1ROTA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rotamase (isomerase)
molecule keywords FKBP59-I
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 26
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rotA00
1B6CA 1FJDA 5HKGA 3ODKA 2IF4A 4ODQA 3NRKA 1ZCNA 2XP5A 5GPGA 2OFNA 3O5JA 2D9FA 3I6CA 1C9HA 5DIUA 2PPNA 1A7XA 1QZ2A 1YW5A 4J4NA 2M08A 2ZR5A 4TW8A 4DRHA 4ODNA 4TW6A 1F40A 2PPOA 2DG3A 4G2PA 4LAWA 2K8IA 4W9OA 4IPXA 2KE0A 3LUOA 4DRKA 1J6YA 3NI6A 2ZQVA 4DIPA 4DRIA 5HWBA 5J6EA 3TCZA 1JVWA 2XP6A 1FKKA 1M5YA 3UI5A 2UZ5A 5BXJA 4MSPA 3UQBA 4NNRA 2L2SA 3O5EA 1YATA 3O5PA 4G50A 4DRQA 3O5KA 4DZ3A 2Q5AA 3CGMA 1QPFA 4ITZA 4ODMA 4DRMA 3B7XA 1FKRA 1Q6IA 2MLZA 1NMVA 3IKGA 2MF9A 3KCEA 4DRJA 4JFLA 3JYJA 1Q1CA 2KI3A 1KT1A 1D7HA 1BL4A 1Q6UA 2FKEA 1KT0A 2ZR4A 4ODRA 1D6OA 4U85A 3O5OA 4DRNA 2RUDA 3JXVA 1FKIA 2XP7A 1NMWA 1ROUA 1PINA 4GGQA 1FKGA 2KR7A 2DG9A 4TNSA 4TX0A 5DIVA 3VAWA 3UQAA 4JFJA 4DT4A 4GIVA 1ROTA 4QT2A 2RQSA 2XPBA 2F2DA 4JFIA 4QIBA 2MPHA 4MGVA 1FKLA 4LAXA 2ZQTA 1TCOC 2KO7A 1D7IA 2DG4A 1FAPA 1BKFA 3O5MA 5B8IC 1W26A 4IQ2A 3MDYB 3KAGA 1D7JA 4DROA 4ODKA 3KACA 4TW7A 3KADA 3UI6A 4ODPA 2Y78A 2PV3A 2XP9A 3O5FA 3PRDA 2M1IA 3CGNA 4C02B 1U79A 2PV2A 4O2TA 2LJ4A 1J4IA 2KFWA 5D75A 3KZ7A 2ITKA 3UQIA 5HW6A 2MLYA 4J4OA 2F21A 2ZQUA 4JYSA 1FKFA 1FKJA 2FAPA 2ZQSA 3RGCA 5HTGA 4LAVA 2VCDA 3O5QA 1FKTA 1J4RA 2RURA 2XP4A 1JNTA 2N87A 2LGOA 4IQCA 4U86A 1FD9A 1HXVA 3PA7A 4W9QA 1ZK6A 4BF8A 2KGJA 3H9RB 1FKSA 3JYMA 1R9HA 2LPVA 2MLXA 4JFKA 2M2AA 1Y0OA 3PRBA 4R0XA 5HUAA 1EYMA 1L1PA 3O5GA 2XP3A 4U84A 4DZ2A 2AWGA 1FKBA 3TDBA 2PPPA 3GPKA 3KAIA 4FN2A 2ZR6A 5HT1A 1Q6HA 4DH0A 2RUQA 2XPAA 1P5QA 1FKDA 4ODLA 3O5DA 2RSEA 1FKHA 3IKDA 5I98A 3O5RA 4TYOA 4LAYA 3TC5A 4DRPA 4FAPA 3UI4A 3NTPA 3EY6A 3RFWA 3O5LA 1N1AA 2VN1A 5DITA 4QT3A 4N19A 3WH0A 3KABA 3OOBA 1J4HA 1QPLA 2PBCA 2PV1A 2XP8A 3O5IA 3FAPA 2LKNA 1PBKA 4W9PA 1JNSA 5HW8A 2MNTA 2JZVA 2RUCA 1F8AB 3IK8A 1NSGA 4JFMA 3IHZA 3UF8A 4ODOA 5HWCA 2F4EA 1T11A 1EQ3A 3KAFA 5HW7A 3KAHA
chains in the Genus database with same CATH superfamily
2DSVA 4MAVA 3ODKA 2IF4A 3NRKA 3ARYA 1C9HA 1A7XA 4MNLA 4DRHA 4TW8A 4G2PA 4LAWA 2K8IA 1CTNA 4W9OA 4IPXA 3LUOA 4R5EA 4DIPA 3RM8A 5HWBA 4MNMA 4HARA 1M5YA 1ZBVA 4UDMA 4Z2JA 2DSZA 2L2SA 3WQWA 4G50A 1EHNA 4DRMA 4URIA 1FKRA 4HBEA 3KCEA 4DRJA 1W1VA 3WD4A 1Q1CA 4ZPTR 3RM4A 4ODRA 1HKIA 2RUDA 3WD3A 1NMWA 4GGQA 3VAWA 2KR7A 2DG9A 1XRVA 4LAXA 1D7IA 1W26A 4IQ2A 1H0IA 1D7JA 1WB0A 1X6NA 4ODPA 2Y78A 2XP9A 1NWRA 2M1IA 5HBFA 3KZ7A 2PI6A 1O6IA 2DT0A 4Q22A 1W1PA 4LAVA 3O5QA 4DWSB 3ARPA 4S3KA 2LGOA 1FD9A 3WIJA 2DT1A 2KGJA 3H9RB 2PN0A 2LPVA 4JFKA 1EYMA 1L1PA 2XP3A 4FN2A 1VF8A 4XAKA 4ZS6A 2RUQA 1WAWA 3IKDA 4Z2IA 1N1AA 3B9DA 1ZL1A 3GTYX 3KABA 4NSBA 1TFVA 3FAPA 2LKNA 4Z2LA 4Q7NA 1JNSA 2RUCA 1F8AB 4IT6A 3PR9A 2F4EA 1IX5A 1B6CA 4HBOA 1ZCNA 3O5JA 3I6CA 4QZVB 1QZ2A 1YW5A 4MNJA 4KQZA 4DWSC 4ODNA 2PPOA 3G6MA 2AOSA 1JVWA 1RD6A 1FKKA 4DWSA 2UZ5A 2O92A 1EDQA 2FDMA 4DZ3A 4DRQA 3O5KA 1QPFA 3GU0A 3B7XA 4ML4A 3IKGA 1LJYA 2MF9A 3WKZA 1E6NA 3ARWA 1GOIA 1BL4A 1D6OA 3JXVA 1ZBKA 1ROUA 5DIVA 3UQAA 4GIVA 2F2DA 2A3AA 4JFIA 3WL1A 1ZBWA 4QIBA 2MPHA 2ZQTA 1FAPA 1BKFA 5B8IC 3KADA 3UI6A 3O5FA 2PV3A 3CGNA 4C02B 2PV2A 1J4IA 2KFWA 3WD0A 2ITKA 1ZBCA 2F21A 2ZQUA 4JYSA 2G41A 1FKJA 2ZQSA 5HTGA 1LL7A 2XP4A 1J4RA 3RM9A 1X6LA 4U86A 1HJVA 4BF8A 1J6YA 3PRAA 1FKBA 5HW7A 3GPKA 2ZR6A 1P5QA 1FKDA 2RSEA 3O5RA 4TYOA 4LAYA 3RMEA 2OLHA 3O5LA 2ETNA 2VN1A 5DITA 3CHFA 1E6RA 4PTMA 4N19A 5JH8A 2YBTA 2XP8A 3O5IA 2PV1A 3CH9A 3B9AA 3AS0A 1LG1A 4P8WA 4ZPVR 2JZVA 1D2KA 1LG2A 1NSGA 4JFMA 3IHZA 2QF8A 1UR8A 1LQ0A 3AS3A 4KR0B 4ODQA 2DT2A 5GPGA 2DT3A 4AY1A 2D9FA 4LGXA 3ARZA 4J4NA 3CHDA 2M08A 2ZR5A 3BMBA 1EIBA 2DSWA 3FY1A 1F40A 4ZPWR 3NI6A 3UI5A 5BXJA 3B9EA 3O5PA 2Q5AA 1NWSA 3ARXA 1Q6IA 3B8SA 1NMVA 3WD2A 4JFLA 3JYJA 1KT1A 1D7HA 1Q6UA 2FKEA 4L3NA 3O5OA 3G6LA 5GPRA 1FKIA 2XP7A 1PINA 1FFRA 4TX0A 1WNOA 4WKAA 1ROTA 2ESCA 3OA5A 4MGVA 1FKLA 1SYTA 1W9UA 1TCOC 2DG4A 1KFWA 3O5MA 2O9OA 1OGGA 3ALGA 4ODKA 1W9PA 2WM0A 3KACA 4TW7A 3AQUA 3PRDA 4Z2KA 1U79A 2A3CA 4O2TA 3W4RA 1HKKA 4J4OA 2DPEA 4WK9A 1HKJA 1FKTA 2RURA 1HXVA 3PA7A 1ZK6A 4P8VA 3JYMA 4R0XA 2EULA 3PRBA 2AWGA 3TDBA 5HT1A 3KAIA 1Q6HA 3ARTA 2XPAA 4ODLA 3O5DA 4W5UA 4DRPA 3BXWA 3NTPA 2B5UB 3EY6A 3RFWA 3WD1A 4QT3A 2WLZA 1OGBA 4WKFA 3OOBA 2PBCA 3CHCA 1PBKA 5HW8A 1W9VA 5HWCA 4Z2GA 1T11A 3KAFA 1HJXA 1HJWA 3QOKA 1FJDA 5HKGA 3ARUA 2XP5A 1JNEA 2OFNA 5DIUA 2PPNA 1FFQA 4L72B 1HKMA 1W1TA 2IUZA 4TW6A 2DG3A 1LL6A 3FXYA 1OWQA 5DEZA 1JCHB 2KE0A 4P8XA 4DRKA 3WL0A 2ZQVA 4DRIA 4Z2HA 5J6EA 2A3EA 3TCZA 2XP6A 1LL4A 4MSPA 3UQBA 4NNRA 1XHGA 1SR0A 3O5EA 1YATA 3CGMA 4ITZA 4ODMA 4WKHA 2MLZA 4DWSD 1ZB5A 2KI3A 4U85A 1KT0A 2ZR4A 4DRNA 1JNDA 4TNSA 1FKGA 1GRJA 4JFJA 4DT4A 3CHEA 3CZ8A 4QT2A 2RQSA 2XPBA 2KO7A 3MDYB 3KAGA 4WIWA 4DROA 1E6PA 4IT4A 2A3BA 2YBUA 5DF0A 1K9TA 1E15A 2LJ4A 2F23A 2DSUA 5D75A 3UQIA 5HW6A 2MLYA 4MTVA 4WJXA 3ARRA 1FKFA 4MPKA 1ZU8A 2FAPA 3RGCA 1NWUA 2VCDA 3ARSA 1JNTA 2WK2A 2N87A 3AS2A 4IQCA 3AS1A 4W9QA 4P8UA 5DO2A 1FKSA 4S3JA 1R9HA 1NWTA 2MLXA 5HUAA 2M2AA 1Y0OA 2WLYA 3ARVA 3O5GA 4U84A 5GQBA 4DZ2A 3AROA 2PPPA 4DH0A 3ARQA 1GPFA 1GUVA 1NH6A 1FKHA 5I98A 4NZCA 2B31A 4FAPA 3TC5A 3UI4A 1ITXA 2G8ZA 1UR9A 3EIPA 2P4VA 3ALFA 3WH0A 1E44A 1J4HA 1E9LA 1QPLA 3WQVA 4W9PA 1H0GA 2MNTA 1E6ZA 3IK8A 4MNKA 3UF8A 4ODOA 1W1YA 1EQ3A 3KAHA
chains in the Genus database with same CATH topology
2DSVA 4MAVA 3ODKA 2IF4A 3NRKA 3ARYA 1C9HA 1A7XA 4MNLA 4DRHA 4TW8A 4G2PA 4LAWA 2K8IA 1CTNA 4W9OA 4IPXA 3LUOA 4R5EA 4DIPA 3RM8A 5HWBA 4MNMA 4HARA 1M5YA 1ZBVA 4Z2JA 2DSZA 2L2SA 3WQWA 4G50A 1EHNA 4DRMA 4URIA 1FKRA 4HBEA 3KCEA 4DRJA 1W1VA 3WD4A 1Q1CA 4ZPTR 3RM4A 4ODRA 1HKIA 2RUDA 3WD3A 1NMWA 4GGQA 3VAWA 2KR7A 2DG9A 1XRVA 4LAXA 1D7IA 1W26A 4IQ2A 1H0IA 1D7JA 1WB0A 1X6NA 4ODPA 2Y78A 2XP9A 1NWRA 2M1IA 5HBFA 3KZ7A 2PI6A 1O6IA 2DT0A 4Q22A 1W1PA 4LAVA 3O5QA 4DWSB 3ARPA 4S3KA 2LGOA 1FD9A 3WIJA 2DT1A 2KGJA 3H9RB 2LPVA 4JFKA 1EYMA 1L1PA 2XP3A 4FN2A 1VF8A 4XAKA 4ZS6A 2RUQA 1WAWA 3IKDA 4Z2IA 1N1AA 3B9DA 1ZL1A 3KABA 4NSBA 1TFVA 3FAPA 2LKNA 4Z2LA 4Q7NA 1JNSA 2RUCA 1F8AB 4IT6A 3PR9A 2F4EA 1IX5A 1B6CA 4HBOA 1ZCNA 3O5JA 3I6CA 4QZVB 1QZ2A 1YW5A 4MNJA 4KQZA 4DWSC 4ODNA 2PPOA 3G6MA 2AOSA 1JVWA 1RD6A 1FKKA 4DWSA 2UZ5A 2O92A 1EDQA 2FDMA 4DZ3A 4DRQA 3O5KA 1QPFA 3B7XA 4ML4A 3IKGA 1LJYA 2MF9A 3WKZA 1E6NA 3ARWA 1GOIA 1BL4A 1D6OA 3JXVA 1ZBKA 1ROUA 5DIVA 3UQAA 4GIVA 2F2DA 2A3AA 4JFIA 3WL1A 1ZBWA 4QIBA 2MPHA 2ZQTA 1FAPA 1BKFA 5B8IC 3KADA 3UI6A 3O5FA 2PV3A 3CGNA 4C02B 2PV2A 1J4IA 2KFWA 3WD0A 2ITKA 1ZBCA 2F21A 2ZQUA 4JYSA 2G41A 1FKJA 2ZQSA 5HTGA 1LL7A 2XP4A 1J4RA 3RM9A 1X6LA 4U86A 1HJVA 4BF8A 1J6YA 3PRAA 1FKBA 5HW7A 3GPKA 2ZR6A 1P5QA 1FKDA 2RSEA 3O5RA 4TYOA 4LAYA 3RMEA 2OLHA 3O5LA 2VN1A 5DITA 3CHFA 1E6RA 4PTMA 4N19A 5JH8A 2YBTA 2XP8A 3O5IA 2PV1A 3CH9A 3B9AA 3AS0A 1LG1A 4P8WA 4ZPVR 2JZVA 1D2KA 1LG2A 1NSGA 4JFMA 3IHZA 2QF8A 1UR8A 1LQ0A 3AS3A 4KR0B 4ODQA 2DT2A 5GPGA 2DT3A 4AY1A 2D9FA 4LGXA 3ARZA 4J4NA 3CHDA 2M08A 2ZR5A 1EIBA 2DSWA 3FY1A 1F40A 4ZPWR 3NI6A 3UI5A 5BXJA 3B9EA 3O5PA 2Q5AA 1NWSA 3ARXA 1Q6IA 3B8SA 1NMVA 3WD2A 4JFLA 3JYJA 1KT1A 1D7HA 1Q6UA 2FKEA 4L3NA 3O5OA 3G6LA 5GPRA 1FKIA 2XP7A 1PINA 1FFRA 4TX0A 1WNOA 4WKAA 1ROTA 2ESCA 3OA5A 4MGVA 1FKLA 1SYTA 1W9UA 1TCOC 2DG4A 1KFWA 3O5MA 2O9OA 1OGGA 3ALGA 4ODKA 1W9PA 2WM0A 3KACA 4TW7A 3AQUA 3PRDA 4Z2KA 1U79A 2A3CA 4O2TA 3W4RA 1HKKA 4J4OA 2DPEA 4WK9A 1HKJA 1FKTA 2RURA 1HXVA 3PA7A 1ZK6A 4P8VA 3JYMA 4R0XA 3PRBA 2AWGA 3TDBA 5HT1A 3KAIA 1Q6HA 3ARTA 2XPAA 4ODLA 3O5DA 4W5UA 4DRPA 3BXWA 3NTPA 3EY6A 3RFWA 3WD1A 4QT3A 2WLZA 1OGBA 4WKFA 3OOBA 2PBCA 3CHCA 1PBKA 5HW8A 1W9VA 5HWCA 4Z2GA 1T11A 3KAFA 1HJXA 1HJWA 3QOKA 1FJDA 5HKGA 3ARUA 2XP5A 1JNEA 2OFNA 5DIUA 2PPNA 1FFQA 4L72B 1HKMA 1W1TA 2IUZA 4TW6A 2DG3A 1LL6A 3FXYA 1OWQA 5DEZA 2KE0A 4P8XA 4DRKA 3WL0A 2ZQVA 4DRIA 4Z2HA 5J6EA 2A3EA 3TCZA 2XP6A 1LL4A 4MSPA 3UQBA 4NNRA 1XHGA 1SR0A 3O5EA 1YATA 3CGMA 4ITZA 4ODMA 4WKHA 2MLZA 4DWSD 1ZB5A 2KI3A 4U85A 1KT0A 2ZR4A 4DRNA 1JNDA 4TNSA 1FKGA 4JFJA 4DT4A 3CHEA 3CZ8A 4QT2A 2RQSA 2XPBA 2KO7A 3MDYB 3KAGA 4WIWA 4DROA 1E6PA 4IT4A 2A3BA 2YBUA 5DF0A 1K9TA 1E15A 2LJ4A 2DSUA 5D75A 3UQIA 5HW6A 2MLYA 4MTVA 4WJXA 3ARRA 1FKFA 4MPKA 1ZU8A 2FAPA 3RGCA 1NWUA 2VCDA 3ARSA 1JNTA 2WK2A 2N87A 3AS2A 4IQCA 3AS1A 4W9QA 4P8UA 5DO2A 1FKSA 4S3JA 1R9HA 1NWTA 2MLXA 5HUAA 2M2AA 1Y0OA 2WLYA 3ARVA 3O5GA 4U84A 5GQBA 4DZ2A 3AROA 2PPPA 4DH0A 3ARQA 1GPFA 1GUVA 1NH6A 1FKHA 5I98A 4NZCA 2B31A 4FAPA 3TC5A 3UI4A 1ITXA 2G8ZA 1UR9A 3ALFA 3WH0A 1E9LA 1J4HA 1QPLA 3WQVA 4W9PA 1H0GA 2MNTA 1E6ZA 3IK8A 4MNKA 3UF8A 4ODOA 1W1YA 1EQ3A 3KAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6C A;  1FJD A;  5HKG A;  3ODK A;  2IF4 A;  4ODQ A;  3NRK A;  1ZCN A;  2XP5 A;  5GPG A;  2OFN A;  3O5J A;  2D9F A;  3I6C A;  1C9H A;  5DIU A;  2PPN A;  1A7X A;  1QZ2 A;  1YW5 A;  4J4N A;  2M08 A;  2ZR5 A;  4TW8 A;  4DRH A;  4ODN A;  4TW6 A;  1F40 A;  2PPO A;  2DG3 A;  4G2P A;  4LAW A;  2K8I A;  4W9O A;  4IPX A;  2KE0 A;  3LUO A;  4DRK A;  1J6Y A;  3NI6 A;  2ZQV A;  4DIP A;  4DRI A;  5HWB A;  5J6E A;  3TCZ A;  1JVW A;  2XP6 A;  1FKK A;  1M5Y A;  3UI5 A;  2UZ5 A;  5BXJ A;  4MSP A;  3UQB A;  4NNR A;  2L2S A;  3O5E A;  1YAT A;  3O5P A;  4G50 A;  4DRQ A;  3O5K A;  4DZ3 A;  2Q5A A;  3CGM A;  1QPF A;  4ITZ A;  4ODM A;  4DRM A;  3B7X A;  1FKR A;  1Q6I A;  2MLZ A;  1NMV A;  3IKG A;  2MF9 A;  3KCE A;  4DRJ A;  4JFL A;  3JYJ A;  1Q1C A;  2KI3 A;  1KT1 A;  1D7H A;  1BL4 A;  1Q6U A;  2FKE A;  1KT0 A;  2ZR4 A;  4ODR A;  1D6O A;  4U85 A;  3O5O A;  4DRN A;  2RUD A;  3JXV A;  1FKI A;  2XP7 A;  1NMW A;  1ROU A;  1PIN A;  4GGQ A;  1FKG A;  2KR7 A;  2DG9 A;  4TNS A;  4TX0 A;  5DIV A;  3VAW A;  3UQA A;  4JFJ A;  4DT4 A;  4GIV A;  1ROT A;  4QT2 A;  2RQS A;  2XPB A;  2F2D A;  4JFI A;  4QIB A;  2MPH A;  4MGV A;  1FKL A;  4LAX A;  2ZQT A;  1TCO C;  2KO7 A;  1D7I A;  2DG4 A;  1FAP A;  1BKF A;  3O5M A;  5B8I C;  1W26 A;  4IQ2 A;  3MDY B;  3KAG A;  1D7J A;  4DRO A;  4ODK A;  3KAC A;  4TW7 A;  3KAD A;  3UI6 A;  4ODP A;  2Y78 A;  2PV3 A;  2XP9 A;  3O5F A;  3PRD A;  2M1I A;  3CGN A;  4C02 B;  1U79 A;  2PV2 A;  4O2T A;  2LJ4 A;  1J4I A;  2KFW A;  5D75 A;  3KZ7 A;  2ITK A;  3UQI A;  5HW6 A;  2MLY A;  4J4O A;  2F21 A;  2ZQU A;  4JYS A;  1FKF A;  1FKJ A;  2FAP A;  2ZQS A;  3RGC A;  5HTG A;  4LAV A;  2VCD A;  3O5Q A;  1FKT A;  1J4R A;  2RUR A;  2XP4 A;  1JNT A;  2N87 A;  2LGO A;  4IQC A;  4U86 A;  1FD9 A;  1HXV A;  3PA7 A;  4W9Q A;  1ZK6 A;  4BF8 A;  2KGJ A;  3H9R B;  1FKS A;  3JYM A;  1R9H A;  2LPV A;  2MLX A;  4JFK A;  2M2A A;  1Y0O A;  3PRB A;  4R0X A;  5HUA A;  1EYM A;  1L1P A;  3O5G A;  2XP3 A;  4U84 A;  4DZ2 A;  2AWG A;  1FKB A;  3TDB A;  2PPP A;  3GPK A;  3KAI A;  4FN2 A;  2ZR6 A;  5HT1 A;  1Q6H A;  4DH0 A;  2RUQ A;  2XPA A;  1P5Q A;  1FKD A;  4ODL A;  3O5D A;  2RSE A;  1FKH A;  3IKD A;  5I98 A;  3O5R A;  4TYO A;  4LAY A;  3TC5 A;  4DRP A;  4FAP A;  3UI4 A;  3NTP A;  3EY6 A;  3RFW A;  3O5L A;  1N1A A;  2VN1 A;  5DIT A;  4QT3 A;  4N19 A;  3WH0 A;  3KAB A;  3OOB A;  1J4H A;  1QPL A;  2PBC A;  2PV1 A;  2XP8 A;  3O5I A;  3FAP A;  2LKN A;  1PBK A;  4W9P A;  1JNS A;  5HW8 A;  2MNT A;  2JZV A;  2RUC A;  1F8A B;  3IK8 A;  1NSG A;  4JFM A;  3IHZ A;  3UF8 A;  4ODO A;  5HWC A;  2F4E A;  1T11 A;  1EQ3 A;  3KAF A;  5HW7 A;  3KAH A; 
#chains in the Genus database with same CATH topology
 2DSV A;  4MAV A;  3ODK A;  2IF4 A;  3NRK A;  3ARY A;  1C9H A;  1A7X A;  4MNL A;  4DRH A;  4TW8 A;  4G2P A;  4LAW A;  2K8I A;  1CTN A;  4W9O A;  4IPX A;  3LUO A;  4R5E A;  4DIP A;  3RM8 A;  5HWB A;  4MNM A;  4HAR A;  1M5Y A;  1ZBV A;  4UDM A;  4Z2J A;  2DSZ A;  2L2S A;  3WQW A;  4G50 A;  1EHN A;  4DRM A;  4URI A;  1FKR A;  4HBE A;  3KCE A;  4DRJ A;  1W1V A;  3WD4 A;  1Q1C A;  4ZPT R;  3RM4 A;  4ODR A;  1HKI A;  2RUD A;  3WD3 A;  1NMW A;  4GGQ A;  3VAW A;  2KR7 A;  2DG9 A;  1XRV A;  4LAX A;  1D7I A;  1W26 A;  4IQ2 A;  1H0I A;  1D7J A;  1WB0 A;  1X6N A;  4ODP A;  2Y78 A;  2XP9 A;  1NWR A;  2M1I A;  5HBF A;  3KZ7 A;  2PI6 A;  1O6I A;  2DT0 A;  4Q22 A;  1W1P A;  4LAV A;  3O5Q A;  4DWS B;  3ARP A;  4S3K A;  2LGO A;  1FD9 A;  3WIJ A;  2DT1 A;  2KGJ A;  3H9R B;  2PN0 A;  2LPV A;  4JFK A;  1EYM A;  1L1P A;  2XP3 A;  4FN2 A;  1VF8 A;  4XAK A;  4ZS6 A;  2RUQ A;  1WAW A;  3IKD A;  4Z2I A;  1N1A A;  3B9D A;  1ZL1 A;  3GTY X;  3KAB A;  4NSB A;  1TFV A;  3FAP A;  2LKN A;  4Z2L A;  4Q7N A;  1JNS A;  2RUC A;  1F8A B;  4IT6 A;  3PR9 A;  2F4E A;  1IX5 A;  1B6C A;  4HBO A;  1ZCN A;  3O5J A;  3I6C A;  4QZV B;  1QZ2 A;  1YW5 A;  4MNJ A;  4KQZ A;  4DWS C;  4ODN A;  2PPO A;  3G6M A;  2AOS A;  1JVW A;  1RD6 A;  1FKK A;  4DWS A;  2UZ5 A;  2O92 A;  1EDQ A;  2FDM A;  4DZ3 A;  4DRQ A;  3O5K A;  1QPF A;  3GU0 A;  3B7X A;  4ML4 A;  3IKG A;  1LJY A;  2MF9 A;  3WKZ A;  1E6N A;  3ARW A;  1GOI A;  1BL4 A;  1D6O A;  3JXV A;  1ZBK A;  1ROU A;  5DIV A;  3UQA A;  4GIV A;  2F2D A;  2A3A A;  4JFI A;  3WL1 A;  1ZBW A;  4QIB A;  2MPH A;  2ZQT A;  1FAP A;  1BKF A;  5B8I C;  3KAD A;  3UI6 A;  3O5F A;  2PV3 A;  3CGN A;  4C02 B;  2PV2 A;  1J4I A;  2KFW A;  3WD0 A;  2ITK A;  1ZBC A;  2F21 A;  2ZQU A;  4JYS A;  2G41 A;  1FKJ A;  2ZQS A;  5HTG A;  1LL7 A;  2XP4 A;  1J4R A;  3RM9 A;  1X6L A;  4U86 A;  1HJV A;  4BF8 A;  1J6Y A;  3PRA A;  1FKB A;  5HW7 A;  3GPK A;  2ZR6 A;  1P5Q A;  1FKD A;  2RSE A;  3O5R A;  4TYO A;  4LAY A;  3RME A;  2OLH A;  3O5L A;  2ETN A;  2VN1 A;  5DIT A;  3CHF A;  1E6R A;  4PTM A;  4N19 A;  5JH8 A;  2YBT A;  2XP8 A;  3O5I A;  2PV1 A;  3CH9 A;  3B9A A;  3AS0 A;  1LG1 A;  4P8W A;  4ZPV R;  2JZV A;  1D2K A;  1LG2 A;  1NSG A;  4JFM A;  3IHZ A;  2QF8 A;  1UR8 A;  1LQ0 A;  3AS3 A;  4KR0 B;  4ODQ A;  2DT2 A;  5GPG A;  2DT3 A;  4AY1 A;  2D9F A;  4LGX A;  3ARZ A;  4J4N A;  3CHD A;  2M08 A;  2ZR5 A;  3BMB A;  1EIB A;  2DSW A;  3FY1 A;  1F40 A;  4ZPW R;  3NI6 A;  3UI5 A;  5BXJ A;  3B9E A;  3O5P A;  2Q5A A;  1NWS A;  3ARX A;  1Q6I A;  3B8S A;  1NMV A;  3WD2 A;  4JFL A;  3JYJ A;  1KT1 A;  1D7H A;  1Q6U A;  2FKE A;  4L3N A;  3O5O A;  3G6L A;  5GPR A;  1FKI A;  2XP7 A;  1PIN A;  1FFR A;  4TX0 A;  1WNO A;  4WKA A;  1ROT A;  2ESC A;  3OA5 A;  4MGV A;  1FKL A;  1SYT A;  1W9U A;  1TCO C;  2DG4 A;  1KFW A;  3O5M A;  2O9O A;  1OGG A;  3ALG A;  4ODK A;  1W9P A;  2WM0 A;  3KAC A;  4TW7 A;  3AQU A;  3PRD A;  4Z2K A;  1U79 A;  2A3C A;  4O2T A;  3W4R A;  1HKK A;  4J4O A;  2DPE A;  4WK9 A;  1HKJ A;  1FKT A;  2RUR A;  1HXV A;  3PA7 A;  1ZK6 A;  4P8V A;  3JYM A;  4R0X A;  2EUL A;  3PRB A;  2AWG A;  3TDB A;  5HT1 A;  3KAI A;  1Q6H A;  3ART A;  2XPA A;  4ODL A;  3O5D A;  4W5U A;  4DRP A;  3BXW A;  3NTP A;  2B5U B;  3EY6 A;  3RFW A;  3WD1 A;  4QT3 A;  2WLZ A;  1OGB A;  4WKF A;  3OOB A;  2PBC A;  3CHC A;  1PBK A;  5HW8 A;  1W9V A;  5HWC A;  4Z2G A;  1T11 A;  3KAF A;  1HJX A;  1HJW A;  3QOK A;  1FJD A;  5HKG A;  3ARU A;  2XP5 A;  1JNE A;  2OFN A;  5DIU A;  2PPN A;  1FFQ A;  4L72 B;  1HKM A;  1W1T A;  2IUZ A;  4TW6 A;  2DG3 A;  1LL6 A;  3FXY A;  1OWQ A;  5DEZ A;  1JCH B;  2KE0 A;  4P8X A;  4DRK A;  3WL0 A;  2ZQV A;  4DRI A;  4Z2H A;  5J6E A;  2A3E A;  3TCZ A;  2XP6 A;  1LL4 A;  4MSP A;  3UQB A;  4NNR A;  1XHG A;  1SR0 A;  3O5E A;  1YAT A;  3CGM A;  4ITZ A;  4ODM A;  4WKH A;  2MLZ A;  4DWS D;  1ZB5 A;  2KI3 A;  4U85 A;  1KT0 A;  2ZR4 A;  4DRN A;  1JND A;  4TNS A;  1FKG A;  1GRJ A;  4JFJ A;  4DT4 A;  3CHE A;  3CZ8 A;  4QT2 A;  2RQS A;  2XPB A;  2KO7 A;  3MDY B;  3KAG A;  4WIW A;  4DRO A;  1E6P A;  4IT4 A;  2A3B A;  2YBU A;  5DF0 A;  1K9T A;  1E15 A;  2LJ4 A;  2F23 A;  2DSU A;  5D75 A;  3UQI A;  5HW6 A;  2MLY A;  4MTV A;  4WJX A;  3ARR A;  1FKF A;  4MPK A;  1ZU8 A;  2FAP A;  3RGC A;  1NWU A;  2VCD A;  3ARS A;  1JNT A;  2WK2 A;  2N87 A;  3AS2 A;  4IQC A;  3AS1 A;  4W9Q A;  4P8U A;  5DO2 A;  1FKS A;  4S3J A;  1R9H A;  1NWT A;  2MLX A;  5HUA A;  2M2A A;  1Y0O A;  2WLY A;  3ARV A;  3O5G A;  4U84 A;  5GQB A;  4DZ2 A;  3ARO A;  2PPP A;  4DH0 A;  3ARQ A;  1GPF A;  1GUV A;  1NH6 A;  1FKH A;  5I98 A;  4NZC A;  2B31 A;  4FAP A;  3TC5 A;  3UI4 A;  1ITX A;  2G8Z A;  1UR9 A;  3EIP A;  2P4V A;  3ALF A;  3WH0 A;  1E44 A;  1J4H A;  1E9L A;  1QPL A;  3WQV A;  4W9P A;  1H0G A;  2MNT A;  1E6Z A;  3IK8 A;  4MNK A;  3UF8 A;  4ODO A;  1W1Y A;  1EQ3 A;  3KAH A; 
#chains in the Genus database with same CATH homology
 2DSV A;  4MAV A;  3ODK A;  2IF4 A;  3NRK A;  3ARY A;  1C9H A;  1A7X A;  4MNL A;  4DRH A;  4TW8 A;  4G2P A;  4LAW A;  2K8I A;  1CTN A;  4W9O A;  4IPX A;  3LUO A;  4R5E A;  4DIP A;  3RM8 A;  5HWB A;  4MNM A;  4HAR A;  1M5Y A;  1ZBV A;  4Z2J A;  2DSZ A;  2L2S A;  3WQW A;  4G50 A;  1EHN A;  4DRM A;  4URI A;  1FKR A;  4HBE A;  3KCE A;  4DRJ A;  1W1V A;  3WD4 A;  1Q1C A;  4ZPT R;  3RM4 A;  4ODR A;  1HKI A;  2RUD A;  3WD3 A;  1NMW A;  4GGQ A;  3VAW A;  2KR7 A;  2DG9 A;  1XRV A;  4LAX A;  1D7I A;  1W26 A;  4IQ2 A;  1H0I A;  1D7J A;  1WB0 A;  1X6N A;  4ODP A;  2Y78 A;  2XP9 A;  1NWR A;  2M1I A;  5HBF A;  3KZ7 A;  2PI6 A;  1O6I A;  2DT0 A;  4Q22 A;  1W1P A;  4LAV A;  3O5Q A;  4DWS B;  3ARP A;  4S3K A;  2LGO A;  1FD9 A;  3WIJ A;  2DT1 A;  2KGJ A;  3H9R B;  2LPV A;  4JFK A;  1EYM A;  1L1P A;  2XP3 A;  4FN2 A;  1VF8 A;  4XAK A;  4ZS6 A;  2RUQ A;  1WAW A;  3IKD A;  4Z2I A;  1N1A A;  3B9D A;  1ZL1 A;  3KAB A;  4NSB A;  1TFV A;  3FAP A;  2LKN A;  4Z2L A;  4Q7N A;  1JNS A;  2RUC A;  1F8A B;  4IT6 A;  3PR9 A;  2F4E A;  1IX5 A;  1B6C A;  4HBO A;  1ZCN A;  3O5J A;  3I6C A;  4QZV B;  1QZ2 A;  1YW5 A;  4MNJ A;  4KQZ A;  4DWS C;  4ODN A;  2PPO A;  3G6M A;  2AOS A;  1JVW A;  1RD6 A;  1FKK A;  4DWS A;  2UZ5 A;  2O92 A;  1EDQ A;  2FDM A;  4DZ3 A;  4DRQ A;  3O5K A;  1QPF A;  3B7X A;  4ML4 A;  3IKG A;  1LJY A;  2MF9 A;  3WKZ A;  1E6N A;  3ARW A;  1GOI A;  1BL4 A;  1D6O A;  3JXV A;  1ZBK A;  1ROU A;  5DIV A;  3UQA A;  4GIV A;  2F2D A;  2A3A A;  4JFI A;  3WL1 A;  1ZBW A;  4QIB A;  2MPH A;  2ZQT A;  1FAP A;  1BKF A;  5B8I C;  3KAD A;  3UI6 A;  3O5F A;  2PV3 A;  3CGN A;  4C02 B;  2PV2 A;  1J4I A;  2KFW A;  3WD0 A;  2ITK A;  1ZBC A;  2F21 A;  2ZQU A;  4JYS A;  2G41 A;  1FKJ A;  2ZQS A;  5HTG A;  1LL7 A;  2XP4 A;  1J4R A;  3RM9 A;  1X6L A;  4U86 A;  1HJV A;  4BF8 A;  1J6Y A;  3PRA A;  1FKB A;  5HW7 A;  3GPK A;  2ZR6 A;  1P5Q A;  1FKD A;  2RSE A;  3O5R A;  4TYO A;  4LAY A;  3RME A;  2OLH A;  3O5L A;  2VN1 A;  5DIT A;  3CHF A;  1E6R A;  4PTM A;  4N19 A;  5JH8 A;  2YBT A;  2XP8 A;  3O5I A;  2PV1 A;  3CH9 A;  3B9A A;  3AS0 A;  1LG1 A;  4P8W A;  4ZPV R;  2JZV A;  1D2K A;  1LG2 A;  1NSG A;  4JFM A;  3IHZ A;  2QF8 A;  1UR8 A;  1LQ0 A;  3AS3 A;  4KR0 B;  4ODQ A;  2DT2 A;  5GPG A;  2DT3 A;  4AY1 A;  2D9F A;  4LGX A;  3ARZ A;  4J4N A;  3CHD A;  2M08 A;  2ZR5 A;  1EIB A;  2DSW A;  3FY1 A;  1F40 A;  4ZPW R;  3NI6 A;  3UI5 A;  5BXJ A;  3B9E A;  3O5P A;  2Q5A A;  1NWS A;  3ARX A;  1Q6I A;  3B8S A;  1NMV A;  3WD2 A;  4JFL A;  3JYJ A;  1KT1 A;  1D7H A;  1Q6U A;  2FKE A;  4L3N A;  3O5O A;  3G6L A;  5GPR A;  1FKI A;  2XP7 A;  1PIN A;  1FFR A;  4TX0 A;  1WNO A;  4WKA A;  1ROT A;  2ESC A;  3OA5 A;  4MGV A;  1FKL A;  1SYT A;  1W9U A;  1TCO C;  2DG4 A;  1KFW A;  3O5M A;  2O9O A;  1OGG A;  3ALG A;  4ODK A;  1W9P A;  2WM0 A;  3KAC A;  4TW7 A;  3AQU A;  3PRD A;  4Z2K A;  1U79 A;  2A3C A;  4O2T A;  3W4R A;  1HKK A;  4J4O A;  2DPE A;  4WK9 A;  1HKJ A;  1FKT A;  2RUR A;  1HXV A;  3PA7 A;  1ZK6 A;  4P8V A;  3JYM A;  4R0X A;  3PRB A;  2AWG A;  3TDB A;  5HT1 A;  3KAI A;  1Q6H A;  3ART A;  2XPA A;  4ODL A;  3O5D A;  4W5U A;  4DRP A;  3BXW A;  3NTP A;  3EY6 A;  3RFW A;  3WD1 A;  4QT3 A;  2WLZ A;  1OGB A;  4WKF A;  3OOB A;  2PBC A;  3CHC A;  1PBK A;  5HW8 A;  1W9V A;  5HWC A;  4Z2G A;  1T11 A;  3KAF A;  1HJX A;  1HJW A;  3QOK A;  1FJD A;  5HKG A;  3ARU A;  2XP5 A;  1JNE A;  2OFN A;  5DIU A;  2PPN A;  1FFQ A;  4L72 B;  1HKM A;  1W1T A;  2IUZ A;  4TW6 A;  2DG3 A;  1LL6 A;  3FXY A;  1OWQ A;  5DEZ A;  2KE0 A;  4P8X A;  4DRK A;  3WL0 A;  2ZQV A;  4DRI A;  4Z2H A;  5J6E A;  2A3E A;  3TCZ A;  2XP6 A;  1LL4 A;  4MSP A;  3UQB A;  4NNR A;  1XHG A;  1SR0 A;  3O5E A;  1YAT A;  3CGM A;  4ITZ A;  4ODM A;  4WKH A;  2MLZ A;  4DWS D;  1ZB5 A;  2KI3 A;  4U85 A;  1KT0 A;  2ZR4 A;  4DRN A;  1JND A;  4TNS A;  1FKG A;  4JFJ A;  4DT4 A;  3CHE A;  3CZ8 A;  4QT2 A;  2RQS A;  2XPB A;  2KO7 A;  3MDY B;  3KAG A;  4WIW A;  4DRO A;  1E6P A;  4IT4 A;  2A3B A;  2YBU A;  5DF0 A;  1K9T A;  1E15 A;  2LJ4 A;  2DSU A;  5D75 A;  3UQI A;  5HW6 A;  2MLY A;  4MTV A;  4WJX A;  3ARR A;  1FKF A;  4MPK A;  1ZU8 A;  2FAP A;  3RGC A;  1NWU A;  2VCD A;  3ARS A;  1JNT A;  2WK2 A;  2N87 A;  3AS2 A;  4IQC A;  3AS1 A;  4W9Q A;  4P8U A;  5DO2 A;  1FKS A;  4S3J A;  1R9H A;  1NWT A;  2MLX A;  5HUA A;  2M2A A;  1Y0O A;  2WLY A;  3ARV A;  3O5G A;  4U84 A;  5GQB A;  4DZ2 A;  3ARO A;  2PPP A;  4DH0 A;  3ARQ A;  1GPF A;  1GUV A;  1NH6 A;  1FKH A;  5I98 A;  4NZC A;  2B31 A;  4FAP A;  3TC5 A;  3UI4 A;  1ITX A;  2G8Z A;  1UR9 A;  3ALF A;  3WH0 A;  1E9L A;  1J4H A;  1QPL A;  3WQV A;  4W9P A;  1H0G A;  2MNT A;  1E6Z A;  3IK8 A;  4MNK A;  3UF8 A;  4ODO A;  1W1Y A;  1EQ3 A;  3KAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...