5HT1A

Structure of apo c. glabrata fkbp12
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
AMSETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
total genus 24
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ht1A00
2UZ5A 3O5QA 2XPBA 1Q6UA 4IQCA 5DITA 4DRJA 1F8AB 1B6CA 1PINA 2RUCA 2LPVA 1JNSA 4LAXA 2PV2A 5DIUA 3FAPA 2VN1A 2ZQTA 1N1AA 3O5KA 3UQAA 5HTGA 1W26A 3WH0A 2RQSA 1L1PA 3CGNA 4TW7A 1NMVA 2XPAA 4ODOA 4TX0A 5HT1A 1HXVA 3RGCA 3KACA 4TW8A 3H9RB 3GPKA 2LGOA 1BKFA 1FKLA 2XP6A 4J4OA 4QT3A 4DRPA 3NRKA 1J4IA 4U86A 3TDBA 3I6CA 2FAPA 3O5JA 3KAHA 1EYMA 2RSEA 2Y78A 2RURA 3KZ7A 3PRDA 3O5OA 1FKRA 3O5LA 3RFWA 2M2AA 2N87A 2XP7A 4ODPA 4DZ2A 1YW5A 3IHZA 2ZR6A 3UF8A 4QT2A 4W9PA 3KADA 5I98A 4W9QA 1YATA 2ITKA 2PPOA 1FAPA 4ODKA 3JYJA 2L2SA 4JFMA 2IF4A 1J4HA 3MDYB 2VCDA 3KCEA 1J4RA 1FKGA 2F21A 2KO7A 3VAWA 5HW8A 1A7XA 2MLZA 4DZ3A 2ZR5A 4LAYA 5HW7A 4BF8A 3UI4A 2M08A 1Y0OA 1NMWA 1FD9A 3KAFA 5HUAA 2PPPA 4DT4A 2RUQA 4LAWA 5D75A 1F40A 4R0XA 4IPXA 4ODMA 1FKIA 2K8IA 2Q5AA 3UQIA 1QPLA 4JFLA 2PPNA 4DRIA 1FKHA 3PRBA 1FKTA 4IQ2A 5B8IC 1ZCNA 1EQ3A 5HWCA 3O5FA 4DRKA 2ZQUA 2RUDA 2XP3A 3IKGA 5HKGA 4G2PA 2ZQSA 1Q6IA 1QZ2A 1J6YA 1FKBA 3CGMA 1QPFA 3B7XA 3KAIA 2OFNA 1FKFA 3O5GA 2LKNA 3O5EA 4QIBA 4JFIA 2DG3A 5HW6A 1JVWA 4MSPA 3UI6A 2M1IA 4DRQA 5BXJA 4JYSA 1FKKA 1ZK6A 4ODQA 1KT1A 4LAVA 3ODKA 2DG4A 1BL4A 3UI5A 1M5YA 1D7IA 3IK8A 2KI3A 3O5MA 4TYOA 4JFJA 4DRMA 3JYMA 1FKDA 3PA7A 1ROTA 2AWGA 3NTPA 4TW6A 2KFWA 4U84A 5J6EA 2PV3A 4JFKA 4J4NA 3O5IA 1ROUA 3JXVA 3OOBA 1D7JA 3KABA 1P5QA 1FKJA 3KAGA 5GPGA 3EY6A 4DRNA 2KGJA 4MGVA 3LUOA 2KE0A 1TCOC 2MLYA 2XP5A 1FKSA 3O5RA 4FN2A 4NNRA 2MF9A 4ODLA 4TNSA 4DIPA 1Q6HA 1FJDA 3TC5A 1U79A 4G50A 1KT0A 2PV1A 2XP9A 2ZR4A 3O5PA 2ZQVA 4ITZA 3O5DA 4N19A 3TCZA 2F2DA 4GIVA 2XP8A 4W9OA 4GGQA 5DIVA 1R9HA 4U85A 2PBCA 4DROA 3IKDA 4ODRA 4DH0A 1T11A 1D7HA 1C9HA 1Q1CA 5HWBA 2DG9A 4ODNA 2MPHA 3UQBA 2D9FA 4C02B 2JZVA 1JNTA 4O2TA 2KR7A 1PBKA 2F4EA 4FAPA 1D6OA 2MNTA 2FKEA 2MLXA 2LJ4A 1NSGA 2XP4A 4DRHA 3NI6A
chains in the Genus database with same CATH superfamily
3B8SA 1CTNA 1LL6A 1D2KA 2VN1A 3UQAA 1W26A 3OA5A 1E6NA 3WH0A 3AS0A 4PTMA 4TX0A 3ALFA 3FY1A 4S3JA 1H0IA 4DWSA 4TW8A 1BKFA 4QT3A 1UR9A 3NRKA 3CHEA 2FAPA 2Y78A 1FKRA 3O5LA 4MTVA 2M2AA 2N87A 4DWSD 2XP7A 4DZ2A 1JNDA 3UF8A 3KADA 4ZPWR 1HKJA 2L2SA 2QF8A 3GU0A 5JH8A 2VCDA 1J4RA 3RM4A 4P8XA 2G41A 2IUZA 1Y0OA 3KAFA 1F40A 4ODMA 1TFVA 2WLYA 2B31A 2Q5AA 1FFRA 3ARRA 1RD6A 1O6IA 1OGGA 1ZCNA 4HARA 1EQ3A 1VF8A 4MNJA 2RUDA 3IKGA 1LG2A 1Q6IA 1FKBA 4WK9A 4W5UA 2DSVA 1ZBCA 3W4RA 3WD2A 3CZ8A 3PR9A 5DEZA 2YBTA 5BXJA 1SYTA 4ODQA 1ZL1A 1E6RA 4LAVA 3ODKA 2DG4A 3UI5A 1D7IA 4ZS6A 3JYMA 3PA7A 3WL0A 2PV3A 3AROA 4J4NA 3O5IA 3OOBA 3KABA 1ZB5A 3EY6A 4DRNA 2KGJA 1TCOC 4ODLA 4TNSA 5GQBA 2G8ZA 3TCZA 3O5DA 2F2DA 4Z2IA 4UDMA 4ODRA 1T11A 1Q1CA 1IX5A 2DG9A 2JZVA 2KR7A 2F4EA 1D6OA 1KFWA 2MNTA 2MLXA 2WM0A 4Q22A 1Q6UA 5DITA 1F8AB 1B6CA 2RUCA 4LAXA 5DIUA 1X6LA 2ZQTA 3G6LA 1L1PA 1WAWA 1HKKA 1NMVA 2XPAA 3CH9A 4ODOA 5HT1A 4WJXA 4AY1A 4MNKA 3H9RB 4J4OA 1J4IA 4QZVB 3PRDA 3O5OA 4Z2HA 3RFWA 3AQUA 4MAVA 1YW5A 4QT2A 5I98A 1JCHB 1ZBVA 3JYJA 2ESCA 2OLHA 4WIWA 2IF4A 3AS2A 3MDYB 3KCEA 2KO7A 5HW8A 4LAYA 3FXYA 4ZPVR 1NMWA 5HUAA 4DT4A 4WKHA 4LAWA 4R0XA 4MPKA 3CHDA 2PPNA 1ZU8A 4DRIA 4Z2KA 3GTYX 2DT3A 2A3AA 3O5FA 1UR8A 1LQ0A 5HKGA 4G2PA 1HJWA 1QZ2A 1QPFA 3KAIA 3AS1A 2O92A 3ARQA 3O5EA 1NWRA 4QIBA 4JFIA 4XAKA 2F23A 3B9EA 1HKMA 1JVWA 4MSPA 3RM9A 3ARWA 1KT1A 4URIA 5DO2A 1W1TA 3WL1A 3NTPA 4U84A 5J6EA 1EHNA 1LL7A 3B9AA 3JXVA 1NWSA 1FKJA 5GPGA 2DT2A 4MGVA 2MLYA 3WIJA 4BF8A 4DIPA 1FJDA 3QOKA 1FFQA 2XP9A 2DT0A 4ITZA 4L3NA 1ZBWA 1SR0A 4HBOA 4IT6A 4W9OA 3B9DA 1R9HA 4U85A 2PBCA 4DROA 1D7HA 5HWBA 3UQBA 4DWSC 1NH6A 1PBKA 4P8VA 2FKEA 2LJ4A 4Q7NA 2UZ5A 3O5QA 4ZPTR 2A3EA 4IQCA 1JNEA 1JNSA 4P8UA 2WK2A 1W9UA 2PV2A 2PN0A 1N1AA 5HTGA 3RGCA 3PRAA 1WNOA 3GPKA 1W1VA 1E9LA 4U86A 3I6CA 3O5JA 3KAHA 1EYMA 2RSEA 1GPFA 4KR0B 4ODPA 1E6ZA 4W9QA 2EULA 1FAPA 1LL4A 4JFMA 3VAWA 2MLZA 4DZ3A 5HW7A 3UI4A 2M08A 3WQWA 1FD9A 4DWSB 2K8IA 1WB0A 3UQIA 1FKHA 1W1YA 5B8IC 2DSUA 5HWCA 4DRKA 2ZQUA 3ARSA 2ZQSA 3WD0A 3CGMA 5DF0A 3EIPA 1LG1A 1W9PA 2LKNA 1GRJA 3ARYA 4LGXA 2DG3A 2PI6A 1HJVA 5HW6A 1W9VA 3UI6A 4DRQA 2B5UB 4JYSA 1GUVA 1M5YA 2KI3A 3O5MA 4DRMA 4JFJA 4TW6A 1ROTA 4WKAA 2KFWA 4WKFA 4JFKA 1D7JA 3KAGA 1P5QA 3G6MA 1LJYA 4ML4A 1H0GA 4NNRA 2KE0A 4FN2A 3O5RA 1ITXA 1Q6HA 3ARPA 3ALGA 1U79A 4G50A 1E6PA 3O5PA 1GOIA 2ETNA 4HBEA 3ARUA 4GGQA 4DH0A 4Z2GA 1XHGA 1HJXA 4ODNA 2D9FA 4C02B 4O2TA 4FAPA 1X6NA 4MNLA 1EIBA 2XP4A 1NSGA 3ARZA 1HKIA 2XPBA 4IT4A 4DRJA 1PINA 2LPVA 1ZBKA 5GPRA 3FAPA 3O5KA 2RQSA 3CGNA 4TW7A 1HXVA 3KACA 2LGOA 1E44A 1FKLA 2XP6A 4DRPA 3TDBA 3KZ7A 2RURA 3BXWA 3CHFA 2ZR6A 3IHZA 4W9PA 1YATA 2ITKA 2PPOA 4ODKA 4NSBA 2YBUA 1J4HA 1FKGA 2F21A 3WKZA 3WQVA 1A7XA 2ZR5A 4R5EA 2A3CA 1OWQA 2PPPA 2RUQA 5D75A 1NWTA 4IPXA 1FKIA 3WD1A 2WLZA 1QPLA 4JFLA 3BMBA 3PRBA 1FKTA 4IQ2A 4L72B 2XP3A 4Z2LA 3AS3A 4KQZA 1J6YA 3B7XA 2OFNA 1FKFA 3O5GA 2DPEA 4Z2JA 3ARTA 1XRVA 3CHCA 2DSZA 2M1IA 1FKKA 1ZK6A 3RMEA 5HBFA 3WD4A 2O9OA 1BL4A 4NZCA 3IK8A 4TYOA 1FKDA 1W1PA 2AWGA 2AOSA 3RM8A 3TC5A 1ROUA 4P8WA 1NWUA 1K9TA 4MNMA 3LUOA 2XP5A 1FKSA 1OGBA 2MF9A 2DT1A 1EDQA 3ARVA 1KT0A 2PV1A 2ZR4A 4N19A 2ZQVA 2A3BA 3WD3A 4GIVA 4S3KA 2DSWA 2XP8A 2P4VA 5DIVA 3IKDA 3ARXA 1C9HA 2FDMA 2MPHA 1JNTA 1E15A 4DRHA 3NI6A
chains in the Genus database with same CATH topology
3B8SA 1CTNA 1LL6A 1D2KA 2VN1A 3UQAA 1W26A 3OA5A 1E6NA 3WH0A 3AS0A 4PTMA 4TX0A 3ALFA 3FY1A 4S3JA 1H0IA 4DWSA 4TW8A 1BKFA 4QT3A 1UR9A 3NRKA 3CHEA 2FAPA 2Y78A 1FKRA 3O5LA 4MTVA 2M2AA 2N87A 4DWSD 2XP7A 4DZ2A 1JNDA 3UF8A 3KADA 4ZPWR 1HKJA 2L2SA 2QF8A 5JH8A 2VCDA 1J4RA 3RM4A 4P8XA 2G41A 2IUZA 1Y0OA 3KAFA 1F40A 4ODMA 1TFVA 2WLYA 2B31A 2Q5AA 1FFRA 3ARRA 1RD6A 1O6IA 1OGGA 1ZCNA 4HARA 1EQ3A 1VF8A 4MNJA 2RUDA 3IKGA 1LG2A 1Q6IA 1FKBA 4WK9A 4W5UA 2DSVA 1ZBCA 3W4RA 3WD2A 3CZ8A 3PR9A 5DEZA 2YBTA 5BXJA 1SYTA 4ODQA 1ZL1A 1E6RA 4LAVA 3ODKA 2DG4A 3UI5A 1D7IA 4ZS6A 3JYMA 3PA7A 3WL0A 2PV3A 3AROA 4J4NA 3O5IA 3OOBA 3KABA 1ZB5A 3EY6A 4DRNA 2KGJA 1TCOC 4ODLA 4TNSA 5GQBA 2G8ZA 3TCZA 3O5DA 2F2DA 4Z2IA 4ODRA 1T11A 1Q1CA 1IX5A 2DG9A 2JZVA 2KR7A 2F4EA 1D6OA 1KFWA 2MNTA 2MLXA 2WM0A 4Q22A 1Q6UA 5DITA 1F8AB 1B6CA 2RUCA 4LAXA 5DIUA 1X6LA 2ZQTA 3G6LA 1L1PA 1WAWA 1HKKA 1NMVA 2XPAA 3CH9A 4ODOA 5HT1A 4WJXA 4AY1A 4MNKA 3H9RB 4J4OA 1J4IA 4QZVB 3PRDA 3O5OA 4Z2HA 3RFWA 3AQUA 4MAVA 1YW5A 4QT2A 5I98A 1ZBVA 3JYJA 2ESCA 2OLHA 4WIWA 2IF4A 3AS2A 3MDYB 3KCEA 2KO7A 5HW8A 4LAYA 3FXYA 4ZPVR 1NMWA 5HUAA 4DT4A 4WKHA 4LAWA 4R0XA 4MPKA 3CHDA 2PPNA 1ZU8A 4DRIA 4Z2KA 2DT3A 2A3AA 3O5FA 1UR8A 1LQ0A 5HKGA 4G2PA 1HJWA 1QZ2A 1QPFA 3KAIA 3AS1A 2O92A 3ARQA 3O5EA 1NWRA 4QIBA 4JFIA 4XAKA 3B9EA 1HKMA 1JVWA 4MSPA 3RM9A 3ARWA 1KT1A 4URIA 5DO2A 1W1TA 3WL1A 3NTPA 4U84A 5J6EA 1EHNA 1LL7A 3B9AA 3JXVA 1NWSA 1FKJA 5GPGA 2DT2A 4MGVA 2MLYA 3WIJA 4BF8A 4DIPA 1FJDA 3QOKA 1FFQA 2XP9A 2DT0A 4ITZA 4L3NA 1ZBWA 1SR0A 4HBOA 4IT6A 4W9OA 3B9DA 1R9HA 4U85A 2PBCA 4DROA 1D7HA 5HWBA 3UQBA 4DWSC 1NH6A 1PBKA 4P8VA 2FKEA 2LJ4A 4Q7NA 2UZ5A 3O5QA 4ZPTR 2A3EA 4IQCA 1JNEA 1JNSA 4P8UA 2WK2A 1W9UA 2PV2A 1N1AA 5HTGA 3RGCA 3PRAA 1WNOA 3GPKA 1W1VA 1E9LA 4U86A 3I6CA 3O5JA 3KAHA 1EYMA 2RSEA 1GPFA 4KR0B 4ODPA 1E6ZA 4W9QA 1FAPA 1LL4A 4JFMA 3VAWA 2MLZA 4DZ3A 5HW7A 3UI4A 2M08A 3WQWA 1FD9A 4DWSB 2K8IA 1WB0A 3UQIA 1FKHA 1W1YA 5B8IC 2DSUA 5HWCA 4DRKA 2ZQUA 3ARSA 2ZQSA 3WD0A 3CGMA 5DF0A 1LG1A 1W9PA 2LKNA 3ARYA 4LGXA 2DG3A 2PI6A 1HJVA 5HW6A 1W9VA 3UI6A 4DRQA 4JYSA 1GUVA 1M5YA 2KI3A 3O5MA 4DRMA 4JFJA 4TW6A 1ROTA 4WKAA 2KFWA 4WKFA 4JFKA 1D7JA 3KAGA 1P5QA 3G6MA 1LJYA 4ML4A 1H0GA 4NNRA 2KE0A 4FN2A 3O5RA 1ITXA 1Q6HA 3ARPA 3ALGA 1U79A 4G50A 1E6PA 3O5PA 1GOIA 4HBEA 3ARUA 4GGQA 4DH0A 4Z2GA 1XHGA 1HJXA 4ODNA 2D9FA 4C02B 4O2TA 4FAPA 1X6NA 4MNLA 1EIBA 2XP4A 1NSGA 3ARZA 1HKIA 2XPBA 4IT4A 4DRJA 1PINA 2LPVA 1ZBKA 5GPRA 3FAPA 3O5KA 2RQSA 3CGNA 4TW7A 1HXVA 3KACA 2LGOA 1FKLA 2XP6A 4DRPA 3TDBA 3KZ7A 2RURA 3BXWA 3CHFA 2ZR6A 3IHZA 4W9PA 1YATA 2ITKA 2PPOA 4ODKA 4NSBA 2YBUA 1J4HA 1FKGA 2F21A 3WKZA 3WQVA 1A7XA 2ZR5A 4R5EA 2A3CA 1OWQA 2PPPA 2RUQA 5D75A 1NWTA 4IPXA 1FKIA 3WD1A 2WLZA 1QPLA 4JFLA 3PRBA 1FKTA 4IQ2A 4L72B 2XP3A 4Z2LA 3AS3A 4KQZA 1J6YA 3B7XA 2OFNA 1FKFA 3O5GA 2DPEA 4Z2JA 3ARTA 1XRVA 3CHCA 2DSZA 2M1IA 1FKKA 1ZK6A 3RMEA 5HBFA 3WD4A 2O9OA 1BL4A 4NZCA 3IK8A 4TYOA 1FKDA 1W1PA 2AWGA 2AOSA 3RM8A 3TC5A 1ROUA 4P8WA 1NWUA 1K9TA 4MNMA 3LUOA 2XP5A 1FKSA 1OGBA 2MF9A 2DT1A 1EDQA 3ARVA 1KT0A 2PV1A 2ZR4A 4N19A 2ZQVA 2A3BA 3WD3A 4GIVA 4S3KA 2DSWA 2XP8A 5DIVA 3IKDA 3ARXA 1C9HA 2FDMA 2MPHA 1JNTA 1E15A 4DRHA 3NI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ5 A;  3O5Q A;  2XPB A;  1Q6U A;  4IQC A;  5DIT A;  4DRJ A;  1F8A B;  1B6C A;  1PIN A;  2RUC A;  2LPV A;  1JNS A;  4LAX A;  2PV2 A;  5DIU A;  3FAP A;  2VN1 A;  2ZQT A;  1N1A A;  3O5K A;  3UQA A;  5HTG A;  1W26 A;  3WH0 A;  2RQS A;  1L1P A;  3CGN A;  4TW7 A;  1NMV A;  2XPA A;  4ODO A;  4TX0 A;  5HT1 A;  1HXV A;  3RGC A;  3KAC A;  4TW8 A;  3H9R B;  3GPK A;  2LGO A;  1BKF A;  1FKL A;  2XP6 A;  4J4O A;  4QT3 A;  4DRP A;  3NRK A;  1J4I A;  4U86 A;  3TDB A;  3I6C A;  2FAP A;  3O5J A;  3KAH A;  1EYM A;  2RSE A;  2Y78 A;  2RUR A;  3KZ7 A;  3PRD A;  3O5O A;  1FKR A;  3O5L A;  3RFW A;  2M2A A;  2N87 A;  2XP7 A;  4ODP A;  4DZ2 A;  1YW5 A;  3IHZ A;  2ZR6 A;  3UF8 A;  4QT2 A;  4W9P A;  3KAD A;  5I98 A;  4W9Q A;  1YAT A;  2ITK A;  2PPO A;  1FAP A;  4ODK A;  3JYJ A;  2L2S A;  4JFM A;  2IF4 A;  1J4H A;  3MDY B;  2VCD A;  3KCE A;  1J4R A;  1FKG A;  2F21 A;  2KO7 A;  3VAW A;  5HW8 A;  1A7X A;  2MLZ A;  4DZ3 A;  2ZR5 A;  4LAY A;  5HW7 A;  4BF8 A;  3UI4 A;  2M08 A;  1Y0O A;  1NMW A;  1FD9 A;  3KAF A;  5HUA A;  2PPP A;  4DT4 A;  2RUQ A;  4LAW A;  5D75 A;  1F40 A;  4R0X A;  4IPX A;  4ODM A;  1FKI A;  2K8I A;  2Q5A A;  3UQI A;  1QPL A;  4JFL A;  2PPN A;  4DRI A;  1FKH A;  3PRB A;  1FKT A;  4IQ2 A;  5B8I C;  1ZCN A;  1EQ3 A;  5HWC A;  3O5F A;  4DRK A;  2ZQU A;  2RUD A;  2XP3 A;  3IKG A;  5HKG A;  4G2P A;  2ZQS A;  1Q6I A;  1QZ2 A;  1J6Y A;  1FKB A;  3CGM A;  1QPF A;  3B7X A;  3KAI A;  2OFN A;  1FKF A;  3O5G A;  2LKN A;  3O5E A;  4QIB A;  4JFI A;  2DG3 A;  5HW6 A;  1JVW A;  4MSP A;  3UI6 A;  2M1I A;  4DRQ A;  5BXJ A;  4JYS A;  1FKK A;  1ZK6 A;  4ODQ A;  1KT1 A;  4LAV A;  3ODK A;  2DG4 A;  1BL4 A;  3UI5 A;  1M5Y A;  1D7I A;  3IK8 A;  2KI3 A;  3O5M A;  4TYO A;  4JFJ A;  4DRM A;  3JYM A;  1FKD A;  3PA7 A;  1ROT A;  2AWG A;  3NTP A;  4TW6 A;  2KFW A;  4U84 A;  5J6E A;  2PV3 A;  4JFK A;  4J4N A;  3O5I A;  1ROU A;  3JXV A;  3OOB A;  1D7J A;  3KAB A;  1P5Q A;  1FKJ A;  3KAG A;  5GPG A;  3EY6 A;  4DRN A;  2KGJ A;  4MGV A;  3LUO A;  2KE0 A;  1TCO C;  2MLY A;  2XP5 A;  1FKS A;  3O5R A;  4FN2 A;  4NNR A;  2MF9 A;  4ODL A;  4TNS A;  4DIP A;  1Q6H A;  1FJD A;  3TC5 A;  1U79 A;  4G50 A;  1KT0 A;  2PV1 A;  2XP9 A;  2ZR4 A;  3O5P A;  2ZQV A;  4ITZ A;  3O5D A;  4N19 A;  3TCZ A;  2F2D A;  4GIV A;  2XP8 A;  4W9O A;  4GGQ A;  5DIV A;  1R9H A;  4U85 A;  2PBC A;  4DRO A;  3IKD A;  4ODR A;  4DH0 A;  1T11 A;  1D7H A;  1C9H A;  1Q1C A;  5HWB A;  2DG9 A;  4ODN A;  2MPH A;  3UQB A;  2D9F A;  4C02 B;  2JZV A;  1JNT A;  4O2T A;  2KR7 A;  1PBK A;  2F4E A;  4FAP A;  1D6O A;  2MNT A;  2FKE A;  2MLX A;  2LJ4 A;  1NSG A;  2XP4 A;  4DRH A;  3NI6 A; 
#chains in the Genus database with same CATH topology
 3B8S A;  1CTN A;  1LL6 A;  1D2K A;  2VN1 A;  3UQA A;  1W26 A;  3OA5 A;  1E6N A;  3WH0 A;  3AS0 A;  4PTM A;  4TX0 A;  3ALF A;  3FY1 A;  4S3J A;  1H0I A;  4DWS A;  4TW8 A;  1BKF A;  4QT3 A;  1UR9 A;  3NRK A;  3CHE A;  2FAP A;  2Y78 A;  1FKR A;  3O5L A;  4MTV A;  2M2A A;  2N87 A;  4DWS D;  2XP7 A;  4DZ2 A;  1JND A;  3UF8 A;  3KAD A;  4ZPW R;  1HKJ A;  2L2S A;  2QF8 A;  3GU0 A;  5JH8 A;  2VCD A;  1J4R A;  3RM4 A;  4P8X A;  2G41 A;  2IUZ A;  1Y0O A;  3KAF A;  1F40 A;  4ODM A;  1TFV A;  2WLY A;  2B31 A;  2Q5A A;  1FFR A;  3ARR A;  1RD6 A;  1O6I A;  1OGG A;  1ZCN A;  4HAR A;  1EQ3 A;  1VF8 A;  4MNJ A;  2RUD A;  3IKG A;  1LG2 A;  1Q6I A;  1FKB A;  4WK9 A;  4W5U A;  2DSV A;  1ZBC A;  3W4R A;  3WD2 A;  3CZ8 A;  3PR9 A;  5DEZ A;  2YBT A;  5BXJ A;  1SYT A;  4ODQ A;  1ZL1 A;  1E6R A;  4LAV A;  3ODK A;  2DG4 A;  3UI5 A;  1D7I A;  4ZS6 A;  3JYM A;  3PA7 A;  3WL0 A;  2PV3 A;  3ARO A;  4J4N A;  3O5I A;  3OOB A;  3KAB A;  1ZB5 A;  3EY6 A;  4DRN A;  2KGJ A;  1TCO C;  4ODL A;  4TNS A;  5GQB A;  2G8Z A;  3TCZ A;  3O5D A;  2F2D A;  4Z2I A;  4UDM A;  4ODR A;  1T11 A;  1Q1C A;  1IX5 A;  2DG9 A;  2JZV A;  2KR7 A;  2F4E A;  1D6O A;  1KFW A;  2MNT A;  2MLX A;  2WM0 A;  4Q22 A;  1Q6U A;  5DIT A;  1F8A B;  1B6C A;  2RUC A;  4LAX A;  5DIU A;  1X6L A;  2ZQT A;  3G6L A;  1L1P A;  1WAW A;  1HKK A;  1NMV A;  2XPA A;  3CH9 A;  4ODO A;  5HT1 A;  4WJX A;  4AY1 A;  4MNK A;  3H9R B;  4J4O A;  1J4I A;  4QZV B;  3PRD A;  3O5O A;  4Z2H A;  3RFW A;  3AQU A;  4MAV A;  1YW5 A;  4QT2 A;  5I98 A;  1JCH B;  1ZBV A;  3JYJ A;  2ESC A;  2OLH A;  4WIW A;  2IF4 A;  3AS2 A;  3MDY B;  3KCE A;  2KO7 A;  5HW8 A;  4LAY A;  3FXY A;  4ZPV R;  1NMW A;  5HUA A;  4DT4 A;  4WKH A;  4LAW A;  4R0X A;  4MPK A;  3CHD A;  2PPN A;  1ZU8 A;  4DRI A;  4Z2K A;  3GTY X;  2DT3 A;  2A3A A;  3O5F A;  1UR8 A;  1LQ0 A;  5HKG A;  4G2P A;  1HJW A;  1QZ2 A;  1QPF A;  3KAI A;  3AS1 A;  2O92 A;  3ARQ A;  3O5E A;  1NWR A;  4QIB A;  4JFI A;  4XAK A;  2F23 A;  3B9E A;  1HKM A;  1JVW A;  4MSP A;  3RM9 A;  3ARW A;  1KT1 A;  4URI A;  5DO2 A;  1W1T A;  3WL1 A;  3NTP A;  4U84 A;  5J6E A;  1EHN A;  1LL7 A;  3B9A A;  3JXV A;  1NWS A;  1FKJ A;  5GPG A;  2DT2 A;  4MGV A;  2MLY A;  3WIJ A;  4BF8 A;  4DIP A;  1FJD A;  3QOK A;  1FFQ A;  2XP9 A;  2DT0 A;  4ITZ A;  4L3N A;  1ZBW A;  1SR0 A;  4HBO A;  4IT6 A;  4W9O A;  3B9D A;  1R9H A;  4U85 A;  2PBC A;  4DRO A;  1D7H A;  5HWB A;  3UQB A;  4DWS C;  1NH6 A;  1PBK A;  4P8V A;  2FKE A;  2LJ4 A;  4Q7N A;  2UZ5 A;  3O5Q A;  4ZPT R;  2A3E A;  4IQC A;  1JNE A;  1JNS A;  4P8U A;  2WK2 A;  1W9U A;  2PV2 A;  2PN0 A;  1N1A A;  5HTG A;  3RGC A;  3PRA A;  1WNO A;  3GPK A;  1W1V A;  1E9L A;  4U86 A;  3I6C A;  3O5J A;  3KAH A;  1EYM A;  2RSE A;  1GPF A;  4KR0 B;  4ODP A;  1E6Z A;  4W9Q A;  2EUL A;  1FAP A;  1LL4 A;  4JFM A;  3VAW A;  2MLZ A;  4DZ3 A;  5HW7 A;  3UI4 A;  2M08 A;  3WQW A;  1FD9 A;  4DWS B;  2K8I A;  1WB0 A;  3UQI A;  1FKH A;  1W1Y A;  5B8I C;  2DSU A;  5HWC A;  4DRK A;  2ZQU A;  3ARS A;  2ZQS A;  3WD0 A;  3CGM A;  5DF0 A;  3EIP A;  1LG1 A;  1W9P A;  2LKN A;  1GRJ A;  3ARY A;  4LGX A;  2DG3 A;  2PI6 A;  1HJV A;  5HW6 A;  1W9V A;  3UI6 A;  4DRQ A;  2B5U B;  4JYS A;  1GUV A;  1M5Y A;  2KI3 A;  3O5M A;  4DRM A;  4JFJ A;  4TW6 A;  1ROT A;  4WKA A;  2KFW A;  4WKF A;  4JFK A;  1D7J A;  3KAG A;  1P5Q A;  3G6M A;  1LJY A;  4ML4 A;  1H0G A;  4NNR A;  2KE0 A;  4FN2 A;  3O5R A;  1ITX A;  1Q6H A;  3ARP A;  3ALG A;  1U79 A;  4G50 A;  1E6P A;  3O5P A;  1GOI A;  2ETN A;  4HBE A;  3ARU A;  4GGQ A;  4DH0 A;  4Z2G A;  1XHG A;  1HJX A;  4ODN A;  2D9F A;  4C02 B;  4O2T A;  4FAP A;  1X6N A;  4MNL A;  1EIB A;  2XP4 A;  1NSG A;  3ARZ A;  1HKI A;  2XPB A;  4IT4 A;  4DRJ A;  1PIN A;  2LPV A;  1ZBK A;  5GPR A;  3FAP A;  3O5K A;  2RQS A;  3CGN A;  4TW7 A;  1HXV A;  3KAC A;  2LGO A;  1E44 A;  1FKL A;  2XP6 A;  4DRP A;  3TDB A;  3KZ7 A;  2RUR A;  3BXW A;  3CHF A;  2ZR6 A;  3IHZ A;  4W9P A;  1YAT A;  2ITK A;  2PPO A;  4ODK A;  4NSB A;  2YBU A;  1J4H A;  1FKG A;  2F21 A;  3WKZ A;  3WQV A;  1A7X A;  2ZR5 A;  4R5E A;  2A3C A;  1OWQ A;  2PPP A;  2RUQ A;  5D75 A;  1NWT A;  4IPX A;  1FKI A;  3WD1 A;  2WLZ A;  1QPL A;  4JFL A;  3BMB A;  3PRB A;  1FKT A;  4IQ2 A;  4L72 B;  2XP3 A;  4Z2L A;  3AS3 A;  4KQZ A;  1J6Y A;  3B7X A;  2OFN A;  1FKF A;  3O5G A;  2DPE A;  4Z2J A;  3ART A;  1XRV A;  3CHC A;  2DSZ A;  2M1I A;  1FKK A;  1ZK6 A;  3RME A;  5HBF A;  3WD4 A;  2O9O A;  1BL4 A;  4NZC A;  3IK8 A;  4TYO A;  1FKD A;  1W1P A;  2AWG A;  2AOS A;  3RM8 A;  3TC5 A;  1ROU A;  4P8W A;  1NWU A;  1K9T A;  4MNM A;  3LUO A;  2XP5 A;  1FKS A;  1OGB A;  2MF9 A;  2DT1 A;  1EDQ A;  3ARV A;  1KT0 A;  2PV1 A;  2ZR4 A;  4N19 A;  2ZQV A;  2A3B A;  3WD3 A;  4GIV A;  4S3K A;  2DSW A;  2XP8 A;  2P4V A;  5DIV A;  3IKD A;  3ARX A;  1C9H A;  2FDM A;  2MPH A;  1JNT A;  1E15 A;  4DRH A;  3NI6 A; 
#chains in the Genus database with same CATH homology
 3B8S A;  1CTN A;  1LL6 A;  1D2K A;  2VN1 A;  3UQA A;  1W26 A;  3OA5 A;  1E6N A;  3WH0 A;  3AS0 A;  4PTM A;  4TX0 A;  3ALF A;  3FY1 A;  4S3J A;  1H0I A;  4DWS A;  4TW8 A;  1BKF A;  4QT3 A;  1UR9 A;  3NRK A;  3CHE A;  2FAP A;  2Y78 A;  1FKR A;  3O5L A;  4MTV A;  2M2A A;  2N87 A;  4DWS D;  2XP7 A;  4DZ2 A;  1JND A;  3UF8 A;  3KAD A;  4ZPW R;  1HKJ A;  2L2S A;  2QF8 A;  5JH8 A;  2VCD A;  1J4R A;  3RM4 A;  4P8X A;  2G41 A;  2IUZ A;  1Y0O A;  3KAF A;  1F40 A;  4ODM A;  1TFV A;  2WLY A;  2B31 A;  2Q5A A;  1FFR A;  3ARR A;  1RD6 A;  1O6I A;  1OGG A;  1ZCN A;  4HAR A;  1EQ3 A;  1VF8 A;  4MNJ A;  2RUD A;  3IKG A;  1LG2 A;  1Q6I A;  1FKB A;  4WK9 A;  4W5U A;  2DSV A;  1ZBC A;  3W4R A;  3WD2 A;  3CZ8 A;  3PR9 A;  5DEZ A;  2YBT A;  5BXJ A;  1SYT A;  4ODQ A;  1ZL1 A;  1E6R A;  4LAV A;  3ODK A;  2DG4 A;  3UI5 A;  1D7I A;  4ZS6 A;  3JYM A;  3PA7 A;  3WL0 A;  2PV3 A;  3ARO A;  4J4N A;  3O5I A;  3OOB A;  3KAB A;  1ZB5 A;  3EY6 A;  4DRN A;  2KGJ A;  1TCO C;  4ODL A;  4TNS A;  5GQB A;  2G8Z A;  3TCZ A;  3O5D A;  2F2D A;  4Z2I A;  4ODR A;  1T11 A;  1Q1C A;  1IX5 A;  2DG9 A;  2JZV A;  2KR7 A;  2F4E A;  1D6O A;  1KFW A;  2MNT A;  2MLX A;  2WM0 A;  4Q22 A;  1Q6U A;  5DIT A;  1F8A B;  1B6C A;  2RUC A;  4LAX A;  5DIU A;  1X6L A;  2ZQT A;  3G6L A;  1L1P A;  1WAW A;  1HKK A;  1NMV A;  2XPA A;  3CH9 A;  4ODO A;  5HT1 A;  4WJX A;  4AY1 A;  4MNK A;  3H9R B;  4J4O A;  1J4I A;  4QZV B;  3PRD A;  3O5O A;  4Z2H A;  3RFW A;  3AQU A;  4MAV A;  1YW5 A;  4QT2 A;  5I98 A;  1ZBV A;  3JYJ A;  2ESC A;  2OLH A;  4WIW A;  2IF4 A;  3AS2 A;  3MDY B;  3KCE A;  2KO7 A;  5HW8 A;  4LAY A;  3FXY A;  4ZPV R;  1NMW A;  5HUA A;  4DT4 A;  4WKH A;  4LAW A;  4R0X A;  4MPK A;  3CHD A;  2PPN A;  1ZU8 A;  4DRI A;  4Z2K A;  2DT3 A;  2A3A A;  3O5F A;  1UR8 A;  1LQ0 A;  5HKG A;  4G2P A;  1HJW A;  1QZ2 A;  1QPF A;  3KAI A;  3AS1 A;  2O92 A;  3ARQ A;  3O5E A;  1NWR A;  4QIB A;  4JFI A;  4XAK A;  3B9E A;  1HKM A;  1JVW A;  4MSP A;  3RM9 A;  3ARW A;  1KT1 A;  4URI A;  5DO2 A;  1W1T A;  3WL1 A;  3NTP A;  4U84 A;  5J6E A;  1EHN A;  1LL7 A;  3B9A A;  3JXV A;  1NWS A;  1FKJ A;  5GPG A;  2DT2 A;  4MGV A;  2MLY A;  3WIJ A;  4BF8 A;  4DIP A;  1FJD A;  3QOK A;  1FFQ A;  2XP9 A;  2DT0 A;  4ITZ A;  4L3N A;  1ZBW A;  1SR0 A;  4HBO A;  4IT6 A;  4W9O A;  3B9D A;  1R9H A;  4U85 A;  2PBC A;  4DRO A;  1D7H A;  5HWB A;  3UQB A;  4DWS C;  1NH6 A;  1PBK A;  4P8V A;  2FKE A;  2LJ4 A;  4Q7N A;  2UZ5 A;  3O5Q A;  4ZPT R;  2A3E A;  4IQC A;  1JNE A;  1JNS A;  4P8U A;  2WK2 A;  1W9U A;  2PV2 A;  1N1A A;  5HTG A;  3RGC A;  3PRA A;  1WNO A;  3GPK A;  1W1V A;  1E9L A;  4U86 A;  3I6C A;  3O5J A;  3KAH A;  1EYM A;  2RSE A;  1GPF A;  4KR0 B;  4ODP A;  1E6Z A;  4W9Q A;  1FAP A;  1LL4 A;  4JFM A;  3VAW A;  2MLZ A;  4DZ3 A;  5HW7 A;  3UI4 A;  2M08 A;  3WQW A;  1FD9 A;  4DWS B;  2K8I A;  1WB0 A;  3UQI A;  1FKH A;  1W1Y A;  5B8I C;  2DSU A;  5HWC A;  4DRK A;  2ZQU A;  3ARS A;  2ZQS A;  3WD0 A;  3CGM A;  5DF0 A;  1LG1 A;  1W9P A;  2LKN A;  3ARY A;  4LGX A;  2DG3 A;  2PI6 A;  1HJV A;  5HW6 A;  1W9V A;  3UI6 A;  4DRQ A;  4JYS A;  1GUV A;  1M5Y A;  2KI3 A;  3O5M A;  4DRM A;  4JFJ A;  4TW6 A;  1ROT A;  4WKA A;  2KFW A;  4WKF A;  4JFK A;  1D7J A;  3KAG A;  1P5Q A;  3G6M A;  1LJY A;  4ML4 A;  1H0G A;  4NNR A;  2KE0 A;  4FN2 A;  3O5R A;  1ITX A;  1Q6H A;  3ARP A;  3ALG A;  1U79 A;  4G50 A;  1E6P A;  3O5P A;  1GOI A;  4HBE A;  3ARU A;  4GGQ A;  4DH0 A;  4Z2G A;  1XHG A;  1HJX A;  4ODN A;  2D9F A;  4C02 B;  4O2T A;  4FAP A;  1X6N A;  4MNL A;  1EIB A;  2XP4 A;  1NSG A;  3ARZ A;  1HKI A;  2XPB A;  4IT4 A;  4DRJ A;  1PIN A;  2LPV A;  1ZBK A;  5GPR A;  3FAP A;  3O5K A;  2RQS A;  3CGN A;  4TW7 A;  1HXV A;  3KAC A;  2LGO A;  1FKL A;  2XP6 A;  4DRP A;  3TDB A;  3KZ7 A;  2RUR A;  3BXW A;  3CHF A;  2ZR6 A;  3IHZ A;  4W9P A;  1YAT A;  2ITK A;  2PPO A;  4ODK A;  4NSB A;  2YBU A;  1J4H A;  1FKG A;  2F21 A;  3WKZ A;  3WQV A;  1A7X A;  2ZR5 A;  4R5E A;  2A3C A;  1OWQ A;  2PPP A;  2RUQ A;  5D75 A;  1NWT A;  4IPX A;  1FKI A;  3WD1 A;  2WLZ A;  1QPL A;  4JFL A;  3PRB A;  1FKT A;  4IQ2 A;  4L72 B;  2XP3 A;  4Z2L A;  3AS3 A;  4KQZ A;  1J6Y A;  3B7X A;  2OFN A;  1FKF A;  3O5G A;  2DPE A;  4Z2J A;  3ART A;  1XRV A;  3CHC A;  2DSZ A;  2M1I A;  1FKK A;  1ZK6 A;  3RME A;  5HBF A;  3WD4 A;  2O9O A;  1BL4 A;  4NZC A;  3IK8 A;  4TYO A;  1FKD A;  1W1P A;  2AWG A;  2AOS A;  3RM8 A;  3TC5 A;  1ROU A;  4P8W A;  1NWU A;  1K9T A;  4MNM A;  3LUO A;  2XP5 A;  1FKS A;  1OGB A;  2MF9 A;  2DT1 A;  1EDQ A;  3ARV A;  1KT0 A;  2PV1 A;  2ZR4 A;  4N19 A;  2ZQV A;  2A3B A;  3WD3 A;  4GIV A;  4S3K A;  2DSW A;  2XP8 A;  5DIV A;  3IKD A;  3ARX A;  1C9H A;  2FDM A;  2MPH A;  1JNT A;  1E15 A;  4DRH A;  3NI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...