5HT1A

Structure of apo c. glabrata fkbp12
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
b'AMSETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
total genus 24
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ht1A00
3O5LA 3PRDA 4IQ2A 1F8AB 1PINA 2M08A 2RUDA 3O5KA 5DIUA 5D75A 2JZVA 1W26A 1M5YA 2OFNA 4FN2A 4DT4A 4BF8A 4IQCA 4DRKA 3TDBA 4DRIA 4DRJA 1EQ3A 2RQSA 1KT1A 5GPGA 3KAHA 3H9RB 2ZQSA 1N1AA 3JYJA 5HKGA 3PRBA 2RURA 3UQBA 1T11A 1BL4A 1D7HA 4JFLA 1HXVA 2XP7A 4ODPA 3PA7A 1Q6UA 1A7XA 2F2DA 4J4OA 4TYOA 5HTGA 2F4EA 3KCEA 1D7JA 2KE0A 4MSPA 4J4NA 5DIVA 3KADA 2ZQUA 2LKNA 2ZR5A 1Q6IA 2XP6A 2PV2A 3KAGA 5HW7A 5HUAA 3EY6A 3NTPA 3UQAA 1NMWA 3KABA 2FKEA 3O5PA 3JXVA 1L1PA 3KACA 4G2PA 4DRNA 4U84A 2LGOA 1F40A 2PPNA 2MLZA 2DG3A 1FKIA 1PBKA 1Q6HA 4LAYA 4O2TA 1TCOC 2PBCA 4ODRA 3TCZA 4DRHA 1J6YA 3CGMA 1JNTA 4ITZA 4DZ2A 4C02B 3O5DA 1FJDA 2PV1A 4DROA 1J4IA 3NI6A 4TW8A 1KT0A 2DG4A 2KR7A 3O5EA 3KAFA 3IHZA 2KO7A 2ITKA 3FAPA 4ODQA 5HT1A 3TC5A 4MGVA 5HWBA 2M2AA 2LJ4A 1NMVA 2L2SA 4LAWA 3O5QA 4TNSA 4ODLA 4JYSA 1BKFA 1EYMA 1FKTA 2XPAA 2DG9A 3IK8A 2XP5A 4DH0A 2PPOA 1ROUA 4DZ3A 2RUCA 4U85A 1FKBA 4IPXA 1ROTA 2MLYA 4QIBA 1FKDA 4U86A 2K8IA 3O5RA 4R0XA 1D7IA 3KZ7A 2IF4A 4W9OA 3KAIA 1P5QA 4TX0A 1NSGA 4QT2A 2Y78A 2XPBA 1FKJA 3O5GA 2XP3A 4TW6A 3WH0A 3O5OA 2PV3A 2MNTA 1B6CA 4JFMA 4DRMA 2XP4A 5J6EA 2D9FA 1D6OA 3UI5A 2XP8A 2ZR4A 5HW6A 3UQIA 5HWCA 4DIPA 2KGJA 2ZQTA 3RFWA 4JFIA 4TW7A 4JFKA 1QPFA 3UF8A 3I6CA 2PPPA 1J4HA 4G50A 2RUQA 2MLXA 3IKDA 2XP9A 2ZQVA 2UZ5A 3GPKA 2KFWA 3VAWA 2LPVA 1FAPA 4GIVA 4ODOA 4W9QA 3UI4A 1Y0OA 3CGNA 3UI6A 3RGCA 4DRPA 1FKKA 2VN1A 1YW5A 3B7XA 1ZCNA 1J4RA 5I98A 5DITA 1C9HA 2AWGA 2F21A 4N19A 4ODMA 1FKHA 1U79A 2M1IA 4W9PA 3NRKA 3O5FA 2MF9A 3IKGA 3OOBA 3LUOA 1YATA 2MPHA 2KI3A 5B8IC 1Q1CA 2FAPA 3O5JA 4DRQA 2VCDA 1QPLA 2Q5AA 4GGQA 1FKGA 1FKFA 2RSEA 2ZR6A 3JYMA 4NNRA 5BXJA 1FKSA 3ODKA 1JVWA 1FKRA 4LAXA 3MDYB 1JNSA 1FD9A 1R9HA 3O5IA 4ODNA 3O5MA 4QT3A 2N87A 4ODKA 1FKLA 4JFJA 1ZK6A 1QZ2A 4FAPA 5HW8A 4LAVA
chains in the Genus database with same CATH superfamily
3O5LA 2M08A 3O5KA 2DT0A 1W26A 3AS0A 1M5YA 4FN2A 4BF8A 4DRKA 1EQ3A 4DRIA 4DRJA 3KAHA 1W9PA 3H9RB 3WD3A 3PRBA 2RURA 4MNMA 3QOKA 4ODPA 1Q6UA 3EIPA 5DO2A 3GU0A 2PN0A 3B9EA 1Q6IA 2XP6A 3WIJA 4MNLA 3JXVA 3WL1A 3KACA 4G2PA 2A3CA 2LGOA 4O2TA 2DSVA 1FKIA 1PBKA 4DRHA 1JNTA 4C02B 4P8VA 3WD1A 2WLYA 1LL4A 2KR7A 5HWBA 3FAPA 4Q7NA 3O5QA 4L3NA 4TNSA 4JYSA 1EYMA 1FKTA 2DG9A 2P4VA 2QF8A 4DH0A 1NWTA 1ROUA 1SR0A 2K8IA 3O5RA 1XRVA 4TX0A 1FKJA 3O5GA 3O5OA 4DWSC 2XP4A 5HW6A 2XP8A 3RFWA 4JFIA 2PPPA 2RUQA 2MLXA 1E6PA 2ZQVA 1LL6A 2LPVA 1E44A 4GIVA 4W9QA 1W9VA 1Y0OA 4DRPA 1YW5A 5I98A 1C9HA 2O9OA 1O6IA 3WD0A 2DT3A 3CZ8A 5B8IC 1Q1CA 3O5JA 2Q5AA 5HBFA 4NNRA 2ZR6A 5GPRA 5BXJA 2B5UB 3MDYB 1JNSA 4LGXA 4S3JA 4KR0B 3WQWA 2N87A 3ARUA 4ODKA 4Z2LA 1QZ2A 2IUZA 4LAVA 1LJYA 2DSWA 5DIUA 1FFRA 4Z2IA 5D75A 1SYTA 1HJVA 3WD4A 1HKKA 5GPGA 1K9TA 3JYJA 5HKGA 5DEZA 1W1PA 2EULA 4JFLA 1HXVA 1A7XA 4MSPA 4MTVA 2ZR5A 2PV2A 3KAGA 5HUAA 3EY6A 3G6LA 1LG1A 3NTPA 3UQAA 1NMWA 2FKEA 4NSBA 1L1PA 4DRNA 4UDMA 4L72B 2PPNA 4ITZA 4DZ2A 1FJDA 3O5DA 4WKFA 1J4IA 1KT0A 2DG4A 1KFWA 5HT1A 1NMVA 2L2SA 4LAWA 3ARQA 3IK8A 1OWQA 1ROTA 2MLYA 4MNJA 1LL7A 1P5QA 1NSGA 3ARXA 1OGBA 2MNTA 4JFMA 1X6LA 1D6OA 5HWCA 2YBUA 4ZPVR 4DIPA 2ZQTA 1QPFA 1ZBKA 3UF8A 1GUVA 4HARA 1WB0A 3I6CA 1JNDA 3FXYA 1J4HA 4P8XA 3GPKA 3UI4A 1FAPA 4ML4A 1GPFA 3CGNA 4KQZA 1FKKA 1RD6A 4QZVB 1ZCNA 1J4RA 1E6ZA 1E6RA 3CHFA 1FKHA 1ZB5A 2MF9A 3IKGA 1YATA 4R5EA 2YBTA 3CH9A 2FAPA 1WNOA 2PI6A 4GGQA 2ETNA 2DSZA 3JYMA 1W1YA 3ODKA 1JVWA 3GTYX 4LAXA 1W9UA 3O5MA 1FKLA 1E9LA 2AOSA 4JFJA 2A3BA 3VAWA 1IX5A 3ARYA 4IQ2A 1GOIA 1PINA 1H0GA 1EHNA 2O92A 2RUDA 2WLZA 4WJXA 1ZL1A 4XAKA 1OGGA 3CHDA 2RQSA 2F23A 3UQBA 4P8WA 1D7HA 3CHCA 4NZCA 3PA7A 2F2DA 2OLHA 4J4OA 4TYOA 5HTGA 1D7JA 4MAVA 2KE0A 3ARRA 4J4NA 5DIVA 3KADA 1VF8A 2LKNA 2WK2A 4DWSB 3BMBA 1EIBA 3AS2A 4Z2JA 3KABA 3AQUA 3O5PA 1E6NA 3AS1A 2MLZA 4LAYA 1TCOC 3ARZA 1E15A 1WAWA 2PV1A 4DROA 3PRAA 3O5EA 3ARWA 3IHZA 2KO7A 2ITKA 1HKMA 2ESCA 4ODQA 4ZPWR 4Q22A 4PTMA 4P8UA 1BKFA 2XPAA 2DT2A 2PPOA 4DZ3A 2RUCA 1FKBA 3FY1A 2DPEA 2DT1A 4R0XA 1H0IA 1D7IA 4W9OA 4QT2A 5GQBA 2Y78A 2XPBA 1HKJA 4DRMA 2PV3A 2FDMA 1B6CA 1ITXA 3UI5A 4W5UA 2KGJA 4TW7A 4JFKA 3IKDA 4ZPTR 2A3AA 2XP9A 3B9AA 3B7XA 1NWSA 3B8SA 5DITA 3ARTA 2F21A 4N19A 4DWSA 4W9PA 1HJWA 1W1VA 1LG2A 3O5FA 3OOBA 3WD2A 1ZBCA 3WQVA 4Z2KA 4DRQA 1FFQA 2VCDA 1FKFA 1D2KA 1NWRA 2RSEA 1UR8A 1FKRA 3AROA 1HKIA 4S3KA 1UR9A 4QT3A 1ZK6A 1XHGA 3PRDA 1ZBVA 1F8AB 3ALFA 3ARSA 2JZVA 2G41A 2OFNA 1HJXA 4DT4A 4IQCA 1JNEA 3TDBA 4WIWA 3W4RA 1KT1A 2ZQSA 1N1AA 3RM4A 4DWSD 1T11A 3ALGA 4MNKA 1BL4A 1ZBWA 2XP7A 2F4EA 3KCEA 1GRJA 4HBEA 3RM9A 2ZQUA 5HW7A 3ARVA 3WL0A 4Z2GA 4U84A 3ARPA 2DG3A 4ODRA 1Q6HA 3B9DA 2PBCA 3TCZA 1J6YA 2DSUA 3CGMA 3NI6A 3PR9A 4TW8A 3G6MA 2G8ZA 3KAFA 3TC5A 4IT4A 4MGVA 2M2AA 2LJ4A 3AS3A 4ODLA 3BXWA 2XP5A 1EDQA 3OA5A 4U85A 1ZU8A 4IPXA 3CHEA 4QIBA 1FKDA 1X6NA 4U86A 3KZ7A 2IF4A 3WKZA 3KAIA 4HBOA 1JCHB 3RMEA 4TW6A 4URIA 2XP3A 3WH0A 5J6EA 2D9FA 2ZR4A 3UQIA 1TFVA 4WKAA 1NWUA 4G50A 2UZ5A 2KFWA 4ODOA 2A3EA 3UI6A 3RGCA 2VN1A 4IT6A 2B31A 1CTNA 2AWGA 1W1TA 4ODMA 1U79A 2M1IA 4Z2HA 4ZS6A 3NRKA 3LUOA 4MPKA 2MPHA 2KI3A 1LQ0A 1QPLA 1FKGA 5DF0A 5JH8A 1FKSA 1NH6A 1FD9A 4WKHA 1R9HA 3O5IA 4ODNA 4WK9A 3RM8A 4AY1A 2WM0A 4FAPA 5HW8A 1F40A
chains in the Genus database with same CATH topology
3O5LA 2M08A 3O5KA 2DT0A 1W26A 3AS0A 1M5YA 4FN2A 4BF8A 4DRKA 1EQ3A 4DRIA 4DRJA 3KAHA 1W9PA 3H9RB 3WD3A 3PRBA 2RURA 4MNMA 3QOKA 4ODPA 1Q6UA 5DO2A 3B9EA 1Q6IA 2XP6A 3WIJA 4MNLA 3JXVA 3WL1A 3KACA 4G2PA 2A3CA 2LGOA 4O2TA 2DSVA 1FKIA 1PBKA 4DRHA 1JNTA 4C02B 4P8VA 3WD1A 2WLYA 1LL4A 2KR7A 5HWBA 3FAPA 4Q7NA 3O5QA 4L3NA 4TNSA 4JYSA 1EYMA 1FKTA 2DG9A 2QF8A 4DH0A 1NWTA 1ROUA 1SR0A 2K8IA 3O5RA 1XRVA 4TX0A 1FKJA 3O5GA 3O5OA 4DWSC 2XP4A 5HW6A 2XP8A 3RFWA 4JFIA 2PPPA 2RUQA 2MLXA 1E6PA 2ZQVA 1LL6A 2LPVA 4GIVA 4W9QA 1W9VA 1Y0OA 4DRPA 1YW5A 5I98A 1C9HA 2O9OA 1O6IA 3WD0A 2DT3A 3CZ8A 5B8IC 1Q1CA 3O5JA 2Q5AA 5HBFA 4NNRA 2ZR6A 5GPRA 5BXJA 3MDYB 1JNSA 4LGXA 4S3JA 4KR0B 3WQWA 2N87A 3ARUA 4ODKA 4Z2LA 1QZ2A 2IUZA 4LAVA 1LJYA 2DSWA 5DIUA 1FFRA 4Z2IA 5D75A 1SYTA 1HJVA 3WD4A 1HKKA 5GPGA 1K9TA 3JYJA 5HKGA 5DEZA 1W1PA 4JFLA 1HXVA 1A7XA 4MSPA 4MTVA 2ZR5A 2PV2A 3KAGA 5HUAA 3EY6A 3G6LA 1LG1A 3NTPA 3UQAA 1NMWA 2FKEA 4NSBA 1L1PA 4DRNA 4L72B 2PPNA 4ITZA 4DZ2A 1FJDA 3O5DA 4WKFA 1J4IA 1KT0A 2DG4A 1KFWA 5HT1A 1NMVA 2L2SA 4LAWA 3ARQA 3IK8A 1OWQA 1ROTA 2MLYA 4MNJA 1LL7A 1P5QA 1NSGA 3ARXA 1OGBA 2MNTA 4JFMA 1X6LA 1D6OA 5HWCA 2YBUA 4ZPVR 4DIPA 2ZQTA 1QPFA 1ZBKA 3UF8A 1GUVA 4HARA 1WB0A 3I6CA 1JNDA 3FXYA 1J4HA 4P8XA 3GPKA 3UI4A 1FAPA 4ML4A 1GPFA 3CGNA 4KQZA 1FKKA 1RD6A 4QZVB 1ZCNA 1J4RA 1E6ZA 1E6RA 3CHFA 1FKHA 1ZB5A 2MF9A 3IKGA 1YATA 4R5EA 2YBTA 3CH9A 2FAPA 1WNOA 2PI6A 4GGQA 2DSZA 3JYMA 1W1YA 3ODKA 1JVWA 4LAXA 1W9UA 3O5MA 1FKLA 1E9LA 2AOSA 4JFJA 2A3BA 3VAWA 1IX5A 3ARYA 4IQ2A 1GOIA 1PINA 1H0GA 1EHNA 2O92A 2RUDA 2WLZA 4WJXA 1ZL1A 4XAKA 1OGGA 3CHDA 2RQSA 3UQBA 4P8WA 1D7HA 3CHCA 4NZCA 3PA7A 2F2DA 2OLHA 4J4OA 4TYOA 5HTGA 1D7JA 4MAVA 2KE0A 3ARRA 4J4NA 5DIVA 3KADA 1VF8A 2LKNA 2WK2A 4DWSB 1EIBA 3AS2A 4Z2JA 3KABA 3AQUA 3O5PA 1E6NA 3AS1A 2MLZA 4LAYA 1TCOC 3ARZA 1E15A 1WAWA 2PV1A 4DROA 3PRAA 3O5EA 3ARWA 3IHZA 2KO7A 2ITKA 1HKMA 2ESCA 4ODQA 4ZPWR 4Q22A 4PTMA 4P8UA 1BKFA 2XPAA 2DT2A 2PPOA 4DZ3A 2RUCA 1FKBA 3FY1A 2DPEA 2DT1A 4R0XA 1H0IA 1D7IA 4W9OA 4QT2A 5GQBA 2Y78A 2XPBA 1HKJA 4DRMA 2PV3A 2FDMA 1B6CA 1ITXA 3UI5A 4W5UA 2KGJA 4TW7A 4JFKA 3IKDA 4ZPTR 2A3AA 2XP9A 3B9AA 3B7XA 1NWSA 3B8SA 5DITA 3ARTA 2F21A 4N19A 4DWSA 4W9PA 1HJWA 1W1VA 1LG2A 3O5FA 3OOBA 3WD2A 1ZBCA 3WQVA 4Z2KA 4DRQA 1FFQA 2VCDA 1FKFA 1D2KA 1NWRA 2RSEA 1UR8A 1FKRA 3AROA 1HKIA 4S3KA 1UR9A 4QT3A 1ZK6A 1XHGA 3PRDA 1ZBVA 1F8AB 3ALFA 3ARSA 2JZVA 2G41A 2OFNA 1HJXA 4DT4A 4IQCA 1JNEA 3TDBA 4WIWA 3W4RA 1KT1A 2ZQSA 1N1AA 3RM4A 4DWSD 1T11A 3ALGA 4MNKA 1BL4A 1ZBWA 2XP7A 2F4EA 3KCEA 3RM9A 4HBEA 2ZQUA 5HW7A 3ARVA 3WL0A 4Z2GA 4U84A 3ARPA 2DG3A 4ODRA 1Q6HA 3B9DA 2PBCA 3TCZA 1J6YA 2DSUA 3CGMA 3NI6A 3PR9A 4TW8A 3G6MA 2G8ZA 3KAFA 3TC5A 4IT4A 4MGVA 2M2AA 2LJ4A 3AS3A 4ODLA 3BXWA 2XP5A 1EDQA 3OA5A 4U85A 1ZU8A 4IPXA 3CHEA 4QIBA 1FKDA 1X6NA 4U86A 3KZ7A 2IF4A 3WKZA 3KAIA 4HBOA 3RMEA 4TW6A 4URIA 2XP3A 3WH0A 5J6EA 2D9FA 2ZR4A 3UQIA 1TFVA 4WKAA 1NWUA 4G50A 2UZ5A 2KFWA 4ODOA 2A3EA 3UI6A 3RGCA 2VN1A 4IT6A 2B31A 1CTNA 2AWGA 1W1TA 4ODMA 1U79A 2M1IA 4Z2HA 4ZS6A 3NRKA 3LUOA 4MPKA 2MPHA 2KI3A 1LQ0A 1QPLA 1FKGA 5DF0A 5JH8A 1FKSA 1NH6A 1FD9A 4WKHA 1R9HA 3O5IA 4ODNA 4WK9A 3RM8A 4AY1A 2WM0A 4FAPA 5HW8A 1F40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5L A;  3PRD A;  4IQ2 A;  1F8A B;  1PIN A;  2M08 A;  2RUD A;  3O5K A;  5DIU A;  5D75 A;  2JZV A;  1W26 A;  1M5Y A;  2OFN A;  4FN2 A;  4DT4 A;  4BF8 A;  4IQC A;  4DRK A;  3TDB A;  4DRI A;  4DRJ A;  1EQ3 A;  2RQS A;  1KT1 A;  5GPG A;  3KAH A;  3H9R B;  2ZQS A;  1N1A A;  3JYJ A;  5HKG A;  3PRB A;  2RUR A;  3UQB A;  1T11 A;  1BL4 A;  1D7H A;  4JFL A;  1HXV A;  2XP7 A;  4ODP A;  3PA7 A;  1Q6U A;  1A7X A;  2F2D A;  4J4O A;  4TYO A;  5HTG A;  2F4E A;  3KCE A;  1D7J A;  2KE0 A;  4MSP A;  4J4N A;  5DIV A;  3KAD A;  2ZQU A;  2LKN A;  2ZR5 A;  1Q6I A;  2XP6 A;  2PV2 A;  3KAG A;  5HW7 A;  5HUA A;  3EY6 A;  3NTP A;  3UQA A;  1NMW A;  3KAB A;  2FKE A;  3O5P A;  3JXV A;  1L1P A;  3KAC A;  4G2P A;  4DRN A;  4U84 A;  2LGO A;  1F40 A;  2PPN A;  2MLZ A;  2DG3 A;  1FKI A;  1PBK A;  1Q6H A;  4LAY A;  4O2T A;  1TCO C;  2PBC A;  4ODR A;  3TCZ A;  4DRH A;  1J6Y A;  3CGM A;  1JNT A;  4ITZ A;  4DZ2 A;  4C02 B;  3O5D A;  1FJD A;  2PV1 A;  4DRO A;  1J4I A;  3NI6 A;  4TW8 A;  1KT0 A;  2DG4 A;  2KR7 A;  3O5E A;  3KAF A;  3IHZ A;  2KO7 A;  2ITK A;  3FAP A;  4ODQ A;  5HT1 A;  3TC5 A;  4MGV A;  5HWB A;  2M2A A;  2LJ4 A;  1NMV A;  2L2S A;  4LAW A;  3O5Q A;  4TNS A;  4ODL A;  4JYS A;  1BKF A;  1EYM A;  1FKT A;  2XPA A;  2DG9 A;  3IK8 A;  2XP5 A;  4DH0 A;  2PPO A;  1ROU A;  4DZ3 A;  2RUC A;  4U85 A;  1FKB A;  4IPX A;  1ROT A;  2MLY A;  4QIB A;  1FKD A;  4U86 A;  2K8I A;  3O5R A;  4R0X A;  1D7I A;  3KZ7 A;  2IF4 A;  4W9O A;  3KAI A;  1P5Q A;  4TX0 A;  1NSG A;  4QT2 A;  2Y78 A;  2XPB A;  1FKJ A;  3O5G A;  2XP3 A;  4TW6 A;  3WH0 A;  3O5O A;  2PV3 A;  2MNT A;  1B6C A;  4JFM A;  4DRM A;  2XP4 A;  5J6E A;  2D9F A;  1D6O A;  3UI5 A;  2XP8 A;  2ZR4 A;  5HW6 A;  3UQI A;  5HWC A;  4DIP A;  2KGJ A;  2ZQT A;  3RFW A;  4JFI A;  4TW7 A;  4JFK A;  1QPF A;  3UF8 A;  3I6C A;  2PPP A;  1J4H A;  4G50 A;  2RUQ A;  2MLX A;  3IKD A;  2XP9 A;  2ZQV A;  2UZ5 A;  3GPK A;  2KFW A;  3VAW A;  2LPV A;  1FAP A;  4GIV A;  4ODO A;  4W9Q A;  3UI4 A;  1Y0O A;  3CGN A;  3UI6 A;  3RGC A;  4DRP A;  1FKK A;  2VN1 A;  1YW5 A;  3B7X A;  1ZCN A;  1J4R A;  5I98 A;  5DIT A;  1C9H A;  2AWG A;  2F21 A;  4N19 A;  4ODM A;  1FKH A;  1U79 A;  2M1I A;  4W9P A;  3NRK A;  3O5F A;  2MF9 A;  3IKG A;  3OOB A;  3LUO A;  1YAT A;  2MPH A;  2KI3 A;  5B8I C;  1Q1C A;  2FAP A;  3O5J A;  4DRQ A;  2VCD A;  1QPL A;  2Q5A A;  4GGQ A;  1FKG A;  1FKF A;  2RSE A;  2ZR6 A;  3JYM A;  4NNR A;  5BXJ A;  1FKS A;  3ODK A;  1JVW A;  1FKR A;  4LAX A;  3MDY B;  1JNS A;  1FD9 A;  1R9H A;  3O5I A;  4ODN A;  3O5M A;  4QT3 A;  2N87 A;  4ODK A;  1FKL A;  4JFJ A;  1ZK6 A;  1QZ2 A;  4FAP A;  5HW8 A;  4LAV A; 
#chains in the Genus database with same CATH topology
 3O5L A;  2M08 A;  3O5K A;  2DT0 A;  1W26 A;  3AS0 A;  1M5Y A;  4FN2 A;  4BF8 A;  4DRK A;  1EQ3 A;  4DRI A;  4DRJ A;  3KAH A;  1W9P A;  3H9R B;  3WD3 A;  3PRB A;  2RUR A;  4MNM A;  3QOK A;  4ODP A;  1Q6U A;  3EIP A;  5DO2 A;  3GU0 A;  2PN0 A;  3B9E A;  1Q6I A;  2XP6 A;  3WIJ A;  4MNL A;  3JXV A;  3WL1 A;  3KAC A;  4G2P A;  2A3C A;  2LGO A;  4O2T A;  2DSV A;  1FKI A;  1PBK A;  4DRH A;  1JNT A;  4C02 B;  4P8V A;  3WD1 A;  2WLY A;  1LL4 A;  2KR7 A;  5HWB A;  3FAP A;  4Q7N A;  3O5Q A;  4L3N A;  4TNS A;  4JYS A;  1EYM A;  1FKT A;  2DG9 A;  2P4V A;  2QF8 A;  4DH0 A;  1NWT A;  1ROU A;  1SR0 A;  2K8I A;  3O5R A;  1XRV A;  4TX0 A;  1FKJ A;  3O5G A;  3O5O A;  4DWS C;  2XP4 A;  5HW6 A;  2XP8 A;  3RFW A;  4JFI A;  2PPP A;  2RUQ A;  2MLX A;  1E6P A;  2ZQV A;  1LL6 A;  2LPV A;  1E44 A;  4GIV A;  4W9Q A;  1W9V A;  1Y0O A;  4DRP A;  1YW5 A;  5I98 A;  1C9H A;  2O9O A;  1O6I A;  3WD0 A;  2DT3 A;  3CZ8 A;  5B8I C;  1Q1C A;  3O5J A;  2Q5A A;  5HBF A;  4NNR A;  2ZR6 A;  5GPR A;  5BXJ A;  2B5U B;  3MDY B;  1JNS A;  4LGX A;  4S3J A;  4KR0 B;  3WQW A;  2N87 A;  3ARU A;  4ODK A;  4Z2L A;  1QZ2 A;  2IUZ A;  4LAV A;  1LJY A;  2DSW A;  5DIU A;  1FFR A;  4Z2I A;  5D75 A;  1SYT A;  1HJV A;  3WD4 A;  1HKK A;  5GPG A;  1K9T A;  3JYJ A;  5HKG A;  5DEZ A;  1W1P A;  2EUL A;  4JFL A;  1HXV A;  1A7X A;  4MSP A;  4MTV A;  2ZR5 A;  2PV2 A;  3KAG A;  5HUA A;  3EY6 A;  3G6L A;  1LG1 A;  3NTP A;  3UQA A;  1NMW A;  2FKE A;  4NSB A;  1L1P A;  4DRN A;  4UDM A;  4L72 B;  2PPN A;  4ITZ A;  4DZ2 A;  1FJD A;  3O5D A;  4WKF A;  1J4I A;  1KT0 A;  2DG4 A;  1KFW A;  5HT1 A;  1NMV A;  2L2S A;  4LAW A;  3ARQ A;  3IK8 A;  1OWQ A;  1ROT A;  2MLY A;  4MNJ A;  1LL7 A;  1P5Q A;  1NSG A;  3ARX A;  1OGB A;  2MNT A;  4JFM A;  1X6L A;  1D6O A;  5HWC A;  2YBU A;  4ZPV R;  4DIP A;  2ZQT A;  1QPF A;  1ZBK A;  3UF8 A;  1GUV A;  4HAR A;  1WB0 A;  3I6C A;  1JND A;  3FXY A;  1J4H A;  4P8X A;  3GPK A;  3UI4 A;  1FAP A;  4ML4 A;  1GPF A;  3CGN A;  4KQZ A;  1FKK A;  1RD6 A;  4QZV B;  1ZCN A;  1J4R A;  1E6Z A;  1E6R A;  3CHF A;  1FKH A;  1ZB5 A;  2MF9 A;  3IKG A;  1YAT A;  4R5E A;  2YBT A;  3CH9 A;  2FAP A;  1WNO A;  2PI6 A;  4GGQ A;  2ETN A;  2DSZ A;  3JYM A;  1W1Y A;  3ODK A;  1JVW A;  3GTY X;  4LAX A;  1W9U A;  3O5M A;  1FKL A;  1E9L A;  2AOS A;  4JFJ A;  2A3B A;  3VAW A;  1IX5 A;  3ARY A;  4IQ2 A;  1GOI A;  1PIN A;  1H0G A;  1EHN A;  2O92 A;  2RUD A;  2WLZ A;  4WJX A;  1ZL1 A;  4XAK A;  1OGG A;  3CHD A;  2RQS A;  2F23 A;  3UQB A;  4P8W A;  1D7H A;  3CHC A;  4NZC A;  3PA7 A;  2F2D A;  2OLH A;  4J4O A;  4TYO A;  5HTG A;  1D7J A;  4MAV A;  2KE0 A;  3ARR A;  4J4N A;  5DIV A;  3KAD A;  1VF8 A;  2LKN A;  2WK2 A;  4DWS B;  3BMB A;  1EIB A;  3AS2 A;  4Z2J A;  3KAB A;  3AQU A;  3O5P A;  1E6N A;  3AS1 A;  2MLZ A;  4LAY A;  1TCO C;  3ARZ A;  1E15 A;  1WAW A;  2PV1 A;  4DRO A;  3PRA A;  3O5E A;  3ARW A;  3IHZ A;  2KO7 A;  2ITK A;  1HKM A;  2ESC A;  4ODQ A;  4ZPW R;  4Q22 A;  4PTM A;  4P8U A;  1BKF A;  2XPA A;  2DT2 A;  2PPO A;  4DZ3 A;  2RUC A;  1FKB A;  3FY1 A;  2DPE A;  2DT1 A;  4R0X A;  1H0I A;  1D7I A;  4W9O A;  4QT2 A;  5GQB A;  2Y78 A;  2XPB A;  1HKJ A;  4DRM A;  2PV3 A;  2FDM A;  1B6C A;  1ITX A;  3UI5 A;  4W5U A;  2KGJ A;  4TW7 A;  4JFK A;  3IKD A;  4ZPT R;  2A3A A;  2XP9 A;  3B9A A;  3B7X A;  1NWS A;  3B8S A;  5DIT A;  3ART A;  2F21 A;  4N19 A;  4DWS A;  4W9P A;  1HJW A;  1W1V A;  1LG2 A;  3O5F A;  3OOB A;  3WD2 A;  1ZBC A;  3WQV A;  4Z2K A;  4DRQ A;  1FFQ A;  2VCD A;  1FKF A;  1D2K A;  1NWR A;  2RSE A;  1UR8 A;  1FKR A;  3ARO A;  1HKI A;  4S3K A;  1UR9 A;  4QT3 A;  1ZK6 A;  1XHG A;  3PRD A;  1ZBV A;  1F8A B;  3ALF A;  3ARS A;  2JZV A;  2G41 A;  2OFN A;  1HJX A;  4DT4 A;  4IQC A;  1JNE A;  3TDB A;  4WIW A;  3W4R A;  1KT1 A;  2ZQS A;  1N1A A;  3RM4 A;  4DWS D;  1T11 A;  3ALG A;  4MNK A;  1BL4 A;  1ZBW A;  2XP7 A;  2F4E A;  3KCE A;  1GRJ A;  4HBE A;  3RM9 A;  2ZQU A;  5HW7 A;  3ARV A;  3WL0 A;  4Z2G A;  4U84 A;  3ARP A;  2DG3 A;  4ODR A;  1Q6H A;  3B9D A;  2PBC A;  3TCZ A;  1J6Y A;  2DSU A;  3CGM A;  3NI6 A;  3PR9 A;  4TW8 A;  3G6M A;  2G8Z A;  3KAF A;  3TC5 A;  4IT4 A;  4MGV A;  2M2A A;  2LJ4 A;  3AS3 A;  4ODL A;  3BXW A;  2XP5 A;  1EDQ A;  3OA5 A;  4U85 A;  1ZU8 A;  4IPX A;  3CHE A;  4QIB A;  1FKD A;  1X6N A;  4U86 A;  3KZ7 A;  2IF4 A;  3WKZ A;  3KAI A;  4HBO A;  1JCH B;  3RME A;  4TW6 A;  4URI A;  2XP3 A;  3WH0 A;  5J6E A;  2D9F A;  2ZR4 A;  3UQI A;  1TFV A;  4WKA A;  1NWU A;  4G50 A;  2UZ5 A;  2KFW A;  4ODO A;  2A3E A;  3UI6 A;  3RGC A;  2VN1 A;  4IT6 A;  2B31 A;  1CTN A;  2AWG A;  1W1T A;  4ODM A;  1U79 A;  2M1I A;  4Z2H A;  4ZS6 A;  3NRK A;  3LUO A;  4MPK A;  2MPH A;  2KI3 A;  1LQ0 A;  1QPL A;  1FKG A;  5DF0 A;  5JH8 A;  1FKS A;  1NH6 A;  1FD9 A;  4WKH A;  1R9H A;  3O5I A;  4ODN A;  4WK9 A;  3RM8 A;  4AY1 A;  2WM0 A;  4FAP A;  5HW8 A;  1F40 A; 
#chains in the Genus database with same CATH homology
 3O5L A;  2M08 A;  3O5K A;  2DT0 A;  1W26 A;  3AS0 A;  1M5Y A;  4FN2 A;  4BF8 A;  4DRK A;  1EQ3 A;  4DRI A;  4DRJ A;  3KAH A;  1W9P A;  3H9R B;  3WD3 A;  3PRB A;  2RUR A;  4MNM A;  3QOK A;  4ODP A;  1Q6U A;  5DO2 A;  3B9E A;  1Q6I A;  2XP6 A;  3WIJ A;  4MNL A;  3JXV A;  3WL1 A;  3KAC A;  4G2P A;  2A3C A;  2LGO A;  4O2T A;  2DSV A;  1FKI A;  1PBK A;  4DRH A;  1JNT A;  4C02 B;  4P8V A;  3WD1 A;  2WLY A;  1LL4 A;  2KR7 A;  5HWB A;  3FAP A;  4Q7N A;  3O5Q A;  4L3N A;  4TNS A;  4JYS A;  1EYM A;  1FKT A;  2DG9 A;  2QF8 A;  4DH0 A;  1NWT A;  1ROU A;  1SR0 A;  2K8I A;  3O5R A;  1XRV A;  4TX0 A;  1FKJ A;  3O5G A;  3O5O A;  4DWS C;  2XP4 A;  5HW6 A;  2XP8 A;  3RFW A;  4JFI A;  2PPP A;  2RUQ A;  2MLX A;  1E6P A;  2ZQV A;  1LL6 A;  2LPV A;  4GIV A;  4W9Q A;  1W9V A;  1Y0O A;  4DRP A;  1YW5 A;  5I98 A;  1C9H A;  2O9O A;  1O6I A;  3WD0 A;  2DT3 A;  3CZ8 A;  5B8I C;  1Q1C A;  3O5J A;  2Q5A A;  5HBF A;  4NNR A;  2ZR6 A;  5GPR A;  5BXJ A;  3MDY B;  1JNS A;  4LGX A;  4S3J A;  4KR0 B;  3WQW A;  2N87 A;  3ARU A;  4ODK A;  4Z2L A;  1QZ2 A;  2IUZ A;  4LAV A;  1LJY A;  2DSW A;  5DIU A;  1FFR A;  4Z2I A;  5D75 A;  1SYT A;  1HJV A;  3WD4 A;  1HKK A;  5GPG A;  1K9T A;  3JYJ A;  5HKG A;  5DEZ A;  1W1P A;  4JFL A;  1HXV A;  1A7X A;  4MSP A;  4MTV A;  2ZR5 A;  2PV2 A;  3KAG A;  5HUA A;  3EY6 A;  3G6L A;  1LG1 A;  3NTP A;  3UQA A;  1NMW A;  2FKE A;  4NSB A;  1L1P A;  4DRN A;  4L72 B;  2PPN A;  4ITZ A;  4DZ2 A;  1FJD A;  3O5D A;  4WKF A;  1J4I A;  1KT0 A;  2DG4 A;  1KFW A;  5HT1 A;  1NMV A;  2L2S A;  4LAW A;  3ARQ A;  3IK8 A;  1OWQ A;  1ROT A;  2MLY A;  4MNJ A;  1LL7 A;  1P5Q A;  1NSG A;  3ARX A;  1OGB A;  2MNT A;  4JFM A;  1X6L A;  1D6O A;  5HWC A;  2YBU A;  4ZPV R;  4DIP A;  2ZQT A;  1QPF A;  1ZBK A;  3UF8 A;  1GUV A;  4HAR A;  1WB0 A;  3I6C A;  1JND A;  3FXY A;  1J4H A;  4P8X A;  3GPK A;  3UI4 A;  1FAP A;  4ML4 A;  1GPF A;  3CGN A;  4KQZ A;  1FKK A;  1RD6 A;  4QZV B;  1ZCN A;  1J4R A;  1E6Z A;  1E6R A;  3CHF A;  1FKH A;  1ZB5 A;  2MF9 A;  3IKG A;  1YAT A;  4R5E A;  2YBT A;  3CH9 A;  2FAP A;  1WNO A;  2PI6 A;  4GGQ A;  2DSZ A;  3JYM A;  1W1Y A;  3ODK A;  1JVW A;  4LAX A;  1W9U A;  3O5M A;  1FKL A;  1E9L A;  2AOS A;  4JFJ A;  2A3B A;  3VAW A;  1IX5 A;  3ARY A;  4IQ2 A;  1GOI A;  1PIN A;  1H0G A;  1EHN A;  2O92 A;  2RUD A;  2WLZ A;  4WJX A;  1ZL1 A;  4XAK A;  1OGG A;  3CHD A;  2RQS A;  3UQB A;  4P8W A;  1D7H A;  3CHC A;  4NZC A;  3PA7 A;  2F2D A;  2OLH A;  4J4O A;  4TYO A;  5HTG A;  1D7J A;  4MAV A;  2KE0 A;  3ARR A;  4J4N A;  5DIV A;  3KAD A;  1VF8 A;  2LKN A;  2WK2 A;  4DWS B;  1EIB A;  3AS2 A;  4Z2J A;  3KAB A;  3AQU A;  3O5P A;  1E6N A;  3AS1 A;  2MLZ A;  4LAY A;  1TCO C;  3ARZ A;  1E15 A;  1WAW A;  2PV1 A;  4DRO A;  3PRA A;  3O5E A;  3ARW A;  3IHZ A;  2KO7 A;  2ITK A;  1HKM A;  2ESC A;  4ODQ A;  4ZPW R;  4Q22 A;  4PTM A;  4P8U A;  1BKF A;  2XPA A;  2DT2 A;  2PPO A;  4DZ3 A;  2RUC A;  1FKB A;  3FY1 A;  2DPE A;  2DT1 A;  4R0X A;  1H0I A;  1D7I A;  4W9O A;  4QT2 A;  5GQB A;  2Y78 A;  2XPB A;  1HKJ A;  4DRM A;  2PV3 A;  2FDM A;  1B6C A;  1ITX A;  3UI5 A;  4W5U A;  2KGJ A;  4TW7 A;  4JFK A;  3IKD A;  4ZPT R;  2A3A A;  2XP9 A;  3B9A A;  3B7X A;  1NWS A;  3B8S A;  5DIT A;  3ART A;  2F21 A;  4N19 A;  4DWS A;  4W9P A;  1HJW A;  1W1V A;  1LG2 A;  3O5F A;  3OOB A;  3WD2 A;  1ZBC A;  3WQV A;  4Z2K A;  4DRQ A;  1FFQ A;  2VCD A;  1FKF A;  1D2K A;  1NWR A;  2RSE A;  1UR8 A;  1FKR A;  3ARO A;  1HKI A;  4S3K A;  1UR9 A;  4QT3 A;  1ZK6 A;  1XHG A;  3PRD A;  1ZBV A;  1F8A B;  3ALF A;  3ARS A;  2JZV A;  2G41 A;  2OFN A;  1HJX A;  4DT4 A;  4IQC A;  1JNE A;  3TDB A;  4WIW A;  3W4R A;  1KT1 A;  2ZQS A;  1N1A A;  3RM4 A;  4DWS D;  1T11 A;  3ALG A;  4MNK A;  1BL4 A;  1ZBW A;  2XP7 A;  2F4E A;  3KCE A;  3RM9 A;  4HBE A;  2ZQU A;  5HW7 A;  3ARV A;  3WL0 A;  4Z2G A;  4U84 A;  3ARP A;  2DG3 A;  4ODR A;  1Q6H A;  3B9D A;  2PBC A;  3TCZ A;  1J6Y A;  2DSU A;  3CGM A;  3NI6 A;  3PR9 A;  4TW8 A;  3G6M A;  2G8Z A;  3KAF A;  3TC5 A;  4IT4 A;  4MGV A;  2M2A A;  2LJ4 A;  3AS3 A;  4ODL A;  3BXW A;  2XP5 A;  1EDQ A;  3OA5 A;  4U85 A;  1ZU8 A;  4IPX A;  3CHE A;  4QIB A;  1FKD A;  1X6N A;  4U86 A;  3KZ7 A;  2IF4 A;  3WKZ A;  3KAI A;  4HBO A;  3RME A;  4TW6 A;  4URI A;  2XP3 A;  3WH0 A;  5J6E A;  2D9F A;  2ZR4 A;  3UQI A;  1TFV A;  4WKA A;  1NWU A;  4G50 A;  2UZ5 A;  2KFW A;  4ODO A;  2A3E A;  3UI6 A;  3RGC A;  2VN1 A;  4IT6 A;  2B31 A;  1CTN A;  2AWG A;  1W1T A;  4ODM A;  1U79 A;  2M1I A;  4Z2H A;  4ZS6 A;  3NRK A;  3LUO A;  4MPK A;  2MPH A;  2KI3 A;  1LQ0 A;  1QPL A;  1FKG A;  5DF0 A;  5JH8 A;  1FKS A;  1NH6 A;  1FD9 A;  4WKH A;  1R9H A;  3O5I A;  4ODN A;  4WK9 A;  3RM8 A;  4AY1 A;  2WM0 A;  4FAP A;  5HW8 A;  1F40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...