E A;  3AS2 A;  1NH6 A;  2RUR A;  2AWG A;  2DPE A;  4TYO A;  2ZQU A;  4ZS6 A;  5B8I C;  4IQ2 A;  2FDM A;  3IKD A;  4ODO A;  4GGQ A;  1SYT A;  3WQW A;  1HKI A;  5J6E A;  1L1P A;  4ODQ A;  3ARZ A;  2ITK A;  2KR7 A;  2O92 A;  3TDB A;  1Q6I A;  1JND A;  4JFI A;  1OWQ A;  4U84 A;  4WIW A;  1W26 A;  4ODR A;  4NZC A;  3OOB A;  1Y0O A;  1E9L A;  4DRO A;  3RME A;  4DWS B;  4Z2J A;  1E6P A;  5HTG A;  1XHG A;  1FFQ A;  3O5G A;  2PPO A;  3B9D A;  3FAP A;  2N87 A;  1FKS A;  2XP5 A;  1ROT A;  4ODM A;  3O5D A;  1FKD A;  5DIV A;  2A3B A;  1ZBK A;  4QT2 A;  4P8V A;  2PI6 A;  2DG9 A;  1H0G A;  3WKZ A;  1JVW A;  1KFW A;  1HKJ A;  2PPN A;  1T11 A;  1FKF A;  3WD4 A;  2M08 A;  3B9E A;  1NSG A;  1ZBW A;  1EDQ A;  2AOS A;  3WL1 A;  3EY6 A;  4L72 B;  3WD3 A;  1IX5 A;  3ARY A;  1M5Y A;  1W1V A;  1HJV A;  3CH9 A;  2XP3 A;  1W9P A;  3CHD A;  3BXW A;  4NSB A;  2M2A A;  4ZPV R;  4DRQ A;  3OA5 A;  1HJX A;  1WNO A;  2B5U B;  4Z2K A;  4ODP A;  1GUV A;  3IHZ A;  2DG4 A;  1JNS A;  1H0I A;  2IF4 A;  1R9H A;  2ZR4 A;  3UI4 A;  1NWU A;  4MNK A;  5HUA A;  1FKJ A;  4GIV A;  3RM4 A;  2ZR6 A;  3QOK A;  4TNS A;  1D6O A;  5GQB A;  1J6Y A;  3O5O A;  3KAC A;  1GRJ A;  2VCD A;  3IKG A;  3O5F A;  3B8S A;  4P8X A;  4J4O A;  4DRP A;  5HWB A;  4LAW A;  1OGG A;  4JFK A;  5HW6 A;  3ARV A;  4TX0 A;  1EYM A;  1KT0 A;  1ZBC A;  2MF9 A;  1TCO C;  3WD2 A;  1Q6H A;  5DIT A;  3G6M A;  3JYJ A;  2DSU A;  3PRA A;  4R0X A;  3WIJ A;  1ZU8 A;  1E6R A;  3ARQ A;  1RD6 A;  2KI3 A;  3O5I A;  5DF0 A;  3FXY A;  1UR8 A;  1U79 A;  2LGO A;  4W9P A;  4DIP A;  3ART A;  4ODK A;  4P8W A;  1FKG A;  3B9A A;  1UR9 A;  3CGN A;  4ZPT R;  5GPR A;  1FKK A;  1Q1C A;  4IQC A;  1ZBV A;  4Z2G A;  2YBT A;  1FKT A;  4MGV A;  3ARW A;  2F23 A;  3ARX A;  4DRJ A;  1J4H A;  1JCH B;  2KO7 A;  4QZV B;  3LUO A;  1FKI A;  1NMW A;  4JYS A;  3W4R A;  1ZCN A;  2XP6 A;  4DRI A;  1EQ3 A;  2PV1 A;  3O5E A;  4FAP A;  3O5Q A;  1OGB A;  1LJY A;  1B6C A;  2FAP A;  1LG1 A;  3IK8 A;  5HWC A;  5I98 A;  1P5Q A;  1FKH A;  1A7X A;  4DRN A;  2DT3 A;  3CGM A;  1ZL1 A;  2XP4 A;  1D2K A;  3AS3 A;  3RGC A;  2XP8 A;  1KT1 A;  4URI A;  1QZ2 A;  4DZ2 A;  4ODL A;  1W9U A;  4WKF A;  2RQS A;  1HJW A;  1Q6U A;  3ARO A;  1W1P A;  1YW5 A;  2MNT A;  4FN2 A;  1NWT A;  2PBC A;  2LKN A;  4W5U A;  1NWR A;  3GU0 A;  4Q22 A;  2P4V A;  5JH8 A;  2DSW A;  1ZB5 A;  4MNM A;  4JFJ A;  4DRM A;  3UQI A;  3O5R A;  3I6C A;  1HKK A;  3KAB A;  3AQU A;  4TW6 A;  3JXV A;  1ITX A; 
#chains in the Genus database with same CATH homology
 1D7J A;  4WKH A;  3PRD A;  2VN1 A;  2OFN A;  2F21 A;  3ALG A;  3WD0 A;  3JYM A;  3WH0 A;  5DO2 A;  1C9H A;  4DT4 A;  4DWS A;  4Q7N A;  1TFV A;  2PV2 A;  1HKM A;  2KFW A;  3RFW A;  1ROU A;  3TC5 A;  3RM9 A;  3UF8 A;  1CTN A;  3KAH A;  3GPK A;  4DH0 A;  1GOI A;  3WD1 A;  1LG2 A;  2DT0 A;  1NMV A;  3ALF A;  2B31 A;  3KAI A;  3KAD A;  4MNJ A;  2F4E A;  2WM0 A;  4PTM A;  2KGJ A;  2XPB A;  3G6L A;  4MAV A;  4Z2H A;  1X6N A;  3KZ7 A;  2MPH A;  3O5K A;  4N19 A;  2ZQV A;  1E15 A;  1E6Z A;  2A3A A;  2F2D A;  2DSV A;  3CHF A;  3MDY B;  4AY1 A;  1YAT A;  1QPF A;  5HW7 A;  3NI6 A;  2RUC A;  3PRB A;  3UI6 A;  3ARP A;  4U85 A;  4KR0 B;  2K8I A;  4XAK A;  4C02 B;  4LAV A;  1J4R A;  4S3K A;  5HW8 A;  4DWS C;  2Q5A A;  3CHC A;  1FKR A;  4JFM A;  4ODN A;  3O5P A;  4KQZ A;  4DRK A;  4DZ3 A;  3PA7 A;  1JNT A;  1PIN A;  1WB0 A;  2M1I A;  4QIB A;  4HBO A;  4LAY A;  1GPF A;  3ARR A;  1FKB A;  2G41 A;  4S3J A;  4HAR A;  2DSZ A;  2ZQS A;  1ZK6 A;  4MPK A;  3AS1 A;  3TCZ A;  4Z2I A;  2WLY A;  4TW8 A;  1BKF A;  4BF8 A;  1HXV A;  2XP9 A;  3NTP A;  2XPA A;  4LGX A;  1WAW A;  1J4I A;  1LL4 A;  5HKG A;  2IUZ A;  1VF8 A;  3WQV A;  1QPL A;  3ARU A;  2D9F A;  2RUQ A;  2UZ5 A;  3RM8 A;  2WLZ A;  2ESC A;  3CZ8 A;  1FD9 A;  4G50 A;  1JNE A;  2OLH A;  4WKA A;  1F40 A;  2LJ4 A;  4IT4 A;  4JFL A;  4L3N A;  2A3E A;  2RSE A;  5D75 A;  2KE0 A;  3AS0 A;  3H9R B;  3PR9 A;  1LL6 A;  4ML4 A;  4MSP A;  2QF8 A;  1E6N A;  4IPX A;  4O2T A;  4W9Q A;  3NRK A;  4NNR A;  2Y78 A;  5BXJ A;  5GPG A;  1O6I A;  1F8A B;  3ARS A;  3O5L A;  1D7I A;  4TW7 A;  1FAP A;  1NWS A;  3FY1 A;  1W9V A;  1LQ0 A;  4ITZ A;  4LAX A;  2DT1 A;  2RUD A;  2ZR5 A;  1X6L A;  4HBE A;  1W1T A;  4W9O A;  2A3C A;  1PBK A;  2FKE A;  2O9O A;  5DEZ A;  3WL0 A;  2XP7 A;  4QT3 A;  1D7H A;  1FKL A;  1SR0 A;  3B7X A;  2PPP A;  1N1A A;  2YBU A;  2JZV A;  3KCE A;  4G2P A;  1FFR A;  5DIU A;  3O5J A;  4IT6 A;  4P8U A;  1W1Y A;  2WK2 A;  4U86 A;  4WK9 A;  5HT1 A;  2DG3 A;  2MLY A;  1EHN A;  3UQA A;  3O5M A;  2DT2 A;  4Z2L A;  1XRV A;  2L2S A;  4WJX A;  1EIB A;  1LL7 A;  4MNL A;  2MLZ A;  2PV3 A;  4DWS D;  5HBF A;  3CHE A;  3UI5 A;  3UQB A;  4J4N A;  4ZPW R;  4DRH A;  3ODK A;  3KAG A;  3KAF A;  3VAW A;  1K9T A;  1FJD A;  2G8Z A;  2ZQT A;  4MTV A;  2MLX A;  2LPV A;  1BL4 A;  4R5E A;  3AS2 A;  1NH6 A;  2RUR A;  2AWG A;  2DPE A;  4TYO A;  2ZQU A;  4ZS6 A;  5B8I C;  4IQ2 A;  2FDM A;  3IKD A;  4ODO A;  4GGQ A;  1SYT A;  3WQW A;  1HKI A;  5J6E A;  1L1P A;  4ODQ A;  3ARZ A;  2ITK A;  2KR7 A;  2O92 A;  3TDB A;  1Q6I A;  1JND A;  4JFI A;  1OWQ A;  4U84 A;  4WIW A;  1W26 A;  4ODR A;  4NZC A;  3OOB A;  1Y0O A;  1E9L A;  4DRO A;  3RME A;  4DWS B;  4Z2J A;  1E6P A;  5HTG A;  1XHG A;  1FFQ A;  3O5G A;  2PPO A;  3B9D A;  3FAP A;  2N87 A;  1FKS A;  2XP5 A;  1ROT A;  4ODM A;  3O5D A;  1FKD A;  5DIV A;  2A3B A;  1ZBK A;  4QT2 A;  4P8V A;  2PI6 A;  2DG9 A;  1H0G A;  3WKZ A;  1JVW A;  1KFW A;  1HKJ A;  2PPN A;  1T11 A;  1FKF A;  3WD4 A;  2M08 A;  3B9E A;  1NSG A;  1ZBW A;  1EDQ A;  2AOS A;  3WL1 A;  3EY6 A;  4L72 B;  3WD3 A;  1IX5 A;  3ARY A;  1M5Y A;  1W1V A;  1HJV A;  3CH9 A;  2XP3 A;  1W9P A;  3CHD A;  3BXW A;  4NSB A;  2M2A A;  4ZPV R;  4DRQ A;  3OA5 A;  1HJX A;  1WNO A;  4Z2K A;  4ODP A;  1GUV A;  3IHZ A;  2DG4 A;  1JNS A;  1H0I A;  2IF4 A;  1R9H A;  2ZR4 A;  3UI4 A;  1NWU A;  4MNK A;  5HUA A;  1FKJ A;  4GIV A;  3RM4 A;  2ZR6 A;  3QOK A;  4TNS A;  1D6O A;  5GQB A;  1J6Y A;  3O5O A;  3KAC A;  2VCD A;  3IKG A;  3O5F A;  3B8S A;  4P8X A;  4J4O A;  4DRP A;  5HWB A;  4LAW A;  1OGG A;  4JFK A;  5HW6 A;  3ARV A;  4TX0 A;  1EYM A;  1KT0 A;  1ZBC A;  2MF9 A;  1TCO C;  3WD2 A;  1Q6H A;  5DIT A;  3G6M A;  3JYJ A;  2DSU A;  3PRA A;  4R0X A;  3WIJ A;  1ZU8 A;  1E6R A;  3ARQ A;  1RD6 A;  2KI3 A;  3O5I A;  5DF0 A;  3FXY A;  1UR8 A;  1U79 A;  2LGO A;  4W9P A;  4DIP A;  3ART A;  4ODK A;  4P8W A;  1FKG A;  3B9A A;  1UR9 A;  3CGN A;  4ZPT R;  5GPR A;  1FKK A;  1Q1C A;  4IQC A;  1ZBV A;  4Z2G A;  2YBT A;  1FKT A;  4MGV A;  3ARW A;  4DRJ A;  3ARX A;  1J4H A;  2KO7 A;  4QZV B;  3LUO A;  1FKI A;  1NMW A;  4JYS A;  3W4R A;  1ZCN A;  2XP6 A;  4DRI A;  1EQ3 A;  2PV1 A;  3O5E A;  4FAP A;  3O5Q A;  1OGB A;  1LJY A;  1B6C A;  2FAP A;  1LG1 A;  3IK8 A;  5HWC A;  5I98 A;  1P5Q A;  1FKH A;  1A7X A;  4DRN A;  2DT3 A;  3CGM A;  1ZL1 A;  2XP4 A;  1D2K A;  3AS3 A;  3RGC A;  2XP8 A;  1KT1 A;  4URI A;  1QZ2 A;  4DZ2 A;  4ODL A;  1W9U A;  4WKF A;  2RQS A;  1HJW A;  1Q6U A;  3ARO A;  1W1P A;  1YW5 A;  2MNT A;  4FN2 A;  1NWT A;  2PBC A;  2LKN A;  4W5U A;  1NWR A;  4Q22 A;  5JH8 A;  2DSW A;  1ZB5 A;  4MNM A;  4JFJ A;  4DRM A;  3UQI A;  3O5R A;  3I6C A;  1HKK A;  3KAB A;  3AQU A;  4TW6 A;  3JXV A;  1ITX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...