1ROTA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
b'GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP59-I
molecule tags Rotamase (isomerase)
source organism Oryctolagus cuniculus
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
total genus 26
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rotA00
2ZQTA 4G2PA 2ZQSA 3UQIA 2LJ4A 5I98A 1NMVA 2UZ5A 4IQCA 3ODKA 1ROUA 5D75A 1JVWA 3WH0A 1Y0OA 1P5QA 1FKDA 2PPOA 2XPAA 4LAYA 4JYSA 3O5LA 3KADA 1F8AB 3MDYB 1M5YA 2L2SA 3NI6A 4DROA 3B7XA 3JYMA 4DRPA 2MPHA 1FKRA 4JFKA 4W9OA 4JFLA 2KFWA 1KT1A 4DRMA 1FKBA 1B6CA 1U79A 4DZ3A 2FAPA 3UI5A 4ODPA 4DRNA 1A7XA 1FKFA 3KABA 3IKDA 2PPNA 4TNSA 3KACA 1FKTA 2KGJA 2OFNA 3O5JA 1FKGA 4ODLA 4W9PA 3PRBA 2ZQVA 3LUOA 1BL4A 1C9HA 3O5PA 4NNRA 5HT1A 3UI6A 4QT3A 4J4OA 3OOBA 4G50A 2MF9A 2DG4A 1JNTA 1HXVA 1FD9A 1R9HA 2D9FA 5HUAA 3TCZA 4DRQA 2ZQUA 1D7IA 4U86A 4ITZA 3EY6A 3IHZA 1EYMA 1QPFA 4GIVA 4R0XA 1Q6HA 2MLXA 4ODKA 2XP8A 5GPGA 2RSEA 4LAXA 2XP9A 2ZR5A 3UQBA 1TCOC 1YW5A 5HW6A 2Q5AA 2MLZA 2RUCA 1NSGA 3KAFA 1J6YA 2F2DA 1FKLA 2LGOA 1D7JA 2DG9A 2MNTA 1F40A 1Q1CA 4QT2A 4JFIA 4U84A 3O5OA 2N87A 4MGVA 1W26A 5J6EA 4TX0A 1QZ2A 2DG3A 2M08A 3O5DA 2LKNA 2RURA 4FN2A 4ODNA 2KI3A 3O5KA 4LAWA 3O5QA 3TDBA 4C02B 3VAWA 2XPBA 2RQSA 4DRKA 2AWGA 2LPVA 1QPLA 4ODMA 2ZR6A 4TW6A 5BXJA 5HW8A 2VN1A 5HW7A 3JXVA 2PV3A 5HWCA 4TW8A 3O5EA 2M1IA 4DT4A 3PRDA 5HWBA 1PINA 1FKJA 1T11A 1FKSA 1FAPA 4DH0A 2KR7A 2KO7A 4DRHA 1N1AA 2RUDA 3TC5A 3UQAA 5HTGA 2PBCA 2VCDA 4ODQA 5B8IC 4U85A 4QIBA 4W9QA 2FKEA 4JFMA 1FKHA 2PPPA 4JFJA 1ZCNA 1FKIA 1YATA 3H9RB 4DIPA 4DZ2A 1ZK6A 2ITKA 1KT0A 3GPKA 3KAIA 2F21A 3KCEA 4MSPA 4TW7A 3CGNA 1J4IA 1J4RA 2JZVA 3O5FA 3O5GA 1PBKA 2XP7A 1FKKA 4N19A 5DIVA 3IKGA 3CGMA 1ROTA 1J4HA 2PV2A 3IK8A 4TYOA 1BKFA 2K8IA 2M2AA 2XP6A 3RGCA 2F4EA 3PA7A 5DIUA 5DITA 2XP5A 3KAHA 3KAGA 5HKGA 1D6OA 3NTPA 4IPXA 4J4NA 4IQ2A 2KE0A 2PV1A 4FAPA 4BF8A 3NRKA 3O5MA 2MLYA 4ODRA 1D7HA 3RFWA 3UI4A 4DRJA 4DRIA 3O5IA 2Y78A 1L1PA 3FAPA 2ZR4A 3KZ7A 2IF4A 2XP3A 1Q6UA 1NMWA 3O5RA 4LAVA 2XP4A 4GGQA 1FJDA 1JNSA 2RUQA 3I6CA 4ODOA 3UF8A 3JYJA 4O2TA 1Q6IA 1EQ3A
chains in the Genus database with same CATH superfamily
2ZQSA 4S3JA 4LAYA 3MDYB 3CH9A 4W9OA 4JFLA 3G6LA 2KFWA 1U79A 4DZ3A 2F23A 2FAPA 1E6PA 4WJXA 4DRNA 1A7XA 1GOIA 3KACA 2KGJA 2OFNA 1WAWA 3ARTA 3PRBA 2ZQVA 3ARPA 4QT3A 5GQBA 3OOBA 3FY1A 1HXVA 5HUAA 4DRQA 4Z2JA 2ZQUA 1D7IA 2DT0A 4ITZA 3EY6A 1EYMA 2MLXA 2XP8A 5GPGA 3WL1A 1VF8A 2WLZA 2RUCA 2DT2A 3KAFA 2O92A 1D7JA 1KFWA 1F40A 4JFIA 2ETNA 3PR9A 1QZ2A 2RURA 4MNJA 4ODNA 3O5KA 4C02B 3O5QA 4NSBA 4DRKA 4ODMA 1QPLA 5DF0A 5HWCA 1HJVA 2M1IA 1W1PA 1ITXA 2PI6A 2KR7A 3CHEA 2RUDA 3GU0A 3TC5A 4ZPWR 3UQAA 3RM9A 4S3KA 4JFMA 2DSUA 2PPPA 4JFJA 2DSZA 3AS1A 4DZ2A 1FFQA 2F21A 5DEZA 1J4IA 3WD0A 2JZVA 3ARWA 1FKKA 5DIVA 4Z2KA 3AQUA 2DPEA 2PV2A 1WNOA 4LGXA 2XP6A 5DITA 4Z2GA 3KAGA 5HKGA 4J4NA 1WB0A 2KE0A 1H0GA 2PV1A 4WK9A 4WKAA 3RFWA 3O5IA 3WD4A 3FAPA 1LQ0A 3AROA 3O5RA 1JNSA 4O2TA 3I6CA 1JCHB 1EDQA 3JYJA 4TW7A 1OGBA 2ZQTA 4G2PA 1NMVA 2G41A 2UZ5A 3ODKA 1ROUA 4MPKA 2PPOA 4JYSA 1M5YA 3B7XA 3JYMA 4HARA 2O9OA 4DWSA 1JNEA 3ALGA 1B6CA 3UI5A 1LL4A 2PPNA 2WLYA 1FKTA 4WKHA 4ODLA 1C9HA 3O5PA 4NNRA 4MAVA 2DG4A 2A3EA 3TCZA 4U86A 2ESCA 1ZU8A 2A3AA 1O6IA 1Q6HA 1TCOC 1E9LA 1J6YA 4ZPVR 3WL0A 1FKLA 1UR9A 3ALFA 2MNTA 1W26A 5J6EA 3O5DA 2DG3A 1X6NA 3B9EA 1EHNA 3RM8A 4DWSD 2KI3A 3TDBA 1HKMA 1LL7A 1XRVA 2LPVA 2VN1A 3JXVA 2PV3A 3CHFA 4P8WA 3PRDA 2EULA 3PRAA 2FDMA 2PBCA 4ODQA 4U85A 1ZBWA 4DWSB 1FKIA 4AY1A 4DIPA 1GUVA 2A3CA 1ZBVA 2ITKA 2YBUA 3KCEA 3O5FA 4N19A 1NWUA 1EIBA 3ARSA 1J4HA 4XAKA 1BKFA 3RGCA 3PA7A 2G8ZA 1NH6A 1D6OA 1OWQA 2DSWA 4Z2IA 1RD6A 4ODRA 4DRIA 1W9UA 4WIWA 4ZS6A 1FJDA 4GGQA 3ARRA 4ODOA 3UF8A 1W1TA 1EQ3A 3UQIA 2B5UB 5I98A 1JVWA 1SYTA 3ARXA 1Y0OA 1D2KA 3O5LA 2WM0A 3KADA 4DRPA 4DWSC 3ARYA 3NI6A 2MPHA 4MNLA 1KT1A 2P4VA 4DRMA 1FKBA 1FKFA 1E6ZA 1ZBKA 3IKDA 4TNSA 1XHGA 1FKGA 3WQVA 1LJYA 5HT1A 3UI6A 4J4OA 1NWSA 3CZ8A 4P8VA 4L3NA 4G50A 4W5UA 1HJXA 3B9AA 3ARQA 3IHZA 1QPFA 4GIVA 4ODKA 3EIPA 4LAXA 1TFVA 2XP9A 1LG2A 4R5EA 1NSGA 4P8XA 2F2DA 2DG9A 3B9DA 3CHDA 3O5OA 2N87A 4MGVA 2M08A 1E15A 3ARUA 1JNDA 2IUZA 4LAWA 2RQSA 2AWGA 4MNKA 5HW8A 5HW7A 4MTVA 1H0IA 3O5EA 2DSVA 4TW8A 4DT4A 1IX5A 4QZVB 1PINA 1FKJA 1T11A 4DH0A 2KO7A 4NZCA 5HTGA 1NWRA 5B8IC 4W9QA 2FKEA 4PTMA 1FKHA 1ZCNA 1YATA 4KR0B 5GPRA 1ZK6A 3GPKA 2XP7A 3BMBA 4IT6A 1K9TA 3IKGA 3CGMA 4HBOA 1ROTA 3ARVA 1ZBCA 2XP5A 3KAHA 3NTPA 4IPXA 4IQ2A 4FAPA 3RM4A 4ML4A 4BF8A 3CHCA 3NRKA 3OA5A 3O5MA 1D7HA 3WD2A 3GTYX 2Y78A 1L1PA 3AS2A 2ZR4A 4LAVA 1Q6UA 1NMWA 2XP4A 2RUQA 1X6LA 4IQCA 1Q6IA 4L72B 1ZL1A 2LJ4A 3WH0A 5D75A 1E6RA 1P5QA 1FKDA 3WQWA 2XPAA 2PN0A 2B31A 1F8AB 2L2SA 4DROA 1FKRA 4JFKA 1E44A 4ODPA 2WK2A 1CTNA 3KABA 4ZPTR 3O5JA 3QOKA 4W9PA 3LUOA 1BL4A 1UR8A 2MF9A 1JNTA 1FD9A 1R9HA 4HBEA 2D9FA 4MNMA 4KQZA 3ARZA 2YBTA 3AS3A 4R0XA 3WD1A 2RSEA 3BXWA 2ZR5A 3UQBA 1YW5A 5HW6A 2Q5AA 3WD3A 1HJWA 2MLZA 2LGOA 1NWTA 3B8SA 1W9VA 1Q1CA 1W1VA 4QT2A 4U84A 5JH8A 2OLHA 4WKFA 3G6MA 2QF8A 4TX0A 2LKNA 4FN2A 1HKJA 3WIJA 3VAWA 2XPBA 5BXJA 4TW6A 2ZR6A 2DT1A 1FFRA 4Z2LA 5HWBA 1FKSA 1FAPA 4DRHA 1N1AA 1GRJA 1GPFA 4Z2HA 2VCDA 4UDMA 1E6NA 1W1YA 1ZB5A 4QIBA 3WKZA 3H9RB 3AS0A 1SR0A 4P8UA 1KT0A 3KAIA 4MSPA 3W4RA 3CGNA 1J4RA 3O5GA 1PBKA 5HBFA 4URIA 3IK8A 3FXYA 4TYOA 2DT3A 4IT4A 2K8IA 2M2AA 3RMEA 2F4EA 5DIUA 4Q22A 1OGGA 4Q7NA 2MLYA 5DO2A 3UI4A 4DRJA 1W9PA 3KZ7A 2IF4A 2A3BA 2XP3A 1LG1A 1HKIA 2AOSA 1LL6A 1HKKA
chains in the Genus database with same CATH topology
2ZQSA 4S3JA 4LAYA 3MDYB 3CH9A 4W9OA 4JFLA 3G6LA 2KFWA 1U79A 4DZ3A 2FAPA 1E6PA 4WJXA 4DRNA 1A7XA 1GOIA 3KACA 2KGJA 2OFNA 1WAWA 3ARTA 3PRBA 2ZQVA 3ARPA 4QT3A 5GQBA 3OOBA 3FY1A 1HXVA 5HUAA 4DRQA 4Z2JA 2ZQUA 1D7IA 2DT0A 4ITZA 3EY6A 1EYMA 2MLXA 2XP8A 5GPGA 3WL1A 1VF8A 2WLZA 2RUCA 2DT2A 3KAFA 2O92A 1D7JA 1KFWA 1F40A 4JFIA 3PR9A 1QZ2A 2RURA 4MNJA 4ODNA 3O5KA 4C02B 3O5QA 4NSBA 4DRKA 4ODMA 1QPLA 5DF0A 5HWCA 1HJVA 2M1IA 1W1PA 1ITXA 2PI6A 2KR7A 3CHEA 2RUDA 3TC5A 3UQAA 4ZPWR 3RM9A 4S3KA 4JFMA 2DSUA 2PPPA 4JFJA 2DSZA 3AS1A 4DZ2A 1FFQA 2F21A 5DEZA 1J4IA 3WD0A 2JZVA 3ARWA 1FKKA 5DIVA 4Z2KA 3AQUA 2DPEA 2PV2A 1WNOA 4LGXA 2XP6A 5DITA 4Z2GA 3KAGA 5HKGA 4J4NA 1WB0A 2KE0A 1H0GA 2PV1A 4WK9A 4WKAA 3RFWA 3O5IA 3WD4A 3FAPA 1LQ0A 3AROA 3O5RA 1JNSA 4O2TA 3I6CA 1EDQA 3JYJA 4TW7A 1OGBA 2ZQTA 4G2PA 1NMVA 2G41A 2UZ5A 3ODKA 1ROUA 4MPKA 2PPOA 4JYSA 1M5YA 3B7XA 3JYMA 4HARA 2O9OA 4DWSA 1JNEA 3ALGA 1B6CA 3UI5A 1LL4A 2PPNA 2WLYA 1FKTA 4WKHA 4ODLA 1C9HA 3O5PA 4NNRA 4MAVA 2DG4A 2A3EA 3TCZA 4U86A 2ESCA 1ZU8A 2A3AA 1O6IA 1Q6HA 1TCOC 1E9LA 1J6YA 4ZPVR 3WL0A 1FKLA 1UR9A 3ALFA 2MNTA 1W26A 5J6EA 3O5DA 2DG3A 1X6NA 3B9EA 1EHNA 3RM8A 4DWSD 2KI3A 3TDBA 1HKMA 1LL7A 1XRVA 2LPVA 2VN1A 3JXVA 2PV3A 3CHFA 4P8WA 3PRDA 3PRAA 2FDMA 2PBCA 4ODQA 4U85A 1ZBWA 4DWSB 1FKIA 4AY1A 4DIPA 1GUVA 2A3CA 1ZBVA 2ITKA 2YBUA 3KCEA 3O5FA 4N19A 1NWUA 1EIBA 3ARSA 1J4HA 4XAKA 1BKFA 3RGCA 3PA7A 2G8ZA 1NH6A 1D6OA 1OWQA 2DSWA 4Z2IA 1RD6A 4ODRA 4DRIA 1W9UA 4WIWA 4ZS6A 1FJDA 4GGQA 3ARRA 4ODOA 3UF8A 1W1TA 1EQ3A 3UQIA 5I98A 1JVWA 1SYTA 3ARXA 1Y0OA 1D2KA 3O5LA 2WM0A 3KADA 4DRPA 4DWSC 3ARYA 3NI6A 2MPHA 4MNLA 1KT1A 4DRMA 1FKBA 1FKFA 1E6ZA 1ZBKA 3IKDA 4TNSA 1XHGA 1FKGA 3WQVA 1LJYA 5HT1A 3UI6A 4J4OA 1NWSA 3CZ8A 4P8VA 4L3NA 4G50A 4W5UA 1HJXA 3B9AA 3ARQA 3IHZA 1QPFA 4GIVA 4ODKA 4LAXA 1TFVA 2XP9A 1LG2A 4R5EA 1NSGA 4P8XA 2F2DA 2DG9A 3B9DA 3CHDA 3O5OA 2N87A 4MGVA 2M08A 1E15A 3ARUA 1JNDA 2IUZA 4LAWA 2RQSA 2AWGA 4MNKA 5HW8A 5HW7A 4MTVA 1H0IA 3O5EA 2DSVA 4TW8A 4DT4A 1IX5A 4QZVB 1PINA 1FKJA 1T11A 4DH0A 2KO7A 4NZCA 5HTGA 1NWRA 5B8IC 4W9QA 2FKEA 4PTMA 1FKHA 1ZCNA 1YATA 4KR0B 5GPRA 1ZK6A 3GPKA 2XP7A 4IT6A 1K9TA 3IKGA 3CGMA 4HBOA 1ROTA 3ARVA 1ZBCA 2XP5A 3KAHA 3NTPA 4IPXA 4IQ2A 4FAPA 3RM4A 4ML4A 4BF8A 3CHCA 3NRKA 3OA5A 3O5MA 1D7HA 3WD2A 2Y78A 1L1PA 3AS2A 2ZR4A 4LAVA 1Q6UA 1NMWA 2XP4A 2RUQA 1X6LA 4IQCA 1Q6IA 4L72B 1ZL1A 2LJ4A 3WH0A 5D75A 1E6RA 1P5QA 1FKDA 3WQWA 2XPAA 2B31A 1F8AB 2L2SA 4DROA 1FKRA 4JFKA 4ODPA 2WK2A 1CTNA 3KABA 4ZPTR 3O5JA 3QOKA 4W9PA 3LUOA 1BL4A 1UR8A 2MF9A 1JNTA 1FD9A 1R9HA 4HBEA 2D9FA 4MNMA 4KQZA 3ARZA 2YBTA 3AS3A 4R0XA 3WD1A 2RSEA 3BXWA 2ZR5A 3UQBA 1YW5A 5HW6A 2Q5AA 3WD3A 1HJWA 2MLZA 2LGOA 1NWTA 3B8SA 1W9VA 1Q1CA 1W1VA 4QT2A 4U84A 5JH8A 2OLHA 4WKFA 3G6MA 2QF8A 4TX0A 2LKNA 4FN2A 1HKJA 3WIJA 3VAWA 2XPBA 5BXJA 4TW6A 2ZR6A 2DT1A 1FFRA 4Z2LA 5HWBA 1FKSA 1FAPA 4DRHA 1N1AA 1GPFA 4Z2HA 2VCDA 1E6NA 1W1YA 1ZB5A 4QIBA 3WKZA 3H9RB 3AS0A 1SR0A 4P8UA 1KT0A 3KAIA 4MSPA 3W4RA 3CGNA 1J4RA 3O5GA 1PBKA 5HBFA 4URIA 3IK8A 3FXYA 4TYOA 2DT3A 4IT4A 2K8IA 2M2AA 3RMEA 2F4EA 5DIUA 4Q22A 1OGGA 4Q7NA 2MLYA 5DO2A 3UI4A 4DRJA 1W9PA 3KZ7A 2IF4A 2A3BA 2XP3A 1LG1A 1HKIA 2AOSA 1LL6A 1HKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQT A;  4G2P A;  2ZQS A;  3UQI A;  2LJ4 A;  5I98 A;  1NMV A;  2UZ5 A;  4IQC A;  3ODK A;  1ROU A;  5D75 A;  1JVW A;  3WH0 A;  1Y0O A;  1P5Q A;  1FKD A;  2PPO A;  2XPA A;  4LAY A;  4JYS A;  3O5L A;  3KAD A;  1F8A B;  3MDY B;  1M5Y A;  2L2S A;  3NI6 A;  4DRO A;  3B7X A;  3JYM A;  4DRP A;  2MPH A;  1FKR A;  4JFK A;  4W9O A;  4JFL A;  2KFW A;  1KT1 A;  4DRM A;  1FKB A;  1B6C A;  1U79 A;  4DZ3 A;  2FAP A;  3UI5 A;  4ODP A;  4DRN A;  1A7X A;  1FKF A;  3KAB A;  3IKD A;  2PPN A;  4TNS A;  3KAC A;  1FKT A;  2KGJ A;  2OFN A;  3O5J A;  1FKG A;  4ODL A;  4W9P A;  3PRB A;  2ZQV A;  3LUO A;  1BL4 A;  1C9H A;  3O5P A;  4NNR A;  5HT1 A;  3UI6 A;  4QT3 A;  4J4O A;  3OOB A;  4G50 A;  2MF9 A;  2DG4 A;  1JNT A;  1HXV A;  1FD9 A;  1R9H A;  2D9F A;  5HUA A;  3TCZ A;  4DRQ A;  2ZQU A;  1D7I A;  4U86 A;  4ITZ A;  3EY6 A;  3IHZ A;  1EYM A;  1QPF A;  4GIV A;  4R0X A;  1Q6H A;  2MLX A;  4ODK A;  2XP8 A;  5GPG A;  2RSE A;  4LAX A;  2XP9 A;  2ZR5 A;  3UQB A;  1TCO C;  1YW5 A;  5HW6 A;  2Q5A A;  2MLZ A;  2RUC A;  1NSG A;  3KAF A;  1J6Y A;  2F2D A;  1FKL A;  2LGO A;  1D7J A;  2DG9 A;  2MNT A;  1F40 A;  1Q1C A;  4QT2 A;  4JFI A;  4U84 A;  3O5O A;  2N87 A;  4MGV A;  1W26 A;  5J6E A;  4TX0 A;  1QZ2 A;  2DG3 A;  2M08 A;  3O5D A;  2LKN A;  2RUR A;  4FN2 A;  4ODN A;  2KI3 A;  3O5K A;  4LAW A;  3O5Q A;  3TDB A;  4C02 B;  3VAW A;  2XPB A;  2RQS A;  4DRK A;  2AWG A;  2LPV A;  1QPL A;  4ODM A;  2ZR6 A;  4TW6 A;  5BXJ A;  5HW8 A;  2VN1 A;  5HW7 A;  3JXV A;  2PV3 A;  5HWC A;  4TW8 A;  3O5E A;  2M1I A;  4DT4 A;  3PRD A;  5HWB A;  1PIN A;  1FKJ A;  1T11 A;  1FKS A;  1FAP A;  4DH0 A;  2KR7 A;  2KO7 A;  4DRH A;  1N1A A;  2RUD A;  3TC5 A;  3UQA A;  5HTG A;  2PBC A;  2VCD A;  4ODQ A;  5B8I C;  4U85 A;  4QIB A;  4W9Q A;  2FKE A;  4JFM A;  1FKH A;  2PPP A;  4JFJ A;  1ZCN A;  1FKI A;  1YAT A;  3H9R B;  4DIP A;  4DZ2 A;  1ZK6 A;  2ITK A;  1KT0 A;  3GPK A;  3KAI A;  2F21 A;  3KCE A;  4MSP A;  4TW7 A;  3CGN A;  1J4I A;  1J4R A;  2JZV A;  3O5F A;  3O5G A;  1PBK A;  2XP7 A;  1FKK A;  4N19 A;  5DIV A;  3IKG A;  3CGM A;  1ROT A;  1J4H A;  2PV2 A;  3IK8 A;  4TYO A;  1BKF A;  2K8I A;  2M2A A;  2XP6 A;  3RGC A;  2F4E A;  3PA7 A;  5DIU A;  5DIT A;  2XP5 A;  3KAH A;  3KAG A;  5HKG A;  1D6O A;  3NTP A;  4IPX A;  4J4N A;  4IQ2 A;  2KE0 A;  2PV1 A;  4FAP A;  4BF8 A;  3NRK A;  3O5M A;  2MLY A;  4ODR A;  1D7H A;  3RFW A;  3UI4 A;  4DRJ A;  4DRI A;  3O5I A;  2Y78 A;  1L1P A;  3FAP A;  2ZR4 A;  3KZ7 A;  2IF4 A;  2XP3 A;  1Q6U A;  1NMW A;  3O5R A;  4LAV A;  2XP4 A;  4GGQ A;  1FJD A;  1JNS A;  2RUQ A;  3I6C A;  4ODO A;  3UF8 A;  3JYJ A;  4O2T A;  1Q6I A;  1EQ3 A; 
#chains in the Genus database with same CATH topology
 2ZQS A;  4S3J A;  4LAY A;  3MDY B;  3CH9 A;  4W9O A;  4JFL A;  3G6L A;  2KFW A;  1U79 A;  4DZ3 A;  2F23 A;  2FAP A;  1E6P A;  4WJX A;  4DRN A;  1A7X A;  1GOI A;  3KAC A;  2KGJ A;  2OFN A;  1WAW A;  3ART A;  3PRB A;  2ZQV A;  3ARP A;  4QT3 A;  5GQB A;  3OOB A;  3FY1 A;  1HXV A;  5HUA A;  4DRQ A;  4Z2J A;  2ZQU A;  1D7I A;  2DT0 A;  4ITZ A;  3EY6 A;  1EYM A;  2MLX A;  2XP8 A;  5GPG A;  3WL1 A;  1VF8 A;  2WLZ A;  2RUC A;  2DT2 A;  3KAF A;  2O92 A;  1D7J A;  1KFW A;  1F40 A;  4JFI A;  2ETN A;  3PR9 A;  1QZ2 A;  2RUR A;  4MNJ A;  4ODN A;  3O5K A;  4C02 B;  3O5Q A;  4NSB A;  4DRK A;  4ODM A;  1QPL A;  5DF0 A;  5HWC A;  1HJV A;  2M1I A;  1W1P A;  1ITX A;  2PI6 A;  2KR7 A;  3CHE A;  2RUD A;  3GU0 A;  3TC5 A;  4ZPW R;  3UQA A;  3RM9 A;  4S3K A;  4JFM A;  2DSU A;  2PPP A;  4JFJ A;  2DSZ A;  3AS1 A;  4DZ2 A;  1FFQ A;  2F21 A;  5DEZ A;  1J4I A;  3WD0 A;  2JZV A;  3ARW A;  1FKK A;  5DIV A;  4Z2K A;  3AQU A;  2DPE A;  2PV2 A;  1WNO A;  4LGX A;  2XP6 A;  5DIT A;  4Z2G A;  3KAG A;  5HKG A;  4J4N A;  1WB0 A;  2KE0 A;  1H0G A;  2PV1 A;  4WK9 A;  4WKA A;  3RFW A;  3O5I A;  3WD4 A;  3FAP A;  1LQ0 A;  3ARO A;  3O5R A;  1JNS A;  4O2T A;  3I6C A;  1JCH B;  1EDQ A;  3JYJ A;  4TW7 A;  1OGB A;  2ZQT A;  4G2P A;  1NMV A;  2G41 A;  2UZ5 A;  3ODK A;  1ROU A;  4MPK A;  2PPO A;  4JYS A;  1M5Y A;  3B7X A;  3JYM A;  4HAR A;  2O9O A;  4DWS A;  1JNE A;  3ALG A;  1B6C A;  3UI5 A;  1LL4 A;  2PPN A;  2WLY A;  1FKT A;  4WKH A;  4ODL A;  1C9H A;  3O5P A;  4NNR A;  4MAV A;  2DG4 A;  2A3E A;  3TCZ A;  4U86 A;  2ESC A;  1ZU8 A;  2A3A A;  1O6I A;  1Q6H A;  1TCO C;  1E9L A;  1J6Y A;  4ZPV R;  3WL0 A;  1FKL A;  1UR9 A;  3ALF A;  2MNT A;  1W26 A;  5J6E A;  3O5D A;  2DG3 A;  1X6N A;  3B9E A;  1EHN A;  3RM8 A;  4DWS D;  2KI3 A;  3TDB A;  1HKM A;  1LL7 A;  1XRV A;  2LPV A;  2VN1 A;  3JXV A;  2PV3 A;  3CHF A;  4P8W A;  3PRD A;  2EUL A;  3PRA A;  2FDM A;  2PBC A;  4ODQ A;  4U85 A;  1ZBW A;  4DWS B;  1FKI A;  4AY1 A;  4DIP A;  1GUV A;  2A3C A;  1ZBV A;  2ITK A;  2YBU A;  3KCE A;  3O5F A;  4N19 A;  1NWU A;  1EIB A;  3ARS A;  1J4H A;  4XAK A;  1BKF A;  3RGC A;  3PA7 A;  2G8Z A;  1NH6 A;  1D6O A;  1OWQ A;  2DSW A;  4Z2I A;  1RD6 A;  4ODR A;  4DRI A;  1W9U A;  4WIW A;  4ZS6 A;  1FJD A;  4GGQ A;  3ARR A;  4ODO A;  3UF8 A;  1W1T A;  1EQ3 A;  3UQI A;  2B5U B;  5I98 A;  1JVW A;  1SYT A;  3ARX A;  1Y0O A;  1D2K A;  3O5L A;  2WM0 A;  3KAD A;  4DRP A;  4DWS C;  3ARY A;  3NI6 A;  2MPH A;  4MNL A;  1KT1 A;  2P4V A;  4DRM A;  1FKB A;  1FKF A;  1E6Z A;  1ZBK A;  3IKD A;  4TNS A;  1XHG A;  1FKG A;  3WQV A;  1LJY A;  5HT1 A;  3UI6 A;  4J4O A;  1NWS A;  3CZ8 A;  4P8V A;  4L3N A;  4G50 A;  4W5U A;  1HJX A;  3B9A A;  3ARQ A;  3IHZ A;  1QPF A;  4GIV A;  4ODK A;  3EIP A;  4LAX A;  1TFV A;  2XP9 A;  1LG2 A;  4R5E A;  1NSG A;  4P8X A;  2F2D A;  2DG9 A;  3B9D A;  3CHD A;  3O5O A;  2N87 A;  4MGV A;  2M08 A;  1E15 A;  3ARU A;  1JND A;  2IUZ A;  4LAW A;  2RQS A;  2AWG A;  4MNK A;  5HW8 A;  5HW7 A;  4MTV A;  1H0I A;  3O5E A;  2DSV A;  4TW8 A;  4DT4 A;  1IX5 A;  4QZV B;  1PIN A;  1FKJ A;  1T11 A;  4DH0 A;  2KO7 A;  4NZC A;  5HTG A;  1NWR A;  5B8I C;  4W9Q A;  2FKE A;  4PTM A;  1FKH A;  1ZCN A;  1YAT A;  4KR0 B;  5GPR A;  1ZK6 A;  3GPK A;  2XP7 A;  3BMB A;  4IT6 A;  1K9T A;  3IKG A;  3CGM A;  4HBO A;  1ROT A;  3ARV A;  1ZBC A;  2XP5 A;  3KAH A;  3NTP A;  4IPX A;  4IQ2 A;  4FAP A;  3RM4 A;  4ML4 A;  4BF8 A;  3CHC A;  3NRK A;  3OA5 A;  3O5M A;  1D7H A;  3WD2 A;  3GTY X;  2Y78 A;  1L1P A;  3AS2 A;  2ZR4 A;  4LAV A;  1Q6U A;  1NMW A;  2XP4 A;  2RUQ A;  1X6L A;  4IQC A;  1Q6I A;  4L72 B;  1ZL1 A;  2LJ4 A;  3WH0 A;  5D75 A;  1E6R A;  1P5Q A;  1FKD A;  3WQW A;  2XPA A;  2PN0 A;  2B31 A;  1F8A B;  2L2S A;  4DRO A;  1FKR A;  4JFK A;  1E44 A;  4ODP A;  2WK2 A;  1CTN A;  3KAB A;  4ZPT R;  3O5J A;  3QOK A;  4W9P A;  3LUO A;  1BL4 A;  1UR8 A;  2MF9 A;  1JNT A;  1FD9 A;  1R9H A;  4HBE A;  2D9F A;  4MNM A;  4KQZ A;  3ARZ A;  2YBT A;  3AS3 A;  4R0X A;  3WD1 A;  2RSE A;  3BXW A;  2ZR5 A;  3UQB A;  1YW5 A;  5HW6 A;  2Q5A A;  3WD3 A;  1HJW A;  2MLZ A;  2LGO A;  1NWT A;  3B8S A;  1W9V A;  1Q1C A;  1W1V A;  4QT2 A;  4U84 A;  5JH8 A;  2OLH A;  4WKF A;  3G6M A;  2QF8 A;  4TX0 A;  2LKN A;  4FN2 A;  1HKJ A;  3WIJ A;  3VAW A;  2XPB A;  5BXJ A;  4TW6 A;  2ZR6 A;  2DT1 A;  1FFR A;  4Z2L A;  5HWB A;  1FKS A;  1FAP A;  4DRH A;  1N1A A;  1GRJ A;  1GPF A;  4Z2H A;  2VCD A;  4UDM A;  1E6N A;  1W1Y A;  1ZB5 A;  4QIB A;  3WKZ A;  3H9R B;  3AS0 A;  1SR0 A;  4P8U A;  1KT0 A;  3KAI A;  4MSP A;  3W4R A;  3CGN A;  1J4R A;  3O5G A;  1PBK A;  5HBF A;  4URI A;  3IK8 A;  3FXY A;  4TYO A;  2DT3 A;  4IT4 A;  2K8I A;  2M2A A;  3RME A;  2F4E A;  5DIU A;  4Q22 A;  1OGG A;  4Q7N A;  2MLY A;  5DO2 A;  3UI4 A;  4DRJ A;  1W9P A;  3KZ7 A;  2IF4 A;  2A3B A;  2XP3 A;  1LG1 A;  1HKI A;  2AOS A;  1LL6 A;  1HKK A; 
#chains in the Genus database with same CATH homology
 2ZQS A;  4S3J A;  4LAY A;  3MDY B;  3CH9 A;  4W9O A;  4JFL A;  3G6L A;  2KFW A;  1U79 A;  4DZ3 A;  2FAP A;  1E6P A;  4WJX A;  4DRN A;  1A7X A;  1GOI A;  3KAC A;  2KGJ A;  2OFN A;  1WAW A;  3ART A;  3PRB A;  2ZQV A;  3ARP A;  4QT3 A;  5GQB A;  3OOB A;  3FY1 A;  1HXV A;  5HUA A;  4DRQ A;  4Z2J A;  2ZQU A;  1D7I A;  2DT0 A;  4ITZ A;  3EY6 A;  1EYM A;  2MLX A;  2XP8 A;  5GPG A;  3WL1 A;  1VF8 A;  2WLZ A;  2RUC A;  2DT2 A;  3KAF A;  2O92 A;  1D7J A;  1KFW A;  1F40 A;  4JFI A;  3PR9 A;  1QZ2 A;  2RUR A;  4MNJ A;  4ODN A;  3O5K A;  4C02 B;  3O5Q A;  4NSB A;  4DRK A;  4ODM A;  1QPL A;  5DF0 A;  5HWC A;  1HJV A;  2M1I A;  1W1P A;  1ITX A;  2PI6 A;  2KR7 A;  3CHE A;  2RUD A;  3TC5 A;  3UQA A;  4ZPW R;  3RM9 A;  4S3K A;  4JFM A;  2DSU A;  2PPP A;  4JFJ A;  2DSZ A;  3AS1 A;  4DZ2 A;  1FFQ A;  2F21 A;  5DEZ A;  1J4I A;  3WD0 A;  2JZV A;  3ARW A;  1FKK A;  5DIV A;  4Z2K A;  3AQU A;  2DPE A;  2PV2 A;  1WNO A;  4LGX A;  2XP6 A;  5DIT A;  4Z2G A;  3KAG A;  5HKG A;  4J4N A;  1WB0 A;  2KE0 A;  1H0G A;  2PV1 A;  4WK9 A;  4WKA A;  3RFW A;  3O5I A;  3WD4 A;  3FAP A;  1LQ0 A;  3ARO A;  3O5R A;  1JNS A;  4O2T A;  3I6C A;  1EDQ A;  3JYJ A;  4TW7 A;  1OGB A;  2ZQT A;  4G2P A;  1NMV A;  2G41 A;  2UZ5 A;  3ODK A;  1ROU A;  4MPK A;  2PPO A;  4JYS A;  1M5Y A;  3B7X A;  3JYM A;  4HAR A;  2O9O A;  4DWS A;  1JNE A;  3ALG A;  1B6C A;  3UI5 A;  1LL4 A;  2PPN A;  2WLY A;  1FKT A;  4WKH A;  4ODL A;  1C9H A;  3O5P A;  4NNR A;  4MAV A;  2DG4 A;  2A3E A;  3TCZ A;  4U86 A;  2ESC A;  1ZU8 A;  2A3A A;  1O6I A;  1Q6H A;  1TCO C;  1E9L A;  1J6Y A;  4ZPV R;  3WL0 A;  1FKL A;  1UR9 A;  3ALF A;  2MNT A;  1W26 A;  5J6E A;  3O5D A;  2DG3 A;  1X6N A;  3B9E A;  1EHN A;  3RM8 A;  4DWS D;  2KI3 A;  3TDB A;  1HKM A;  1LL7 A;  1XRV A;  2LPV A;  2VN1 A;  3JXV A;  2PV3 A;  3CHF A;  4P8W A;  3PRD A;  3PRA A;  2FDM A;  2PBC A;  4ODQ A;  4U85 A;  1ZBW A;  4DWS B;  1FKI A;  4AY1 A;  4DIP A;  1GUV A;  2A3C A;  1ZBV A;  2ITK A;  2YBU A;  3KCE A;  3O5F A;  4N19 A;  1NWU A;  1EIB A;  3ARS A;  1J4H A;  4XAK A;  1BKF A;  3RGC A;  3PA7 A;  2G8Z A;  1NH6 A;  1D6O A;  1OWQ A;  2DSW A;  4Z2I A;  1RD6 A;  4ODR A;  4DRI A;  1W9U A;  4WIW A;  4ZS6 A;  1FJD A;  4GGQ A;  3ARR A;  4ODO A;  3UF8 A;  1W1T A;  1EQ3 A;  3UQI A;  5I98 A;  1JVW A;  1SYT A;  3ARX A;  1Y0O A;  1D2K A;  3O5L A;  2WM0 A;  3KAD A;  4DRP A;  4DWS C;  3ARY A;  3NI6 A;  2MPH A;  4MNL A;  1KT1 A;  4DRM A;  1FKB A;  1FKF A;  1E6Z A;  1ZBK A;  3IKD A;  4TNS A;  1XHG A;  1FKG A;  3WQV A;  1LJY A;  5HT1 A;  3UI6 A;  4J4O A;  1NWS A;  3CZ8 A;  4P8V A;  4L3N A;  4G50 A;  4W5U A;  1HJX A;  3B9A A;  3ARQ A;  3IHZ A;  1QPF A;  4GIV A;  4ODK A;  4LAX A;  1TFV A;  2XP9 A;  1LG2 A;  4R5E A;  1NSG A;  4P8X A;  2F2D A;  2DG9 A;  3B9D A;  3CHD A;  3O5O A;  2N87 A;  4MGV A;  2M08 A;  1E15 A;  3ARU A;  1JND A;  2IUZ A;  4LAW A;  2RQS A;  2AWG A;  4MNK A;  5HW8 A;  5HW7 A;  4MTV A;  1H0I A;  3O5E A;  2DSV A;  4TW8 A;  4DT4 A;  1IX5 A;  4QZV B;  1PIN A;  1FKJ A;  1T11 A;  4DH0 A;  2KO7 A;  4NZC A;  5HTG A;  1NWR A;  5B8I C;  4W9Q A;  2FKE A;  4PTM A;  1FKH A;  1ZCN A;  1YAT A;  4KR0 B;  5GPR A;  1ZK6 A;  3GPK A;  2XP7 A;  4IT6 A;  1K9T A;  3IKG A;  3CGM A;  4HBO A;  1ROT A;  3ARV A;  1ZBC A;  2XP5 A;  3KAH A;  3NTP A;  4IPX A;  4IQ2 A;  4FAP A;  3RM4 A;  4ML4 A;  4BF8 A;  3CHC A;  3NRK A;  3OA5 A;  3O5M A;  1D7H A;  3WD2 A;  2Y78 A;  1L1P A;  3AS2 A;  2ZR4 A;  4LAV A;  1Q6U A;  1NMW A;  2XP4 A;  2RUQ A;  1X6L A;  4IQC A;  1Q6I A;  4L72 B;  1ZL1 A;  2LJ4 A;  3WH0 A;  5D75 A;  1E6R A;  1P5Q A;  1FKD A;  3WQW A;  2XPA A;  2B31 A;  1F8A B;  2L2S A;  4DRO A;  1FKR A;  4JFK A;  4ODP A;  2WK2 A;  1CTN A;  3KAB A;  4ZPT R;  3O5J A;  3QOK A;  4W9P A;  3LUO A;  1BL4 A;  1UR8 A;  2MF9 A;  1JNT A;  1FD9 A;  1R9H A;  4HBE A;  2D9F A;  4MNM A;  4KQZ A;  3ARZ A;  2YBT A;  3AS3 A;  4R0X A;  3WD1 A;  2RSE A;  3BXW A;  2ZR5 A;  3UQB A;  1YW5 A;  5HW6 A;  2Q5A A;  3WD3 A;  1HJW A;  2MLZ A;  2LGO A;  1NWT A;  3B8S A;  1W9V A;  1Q1C A;  1W1V A;  4QT2 A;  4U84 A;  5JH8 A;  2OLH A;  4WKF A;  3G6M A;  2QF8 A;  4TX0 A;  2LKN A;  4FN2 A;  1HKJ A;  3WIJ A;  3VAW A;  2XPB A;  5BXJ A;  4TW6 A;  2ZR6 A;  2DT1 A;  1FFR A;  4Z2L A;  5HWB A;  1FKS A;  1FAP A;  4DRH A;  1N1A A;  1GPF A;  4Z2H A;  2VCD A;  1E6N A;  1W1Y A;  1ZB5 A;  4QIB A;  3WKZ A;  3H9R B;  3AS0 A;  1SR0 A;  4P8U A;  1KT0 A;  3KAI A;  4MSP A;  3W4R A;  3CGN A;  1J4R A;  3O5G A;  1PBK A;  5HBF A;  4URI A;  3IK8 A;  3FXY A;  4TYO A;  2DT3 A;  4IT4 A;  2K8I A;  2M2A A;  3RME A;  2F4E A;  5DIU A;  4Q22 A;  1OGG A;  4Q7N A;  2MLY A;  5DO2 A;  3UI4 A;  4DRJ A;  1W9P A;  3KZ7 A;  2IF4 A;  2A3B A;  2XP3 A;  1LG1 A;  1HKI A;  2AOS A;  1LL6 A;  1HKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...