5HT1A

Structure of apo c. glabrata fkbp12
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
AMSETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
total genus 24
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ht1A00
5J6EA 2K8IA 2MLZA 2Q5AA 5HTGA 4FN2A 5DIVA 1HXVA 3KABA 4ODKA 4R0XA 1FKJA 2AWGA 3WH0A 1FKSA 1P5QA 2ZQVA 1F40A 2MLYA 3O5MA 3IHZA 4ODLA 2MNTA 3NTPA 2VN1A 4DRHA 2XP4A 4ODQA 3TC5A 2RUCA 2XP3A 4C02B 1D6OA 2LGOA 2LKNA 1J4IA 1C9HA 2KI3A 4J4OA 1T11A 5B8IC 3IKGA 1FKTA 3UI4A 2PPOA 3ODKA 3O5GA 3IKDA 2F4EA 2RUDA 4DZ3A 1EQ3A 2XP7A 1D7HA 3KCEA 3UQAA 1Q1CA 3MDYB 3O5IA 3O5QA 4ODRA 4BF8A 1FD9A 4ITZA 1Q6UA 3PA7A 3O5OA 4NNRA 2OFNA 2PV2A 4DH0A 3CGMA 1R9HA 4DRNA 2M1IA 2ZR4A 3LUOA 2L2SA 2KE0A 2KR7A 1NMWA 3KAFA 2PPNA 4LAWA 4ODOA 3RFWA 1FKFA 1PINA 4DRMA 1NSGA 2ZQTA 1A7XA 4JFJA 1KT0A 4ODNA 1ROTA 1U79A 4DRQA 2MF9A 2RUQA 1BKFA 1JNTA 2PV1A 2XP8A 1J6YA 3GPKA 2UZ5A 1PBKA 2KFWA 1EYMA 3KADA 3KAGA 3EY6A 1TCOC 3KAIA 2MPHA 4JFIA 1ZCNA 4QT3A 1D7JA 3PRDA 4W9QA 4IQCA 2ITKA 3JYJA 4IQ2A 2PV3A 5HKGA 4DRIA 4LAYA 3VAWA 1L1PA 4TW7A 2ZQUA 3H9RB 3TDBA 2JZVA 5DIUA 2ZR5A 5HT1A 3TCZA 4U84A 3NRKA 3I6CA 3KAHA 1W26A 2LPVA 2PBCA 1FAPA 4QIBA 4N19A 4DROA 1ZK6A 3KACA 3PRBA 1KT1A 1ROUA 1J4RA 5D75A 2DG3A 1BL4A 2XP6A 5HWBA 2IF4A 1D7IA 1Q6HA 1FKHA 2RSEA 4ODPA 4TX0A 4U85A 2F2DA 4GGQA 4DRPA 1FKRA 1FKDA 3JXVA 3UQIA 1J4HA 2ZR6A 1M5YA 3NI6A 1FKLA 1Y0OA 4W9OA 4MGVA 5DITA 2XP5A 3FAPA 5GPGA 1YATA 4DRKA 4DRJA 1FKBA 4IPXA 4G50A 3B7XA 1QPFA 4TW8A 1FKGA 3O5KA 4JFLA 2KGJA 2RURA 3UI6A 1FKIA 4TNSA 1QZ2A 4ODMA 3JYMA 3O5FA 2M2AA 5HWCA 2XPBA 2PPPA 2Y78A 3IK8A 4JFMA 1Q6IA 2F21A 2D9FA 2ZQSA 3O5EA 2M08A 4TYOA 2FAPA 4JFKA 2XPAA 3O5DA 4DIPA 2LJ4A 4O2TA 5HW8A 3RGCA 4LAXA 2VCDA 3O5LA 5HW6A 4U86A 4JYSA 4G2PA 1B6CA 2KO7A 5BXJA 1N1AA 2RQSA 4GIVA 2N87A 5I98A 2FKEA 1NMVA 3KZ7A 4DZ2A 5HUAA 1YW5A 2DG9A 2MLXA 1FJDA 3CGNA 3O5RA 4TW6A 3UI5A 4FAPA 3UF8A 2XP9A 3O5PA 5HW7A 1JVWA 2DG4A 1FKKA 1QPLA 4W9PA 3OOBA 3UQBA 4DT4A 4MSPA 1JNSA 3O5JA 4J4NA 1F8AB 4QT2A 4LAVA
chains in the Genus database with same CATH superfamily
5J6EA 1E6NA 4WKFA 5DIVA 3KABA 4ODKA 1W1VA 3WH0A 1XRVA 1LQ0A 4DRHA 4ODQA 3TC5A 2RUCA 2LKNA 2LGOA 2WLZA 4Z2LA 4KR0B 5GQBA 3ODKA 3IKDA 2F4EA 5GPRA 1D7HA 3UQAA 3MDYB 1HKIA 1FD9A 2DPEA 4ITZA 4L72B 4QZVB 4IT4A 2PV2A 4DH0A 1GPFA 3CGMA 2ZR4A 1JNEA 3ARTA 3FXYA 1FKFA 2WLYA 2ZQTA 4MAVA 3B9EA 3WQVA 2RUQA 1JNTA 3WD0A 1JNDA 4Z2IA 1PBKA 3KADA 3KAGA 3KAIA 3AS2A 4W9QA 3JYJA 1W9PA 1X6LA 4DRIA 2DSZA 3WIJA 3EIPA 2ZQUA 3TDBA 5DIUA 2ZR5A 4Z2HA 1FAPA 1HKJA 2OLHA 3PRBA 1ROUA 2XP6A 4DWSD 4NSBA 4WIWA 2RSEA 4U85A 4TX0A 1E44A 2DSUA 3JXVA 3UQIA 1J4HA 1Y0OA 1W1PA 4MGVA 2XP5A 3FAPA 1FKBA 2A3EA 4IPXA 4P8UA 3O5KA 4DWSC 2M2AA 5HWCA 5DEZA 1NH6A 1Q6IA 2ZQSA 4TYOA 1VF8A 1OGBA 4JFKA 3O5DA 4HBOA 5HW6A 4MTVA 4JYSA 1WNOA 2KO7A 5BXJA 2A3BA 3CHCA 4LGXA 4DWSA 3CGNA 4TW6A 3UI5A 5HW7A 1ITXA 1GUVA 1FFQA 3OOBA 3WKZA 1JNSA 1EHNA 3O5JA 1E6RA 2K8IA 5HTGA 2A3CA 3FY1A 2DT0A 3IHZA 4ODLA 2MNTA 3NTPA 2XP3A 3CZ8A 3PR9A 4ZS6A 2KI3A 1T11A 1FKTA 3ARVA 1W1TA 3UI4A 3QOKA 1KFWA 3O5IA 4IT6A 4ODRA 3G6LA 3PA7A 3O5OA 5JH8A 1R9HA 4MNLA 2YBUA 1NMWA 4MPKA 1NSGA 4WJXA 4ODNA 1U79A 2MF9A 3WQWA 2XP8A 4Z2JA 1SR0A 1FFRA 1D7JA 3ARUA 2WK2A 4IQCA 2ITKA 2PV3A 3VAWA 2G41A 1NWTA 3H9RB 4Z2GA 2P4VA 4XAKA 4U84A 4DROA 1W1YA 4N19A 1KT1A 2DG3A 2F2DA 4GGQA 4DRPA 1HKKA 4PTMA 2WM0A 2YBTA 1YATA 1NWSA 1E6ZA 3B7XA 4TW8A 3ARRA 3ALFA 1ZU8A 1ZL1A 2Y78A 1X6NA 2D9FA 4ZPVR 2M08A 2XPAA 5HW8A 3WD3A 4O2TA 3CH9A 2VCDA 3RM8A 3AS0A 4G2PA 3G6MA 5I98A 4MNJA 3KZ7A 1TFVA 1IX5A 2MLXA 3O5RA 4HBEA 4ML4A 4FAPA 3UF8A 3O5PA 1JVWA 5HBFA 1QPLA 4W9PA 3WD1A 3UQBA 1LL4A 3B8SA 4J4NA 1W9VA 4TNSA 2MLZA 1NWRA 5DF0A 1P5QA 4AY1A 1LG2A 1NWUA 1WB0A 4R5EA 4C02B 1J4IA 2DT3A 4J4OA 1E9LA 3IKGA 2FDMA 2PPOA 3ARZA 2DSWA 3O5GA 2RUDA 4WKAA 3KCEA 4ZPWR 3O5QA 4BF8A 3ARQA 4NNRA 1LJYA 2OFNA 4S3JA 2M1IA 4HARA 2KE0A 2KR7A 3KAFA 2PPNA 3W4RA 3B9AA 4DRMA 1PINA 2QF8A 2PI6A 1A7XA 1OGGA 1ROTA 2F23A 3AS3A 4P8WA 3AQUA 1BKFA 1HJXA 1J6YA 3RM9A 2UZ5A 2KFWA 1EYMA 3ARYA 1E15A 3EY6A 1TCOC 4JFIA 3PRDA 1E6PA 5HKGA 1L1PA 4TW7A 2JZVA 3TCZA 3KAHA 1W26A 2LPVA 4KQZA 1SYTA 1J4RA 3AS1A 5D75A 1BL4A 3ARPA 4ODPA 1Q6HA 4WKHA 1FKHA 4Z2KA 1FKDA 2ZR6A 1M5YA 3NI6A 5GPGA 4DRKA 1UR9A 4DRJA 3ARXA 2DT1A 1FKGA 3UI6A 1CTNA 2KGJA 1FKIA 3B9DA 3JYMA 3O5FA 2PN0A 3AROA 3IK8A 2PPPA 2O9OA 3O5EA 2FAPA 4DIPA 2LJ4A 4P8XA 1ZBCA 4Q22A 3CHEA 1ZBWA 1N1AA 4GIVA 2N87A 4P8VA 3GU0A 1K9TA 1LL6A 2FKEA 4URIA 3RM4A 2DT2A 2DG9A 2O92A 1FJDA 2B5UB 1FKKA 3CHDA 4DT4A 1GRJA 4DZ2A 2Q5AA 4FN2A 1HXVA 2G8ZA 4R0XA 1FKJA 2AWGA 3BMBA 1FKSA 5DO2A 2ZQVA 1F40A 2MLYA 3O5MA 4L3NA 1O6IA 2VN1A 4MNKA 2XP4A 3WL1A 3OA5A 1D6OA 2AOSA 1C9HA 1EIBA 2EULA 5B8IC 1HJWA 2ETNA 4W5UA 3WD2A 4DZ3A 1EQ3A 2XP7A 3PRAA 1Q1CA 1EDQA 1UR8A 1Q6UA 4UDMA 4DRNA 3LUOA 2L2SA 4DWSB 2B31A 3ALGA 3RFWA 4LAWA 4ODOA 1F8AB 2DSVA 4JFJA 1KT0A 3BXWA 2IUZA 4DRQA 2PV1A 3GPKA 2MPHA 4S3KA 1ZCNA 4QT3A 4IQ2A 4LAYA 5HT1A 3NRKA 3I6CA 4QIBA 2PBCA 1ZK6A 3KACA 5HWBA 2IF4A 1D7IA 1FKRA 1FKLA 1LG1A 4W9OA 4NZCA 5DITA 3ARSA 1ZB5A 4G50A 4Q7NA 1QPFA 1H0IA 1ZBKA 4JFLA 2RURA 4ZPTR 1QZ2A 4ODMA 4MNMA 3CHFA 2XPBA 4JFMA 1HKMA 1D2KA 1XHGA 2F21A 1H0GA 1GOIA 2ESCA 3RGCA 4LAXA 3ARWA 3O5LA 4U86A 1B6CA 2RQSA 4WK9A 1OWQA 1NMVA 3RMEA 1JCHB 5HUAA 1YW5A 1RD6A 3WL0A 3GTYX 1HJVA 2XP9A 2DG4A 1ZBVA 3WD4A 2A3AA 4MSPA 1W9UA 1WAWA 4QT2A 4LAVA 1LL7A
chains in the Genus database with same CATH topology
5J6EA 1E6NA 4WKFA 5DIVA 3KABA 4ODKA 1W1VA 3WH0A 1XRVA 1LQ0A 4DRHA 4ODQA 3TC5A 2RUCA 2LKNA 2LGOA 2WLZA 4Z2LA 4KR0B 5GQBA 3ODKA 3IKDA 2F4EA 5GPRA 1D7HA 3UQAA 3MDYB 1HKIA 1FD9A 2DPEA 4ITZA 4L72B 4QZVB 4IT4A 2PV2A 4DH0A 1GPFA 3CGMA 2ZR4A 1JNEA 3ARTA 3FXYA 1FKFA 2WLYA 2ZQTA 4MAVA 3B9EA 3WQVA 2RUQA 1JNTA 3WD0A 1JNDA 4Z2IA 1PBKA 3KADA 3KAGA 3KAIA 3AS2A 4W9QA 3JYJA 1W9PA 1X6LA 4DRIA 2DSZA 3WIJA 2ZQUA 3TDBA 5DIUA 2ZR5A 4Z2HA 1FAPA 1HKJA 2OLHA 3PRBA 1ROUA 2XP6A 4DWSD 4NSBA 4WIWA 2RSEA 4U85A 4TX0A 2DSUA 3JXVA 3UQIA 1J4HA 1Y0OA 1W1PA 4MGVA 2XP5A 3FAPA 1FKBA 2A3EA 4IPXA 4P8UA 3O5KA 4DWSC 2M2AA 5HWCA 5DEZA 1NH6A 1Q6IA 2ZQSA 4TYOA 1VF8A 1OGBA 4JFKA 3O5DA 4HBOA 5HW6A 4MTVA 4JYSA 1WNOA 2KO7A 5BXJA 2A3BA 3CHCA 4LGXA 4DWSA 3CGNA 4TW6A 3UI5A 5HW7A 1ITXA 1GUVA 1FFQA 3OOBA 3WKZA 1JNSA 1EHNA 3O5JA 1E6RA 2K8IA 5HTGA 2A3CA 3FY1A 2DT0A 3IHZA 4ODLA 2MNTA 3NTPA 2XP3A 3CZ8A 3PR9A 4ZS6A 2KI3A 1T11A 1FKTA 3ARVA 1W1TA 3UI4A 3QOKA 1KFWA 3O5IA 4IT6A 4ODRA 3G6LA 3PA7A 3O5OA 5JH8A 1R9HA 4MNLA 2YBUA 1NMWA 4MPKA 1NSGA 4WJXA 4ODNA 1U79A 2MF9A 3WQWA 2XP8A 4Z2JA 1SR0A 1FFRA 1D7JA 3ARUA 2WK2A 4IQCA 2ITKA 2PV3A 3VAWA 2G41A 1NWTA 3H9RB 4Z2GA 4XAKA 4U84A 4DROA 1W1YA 4N19A 1KT1A 2DG3A 2F2DA 4GGQA 4DRPA 1HKKA 4PTMA 2WM0A 2YBTA 1YATA 1NWSA 1E6ZA 3B7XA 4TW8A 3ARRA 3ALFA 1ZU8A 1ZL1A 2Y78A 1X6NA 2D9FA 4ZPVR 2M08A 2XPAA 5HW8A 3WD3A 4O2TA 3CH9A 2VCDA 3RM8A 3AS0A 4G2PA 3G6MA 5I98A 4MNJA 3KZ7A 1TFVA 1IX5A 2MLXA 3O5RA 4HBEA 4ML4A 4FAPA 3UF8A 3O5PA 1JVWA 5HBFA 1QPLA 4W9PA 3WD1A 3UQBA 1LL4A 3B8SA 4J4NA 1W9VA 4TNSA 2MLZA 1NWRA 5DF0A 1P5QA 4AY1A 1LG2A 1NWUA 1WB0A 4R5EA 4C02B 1J4IA 2DT3A 4J4OA 1E9LA 3IKGA 2FDMA 2PPOA 3ARZA 2DSWA 3O5GA 2RUDA 4WKAA 3KCEA 4ZPWR 3O5QA 4BF8A 3ARQA 4NNRA 1LJYA 2OFNA 4S3JA 2M1IA 4HARA 2KE0A 2KR7A 3KAFA 2PPNA 3W4RA 3B9AA 4DRMA 1PINA 2QF8A 2PI6A 1A7XA 1OGGA 1ROTA 3AS3A 4P8WA 3AQUA 1BKFA 1HJXA 1J6YA 3RM9A 2UZ5A 2KFWA 1EYMA 3ARYA 1E15A 3EY6A 1TCOC 4JFIA 3PRDA 1E6PA 5HKGA 1L1PA 4TW7A 2JZVA 3TCZA 3KAHA 1W26A 2LPVA 4KQZA 1SYTA 1J4RA 3AS1A 5D75A 1BL4A 3ARPA 4ODPA 1Q6HA 4WKHA 1FKHA 4Z2KA 1FKDA 2ZR6A 1M5YA 3NI6A 5GPGA 4DRKA 1UR9A 4DRJA 3ARXA 2DT1A 1FKGA 3UI6A 1CTNA 2KGJA 1FKIA 3B9DA 3JYMA 3O5FA 3AROA 3IK8A 2PPPA 3O5EA 2O9OA 2FAPA 4DIPA 2LJ4A 4P8XA 1ZBCA 4Q22A 3CHEA 1ZBWA 1N1AA 4GIVA 2N87A 4P8VA 1K9TA 1LL6A 2FKEA 4URIA 3RM4A 2DT2A 2DG9A 2O92A 1FJDA 1FKKA 3CHDA 4DT4A 4DZ2A 2Q5AA 4FN2A 1HXVA 2G8ZA 4R0XA 1FKJA 2AWGA 5DO2A 1FKSA 2ZQVA 1F40A 2MLYA 3O5MA 4L3NA 1O6IA 2VN1A 4MNKA 2XP4A 3WL1A 3OA5A 1D6OA 2AOSA 1C9HA 1EIBA 5B8IC 1HJWA 4W5UA 3WD2A 4DZ3A 1EQ3A 2XP7A 3PRAA 1Q1CA 1EDQA 1UR8A 1Q6UA 4DRNA 3LUOA 2L2SA 4DWSB 2B31A 3ALGA 3RFWA 4LAWA 4ODOA 1F8AB 2DSVA 4JFJA 1KT0A 3BXWA 2IUZA 4DRQA 2PV1A 3GPKA 2MPHA 4S3KA 1ZCNA 4QT3A 4IQ2A 4LAYA 5HT1A 3NRKA 3I6CA 4QIBA 2PBCA 1ZK6A 3KACA 5HWBA 2IF4A 1D7IA 1FKRA 1FKLA 1LG1A 4W9OA 4NZCA 5DITA 3ARSA 1ZB5A 4G50A 4Q7NA 1QPFA 1H0IA 1ZBKA 4JFLA 2RURA 4ZPTR 1QZ2A 4ODMA 4MNMA 3CHFA 2XPBA 4JFMA 1HKMA 1D2KA 1XHGA 2F21A 1H0GA 1GOIA 2ESCA 3RGCA 4LAXA 3ARWA 3O5LA 4U86A 1B6CA 2RQSA 4WK9A 1OWQA 1NMVA 3RMEA 5HUAA 1YW5A 1RD6A 3WL0A 1HJVA 2XP9A 2DG4A 1ZBVA 3WD4A 2A3AA 4MSPA 1W9UA 1WAWA 4QT2A 4LAVA 1LL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J6E A;  2K8I A;  2MLZ A;  2Q5A A;  5HTG A;  4FN2 A;  5DIV A;  1HXV A;  3KAB A;  4ODK A;  4R0X A;  1FKJ A;  2AWG A;  3WH0 A;  1FKS A;  1P5Q A;  2ZQV A;  1F40 A;  2MLY A;  3O5M A;  3IHZ A;  4ODL A;  2MNT A;  3NTP A;  2VN1 A;  4DRH A;  2XP4 A;  4ODQ A;  3TC5 A;  2RUC A;  2XP3 A;  4C02 B;  1D6O A;  2LGO A;  2LKN A;  1J4I A;  1C9H A;  2KI3 A;  4J4O A;  1T11 A;  5B8I C;  3IKG A;  1FKT A;  3UI4 A;  2PPO A;  3ODK A;  3O5G A;  3IKD A;  2F4E A;  2RUD A;  4DZ3 A;  1EQ3 A;  2XP7 A;  1D7H A;  3KCE A;  3UQA A;  1Q1C A;  3MDY B;  3O5I A;  3O5Q A;  4ODR A;  4BF8 A;  1FD9 A;  4ITZ A;  1Q6U A;  3PA7 A;  3O5O A;  4NNR A;  2OFN A;  2PV2 A;  4DH0 A;  3CGM A;  1R9H A;  4DRN A;  2M1I A;  2ZR4 A;  3LUO A;  2L2S A;  2KE0 A;  2KR7 A;  1NMW A;  3KAF A;  2PPN A;  4LAW A;  4ODO A;  3RFW A;  1FKF A;  1PIN A;  4DRM A;  1NSG A;  2ZQT A;  1A7X A;  4JFJ A;  1KT0 A;  4ODN A;  1ROT A;  1U79 A;  4DRQ A;  2MF9 A;  2RUQ A;  1BKF A;  1JNT A;  2PV1 A;  2XP8 A;  1J6Y A;  3GPK A;  2UZ5 A;  1PBK A;  2KFW A;  1EYM A;  3KAD A;  3KAG A;  3EY6 A;  1TCO C;  3KAI A;  2MPH A;  4JFI A;  1ZCN A;  4QT3 A;  1D7J A;  3PRD A;  4W9Q A;  4IQC A;  2ITK A;  3JYJ A;  4IQ2 A;  2PV3 A;  5HKG A;  4DRI A;  4LAY A;  3VAW A;  1L1P A;  4TW7 A;  2ZQU A;  3H9R B;  3TDB A;  2JZV A;  5DIU A;  2ZR5 A;  5HT1 A;  3TCZ A;  4U84 A;  3NRK A;  3I6C A;  3KAH A;  1W26 A;  2LPV A;  2PBC A;  1FAP A;  4QIB A;  4N19 A;  4DRO A;  1ZK6 A;  3KAC A;  3PRB A;  1KT1 A;  1ROU A;  1J4R A;  5D75 A;  2DG3 A;  1BL4 A;  2XP6 A;  5HWB A;  2IF4 A;  1D7I A;  1Q6H A;  1FKH A;  2RSE A;  4ODP A;  4TX0 A;  4U85 A;  2F2D A;  4GGQ A;  4DRP A;  1FKR A;  1FKD A;  3JXV A;  3UQI A;  1J4H A;  2ZR6 A;  1M5Y A;  3NI6 A;  1FKL A;  1Y0O A;  4W9O A;  4MGV A;  5DIT A;  2XP5 A;  3FAP A;  5GPG A;  1YAT A;  4DRK A;  4DRJ A;  1FKB A;  4IPX A;  4G50 A;  3B7X A;  1QPF A;  4TW8 A;  1FKG A;  3O5K A;  4JFL A;  2KGJ A;  2RUR A;  3UI6 A;  1FKI A;  4TNS A;  1QZ2 A;  4ODM A;  3JYM A;  3O5F A;  2M2A A;  5HWC A;  2XPB A;  2PPP A;  2Y78 A;  3IK8 A;  4JFM A;  1Q6I A;  2F21 A;  2D9F A;  2ZQS A;  3O5E A;  2M08 A;  4TYO A;  2FAP A;  4JFK A;  2XPA A;  3O5D A;  4DIP A;  2LJ4 A;  4O2T A;  5HW8 A;  3RGC A;  4LAX A;  2VCD A;  3O5L A;  5HW6 A;  4U86 A;  4JYS A;  4G2P A;  1B6C A;  2KO7 A;  5BXJ A;  1N1A A;  2RQS A;  4GIV A;  2N87 A;  5I98 A;  2FKE A;  1NMV A;  3KZ7 A;  4DZ2 A;  5HUA A;  1YW5 A;  2DG9 A;  2MLX A;  1FJD A;  3CGN A;  3O5R A;  4TW6 A;  3UI5 A;  4FAP A;  3UF8 A;  2XP9 A;  3O5P A;  5HW7 A;  1JVW A;  2DG4 A;  1FKK A;  1QPL A;  4W9P A;  3OOB A;  3UQB A;  4DT4 A;  4MSP A;  1JNS A;  3O5J A;  4J4N A;  1F8A B;  4QT2 A;  4LAV A; 
#chains in the Genus database with same CATH topology
 5J6E A;  1E6N A;  4WKF A;  5DIV A;  3KAB A;  4ODK A;  1W1V A;  3WH0 A;  1XRV A;  1LQ0 A;  4DRH A;  4ODQ A;  3TC5 A;  2RUC A;  2LKN A;  2LGO A;  2WLZ A;  4Z2L A;  4KR0 B;  5GQB A;  3ODK A;  3IKD A;  2F4E A;  5GPR A;  1D7H A;  3UQA A;  3MDY B;  1HKI A;  1FD9 A;  2DPE A;  4ITZ A;  4L72 B;  4QZV B;  4IT4 A;  2PV2 A;  4DH0 A;  1GPF A;  3CGM A;  2ZR4 A;  1JNE A;  3ART A;  3FXY A;  1FKF A;  2WLY A;  2ZQT A;  4MAV A;  3B9E A;  3WQV A;  2RUQ A;  1JNT A;  3WD0 A;  1JND A;  4Z2I A;  1PBK A;  3KAD A;  3KAG A;  3KAI A;  3AS2 A;  4W9Q A;  3JYJ A;  1W9P A;  1X6L A;  4DRI A;  2DSZ A;  3WIJ A;  3EIP A;  2ZQU A;  3TDB A;  5DIU A;  2ZR5 A;  4Z2H A;  1FAP A;  1HKJ A;  2OLH A;  3PRB A;  1ROU A;  2XP6 A;  4DWS D;  4NSB A;  4WIW A;  2RSE A;  4U85 A;  4TX0 A;  1E44 A;  2DSU A;  3JXV A;  3UQI A;  1J4H A;  1Y0O A;  1W1P A;  4MGV A;  2XP5 A;  3FAP A;  1FKB A;  2A3E A;  4IPX A;  4P8U A;  3O5K A;  4DWS C;  2M2A A;  5HWC A;  5DEZ A;  1NH6 A;  1Q6I A;  2ZQS A;  4TYO A;  1VF8 A;  1OGB A;  4JFK A;  3O5D A;  4HBO A;  5HW6 A;  4MTV A;  4JYS A;  1WNO A;  2KO7 A;  5BXJ A;  2A3B A;  3CHC A;  4LGX A;  4DWS A;  3CGN A;  4TW6 A;  3UI5 A;  5HW7 A;  1ITX A;  1GUV A;  1FFQ A;  3OOB A;  3WKZ A;  1JNS A;  1EHN A;  3O5J A;  1E6R A;  2K8I A;  5HTG A;  2A3C A;  3FY1 A;  2DT0 A;  3IHZ A;  4ODL A;  2MNT A;  3NTP A;  2XP3 A;  3CZ8 A;  3PR9 A;  4ZS6 A;  2KI3 A;  1T11 A;  1FKT A;  3ARV A;  1W1T A;  3UI4 A;  3QOK A;  1KFW A;  3O5I A;  4IT6 A;  4ODR A;  3G6L A;  3PA7 A;  3O5O A;  5JH8 A;  1R9H A;  4MNL A;  2YBU A;  1NMW A;  4MPK A;  1NSG A;  4WJX A;  4ODN A;  1U79 A;  2MF9 A;  3WQW A;  2XP8 A;  4Z2J A;  1SR0 A;  1FFR A;  1D7J A;  3ARU A;  2WK2 A;  4IQC A;  2ITK A;  2PV3 A;  3VAW A;  2G41 A;  1NWT A;  3H9R B;  4Z2G A;  2P4V A;  4XAK A;  4U84 A;  4DRO A;  1W1Y A;  4N19 A;  1KT1 A;  2DG3 A;  2F2D A;  4GGQ A;  4DRP A;  1HKK A;  4PTM A;  2WM0 A;  2YBT A;  1YAT A;  1NWS A;  1E6Z A;  3B7X A;  4TW8 A;  3ARR A;  3ALF A;  1ZU8 A;  1ZL1 A;  2Y78 A;  1X6N A;  2D9F A;  4ZPV R;  2M08 A;  2XPA A;  5HW8 A;  3WD3 A;  4O2T A;  3CH9 A;  2VCD A;  3RM8 A;  3AS0 A;  4G2P A;  3G6M A;  5I98 A;  4MNJ A;  3KZ7 A;  1TFV A;  1IX5 A;  2MLX A;  3O5R A;  4HBE A;  4ML4 A;  4FAP A;  3UF8 A;  3O5P A;  1JVW A;  5HBF A;  1QPL A;  4W9P A;  3WD1 A;  3UQB A;  1LL4 A;  3B8S A;  4J4N A;  1W9V A;  4TNS A;  2MLZ A;  1NWR A;  5DF0 A;  1P5Q A;  4AY1 A;  1LG2 A;  1NWU A;  1WB0 A;  4R5E A;  4C02 B;  1J4I A;  2DT3 A;  4J4O A;  1E9L A;  3IKG A;  2FDM A;  2PPO A;  3ARZ A;  2DSW A;  3O5G A;  2RUD A;  4WKA A;  3KCE A;  4ZPW R;  3O5Q A;  4BF8 A;  3ARQ A;  4NNR A;  1LJY A;  2OFN A;  4S3J A;  2M1I A;  4HAR A;  2KE0 A;  2KR7 A;  3KAF A;  2PPN A;  3W4R A;  3B9A A;  4DRM A;  1PIN A;  2QF8 A;  2PI6 A;  1A7X A;  1OGG A;  1ROT A;  2F23 A;  3AS3 A;  4P8W A;  3AQU A;  1BKF A;  1HJX A;  1J6Y A;  3RM9 A;  2UZ5 A;  2KFW A;  1EYM A;  3ARY A;  1E15 A;  3EY6 A;  1TCO C;  4JFI A;  3PRD A;  1E6P A;  5HKG A;  1L1P A;  4TW7 A;  2JZV A;  3TCZ A;  3KAH A;  1W26 A;  2LPV A;  4KQZ A;  1SYT A;  1J4R A;  3AS1 A;  5D75 A;  1BL4 A;  3ARP A;  4ODP A;  1Q6H A;  4WKH A;  1FKH A;  4Z2K A;  1FKD A;  2ZR6 A;  1M5Y A;  3NI6 A;  5GPG A;  4DRK A;  1UR9 A;  4DRJ A;  3ARX A;  2DT1 A;  1FKG A;  3UI6 A;  1CTN A;  2KGJ A;  1FKI A;  3B9D A;  3JYM A;  3O5F A;  2PN0 A;  3ARO A;  3IK8 A;  2PPP A;  2O9O A;  3O5E A;  2FAP A;  4DIP A;  2LJ4 A;  4P8X A;  1ZBC A;  4Q22 A;  3CHE A;  1ZBW A;  1N1A A;  4GIV A;  2N87 A;  4P8V A;  3GU0 A;  1K9T A;  1LL6 A;  2FKE A;  4URI A;  3RM4 A;  2DT2 A;  2DG9 A;  2O92 A;  1FJD A;  2B5U B;  1FKK A;  3CHD A;  4DT4 A;  1GRJ A;  4DZ2 A;  2Q5A A;  4FN2 A;  1HXV A;  2G8Z A;  4R0X A;  1FKJ A;  2AWG A;  3BMB A;  1FKS A;  5DO2 A;  2ZQV A;  1F40 A;  2MLY A;  3O5M A;  4L3N A;  1O6I A;  2VN1 A;  4MNK A;  2XP4 A;  3WL1 A;  3OA5 A;  1D6O A;  2AOS A;  1C9H A;  1EIB A;  2EUL A;  5B8I C;  1HJW A;  2ETN A;  4W5U A;  3WD2 A;  4DZ3 A;  1EQ3 A;  2XP7 A;  3PRA A;  1Q1C A;  1EDQ A;  1UR8 A;  1Q6U A;  4UDM A;  4DRN A;  3LUO A;  2L2S A;  4DWS B;  2B31 A;  3ALG A;  3RFW A;  4LAW A;  4ODO A;  1F8A B;  2DSV A;  4JFJ A;  1KT0 A;  3BXW A;  2IUZ A;  4DRQ A;  2PV1 A;  3GPK A;  2MPH A;  4S3K A;  1ZCN A;  4QT3 A;  4IQ2 A;  4LAY A;  5HT1 A;  3NRK A;  3I6C A;  4QIB A;  2PBC A;  1ZK6 A;  3KAC A;  5HWB A;  2IF4 A;  1D7I A;  1FKR A;  1FKL A;  1LG1 A;  4W9O A;  4NZC A;  5DIT A;  3ARS A;  1ZB5 A;  4G50 A;  4Q7N A;  1QPF A;  1H0I A;  1ZBK A;  4JFL A;  2RUR A;  4ZPT R;  1QZ2 A;  4ODM A;  4MNM A;  3CHF A;  2XPB A;  4JFM A;  1HKM A;  1D2K A;  1XHG A;  2F21 A;  1H0G A;  1GOI A;  2ESC A;  3RGC A;  4LAX A;  3ARW A;  3O5L A;  4U86 A;  1B6C A;  2RQS A;  4WK9 A;  1OWQ A;  1NMV A;  3RME A;  1JCH B;  5HUA A;  1YW5 A;  1RD6 A;  3WL0 A;  3GTY X;  1HJV A;  2XP9 A;  2DG4 A;  1ZBV A;  3WD4 A;  2A3A A;  4MSP A;  1W9U A;  1WAW A;  4QT2 A;  4LAV A;  1LL7 A; 
#chains in the Genus database with same CATH homology
 5J6E A;  1E6N A;  4WKF A;  5DIV A;  3KAB A;  4ODK A;  1W1V A;  3WH0 A;  1XRV A;  1LQ0 A;  4DRH A;  4ODQ A;  3TC5 A;  2RUC A;  2LKN A;  2LGO A;  2WLZ A;  4Z2L A;  4KR0 B;  5GQB A;  3ODK A;  3IKD A;  2F4E A;  5GPR A;  1D7H A;  3UQA A;  3MDY B;  1HKI A;  1FD9 A;  2DPE A;  4ITZ A;  4L72 B;  4QZV B;  4IT4 A;  2PV2 A;  4DH0 A;  1GPF A;  3CGM A;  2ZR4 A;  1JNE A;  3ART A;  3FXY A;  1FKF A;  2WLY A;  2ZQT A;  4MAV A;  3B9E A;  3WQV A;  2RUQ A;  1JNT A;  3WD0 A;  1JND A;  4Z2I A;  1PBK A;  3KAD A;  3KAG A;  3KAI A;  3AS2 A;  4W9Q A;  3JYJ A;  1W9P A;  1X6L A;  4DRI A;  2DSZ A;  3WIJ A;  2ZQU A;  3TDB A;  5DIU A;  2ZR5 A;  4Z2H A;  1FAP A;  1HKJ A;  2OLH A;  3PRB A;  1ROU A;  2XP6 A;  4DWS D;  4NSB A;  4WIW A;  2RSE A;  4U85 A;  4TX0 A;  2DSU A;  3JXV A;  3UQI A;  1J4H A;  1Y0O A;  1W1P A;  4MGV A;  2XP5 A;  3FAP A;  1FKB A;  2A3E A;  4IPX A;  4P8U A;  3O5K A;  4DWS C;  2M2A A;  5HWC A;  5DEZ A;  1NH6 A;  1Q6I A;  2ZQS A;  4TYO A;  1VF8 A;  1OGB A;  4JFK A;  3O5D A;  4HBO A;  5HW6 A;  4MTV A;  4JYS A;  1WNO A;  2KO7 A;  5BXJ A;  2A3B A;  3CHC A;  4LGX A;  4DWS A;  3CGN A;  4TW6 A;  3UI5 A;  5HW7 A;  1ITX A;  1GUV A;  1FFQ A;  3OOB A;  3WKZ A;  1JNS A;  1EHN A;  3O5J A;  1E6R A;  2K8I A;  5HTG A;  2A3C A;  3FY1 A;  2DT0 A;  3IHZ A;  4ODL A;  2MNT A;  3NTP A;  2XP3 A;  3CZ8 A;  3PR9 A;  4ZS6 A;  2KI3 A;  1T11 A;  1FKT A;  3ARV A;  1W1T A;  3UI4 A;  3QOK A;  1KFW A;  3O5I A;  4IT6 A;  4ODR A;  3G6L A;  3PA7 A;  3O5O A;  5JH8 A;  1R9H A;  4MNL A;  2YBU A;  1NMW A;  4MPK A;  1NSG A;  4WJX A;  4ODN A;  1U79 A;  2MF9 A;  3WQW A;  2XP8 A;  4Z2J A;  1SR0 A;  1FFR A;  1D7J A;  3ARU A;  2WK2 A;  4IQC A;  2ITK A;  2PV3 A;  3VAW A;  2G41 A;  1NWT A;  3H9R B;  4Z2G A;  4XAK A;  4U84 A;  4DRO A;  1W1Y A;  4N19 A;  1KT1 A;  2DG3 A;  2F2D A;  4GGQ A;  4DRP A;  1HKK A;  4PTM A;  2WM0 A;  2YBT A;  1YAT A;  1NWS A;  1E6Z A;  3B7X A;  4TW8 A;  3ARR A;  3ALF A;  1ZU8 A;  1ZL1 A;  2Y78 A;  1X6N A;  2D9F A;  4ZPV R;  2M08 A;  2XPA A;  5HW8 A;  3WD3 A;  4O2T A;  3CH9 A;  2VCD A;  3RM8 A;  3AS0 A;  4G2P A;  3G6M A;  5I98 A;  4MNJ A;  3KZ7 A;  1TFV A;  1IX5 A;  2MLX A;  3O5R A;  4HBE A;  4ML4 A;  4FAP A;  3UF8 A;  3O5P A;  1JVW A;  5HBF A;  1QPL A;  4W9P A;  3WD1 A;  3UQB A;  1LL4 A;  3B8S A;  4J4N A;  1W9V A;  4TNS A;  2MLZ A;  1NWR A;  5DF0 A;  1P5Q A;  4AY1 A;  1LG2 A;  1NWU A;  1WB0 A;  4R5E A;  4C02 B;  1J4I A;  2DT3 A;  4J4O A;  1E9L A;  3IKG A;  2FDM A;  2PPO A;  3ARZ A;  2DSW A;  3O5G A;  2RUD A;  4WKA A;  3KCE A;  4ZPW R;  3O5Q A;  4BF8 A;  3ARQ A;  4NNR A;  1LJY A;  2OFN A;  4S3J A;  2M1I A;  4HAR A;  2KE0 A;  2KR7 A;  3KAF A;  2PPN A;  3W4R A;  3B9A A;  4DRM A;  1PIN A;  2QF8 A;  2PI6 A;  1A7X A;  1OGG A;  1ROT A;  3AS3 A;  4P8W A;  3AQU A;  1BKF A;  1HJX A;  1J6Y A;  3RM9 A;  2UZ5 A;  2KFW A;  1EYM A;  3ARY A;  1E15 A;  3EY6 A;  1TCO C;  4JFI A;  3PRD A;  1E6P A;  5HKG A;  1L1P A;  4TW7 A;  2JZV A;  3TCZ A;  3KAH A;  1W26 A;  2LPV A;  4KQZ A;  1SYT A;  1J4R A;  3AS1 A;  5D75 A;  1BL4 A;  3ARP A;  4ODP A;  1Q6H A;  4WKH A;  1FKH A;  4Z2K A;  1FKD A;  2ZR6 A;  1M5Y A;  3NI6 A;  5GPG A;  4DRK A;  1UR9 A;  4DRJ A;  3ARX A;  2DT1 A;  1FKG A;  3UI6 A;  1CTN A;  2KGJ A;  1FKI A;  3B9D A;  3JYM A;  3O5F A;  3ARO A;  3IK8 A;  2PPP A;  3O5E A;  2O9O A;  2FAP A;  4DIP A;  2LJ4 A;  4P8X A;  1ZBC A;  4Q22 A;  3CHE A;  1ZBW A;  1N1A A;  4GIV A;  2N87 A;  4P8V A;  1K9T A;  1LL6 A;  2FKE A;  4URI A;  3RM4 A;  2DT2 A;  2DG9 A;  2O92 A;  1FJD A;  1FKK A;  3CHD A;  4DT4 A;  4DZ2 A;  2Q5A A;  4FN2 A;  1HXV A;  2G8Z A;  4R0X A;  1FKJ A;  2AWG A;  5DO2 A;  1FKS A;  2ZQV A;  1F40 A;  2MLY A;  3O5M A;  4L3N A;  1O6I A;  2VN1 A;  4MNK A;  2XP4 A;  3WL1 A;  3OA5 A;  1D6O A;  2AOS A;  1C9H A;  1EIB A;  5B8I C;  1HJW A;  4W5U A;  3WD2 A;  4DZ3 A;  1EQ3 A;  2XP7 A;  3PRA A;  1Q1C A;  1EDQ A;  1UR8 A;  1Q6U A;  4DRN A;  3LUO A;  2L2S A;  4DWS B;  2B31 A;  3ALG A;  3RFW A;  4LAW A;  4ODO A;  1F8A B;  2DSV A;  4JFJ A;  1KT0 A;  3BXW A;  2IUZ A;  4DRQ A;  2PV1 A;  3GPK A;  2MPH A;  4S3K A;  1ZCN A;  4QT3 A;  4IQ2 A;  4LAY A;  5HT1 A;  3NRK A;  3I6C A;  4QIB A;  2PBC A;  1ZK6 A;  3KAC A;  5HWB A;  2IF4 A;  1D7I A;  1FKR A;  1FKL A;  1LG1 A;  4W9O A;  4NZC A;  5DIT A;  3ARS A;  1ZB5 A;  4G50 A;  4Q7N A;  1QPF A;  1H0I A;  1ZBK A;  4JFL A;  2RUR A;  4ZPT R;  1QZ2 A;  4ODM A;  4MNM A;  3CHF A;  2XPB A;  4JFM A;  1HKM A;  1D2K A;  1XHG A;  2F21 A;  1H0G A;  1GOI A;  2ESC A;  3RGC A;  4LAX A;  3ARW A;  3O5L A;  4U86 A;  1B6C A;  2RQS A;  4WK9 A;  1OWQ A;  1NMV A;  3RME A;  5HUA A;  1YW5 A;  1RD6 A;  3WL0 A;  1HJV A;  2XP9 A;  2DG4 A;  1ZBV A;  3WD4 A;  2A3A A;  4MSP A;  1W9U A;  1WAW A;  4QT2 A;  4LAV A;  1LL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...