5HT1A

Structure of apo c. glabrata fkbp12
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
AMSETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida glabrata (strain atcc 2001 / cbs 138 / jcm 3761 / nbrc 0622 / nrrl y-65)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 24
structure length 115
sequence length 115
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ht1A00
3KCEA 1Q6IA 4DRHA 4JYSA 4GGQA 2PV3A 3TDBA 3LUOA 4NNRA 4LAWA 2KGJA 1J6YA 2RUQA 4FAPA 1FKSA 3WH0A 4J4NA 2N87A 4ODNA 4TYOA 4DROA 2XP8A 1F40A 4TW8A 2FKEA 1QZ2A 2D9FA 2DG3A 3EY6A 2RSEA 1D7JA 2KR7A 2XP6A 3H9RB 2MLXA 4TW7A 1FJDA 1C9HA 2MLYA 5BXJA 1L1PA 5I98A 1D7IA 1ZCNA 3TCZA 1JVWA 4G2PA 2JZVA 4LAVA 3NRKA 3KADA 1D7HA 2K8IA 3O5KA 4DRPA 3PRDA 2M08A 3O5FA 2ZQVA 3KAHA 5HWCA 1FKIA 2AWGA 4LAXA 2ZR4A 1FD9A 4MSPA 5HT1A 5HW6A 2RURA 4IQCA 5HWBA 4QIBA 3O5RA 1JNTA 4ITZA 1HXVA 2DG4A 1FKJA 2XPBA 2F4EA 3IKDA 2F21A 2KFWA 2PPOA 1W26A 4C02B 4IQ2A 1QPFA 4N19A 4FN2A 2XP7A 2MNTA 5HTGA 1D6OA 3O5GA 1EYMA 1ZK6A 3O5MA 4ODOA 1R9HA 4JFKA 3CGMA 1FKDA 2RUCA 4DRQA 4QT3A 3UF8A 4JFJA 4ODMA 2OFNA 1PBKA 3JYJA 3O5QA 2VCDA 4G50A 2UZ5A 1N1AA 2KO7A 2MF9A 4QT2A 3VAWA 1BKFA 2ZQUA 3KAFA 2ZR6A 3MDYB 3UI4A 5HW7A 2MLZA 4DRMA 2LJ4A 1PINA 5J6EA 3IKGA 1TCOC 1Q1CA 1YATA 1A7XA 4ODKA 3RGCA 3GPKA 4DT4A 1FKFA 5DIVA 4DRKA 4ODQA 3RFWA 3NTPA 1ROUA 4ODPA 4TX0A 1U79A 2M1IA 2XP4A 4ODLA 3UQBA 1FKKA 2PV2A 4MGVA 2XP3A 4TNSA 1Q6UA 4TW6A 3KACA 2XP9A 1M5YA 1FKLA 5GPGA 3I6CA 3O5IA 2LKNA 1J4HA 2Q5AA 3KAIA 3OOBA 5B8IC 2PV1A 2XPAA 3UQAA 3O5PA 2RUDA 2PBCA 4DZ3A 1FKBA 4LAYA 4DRNA 1Y0OA 1ROTA 3CGNA 3O5LA 1NMWA 2KE0A 2Y78A 3O5JA 1FAPA 4DRJA 4ODRA 1KT0A 5D75A 2XP5A 4GIVA 5HKGA 1YW5A 2PPNA 2VN1A 2DG9A 1FKTA 2ZR5A 1J4RA 3IHZA 3B7XA 4U84A 1JNSA 3PRBA 4O2TA 2L2SA 4DIPA 4JFIA 1QPLA 4W9PA 2LPVA 2ZQSA 1Q6HA 3NI6A 1FKRA 1T11A 3ODKA 4W9QA 2FAPA 2KI3A 3JYMA 3UI5A 1B6CA 2ITKA 2M2AA 1KT1A 3O5OA 2RQSA 3PA7A 4JFLA 4DH0A 4W9OA 1FKGA 4J4OA 3JXVA 2PPPA 2IF4A 2ZQTA 5DITA 4DZ2A 5HUAA 1BL4A 1P5QA 3UQIA 1NSGA 3KABA 4U86A 4JFMA 3FAPA 1FKHA 2LGOA 3KAGA 3O5DA 4IPXA 5HW8A 4BF8A 1EQ3A 3KZ7A 4U85A 3IK8A 4DRIA 2F2DA 1J4IA 1NMVA 3UI6A 4R0XA 1F8AB 5DIUA 3TC5A 2MPHA 3O5EA
chains in the Genus database with same CATH superfamily
1W1YA 5GQBA 4HBOA 4NNRA 3WH0A 3ARTA 2N87A 4TYOA 4TW8A 2FKEA 3EY6A 3H9RB 2KR7A 1HJWA 1SR0A 1C9HA 2MLYA 5BXJA 1L1PA 1D7IA 3KADA 1NWSA 2K8IA 3O5KA 1H0GA 3PRDA 4URIA 4LAXA 2ZR4A 3WD1A 4MSPA 5HW6A 5HWBA 3O5RA 1HXVA 1FKJA 3WD0A 3IKDA 1W26A 4C02B 1E15A 1X6LA 5DO2A 4JFKA 4WKFA 1FKDA 1JNEA 4JFJA 3JYJA 2KO7A 3VAWA 3UI4A 2LJ4A 5J6EA 4ODKA 1YATA 3RGCA 1ZB5A 1FKFA 3RFWA 3B9DA 5DEZA 1U79A 2M1IA 4WIWA 5B8IC 3UQAA 2XPAA 2RUDA 4DWSD 3AQUA 1FKBA 4LAYA 1Y0OA 1W9UA 1W1PA 1NWRA 1RD6A 3CH9A 5HKGA 1EIBA 2VN1A 2DG9A 2WLYA 3B8SA 4U84A 1JNSA 3PRBA 4Z2IA 4MNLA 4W9PA 1K9TA 4L3NA 4MAVA 1B6CA 2RQSA 3ARPA 4JFLA 1FKGA 5HUAA 2ZQTA 1BL4A 2B5UB 3UQIA 1NSGA 3KABA 4MPKA 1WAWA 4IPXA 3KAGA 3O5DA 2DSWA 3ALGA 4BF8A 2WM0A 1UR9A 3KZ7A 2F2DA 3UI6A 3CHFA 3FY1A 1E6NA 4JYSA 1LL7A 4MTVA 4XAKA 3LUOA 4DWSC 2KGJA 4DROA 2FDMA 1F40A 1GUVA 1QZ2A 1XHGA 2D9FA 1D7JA 1LL4A 4TW7A 4Z2HA 1FJDA 1HKJA 2OLHA 1ZCNA 1JVWA 4LAVA 2JZVA 4P8VA 4ZPWR 4DRPA 5HWCA 2PI6A 1FKIA 4QZVB 2ESCA 4UDMA 1FD9A 3WQWA 2DSVA 1FFQA 2F4EA 2IUZA 1E6PA 2PPOA 4IQ2A 4KR0B 2MNTA 1D6OA 3O5MA 4ODOA 4DRQA 4QT3A 3UF8A 4ODMA 2OFNA 1PBKA 3O5QA 4Z2GA 2VCDA 4QT2A 1BKFA 2MLZA 1ZBKA 1PINA 4Z2LA 1E9LA 2B31A 3IKGA 1TCOC 4DT4A 3ARYA 2YBUA 1ROUA 1HKMA 2PV2A 2PN0A 1E6RA 4DWSA 3KACA 3I6CA 2A3CA 1GPFA 3O5IA 3WKZA 2Q5AA 3KAIA 2PBCA 1HKIA 3QOKA 3CGNA 3AS1A 2Y78A 3O5JA 1FAPA 1FKTA 4PTMA 2L2SA 4JFIA 4W5UA 1SYTA 2DT0A 4Q22A 2ZQSA 1ZBVA 3NI6A 1FKRA 1OWQA 3ODKA 4W9QA 2FAPA 3JYMA 1ITXA 2M2AA 1KT1A 4W9OA 4J4OA 3BXWA 3JXVA 2PPPA 4DWSB 2DT3A 1CTNA 1LL6A 4JFMA 3FAPA 4ZPTR 1FKHA 2LGOA 4ML4A 5HW8A 4DRIA 2ETNA 2WLZA 3KCEA 4DRHA 4GGQA 4LAWA 4WKAA 1ZBCA 4FAPA 3AROA 1FKSA 4P8XA 3WD4A 4P8UA 3AS3A 3WIJA 2XP8A 4ZS6A 2DG3A 3B9AA 2RSEA 1ZBWA 3GU0A 3ALFA 5GPRA 2DSZA 5I98A 3TCZA 4G2PA 3NRKA 1D7HA 1KFWA 1LJYA 1OGGA 3KAHA 5HBFA 4WK9A 5HT1A 4QIBA 1JNTA 2DG4A 3WQVA 2F21A 2A3AA 1QPFA 4N19A 4FN2A 4NSBA 1O6IA 1ZK6A 3ARWA 1R9HA 2RUCA 1X6NA 4G50A 3W4RA 5JH8A 2G8ZA 4DRMA 1GOIA 2O9OA 1H0IA 4WKHA 2A3EA 4WJXA 5DIVA 3NTPA 4S3JA 4IT6A 3UQBA 1OGBA 3CHEA 2XP4A 3ARRA 1FKKA 3RM8A 2XP3A 4TW6A 1W1VA 2XP9A 3OA5A 1FKLA 2LKNA 1WB0A 3PR9A 2PV1A 1ZU8A 3O5LA 2DT2A 2KE0A 3BMBA 3CHCA 4R5EA 4ODRA 3EIPA 2PPNA 2F23A 3CZ8A 2ZR5A 3IHZA 3ARSA 3B7XA 3G6MA 5DF0A 1QPLA 1D2KA 3RM4A 1UR8A 3WL0A 1VF8A 2LPVA 1NWUA 2O92A 2YBTA 2KI3A 3UI5A 2ITKA 3O5OA 4DH0A 4DZ2A 2IF4A 1P5QA 4Z2JA 4U86A 1XRVA 1NWTA 1EDQA 1EQ3A 1J4IA 1NMVA 2MPHA 3O5EA 1Q6IA 3ARQA 2PV3A 3TDBA 3B9EA 1HKKA 1J6YA 2RUQA 1LG2A 4J4NA 4ODNA 1IX5A 1E44A 3ARXA 3AS0A 2XP6A 4MNKA 2MLXA 2P4VA 1LG1A 2M08A 3O5FA 2ZQVA 3WL1A 4AY1A 2AWGA 2DSUA 2A3BA 1LQ0A 2RURA 4IQCA 3ARZA 4ITZA 2XPBA 2KFWA 4LGXA 5HTGA 2XP7A 3RMEA 3O5GA 1EYMA 3CGMA 4ZPVR 1W1TA 2UZ5A 1N1AA 2MF9A 2ZQUA 3KAFA 2ZR6A 1JNDA 3MDYB 5HW7A 1FFRA 1EHNA 1Q1CA 1A7XA 1HJVA 3WD3A 3GPKA 1HJXA 4DRKA 4ODQA 3RM9A 4TX0A 3G6LA 4ODPA 4ODLA 2EULA 4MGVA 4TNSA 3FXYA 1Q6UA 1M5YA 5GPGA 3CHDA 1J4HA 3OOBA 4S3KA 3O5PA 4DZ3A 1E6ZA 3GTYX 4DRNA 1ROTA 2DPEA 2G41A 1NMWA 4IT4A 4Z2KA 1JCHB 4DRJA 1TFVA 1KT0A 5D75A 4HARA 2XP5A 4GIVA 1YW5A 1NH6A 1J4RA 4MNMA 2QF8A 4O2TA 4DIPA 1W9PA 4KQZA 1Q6HA 1T11A 1WNOA 1GRJA 2DT1A 1W9VA 3PA7A 2AOSA 3ARVA 3AS2A 3WD2A 4MNJA 5DITA 4HBEA 4L72B 2WK2A 4P8WA 3IK8A 4U85A 3PRAA 4Q7NA 4R0XA 1F8AB 4NZCA 5DIUA 3TC5A 1ZL1A 3ARUA
chains in the Genus database with same CATH topology
1W1YA 5GQBA 4HBOA 4NNRA 3WH0A 3ARTA 2N87A 4TYOA 4TW8A 2FKEA 3EY6A 3H9RB 2KR7A 1HJWA 1SR0A 1C9HA 2MLYA 5BXJA 1L1PA 1D7IA 3KADA 1NWSA 2K8IA 3O5KA 1H0GA 3PRDA 4URIA 4LAXA 2ZR4A 3WD1A 4MSPA 5HW6A 5HWBA 3O5RA 1HXVA 1FKJA 3WD0A 3IKDA 1W26A 4C02B 1E15A 1X6LA 5DO2A 4JFKA 4WKFA 1FKDA 1JNEA 4JFJA 3JYJA 2KO7A 3VAWA 3UI4A 2LJ4A 5J6EA 4ODKA 1YATA 3RGCA 1ZB5A 1FKFA 3RFWA 3B9DA 5DEZA 1U79A 2M1IA 4WIWA 5B8IC 3UQAA 2XPAA 2RUDA 4DWSD 3AQUA 1FKBA 4LAYA 1Y0OA 1W9UA 1W1PA 1NWRA 1RD6A 3CH9A 5HKGA 1EIBA 2VN1A 2DG9A 2WLYA 3B8SA 4U84A 1JNSA 3PRBA 4Z2IA 4MNLA 4W9PA 1K9TA 4L3NA 4MAVA 1B6CA 2RQSA 3ARPA 4JFLA 1FKGA 5HUAA 2ZQTA 1BL4A 3UQIA 1NSGA 3KABA 4MPKA 1WAWA 4IPXA 3KAGA 3O5DA 2DSWA 3ALGA 4BF8A 2WM0A 1UR9A 3KZ7A 2F2DA 3UI6A 3CHFA 3FY1A 1E6NA 4JYSA 1LL7A 4MTVA 4XAKA 3LUOA 4DWSC 2KGJA 4DROA 2FDMA 1F40A 1GUVA 1QZ2A 1XHGA 2D9FA 1D7JA 1LL4A 4TW7A 4Z2HA 1FJDA 1HKJA 2OLHA 1ZCNA 1JVWA 4LAVA 2JZVA 4P8VA 4ZPWR 4DRPA 5HWCA 2PI6A 1FKIA 4QZVB 2ESCA 1FD9A 3WQWA 2DSVA 1FFQA 2F4EA 2IUZA 1E6PA 2PPOA 4IQ2A 4KR0B 2MNTA 1D6OA 3O5MA 4ODOA 4DRQA 4QT3A 3UF8A 4ODMA 2OFNA 1PBKA 3O5QA 4Z2GA 2VCDA 4QT2A 1BKFA 2MLZA 1ZBKA 1PINA 4Z2LA 1E9LA 2B31A 3IKGA 1TCOC 4DT4A 3ARYA 2YBUA 1ROUA 1HKMA 2PV2A 1E6RA 4DWSA 3KACA 3I6CA 2A3CA 1GPFA 3O5IA 3WKZA 2Q5AA 3KAIA 2PBCA 1HKIA 3QOKA 3CGNA 3AS1A 2Y78A 3O5JA 1FAPA 1FKTA 4PTMA 2L2SA 4JFIA 4W5UA 1SYTA 2DT0A 4Q22A 2ZQSA 1ZBVA 3NI6A 1FKRA 1OWQA 3ODKA 4W9QA 2FAPA 3JYMA 1ITXA 2M2AA 1KT1A 4W9OA 4J4OA 3BXWA 3JXVA 2PPPA 4DWSB 2DT3A 1CTNA 1LL6A 4JFMA 3FAPA 4ZPTR 1FKHA 2LGOA 4ML4A 5HW8A 4DRIA 2WLZA 3KCEA 4DRHA 4GGQA 4LAWA 4WKAA 1ZBCA 4FAPA 3AROA 1FKSA 4P8XA 3WD4A 4P8UA 3AS3A 3WIJA 2XP8A 4ZS6A 2DG3A 3B9AA 2RSEA 1ZBWA 3ALFA 5GPRA 2DSZA 5I98A 3TCZA 4G2PA 3NRKA 1D7HA 1KFWA 1LJYA 1OGGA 3KAHA 5HBFA 4WK9A 5HT1A 4QIBA 1JNTA 2DG4A 3WQVA 2F21A 2A3AA 1QPFA 4N19A 4FN2A 4NSBA 1O6IA 1ZK6A 3ARWA 1R9HA 2RUCA 1X6NA 4G50A 3W4RA 5JH8A 2G8ZA 4DRMA 1GOIA 2O9OA 1H0IA 4WKHA 2A3EA 4WJXA 5DIVA 3NTPA 4S3JA 4IT6A 3UQBA 1OGBA 3CHEA 2XP4A 3ARRA 1FKKA 3RM8A 2XP3A 4TW6A 1W1VA 2XP9A 3OA5A 1FKLA 2LKNA 1WB0A 3PR9A 2PV1A 1ZU8A 3O5LA 2DT2A 2KE0A 3CHCA 4R5EA 4ODRA 2PPNA 3CZ8A 2ZR5A 3IHZA 3ARSA 3B7XA 3G6MA 5DF0A 1QPLA 1D2KA 3RM4A 1UR8A 3WL0A 1VF8A 2LPVA 1NWUA 2O92A 2YBTA 2KI3A 3UI5A 2ITKA 3O5OA 4DH0A 4DZ2A 2IF4A 1P5QA 4Z2JA 4U86A 1XRVA 1NWTA 1EDQA 1EQ3A 1J4IA 1NMVA 2MPHA 3O5EA 1Q6IA 3ARQA 2PV3A 3TDBA 3B9EA 1HKKA 1J6YA 2RUQA 1LG2A 4J4NA 4ODNA 1IX5A 3ARXA 3AS0A 2XP6A 4MNKA 2MLXA 1LG1A 2M08A 3O5FA 2ZQVA 3WL1A 4AY1A 2AWGA 2DSUA 2A3BA 1LQ0A 2RURA 4IQCA 3ARZA 4ITZA 2XPBA 2KFWA 4LGXA 5HTGA 2XP7A 3RMEA 3O5GA 1EYMA 3CGMA 4ZPVR 1W1TA 2UZ5A 1N1AA 2MF9A 2ZQUA 3KAFA 2ZR6A 1JNDA 3MDYB 5HW7A 1FFRA 1EHNA 1Q1CA 1A7XA 1HJVA 3WD3A 3GPKA 1HJXA 4DRKA 4ODQA 3RM9A 4TX0A 3G6LA 4ODPA 4ODLA 4MGVA 4TNSA 3FXYA 1Q6UA 1M5YA 5GPGA 3CHDA 1J4HA 3OOBA 4S3KA 3O5PA 4DZ3A 1E6ZA 4DRNA 1ROTA 2DPEA 2G41A 1NMWA 4IT4A 4Z2KA 4DRJA 1TFVA 1KT0A 5D75A 4HARA 2XP5A 4GIVA 1YW5A 1NH6A 1J4RA 4MNMA 2QF8A 4O2TA 4DIPA 1W9PA 4KQZA 1Q6HA 1T11A 1WNOA 2DT1A 1W9VA 3PA7A 2AOSA 3ARVA 3AS2A 3WD2A 4MNJA 5DITA 4HBEA 4L72B 2WK2A 4P8WA 3IK8A 4U85A 3PRAA 4Q7NA 4R0XA 1F8AB 4NZCA 5DIUA 3TC5A 1ZL1A 3ARUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KCE A;  1Q6I A;  4DRH A;  4JYS A;  4GGQ A;  2PV3 A;  3TDB A;  3LUO A;  4NNR A;  4LAW A;  2KGJ A;  1J6Y A;  2RUQ A;  4FAP A;  1FKS A;  3WH0 A;  4J4N A;  2N87 A;  4ODN A;  4TYO A;  4DRO A;  2XP8 A;  1F40 A;  4TW8 A;  2FKE A;  1QZ2 A;  2D9F A;  2DG3 A;  3EY6 A;  2RSE A;  1D7J A;  2KR7 A;  2XP6 A;  3H9R B;  2MLX A;  4TW7 A;  1FJD A;  1C9H A;  2MLY A;  5BXJ A;  1L1P A;  5I98 A;  1D7I A;  1ZCN A;  3TCZ A;  1JVW A;  4G2P A;  2JZV A;  4LAV A;  3NRK A;  3KAD A;  1D7H A;  2K8I A;  3O5K A;  4DRP A;  3PRD A;  2M08 A;  3O5F A;  2ZQV A;  3KAH A;  5HWC A;  1FKI A;  2AWG A;  4LAX A;  2ZR4 A;  1FD9 A;  4MSP A;  5HT1 A;  5HW6 A;  2RUR A;  4IQC A;  5HWB A;  4QIB A;  3O5R A;  1JNT A;  4ITZ A;  1HXV A;  2DG4 A;  1FKJ A;  2XPB A;  2F4E A;  3IKD A;  2F21 A;  2KFW A;  2PPO A;  1W26 A;  4C02 B;  4IQ2 A;  1QPF A;  4N19 A;  4FN2 A;  2XP7 A;  2MNT A;  5HTG A;  1D6O A;  3O5G A;  1EYM A;  1ZK6 A;  3O5M A;  4ODO A;  1R9H A;  4JFK A;  3CGM A;  1FKD A;  2RUC A;  4DRQ A;  4QT3 A;  3UF8 A;  4JFJ A;  4ODM A;  2OFN A;  1PBK A;  3JYJ A;  3O5Q A;  2VCD A;  4G50 A;  2UZ5 A;  1N1A A;  2KO7 A;  2MF9 A;  4QT2 A;  3VAW A;  1BKF A;  2ZQU A;  3KAF A;  2ZR6 A;  3MDY B;  3UI4 A;  5HW7 A;  2MLZ A;  4DRM A;  2LJ4 A;  1PIN A;  5J6E A;  3IKG A;  1TCO C;  1Q1C A;  1YAT A;  1A7X A;  4ODK A;  3RGC A;  3GPK A;  4DT4 A;  1FKF A;  5DIV A;  4DRK A;  4ODQ A;  3RFW A;  3NTP A;  1ROU A;  4ODP A;  4TX0 A;  1U79 A;  2M1I A;  2XP4 A;  4ODL A;  3UQB A;  1FKK A;  2PV2 A;  4MGV A;  2XP3 A;  4TNS A;  1Q6U A;  4TW6 A;  3KAC A;  2XP9 A;  1M5Y A;  1FKL A;  5GPG A;  3I6C A;  3O5I A;  2LKN A;  1J4H A;  2Q5A A;  3KAI A;  3OOB A;  5B8I C;  2PV1 A;  2XPA A;  3UQA A;  3O5P A;  2RUD A;  2PBC A;  4DZ3 A;  1FKB A;  4LAY A;  4DRN A;  1Y0O A;  1ROT A;  3CGN A;  3O5L A;  1NMW A;  2KE0 A;  2Y78 A;  3O5J A;  1FAP A;  4DRJ A;  4ODR A;  1KT0 A;  5D75 A;  2XP5 A;  4GIV A;  5HKG A;  1YW5 A;  2PPN A;  2VN1 A;  2DG9 A;  1FKT A;  2ZR5 A;  1J4R A;  3IHZ A;  3B7X A;  4U84 A;  1JNS A;  3PRB A;  4O2T A;  2L2S A;  4DIP A;  4JFI A;  1QPL A;  4W9P A;  2LPV A;  2ZQS A;  1Q6H A;  3NI6 A;  1FKR A;  1T11 A;  3ODK A;  4W9Q A;  2FAP A;  2KI3 A;  3JYM A;  3UI5 A;  1B6C A;  2ITK A;  2M2A A;  1KT1 A;  3O5O A;  2RQS A;  3PA7 A;  4JFL A;  4DH0 A;  4W9O A;  1FKG A;  4J4O A;  3JXV A;  2PPP A;  2IF4 A;  2ZQT A;  5DIT A;  4DZ2 A;  5HUA A;  1BL4 A;  1P5Q A;  3UQI A;  1NSG A;  3KAB A;  4U86 A;  4JFM A;  3FAP A;  1FKH A;  2LGO A;  3KAG A;  3O5D A;  4IPX A;  5HW8 A;  4BF8 A;  1EQ3 A;  3KZ7 A;  4U85 A;  3IK8 A;  4DRI A;  2F2D A;  1J4I A;  1NMV A;  3UI6 A;  4R0X A;  1F8A B;  5DIU A;  3TC5 A;  2MPH A;  3O5E A; 
#chains in the Genus database with same CATH topology
 1W1Y A;  5GQB A;  4HBO A;  4NNR A;  3WH0 A;  3ART A;  2N87 A;  4TYO A;  4TW8 A;  2FKE A;  3EY6 A;  3H9R B;  2KR7 A;  1HJW A;  1SR0 A;  1C9H A;  2MLY A;  5BXJ A;  1L1P A;  1D7I A;  3KAD A;  1NWS A;  2K8I A;  3O5K A;  1H0G A;  3PRD A;  4URI A;  4LAX A;  2ZR4 A;  3WD1 A;  4MSP A;  5HW6 A;  5HWB A;  3O5R A;  1HXV A;  1FKJ A;  3WD0 A;  3IKD A;  1W26 A;  4C02 B;  1E15 A;  1X6L A;  5DO2 A;  4JFK A;  4WKF A;  1FKD A;  1JNE A;  4JFJ A;  3JYJ A;  2KO7 A;  3VAW A;  3UI4 A;  2LJ4 A;  5J6E A;  4ODK A;  1YAT A;  3RGC A;  1ZB5 A;  1FKF A;  3RFW A;  3B9D A;  5DEZ A;  1U79 A;  2M1I A;  4WIW A;  5B8I C;  3UQA A;  2XPA A;  2RUD A;  4DWS D;  3AQU A;  1FKB A;  4LAY A;  1Y0O A;  1W9U A;  1W1P A;  1NWR A;  1RD6 A;  3CH9 A;  5HKG A;  1EIB A;  2VN1 A;  2DG9 A;  2WLY A;  3B8S A;  4U84 A;  1JNS A;  3PRB A;  4Z2I A;  4MNL A;  4W9P A;  1K9T A;  4L3N A;  4MAV A;  1B6C A;  2RQS A;  3ARP A;  4JFL A;  1FKG A;  5HUA A;  2ZQT A;  1BL4 A;  2B5U B;  3UQI A;  1NSG A;  3KAB A;  4MPK A;  1WAW A;  4IPX A;  3KAG A;  3O5D A;  2DSW A;  3ALG A;  4BF8 A;  2WM0 A;  1UR9 A;  3KZ7 A;  2F2D A;  3UI6 A;  3CHF A;  3FY1 A;  1E6N A;  4JYS A;  1LL7 A;  4MTV A;  4XAK A;  3LUO A;  4DWS C;  2KGJ A;  4DRO A;  2FDM A;  1F40 A;  1GUV A;  1QZ2 A;  1XHG A;  2D9F A;  1D7J A;  1LL4 A;  4TW7 A;  4Z2H A;  1FJD A;  1HKJ A;  2OLH A;  1ZCN A;  1JVW A;  4LAV A;  2JZV A;  4P8V A;  4ZPW R;  4DRP A;  5HWC A;  2PI6 A;  1FKI A;  4QZV B;  2ESC A;  4UDM A;  1FD9 A;  3WQW A;  2DSV A;  1FFQ A;  2F4E A;  2IUZ A;  1E6P A;  2PPO A;  4IQ2 A;  4KR0 B;  2MNT A;  1D6O A;  3O5M A;  4ODO A;  4DRQ A;  4QT3 A;  3UF8 A;  4ODM A;  2OFN A;  1PBK A;  3O5Q A;  4Z2G A;  2VCD A;  4QT2 A;  1BKF A;  2MLZ A;  1ZBK A;  1PIN A;  4Z2L A;  1E9L A;  2B31 A;  3IKG A;  1TCO C;  4DT4 A;  3ARY A;  2YBU A;  1ROU A;  1HKM A;  2PV2 A;  2PN0 A;  1E6R A;  4DWS A;  3KAC A;  3I6C A;  2A3C A;  1GPF A;  3O5I A;  3WKZ A;  2Q5A A;  3KAI A;  2PBC A;  1HKI A;  3QOK A;  3CGN A;  3AS1 A;  2Y78 A;  3O5J A;  1FAP A;  1FKT A;  4PTM A;  2L2S A;  4JFI A;  4W5U A;  1SYT A;  2DT0 A;  4Q22 A;  2ZQS A;  1ZBV A;  3NI6 A;  1FKR A;  1OWQ A;  3ODK A;  4W9Q A;  2FAP A;  3JYM A;  1ITX A;  2M2A A;  1KT1 A;  4W9O A;  4J4O A;  3BXW A;  3JXV A;  2PPP A;  4DWS B;  2DT3 A;  1CTN A;  1LL6 A;  4JFM A;  3FAP A;  4ZPT R;  1FKH A;  2LGO A;  4ML4 A;  5HW8 A;  4DRI A;  2ETN A;  2WLZ A;  3KCE A;  4DRH A;  4GGQ A;  4LAW A;  4WKA A;  1ZBC A;  4FAP A;  3ARO A;  1FKS A;  4P8X A;  3WD4 A;  4P8U A;  3AS3 A;  3WIJ A;  2XP8 A;  4ZS6 A;  2DG3 A;  3B9A A;  2RSE A;  1ZBW A;  3GU0 A;  3ALF A;  5GPR A;  2DSZ A;  5I98 A;  3TCZ A;  4G2P A;  3NRK A;  1D7H A;  1KFW A;  1LJY A;  1OGG A;  3KAH A;  5HBF A;  4WK9 A;  5HT1 A;  4QIB A;  1JNT A;  2DG4 A;  3WQV A;  2F21 A;  2A3A A;  1QPF A;  4N19 A;  4FN2 A;  4NSB A;  1O6I A;  1ZK6 A;  3ARW A;  1R9H A;  2RUC A;  1X6N A;  4G50 A;  3W4R A;  5JH8 A;  2G8Z A;  4DRM A;  1GOI A;  2O9O A;  1H0I A;  4WKH A;  2A3E A;  4WJX A;  5DIV A;  3NTP A;  4S3J A;  4IT6 A;  3UQB A;  1OGB A;  3CHE A;  2XP4 A;  3ARR A;  1FKK A;  3RM8 A;  2XP3 A;  4TW6 A;  1W1V A;  2XP9 A;  3OA5 A;  1FKL A;  2LKN A;  1WB0 A;  3PR9 A;  2PV1 A;  1ZU8 A;  3O5L A;  2DT2 A;  2KE0 A;  3BMB A;  3CHC A;  4R5E A;  4ODR A;  3EIP A;  2PPN A;  2F23 A;  3CZ8 A;  2ZR5 A;  3IHZ A;  3ARS A;  3B7X A;  3G6M A;  5DF0 A;  1QPL A;  1D2K A;  3RM4 A;  1UR8 A;  3WL0 A;  1VF8 A;  2LPV A;  1NWU A;  2O92 A;  2YBT A;  2KI3 A;  3UI5 A;  2ITK A;  3O5O A;  4DH0 A;  4DZ2 A;  2IF4 A;  1P5Q A;  4Z2J A;  4U86 A;  1XRV A;  1NWT A;  1EDQ A;  1EQ3 A;  1J4I A;  1NMV A;  2MPH A;  3O5E A;  1Q6I A;  3ARQ A;  2PV3 A;  3TDB A;  3B9E A;  1HKK A;  1J6Y A;  2RUQ A;  1LG2 A;  4J4N A;  4ODN A;  1IX5 A;  1E44 A;  3ARX A;  3AS0 A;  2XP6 A;  4MNK A;  2MLX A;  2P4V A;  1LG1 A;  2M08 A;  3O5F A;  2ZQV A;  3WL1 A;  4AY1 A;  2AWG A;  2DSU A;  2A3B A;  1LQ0 A;  2RUR A;  4IQC A;  3ARZ A;  4ITZ A;  2XPB A;  2KFW A;  4LGX A;  5HTG A;  2XP7 A;  3RME A;  3O5G A;  1EYM A;  3CGM A;  4ZPV R;  1W1T A;  2UZ5 A;  1N1A A;  2MF9 A;  2ZQU A;  3KAF A;  2ZR6 A;  1JND A;  3MDY B;  5HW7 A;  1FFR A;  1EHN A;  1Q1C A;  1A7X A;  1HJV A;  3WD3 A;  3GPK A;  1HJX A;  4DRK A;  4ODQ A;  3RM9 A;  4TX0 A;  3G6L A;  4ODP A;  4ODL A;  2EUL A;  4MGV A;  4TNS A;  3FXY A;  1Q6U A;  1M5Y A;  5GPG A;  3CHD A;  1J4H A;  3OOB A;  4S3K A;  3O5P A;  4DZ3 A;  1E6Z A;  3GTY X;  4DRN A;  1ROT A;  2DPE A;  2G41 A;  1NMW A;  4IT4 A;  4Z2K A;  1JCH B;  4DRJ A;  1TFV A;  1KT0 A;  5D75 A;  4HAR A;  2XP5 A;  4GIV A;  1YW5 A;  1NH6 A;  1J4R A;  4MNM A;  2QF8 A;  4O2T A;  4DIP A;  1W9P A;  4KQZ A;  1Q6H A;  1T11 A;  1WNO A;  1GRJ A;  2DT1 A;  1W9V A;  3PA7 A;  2AOS A;  3ARV A;  3AS2 A;  3WD2 A;  4MNJ A;  5DIT A;  4HBE A;  4L72 B;  2WK2 A;  4P8W A;  3IK8 A;  4U85 A;  3PRA A;  4Q7N A;  4R0X A;  1F8A B;  4NZC A;  5DIU A;  3TC5 A;  1ZL1 A;  3ARU A; 
#chains in the Genus database with same CATH homology
 1W1Y A;  5GQB A;  4HBO A;  4NNR A;  3WH0 A;  3ART A;  2N87 A;  4TYO A;  4TW8 A;  2FKE A;  3EY6 A;  3H9R B;  2KR7 A;  1HJW A;  1SR0 A;  1C9H A;  2MLY A;  5BXJ A;  1L1P A;  1D7I A;  3KAD A;  1NWS A;  2K8I A;  3O5K A;  1H0G A;  3PRD A;  4URI A;  4LAX A;  2ZR4 A;  3WD1 A;  4MSP A;  5HW6 A;  5HWB A;  3O5R A;  1HXV A;  1FKJ A;  3WD0 A;  3IKD A;  1W26 A;  4C02 B;  1E15 A;  1X6L A;  5DO2 A;  4JFK A;  4WKF A;  1FKD A;  1JNE A;  4JFJ A;  3JYJ A;  2KO7 A;  3VAW A;  3UI4 A;  2LJ4 A;  5J6E A;  4ODK A;  1YAT A;  3RGC A;  1ZB5 A;  1FKF A;  3RFW A;  3B9D A;  5DEZ A;  1U79 A;  2M1I A;  4WIW A;  5B8I C;  3UQA A;  2XPA A;  2RUD A;  4DWS D;  3AQU A;  1FKB A;  4LAY A;  1Y0O A;  1W9U A;  1W1P A;  1NWR A;  1RD6 A;  3CH9 A;  5HKG A;  1EIB A;  2VN1 A;  2DG9 A;  2WLY A;  3B8S A;  4U84 A;  1JNS A;  3PRB A;  4Z2I A;  4MNL A;  4W9P A;  1K9T A;  4L3N A;  4MAV A;  1B6C A;  2RQS A;  3ARP A;  4JFL A;  1FKG A;  5HUA A;  2ZQT A;  1BL4 A;  3UQI A;  1NSG A;  3KAB A;  4MPK A;  1WAW A;  4IPX A;  3KAG A;  3O5D A;  2DSW A;  3ALG A;  4BF8 A;  2WM0 A;  1UR9 A;  3KZ7 A;  2F2D A;  3UI6 A;  3CHF A;  3FY1 A;  1E6N A;  4JYS A;  1LL7 A;  4MTV A;  4XAK A;  3LUO A;  4DWS C;  2KGJ A;  4DRO A;  2FDM A;  1F40 A;  1GUV A;  1QZ2 A;  1XHG A;  2D9F A;  1D7J A;  1LL4 A;  4TW7 A;  4Z2H A;  1FJD A;  1HKJ A;  2OLH A;  1ZCN A;  1JVW A;  4LAV A;  2JZV A;  4P8V A;  4ZPW R;  4DRP A;  5HWC A;  2PI6 A;  1FKI A;  4QZV B;  2ESC A;  1FD9 A;  3WQW A;  2DSV A;  1FFQ A;  2F4E A;  2IUZ A;  1E6P A;  2PPO A;  4IQ2 A;  4KR0 B;  2MNT A;  1D6O A;  3O5M A;  4ODO A;  4DRQ A;  4QT3 A;  3UF8 A;  4ODM A;  2OFN A;  1PBK A;  3O5Q A;  4Z2G A;  2VCD A;  4QT2 A;  1BKF A;  2MLZ A;  1ZBK A;  1PIN A;  4Z2L A;  1E9L A;  2B31 A;  3IKG A;  1TCO C;  4DT4 A;  3ARY A;  2YBU A;  1ROU A;  1HKM A;  2PV2 A;  1E6R A;  4DWS A;  3KAC A;  3I6C A;  2A3C A;  1GPF A;  3O5I A;  3WKZ A;  2Q5A A;  3KAI A;  2PBC A;  1HKI A;  3QOK A;  3CGN A;  3AS1 A;  2Y78 A;  3O5J A;  1FAP A;  1FKT A;  4PTM A;  2L2S A;  4JFI A;  4W5U A;  1SYT A;  2DT0 A;  4Q22 A;  2ZQS A;  1ZBV A;  3NI6 A;  1FKR A;  1OWQ A;  3ODK A;  4W9Q A;  2FAP A;  3JYM A;  1ITX A;  2M2A A;  1KT1 A;  4W9O A;  4J4O A;  3BXW A;  3JXV A;  2PPP A;  4DWS B;  2DT3 A;  1CTN A;  1LL6 A;  4JFM A;  3FAP A;  4ZPT R;  1FKH A;  2LGO A;  4ML4 A;  5HW8 A;  4DRI A;  2WLZ A;  3KCE A;  4DRH A;  4GGQ A;  4LAW A;  4WKA A;  1ZBC A;  4FAP A;  3ARO A;  1FKS A;  4P8X A;  3WD4 A;  4P8U A;  3AS3 A;  3WIJ A;  2XP8 A;  4ZS6 A;  2DG3 A;  3B9A A;  2RSE A;  1ZBW A;  3ALF A;  5GPR A;  2DSZ A;  5I98 A;  3TCZ A;  4G2P A;  3NRK A;  1D7H A;  1KFW A;  1LJY A;  1OGG A;  3KAH A;  5HBF A;  4WK9 A;  5HT1 A;  4QIB A;  1JNT A;  2DG4 A;  3WQV A;  2F21 A;  2A3A A;  1QPF A;  4N19 A;  4FN2 A;  4NSB A;  1O6I A;  1ZK6 A;  3ARW A;  1R9H A;  2RUC A;  1X6N A;  4G50 A;  3W4R A;  5JH8 A;  2G8Z A;  4DRM A;  1GOI A;  2O9O A;  1H0I A;  4WKH A;  2A3E A;  4WJX A;  5DIV A;  3NTP A;  4S3J A;  4IT6 A;  3UQB A;  1OGB A;  3CHE A;  2XP4 A;  3ARR A;  1FKK A;  3RM8 A;  2XP3 A;  4TW6 A;  1W1V A;  2XP9 A;  3OA5 A;  1FKL A;  2LKN A;  1WB0 A;  3PR9 A;  2PV1 A;  1ZU8 A;  3O5L A;  2DT2 A;  2KE0 A;  3CHC A;  4R5E A;  4ODR A;  2PPN A;  3CZ8 A;  2ZR5 A;  3IHZ A;  3ARS A;  3B7X A;  3G6M A;  5DF0 A;  1QPL A;  1D2K A;  3RM4 A;  1UR8 A;  3WL0 A;  1VF8 A;  2LPV A;  1NWU A;  2O92 A;  2YBT A;  2KI3 A;  3UI5 A;  2ITK A;  3O5O A;  4DH0 A;  4DZ2 A;  2IF4 A;  1P5Q A;  4Z2J A;  4U86 A;  1XRV A;  1NWT A;  1EDQ A;  1EQ3 A;  1J4I A;  1NMV A;  2MPH A;  3O5E A;  1Q6I A;  3ARQ A;  2PV3 A;  3TDB A;  3B9E A;  1HKK A;  1J6Y A;  2RUQ A;  1LG2 A;  4J4N A;  4ODN A;  1IX5 A;  3ARX A;  3AS0 A;  2XP6 A;  4MNK A;  2MLX A;  1LG1 A;  2M08 A;  3O5F A;  2ZQV A;  3WL1 A;  4AY1 A;  2AWG A;  2DSU A;  2A3B A;  1LQ0 A;  2RUR A;  4IQC A;  3ARZ A;  4ITZ A;  2XPB A;  2KFW A;  4LGX A;  5HTG A;  2XP7 A;  3RME A;  3O5G A;  1EYM A;  3CGM A;  4ZPV R;  1W1T A;  2UZ5 A;  1N1A A;  2MF9 A;  2ZQU A;  3KAF A;  2ZR6 A;  1JND A;  3MDY B;  5HW7 A;  1FFR A;  1EHN A;  1Q1C A;  1A7X A;  1HJV A;  3WD3 A;  3GPK A;  1HJX A;  4DRK A;  4ODQ A;  3RM9 A;  4TX0 A;  3G6L A;  4ODP A;  4ODL A;  4MGV A;  4TNS A;  3FXY A;  1Q6U A;  1M5Y A;  5GPG A;  3CHD A;  1J4H A;  3OOB A;  4S3K A;  3O5P A;  4DZ3 A;  1E6Z A;  4DRN A;  1ROT A;  2DPE A;  2G41 A;  1NMW A;  4IT4 A;  4Z2K A;  4DRJ A;  1TFV A;  1KT0 A;  5D75 A;  4HAR A;  2XP5 A;  4GIV A;  1YW5 A;  1NH6 A;  1J4R A;  4MNM A;  2QF8 A;  4O2T A;  4DIP A;  1W9P A;  4KQZ A;  1Q6H A;  1T11 A;  1WNO A;  2DT1 A;  1W9V A;  3PA7 A;  2AOS A;  3ARV A;  3AS2 A;  3WD2 A;  4MNJ A;  5DIT A;  4HBE A;  4L72 B;  2WK2 A;  4P8W A;  3IK8 A;  4U85 A;  3PRA A;  4Q7N A;  4R0X A;  1F8A B;  4NZC A;  5DIU A;  3TC5 A;  1ZL1 A;  3ARU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...