1ROTA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
b'GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP59-I
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Rotamase (isomerase)
total genus 26
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rotA00
1FJDA 3O5QA 4DRKA 5HUAA 2XP6A 4JFLA 3ODKA 2K8IA 2ZQVA 4ODRA 5DIVA 1M5YA 4DZ3A 3KAFA 1R9HA 2LPVA 4DZ2A 1BKFA 2FKEA 3O5OA 4LAXA 4R0XA 4TYOA 3CGMA 4JFIA 3UI4A 3FAPA 5J6EA 2XP9A 3IHZA 3PRDA 1KT0A 1P5QA 4TW7A 3TDBA 2XP5A 2MLZA 4NNRA 4ODPA 2KFWA 2RUQA 1D7JA 4ODKA 3TCZA 2OFNA 2XPAA 4DH0A 3IKGA 5HW6A 2FAPA 3KAIA 1FKJA 4MSPA 2IF4A 4TW8A 1PINA 2DG3A 3KABA 2KR7A 2PV3A 3KCEA 3O5FA 4J4NA 3UI5A 1NMWA 2M1IA 3KAHA 3TC5A 5I98A 3OOBA 3O5JA 1J4IA 3EY6A 3PRBA 1FAPA 1FKHA 4GGQA 3UQAA 2RUCA 2MPHA 4JFMA 5HWBA 3O5LA 5GPGA 1L1PA 4DIPA 1FKGA 2LKNA 1F40A 1T11A 4O2TA 1F8AB 4ODNA 4N19A 3JYJA 1BL4A 3PA7A 4U84A 1B6CA 5DIUA 4DRIA 2AWGA 1FKTA 3IKDA 1TCOC 3O5GA 1KT1A 2D9FA 3KZ7A 4TW6A 5DITA 1ZK6A 3KACA 3O5PA 3KADA 4TNSA 4W9PA 2F4EA 2DG9A 2Q5AA 4ODLA 1NMVA 2ZQUA 1ROTA 4IQ2A 3I6CA 2ZR5A 1U79A 3RGCA 4ODOA 1D7IA 1ZCNA 2XP3A 3LUOA 3VAWA 3UQBA 1JNSA 2XP4A 4G2PA 4DROA 2Y78A 4QIBA 4ITZA 1FKRA 4JYSA 3UI6A 2LGOA 4DRHA 1J4HA 1QZ2A 2MNTA 1YW5A 3NTPA 4JFKA 4LAVA 2ITKA 2VCDA 5HWCA 3NI6A 3O5MA 1FKDA 2PBCA 2MLXA 1FKSA 3O5KA 2KGJA 1D6OA 3O5EA 3UQIA 4IQCA 1W26A 4DRQA 1Y0OA 3MDYB 5B8IC 1N1AA 2M08A 2MLYA 1FKBA 3JXVA 5D75A 1FKIA 1J6YA 1D7HA 1YATA 1A7XA 2LJ4A 4DRMA 2N87A 2F21A 1Q1CA 5HKGA 2PV2A 4ODQA 1EQ3A 2PPPA 4JFJA 4QT2A 2L2SA 4U85A 1HXVA 3RFWA 4DRJA 4MGVA 1QPFA 4G50A 4DT4A 1QPLA 4TX0A 3WH0A 3H9RB 4DRPA 2ZR6A 2RQSA 2DG4A 2MF9A 1FKLA 3NRKA 2F2DA 3IK8A 4FN2A 2ZQSA 5HW7A 2KE0A 3O5DA 1ROUA 3GPKA 1Q6HA 1EYMA 2RSEA 3B7XA 3KAGA 4LAYA 4ODMA 4U86A 2UZ5A 4C02B 4IPXA 2RUDA 2KI3A 2ZQTA 4LAWA 1FD9A 2PV1A 1PBKA 1NSGA 1FKKA 1Q6UA 5HW8A 3O5IA 1Q6IA 4FAPA 1JVWA 4BF8A 3JYMA 2VN1A 5HTGA 1FKFA 1J4RA 1JNTA 2XP7A 2M2AA 3UF8A 4DRNA 1C9HA 4J4OA 5BXJA 4QT3A 2XPBA 2JZVA 2RURA 2ZR4A 2KO7A 4W9OA 2PPNA 4W9QA 3O5RA 3CGNA 4GIVA 2PPOA 5HT1A 2XP8A
chains in the Genus database with same CATH superfamily
4DRKA 4ZPVR 4JFLA 3ARQA 5DIVA 2G8ZA 1M5YA 1R9HA 4DZ2A 2FKEA 4LAXA 4JFIA 3EIPA 2XP9A 4TW7A 2XP5A 2MLZA 1ZBWA 1WNOA 2OFNA 4DH0A 1OGBA 3PRAA 4WK9A 1TFVA 4TW8A 4KR0B 3KCEA 4J4NA 2M1IA 4WKHA 1GPFA 3O5JA 5DF0A 3PRBA 1FAPA 3WKZA 3UQAA 5HWBA 3O5LA 4ML4A 5GPGA 1F8AB 4S3KA 1BL4A 3PA7A 4NSBA 3ALFA 4DWSC 3IKDA 1FKTA 3O5GA 3AROA 5DITA 4W9PA 2ZQUA 4IQ2A 1ROTA 4P8UA 2DSZA 4WIWA 3WQVA 1U79A 1D7IA 1FFRA 2XP4A 4MPKA 2YBTA 3UI6A 1WAWA 2ITKA 2VCDA 5HWCA 4DRQA 5B8IC 1N1AA 1FKBA 3CHEA 1A7XA 2F21A 4WKAA 5HKGA 2PV2A 1EHNA 4QT2A 1NWUA 2L2SA 4P8XA 4DRJA 1E6ZA 1E9LA 3WH0A 1E15A 4DRPA 4KQZA 3IK8A 1E6PA 1EYMA 4LGXA 4ZS6A 1RD6A 4LAWA 1H0GA 2PV1A 3WQWA 1SYTA 1Q6UA 3AS1A 1JVWA 1FKFA 2WM0A 1EDQA 3AS3A 1HJXA 4W9OA 3CGNA 4MNJA 3CHCA 3ARYA 1FJDA 1H0IA 2XP6A 5HUAA 3ODKA 2ZQVA 3WL1A 4DZ3A 3OA5A 3O5OA 4R0XA 3ALGA 1K9TA 4HBOA 2WK2A 3FAPA 3PRDA 5J6EA 1KT0A 1P5QA 1W1YA 3TDBA 2O9OA 1HKJA 4ZPWR 3TCZA 5HW6A 3IKGA 3CHFA 1OGGA 3KAIA 3WL0A 3G6MA 2B31A 2DG3A 3WD2A 5I98A 3AQUA 2DT1A 1NH6A 2RUCA 2MPHA 4JFMA 1L1PA 1FKGA 2LKNA 1WB0A 2QF8A 3ARXA 2AWGA 2F23A 1TCOC 1KT1A 2D9FA 1ZK6A 2A3CA 3KACA 4TNSA 3KADA 2B5UB 2F4EA 2DG9A 4IT6A 1HJVA 3WD1A 4MTVA 4W5UA 1X6NA 3VAWA 4HBEA 2IUZA 3RGCA 1JNDA 1JNSA 4G2PA 2Y78A 2DPEA 1FKRA 4JYSA 2LGOA 4Z2LA 1J4HA 1YW5A 3NTPA 4JFKA 1FKDA 1HKIA 2MLXA 1KFWA 1CTNA 4QZVB 2M08A 1D7HA 4DRMA 2LJ4A 2N87A 5DO2A 4ODQA 3ARRA 4U85A 3RFWA 1QPFA 3RM9A 1QPLA 1W9VA 3H9RB 3WD4A 1ZBCA 1FKLA 2F2DA 2OLHA 1Q6HA 1XRVA 2RSEA 3B7XA 4Q7NA 1X6LA 3GTYX 5GQBA 4IPXA 2RUDA 2ZQTA 1GUVA 1NWTA 3ARZA 3CZ8A 5JH8A 3CH9A 1PBKA 5GPRA 4L72B 1FKKA 4BF8A 3JYMA 2VN1A 1O6IA 3PR9A 2XP7A 1C9HA 4W9QA 5HT1A 2XP8A 1LJYA 2O92A 3B9DA 2A3EA 2LPVA 1BKFA 3FY1A 2ESCA 3IHZA 3WD0A 4Z2GA 4NNRA 4ODPA 2WLYA 4ZPTR 1LL6A 2FAPA 3WD3A 1FFQA 4Z2IA 4DWSD 2PV3A 2YBUA 3W4RA 1ZL1A 3ARSA 1FKHA 3EY6A 4S3JA 2DT0A 1ZBKA 4Q22A 1T11A 1IX5A 1LQ0A 5DIUA 1W1VA 1EIBA 2G41A 4TW6A 1OWQA 1W9UA 3KZ7A 3QOKA 3O5PA 4ODLA 3AS2A 4DWSB 3I6CA 2ZR5A 3LUOA 1ZCNA 2XP3A 3UQBA 4DROA 4QIBA 4P8WA 4MNMA 1ITXA 1QZ2A 1E6NA 4PTMA 4LAVA 3NI6A 3O5MA 2PBCA 3ARTA 1FKSA 1D6OA 3UQIA 4IQCA 1W26A 1Y0OA 3MDYB 4L3NA 1UR8A 4Z2KA 2DSUA 3JXVA 5D75A 2PN0A 1J6YA 1LL4A 1E6RA 2PPPA 4DT4A 4MGVA 4G50A 4TX0A 2RQSA 2DG4A 3NRKA 1E44A 4P8VA 2KE0A 2ETNA 3GPKA 3KAGA 4MNKA 4ODMA 3G6LA 4NZCA 4U86A 4C02B 2A3AA 1FD9A 1LG1A 2DSVA 3ARPA 1ZBVA 3WIJA 1Q6IA 4FAPA 5DEZA 3BXWA 5HTGA 1J4RA 2M2AA 3UF8A 4J4OA 4QT3A 1W9PA 2XPBA 2JZVA 2RURA 2PPNA 3ARWA 2DT3A 3RM4A 2PPOA 1F40A 4MNLA 3BMBA 1NWRA 3B8SA 4HARA 3O5QA 1W1TA 1HKMA 2K8IA 4ODRA 4R5EA 1NWSA 1HKKA 3KAFA 3B9AA 4TYOA 2DT2A 3CGMA 3UI4A 1GOIA 3GU0A 2DSWA 2KFWA 2RUQA 1D7JA 4ODKA 2XPAA 1D2KA 1FKJA 4MSPA 4AY1A 2IF4A 3UI5A 1PINA 3KABA 2KR7A 3O5FA 1NMWA 3KAHA 1VF8A 3TC5A 3OOBA 3ARUA 1J4IA 1W1PA 4GGQA 4UDMA 4DIPA 4O2TA 4ODNA 4N19A 3JYJA 4U84A 1B6CA 4DRIA 5HBFA 3RMEA 2Q5AA 1NMVA 1JNEA 3ARVA 4ODOA 3RM8A 4ITZA 1UR9A 4DRHA 2MNTA 3O5KA 2KGJA 3O5EA 4Z2JA 1JCHB 2FDMA 2PI6A 4Z2HA 2MLYA 1FKIA 1SR0A 1YATA 1Q1CA 1GRJA 1EQ3A 4JFJA 3AS0A 4URIA 1HXVA 2WLZA 1LG2A 2ZR6A 2MF9A 2P4VA 4FN2A 4DWSA 1XHGA 5HW7A 2ZQSA 4WKFA 3O5DA 1ROUA 2EULA 4LAYA 2AOSA 1LL7A 2UZ5A 3CHDA 4XAKA 2KI3A 3B9EA 1NSGA 5HW8A 3O5IA 1JNTA 1HJWA 3FXYA 4DRNA 2A3BA 4IT4A 1ZU8A 5BXJA 2ZR4A 2KO7A 4WJXA 3O5RA 4GIVA 4MAVA 1ZB5A
chains in the Genus database with same CATH topology
4DRKA 4ZPVR 4JFLA 3ARQA 5DIVA 2G8ZA 1M5YA 1R9HA 4DZ2A 2FKEA 4LAXA 4JFIA 2XP9A 4TW7A 2XP5A 2MLZA 1ZBWA 1WNOA 2OFNA 4DH0A 1OGBA 3PRAA 4WK9A 1TFVA 4TW8A 4KR0B 3KCEA 4J4NA 2M1IA 4WKHA 1GPFA 3O5JA 5DF0A 3PRBA 1FAPA 3WKZA 3UQAA 5HWBA 3O5LA 4ML4A 5GPGA 1F8AB 4S3KA 1BL4A 3PA7A 4NSBA 3ALFA 4DWSC 3O5GA 1FKTA 3IKDA 3AROA 5DITA 4W9PA 2ZQUA 4IQ2A 1ROTA 4P8UA 2DSZA 4WIWA 3WQVA 1U79A 1D7IA 1FFRA 2XP4A 4MPKA 2YBTA 3UI6A 1WAWA 2ITKA 2VCDA 5HWCA 4DRQA 5B8IC 1N1AA 1FKBA 3CHEA 1A7XA 2F21A 4WKAA 5HKGA 2PV2A 1EHNA 4QT2A 1NWUA 2L2SA 4P8XA 4DRJA 1E6ZA 1E9LA 3WH0A 1E15A 4DRPA 4KQZA 3IK8A 1E6PA 1EYMA 4LGXA 4ZS6A 1RD6A 4LAWA 1H0GA 2PV1A 3WQWA 1SYTA 1Q6UA 3AS1A 1JVWA 1FKFA 2WM0A 1EDQA 3AS3A 1HJXA 4W9OA 3CGNA 4MNJA 3CHCA 3ARYA 1FJDA 1H0IA 2XP6A 5HUAA 3ODKA 2ZQVA 3WL1A 4DZ3A 3OA5A 3O5OA 4R0XA 3ALGA 1K9TA 4HBOA 2WK2A 3FAPA 3PRDA 5J6EA 1KT0A 1P5QA 1W1YA 3TDBA 2O9OA 1HKJA 4ZPWR 3TCZA 5HW6A 3IKGA 3CHFA 1OGGA 3KAIA 3WL0A 3G6MA 2B31A 2DG3A 3WD2A 5I98A 3AQUA 2DT1A 1NH6A 2RUCA 2MPHA 4JFMA 1L1PA 1FKGA 2LKNA 1WB0A 2QF8A 3ARXA 2AWGA 1TCOC 1KT1A 2D9FA 1ZK6A 2A3CA 3KACA 4TNSA 3KADA 2F4EA 2DG9A 4IT6A 1HJVA 3WD1A 4MTVA 4W5UA 1X6NA 3VAWA 4HBEA 2IUZA 3RGCA 1JNDA 1JNSA 4G2PA 2Y78A 2DPEA 1FKRA 4JYSA 2LGOA 4Z2LA 1J4HA 1YW5A 3NTPA 4JFKA 1FKDA 1HKIA 2MLXA 1KFWA 1CTNA 4QZVB 2M08A 1D7HA 4DRMA 2LJ4A 2N87A 5DO2A 4ODQA 3ARRA 4U85A 3RFWA 1QPFA 3RM9A 1QPLA 1W9VA 3H9RB 3WD4A 1ZBCA 1FKLA 2F2DA 2OLHA 1Q6HA 1XRVA 2RSEA 3B7XA 4Q7NA 1X6LA 5GQBA 4IPXA 2RUDA 2ZQTA 1GUVA 1NWTA 3ARZA 3CZ8A 5JH8A 3CH9A 1PBKA 5GPRA 4L72B 1FKKA 4BF8A 3JYMA 2VN1A 1O6IA 3PR9A 2XP7A 1C9HA 4W9QA 5HT1A 2XP8A 1LJYA 2O92A 3B9DA 2A3EA 2LPVA 1BKFA 3FY1A 2ESCA 3IHZA 3WD0A 4Z2GA 4NNRA 4ODPA 2WLYA 4ZPTR 1LL6A 2FAPA 3WD3A 1FFQA 4Z2IA 4DWSD 2PV3A 2YBUA 3W4RA 1ZL1A 3ARSA 1FKHA 3EY6A 4S3JA 2DT0A 1ZBKA 4Q22A 1T11A 1IX5A 1LQ0A 5DIUA 1W1VA 1EIBA 2G41A 4TW6A 1OWQA 1W9UA 3KZ7A 3QOKA 3O5PA 4ODLA 3AS2A 4DWSB 3I6CA 2ZR5A 3LUOA 1ZCNA 2XP3A 3UQBA 4DROA 4QIBA 4P8WA 4MNMA 1ITXA 1QZ2A 1E6NA 4PTMA 4LAVA 3NI6A 3O5MA 2PBCA 3ARTA 1FKSA 1D6OA 3UQIA 4IQCA 1W26A 1Y0OA 3MDYB 4L3NA 1UR8A 4Z2KA 2DSUA 3JXVA 5D75A 1J6YA 1LL4A 1E6RA 2PPPA 4DT4A 4MGVA 4G50A 4TX0A 2RQSA 3NRKA 2DG4A 4P8VA 2KE0A 3GPKA 3KAGA 4MNKA 4ODMA 3G6LA 4NZCA 4U86A 4C02B 2A3AA 1FD9A 1LG1A 2DSVA 3ARPA 1ZBVA 3WIJA 1Q6IA 4FAPA 5DEZA 3BXWA 5HTGA 1J4RA 2M2AA 3UF8A 4J4OA 4QT3A 1W9PA 2XPBA 2JZVA 2RURA 2PPNA 3ARWA 2DT3A 3RM4A 2PPOA 1F40A 4MNLA 1NWRA 3B8SA 4HARA 3O5QA 1W1TA 1HKMA 2K8IA 4ODRA 4R5EA 1NWSA 1HKKA 3KAFA 3B9AA 4TYOA 2DT2A 3CGMA 3UI4A 1GOIA 2DSWA 2KFWA 2RUQA 1D7JA 4ODKA 2XPAA 1D2KA 1FKJA 4MSPA 4AY1A 2IF4A 3UI5A 1PINA 3KABA 2KR7A 3O5FA 1NMWA 3KAHA 1VF8A 3TC5A 3OOBA 3ARUA 1J4IA 1W1PA 4GGQA 4DIPA 4O2TA 4ODNA 4N19A 3JYJA 4U84A 1B6CA 4DRIA 5HBFA 3RMEA 2Q5AA 1NMVA 1JNEA 3ARVA 4ODOA 3RM8A 4ITZA 1UR9A 4DRHA 2MNTA 3O5KA 2KGJA 3O5EA 4Z2JA 2FDMA 2PI6A 4Z2HA 2MLYA 1FKIA 1SR0A 1YATA 1Q1CA 1EQ3A 4JFJA 3AS0A 4URIA 1HXVA 2WLZA 1LG2A 2ZR6A 2MF9A 4DWSA 4FN2A 1XHGA 5HW7A 2ZQSA 4WKFA 3O5DA 1ROUA 4LAYA 2AOSA 1LL7A 2UZ5A 3CHDA 4XAKA 2KI3A 3B9EA 1NSGA 5HW8A 3O5IA 1JNTA 1HJWA 3FXYA 4DRNA 2A3BA 4IT4A 1ZU8A 5BXJA 2ZR4A 2KO7A 4WJXA 3O5RA 4GIVA 4MAVA 1ZB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJD A;  3O5Q A;  4DRK A;  5HUA A;  2XP6 A;  4JFL A;  3ODK A;  2K8I A;  2ZQV A;  4ODR A;  5DIV A;  1M5Y A;  4DZ3 A;  3KAF A;  1R9H A;  2LPV A;  4DZ2 A;  1BKF A;  2FKE A;  3O5O A;  4LAX A;  4R0X A;  4TYO A;  3CGM A;  4JFI A;  3UI4 A;  3FAP A;  5J6E A;  2XP9 A;  3IHZ A;  3PRD A;  1KT0 A;  1P5Q A;  4TW7 A;  3TDB A;  2XP5 A;  2MLZ A;  4NNR A;  4ODP A;  2KFW A;  2RUQ A;  1D7J A;  4ODK A;  3TCZ A;  2OFN A;  2XPA A;  4DH0 A;  3IKG A;  5HW6 A;  2FAP A;  3KAI A;  1FKJ A;  4MSP A;  2IF4 A;  4TW8 A;  1PIN A;  2DG3 A;  3KAB A;  2KR7 A;  2PV3 A;  3KCE A;  3O5F A;  4J4N A;  3UI5 A;  1NMW A;  2M1I A;  3KAH A;  3TC5 A;  5I98 A;  3OOB A;  3O5J A;  1J4I A;  3EY6 A;  3PRB A;  1FAP A;  1FKH A;  4GGQ A;  3UQA A;  2RUC A;  2MPH A;  4JFM A;  5HWB A;  3O5L A;  5GPG A;  1L1P A;  4DIP A;  1FKG A;  2LKN A;  1F40 A;  1T11 A;  4O2T A;  1F8A B;  4ODN A;  4N19 A;  3JYJ A;  1BL4 A;  3PA7 A;  4U84 A;  1B6C A;  5DIU A;  4DRI A;  2AWG A;  1FKT A;  3IKD A;  1TCO C;  3O5G A;  1KT1 A;  2D9F A;  3KZ7 A;  4TW6 A;  5DIT A;  1ZK6 A;  3KAC A;  3O5P A;  3KAD A;  4TNS A;  4W9P A;  2F4E A;  2DG9 A;  2Q5A A;  4ODL A;  1NMV A;  2ZQU A;  1ROT A;  4IQ2 A;  3I6C A;  2ZR5 A;  1U79 A;  3RGC A;  4ODO A;  1D7I A;  1ZCN A;  2XP3 A;  3LUO A;  3VAW A;  3UQB A;  1JNS A;  2XP4 A;  4G2P A;  4DRO A;  2Y78 A;  4QIB A;  4ITZ A;  1FKR A;  4JYS A;  3UI6 A;  2LGO A;  4DRH A;  1J4H A;  1QZ2 A;  2MNT A;  1YW5 A;  3NTP A;  4JFK A;  4LAV A;  2ITK A;  2VCD A;  5HWC A;  3NI6 A;  3O5M A;  1FKD A;  2PBC A;  2MLX A;  1FKS A;  3O5K A;  2KGJ A;  1D6O A;  3O5E A;  3UQI A;  4IQC A;  1W26 A;  4DRQ A;  1Y0O A;  3MDY B;  5B8I C;  1N1A A;  2M08 A;  2MLY A;  1FKB A;  3JXV A;  5D75 A;  1FKI A;  1J6Y A;  1D7H A;  1YAT A;  1A7X A;  2LJ4 A;  4DRM A;  2N87 A;  2F21 A;  1Q1C A;  5HKG A;  2PV2 A;  4ODQ A;  1EQ3 A;  2PPP A;  4JFJ A;  4QT2 A;  2L2S A;  4U85 A;  1HXV A;  3RFW A;  4DRJ A;  4MGV A;  1QPF A;  4G50 A;  4DT4 A;  1QPL A;  4TX0 A;  3WH0 A;  3H9R B;  4DRP A;  2ZR6 A;  2RQS A;  2DG4 A;  2MF9 A;  1FKL A;  3NRK A;  2F2D A;  3IK8 A;  4FN2 A;  2ZQS A;  5HW7 A;  2KE0 A;  3O5D A;  1ROU A;  3GPK A;  1Q6H A;  1EYM A;  2RSE A;  3B7X A;  3KAG A;  4LAY A;  4ODM A;  4U86 A;  2UZ5 A;  4C02 B;  4IPX A;  2RUD A;  2KI3 A;  2ZQT A;  4LAW A;  1FD9 A;  2PV1 A;  1PBK A;  1NSG A;  1FKK A;  1Q6U A;  5HW8 A;  3O5I A;  1Q6I A;  4FAP A;  1JVW A;  4BF8 A;  3JYM A;  2VN1 A;  5HTG A;  1FKF A;  1J4R A;  1JNT A;  2XP7 A;  2M2A A;  3UF8 A;  4DRN A;  1C9H A;  4J4O A;  5BXJ A;  4QT3 A;  2XPB A;  2JZV A;  2RUR A;  2ZR4 A;  2KO7 A;  4W9O A;  2PPN A;  4W9Q A;  3O5R A;  3CGN A;  4GIV A;  2PPO A;  5HT1 A;  2XP8 A; 
#chains in the Genus database with same CATH topology
 4DRK A;  4ZPV R;  4JFL A;  3ARQ A;  5DIV A;  2G8Z A;  1M5Y A;  1R9H A;  4DZ2 A;  2FKE A;  4LAX A;  4JFI A;  3EIP A;  2XP9 A;  4TW7 A;  2XP5 A;  2MLZ A;  1ZBW A;  1WNO A;  2OFN A;  4DH0 A;  1OGB A;  3PRA A;  4WK9 A;  1TFV A;  4TW8 A;  4KR0 B;  3KCE A;  4J4N A;  2M1I A;  4WKH A;  1GPF A;  3O5J A;  5DF0 A;  3PRB A;  1FAP A;  3WKZ A;  3UQA A;  5HWB A;  3O5L A;  4ML4 A;  5GPG A;  1F8A B;  4S3K A;  1BL4 A;  3PA7 A;  4NSB A;  3ALF A;  4DWS C;  3IKD A;  1FKT A;  3O5G A;  3ARO A;  5DIT A;  4W9P A;  2ZQU A;  4IQ2 A;  1ROT A;  4P8U A;  2DSZ A;  4WIW A;  3WQV A;  1U79 A;  1D7I A;  1FFR A;  2XP4 A;  4MPK A;  2YBT A;  3UI6 A;  1WAW A;  2ITK A;  2VCD A;  5HWC A;  4DRQ A;  5B8I C;  1N1A A;  1FKB A;  3CHE A;  1A7X A;  2F21 A;  4WKA A;  5HKG A;  2PV2 A;  1EHN A;  4QT2 A;  1NWU A;  2L2S A;  4P8X A;  4DRJ A;  1E6Z A;  1E9L A;  3WH0 A;  1E15 A;  4DRP A;  4KQZ A;  3IK8 A;  1E6P A;  1EYM A;  4LGX A;  4ZS6 A;  1RD6 A;  4LAW A;  1H0G A;  2PV1 A;  3WQW A;  1SYT A;  1Q6U A;  3AS1 A;  1JVW A;  1FKF A;  2WM0 A;  1EDQ A;  3AS3 A;  1HJX A;  4W9O A;  3CGN A;  4MNJ A;  3CHC A;  3ARY A;  1FJD A;  1H0I A;  2XP6 A;  5HUA A;  3ODK A;  2ZQV A;  3WL1 A;  4DZ3 A;  3OA5 A;  3O5O A;  4R0X A;  3ALG A;  1K9T A;  4HBO A;  2WK2 A;  3FAP A;  3PRD A;  5J6E A;  1KT0 A;  1P5Q A;  1W1Y A;  3TDB A;  2O9O A;  1HKJ A;  4ZPW R;  3TCZ A;  5HW6 A;  3IKG A;  3CHF A;  1OGG A;  3KAI A;  3WL0 A;  3G6M A;  2B31 A;  2DG3 A;  3WD2 A;  5I98 A;  3AQU A;  2DT1 A;  1NH6 A;  2RUC A;  2MPH A;  4JFM A;  1L1P A;  1FKG A;  2LKN A;  1WB0 A;  2QF8 A;  3ARX A;  2AWG A;  2F23 A;  1TCO C;  1KT1 A;  2D9F A;  1ZK6 A;  2A3C A;  3KAC A;  4TNS A;  3KAD A;  2B5U B;  2F4E A;  2DG9 A;  4IT6 A;  1HJV A;  3WD1 A;  4MTV A;  4W5U A;  1X6N A;  3VAW A;  4HBE A;  2IUZ A;  3RGC A;  1JND A;  1JNS A;  4G2P A;  2Y78 A;  2DPE A;  1FKR A;  4JYS A;  2LGO A;  4Z2L A;  1J4H A;  1YW5 A;  3NTP A;  4JFK A;  1FKD A;  1HKI A;  2MLX A;  1KFW A;  1CTN A;  4QZV B;  2M08 A;  1D7H A;  4DRM A;  2LJ4 A;  2N87 A;  5DO2 A;  4ODQ A;  3ARR A;  4U85 A;  3RFW A;  1QPF A;  3RM9 A;  1QPL A;  1W9V A;  3H9R B;  3WD4 A;  1ZBC A;  1FKL A;  2F2D A;  2OLH A;  1Q6H A;  1XRV A;  2RSE A;  3B7X A;  4Q7N A;  1X6L A;  3GTY X;  5GQB A;  4IPX A;  2RUD A;  2ZQT A;  1GUV A;  1NWT A;  3ARZ A;  3CZ8 A;  5JH8 A;  3CH9 A;  1PBK A;  5GPR A;  4L72 B;  1FKK A;  4BF8 A;  3JYM A;  2VN1 A;  1O6I A;  3PR9 A;  2XP7 A;  1C9H A;  4W9Q A;  5HT1 A;  2XP8 A;  1LJY A;  2O92 A;  3B9D A;  2A3E A;  2LPV A;  1BKF A;  3FY1 A;  2ESC A;  3IHZ A;  3WD0 A;  4Z2G A;  4NNR A;  4ODP A;  2WLY A;  4ZPT R;  1LL6 A;  2FAP A;  3WD3 A;  1FFQ A;  4Z2I A;  4DWS D;  2PV3 A;  2YBU A;  3W4R A;  1ZL1 A;  3ARS A;  1FKH A;  3EY6 A;  4S3J A;  2DT0 A;  1ZBK A;  4Q22 A;  1T11 A;  1IX5 A;  1LQ0 A;  5DIU A;  1W1V A;  1EIB A;  2G41 A;  4TW6 A;  1OWQ A;  1W9U A;  3KZ7 A;  3QOK A;  3O5P A;  4ODL A;  3AS2 A;  4DWS B;  3I6C A;  2ZR5 A;  3LUO A;  1ZCN A;  2XP3 A;  3UQB A;  4DRO A;  4QIB A;  4P8W A;  4MNM A;  1ITX A;  1QZ2 A;  1E6N A;  4PTM A;  4LAV A;  3NI6 A;  3O5M A;  2PBC A;  3ART A;  1FKS A;  1D6O A;  3UQI A;  4IQC A;  1W26 A;  1Y0O A;  3MDY B;  4L3N A;  1UR8 A;  4Z2K A;  2DSU A;  3JXV A;  5D75 A;  2PN0 A;  1J6Y A;  1LL4 A;  1E6R A;  2PPP A;  4DT4 A;  4MGV A;  4G50 A;  4TX0 A;  2RQS A;  2DG4 A;  3NRK A;  1E44 A;  4P8V A;  2KE0 A;  2ETN A;  3GPK A;  3KAG A;  4MNK A;  4ODM A;  3G6L A;  4NZC A;  4U86 A;  4C02 B;  2A3A A;  1FD9 A;  1LG1 A;  2DSV A;  3ARP A;  1ZBV A;  3WIJ A;  1Q6I A;  4FAP A;  5DEZ A;  3BXW A;  5HTG A;  1J4R A;  2M2A A;  3UF8 A;  4J4O A;  4QT3 A;  1W9P A;  2XPB A;  2JZV A;  2RUR A;  2PPN A;  3ARW A;  2DT3 A;  3RM4 A;  2PPO A;  1F40 A;  4MNL A;  3BMB A;  1NWR A;  3B8S A;  4HAR A;  3O5Q A;  1W1T A;  1HKM A;  2K8I A;  4ODR A;  4R5E A;  1NWS A;  1HKK A;  3KAF A;  3B9A A;  4TYO A;  2DT2 A;  3CGM A;  3UI4 A;  1GOI A;  3GU0 A;  2DSW A;  2KFW A;  2RUQ A;  1D7J A;  4ODK A;  2XPA A;  1D2K A;  1FKJ A;  4MSP A;  4AY1 A;  2IF4 A;  3UI5 A;  1PIN A;  3KAB A;  2KR7 A;  3O5F A;  1NMW A;  3KAH A;  1VF8 A;  3TC5 A;  3OOB A;  3ARU A;  1J4I A;  1W1P A;  4GGQ A;  4UDM A;  4DIP A;  4O2T A;  4ODN A;  4N19 A;  3JYJ A;  4U84 A;  1B6C A;  4DRI A;  5HBF A;  3RME A;  2Q5A A;  1NMV A;  1JNE A;  3ARV A;  4ODO A;  3RM8 A;  4ITZ A;  1UR9 A;  4DRH A;  2MNT A;  3O5K A;  2KGJ A;  3O5E A;  4Z2J A;  1JCH B;  2FDM A;  2PI6 A;  4Z2H A;  2MLY A;  1FKI A;  1SR0 A;  1YAT A;  1Q1C A;  1GRJ A;  1EQ3 A;  4JFJ A;  3AS0 A;  4URI A;  1HXV A;  2WLZ A;  1LG2 A;  2ZR6 A;  2MF9 A;  2P4V A;  4FN2 A;  4DWS A;  1XHG A;  5HW7 A;  2ZQS A;  4WKF A;  3O5D A;  1ROU A;  2EUL A;  4LAY A;  2AOS A;  1LL7 A;  2UZ5 A;  3CHD A;  4XAK A;  2KI3 A;  3B9E A;  1NSG A;  5HW8 A;  3O5I A;  1JNT A;  1HJW A;  3FXY A;  4DRN A;  2A3B A;  4IT4 A;  1ZU8 A;  5BXJ A;  2ZR4 A;  2KO7 A;  4WJX A;  3O5R A;  4GIV A;  4MAV A;  1ZB5 A; 
#chains in the Genus database with same CATH homology
 4DRK A;  4ZPV R;  4JFL A;  3ARQ A;  5DIV A;  2G8Z A;  1M5Y A;  1R9H A;  4DZ2 A;  2FKE A;  4LAX A;  4JFI A;  2XP9 A;  4TW7 A;  2XP5 A;  2MLZ A;  1ZBW A;  1WNO A;  2OFN A;  4DH0 A;  1OGB A;  3PRA A;  4WK9 A;  1TFV A;  4TW8 A;  4KR0 B;  3KCE A;  4J4N A;  2M1I A;  4WKH A;  1GPF A;  3O5J A;  5DF0 A;  3PRB A;  1FAP A;  3WKZ A;  3UQA A;  5HWB A;  3O5L A;  4ML4 A;  5GPG A;  1F8A B;  4S3K A;  1BL4 A;  3PA7 A;  4NSB A;  3ALF A;  4DWS C;  3O5G A;  1FKT A;  3IKD A;  3ARO A;  5DIT A;  4W9P A;  2ZQU A;  4IQ2 A;  1ROT A;  4P8U A;  2DSZ A;  4WIW A;  3WQV A;  1U79 A;  1D7I A;  1FFR A;  2XP4 A;  4MPK A;  2YBT A;  3UI6 A;  1WAW A;  2ITK A;  2VCD A;  5HWC A;  4DRQ A;  5B8I C;  1N1A A;  1FKB A;  3CHE A;  1A7X A;  2F21 A;  4WKA A;  5HKG A;  2PV2 A;  1EHN A;  4QT2 A;  1NWU A;  2L2S A;  4P8X A;  4DRJ A;  1E6Z A;  1E9L A;  3WH0 A;  1E15 A;  4DRP A;  4KQZ A;  3IK8 A;  1E6P A;  1EYM A;  4LGX A;  4ZS6 A;  1RD6 A;  4LAW A;  1H0G A;  2PV1 A;  3WQW A;  1SYT A;  1Q6U A;  3AS1 A;  1JVW A;  1FKF A;  2WM0 A;  1EDQ A;  3AS3 A;  1HJX A;  4W9O A;  3CGN A;  4MNJ A;  3CHC A;  3ARY A;  1FJD A;  1H0I A;  2XP6 A;  5HUA A;  3ODK A;  2ZQV A;  3WL1 A;  4DZ3 A;  3OA5 A;  3O5O A;  4R0X A;  3ALG A;  1K9T A;  4HBO A;  2WK2 A;  3FAP A;  3PRD A;  5J6E A;  1KT0 A;  1P5Q A;  1W1Y A;  3TDB A;  2O9O A;  1HKJ A;  4ZPW R;  3TCZ A;  5HW6 A;  3IKG A;  3CHF A;  1OGG A;  3KAI A;  3WL0 A;  3G6M A;  2B31 A;  2DG3 A;  3WD2 A;  5I98 A;  3AQU A;  2DT1 A;  1NH6 A;  2RUC A;  2MPH A;  4JFM A;  1L1P A;  1FKG A;  2LKN A;  1WB0 A;  2QF8 A;  3ARX A;  2AWG A;  1TCO C;  1KT1 A;  2D9F A;  1ZK6 A;  2A3C A;  3KAC A;  4TNS A;  3KAD A;  2F4E A;  2DG9 A;  4IT6 A;  1HJV A;  3WD1 A;  4MTV A;  4W5U A;  1X6N A;  3VAW A;  4HBE A;  2IUZ A;  3RGC A;  1JND A;  1JNS A;  4G2P A;  2Y78 A;  2DPE A;  1FKR A;  4JYS A;  2LGO A;  4Z2L A;  1J4H A;  1YW5 A;  3NTP A;  4JFK A;  1FKD A;  1HKI A;  2MLX A;  1KFW A;  1CTN A;  4QZV B;  2M08 A;  1D7H A;  4DRM A;  2LJ4 A;  2N87 A;  5DO2 A;  4ODQ A;  3ARR A;  4U85 A;  3RFW A;  1QPF A;  3RM9 A;  1QPL A;  1W9V A;  3H9R B;  3WD4 A;  1ZBC A;  1FKL A;  2F2D A;  2OLH A;  1Q6H A;  1XRV A;  2RSE A;  3B7X A;  4Q7N A;  1X6L A;  5GQB A;  4IPX A;  2RUD A;  2ZQT A;  1GUV A;  1NWT A;  3ARZ A;  3CZ8 A;  5JH8 A;  3CH9 A;  1PBK A;  5GPR A;  4L72 B;  1FKK A;  4BF8 A;  3JYM A;  2VN1 A;  1O6I A;  3PR9 A;  2XP7 A;  1C9H A;  4W9Q A;  5HT1 A;  2XP8 A;  1LJY A;  2O92 A;  3B9D A;  2A3E A;  2LPV A;  1BKF A;  3FY1 A;  2ESC A;  3IHZ A;  3WD0 A;  4Z2G A;  4NNR A;  4ODP A;  2WLY A;  4ZPT R;  1LL6 A;  2FAP A;  3WD3 A;  1FFQ A;  4Z2I A;  4DWS D;  2PV3 A;  2YBU A;  3W4R A;  1ZL1 A;  3ARS A;  1FKH A;  3EY6 A;  4S3J A;  2DT0 A;  1ZBK A;  4Q22 A;  1T11 A;  1IX5 A;  1LQ0 A;  5DIU A;  1W1V A;  1EIB A;  2G41 A;  4TW6 A;  1OWQ A;  1W9U A;  3KZ7 A;  3QOK A;  3O5P A;  4ODL A;  3AS2 A;  4DWS B;  3I6C A;  2ZR5 A;  3LUO A;  1ZCN A;  2XP3 A;  3UQB A;  4DRO A;  4QIB A;  4P8W A;  4MNM A;  1ITX A;  1QZ2 A;  1E6N A;  4PTM A;  4LAV A;  3NI6 A;  3O5M A;  2PBC A;  3ART A;  1FKS A;  1D6O A;  3UQI A;  4IQC A;  1W26 A;  1Y0O A;  3MDY B;  4L3N A;  1UR8 A;  4Z2K A;  2DSU A;  3JXV A;  5D75 A;  1J6Y A;  1LL4 A;  1E6R A;  2PPP A;  4DT4 A;  4MGV A;  4G50 A;  4TX0 A;  2RQS A;  3NRK A;  2DG4 A;  4P8V A;  2KE0 A;  3GPK A;  3KAG A;  4MNK A;  4ODM A;  3G6L A;  4NZC A;  4U86 A;  4C02 B;  2A3A A;  1FD9 A;  1LG1 A;  2DSV A;  3ARP A;  1ZBV A;  3WIJ A;  1Q6I A;  4FAP A;  5DEZ A;  3BXW A;  5HTG A;  1J4R A;  2M2A A;  3UF8 A;  4J4O A;  4QT3 A;  1W9P A;  2XPB A;  2JZV A;  2RUR A;  2PPN A;  3ARW A;  2DT3 A;  3RM4 A;  2PPO A;  1F40 A;  4MNL A;  1NWR A;  3B8S A;  4HAR A;  3O5Q A;  1W1T A;  1HKM A;  2K8I A;  4ODR A;  4R5E A;  1NWS A;  1HKK A;  3KAF A;  3B9A A;  4TYO A;  2DT2 A;  3CGM A;  3UI4 A;  1GOI A;  2DSW A;  2KFW A;  2RUQ A;  1D7J A;  4ODK A;  2XPA A;  1D2K A;  1FKJ A;  4MSP A;  4AY1 A;  2IF4 A;  3UI5 A;  1PIN A;  3KAB A;  2KR7 A;  3O5F A;  1NMW A;  3KAH A;  1VF8 A;  3TC5 A;  3OOB A;  3ARU A;  1J4I A;  1W1P A;  4GGQ A;  4DIP A;  4O2T A;  4ODN A;  4N19 A;  3JYJ A;  4U84 A;  1B6C A;  4DRI A;  5HBF A;  3RME A;  2Q5A A;  1NMV A;  1JNE A;  3ARV A;  4ODO A;  3RM8 A;  4ITZ A;  1UR9 A;  4DRH A;  2MNT A;  3O5K A;  2KGJ A;  3O5E A;  4Z2J A;  2FDM A;  2PI6 A;  4Z2H A;  2MLY A;  1FKI A;  1SR0 A;  1YAT A;  1Q1C A;  1EQ3 A;  4JFJ A;  3AS0 A;  4URI A;  1HXV A;  2WLZ A;  1LG2 A;  2ZR6 A;  2MF9 A;  4DWS A;  4FN2 A;  1XHG A;  5HW7 A;  2ZQS A;  4WKF A;  3O5D A;  1ROU A;  4LAY A;  2AOS A;  1LL7 A;  2UZ5 A;  3CHD A;  4XAK A;  2KI3 A;  3B9E A;  1NSG A;  5HW8 A;  3O5I A;  1JNT A;  1HJW A;  3FXY A;  4DRN A;  2A3B A;  4IT4 A;  1ZU8 A;  5BXJ A;  2ZR4 A;  2KO7 A;  4WJX A;  3O5R A;  4GIV A;  4MAV A;  1ZB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...