3IKGA

Structure-based design of novel pin1 inhibitors (i)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ikgA00
2FKEA 2XP7A 3KABA 2LJ4A 2Y78A 3KZ7A 3ODKA 5GPGA 2L2SA 2RSEA 4DH0A 2OFNA 3KACA 5B8IC 4W9PA 1QZ2A 3RFWA 3O5KA 1NMVA 1J4RA 2PBCA 2ZQTA 4ODKA 2ZR6A 2RUCA 1FKGA 2KFWA 4W9QA 1FKDA 1M5YA 4JFIA 1D7JA 4FN2A 3MDYB 3O5FA 2DG9A 1T11A 4TW6A 3RGCA 5HW7A 4U85A 2RUQA 3EY6A 5I98A 4DIPA 5DITA 4ODQA 2MLXA 2MNTA 1FKKA 2PPNA 1R9HA 4DRMA 3KCEA 1Q1CA 4G2PA 5DIVA 3TC5A 3O5PA 3TDBA 5D75A 1FKIA 4JFJA 1QPFA 1FAPA 1KT0A 4GIVA 2ZR4A 3TCZA 2XPBA 4QT3A 4ODNA 3UI5A 3UQIA 1EYMA 4IPXA 4TYOA 2UZ5A 1TCOC 4LAXA 4ODPA 4QT2A 1D6OA 4O2TA 1F40A 1FKJA 3PRDA 2XP9A 3O5DA 1J4HA 2XP6A 3UI4A 3KAHA 1FKRA 5HUAA 3VAWA 3O5QA 2RQSA 4LAWA 3O5EA 3KADA 1PINA 2PPPA 4W9OA 1FKTA 4DT4A 3CGMA 2AWGA 4FAPA 3I6CA 1L1PA 2F4EA 2DG4A 3IHZA 2JZVA 2MLYA 4TX0A 2XP8A 1A7XA 3NI6A 1F8AB 1FKFA 3JXVA 1JNTA 4ODOA 3CGNA 4R0XA 3B7XA 1P5QA 4DRJA 2MLZA 2PPOA 3O5RA 3JYJA 1D7IA 3UQAA 1NSGA 4ODRA 2XP5A 4DROA 4TNSA 3OOBA 1W26A 2KI3A 4C02B 2KR7A 5HT1A 1FJDA 2DG3A 3FAPA 1YATA 1N1AA 1Q6UA 1U79A 1C9HA 4LAYA 1PBKA 3UQBA 3H9RB 2M1IA 1JVWA 1ROTA 3NRKA 3UF8A 3GPKA 2PV1A 2ZR5A 1D7HA 4DRHA 3O5OA 4LAVA 2D9FA 2MPHA 4G50A 1FKSA 1FKLA 4JYSA 1Y0OA 2PV2A 4NNRA 5J6EA 5HWBA 2FAPA 2Q5AA 2VN1A 2XPAA 1J4IA 1ZCNA 1B6CA 2XP3A 2RURA 4MGVA 3PA7A 2ZQSA 3IKDA 1YW5A 3O5GA 1FD9A 1NMWA 3LUOA 4JFLA 4ODMA 2KO7A 4U86A 2XP4A 4N19A 2ZQUA 4JFKA 5HW6A 4MSPA 2M2AA 3UI6A 4QIBA 3O5MA 4BF8A 2M08A 4IQCA 4DRIA 4TW8A 3WH0A 4ITZA 1EQ3A 3IK8A 1Q6HA 5BXJA 2K8IA 5HWCA 2F2DA 2N87A 3KAGA 1BL4A 1Q6IA 2ITKA 3NTPA 2KGJA 3KAFA 3KAIA 3O5JA 3PRBA 1ZK6A 2ZQVA 4IQ2A 1JNSA 4U84A 4TW7A 4J4NA 1HXVA 3O5IA 2PV3A 5HW8A 1ROUA 3O5LA 1QPLA 2LPVA 1FKBA 4ODLA 1J6YA 4DRQA 5HKGA 1BKFA 2RUDA 2F21A 2MF9A 4DZ2A 2VCDA 3IKGA 4JFMA 1FKHA 2KE0A 3JYMA 4GGQA 4J4OA 1KT1A 2LGOA 5DIUA 4DRNA 4DRPA 4DZ3A 4DRKA 2IF4A 2LKNA 5HTGA
chains in the Genus database with same CATH superfamily
2FKEA 1JNEA 2LJ4A 2Y78A 3PR9A 1H0GA 1FFRA 3AQUA 4ZPVR 5GPGA 2IUZA 4DH0A 2OFNA 4Q7NA 3RFWA 1NMVA 2B31A 1WB0A 2ZQTA 4MPKA 4ODKA 4Z2KA 4Z2LA 2KFWA 1W1VA 4PTMA 1K9TA 2RUQA 4ODQA 1NWTA 4WKAA 1LQ0A 4G2PA 1Q1CA 3TC5A 4XAKA 1FKIA 3RM4A 2XPBA 4QT3A 1W1YA 4TYOA 3WKZA 1TCOC 4LAXA 4ODPA 2P4VA 3PRDA 1UR8A 4WKHA 3EIPA 3UI4A 3KAHA 5HUAA 4LAWA 3ARWA 1OGGA 2AWGA 2PN0A 1L1PA 2F4EA 2DG4A 3IHZA 2MLYA 5GPRA 1A7XA 3NI6A 1FKFA 1HJXA 3ARSA 4KQZA 3CGNA 3B7XA 1P5QA 1LL4A 2PPOA 3AROA 4ODRA 1LJYA 1VF8A 2XP5A 4WKFA 1W26A 1GOIA 4IT6A 2WK2A 1Q6UA 1HKKA 3UQBA 1KFWA 4WK9A 2DT2A 3ARZA 3O5OA 2MPHA 4NNRA 3ARTA 2PV2A 5HWBA 1ZB5A 1B6CA 2RURA 4ZS6A 1HKMA 1YW5A 1NMWA 4NZCA 4JFKA 2AOSA 3O5MA 2M08A 5BXJA 2K8IA 5HWCA 2N87A 3KAGA 1BL4A 1Q6IA 2G41A 3KAFA 3PRBA 1ZK6A 5DF0A 3WD1A 4TW7A 1QPLA 2LPVA 4ODLA 1J6YA 2WLZA 2DPEA 1BKFA 3WD0A 2ESCA 2A3BA 1W9PA 2MF9A 4DZ2A 1NWRA 2VCDA 3IKGA 1FKHA 3FY1A 5DIUA 4DRPA 3BMBA 2PI6A 3KZ7A 3BXWA 2RSEA 3KACA 3B8SA 1QZ2A 3O5KA 1IX5A 2RUCA 2DT1A 1FKGA 4W9QA 4W9PA 1M5YA 2F23A 5HW7A 4MNJA 4DIPA 1E9LA 2MLXA 1HJWA 2MNTA 1HJVA 3KCEA 2WLYA 2FDMA 4P8VA 3TDBA 4Q22A 5D75A 1E6PA 3B9EA 4JFJA 1FAPA 3TCZA 2O9OA 4ODNA 1NWUA 4O2TA 1F40A 1SR0A 1XHGA 1J4HA 4MAVA 1FKRA 3VAWA 3O5QA 4URIA 2B5UB 3KADA 4DWSB 4DT4A 3I6CA 4AY1A 2XP8A 3WD4A 3FXYA 4ODOA 4R0XA 3RM8A 3ARVA 1ZBCA 2MLZA 3O5RA 3UQAA 1O6IA 1ZBVA 3CHCA 4TNSA 4C02B 2KR7A 2DG3A 4HARA 1YATA 1N1AA 1U79A 2M1IA 3NRKA 1X6LA 2QF8A 3ARXA 2ZR5A 4LAVA 1EDQA 1EHNA 2D9FA 4KR0B 4JYSA 1Y0OA 1ZBKA 2FAPA 1ZCNA 3PA7A 2DT3A 2A3CA 4ODMA 4Z2JA 3O5GA 4JFLA 3PRAA 2DSZA 4N19A 1LL6A 5HW6A 3WQWA 4MSPA 3AS3A 4QIBA 1E15A 4TW8A 3WH0A 3QOKA 1CTNA 1EQ3A 1Q6HA 4NSBA 3NTPA 4P8WA 2KGJA 3KAIA 3O5JA 3ARQA 1E6NA 4IQ2A 4U84A 5HW8A 1ROUA 3O5LA 3B9DA 4ZPTR 2RUDA 4WIWA 4JFMA 4J4OA 4DRNA 1JCHB 1ITXA 2XP7A 3KABA 2L2SA 4HBOA 4HBEA 3GU0A 3RGCA 3O5FA 2DG9A 1T11A 3EY6A 1OGBA 5DITA 1WAWA 1R9HA 4DRMA 5DIVA 1GUVA 4WJXA 3O5PA 5DEZA 1W1PA 3OA5A 1QPFA 1KT0A 3UQIA 1EYMA 2UZ5A 4L3NA 1FKJA 2XP9A 5DO2A 4IT4A 1W1TA 3WD3A 3WQVA 4W9OA 1NH6A 1PINA 2PPPA 1FKTA 2WM0A 3CHEA 3ALGA 1HKJA 2JZVA 2G8ZA 4TX0A 4DRJA 3ARUA 4DWSC 1NSGA 4DROA 4LGXA 2KI3A 1FJDA 3FAPA 1C9HA 1PBKA 3H9RB 1JVWA 1D7HA 4DRHA 1FKSA 1FKLA 1HKIA 1NWSA 5J6EA 4UDMA 2Q5AA 2XPAA 1J4IA 2XP3A 2ZQSA 3LUOA 3CZ8A 4ML4A 2KO7A 1JNDA 3UI6A 4DRIA 2EULA 5HBFA 4MNLA 2F2DA 4S3KA 3B9AA 2A3EA 4ZPWR 4S3JA 3RM9A 3GTYX 1XRVA 1ZL1A 2YBUA 2PV3A 4P8UA 4Z2HA 3ARYA 3ARPA 2DT0A 3AS1A 2KE0A 4GGQA 1KT1A 4DZ3A 4DRKA 2IF4A 2LKNA 1TFVA 2ETNA 2A3AA 5HTGA 1LG1A 4DWSA 3ODKA 1E6RA 1EIBA 1LL7A 1OWQA 5B8IC 2DSWA 1J4RA 2PBCA 2ZR6A 1D2KA 1FKDA 4JFIA 1D7JA 1SYTA 3MDYB 4FN2A 4TW6A 1WNOA 4U85A 3CHFA 5I98A 1GRJA 2OLHA 2PPNA 1FKKA 3RMEA 1FFQA 4GIVA 1ZU8A 2ZR4A 3UI5A 4IPXA 1E44A 4QT2A 3G6MA 1D6OA 3O5DA 3AS2A 2XP6A 1W9VA 4P8XA 2RQSA 4MTVA 3O5EA 3AS0A 4MNKA 4FAPA 1X6NA 3CGMA 1F8AB 3JXVA 1JNTA 1ZBWA 4MNMA 3JYJA 1D7IA 3OOBA 4DWSD 1W9UA 5HT1A 2O92A 3ALFA 3G6LA 4LAYA 1ROTA 3UF8A 2PV1A 4Z2IA 1HXVA 2DSVA 4G50A 2VN1A 4MGVA 3WL0A 3IKDA 1FD9A 4W5UA 4Z2GA 4U86A 2XP4A 2ZQUA 2M2AA 5GQBA 4L72B 3CHDA 1E6ZA 4BF8A 4IQCA 3W4RA 1UR9A 4ITZA 3IK8A 5JH8A 3CH9A 4R5EA 2ITKA 1H0IA 2ZQVA 1JNSA 4QZVB 4J4NA 1RD6A 3O5IA 3WD2A 1FKBA 4DRQA 5HKGA 3WIJA 2F21A 2DSUA 2YBTA 3ARRA 1GPFA 3JYMA 2LGOA 1LG2A 3WL1A 3GPKA
chains in the Genus database with same CATH topology
2FKEA 1JNEA 2LJ4A 2Y78A 3PR9A 1H0GA 1FFRA 3AQUA 4ZPVR 5GPGA 2IUZA 4DH0A 2OFNA 4Q7NA 3RFWA 1NMVA 2B31A 1WB0A 2ZQTA 4MPKA 4ODKA 4Z2KA 4Z2LA 2KFWA 1W1VA 4PTMA 1K9TA 2RUQA 4ODQA 1NWTA 4WKAA 1LQ0A 4G2PA 1Q1CA 3TC5A 4XAKA 1FKIA 3RM4A 2XPBA 4QT3A 1W1YA 4TYOA 3WKZA 1TCOC 4LAXA 4ODPA 3PRDA 1UR8A 4WKHA 3UI4A 3KAHA 5HUAA 4LAWA 3ARWA 1OGGA 2AWGA 1L1PA 2F4EA 2DG4A 3IHZA 2MLYA 5GPRA 1A7XA 3NI6A 1FKFA 1HJXA 3ARSA 4KQZA 3CGNA 3B7XA 1P5QA 1LL4A 2PPOA 3AROA 4ODRA 1LJYA 1VF8A 2XP5A 4WKFA 1W26A 1GOIA 4IT6A 2WK2A 1Q6UA 1HKKA 3UQBA 1KFWA 4WK9A 2DT2A 3ARZA 3O5OA 2MPHA 4NNRA 3ARTA 2PV2A 5HWBA 1ZB5A 1B6CA 2RURA 4ZS6A 1HKMA 1YW5A 1NMWA 4NZCA 4JFKA 2AOSA 3O5MA 2M08A 5BXJA 2K8IA 5HWCA 2N87A 3KAGA 1BL4A 1Q6IA 2G41A 3KAFA 3PRBA 1ZK6A 5DF0A 3WD1A 4TW7A 1QPLA 2LPVA 4ODLA 1J6YA 2WLZA 2DPEA 1BKFA 3WD0A 2ESCA 2A3BA 1W9PA 2MF9A 4DZ2A 1NWRA 2VCDA 3IKGA 1FKHA 3FY1A 5DIUA 4DRPA 2PI6A 3KZ7A 3BXWA 2RSEA 3KACA 3B8SA 1QZ2A 3O5KA 1IX5A 2RUCA 2DT1A 1FKGA 4W9QA 4W9PA 1M5YA 5HW7A 4MNJA 4DIPA 1E9LA 2MLXA 1HJWA 2MNTA 1HJVA 3KCEA 2WLYA 2FDMA 4P8VA 3TDBA 4Q22A 5D75A 1E6PA 3B9EA 4JFJA 1FAPA 3TCZA 2O9OA 4ODNA 1NWUA 4O2TA 1F40A 1SR0A 1XHGA 1J4HA 4MAVA 1FKRA 3VAWA 3O5QA 4URIA 4DWSB 3KADA 4DT4A 3I6CA 4AY1A 2XP8A 3WD4A 3FXYA 4ODOA 4R0XA 3RM8A 3ARVA 1ZBCA 2MLZA 3O5RA 3UQAA 1O6IA 1ZBVA 3CHCA 4TNSA 4C02B 2KR7A 2DG3A 4HARA 1YATA 1N1AA 1U79A 2M1IA 3NRKA 1X6LA 2QF8A 3ARXA 2ZR5A 4LAVA 1EDQA 1EHNA 2D9FA 4KR0B 4JYSA 1Y0OA 1ZBKA 2FAPA 1ZCNA 3PA7A 2DT3A 2A3CA 4ODMA 4Z2JA 3O5GA 4JFLA 3PRAA 2DSZA 4N19A 1LL6A 5HW6A 3WQWA 4MSPA 3AS3A 4QIBA 1E15A 4TW8A 3WH0A 3QOKA 1CTNA 1EQ3A 1Q6HA 4NSBA 3NTPA 4P8WA 2KGJA 3KAIA 3O5JA 3ARQA 1E6NA 4IQ2A 4U84A 5HW8A 1ROUA 3O5LA 3B9DA 4ZPTR 2RUDA 4WIWA 4JFMA 4J4OA 4DRNA 1ITXA 2XP7A 3KABA 2L2SA 4HBOA 4HBEA 3RGCA 3O5FA 2DG9A 1T11A 3EY6A 1OGBA 5DITA 1WAWA 1R9HA 4DRMA 5DIVA 1GUVA 4WJXA 3O5PA 5DEZA 1W1PA 3OA5A 1QPFA 1KT0A 3UQIA 1EYMA 2UZ5A 4L3NA 1FKJA 2XP9A 5DO2A 4IT4A 1W1TA 3WD3A 3WQVA 4W9OA 1NH6A 1PINA 2PPPA 1FKTA 2WM0A 3CHEA 3ALGA 1HKJA 2JZVA 2G8ZA 4TX0A 4DRJA 3ARUA 4DWSC 1NSGA 4DROA 4LGXA 2KI3A 1FJDA 3FAPA 1C9HA 1PBKA 3H9RB 1JVWA 1D7HA 4DRHA 1FKSA 1FKLA 1HKIA 1NWSA 5J6EA 2Q5AA 2XPAA 1J4IA 2XP3A 2ZQSA 3LUOA 3CZ8A 4ML4A 2KO7A 1JNDA 3UI6A 4DRIA 5HBFA 4MNLA 2F2DA 4S3KA 3B9AA 2A3EA 4ZPWR 4S3JA 3RM9A 1XRVA 1ZL1A 2YBUA 2PV3A 4P8UA 4Z2HA 3ARYA 3ARPA 2DT0A 3AS1A 2KE0A 4GGQA 1KT1A 4DZ3A 4DRKA 2IF4A 2LKNA 1TFVA 5HTGA 2A3AA 1LG1A 4DWSA 3ODKA 1E6RA 1EIBA 1LL7A 1OWQA 5B8IC 2DSWA 1J4RA 2PBCA 2ZR6A 1D2KA 1FKDA 4JFIA 1D7JA 1SYTA 3MDYB 4FN2A 4TW6A 1WNOA 4U85A 3CHFA 5I98A 2OLHA 2PPNA 1FKKA 3RMEA 1FFQA 4GIVA 1ZU8A 2ZR4A 3UI5A 4IPXA 4QT2A 3G6MA 1D6OA 3O5DA 3AS2A 2XP6A 1W9VA 4P8XA 2RQSA 4MTVA 3O5EA 3AS0A 4MNKA 4FAPA 1X6NA 3CGMA 1F8AB 3JXVA 1JNTA 1ZBWA 4MNMA 3JYJA 1D7IA 3OOBA 4DWSD 1W9UA 5HT1A 2O92A 3ALFA 3G6LA 4LAYA 1ROTA 3UF8A 2PV1A 4Z2IA 1HXVA 2DSVA 4G50A 2VN1A 4MGVA 3WL0A 3IKDA 1FD9A 4W5UA 4Z2GA 4U86A 2XP4A 2ZQUA 2M2AA 5GQBA 4L72B 3CHDA 1E6ZA 4BF8A 4IQCA 3W4RA 1UR9A 4ITZA 3IK8A 5JH8A 3CH9A 4R5EA 2ITKA 1H0IA 2ZQVA 1JNSA 4QZVB 4J4NA 1RD6A 3O5IA 3WD2A 1FKBA 4DRQA 5HKGA 3WIJA 2F21A 2DSUA 2YBTA 3ARRA 1GPFA 3JYMA 2LGOA 1LG2A 3WL1A 3GPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKE A;  2XP7 A;  3KAB A;  2LJ4 A;  2Y78 A;  3KZ7 A;  3ODK A;  5GPG A;  2L2S A;  2RSE A;  4DH0 A;  2OFN A;  3KAC A;  5B8I C;  4W9P A;  1QZ2 A;  3RFW A;  3O5K A;  1NMV A;  1J4R A;  2PBC A;  2ZQT A;  4ODK A;  2ZR6 A;  2RUC A;  1FKG A;  2KFW A;  4W9Q A;  1FKD A;  1M5Y A;  4JFI A;  1D7J A;  4FN2 A;  3MDY B;  3O5F A;  2DG9 A;  1T11 A;  4TW6 A;  3RGC A;  5HW7 A;  4U85 A;  2RUQ A;  3EY6 A;  5I98 A;  4DIP A;  5DIT A;  4ODQ A;  2MLX A;  2MNT A;  1FKK A;  2PPN A;  1R9H A;  4DRM A;  3KCE A;  1Q1C A;  4G2P A;  5DIV A;  3TC5 A;  3O5P A;  3TDB A;  5D75 A;  1FKI A;  4JFJ A;  1QPF A;  1FAP A;  1KT0 A;  4GIV A;  2ZR4 A;  3TCZ A;  2XPB A;  4QT3 A;  4ODN A;  3UI5 A;  3UQI A;  1EYM A;  4IPX A;  4TYO A;  2UZ5 A;  1TCO C;  4LAX A;  4ODP A;  4QT2 A;  1D6O A;  4O2T A;  1F40 A;  1FKJ A;  3PRD A;  2XP9 A;  3O5D A;  1J4H A;  2XP6 A;  3UI4 A;  3KAH A;  1FKR A;  5HUA A;  3VAW A;  3O5Q A;  2RQS A;  4LAW A;  3O5E A;  3KAD A;  1PIN A;  2PPP A;  4W9O A;  1FKT A;  4DT4 A;  3CGM A;  2AWG A;  4FAP A;  3I6C A;  1L1P A;  2F4E A;  2DG4 A;  3IHZ A;  2JZV A;  2MLY A;  4TX0 A;  2XP8 A;  1A7X A;  3NI6 A;  1F8A B;  1FKF A;  3JXV A;  1JNT A;  4ODO A;  3CGN A;  4R0X A;  3B7X A;  1P5Q A;  4DRJ A;  2MLZ A;  2PPO A;  3O5R A;  3JYJ A;  1D7I A;  3UQA A;  1NSG A;  4ODR A;  2XP5 A;  4DRO A;  4TNS A;  3OOB A;  1W26 A;  2KI3 A;  4C02 B;  2KR7 A;  5HT1 A;  1FJD A;  2DG3 A;  3FAP A;  1YAT A;  1N1A A;  1Q6U A;  1U79 A;  1C9H A;  4LAY A;  1PBK A;  3UQB A;  3H9R B;  2M1I A;  1JVW A;  1ROT A;  3NRK A;  3UF8 A;  3GPK A;  2PV1 A;  2ZR5 A;  1D7H A;  4DRH A;  3O5O A;  4LAV A;  2D9F A;  2MPH A;  4G50 A;  1FKS A;  1FKL A;  4JYS A;  1Y0O A;  2PV2 A;  4NNR A;  5J6E A;  5HWB A;  2FAP A;  2Q5A A;  2VN1 A;  2XPA A;  1J4I A;  1ZCN A;  1B6C A;  2XP3 A;  2RUR A;  4MGV A;  3PA7 A;  2ZQS A;  3IKD A;  1YW5 A;  3O5G A;  1FD9 A;  1NMW A;  3LUO A;  4JFL A;  4ODM A;  2KO7 A;  4U86 A;  2XP4 A;  4N19 A;  2ZQU A;  4JFK A;  5HW6 A;  4MSP A;  2M2A A;  3UI6 A;  4QIB A;  3O5M A;  4BF8 A;  2M08 A;  4IQC A;  4DRI A;  4TW8 A;  3WH0 A;  4ITZ A;  1EQ3 A;  3IK8 A;  1Q6H A;  5BXJ A;  2K8I A;  5HWC A;  2F2D A;  2N87 A;  3KAG A;  1BL4 A;  1Q6I A;  2ITK A;  3NTP A;  2KGJ A;  3KAF A;  3KAI A;  3O5J A;  3PRB A;  1ZK6 A;  2ZQV A;  4IQ2 A;  1JNS A;  4U84 A;  4TW7 A;  4J4N A;  1HXV A;  3O5I A;  2PV3 A;  5HW8 A;  1ROU A;  3O5L A;  1QPL A;  2LPV A;  1FKB A;  4ODL A;  1J6Y A;  4DRQ A;  5HKG A;  1BKF A;  2RUD A;  2F21 A;  2MF9 A;  4DZ2 A;  2VCD A;  3IKG A;  4JFM A;  1FKH A;  2KE0 A;  3JYM A;  4GGQ A;  4J4O A;  1KT1 A;  2LGO A;  5DIU A;  4DRN A;  4DRP A;  4DZ3 A;  4DRK A;  2IF4 A;  2LKN A;  5HTG A; 
#chains in the Genus database with same CATH topology
 2FKE A;  1JNE A;  2LJ4 A;  2Y78 A;  3PR9 A;  1H0G A;  1FFR A;  3AQU A;  4ZPV R;  5GPG A;  2IUZ A;  4DH0 A;  2OFN A;  4Q7N A;  3RFW A;  1NMV A;  2B31 A;  1WB0 A;  2ZQT A;  4MPK A;  4ODK A;  4Z2K A;  4Z2L A;  2KFW A;  1W1V A;  4PTM A;  1K9T A;  2RUQ A;  4ODQ A;  1NWT A;  4WKA A;  1LQ0 A;  4G2P A;  1Q1C A;  3TC5 A;  4XAK A;  1FKI A;  3RM4 A;  2XPB A;  4QT3 A;  1W1Y A;  4TYO A;  3WKZ A;  1TCO C;  4LAX A;  4ODP A;  2P4V A;  3PRD A;  1UR8 A;  4WKH A;  3EIP A;  3UI4 A;  3KAH A;  5HUA A;  4LAW A;  3ARW A;  1OGG A;  2AWG A;  2PN0 A;  1L1P A;  2F4E A;  2DG4 A;  3IHZ A;  2MLY A;  5GPR A;  1A7X A;  3NI6 A;  1FKF A;  1HJX A;  3ARS A;  4KQZ A;  3CGN A;  3B7X A;  1P5Q A;  1LL4 A;  2PPO A;  3ARO A;  4ODR A;  1LJY A;  1VF8 A;  2XP5 A;  4WKF A;  1W26 A;  1GOI A;  4IT6 A;  2WK2 A;  1Q6U A;  1HKK A;  3UQB A;  1KFW A;  4WK9 A;  2DT2 A;  3ARZ A;  3O5O A;  2MPH A;  4NNR A;  3ART A;  2PV2 A;  5HWB A;  1ZB5 A;  1B6C A;  2RUR A;  4ZS6 A;  1HKM A;  1YW5 A;  1NMW A;  4NZC A;  4JFK A;  2AOS A;  3O5M A;  2M08 A;  5BXJ A;  2K8I A;  5HWC A;  2N87 A;  3KAG A;  1BL4 A;  1Q6I A;  2G41 A;  3KAF A;  3PRB A;  1ZK6 A;  5DF0 A;  3WD1 A;  4TW7 A;  1QPL A;  2LPV A;  4ODL A;  1J6Y A;  2WLZ A;  2DPE A;  1BKF A;  3WD0 A;  2ESC A;  2A3B A;  1W9P A;  2MF9 A;  4DZ2 A;  1NWR A;  2VCD A;  3IKG A;  1FKH A;  3FY1 A;  5DIU A;  4DRP A;  3BMB A;  2PI6 A;  3KZ7 A;  3BXW A;  2RSE A;  3KAC A;  3B8S A;  1QZ2 A;  3O5K A;  1IX5 A;  2RUC A;  2DT1 A;  1FKG A;  4W9Q A;  4W9P A;  1M5Y A;  2F23 A;  5HW7 A;  4MNJ A;  4DIP A;  1E9L A;  2MLX A;  1HJW A;  2MNT A;  1HJV A;  3KCE A;  2WLY A;  2FDM A;  4P8V A;  3TDB A;  4Q22 A;  5D75 A;  1E6P A;  3B9E A;  4JFJ A;  1FAP A;  3TCZ A;  2O9O A;  4ODN A;  1NWU A;  4O2T A;  1F40 A;  1SR0 A;  1XHG A;  1J4H A;  4MAV A;  1FKR A;  3VAW A;  3O5Q A;  4URI A;  2B5U B;  3KAD A;  4DWS B;  4DT4 A;  3I6C A;  4AY1 A;  2XP8 A;  3WD4 A;  3FXY A;  4ODO A;  4R0X A;  3RM8 A;  3ARV A;  1ZBC A;  2MLZ A;  3O5R A;  3UQA A;  1O6I A;  1ZBV A;  3CHC A;  4TNS A;  4C02 B;  2KR7 A;  2DG3 A;  4HAR A;  1YAT A;  1N1A A;  1U79 A;  2M1I A;  3NRK A;  1X6L A;  2QF8 A;  3ARX A;  2ZR5 A;  4LAV A;  1EDQ A;  1EHN A;  2D9F A;  4KR0 B;  4JYS A;  1Y0O A;  1ZBK A;  2FAP A;  1ZCN A;  3PA7 A;  2DT3 A;  2A3C A;  4ODM A;  4Z2J A;  3O5G A;  4JFL A;  3PRA A;  2DSZ A;  4N19 A;  1LL6 A;  5HW6 A;  3WQW A;  4MSP A;  3AS3 A;  4QIB A;  1E15 A;  4TW8 A;  3WH0 A;  3QOK A;  1CTN A;  1EQ3 A;  1Q6H A;  4NSB A;  3NTP A;  4P8W A;  2KGJ A;  3KAI A;  3O5J A;  3ARQ A;  1E6N A;  4IQ2 A;  4U84 A;  5HW8 A;  1ROU A;  3O5L A;  3B9D A;  4ZPT R;  2RUD A;  4WIW A;  4JFM A;  4J4O A;  4DRN A;  1JCH B;  1ITX A;  2XP7 A;  3KAB A;  2L2S A;  4HBO A;  4HBE A;  3GU0 A;  3RGC A;  3O5F A;  2DG9 A;  1T11 A;  3EY6 A;  1OGB A;  5DIT A;  1WAW A;  1R9H A;  4DRM A;  5DIV A;  1GUV A;  4WJX A;  3O5P A;  5DEZ A;  1W1P A;  3OA5 A;  1QPF A;  1KT0 A;  3UQI A;  1EYM A;  2UZ5 A;  4L3N A;  1FKJ A;  2XP9 A;  5DO2 A;  4IT4 A;  1W1T A;  3WD3 A;  3WQV A;  4W9O A;  1NH6 A;  1PIN A;  2PPP A;  1FKT A;  2WM0 A;  3CHE A;  3ALG A;  1HKJ A;  2JZV A;  2G8Z A;  4TX0 A;  4DRJ A;  3ARU A;  4DWS C;  1NSG A;  4DRO A;  4LGX A;  2KI3 A;  1FJD A;  3FAP A;  1C9H A;  1PBK A;  3H9R B;  1JVW A;  1D7H A;  4DRH A;  1FKS A;  1FKL A;  1HKI A;  1NWS A;  5J6E A;  4UDM A;  2Q5A A;  2XPA A;  1J4I A;  2XP3 A;  2ZQS A;  3LUO A;  3CZ8 A;  4ML4 A;  2KO7 A;  1JND A;  3UI6 A;  4DRI A;  2EUL A;  5HBF A;  4MNL A;  2F2D A;  4S3K A;  3B9A A;  2A3E A;  4ZPW R;  4S3J A;  3RM9 A;  3GTY X;  1XRV A;  1ZL1 A;  2YBU A;  2PV3 A;  4P8U A;  4Z2H A;  3ARY A;  3ARP A;  2DT0 A;  3AS1 A;  2KE0 A;  4GGQ A;  1KT1 A;  4DZ3 A;  4DRK A;  2IF4 A;  2LKN A;  1TFV A;  2ETN A;  2A3A A;  5HTG A;  1LG1 A;  4DWS A;  3ODK A;  1E6R A;  1EIB A;  1LL7 A;  1OWQ A;  5B8I C;  2DSW A;  1J4R A;  2PBC A;  2ZR6 A;  1D2K A;  1FKD A;  4JFI A;  1D7J A;  1SYT A;  3MDY B;  4FN2 A;  4TW6 A;  1WNO A;  4U85 A;  3CHF A;  5I98 A;  1GRJ A;  2OLH A;  2PPN A;  1FKK A;  3RME A;  1FFQ A;  4GIV A;  1ZU8 A;  2ZR4 A;  3UI5 A;  4IPX A;  1E44 A;  4QT2 A;  3G6M A;  1D6O A;  3O5D A;  3AS2 A;  2XP6 A;  1W9V A;  4P8X A;  2RQS A;  4MTV A;  3O5E A;  3AS0 A;  4MNK A;  4FAP A;  1X6N A;  3CGM A;  1F8A B;  3JXV A;  1JNT A;  1ZBW A;  4MNM A;  3JYJ A;  1D7I A;  3OOB A;  4DWS D;  1W9U A;  5HT1 A;  2O92 A;  3ALF A;  3G6L A;  4LAY A;  1ROT A;  3UF8 A;  2PV1 A;  4Z2I A;  1HXV A;  2DSV A;  4G50 A;  2VN1 A;  4MGV A;  3WL0 A;  3IKD A;  1FD9 A;  4W5U A;  4Z2G A;  4U86 A;  2XP4 A;  2ZQU A;  2M2A A;  5GQB A;  4L72 B;  3CHD A;  1E6Z A;  4BF8 A;  4IQC A;  3W4R A;  1UR9 A;  4ITZ A;  3IK8 A;  5JH8 A;  3CH9 A;  4R5E A;  2ITK A;  1H0I A;  2ZQV A;  1JNS A;  4QZV B;  4J4N A;  1RD6 A;  3O5I A;  3WD2 A;  1FKB A;  4DRQ A;  5HKG A;  3WIJ A;  2F21 A;  2DSU A;  2YBT A;  3ARR A;  1GPF A;  3JYM A;  2LGO A;  1LG2 A;  3WL1 A;  3GPK A; 
#chains in the Genus database with same CATH homology
 2FKE A;  1JNE A;  2LJ4 A;  2Y78 A;  3PR9 A;  1H0G A;  1FFR A;  3AQU A;  4ZPV R;  5GPG A;  2IUZ A;  4DH0 A;  2OFN A;  4Q7N A;  3RFW A;  1NMV A;  2B31 A;  1WB0 A;  2ZQT A;  4MPK A;  4ODK A;  4Z2K A;  4Z2L A;  2KFW A;  1W1V A;  4PTM A;  1K9T A;  2RUQ A;  4ODQ A;  1NWT A;  4WKA A;  1LQ0 A;  4G2P A;  1Q1C A;  3TC5 A;  4XAK A;  1FKI A;  3RM4 A;  2XPB A;  4QT3 A;  1W1Y A;  4TYO A;  3WKZ A;  1TCO C;  4LAX A;  4ODP A;  3PRD A;  1UR8 A;  4WKH A;  3UI4 A;  3KAH A;  5HUA A;  4LAW A;  3ARW A;  1OGG A;  2AWG A;  1L1P A;  2F4E A;  2DG4 A;  3IHZ A;  2MLY A;  5GPR A;  1A7X A;  3NI6 A;  1FKF A;  1HJX A;  3ARS A;  4KQZ A;  3CGN A;  3B7X A;  1P5Q A;  1LL4 A;  2PPO A;  3ARO A;  4ODR A;  1LJY A;  1VF8 A;  2XP5 A;  4WKF A;  1W26 A;  1GOI A;  4IT6 A;  2WK2 A;  1Q6U A;  1HKK A;  3UQB A;  1KFW A;  4WK9 A;  2DT2 A;  3ARZ A;  3O5O A;  2MPH A;  4NNR A;  3ART A;  2PV2 A;  5HWB A;  1ZB5 A;  1B6C A;  2RUR A;  4ZS6 A;  1HKM A;  1YW5 A;  1NMW A;  4NZC A;  4JFK A;  2AOS A;  3O5M A;  2M08 A;  5BXJ A;  2K8I A;  5HWC A;  2N87 A;  3KAG A;  1BL4 A;  1Q6I A;  2G41 A;  3KAF A;  3PRB A;  1ZK6 A;  5DF0 A;  3WD1 A;  4TW7 A;  1QPL A;  2LPV A;  4ODL A;  1J6Y A;  2WLZ A;  2DPE A;  1BKF A;  3WD0 A;  2ESC A;  2A3B A;  1W9P A;  2MF9 A;  4DZ2 A;  1NWR A;  2VCD A;  3IKG A;  1FKH A;  3FY1 A;  5DIU A;  4DRP A;  2PI6 A;  3KZ7 A;  3BXW A;  2RSE A;  3KAC A;  3B8S A;  1QZ2 A;  3O5K A;  1IX5 A;  2RUC A;  2DT1 A;  1FKG A;  4W9Q A;  4W9P A;  1M5Y A;  5HW7 A;  4MNJ A;  4DIP A;  1E9L A;  2MLX A;  1HJW A;  2MNT A;  1HJV A;  3KCE A;  2WLY A;  2FDM A;  4P8V A;  3TDB A;  4Q22 A;  5D75 A;  1E6P A;  3B9E A;  4JFJ A;  1FAP A;  3TCZ A;  2O9O A;  4ODN A;  1NWU A;  4O2T A;  1F40 A;  1SR0 A;  1XHG A;  1J4H A;  4MAV A;  1FKR A;  3VAW A;  3O5Q A;  4URI A;  4DWS B;  3KAD A;  4DT4 A;  3I6C A;  4AY1 A;  2XP8 A;  3WD4 A;  3FXY A;  4ODO A;  4R0X A;  3RM8 A;  3ARV A;  1ZBC A;  2MLZ A;  3O5R A;  3UQA A;  1O6I A;  1ZBV A;  3CHC A;  4TNS A;  4C02 B;  2KR7 A;  2DG3 A;  4HAR A;  1YAT A;  1N1A A;  1U79 A;  2M1I A;  3NRK A;  1X6L A;  2QF8 A;  3ARX A;  2ZR5 A;  4LAV A;  1EDQ A;  1EHN A;  2D9F A;  4KR0 B;  4JYS A;  1Y0O A;  1ZBK A;  2FAP A;  1ZCN A;  3PA7 A;  2DT3 A;  2A3C A;  4ODM A;  4Z2J A;  3O5G A;  4JFL A;  3PRA A;  2DSZ A;  4N19 A;  1LL6 A;  5HW6 A;  3WQW A;  4MSP A;  3AS3 A;  4QIB A;  1E15 A;  4TW8 A;  3WH0 A;  3QOK A;  1CTN A;  1EQ3 A;  1Q6H A;  4NSB A;  3NTP A;  4P8W A;  2KGJ A;  3KAI A;  3O5J A;  3ARQ A;  1E6N A;  4IQ2 A;  4U84 A;  5HW8 A;  1ROU A;  3O5L A;  3B9D A;  4ZPT R;  2RUD A;  4WIW A;  4JFM A;  4J4O A;  4DRN A;  1ITX A;  2XP7 A;  3KAB A;  2L2S A;  4HBO A;  4HBE A;  3RGC A;  3O5F A;  2DG9 A;  1T11 A;  3EY6 A;  1OGB A;  5DIT A;  1WAW A;  1R9H A;  4DRM A;  5DIV A;  1GUV A;  4WJX A;  3O5P A;  5DEZ A;  1W1P A;  3OA5 A;  1QPF A;  1KT0 A;  3UQI A;  1EYM A;  2UZ5 A;  4L3N A;  1FKJ A;  2XP9 A;  5DO2 A;  4IT4 A;  1W1T A;  3WD3 A;  3WQV A;  4W9O A;  1NH6 A;  1PIN A;  2PPP A;  1FKT A;  2WM0 A;  3CHE A;  3ALG A;  1HKJ A;  2JZV A;  2G8Z A;  4TX0 A;  4DRJ A;  3ARU A;  4DWS C;  1NSG A;  4DRO A;  4LGX A;  2KI3 A;  1FJD A;  3FAP A;  1C9H A;  1PBK A;  3H9R B;  1JVW A;  1D7H A;  4DRH A;  1FKS A;  1FKL A;  1HKI A;  1NWS A;  5J6E A;  2Q5A A;  2XPA A;  1J4I A;  2XP3 A;  2ZQS A;  3LUO A;  3CZ8 A;  4ML4 A;  2KO7 A;  1JND A;  3UI6 A;  4DRI A;  5HBF A;  4MNL A;  2F2D A;  4S3K A;  3B9A A;  2A3E A;  4ZPW R;  4S3J A;  3RM9 A;  1XRV A;  1ZL1 A;  2YBU A;  2PV3 A;  4P8U A;  4Z2H A;  3ARY A;  3ARP A;  2DT0 A;  3AS1 A;  2KE0 A;  4GGQ A;  1KT1 A;  4DZ3 A;  4DRK A;  2IF4 A;  2LKN A;  1TFV A;  5HTG A;  2A3A A;  1LG1 A;  4DWS A;  3ODK A;  1E6R A;  1EIB A;  1LL7 A;  1OWQ A;  5B8I C;  2DSW A;  1J4R A;  2PBC A;  2ZR6 A;  1D2K A;  1FKD A;  4JFI A;  1D7J A;  1SYT A;  3MDY B;  4FN2 A;  4TW6 A;  1WNO A;  4U85 A;  3CHF A;  5I98 A;  2OLH A;  2PPN A;  1FKK A;  3RME A;  1FFQ A;  4GIV A;  1ZU8 A;  2ZR4 A;  3UI5 A;  4IPX A;  4QT2 A;  3G6M A;  1D6O A;  3O5D A;  3AS2 A;  2XP6 A;  1W9V A;  4P8X A;  2RQS A;  4MTV A;  3O5E A;  3AS0 A;  4MNK A;  4FAP A;  1X6N A;  3CGM A;  1F8A B;  3JXV A;  1JNT A;  1ZBW A;  4MNM A;  3JYJ A;  1D7I A;  3OOB A;  4DWS D;  1W9U A;  5HT1 A;  2O92 A;  3ALF A;  3G6L A;  4LAY A;  1ROT A;  3UF8 A;  2PV1 A;  4Z2I A;  1HXV A;  2DSV A;  4G50 A;  2VN1 A;  4MGV A;  3WL0 A;  3IKD A;  1FD9 A;  4W5U A;  4Z2G A;  4U86 A;  2XP4 A;  2ZQU A;  2M2A A;  5GQB A;  4L72 B;  3CHD A;  1E6Z A;  4BF8 A;  4IQC A;  3W4R A;  1UR9 A;  4ITZ A;  3IK8 A;  5JH8 A;  3CH9 A;  4R5E A;  2ITK A;  1H0I A;  2ZQV A;  1JNS A;  4QZV B;  4J4N A;  1RD6 A;  3O5I A;  3WD2 A;  1FKB A;  4DRQ A;  5HKG A;  3WIJ A;  2F21 A;  2DSU A;  2YBT A;  3ARR A;  1GPF A;  3JYM A;  2LGO A;  1LG2 A;  3WL1 A;  3GPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...