5HT1A

Structure of apo c. glabrata fkbp12
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
AMSETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 24
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ht1A00
2F2DA 3GPKA 1L1PA 2MNTA 1Q6IA 1KT1A 1ZK6A 4QT3A 3VAWA 2MF9A 2ZQTA 4MSPA 4W9OA 1FKDA 2UZ5A 3LUOA 4TW6A 1FKRA 2KO7A 4JFKA 3CGMA 1C9HA 1Q1CA 2ZQUA 2XP3A 5DIUA 4G2PA 2FAPA 1PBKA 2LPVA 2PV2A 2ZR4A 3NRKA 4ODLA 3KCEA 4JFLA 1FKJA 4DH0A 1J4RA 5D75A 4QT2A 2RQSA 3B7XA 2DG9A 1N1AA 1TCOC 2XPAA 3PA7A 1FAPA 1EYMA 2Y78A 4FAPA 4NNRA 3MDYB 3WH0A 1FD9A 1FKFA 3OOBA 4J4OA 3UI5A 1F40A 2XP4A 4DZ2A 5HTGA 2KI3A 1FKGA 3IKDA 1FJDA 3IK8A 2Q5AA 3TC5A 1FKKA 3O5QA 3H9RB 1J4HA 1PINA 3KAGA 4N19A 4U84A 4W9PA 2MPHA 2XP7A 4TX0A 3RGCA 2N87A 2VN1A 4U85A 1J6YA 2ZQSA 5HUAA 1FKIA 3I6CA 3EY6A 2PPPA 3KAFA 4DT4A 1Y0OA 4DZ3A 5I98A 3NI6A 1JNTA 2RUDA 2F21A 2FKEA 4LAWA 2DG3A 1NMVA 5GPGA 1ROUA 3TDBA 2M1IA 2XP6A 1FKSA 4C02B 3UQBA 1B6CA 2RURA 2DG4A 3O5LA 3UQIA 5BXJA 1P5QA 4JFJA 3O5DA 1D7IA 4J4NA 2AWGA 4IQ2A 2LJ4A 4TYOA 4O2TA 1FKHA 2MLYA 4IQCA 2MLZA 5DITA 2MLXA 3PRBA 1JNSA 1QZ2A 4TW8A 1BKFA 4DROA 3O5OA 2KFWA 3KABA 3ODKA 4GIVA 2M08A 3UI6A 4DRIA 1BL4A 1J4IA 4ODOA 3JYMA 4ODPA 4QIBA 4DRHA 4GGQA 2OFNA 1EQ3A 1FKLA 1W26A 2PPNA 2XPBA 3FAPA 5B8IC 1U79A 2XP8A 5HT1A 3O5RA 4ODRA 4DRPA 5HWBA 3CGNA 3KADA 2XP5A 2RUQA 4DRKA 5HKGA 5HWCA 2PV1A 3PRDA 4ODKA 4LAVA 4DRJA 1KT0A 3KACA 3O5EA 4FN2A 4ODNA 5J6EA 1M5YA 2F4EA 4LAYA 4JYSA 1R9HA 1T11A 1ROTA 2L2SA 4ODMA 5HW6A 2M2AA 2RUCA 4ODQA 1NMWA 4DRNA 1YATA 3TCZA 1FKTA 1NSGA 1D7JA 1ZCNA 3NTPA 4LAXA 2ZQVA 2ITKA 2KE0A 3UF8A 3UQAA 3IHZA 1YW5A 3RFWA 1JVWA 3KAHA 4ITZA 3UI4A 3JXVA 4TNSA 4R0XA 2PBCA 2LKNA 3O5MA 3KAIA 1Q6HA 1A7XA 2LGOA 3JYJA 3O5KA 4MGVA 4BF8A 1HXVA 4W9QA 4JFMA 1QPFA 4G50A 2ZR5A 2K8IA 2ZR6A 1D6OA 2IF4A 2PPOA 4U86A 4DIPA 5HW8A 4TW7A 2JZVA 2KGJA 1Q6UA 2D9FA 3KZ7A 4DRMA 2PV3A 3O5JA 5DIVA 1FKBA 2KR7A 4JFIA 5HW7A 1D7HA 1F8AB 2VCDA 2XP9A 4DRQA 3O5IA 3O5FA 3IKGA 1QPLA 3O5GA 3O5PA 4IPXA 2RSEA
chains in the Genus database with same CATH superfamily
3GPKA 4Z2GA 4WIWA 3WL1A 2ZQTA 2UZ5A 1FKRA 1HJWA 1C9HA 3FY1A 2DSVA 1PBKA 2LPVA 4ODLA 4L3NA 2DSUA 3KCEA 4DH0A 1J4RA 2PN0A 4MNMA 4QT2A 2XPAA 1W1TA 1WB0A 3CH9A 2WLZA 3MDYB 1HJVA 3UI5A 1FJDA 2PI6A 4IT6A 1NWRA 4W9PA 3WL0A 1EDQA 4W5UA 1X6NA 2VN1A 4U85A 1X6LA 4WKHA 2A3AA 3NI6A 3BXWA 2FKEA 1ROUA 2A3CA 2M1IA 2O9OA 4HARA 3O5DA 2LJ4A 1E6NA 2G8ZA 4O2TA 4DWSD 4MPKA 1LJYA 3CHFA 5DITA 1OGBA 3PRBA 2AOSA 1JNSA 1BKFA 4DROA 4NSBA 3O5OA 2KFWA 3AQUA 3ODKA 1BL4A 1J4IA 4ODOA 4ODPA 4QIBA 4WKAA 1NWTA 4Z2IA 3FAPA 5HT1A 3CGNA 5GQBA 2DT3A 5J6EA 1T11A 1ROTA 2L2SA 1WNOA 2M2AA 2RUCA 3RM8A 1FKTA 3UF8A 1O6IA 1YW5A 3RFWA 4ITZA 4R0XA 2DT2A 3AS0A 1HXVA 3QOKA 3ALGA 4JFMA 4W9QA 1E6PA 1JNDA 1HKIA 4ML4A 2ZR6A 1ZBWA 1GRJA 4L72B 3ARUA 4TW7A 3RMEA 1KFWA 2P4VA 1D7HA 1QPLA 1SR0A 2RSEA 2F2DA 2MNTA 4QT3A 1EHNA 3LUOA 3CGMA 5JH8A 1Q1CA 4Q22A 4G2PA 2FAPA 2PV2A 3NRKA 1FKJA 1N1AA 1TCOC 1FAPA 2F23A 2DSZA 4NNRA 4XAKA 3WD0A 4J4OA 2A3EA 2KI3A 1FKGA 3IK8A 3B9DA 3TC5A 2DSWA 3H9RB 3KAGA 1LQ0A 1ITXA 3RGCA 2N87A 1CTNA 5GPRA 3EY6A 4DT4A 3EIPA 1E6RA 2RUDA 3PRAA 3TDBA 3UQBA 3RM9A 2DT1A 2RURA 3FXYA 4R5EA 4JFJA 1D7IA 4J4NA 2AWGA 4TYOA 1E6ZA 3WD1A 4WJXA 2MLZA 3AS2A 3UI6A 1JNEA 4DRIA 3WD3A 1ZB5A 1LL7A 4Z2HA 3O5RA 1NWSA 4ODRA 5HWBA 4KR0B 4DRKA 4DRJA 1KT0A 3KACA 3O5EA 4FN2A 2F4EA 1ZU8A 4ODMA 4PTMA 1NMWA 2DT0A 1ZCNA 2ZQVA 4DWSB 1E44A 3ARSA 1GPFA 1JVWA 3UI4A 3JXVA 4P8UA 2PBCA 2LKNA 3O5MA 3KAIA 3JYJA 4WKFA 3WQWA 4U86A 2KGJA 1HJXA 1Q6UA 4DRMA 4JFIA 4AY1A 2XP9A 4P8VA 4Z2KA 2FDMA 1HKJA 3O5IA 3IKGA 3O5GA 4DWSA 4IPXA 3VAWA 2MF9A 4MSPA 4W9OA 2WLYA 5DEZA 4JFKA 5DIUA 1LL4A 4IT4A 4JFLA 2IUZA 5D75A 3G6LA 3CHCA 3PA7A 1GUVA 1H0IA 3ARVA 2O92A 4FAPA 3AS3A 2ESCA 4ZPTR 1FD9A 1FKFA 3B9EA 4KQZA 2XP4A 3O5QA 4P8XA 1J4HA 3WKZA 3CZ8A 2MPHA 2XP7A 4TX0A 3ARYA 2ZQSA 1FFRA 4MNKA 1FKIA 2PPPA 1Y0OA 1TFVA 2F21A 4LAWA 1NMVA 3ARXA 4ZPVR 4C02B 1B6CA 3O5LA 2B31A 1W1VA 3ARRA 1E9LA 1W1PA 1FKHA 2MLYA 4IQCA 1ZBKA 2MLXA 4Q7NA 1QZ2A 1XHGA 3ARTA 3KABA 4GIVA 2M08A 3JYMA 1FKLA 5B8IC 1U79A 2XP8A 3ARWA 3KADA 2RUQA 2WK2A 2YBTA 2ETNA 4ODKA 1ZBCA 2YBUA 2WM0A 4LAYA 4JYSA 1R9HA 1LL6A 3AS1A 4ODQA 3BMBA 4DRNA 3TCZA 4UDMA 2QF8A 4LAXA 2KE0A 1JCHB 3KAHA 4TNSA 2LGOA 3O5KA 3WD2A 4MGVA 1QPFA 4G50A 4MNJA 2K8IA 1D6OA 2PPOA 1XRVA 1HKMA 2D9FA 2PV3A 3O5JA 5DIVA 5HW7A 1NWUA 4DRQA 3OA5A 1Q6IA 4HBEA 1KT1A 1ZK6A 1FKDA 4TW6A 5DF0A 2KO7A 2ZQUA 2XP3A 3G6MA 3RM4A 1VF8A 2ZR4A 3CHEA 2RQSA 3B7XA 2DG9A 1LG1A 2A3BA 1EYMA 2OLHA 4QZVB 2Y78A 1WAWA 5HBFA 3WH0A 3OOBA 1F40A 4WK9A 4DZ2A 2B5UB 5HTGA 3IKDA 1FFQA 3CHDA 2Q5AA 1FKKA 1PINA 1W9VA 4N19A 4U84A 2DPEA 1RD6A 2G41A 4ZS6A 1LG2A 1J6YA 4MNLA 5HUAA 3I6CA 3KAFA 4DZ3A 1W1YA 5I98A 1JNTA 2DG3A 3ARZA 1D2KA 5GPGA 3B9AA 4NZCA 1IX5A 2XP6A 1FKSA 3GTYX 1H0GA 2DG4A 1GOIA 3UQIA 5BXJA 1P5QA 4IQ2A 4S3JA 4Z2JA 5DO2A 4TW8A 1L1PA 4DRHA 1E15A 2OFNA 4GGQA 1EQ3A 2PPNA 1W26A 2XPBA 4ZPWR 3WQVA 3AROA 4DRPA 4MAVA 1UR8A 1SYTA 2XP5A 5HKGA 5HWCA 2PV1A 1ZL1A 3PRDA 4LAVA 2EULA 4S3KA 1EIBA 4ODNA 1M5YA 3W4RA 1W9UA 5HW6A 1YATA 4HBOA 1NSGA 1D7JA 3NTPA 4URIA 2ITKA 3UQAA 1NH6A 3IHZA 3B8SA 3WIJA 1UR9A 1Q6HA 1A7XA 4BF8A 1OWQA 3ARQA 2ZR5A 4P8WA 2IF4A 1HKKA 1OGGA 4DIPA 5HW8A 3ALFA 2JZVA 4LGXA 3WD4A 3PR9A 1ZBVA 3KZ7A 3GU0A 3ARPA 1FKBA 2KR7A 4MTVA 1F8AB 2VCDA 1K9TA 1W9PA 3O5FA 4DWSC 3O5PA 4Z2LA
chains in the Genus database with same CATH topology
3GPKA 4Z2GA 4WIWA 3WL1A 2ZQTA 2UZ5A 1FKRA 1HJWA 1C9HA 3FY1A 2DSVA 1PBKA 2LPVA 4ODLA 4L3NA 2DSUA 3KCEA 4DH0A 1J4RA 4QT2A 4MNMA 2XPAA 1W1TA 1WB0A 3CH9A 2WLZA 3MDYB 1HJVA 3UI5A 1FJDA 2PI6A 4IT6A 1NWRA 4W9PA 3WL0A 1EDQA 4W5UA 1X6NA 2VN1A 4U85A 1X6LA 4WKHA 2A3AA 3NI6A 3BXWA 2FKEA 1ROUA 2A3CA 2M1IA 2O9OA 4HARA 3O5DA 2LJ4A 1E6NA 2G8ZA 4O2TA 4DWSD 4MPKA 1LJYA 3CHFA 5DITA 1OGBA 3PRBA 2AOSA 1JNSA 1BKFA 4DROA 4NSBA 3O5OA 2KFWA 3AQUA 3ODKA 1BL4A 1J4IA 4ODOA 4ODPA 4QIBA 4WKAA 1NWTA 4Z2IA 3FAPA 5HT1A 3CGNA 5GQBA 2DT3A 5J6EA 1T11A 1ROTA 2L2SA 1WNOA 2M2AA 2RUCA 3RM8A 1FKTA 3UF8A 1O6IA 1YW5A 3RFWA 4ITZA 4R0XA 2DT2A 3AS0A 1HXVA 3QOKA 3ALGA 4JFMA 4W9QA 1E6PA 1JNDA 1HKIA 4ML4A 2ZR6A 1ZBWA 4L72B 3ARUA 4TW7A 3RMEA 1KFWA 1D7HA 1QPLA 1SR0A 2RSEA 2F2DA 2MNTA 4QT3A 1EHNA 3LUOA 3CGMA 5JH8A 1Q1CA 4Q22A 4G2PA 2FAPA 2PV2A 3NRKA 1FKJA 1N1AA 1TCOC 1FAPA 2DSZA 4NNRA 4XAKA 3WD0A 4J4OA 2A3EA 2KI3A 1FKGA 3IK8A 3B9DA 3TC5A 2DSWA 3H9RB 3KAGA 1LQ0A 1ITXA 3RGCA 2N87A 1CTNA 5GPRA 3EY6A 4DT4A 2RUDA 1E6RA 3PRAA 3TDBA 3UQBA 3RM9A 2DT1A 2RURA 3FXYA 4R5EA 4JFJA 1D7IA 4J4NA 2AWGA 4TYOA 1E6ZA 3WD1A 4WJXA 2MLZA 3AS2A 3UI6A 1JNEA 4DRIA 3WD3A 1ZB5A 1LL7A 4Z2HA 3O5RA 1NWSA 4ODRA 5HWBA 4KR0B 4DRKA 4DRJA 1KT0A 3KACA 3O5EA 4FN2A 2F4EA 1ZU8A 4ODMA 4PTMA 1NMWA 2DT0A 1ZCNA 2ZQVA 4DWSB 3ARSA 1GPFA 1JVWA 3UI4A 3JXVA 4P8UA 2PBCA 2LKNA 3O5MA 3KAIA 3JYJA 4WKFA 3WQWA 4U86A 2KGJA 1HJXA 1Q6UA 4DRMA 4JFIA 4AY1A 2XP9A 4P8VA 4Z2KA 2FDMA 1HKJA 3O5IA 3IKGA 3O5GA 4DWSA 4IPXA 3VAWA 2MF9A 4MSPA 4W9OA 2WLYA 5DEZA 4JFKA 5DIUA 1LL4A 4IT4A 4JFLA 2IUZA 5D75A 3G6LA 3CHCA 3PA7A 1GUVA 1H0IA 3ARVA 2O92A 4FAPA 3AS3A 2ESCA 4ZPTR 1FD9A 1FKFA 3B9EA 4KQZA 2XP4A 3O5QA 4P8XA 1J4HA 3WKZA 3CZ8A 2MPHA 2XP7A 4TX0A 3ARYA 2ZQSA 1FFRA 4MNKA 1FKIA 2PPPA 1Y0OA 1TFVA 2F21A 4LAWA 1NMVA 3ARXA 4ZPVR 4C02B 1B6CA 3O5LA 2B31A 1W1VA 3ARRA 1E9LA 1W1PA 1FKHA 2MLYA 4IQCA 1ZBKA 2MLXA 4Q7NA 1QZ2A 1XHGA 3ARTA 3KABA 4GIVA 2M08A 3JYMA 1FKLA 5B8IC 1U79A 2XP8A 3ARWA 3KADA 2RUQA 2WK2A 2YBTA 4ODKA 1ZBCA 2YBUA 2WM0A 4LAYA 4JYSA 1R9HA 1LL6A 3AS1A 4ODQA 4DRNA 3TCZA 2QF8A 4LAXA 2KE0A 3KAHA 4TNSA 2LGOA 3O5KA 3WD2A 4MGVA 1QPFA 4G50A 4MNJA 2K8IA 1D6OA 2PPOA 1XRVA 1HKMA 2D9FA 2PV3A 3O5JA 5DIVA 5HW7A 1NWUA 4DRQA 3OA5A 1Q6IA 4HBEA 1KT1A 1ZK6A 1FKDA 4TW6A 5DF0A 2KO7A 2ZQUA 2XP3A 3G6MA 3RM4A 1VF8A 2ZR4A 3CHEA 2RQSA 3B7XA 2DG9A 1LG1A 2A3BA 1EYMA 2OLHA 4QZVB 2Y78A 1WAWA 5HBFA 3WH0A 3OOBA 1F40A 4WK9A 4DZ2A 5HTGA 3IKDA 1FFQA 3CHDA 2Q5AA 1FKKA 1PINA 1W9VA 4N19A 4U84A 2DPEA 1RD6A 2G41A 4ZS6A 1LG2A 1J6YA 4MNLA 5HUAA 3I6CA 3KAFA 4DZ3A 1W1YA 5I98A 1JNTA 2DG3A 3ARZA 1D2KA 5GPGA 3B9AA 4NZCA 1IX5A 2XP6A 1FKSA 1H0GA 2DG4A 1GOIA 3UQIA 5BXJA 1P5QA 4IQ2A 4S3JA 4Z2JA 5DO2A 4TW8A 1L1PA 4DRHA 1E15A 2OFNA 4GGQA 1EQ3A 2PPNA 1W26A 2XPBA 4ZPWR 3WQVA 3AROA 4DRPA 4MAVA 1UR8A 1SYTA 2XP5A 5HKGA 5HWCA 2PV1A 1ZL1A 3PRDA 4LAVA 4S3KA 1EIBA 4ODNA 1M5YA 3W4RA 1W9UA 5HW6A 1YATA 4HBOA 1NSGA 1D7JA 3NTPA 4URIA 2ITKA 3UQAA 1NH6A 3IHZA 3B8SA 3WIJA 1UR9A 1Q6HA 1A7XA 4BF8A 1OWQA 3ARQA 2ZR5A 4P8WA 2IF4A 1HKKA 1OGGA 4DIPA 5HW8A 3ALFA 2JZVA 4LGXA 3WD4A 3PR9A 1ZBVA 3KZ7A 3ARPA 1FKBA 2KR7A 4MTVA 1F8AB 2VCDA 1K9TA 1W9PA 3O5FA 4DWSC 3O5PA 4Z2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2D A;  3GPK A;  1L1P A;  2MNT A;  1Q6I A;  1KT1 A;  1ZK6 A;  4QT3 A;  3VAW A;  2MF9 A;  2ZQT A;  4MSP A;  4W9O A;  1FKD A;  2UZ5 A;  3LUO A;  4TW6 A;  1FKR A;  2KO7 A;  4JFK A;  3CGM A;  1C9H A;  1Q1C A;  2ZQU A;  2XP3 A;  5DIU A;  4G2P A;  2FAP A;  1PBK A;  2LPV A;  2PV2 A;  2ZR4 A;  3NRK A;  4ODL A;  3KCE A;  4JFL A;  1FKJ A;  4DH0 A;  1J4R A;  5D75 A;  4QT2 A;  2RQS A;  3B7X A;  2DG9 A;  1N1A A;  1TCO C;  2XPA A;  3PA7 A;  1FAP A;  1EYM A;  2Y78 A;  4FAP A;  4NNR A;  3MDY B;  3WH0 A;  1FD9 A;  1FKF A;  3OOB A;  4J4O A;  3UI5 A;  1F40 A;  2XP4 A;  4DZ2 A;  5HTG A;  2KI3 A;  1FKG A;  3IKD A;  1FJD A;  3IK8 A;  2Q5A A;  3TC5 A;  1FKK A;  3O5Q A;  3H9R B;  1J4H A;  1PIN A;  3KAG A;  4N19 A;  4U84 A;  4W9P A;  2MPH A;  2XP7 A;  4TX0 A;  3RGC A;  2N87 A;  2VN1 A;  4U85 A;  1J6Y A;  2ZQS A;  5HUA A;  1FKI A;  3I6C A;  3EY6 A;  2PPP A;  3KAF A;  4DT4 A;  1Y0O A;  4DZ3 A;  5I98 A;  3NI6 A;  1JNT A;  2RUD A;  2F21 A;  2FKE A;  4LAW A;  2DG3 A;  1NMV A;  5GPG A;  1ROU A;  3TDB A;  2M1I A;  2XP6 A;  1FKS A;  4C02 B;  3UQB A;  1B6C A;  2RUR A;  2DG4 A;  3O5L A;  3UQI A;  5BXJ A;  1P5Q A;  4JFJ A;  3O5D A;  1D7I A;  4J4N A;  2AWG A;  4IQ2 A;  2LJ4 A;  4TYO A;  4O2T A;  1FKH A;  2MLY A;  4IQC A;  2MLZ A;  5DIT A;  2MLX A;  3PRB A;  1JNS A;  1QZ2 A;  4TW8 A;  1BKF A;  4DRO A;  3O5O A;  2KFW A;  3KAB A;  3ODK A;  4GIV A;  2M08 A;  3UI6 A;  4DRI A;  1BL4 A;  1J4I A;  4ODO A;  3JYM A;  4ODP A;  4QIB A;  4DRH A;  4GGQ A;  2OFN A;  1EQ3 A;  1FKL A;  1W26 A;  2PPN A;  2XPB A;  3FAP A;  5B8I C;  1U79 A;  2XP8 A;  5HT1 A;  3O5R A;  4ODR A;  4DRP A;  5HWB A;  3CGN A;  3KAD A;  2XP5 A;  2RUQ A;  4DRK A;  5HKG A;  5HWC A;  2PV1 A;  3PRD A;  4ODK A;  4LAV A;  4DRJ A;  1KT0 A;  3KAC A;  3O5E A;  4FN2 A;  4ODN A;  5J6E A;  1M5Y A;  2F4E A;  4LAY A;  4JYS A;  1R9H A;  1T11 A;  1ROT A;  2L2S A;  4ODM A;  5HW6 A;  2M2A A;  2RUC A;  4ODQ A;  1NMW A;  4DRN A;  1YAT A;  3TCZ A;  1FKT A;  1NSG A;  1D7J A;  1ZCN A;  3NTP A;  4LAX A;  2ZQV A;  2ITK A;  2KE0 A;  3UF8 A;  3UQA A;  3IHZ A;  1YW5 A;  3RFW A;  1JVW A;  3KAH A;  4ITZ A;  3UI4 A;  3JXV A;  4TNS A;  4R0X A;  2PBC A;  2LKN A;  3O5M A;  3KAI A;  1Q6H A;  1A7X A;  2LGO A;  3JYJ A;  3O5K A;  4MGV A;  4BF8 A;  1HXV A;  4W9Q A;  4JFM A;  1QPF A;  4G50 A;  2ZR5 A;  2K8I A;  2ZR6 A;  1D6O A;  2IF4 A;  2PPO A;  4U86 A;  4DIP A;  5HW8 A;  4TW7 A;  2JZV A;  2KGJ A;  1Q6U A;  2D9F A;  3KZ7 A;  4DRM A;  2PV3 A;  3O5J A;  5DIV A;  1FKB A;  2KR7 A;  4JFI A;  5HW7 A;  1D7H A;  1F8A B;  2VCD A;  2XP9 A;  4DRQ A;  3O5I A;  3O5F A;  3IKG A;  1QPL A;  3O5G A;  3O5P A;  4IPX A;  2RSE A; 
#chains in the Genus database with same CATH topology
 3GPK A;  4Z2G A;  4WIW A;  3WL1 A;  2ZQT A;  2UZ5 A;  1FKR A;  1HJW A;  1C9H A;  3FY1 A;  2DSV A;  1PBK A;  2LPV A;  4ODL A;  4L3N A;  2DSU A;  3KCE A;  4DH0 A;  1J4R A;  2PN0 A;  4MNM A;  4QT2 A;  2XPA A;  1W1T A;  1WB0 A;  3CH9 A;  2WLZ A;  3MDY B;  1HJV A;  3UI5 A;  1FJD A;  2PI6 A;  4IT6 A;  1NWR A;  4W9P A;  3WL0 A;  1EDQ A;  4W5U A;  1X6N A;  2VN1 A;  4U85 A;  1X6L A;  4WKH A;  2A3A A;  3NI6 A;  3BXW A;  2FKE A;  1ROU A;  2A3C A;  2M1I A;  2O9O A;  4HAR A;  3O5D A;  2LJ4 A;  1E6N A;  2G8Z A;  4O2T A;  4DWS D;  4MPK A;  1LJY A;  3CHF A;  5DIT A;  1OGB A;  3PRB A;  2AOS A;  1JNS A;  1BKF A;  4DRO A;  4NSB A;  3O5O A;  2KFW A;  3AQU A;  3ODK A;  1BL4 A;  1J4I A;  4ODO A;  4ODP A;  4QIB A;  4WKA A;  1NWT A;  4Z2I A;  3FAP A;  5HT1 A;  3CGN A;  5GQB A;  2DT3 A;  5J6E A;  1T11 A;  1ROT A;  2L2S A;  1WNO A;  2M2A A;  2RUC A;  3RM8 A;  1FKT A;  3UF8 A;  1O6I A;  1YW5 A;  3RFW A;  4ITZ A;  4R0X A;  2DT2 A;  3AS0 A;  1HXV A;  3QOK A;  3ALG A;  4JFM A;  4W9Q A;  1E6P A;  1JND A;  1HKI A;  4ML4 A;  2ZR6 A;  1ZBW A;  1GRJ A;  4L72 B;  3ARU A;  4TW7 A;  3RME A;  1KFW A;  2P4V A;  1D7H A;  1QPL A;  1SR0 A;  2RSE A;  2F2D A;  2MNT A;  4QT3 A;  1EHN A;  3LUO A;  3CGM A;  5JH8 A;  1Q1C A;  4Q22 A;  4G2P A;  2FAP A;  2PV2 A;  3NRK A;  1FKJ A;  1N1A A;  1TCO C;  1FAP A;  2F23 A;  2DSZ A;  4NNR A;  4XAK A;  3WD0 A;  4J4O A;  2A3E A;  2KI3 A;  1FKG A;  3IK8 A;  3B9D A;  3TC5 A;  2DSW A;  3H9R B;  3KAG A;  1LQ0 A;  1ITX A;  3RGC A;  2N87 A;  1CTN A;  5GPR A;  3EY6 A;  4DT4 A;  3EIP A;  1E6R A;  2RUD A;  3PRA A;  3TDB A;  3UQB A;  3RM9 A;  2DT1 A;  2RUR A;  3FXY A;  4R5E A;  4JFJ A;  1D7I A;  4J4N A;  2AWG A;  4TYO A;  1E6Z A;  3WD1 A;  4WJX A;  2MLZ A;  3AS2 A;  3UI6 A;  1JNE A;  4DRI A;  3WD3 A;  1ZB5 A;  1LL7 A;  4Z2H A;  3O5R A;  1NWS A;  4ODR A;  5HWB A;  4KR0 B;  4DRK A;  4DRJ A;  1KT0 A;  3KAC A;  3O5E A;  4FN2 A;  2F4E A;  1ZU8 A;  4ODM A;  4PTM A;  1NMW A;  2DT0 A;  1ZCN A;  2ZQV A;  4DWS B;  1E44 A;  3ARS A;  1GPF A;  1JVW A;  3UI4 A;  3JXV A;  4P8U A;  2PBC A;  2LKN A;  3O5M A;  3KAI A;  3JYJ A;  4WKF A;  3WQW A;  4U86 A;  2KGJ A;  1HJX A;  1Q6U A;  4DRM A;  4JFI A;  4AY1 A;  2XP9 A;  4P8V A;  4Z2K A;  2FDM A;  1HKJ A;  3O5I A;  3IKG A;  3O5G A;  4DWS A;  4IPX A;  3VAW A;  2MF9 A;  4MSP A;  4W9O A;  2WLY A;  5DEZ A;  4JFK A;  5DIU A;  1LL4 A;  4IT4 A;  4JFL A;  2IUZ A;  5D75 A;  3G6L A;  3CHC A;  3PA7 A;  1GUV A;  1H0I A;  3ARV A;  2O92 A;  4FAP A;  3AS3 A;  2ESC A;  4ZPT R;  1FD9 A;  1FKF A;  3B9E A;  4KQZ A;  2XP4 A;  3O5Q A;  4P8X A;  1J4H A;  3WKZ A;  3CZ8 A;  2MPH A;  2XP7 A;  4TX0 A;  3ARY A;  2ZQS A;  1FFR A;  4MNK A;  1FKI A;  2PPP A;  1Y0O A;  1TFV A;  2F21 A;  4LAW A;  1NMV A;  3ARX A;  4ZPV R;  4C02 B;  1B6C A;  3O5L A;  2B31 A;  1W1V A;  3ARR A;  1E9L A;  1W1P A;  1FKH A;  2MLY A;  4IQC A;  1ZBK A;  2MLX A;  4Q7N A;  1QZ2 A;  1XHG A;  3ART A;  3KAB A;  4GIV A;  2M08 A;  3JYM A;  1FKL A;  5B8I C;  1U79 A;  2XP8 A;  3ARW A;  3KAD A;  2RUQ A;  2WK2 A;  2YBT A;  2ETN A;  4ODK A;  1ZBC A;  2YBU A;  2WM0 A;  4LAY A;  4JYS A;  1R9H A;  1LL6 A;  3AS1 A;  4ODQ A;  3BMB A;  4DRN A;  3TCZ A;  4UDM A;  2QF8 A;  4LAX A;  2KE0 A;  1JCH B;  3KAH A;  4TNS A;  2LGO A;  3O5K A;  3WD2 A;  4MGV A;  1QPF A;  4G50 A;  4MNJ A;  2K8I A;  1D6O A;  2PPO A;  1XRV A;  1HKM A;  2D9F A;  2PV3 A;  3O5J A;  5DIV A;  5HW7 A;  1NWU A;  4DRQ A;  3OA5 A;  1Q6I A;  4HBE A;  1KT1 A;  1ZK6 A;  1FKD A;  4TW6 A;  5DF0 A;  2KO7 A;  2ZQU A;  2XP3 A;  3G6M A;  3RM4 A;  1VF8 A;  2ZR4 A;  3CHE A;  2RQS A;  3B7X A;  2DG9 A;  1LG1 A;  2A3B A;  1EYM A;  2OLH A;  4QZV B;  2Y78 A;  1WAW A;  5HBF A;  3WH0 A;  3OOB A;  1F40 A;  4WK9 A;  4DZ2 A;  2B5U B;  5HTG A;  3IKD A;  1FFQ A;  3CHD A;  2Q5A A;  1FKK A;  1PIN A;  1W9V A;  4N19 A;  4U84 A;  2DPE A;  1RD6 A;  2G41 A;  4ZS6 A;  1LG2 A;  1J6Y A;  4MNL A;  5HUA A;  3I6C A;  3KAF A;  4DZ3 A;  1W1Y A;  5I98 A;  1JNT A;  2DG3 A;  3ARZ A;  1D2K A;  5GPG A;  3B9A A;  4NZC A;  1IX5 A;  2XP6 A;  1FKS A;  3GTY X;  1H0G A;  2DG4 A;  1GOI A;  3UQI A;  5BXJ A;  1P5Q A;  4IQ2 A;  4S3J A;  4Z2J A;  5DO2 A;  4TW8 A;  1L1P A;  4DRH A;  1E15 A;  2OFN A;  4GGQ A;  1EQ3 A;  2PPN A;  1W26 A;  2XPB A;  4ZPW R;  3WQV A;  3ARO A;  4DRP A;  4MAV A;  1UR8 A;  1SYT A;  2XP5 A;  5HKG A;  5HWC A;  2PV1 A;  1ZL1 A;  3PRD A;  4LAV A;  2EUL A;  4S3K A;  1EIB A;  4ODN A;  1M5Y A;  3W4R A;  1W9U A;  5HW6 A;  1YAT A;  4HBO A;  1NSG A;  1D7J A;  3NTP A;  4URI A;  2ITK A;  3UQA A;  1NH6 A;  3IHZ A;  3B8S A;  3WIJ A;  1UR9 A;  1Q6H A;  1A7X A;  4BF8 A;  1OWQ A;  3ARQ A;  2ZR5 A;  4P8W A;  2IF4 A;  1HKK A;  1OGG A;  4DIP A;  5HW8 A;  3ALF A;  2JZV A;  4LGX A;  3WD4 A;  3PR9 A;  1ZBV A;  3KZ7 A;  3GU0 A;  3ARP A;  1FKB A;  2KR7 A;  4MTV A;  1F8A B;  2VCD A;  1K9T A;  1W9P A;  3O5F A;  4DWS C;  3O5P A;  4Z2L A; 
#chains in the Genus database with same CATH homology
 3GPK A;  4Z2G A;  4WIW A;  3WL1 A;  2ZQT A;  2UZ5 A;  1FKR A;  1HJW A;  1C9H A;  3FY1 A;  2DSV A;  1PBK A;  2LPV A;  4ODL A;  4L3N A;  2DSU A;  3KCE A;  4DH0 A;  1J4R A;  4QT2 A;  4MNM A;  2XPA A;  1W1T A;  1WB0 A;  3CH9 A;  2WLZ A;  3MDY B;  1HJV A;  3UI5 A;  1FJD A;  2PI6 A;  4IT6 A;  1NWR A;  4W9P A;  3WL0 A;  1EDQ A;  4W5U A;  1X6N A;  2VN1 A;  4U85 A;  1X6L A;  4WKH A;  2A3A A;  3NI6 A;  3BXW A;  2FKE A;  1ROU A;  2A3C A;  2M1I A;  2O9O A;  4HAR A;  3O5D A;  2LJ4 A;  1E6N A;  2G8Z A;  4O2T A;  4DWS D;  4MPK A;  1LJY A;  3CHF A;  5DIT A;  1OGB A;  3PRB A;  2AOS A;  1JNS A;  1BKF A;  4DRO A;  4NSB A;  3O5O A;  2KFW A;  3AQU A;  3ODK A;  1BL4 A;  1J4I A;  4ODO A;  4ODP A;  4QIB A;  4WKA A;  1NWT A;  4Z2I A;  3FAP A;  5HT1 A;  3CGN A;  5GQB A;  2DT3 A;  5J6E A;  1T11 A;  1ROT A;  2L2S A;  1WNO A;  2M2A A;  2RUC A;  3RM8 A;  1FKT A;  3UF8 A;  1O6I A;  1YW5 A;  3RFW A;  4ITZ A;  4R0X A;  2DT2 A;  3AS0 A;  1HXV A;  3QOK A;  3ALG A;  4JFM A;  4W9Q A;  1E6P A;  1JND A;  1HKI A;  4ML4 A;  2ZR6 A;  1ZBW A;  4L72 B;  3ARU A;  4TW7 A;  3RME A;  1KFW A;  1D7H A;  1QPL A;  1SR0 A;  2RSE A;  2F2D A;  2MNT A;  4QT3 A;  1EHN A;  3LUO A;  3CGM A;  5JH8 A;  1Q1C A;  4Q22 A;  4G2P A;  2FAP A;  2PV2 A;  3NRK A;  1FKJ A;  1N1A A;  1TCO C;  1FAP A;  2DSZ A;  4NNR A;  4XAK A;  3WD0 A;  4J4O A;  2A3E A;  2KI3 A;  1FKG A;  3IK8 A;  3B9D A;  3TC5 A;  2DSW A;  3H9R B;  3KAG A;  1LQ0 A;  1ITX A;  3RGC A;  2N87 A;  1CTN A;  5GPR A;  3EY6 A;  4DT4 A;  2RUD A;  1E6R A;  3PRA A;  3TDB A;  3UQB A;  3RM9 A;  2DT1 A;  2RUR A;  3FXY A;  4R5E A;  4JFJ A;  1D7I A;  4J4N A;  2AWG A;  4TYO A;  1E6Z A;  3WD1 A;  4WJX A;  2MLZ A;  3AS2 A;  3UI6 A;  1JNE A;  4DRI A;  3WD3 A;  1ZB5 A;  1LL7 A;  4Z2H A;  3O5R A;  1NWS A;  4ODR A;  5HWB A;  4KR0 B;  4DRK A;  4DRJ A;  1KT0 A;  3KAC A;  3O5E A;  4FN2 A;  2F4E A;  1ZU8 A;  4ODM A;  4PTM A;  1NMW A;  2DT0 A;  1ZCN A;  2ZQV A;  4DWS B;  3ARS A;  1GPF A;  1JVW A;  3UI4 A;  3JXV A;  4P8U A;  2PBC A;  2LKN A;  3O5M A;  3KAI A;  3JYJ A;  4WKF A;  3WQW A;  4U86 A;  2KGJ A;  1HJX A;  1Q6U A;  4DRM A;  4JFI A;  4AY1 A;  2XP9 A;  4P8V A;  4Z2K A;  2FDM A;  1HKJ A;  3O5I A;  3IKG A;  3O5G A;  4DWS A;  4IPX A;  3VAW A;  2MF9 A;  4MSP A;  4W9O A;  2WLY A;  5DEZ A;  4JFK A;  5DIU A;  1LL4 A;  4IT4 A;  4JFL A;  2IUZ A;  5D75 A;  3G6L A;  3CHC A;  3PA7 A;  1GUV A;  1H0I A;  3ARV A;  2O92 A;  4FAP A;  3AS3 A;  2ESC A;  4ZPT R;  1FD9 A;  1FKF A;  3B9E A;  4KQZ A;  2XP4 A;  3O5Q A;  4P8X A;  1J4H A;  3WKZ A;  3CZ8 A;  2MPH A;  2XP7 A;  4TX0 A;  3ARY A;  2ZQS A;  1FFR A;  4MNK A;  1FKI A;  2PPP A;  1Y0O A;  1TFV A;  2F21 A;  4LAW A;  1NMV A;  3ARX A;  4ZPV R;  4C02 B;  1B6C A;  3O5L A;  2B31 A;  1W1V A;  3ARR A;  1E9L A;  1W1P A;  1FKH A;  2MLY A;  4IQC A;  1ZBK A;  2MLX A;  4Q7N A;  1QZ2 A;  1XHG A;  3ART A;  3KAB A;  4GIV A;  2M08 A;  3JYM A;  1FKL A;  5B8I C;  1U79 A;  2XP8 A;  3ARW A;  3KAD A;  2RUQ A;  2WK2 A;  2YBT A;  4ODK A;  1ZBC A;  2YBU A;  2WM0 A;  4LAY A;  4JYS A;  1R9H A;  1LL6 A;  3AS1 A;  4ODQ A;  4DRN A;  3TCZ A;  2QF8 A;  4LAX A;  2KE0 A;  3KAH A;  4TNS A;  2LGO A;  3O5K A;  3WD2 A;  4MGV A;  1QPF A;  4G50 A;  4MNJ A;  2K8I A;  1D6O A;  2PPO A;  1XRV A;  1HKM A;  2D9F A;  2PV3 A;  3O5J A;  5DIV A;  5HW7 A;  1NWU A;  4DRQ A;  3OA5 A;  1Q6I A;  4HBE A;  1KT1 A;  1ZK6 A;  1FKD A;  4TW6 A;  5DF0 A;  2KO7 A;  2ZQU A;  2XP3 A;  3G6M A;  3RM4 A;  1VF8 A;  2ZR4 A;  3CHE A;  2RQS A;  3B7X A;  2DG9 A;  1LG1 A;  2A3B A;  1EYM A;  2OLH A;  4QZV B;  2Y78 A;  1WAW A;  5HBF A;  3WH0 A;  3OOB A;  1F40 A;  4WK9 A;  4DZ2 A;  5HTG A;  3IKD A;  1FFQ A;  3CHD A;  2Q5A A;  1FKK A;  1PIN A;  1W9V A;  4N19 A;  4U84 A;  2DPE A;  1RD6 A;  2G41 A;  4ZS6 A;  1LG2 A;  1J6Y A;  4MNL A;  5HUA A;  3I6C A;  3KAF A;  4DZ3 A;  1W1Y A;  5I98 A;  1JNT A;  2DG3 A;  3ARZ A;  1D2K A;  5GPG A;  3B9A A;  4NZC A;  1IX5 A;  2XP6 A;  1FKS A;  1H0G A;  2DG4 A;  1GOI A;  3UQI A;  5BXJ A;  1P5Q A;  4IQ2 A;  4S3J A;  4Z2J A;  5DO2 A;  4TW8 A;  1L1P A;  4DRH A;  1E15 A;  2OFN A;  4GGQ A;  1EQ3 A;  2PPN A;  1W26 A;  2XPB A;  4ZPW R;  3WQV A;  3ARO A;  4DRP A;  4MAV A;  1UR8 A;  1SYT A;  2XP5 A;  5HKG A;  5HWC A;  2PV1 A;  1ZL1 A;  3PRD A;  4LAV A;  4S3K A;  1EIB A;  4ODN A;  1M5Y A;  3W4R A;  1W9U A;  5HW6 A;  1YAT A;  4HBO A;  1NSG A;  1D7J A;  3NTP A;  4URI A;  2ITK A;  3UQA A;  1NH6 A;  3IHZ A;  3B8S A;  3WIJ A;  1UR9 A;  1Q6H A;  1A7X A;  4BF8 A;  1OWQ A;  3ARQ A;  2ZR5 A;  4P8W A;  2IF4 A;  1HKK A;  1OGG A;  4DIP A;  5HW8 A;  3ALF A;  2JZV A;  4LGX A;  3WD4 A;  3PR9 A;  1ZBV A;  3KZ7 A;  3ARP A;  1FKB A;  2KR7 A;  4MTV A;  1F8A B;  2VCD A;  1K9T A;  1W9P A;  3O5F A;  4DWS C;  3O5P A;  4Z2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...