1ROTA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Rotamase (isomerase)
molecule keywords FKBP59-I
total genus 26
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rotA00
4C02B 3KAHA 2DG3A 1C9HA 1F40A 4DROA 3O5JA 2ZR6A 1ROUA 5DIUA 4FN2A 1KT1A 2LPVA 2PPNA 4U84A 5HWBA 4ODRA 5HT1A 5GPGA 5HW8A 3O5DA 4ITZA 4ODQA 1Q6UA 4JYSA 5HW7A 2MPHA 3B7XA 1D7HA 2KGJA 1A7XA 1KT0A 4G2PA 1Q6HA 5HUAA 2Q5AA 2F4EA 3KCEA 2RUCA 1J4RA 4ODMA 2L2SA 4TYOA 1U79A 3O5FA 4MGVA 4U85A 4J4NA 4JFIA 4DRHA 2MF9A 1M5YA 3O5OA 4ODKA 4W9OA 3IHZA 5D75A 1Q1CA 4DRJA 1W26A 3PRDA 2M1IA 1D6OA 1L1PA 4QT2A 3KABA 4FAPA 1Q6IA 3CGNA 3IK8A 3FAPA 3JYJA 1F8AB 1QPFA 3O5MA 4LAXA 4DRKA 2KO7A 3KAGA 2ZR5A 4G50A 5HWCA 3NTPA 1Y0OA 2PBCA 1FKBA 1T11A 2MLZA 2XP8A 2D9FA 1FKGA 3O5QA 2ZR4A 4O2TA 1J4HA 2XPBA 1FKDA 1NSGA 4IQ2A 4NNRA 1PBKA 1FKKA 1TCOC 3UQIA 4R0XA 3IKDA 2XP4A 4DRMA 2MLXA 2MNTA 2JZVA 2XP9A 4W9PA 4DT4A 2IF4A 1NMWA 1ZK6A 2Y78A 4QT3A 2PV1A 3KADA 4DRIA 4DRQA 3H9RB 2PPOA 1D7IA 1PINA 2RUDA 4TNSA 2FAPA 3KAFA 5I98A 4ODNA 2N87A 4ODOA 3JYMA 4TX0A 3UQBA 1J6YA 1NMVA 2MLYA 1FKRA 3LUOA 4GIVA 4DH0A 2F21A 3O5IA 5DITA 5J6EA 3UF8A 3MDYB 2LJ4A 3PRBA 3RGCA 3TCZA 1ZCNA 5B8IC 2XP6A 2PV2A 1D7JA 2RURA 1FD9A 1B6CA 1FKLA 2FKEA 2AWGA 3GPKA 4GGQA 3TDBA 1JNSA 2M08A 3KAIA 4DRNA 1QPLA 4N19A 2ZQSA 2DG4A 1QZ2A 2DG9A 2RUQA 3I6CA 3UI5A 1YW5A 4DZ3A 2KFWA 3UQAA 4TW8A 3O5RA 3CGMA 2PV3A 4ODLA 1R9HA 5HTGA 4DZ2A 4JFJA 1FKIA 1FKTA 1P5QA 3TC5A 5HKGA 1FKJA 4MSPA 4ODPA 2KR7A 1BKFA 3UI6A 3O5LA 2M2AA 3PA7A 1FKFA 3OOBA 2K8IA 3O5PA 3ODKA 4J4OA 1JVWA 2RQSA 4TW7A 1FKSA 5BXJA 2RSEA 2VCDA 2ZQUA 2LKNA 2XPAA 1N1AA 2UZ5A 2KE0A 3KACA 4JFLA 4LAYA 4DRPA 2XP5A 2ZQVA 2XP7A 3NI6A 4DIPA 4U86A 3O5GA 2PPPA 2ZQTA 2ITKA 1EYMA 1FKHA 2OFNA 4IQCA 4JFMA 3KZ7A 4LAWA 4LAVA 1JNTA 1HXVA 3NRKA 5DIVA 4TW6A 4JFKA 4W9QA 3VAWA 3UI4A 1FAPA 2LGOA 3RFWA 5HW6A 1FJDA 4QIBA 1ROTA 3O5KA 4BF8A 2VN1A 1EQ3A 3O5EA 4IPXA 2XP3A 3EY6A 1J4IA 2F2DA 1YATA 1BL4A 2KI3A 3JXVA 3WH0A 3IKGA
chains in the Genus database with same CATH superfamily
3KAHA 2O9OA 1NWTA 4DROA 5DIUA 1KT1A 1HKKA 4ODRA 1UR9A 5HW8A 5HW7A 3B7XA 1D7HA 4URIA 4IT4A 2KGJA 1HJVA 1E6RA 4IT6A 2L2SA 4TYOA 1ZU8A 1U79A 2A3BA 3O5FA 2DPEA 4MGVA 4U85A 2MF9A 1M5YA 1JNDA 3WQVA 3ARXA 1WAWA 1D6OA 3B9DA 3CZ8A 3OA5A 1Q6IA 3CGNA 3IK8A 1F8AB 1QPFA 4LAXA 4DRKA 4XAKA 4W9PA 2XP8A 1FKGA 2DSUA 4S3KA 4NNRA 3IKDA 2XP4A 1LG2A 4ZPVR 2IF4A 2DT1A 1FFQA 2WK2A 4DRQA 1PINA 1E15A 2N87A 2MLYA 3AS3A 4Z2IA 3CHEA 4DH0A 4Z2LA 5DF0A 1W9VA 2DT3A 3MDYB 3PRBA 3RGCA 5B8IC 3RM9A 2RURA 2FKEA 3TDBA 3GPKA 4GGQA 3AS2A 4WK9A 1QPLA 2ZQSA 1W9UA 2RUQA 1YW5A 3WL1A 4P8VA 4ODLA 4WKFA 5HTGA 3W4RA 4DZ2A 1P5QA 3TC5A 1FKJA 3ARQA 4MPKA 1K9TA 2A3CA 1W1TA 2RQSA 2ETNA 3EIPA 5BXJA 2XPAA 3KACA 4MAVA 4JFLA 4MNMA 4HBOA 2PPPA 3RMEA 4LAWA 2OLHA 3G6LA 1OGBA 3GU0A 2DT0A 2LGOA 3ARZA 4KR0B 1W1VA 1ZB5A 4MTVA 1EQ3A 3AROA 3EY6A 2FDMA 1C9HA 5DEZA 1X6LA 2ZR6A 1ROUA 4ODQA 1FFRA 3GTYX 1J4RA 4WJXA 4HBEA 3PRAA 4J4NA 4ODKA 4W9OA 3IHZA 4DRJA 1W26A 4Z2JA 3KABA 3WKZA 3JYJA 3FAPA 3WD1A 2G41A 3O5MA 4WKHA 1GOIA 3KAGA 3CHDA 1FKBA 1NSGA 1KFWA 3UQIA 1PBKA 1FKKA 1TCOC 1RD6A 1W1YA 2MLXA 2XP9A 5GQBA 2Y78A 4ZPWR 3H9RB 2PPOA 3WIJA 1NWSA 2FAPA 3UQBA 4ODNA 3JYMA 4DWSB 2F21A 3O5IA 3ARPA 3ARWA 5J6EA 1ZCNA 2PV2A 1D7JA 1FD9A 1B6CA 1JNSA 2M08A 3KAIA 4N19A 2DG4A 3UI5A 3ARVA 3UQAA 2DSVA 3CGMA 4R5EA 1SYTA 4JFJA 1HKJA 2KR7A 2M2AA 3PA7A 1JCHB 2WM0A 1NH6A 3O5PA 4WKAA 3AQUA 3BMBA 4AY1A 2ZQUA 2UZ5A 4LAYA 2KE0A 2XP5A 4DIPA 4U86A 2YBUA 1HKIA 4UDMA 1EYMA 1FKHA 2OFNA 2G8ZA 4LAVA 3B9EA 1HXVA 1LQ0A 1UR8A 3B9AA 2WLZA 2ESCA 1WB0A 5HBFA 4KQZA 4W5UA 3O5KA 4BF8A 1SR0A 1OGGA 1WNOA 3O5EA 2XP3A 3G6MA 1YATA 2KI3A 4QZVB 4Z2GA 1TFVA 2DT2A 2DG3A 1F40A 4ZS6A 1EIBA 2LPVA 4U84A 5HT1A 4WIWA 5GPGA 3O5DA 4ITZA 1Q6UA 4JYSA 2MPHA 1A7XA 1HJXA 3RM8A 1Q6HA 2YBTA 4L72B 2Q5AA 2F4EA 4ODMA 1HJWA 4NZCA 4MNKA 2B5UB 3O5OA 5D75A 3WL0A 4DWSC 2PN0A 5GPRA 3PRDA 2M1IA 1ITXA 1NWUA 2O92A 1W1PA 2ZR5A 1ZL1A 1Y0OA 2PBCA 1T11A 3O5QA 4LGXA 2ZR4A 1J4HA 2XPBA 1E6PA 4IQ2A 2MNTA 2JZVA 4DT4A 1LL4A 1ZK6A 4ZPTR 4DRIA 4MNJA 1D7IA 1CTNA 2RUDA 4TNSA 1E9LA 4TX0A 4P8XA 1J6YA 1LL7A 1ZBKA 1NMVA 3LUOA 4GIVA 3WD2A 3WD0A 3UF8A 1ZBCA 1LG1A 2DSZA 3FY1A 3ALFA 1H0GA 4DRNA 2DG9A 4S3JA 2KFWA 3B8SA 2QF8A 1R9HA 2AOSA 1FKIA 1FKTA 4P8WA 4MSPA 4ODPA 1OWQA 1BKFA 3O5LA 3PR9A 3OOBA 4J4OA 1GRJA 3AS1A 1FKSA 3ARYA 1E6NA 1N1AA 1LL6A 1D2KA 3NI6A 2XP7A 2ZQTA 2ITKA 4JFMA 4P8UA 3NRKA 4TW6A 4W9QA 3VAWA 3UI4A 1FAPA 3ARTA 3RFWA 3WD4A 4QIBA 1XHGA 2F2DA 1KT0A 3CHFA 1BL4A 3IKGA 4C02B 4L3NA 1EDQA 3O5JA 4FN2A 2PPNA 2WLYA 5HWBA 3BXWA 1LJYA 4DWSA 1JNEA 3WQWA 4G2PA 3ARRA 5HUAA 3KCEA 2RUCA 3AS0A 4DRHA 2EULA 4JFIA 1Q1CA 3WD3A 3QOKA 4Z2HA 4PTMA 4HARA 1L1PA 4QT2A 4FAPA 4DWSD 2B31A 1NWRA 2KO7A 4G50A 5HWCA 1GUVA 3NTPA 3CHCA 2MLZA 2D9FA 3FXYA 4O2TA 1FKDA 4R0XA 4DRMA 2F23A 1NMWA 1E6ZA 4QT3A 2A3AA 2PV1A 3KADA 3CH9A 3KAFA 5I98A 1H0IA 3ARUA 2IUZA 4ODOA 1FKRA 2DSWA 3ARSA 5DITA 2A3EA 2LJ4A 4MNLA 3TCZA 1XRVA 2XP6A 3ALGA 3RM4A 1FKLA 2AWGA 1ZBVA 3I6CA 1QZ2A 4DZ3A 4TW8A 3O5RA 1HKMA 2PV3A 5HKGA 3UI6A 4Z2KA 1FKFA 2K8IA 1E44A 3ODKA 1JVWA 1IX5A 4TW7A 2RSEA 2VCDA 4Q22A 1GPFA 2LKNA 4DRPA 2ZQVA 3O5GA 4ML4A 4IQCA 2P4VA 5JH8A 3KZ7A 1JNTA 1O6IA 5DIVA 4JFKA 1VF8A 4NSBA 1ZBWA 5HW6A 4Q7NA 5DO2A 1ROTA 1EHNA 1W9PA 2VN1A 2PI6A 4IPXA 1J4IA 1FJDA 1X6NA 3JXVA 3WH0A
chains in the Genus database with same CATH topology
3KAHA 2O9OA 1NWTA 4DROA 5DIUA 1KT1A 1HKKA 4ODRA 1UR9A 5HW8A 5HW7A 3B7XA 1D7HA 4URIA 4IT4A 2KGJA 1HJVA 1E6RA 4IT6A 2L2SA 4TYOA 1ZU8A 1U79A 2A3BA 3O5FA 2DPEA 4MGVA 4U85A 2MF9A 1M5YA 1JNDA 3WQVA 3ARXA 1WAWA 1D6OA 3B9DA 3CZ8A 3OA5A 1Q6IA 3CGNA 3IK8A 1F8AB 1QPFA 4LAXA 4DRKA 4XAKA 4W9PA 2XP8A 1FKGA 2DSUA 4S3KA 4NNRA 3IKDA 2XP4A 1LG2A 4ZPVR 2IF4A 2DT1A 1FFQA 2WK2A 4DRQA 1PINA 1E15A 2N87A 2MLYA 3AS3A 4Z2IA 3CHEA 4DH0A 4Z2LA 5DF0A 1W9VA 2DT3A 3MDYB 3PRBA 3RGCA 5B8IC 3RM9A 2RURA 2FKEA 3TDBA 3GPKA 4GGQA 3AS2A 4WK9A 1QPLA 2ZQSA 1W9UA 2RUQA 1YW5A 3WL1A 4P8VA 4ODLA 4WKFA 5HTGA 3W4RA 4DZ2A 1P5QA 3TC5A 1FKJA 3ARQA 4MPKA 1K9TA 2A3CA 1W1TA 2RQSA 5BXJA 2XPAA 3KACA 4MAVA 4JFLA 4MNMA 4HBOA 2PPPA 3RMEA 4LAWA 2OLHA 3G6LA 1OGBA 2DT0A 2LGOA 3ARZA 4KR0B 1W1VA 1ZB5A 4MTVA 1EQ3A 3AROA 3EY6A 2FDMA 1C9HA 5DEZA 1X6LA 2ZR6A 1ROUA 4ODQA 1FFRA 1J4RA 4WJXA 4HBEA 3PRAA 4J4NA 4ODKA 4W9OA 3IHZA 4DRJA 1W26A 4Z2JA 3KABA 3WKZA 3JYJA 3FAPA 3WD1A 2G41A 3O5MA 4WKHA 1GOIA 3KAGA 3CHDA 1FKBA 1NSGA 1KFWA 3UQIA 1PBKA 1FKKA 1TCOC 1RD6A 1W1YA 2MLXA 2XP9A 5GQBA 2Y78A 4ZPWR 3H9RB 2PPOA 3WIJA 1NWSA 2FAPA 3UQBA 4ODNA 3JYMA 4DWSB 2F21A 3O5IA 3ARPA 3ARWA 5J6EA 1ZCNA 2PV2A 1D7JA 1FD9A 1B6CA 1JNSA 2M08A 3KAIA 4N19A 2DG4A 3UI5A 3ARVA 3UQAA 2DSVA 3CGMA 4R5EA 1SYTA 4JFJA 1HKJA 2KR7A 2M2AA 3PA7A 2WM0A 1NH6A 3O5PA 4WKAA 3AQUA 4AY1A 2ZQUA 2UZ5A 4LAYA 2KE0A 2XP5A 4DIPA 4U86A 2YBUA 1HKIA 1EYMA 1FKHA 2OFNA 2G8ZA 4LAVA 3B9EA 1HXVA 1LQ0A 1UR8A 3B9AA 2WLZA 2ESCA 1WB0A 5HBFA 4KQZA 4W5UA 3O5KA 4BF8A 1SR0A 1OGGA 1WNOA 3O5EA 2XP3A 3G6MA 1YATA 2KI3A 4QZVB 4Z2GA 1TFVA 2DT2A 2DG3A 1F40A 4ZS6A 1EIBA 2LPVA 4U84A 5HT1A 4WIWA 5GPGA 3O5DA 4ITZA 1Q6UA 4JYSA 2MPHA 1A7XA 1HJXA 3RM8A 1Q6HA 2YBTA 4L72B 2Q5AA 2F4EA 4ODMA 1HJWA 4NZCA 4MNKA 3O5OA 5D75A 3WL0A 4DWSC 5GPRA 3PRDA 2M1IA 1ITXA 1NWUA 2O92A 1W1PA 2ZR5A 1ZL1A 1Y0OA 2PBCA 1T11A 3O5QA 4LGXA 2ZR4A 1J4HA 2XPBA 1E6PA 4IQ2A 2MNTA 2JZVA 4DT4A 1LL4A 1ZK6A 4ZPTR 4DRIA 4MNJA 1D7IA 1CTNA 2RUDA 4TNSA 1E9LA 4TX0A 4P8XA 1J6YA 1LL7A 1ZBKA 1NMVA 3LUOA 4GIVA 3WD2A 3WD0A 3UF8A 1ZBCA 1LG1A 2DSZA 3FY1A 3ALFA 1H0GA 4DRNA 2DG9A 4S3JA 2KFWA 3B8SA 2QF8A 1R9HA 2AOSA 1FKIA 1FKTA 4P8WA 4MSPA 4ODPA 1OWQA 1BKFA 3O5LA 3PR9A 3OOBA 4J4OA 3AS1A 1FKSA 3ARYA 1E6NA 1N1AA 1LL6A 1D2KA 3NI6A 2XP7A 2ZQTA 4JFMA 2ITKA 4P8UA 3NRKA 4TW6A 4W9QA 3VAWA 3UI4A 1FAPA 3ARTA 3RFWA 3WD4A 4QIBA 1XHGA 2F2DA 1KT0A 3CHFA 1BL4A 3IKGA 4C02B 4L3NA 1EDQA 3O5JA 4FN2A 2PPNA 2WLYA 5HWBA 3BXWA 1LJYA 4DWSA 1JNEA 3WQWA 4G2PA 3ARRA 5HUAA 3KCEA 2RUCA 3AS0A 4DRHA 4JFIA 1Q1CA 3WD3A 3QOKA 4Z2HA 4PTMA 4HARA 1L1PA 4QT2A 4FAPA 4DWSD 2B31A 1NWRA 2KO7A 4G50A 5HWCA 1GUVA 3NTPA 3CHCA 2MLZA 2D9FA 3FXYA 4O2TA 1FKDA 4R0XA 4DRMA 1NMWA 1E6ZA 4QT3A 2A3AA 2PV1A 3KADA 3CH9A 3KAFA 5I98A 1H0IA 3ARUA 2IUZA 4ODOA 1FKRA 2DSWA 3ARSA 5DITA 2A3EA 2LJ4A 4MNLA 3TCZA 1XRVA 2XP6A 3ALGA 3RM4A 1FKLA 2AWGA 1ZBVA 3I6CA 1QZ2A 4DZ3A 4TW8A 3O5RA 1HKMA 2PV3A 5HKGA 3UI6A 4Z2KA 1FKFA 2K8IA 3ODKA 1JVWA 1IX5A 4TW7A 2RSEA 2VCDA 4Q22A 1GPFA 2LKNA 4DRPA 2ZQVA 3O5GA 4ML4A 4IQCA 5JH8A 3KZ7A 1JNTA 1O6IA 5DIVA 4JFKA 1VF8A 4NSBA 1ZBWA 5HW6A 4Q7NA 5DO2A 1ROTA 1EHNA 1W9PA 2VN1A 2PI6A 4IPXA 1J4IA 1FJDA 1X6NA 3JXVA 3WH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C02 B;  3KAH A;  2DG3 A;  1C9H A;  1F40 A;  4DRO A;  3O5J A;  2ZR6 A;  1ROU A;  5DIU A;  4FN2 A;  1KT1 A;  2LPV A;  2PPN A;  4U84 A;  5HWB A;  4ODR A;  5HT1 A;  5GPG A;  5HW8 A;  3O5D A;  4ITZ A;  4ODQ A;  1Q6U A;  4JYS A;  5HW7 A;  2MPH A;  3B7X A;  1D7H A;  2KGJ A;  1A7X A;  1KT0 A;  4G2P A;  1Q6H A;  5HUA A;  2Q5A A;  2F4E A;  3KCE A;  2RUC A;  1J4R A;  4ODM A;  2L2S A;  4TYO A;  1U79 A;  3O5F A;  4MGV A;  4U85 A;  4J4N A;  4JFI A;  4DRH A;  2MF9 A;  1M5Y A;  3O5O A;  4ODK A;  4W9O A;  3IHZ A;  5D75 A;  1Q1C A;  4DRJ A;  1W26 A;  3PRD A;  2M1I A;  1D6O A;  1L1P A;  4QT2 A;  3KAB A;  4FAP A;  1Q6I A;  3CGN A;  3IK8 A;  3FAP A;  3JYJ A;  1F8A B;  1QPF A;  3O5M A;  4LAX A;  4DRK A;  2KO7 A;  3KAG A;  2ZR5 A;  4G50 A;  5HWC A;  3NTP A;  1Y0O A;  2PBC A;  1FKB A;  1T11 A;  2MLZ A;  2XP8 A;  2D9F A;  1FKG A;  3O5Q A;  2ZR4 A;  4O2T A;  1J4H A;  2XPB A;  1FKD A;  1NSG A;  4IQ2 A;  4NNR A;  1PBK A;  1FKK A;  1TCO C;  3UQI A;  4R0X A;  3IKD A;  2XP4 A;  4DRM A;  2MLX A;  2MNT A;  2JZV A;  2XP9 A;  4W9P A;  4DT4 A;  2IF4 A;  1NMW A;  1ZK6 A;  2Y78 A;  4QT3 A;  2PV1 A;  3KAD A;  4DRI A;  4DRQ A;  3H9R B;  2PPO A;  1D7I A;  1PIN A;  2RUD A;  4TNS A;  2FAP A;  3KAF A;  5I98 A;  4ODN A;  2N87 A;  4ODO A;  3JYM A;  4TX0 A;  3UQB A;  1J6Y A;  1NMV A;  2MLY A;  1FKR A;  3LUO A;  4GIV A;  4DH0 A;  2F21 A;  3O5I A;  5DIT A;  5J6E A;  3UF8 A;  3MDY B;  2LJ4 A;  3PRB A;  3RGC A;  3TCZ A;  1ZCN A;  5B8I C;  2XP6 A;  2PV2 A;  1D7J A;  2RUR A;  1FD9 A;  1B6C A;  1FKL A;  2FKE A;  2AWG A;  3GPK A;  4GGQ A;  3TDB A;  1JNS A;  2M08 A;  3KAI A;  4DRN A;  1QPL A;  4N19 A;  2ZQS A;  2DG4 A;  1QZ2 A;  2DG9 A;  2RUQ A;  3I6C A;  3UI5 A;  1YW5 A;  4DZ3 A;  2KFW A;  3UQA A;  4TW8 A;  3O5R A;  3CGM A;  2PV3 A;  4ODL A;  1R9H A;  5HTG A;  4DZ2 A;  4JFJ A;  1FKI A;  1FKT A;  1P5Q A;  3TC5 A;  5HKG A;  1FKJ A;  4MSP A;  4ODP A;  2KR7 A;  1BKF A;  3UI6 A;  3O5L A;  2M2A A;  3PA7 A;  1FKF A;  3OOB A;  2K8I A;  3O5P A;  3ODK A;  4J4O A;  1JVW A;  2RQS A;  4TW7 A;  1FKS A;  5BXJ A;  2RSE A;  2VCD A;  2ZQU A;  2LKN A;  2XPA A;  1N1A A;  2UZ5 A;  2KE0 A;  3KAC A;  4JFL A;  4LAY A;  4DRP A;  2XP5 A;  2ZQV A;  2XP7 A;  3NI6 A;  4DIP A;  4U86 A;  3O5G A;  2PPP A;  2ZQT A;  2ITK A;  1EYM A;  1FKH A;  2OFN A;  4IQC A;  4JFM A;  3KZ7 A;  4LAW A;  4LAV A;  1JNT A;  1HXV A;  3NRK A;  5DIV A;  4TW6 A;  4JFK A;  4W9Q A;  3VAW A;  3UI4 A;  1FAP A;  2LGO A;  3RFW A;  5HW6 A;  1FJD A;  4QIB A;  1ROT A;  3O5K A;  4BF8 A;  2VN1 A;  1EQ3 A;  3O5E A;  4IPX A;  2XP3 A;  3EY6 A;  1J4I A;  2F2D A;  1YAT A;  1BL4 A;  2KI3 A;  3JXV A;  3WH0 A;  3IKG A; 
#chains in the Genus database with same CATH topology
 3KAH A;  2O9O A;  1NWT A;  4DRO A;  5DIU A;  1KT1 A;  1HKK A;  4ODR A;  1UR9 A;  5HW8 A;  5HW7 A;  3B7X A;  1D7H A;  4URI A;  4IT4 A;  2KGJ A;  1HJV A;  1E6R A;  4IT6 A;  2L2S A;  4TYO A;  1ZU8 A;  1U79 A;  2A3B A;  3O5F A;  2DPE A;  4MGV A;  4U85 A;  2MF9 A;  1M5Y A;  1JND A;  3WQV A;  3ARX A;  1WAW A;  1D6O A;  3B9D A;  3CZ8 A;  3OA5 A;  1Q6I A;  3CGN A;  3IK8 A;  1F8A B;  1QPF A;  4LAX A;  4DRK A;  4XAK A;  4W9P A;  2XP8 A;  1FKG A;  2DSU A;  4S3K A;  4NNR A;  3IKD A;  2XP4 A;  1LG2 A;  4ZPV R;  2IF4 A;  2DT1 A;  1FFQ A;  2WK2 A;  4DRQ A;  1PIN A;  1E15 A;  2N87 A;  2MLY A;  3AS3 A;  4Z2I A;  3CHE A;  4DH0 A;  4Z2L A;  5DF0 A;  1W9V A;  2DT3 A;  3MDY B;  3PRB A;  3RGC A;  5B8I C;  3RM9 A;  2RUR A;  2FKE A;  3TDB A;  3GPK A;  4GGQ A;  3AS2 A;  4WK9 A;  1QPL A;  2ZQS A;  1W9U A;  2RUQ A;  1YW5 A;  3WL1 A;  4P8V A;  4ODL A;  4WKF A;  5HTG A;  3W4R A;  4DZ2 A;  1P5Q A;  3TC5 A;  1FKJ A;  3ARQ A;  4MPK A;  1K9T A;  2A3C A;  1W1T A;  2RQS A;  2ETN A;  3EIP A;  5BXJ A;  2XPA A;  3KAC A;  4MAV A;  4JFL A;  4MNM A;  4HBO A;  2PPP A;  3RME A;  4LAW A;  2OLH A;  3G6L A;  1OGB A;  3GU0 A;  2DT0 A;  2LGO A;  3ARZ A;  4KR0 B;  1W1V A;  1ZB5 A;  4MTV A;  1EQ3 A;  3ARO A;  3EY6 A;  2FDM A;  1C9H A;  5DEZ A;  1X6L A;  2ZR6 A;  1ROU A;  4ODQ A;  1FFR A;  3GTY X;  1J4R A;  4WJX A;  4HBE A;  3PRA A;  4J4N A;  4ODK A;  4W9O A;  3IHZ A;  4DRJ A;  1W26 A;  4Z2J A;  3KAB A;  3WKZ A;  3JYJ A;  3FAP A;  3WD1 A;  2G41 A;  3O5M A;  4WKH A;  1GOI A;  3KAG A;  3CHD A;  1FKB A;  1NSG A;  1KFW A;  3UQI A;  1PBK A;  1FKK A;  1TCO C;  1RD6 A;  1W1Y A;  2MLX A;  2XP9 A;  5GQB A;  2Y78 A;  4ZPW R;  3H9R B;  2PPO A;  3WIJ A;  1NWS A;  2FAP A;  3UQB A;  4ODN A;  3JYM A;  4DWS B;  2F21 A;  3O5I A;  3ARP A;  3ARW A;  5J6E A;  1ZCN A;  2PV2 A;  1D7J A;  1FD9 A;  1B6C A;  1JNS A;  2M08 A;  3KAI A;  4N19 A;  2DG4 A;  3UI5 A;  3ARV A;  3UQA A;  2DSV A;  3CGM A;  4R5E A;  1SYT A;  4JFJ A;  1HKJ A;  2KR7 A;  2M2A A;  3PA7 A;  1JCH B;  2WM0 A;  1NH6 A;  3O5P A;  4WKA A;  3AQU A;  3BMB A;  4AY1 A;  2ZQU A;  2UZ5 A;  4LAY A;  2KE0 A;  2XP5 A;  4DIP A;  4U86 A;  2YBU A;  1HKI A;  4UDM A;  1EYM A;  1FKH A;  2OFN A;  2G8Z A;  4LAV A;  3B9E A;  1HXV A;  1LQ0 A;  1UR8 A;  3B9A A;  2WLZ A;  2ESC A;  1WB0 A;  5HBF A;  4KQZ A;  4W5U A;  3O5K A;  4BF8 A;  1SR0 A;  1OGG A;  1WNO A;  3O5E A;  2XP3 A;  3G6M A;  1YAT A;  2KI3 A;  4QZV B;  4Z2G A;  1TFV A;  2DT2 A;  2DG3 A;  1F40 A;  4ZS6 A;  1EIB A;  2LPV A;  4U84 A;  5HT1 A;  4WIW A;  5GPG A;  3O5D A;  4ITZ A;  1Q6U A;  4JYS A;  2MPH A;  1A7X A;  1HJX A;  3RM8 A;  1Q6H A;  2YBT A;  4L72 B;  2Q5A A;  2F4E A;  4ODM A;  1HJW A;  4NZC A;  4MNK A;  2B5U B;  3O5O A;  5D75 A;  3WL0 A;  4DWS C;  2PN0 A;  5GPR A;  3PRD A;  2M1I A;  1ITX A;  1NWU A;  2O92 A;  1W1P A;  2ZR5 A;  1ZL1 A;  1Y0O A;  2PBC A;  1T11 A;  3O5Q A;  4LGX A;  2ZR4 A;  1J4H A;  2XPB A;  1E6P A;  4IQ2 A;  2MNT A;  2JZV A;  4DT4 A;  1LL4 A;  1ZK6 A;  4ZPT R;  4DRI A;  4MNJ A;  1D7I A;  1CTN A;  2RUD A;  4TNS A;  1E9L A;  4TX0 A;  4P8X A;  1J6Y A;  1LL7 A;  1ZBK A;  1NMV A;  3LUO A;  4GIV A;  3WD2 A;  3WD0 A;  3UF8 A;  1ZBC A;  1LG1 A;  2DSZ A;  3FY1 A;  3ALF A;  1H0G A;  4DRN A;  2DG9 A;  4S3J A;  2KFW A;  3B8S A;  2QF8 A;  1R9H A;  2AOS A;  1FKI A;  1FKT A;  4P8W A;  4MSP A;  4ODP A;  1OWQ A;  1BKF A;  3O5L A;  3PR9 A;  3OOB A;  4J4O A;  1GRJ A;  3AS1 A;  1FKS A;  3ARY A;  1E6N A;  1N1A A;  1LL6 A;  1D2K A;  3NI6 A;  2XP7 A;  2ZQT A;  2ITK A;  4JFM A;  4P8U A;  3NRK A;  4TW6 A;  4W9Q A;  3VAW A;  3UI4 A;  1FAP A;  3ART A;  3RFW A;  3WD4 A;  4QIB A;  1XHG A;  2F2D A;  1KT0 A;  3CHF A;  1BL4 A;  3IKG A;  4C02 B;  4L3N A;  1EDQ A;  3O5J A;  4FN2 A;  2PPN A;  2WLY A;  5HWB A;  3BXW A;  1LJY A;  4DWS A;  1JNE A;  3WQW A;  4G2P A;  3ARR A;  5HUA A;  3KCE A;  2RUC A;  3AS0 A;  4DRH A;  2EUL A;  4JFI A;  1Q1C A;  3WD3 A;  3QOK A;  4Z2H A;  4PTM A;  4HAR A;  1L1P A;  4QT2 A;  4FAP A;  4DWS D;  2B31 A;  1NWR A;  2KO7 A;  4G50 A;  5HWC A;  1GUV A;  3NTP A;  3CHC A;  2MLZ A;  2D9F A;  3FXY A;  4O2T A;  1FKD A;  4R0X A;  4DRM A;  2F23 A;  1NMW A;  1E6Z A;  4QT3 A;  2A3A A;  2PV1 A;  3KAD A;  3CH9 A;  3KAF A;  5I98 A;  1H0I A;  3ARU A;  2IUZ A;  4ODO A;  1FKR A;  2DSW A;  3ARS A;  5DIT A;  2A3E A;  2LJ4 A;  4MNL A;  3TCZ A;  1XRV A;  2XP6 A;  3ALG A;  3RM4 A;  1FKL A;  2AWG A;  1ZBV A;  3I6C A;  1QZ2 A;  4DZ3 A;  4TW8 A;  3O5R A;  1HKM A;  2PV3 A;  5HKG A;  3UI6 A;  4Z2K A;  1FKF A;  2K8I A;  1E44 A;  3ODK A;  1JVW A;  1IX5 A;  4TW7 A;  2RSE A;  2VCD A;  4Q22 A;  1GPF A;  2LKN A;  4DRP A;  2ZQV A;  3O5G A;  4ML4 A;  4IQC A;  2P4V A;  5JH8 A;  3KZ7 A;  1JNT A;  1O6I A;  5DIV A;  4JFK A;  1VF8 A;  4NSB A;  1ZBW A;  5HW6 A;  4Q7N A;  5DO2 A;  1ROT A;  1EHN A;  1W9P A;  2VN1 A;  2PI6 A;  4IPX A;  1J4I A;  1FJD A;  1X6N A;  3JXV A;  3WH0 A; 
#chains in the Genus database with same CATH homology
 3KAH A;  2O9O A;  1NWT A;  4DRO A;  5DIU A;  1KT1 A;  1HKK A;  4ODR A;  1UR9 A;  5HW8 A;  5HW7 A;  3B7X A;  1D7H A;  4URI A;  4IT4 A;  2KGJ A;  1HJV A;  1E6R A;  4IT6 A;  2L2S A;  4TYO A;  1ZU8 A;  1U79 A;  2A3B A;  3O5F A;  2DPE A;  4MGV A;  4U85 A;  2MF9 A;  1M5Y A;  1JND A;  3WQV A;  3ARX A;  1WAW A;  1D6O A;  3B9D A;  3CZ8 A;  3OA5 A;  1Q6I A;  3CGN A;  3IK8 A;  1F8A B;  1QPF A;  4LAX A;  4DRK A;  4XAK A;  4W9P A;  2XP8 A;  1FKG A;  2DSU A;  4S3K A;  4NNR A;  3IKD A;  2XP4 A;  1LG2 A;  4ZPV R;  2IF4 A;  2DT1 A;  1FFQ A;  2WK2 A;  4DRQ A;  1PIN A;  1E15 A;  2N87 A;  2MLY A;  3AS3 A;  4Z2I A;  3CHE A;  4DH0 A;  4Z2L A;  5DF0 A;  1W9V A;  2DT3 A;  3MDY B;  3PRB A;  3RGC A;  5B8I C;  3RM9 A;  2RUR A;  2FKE A;  3TDB A;  3GPK A;  4GGQ A;  3AS2 A;  4WK9 A;  1QPL A;  2ZQS A;  1W9U A;  2RUQ A;  1YW5 A;  3WL1 A;  4P8V A;  4ODL A;  4WKF A;  5HTG A;  3W4R A;  4DZ2 A;  1P5Q A;  3TC5 A;  1FKJ A;  3ARQ A;  4MPK A;  1K9T A;  2A3C A;  1W1T A;  2RQS A;  5BXJ A;  2XPA A;  3KAC A;  4MAV A;  4JFL A;  4MNM A;  4HBO A;  2PPP A;  3RME A;  4LAW A;  2OLH A;  3G6L A;  1OGB A;  2DT0 A;  2LGO A;  3ARZ A;  4KR0 B;  1W1V A;  1ZB5 A;  4MTV A;  1EQ3 A;  3ARO A;  3EY6 A;  2FDM A;  1C9H A;  5DEZ A;  1X6L A;  2ZR6 A;  1ROU A;  4ODQ A;  1FFR A;  1J4R A;  4WJX A;  4HBE A;  3PRA A;  4J4N A;  4ODK A;  4W9O A;  3IHZ A;  4DRJ A;  1W26 A;  4Z2J A;  3KAB A;  3WKZ A;  3JYJ A;  3FAP A;  3WD1 A;  2G41 A;  3O5M A;  4WKH A;  1GOI A;  3KAG A;  3CHD A;  1FKB A;  1NSG A;  1KFW A;  3UQI A;  1PBK A;  1FKK A;  1TCO C;  1RD6 A;  1W1Y A;  2MLX A;  2XP9 A;  5GQB A;  2Y78 A;  4ZPW R;  3H9R B;  2PPO A;  3WIJ A;  1NWS A;  2FAP A;  3UQB A;  4ODN A;  3JYM A;  4DWS B;  2F21 A;  3O5I A;  3ARP A;  3ARW A;  5J6E A;  1ZCN A;  2PV2 A;  1D7J A;  1FD9 A;  1B6C A;  1JNS A;  2M08 A;  3KAI A;  4N19 A;  2DG4 A;  3UI5 A;  3ARV A;  3UQA A;  2DSV A;  3CGM A;  4R5E A;  1SYT A;  4JFJ A;  1HKJ A;  2KR7 A;  2M2A A;  3PA7 A;  2WM0 A;  1NH6 A;  3O5P A;  4WKA A;  3AQU A;  4AY1 A;  2ZQU A;  2UZ5 A;  4LAY A;  2KE0 A;  2XP5 A;  4DIP A;  4U86 A;  2YBU A;  1HKI A;  1EYM A;  1FKH A;  2OFN A;  2G8Z A;  4LAV A;  3B9E A;  1HXV A;  1LQ0 A;  1UR8 A;  3B9A A;  2WLZ A;  2ESC A;  1WB0 A;  5HBF A;  4KQZ A;  4W5U A;  3O5K A;  4BF8 A;  1SR0 A;  1OGG A;  1WNO A;  3O5E A;  2XP3 A;  3G6M A;  1YAT A;  2KI3 A;  4QZV B;  4Z2G A;  1TFV A;  2DT2 A;  2DG3 A;  1F40 A;  4ZS6 A;  1EIB A;  2LPV A;  4U84 A;  5HT1 A;  4WIW A;  5GPG A;  3O5D A;  4ITZ A;  1Q6U A;  4JYS A;  2MPH A;  1A7X A;  1HJX A;  3RM8 A;  1Q6H A;  2YBT A;  4L72 B;  2Q5A A;  2F4E A;  4ODM A;  1HJW A;  4NZC A;  4MNK A;  3O5O A;  5D75 A;  3WL0 A;  4DWS C;  5GPR A;  3PRD A;  2M1I A;  1ITX A;  1NWU A;  2O92 A;  1W1P A;  2ZR5 A;  1ZL1 A;  1Y0O A;  2PBC A;  1T11 A;  3O5Q A;  4LGX A;  2ZR4 A;  1J4H A;  2XPB A;  1E6P A;  4IQ2 A;  2MNT A;  2JZV A;  4DT4 A;  1LL4 A;  1ZK6 A;  4ZPT R;  4DRI A;  4MNJ A;  1D7I A;  1CTN A;  2RUD A;  4TNS A;  1E9L A;  4TX0 A;  4P8X A;  1J6Y A;  1LL7 A;  1ZBK A;  1NMV A;  3LUO A;  4GIV A;  3WD2 A;  3WD0 A;  3UF8 A;  1ZBC A;  1LG1 A;  2DSZ A;  3FY1 A;  3ALF A;  1H0G A;  4DRN A;  2DG9 A;  4S3J A;  2KFW A;  3B8S A;  2QF8 A;  1R9H A;  2AOS A;  1FKI A;  1FKT A;  4P8W A;  4MSP A;  4ODP A;  1OWQ A;  1BKF A;  3O5L A;  3PR9 A;  3OOB A;  4J4O A;  3AS1 A;  1FKS A;  3ARY A;  1E6N A;  1N1A A;  1LL6 A;  1D2K A;  3NI6 A;  2XP7 A;  2ZQT A;  4JFM A;  2ITK A;  4P8U A;  3NRK A;  4TW6 A;  4W9Q A;  3VAW A;  3UI4 A;  1FAP A;  3ART A;  3RFW A;  3WD4 A;  4QIB A;  1XHG A;  2F2D A;  1KT0 A;  3CHF A;  1BL4 A;  3IKG A;  4C02 B;  4L3N A;  1EDQ A;  3O5J A;  4FN2 A;  2PPN A;  2WLY A;  5HWB A;  3BXW A;  1LJY A;  4DWS A;  1JNE A;  3WQW A;  4G2P A;  3ARR A;  5HUA A;  3KCE A;  2RUC A;  3AS0 A;  4DRH A;  4JFI A;  1Q1C A;  3WD3 A;  3QOK A;  4Z2H A;  4PTM A;  4HAR A;  1L1P A;  4QT2 A;  4FAP A;  4DWS D;  2B31 A;  1NWR A;  2KO7 A;  4G50 A;  5HWC A;  1GUV A;  3NTP A;  3CHC A;  2MLZ A;  2D9F A;  3FXY A;  4O2T A;  1FKD A;  4R0X A;  4DRM A;  1NMW A;  1E6Z A;  4QT3 A;  2A3A A;  2PV1 A;  3KAD A;  3CH9 A;  3KAF A;  5I98 A;  1H0I A;  3ARU A;  2IUZ A;  4ODO A;  1FKR A;  2DSW A;  3ARS A;  5DIT A;  2A3E A;  2LJ4 A;  4MNL A;  3TCZ A;  1XRV A;  2XP6 A;  3ALG A;  3RM4 A;  1FKL A;  2AWG A;  1ZBV A;  3I6C A;  1QZ2 A;  4DZ3 A;  4TW8 A;  3O5R A;  1HKM A;  2PV3 A;  5HKG A;  3UI6 A;  4Z2K A;  1FKF A;  2K8I A;  3ODK A;  1JVW A;  1IX5 A;  4TW7 A;  2RSE A;  2VCD A;  4Q22 A;  1GPF A;  2LKN A;  4DRP A;  2ZQV A;  3O5G A;  4ML4 A;  4IQC A;  5JH8 A;  3KZ7 A;  1JNT A;  1O6I A;  5DIV A;  4JFK A;  1VF8 A;  4NSB A;  1ZBW A;  5HW6 A;  4Q7N A;  5DO2 A;  1ROT A;  1EHN A;  1W9P A;  2VN1 A;  2PI6 A;  4IPX A;  1J4I A;  1FJD A;  1X6N A;  3JXV A;  3WH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...