3IKGA

Structure-based design of novel pin1 inhibitors (i)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ikgA00
4JFIA 1D7IA 1NMVA 1ROUA 2MPHA 1Q1CA 1PINA 4JFKA 4TYOA 2MNTA 2M2AA 4DROA 1FJDA 1BKFA 3PRDA 1M5YA 2ZR4A 2Q5AA 5HW6A 4IQCA 4IPXA 2LPVA 1YATA 4ODLA 4DIPA 1N1AA 3O5MA 4N19A 5DITA 3O5LA 3PA7A 1FKGA 2MLYA 2VN1A 2XPAA 2RUQA 4DH0A 4DRMA 2KFWA 3NRKA 3RFWA 3UQIA 1F8AB 3IKGA 4BF8A 3KAGA 1J6YA 4U86A 1QPFA 1Y0OA 1TCOC 4IQ2A 4G50A 2PBCA 2LGOA 1FKJA 2ZR6A 4ODQA 2LJ4A 4JFMA 3LUOA 4TNSA 1J4RA 2XPBA 1J4IA 4LAWA 4U84A 5HW7A 3KADA 1Q6HA 3H9RB 3KACA 4JYSA 5HUAA 2PPOA 1QZ2A 2IF4A 1F40A 4FN2A 1KT0A 1EQ3A 3UQAA 4J4NA 1EYMA 4ODOA 1D6OA 1PBKA 1FKIA 5HT1A 2VCDA 1T11A 1D7JA 1QPLA 3NTPA 4J4OA 3UI5A 2RUCA 1FKLA 3JYJA 2PV1A 3KAIA 1ZCNA 4ODKA 4JFLA 1JVWA 4ODMA 2N87A 3O5QA 2PPNA 2DG4A 5I98A 2XP4A 4DRHA 2KE0A 2AWGA 3FAPA 4LAXA 1NMWA 3RGCA 2F4EA 3KAFA 3WH0A 5D75A 4C02B 1R9HA 3CGMA 4G2PA 1D7HA 2RURA 2FAPA 3IHZA 3PRBA 2XP3A 2ZQSA 4JFJA 4W9OA 3EY6A 2ZQTA 3O5JA 1Q6IA 4MSPA 5GPGA 4DRIA 4DRNA 1L1PA 2XP8A 2M1IA 4GIVA 3O5KA 4LAVA 3I6CA 4NNRA 2D9FA 2MF9A 3TC5A 3O5IA 4QT2A 4TW8A 1A7XA 1YW5A 2XP9A 2ZQUA 4W9QA 2FKEA 2XP6A 3NI6A 3MDYB 4DRKA 2ZQVA 2UZ5A 5HWCA 1ZK6A 4U85A 3IKDA 4DZ2A 2M08A 4TW6A 2L2SA 3TCZA 4R0XA 1FD9A 4MGVA 3CGNA 3KABA 2MLXA 1FAPA 3O5PA 4W9PA 1FKBA 1J4HA 1B6CA 1FKSA 3JYMA 1JNSA 4DZ3A 2PV3A 4ITZA 3O5RA 2DG9A 2PV2A 3VAWA 3UQBA 1Q6UA 1NSGA 3KCEA 3UI4A 3UF8A 4DRPA 1U79A 3UI6A 4ODPA 4TX0A 4DRJA 4GGQA 5J6EA 2RQSA 2OFNA 3ODKA 1BL4A 4QT3A 1FKFA 1FKTA 2JZVA 2LKNA 1P5QA 3IK8A 2MLZA 3O5EA 2KR7A 4TW7A 1JNTA 2KGJA 3GPKA 2PPPA 1KT1A 1FKHA 2ITKA 3OOBA 4DRQA 5HW8A 2DG3A 4QIBA 3O5FA 4LAYA 3O5GA 5B8IC 2ZR5A 1HXVA 2Y78A 5HTGA 2RSEA 1FKRA 2KO7A 5DIUA 3B7XA 3O5OA 3TDBA 2XP7A 3KZ7A 1W26A 2XP5A 1FKDA 3O5DA 1FKKA 4FAPA 2RUDA 5BXJA 5HKGA 4ODRA 2F2DA 5HWBA 1ROTA 2KI3A 2F21A 3JXVA 4ODNA 3KAHA 4O2TA 2K8IA 4DT4A 5DIVA 1C9HA
chains in the Genus database with same CATH superfamily
4ZPVR 1ROUA 2DT2A 3WD4A 3ARUA 1ZBVA 2LPVA 1LG2A 3O5MA 3O5LA 2VN1A 2RUQA 3UQIA 1F8AB 4BF8A 2DSWA 4U86A 2DT3A 4HBOA 1TCOC 4JFMA 1D2KA 4U84A 1SR0A 3KADA 3ARYA 4JYSA 1X6NA 4J4NA 5HT1A 4L72B 1T11A 1D7JA 3ARPA 1IX5A 4J4OA 1ZU8A 3UI5A 2RUCA 1HJVA 3AROA 3B9DA 4MAVA 1WNOA 3WL1A 1E15A 2KE0A 1ZBCA 1HJWA 4WIWA 4LAXA 2WLYA 3RGCA 4Z2KA 4DWSB 3CGMA 4DT4A 3PRBA 4JFJA 2ESCA 3EY6A 5GPGA 4MSPA 1L1PA 4DRNA 4AY1A 1X6LA 2M1IA 3ALFA 3B9EA 3I6CA 3OA5A 4QT2A 2ZQUA 4WKAA 3NI6A 4DRKA 1OGBA 2UZ5A 4U85A 1FD9A 2YBTA 3EIPA 4DZ3A 1E6NA 4ITZA 4NSBA 5JH8A 3UI4A 1LL4A 1U79A 3AS1A 1OWQA 4GGQA 2RQSA 3RM4A 1BL4A 4S3JA 1OGGA 4XAKA 3G6LA 5HW8A 4LAYA 5B8IC 1RD6A 4MNLA 3WD3A 3O5OA 3KZ7A 5BXJA 1FKKA 3ARQA 2RUDA 5HWBA 3WQVA 4HARA 4W5UA 2DT0A 3CHFA 3KAHA 2K8IA 4MNMA 1W9VA 1D7IA 4JFKA 2IUZA 1PINA 1O6IA 1FJDA 1BKFA 2ZR4A 2Q5AA 2G8ZA 3GU0A 4ODLA 1HJXA 4N19A 3PA7A 1FKGA 4PTMA 3IKGA 4MNJA 3KAGA 2DT1A 1J6YA 5GPRA 1QPFA 4G50A 1WAWA 2PBCA 2LGOA 1J4RA 2XPBA 4Q22A 1Q6HA 3H9RB 5HUAA 2PPOA 1QZ2A 2B5UB 2WK2A 1W1PA 4FN2A 4S3KA 1FKIA 1FKLA 4Q7NA 2PV1A 3KAIA 4Z2LA 4JFLA 3O5QA 2AOSA 4DWSA 4DRHA 3ARVA 3FAPA 4WKFA 5D75A 1GRJA 1R9HA 3B8SA 2DSVA 1W1YA 3WIJA 4QZVB 3TC5A 1FFQA 2MF9A 1A7XA 4W9QA 2XP9A 2FKEA 1NWRA 1JNDA 1FFRA 4DZ2A 4Z2JA 1ZL1A 3AS2A 3KABA 2MLXA 1FAPA 4W9PA 4P8VA 1FKBA 1J4HA 3JYMA 2PV3A 3O5RA 2PV2A 3VAWA 1Q6UA 3KCEA 3UF8A 4DRPA 3PR9A 4TX0A 4QT3A 1FKTA 2JZVA 1P5QA 1W1TA 4P8WA 3ARSA 3FXYA 1KT1A 2EULA 2ITKA 3AS0A 3GTYX 2A3BA 3O5GA 5HTGA 2RSEA 3B7XA 1JCHB 4FAPA 1FKDA 2F23A 4DWSD 4ZPTR 2F21A 3ARTA 3JXVA 4IT6A 4O2TA 4DROA 3CZ8A 4WJXA 2MNTA 5DEZA 1M5YA 4IQCA 4IPXA 1HKMA 1YATA 1WB0A 5DITA 1CTNA 2MLYA 4DRMA 2ETNA 4UDMA 3NRKA 2WLZA 1E6PA 3PRAA 2ZR6A 3FY1A 4TNSA 1J4IA 4KQZA 1K9TA 1HKJA 1W1VA 1F40A 1E44A 1EDQA 1EYMA 1D6OA 1PBKA 1QPLA 3NTPA 4NZCA 1ZCNA 4ODKA 4ODMA 3WQWA 1UR8A 2DG4A 5I98A 2DSZA 4Z2GA 2AWGA 2PI6A 5DF0A 2O92A 3WH0A 4C02B 4G2PA 1D7HA 2RURA 2FAPA 2PN0A 3IHZA 2XP3A 2ZQTA 3W4RA 3B9AA 1GOIA 4MPKA 4GIVA 3O5KA 4LAVA 4WKHA 1TFVA 1ZBKA 1YW5A 2A3AA 3BMBA 4TW8A 4Z2HA 2XP6A 3MDYB 4LGXA 5HWCA 4Z2IA 2B31A 2L2SA 3TCZA 4R0XA 3O5PA 1B6CA 1HKKA 3UQBA 3CH9A 4ODPA 4DRJA 5J6EA 1W9PA 3ODKA 3IK8A 2MLZA 1KFWA 3ARXA 3O5EA 4TW7A 1NWSA 1H0IA 1JNTA 1XHGA 3GPKA 3WD2A 1EIBA 4DRQA 3O5FA 1E6RA 1NH6A 2Y78A 1FKRA 5DIUA 2G41A 3TDBA 3ARWA 1W26A 2XP5A 3RM9A 3ALGA 2F2DA 2KI3A 2A3EA 4ODNA 1C9HA 4JFIA 1NMVA 1UR9A 1XRVA 2MPHA 1Q1CA 4KR0B 4TYOA 2M2AA 3WL0A 3CHDA 3PRDA 3QOKA 5HW6A 4ZS6A 2P4VA 4DIPA 1N1AA 4P8XA 2XPAA 1ZBWA 4DH0A 2KFWA 3RFWA 4DWSC 3RMEA 1Y0OA 3AQUA 4IQ2A 1FKJA 4ODQA 3BXWA 2LJ4A 3CHCA 3LUOA 4LAWA 5HW7A 3WD1A 3KACA 1LL6A 2IF4A 1HKIA 2A3CA 1KT0A 1EQ3A 3UQAA 4ODOA 1SYTA 2VCDA 2QF8A 4ML4A 4L3NA 4WK9A 3JYJA 4MTVA 1JVWA 4ZPWR 2N87A 1E6ZA 2PPNA 1H0GA 4IT4A 1JNEA 2XP4A 3ARZA 1NMWA 3CHEA 2F4EA 3KAFA 4HBEA 2WM0A 4W9OA 2ZQSA 4DRIA 3G6MA 3O5JA 1Q6IA 2XP8A 4NNRA 2D9FA 3AS3A 3O5IA 1LL7A 3RM8A 2ZQVA 1ITXA 1GUVA 1LJYA 1ZK6A 3IKDA 2M08A 4TW6A 4MGVA 2YBUA 3CGNA 4URIA 1GPFA 2DSUA 1FKSA 1JNSA 1ZB5A 1W9UA 2FDMA 1EHNA 2OLHA 2DG9A 3WD0A 5HBFA 1NSGA 3UI6A 1VF8A 2OFNA 2DPEA 1FKFA 2LKNA 5DO2A 2KR7A 2KGJA 2PPPA 5GQBA 1E9LA 1FKHA 3OOBA 2DG3A 4QIBA 1LQ0A 1HXVA 1NWTA 2ZR5A 2KO7A 4P8UA 2XP7A 3O5DA 5HKGA 1LG1A 4MNKA 4ODRA 1ROTA 1NWUA 3ARRA 2O9OA 4R5EA 5DIVA 3WKZA
chains in the Genus database with same CATH topology
4ZPVR 1ROUA 2DT2A 3WD4A 3ARUA 1ZBVA 2LPVA 1LG2A 3O5MA 3O5LA 2VN1A 2RUQA 3UQIA 1F8AB 4BF8A 2DSWA 4U86A 2DT3A 4HBOA 1TCOC 4JFMA 1D2KA 4U84A 1SR0A 3KADA 3ARYA 4JYSA 1X6NA 4J4NA 5HT1A 4L72B 1T11A 1D7JA 3ARPA 1IX5A 4J4OA 1ZU8A 3UI5A 2RUCA 1HJVA 3AROA 3B9DA 4MAVA 1WNOA 3WL1A 1E15A 2KE0A 1ZBCA 1HJWA 4WIWA 4LAXA 2WLYA 3RGCA 4Z2KA 4DWSB 3CGMA 4DT4A 3PRBA 4JFJA 2ESCA 3EY6A 5GPGA 4MSPA 1L1PA 4DRNA 4AY1A 1X6LA 2M1IA 3ALFA 3B9EA 3I6CA 3OA5A 4QT2A 2ZQUA 4WKAA 3NI6A 4DRKA 1OGBA 2UZ5A 4U85A 1FD9A 2YBTA 4DZ3A 1E6NA 4ITZA 4NSBA 5JH8A 3UI4A 1LL4A 1U79A 3AS1A 1OWQA 4GGQA 2RQSA 3RM4A 1BL4A 4S3JA 1OGGA 4XAKA 3G6LA 5HW8A 4LAYA 5B8IC 1RD6A 4MNLA 3WD3A 3O5OA 3KZ7A 5BXJA 1FKKA 3ARQA 2RUDA 5HWBA 3WQVA 4HARA 4W5UA 2DT0A 3CHFA 3KAHA 2K8IA 4MNMA 1W9VA 1D7IA 4JFKA 2IUZA 1PINA 1O6IA 1FJDA 1BKFA 2ZR4A 2Q5AA 2G8ZA 4ODLA 1HJXA 4N19A 3PA7A 1FKGA 4PTMA 3IKGA 4MNJA 3KAGA 2DT1A 1J6YA 5GPRA 1QPFA 4G50A 1WAWA 2PBCA 2LGOA 1J4RA 2XPBA 4Q22A 1Q6HA 3H9RB 5HUAA 2PPOA 1QZ2A 2WK2A 1W1PA 4FN2A 4S3KA 1FKIA 1FKLA 4Q7NA 2PV1A 3KAIA 4Z2LA 4JFLA 3O5QA 2AOSA 4DWSA 4DRHA 3ARVA 3FAPA 4WKFA 5D75A 1R9HA 3B8SA 2DSVA 1W1YA 3WIJA 4QZVB 3TC5A 1FFQA 2MF9A 1A7XA 4W9QA 2XP9A 2FKEA 1NWRA 1JNDA 1FFRA 4DZ2A 4Z2JA 1ZL1A 3AS2A 3KABA 2MLXA 1FAPA 4W9PA 4P8VA 1FKBA 1J4HA 3JYMA 2PV3A 3O5RA 2PV2A 3VAWA 1Q6UA 3KCEA 3UF8A 4DRPA 3PR9A 4TX0A 4QT3A 1FKTA 2JZVA 1P5QA 1W1TA 4P8WA 3ARSA 3FXYA 1KT1A 2ITKA 3AS0A 2A3BA 3O5GA 5HTGA 2RSEA 3B7XA 4FAPA 1FKDA 4DWSD 4ZPTR 2F21A 3ARTA 3JXVA 4IT6A 4O2TA 4DROA 3CZ8A 4WJXA 2MNTA 5DEZA 1M5YA 4IQCA 4IPXA 1HKMA 1YATA 1WB0A 5DITA 1CTNA 2MLYA 4DRMA 3NRKA 2WLZA 1E6PA 3PRAA 2ZR6A 3FY1A 4TNSA 1J4IA 4KQZA 1K9TA 1HKJA 1W1VA 1F40A 1EDQA 1EYMA 1D6OA 1PBKA 1QPLA 3NTPA 4NZCA 1ZCNA 4ODKA 4ODMA 3WQWA 1UR8A 2DG4A 5I98A 2DSZA 4Z2GA 2AWGA 2PI6A 5DF0A 2O92A 3WH0A 4C02B 4G2PA 1D7HA 2RURA 2FAPA 3IHZA 2XP3A 2ZQTA 3W4RA 3B9AA 1GOIA 4MPKA 4GIVA 3O5KA 4LAVA 4WKHA 1TFVA 1ZBKA 1YW5A 2A3AA 4TW8A 4Z2HA 2XP6A 3MDYB 4LGXA 5HWCA 4Z2IA 2B31A 2L2SA 3TCZA 4R0XA 3O5PA 1B6CA 1HKKA 3UQBA 3CH9A 4ODPA 4DRJA 5J6EA 1W9PA 3ODKA 3IK8A 2MLZA 1KFWA 3ARXA 3O5EA 4TW7A 1NWSA 1H0IA 1JNTA 1XHGA 3GPKA 3WD2A 1EIBA 4DRQA 3O5FA 1E6RA 1NH6A 2Y78A 1FKRA 5DIUA 2G41A 3TDBA 3ARWA 1W26A 2XP5A 3RM9A 3ALGA 2F2DA 2KI3A 2A3EA 4ODNA 1C9HA 4JFIA 1NMVA 1UR9A 1XRVA 2MPHA 1Q1CA 4KR0B 4TYOA 2M2AA 3WL0A 3CHDA 3PRDA 3QOKA 5HW6A 4ZS6A 4DIPA 1N1AA 4P8XA 2XPAA 1ZBWA 4DH0A 2KFWA 3RFWA 4DWSC 3RMEA 1Y0OA 3AQUA 4IQ2A 1FKJA 4ODQA 3BXWA 2LJ4A 3CHCA 3LUOA 4LAWA 5HW7A 3WD1A 3KACA 1LL6A 2IF4A 1HKIA 2A3CA 1KT0A 1EQ3A 3UQAA 4ODOA 1SYTA 2VCDA 2QF8A 4ML4A 4L3NA 4WK9A 3JYJA 4MTVA 1JVWA 4ZPWR 2N87A 1E6ZA 2PPNA 1H0GA 4IT4A 1JNEA 2XP4A 3ARZA 1NMWA 3CHEA 2F4EA 3KAFA 4HBEA 2WM0A 4W9OA 2ZQSA 4DRIA 3G6MA 3O5JA 1Q6IA 2XP8A 4NNRA 2D9FA 3AS3A 3O5IA 1LL7A 3RM8A 2ZQVA 1ITXA 1GUVA 1LJYA 1ZK6A 3IKDA 2M08A 4TW6A 4MGVA 2YBUA 3CGNA 4URIA 1GPFA 2DSUA 1FKSA 1JNSA 1ZB5A 1W9UA 2FDMA 1EHNA 2OLHA 2DG9A 3WD0A 5HBFA 1NSGA 3UI6A 1VF8A 2OFNA 2DPEA 1FKFA 2LKNA 5DO2A 2KR7A 2KGJA 2PPPA 5GQBA 1E9LA 1FKHA 3OOBA 2DG3A 4QIBA 1LQ0A 1HXVA 1NWTA 2ZR5A 2KO7A 4P8UA 2XP7A 3O5DA 5HKGA 1LG1A 4MNKA 4ODRA 1ROTA 1NWUA 3ARRA 2O9OA 4R5EA 5DIVA 3WKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFI A;  1D7I A;  1NMV A;  1ROU A;  2MPH A;  1Q1C A;  1PIN A;  4JFK A;  4TYO A;  2MNT A;  2M2A A;  4DRO A;  1FJD A;  1BKF A;  3PRD A;  1M5Y A;  2ZR4 A;  2Q5A A;  5HW6 A;  4IQC A;  4IPX A;  2LPV A;  1YAT A;  4ODL A;  4DIP A;  1N1A A;  3O5M A;  4N19 A;  5DIT A;  3O5L A;  3PA7 A;  1FKG A;  2MLY A;  2VN1 A;  2XPA A;  2RUQ A;  4DH0 A;  4DRM A;  2KFW A;  3NRK A;  3RFW A;  3UQI A;  1F8A B;  3IKG A;  4BF8 A;  3KAG A;  1J6Y A;  4U86 A;  1QPF A;  1Y0O A;  1TCO C;  4IQ2 A;  4G50 A;  2PBC A;  2LGO A;  1FKJ A;  2ZR6 A;  4ODQ A;  2LJ4 A;  4JFM A;  3LUO A;  4TNS A;  1J4R A;  2XPB A;  1J4I A;  4LAW A;  4U84 A;  5HW7 A;  3KAD A;  1Q6H A;  3H9R B;  3KAC A;  4JYS A;  5HUA A;  2PPO A;  1QZ2 A;  2IF4 A;  1F40 A;  4FN2 A;  1KT0 A;  1EQ3 A;  3UQA A;  4J4N A;  1EYM A;  4ODO A;  1D6O A;  1PBK A;  1FKI A;  5HT1 A;  2VCD A;  1T11 A;  1D7J A;  1QPL A;  3NTP A;  4J4O A;  3UI5 A;  2RUC A;  1FKL A;  3JYJ A;  2PV1 A;  3KAI A;  1ZCN A;  4ODK A;  4JFL A;  1JVW A;  4ODM A;  2N87 A;  3O5Q A;  2PPN A;  2DG4 A;  5I98 A;  2XP4 A;  4DRH A;  2KE0 A;  2AWG A;  3FAP A;  4LAX A;  1NMW A;  3RGC A;  2F4E A;  3KAF A;  3WH0 A;  5D75 A;  4C02 B;  1R9H A;  3CGM A;  4G2P A;  1D7H A;  2RUR A;  2FAP A;  3IHZ A;  3PRB A;  2XP3 A;  2ZQS A;  4JFJ A;  4W9O A;  3EY6 A;  2ZQT A;  3O5J A;  1Q6I A;  4MSP A;  5GPG A;  4DRI A;  4DRN A;  1L1P A;  2XP8 A;  2M1I A;  4GIV A;  3O5K A;  4LAV A;  3I6C A;  4NNR A;  2D9F A;  2MF9 A;  3TC5 A;  3O5I A;  4QT2 A;  4TW8 A;  1A7X A;  1YW5 A;  2XP9 A;  2ZQU A;  4W9Q A;  2FKE A;  2XP6 A;  3NI6 A;  3MDY B;  4DRK A;  2ZQV A;  2UZ5 A;  5HWC A;  1ZK6 A;  4U85 A;  3IKD A;  4DZ2 A;  2M08 A;  4TW6 A;  2L2S A;  3TCZ A;  4R0X A;  1FD9 A;  4MGV A;  3CGN A;  3KAB A;  2MLX A;  1FAP A;  3O5P A;  4W9P A;  1FKB A;  1J4H A;  1B6C A;  1FKS A;  3JYM A;  1JNS A;  4DZ3 A;  2PV3 A;  4ITZ A;  3O5R A;  2DG9 A;  2PV2 A;  3VAW A;  3UQB A;  1Q6U A;  1NSG A;  3KCE A;  3UI4 A;  3UF8 A;  4DRP A;  1U79 A;  3UI6 A;  4ODP A;  4TX0 A;  4DRJ A;  4GGQ A;  5J6E A;  2RQS A;  2OFN A;  3ODK A;  1BL4 A;  4QT3 A;  1FKF A;  1FKT A;  2JZV A;  2LKN A;  1P5Q A;  3IK8 A;  2MLZ A;  3O5E A;  2KR7 A;  4TW7 A;  1JNT A;  2KGJ A;  3GPK A;  2PPP A;  1KT1 A;  1FKH A;  2ITK A;  3OOB A;  4DRQ A;  5HW8 A;  2DG3 A;  4QIB A;  3O5F A;  4LAY A;  3O5G A;  5B8I C;  2ZR5 A;  1HXV A;  2Y78 A;  5HTG A;  2RSE A;  1FKR A;  2KO7 A;  5DIU A;  3B7X A;  3O5O A;  3TDB A;  2XP7 A;  3KZ7 A;  1W26 A;  2XP5 A;  1FKD A;  3O5D A;  1FKK A;  4FAP A;  2RUD A;  5BXJ A;  5HKG A;  4ODR A;  2F2D A;  5HWB A;  1ROT A;  2KI3 A;  2F21 A;  3JXV A;  4ODN A;  3KAH A;  4O2T A;  2K8I A;  4DT4 A;  5DIV A;  1C9H A; 
#chains in the Genus database with same CATH topology
 4ZPV R;  1ROU A;  2DT2 A;  3WD4 A;  3ARU A;  1ZBV A;  2LPV A;  1LG2 A;  3O5M A;  3O5L A;  2VN1 A;  2RUQ A;  3UQI A;  1F8A B;  4BF8 A;  2DSW A;  4U86 A;  2DT3 A;  4HBO A;  1TCO C;  4JFM A;  1D2K A;  4U84 A;  1SR0 A;  3KAD A;  3ARY A;  4JYS A;  1X6N A;  4J4N A;  5HT1 A;  4L72 B;  1T11 A;  1D7J A;  3ARP A;  1IX5 A;  4J4O A;  1ZU8 A;  3UI5 A;  2RUC A;  1HJV A;  3ARO A;  3B9D A;  4MAV A;  1WNO A;  3WL1 A;  1E15 A;  2KE0 A;  1ZBC A;  1HJW A;  4WIW A;  4LAX A;  2WLY A;  3RGC A;  4Z2K A;  4DWS B;  3CGM A;  4DT4 A;  3PRB A;  4JFJ A;  2ESC A;  3EY6 A;  5GPG A;  4MSP A;  1L1P A;  4DRN A;  4AY1 A;  1X6L A;  2M1I A;  3ALF A;  3B9E A;  3I6C A;  3OA5 A;  4QT2 A;  2ZQU A;  4WKA A;  3NI6 A;  4DRK A;  1OGB A;  2UZ5 A;  4U85 A;  1FD9 A;  2YBT A;  3EIP A;  4DZ3 A;  1E6N A;  4ITZ A;  4NSB A;  5JH8 A;  3UI4 A;  1LL4 A;  1U79 A;  3AS1 A;  1OWQ A;  4GGQ A;  2RQS A;  3RM4 A;  1BL4 A;  4S3J A;  1OGG A;  4XAK A;  3G6L A;  5HW8 A;  4LAY A;  5B8I C;  1RD6 A;  4MNL A;  3WD3 A;  3O5O A;  3KZ7 A;  5BXJ A;  1FKK A;  3ARQ A;  2RUD A;  5HWB A;  3WQV A;  4HAR A;  4W5U A;  2DT0 A;  3CHF A;  3KAH A;  2K8I A;  4MNM A;  1W9V A;  1D7I A;  4JFK A;  2IUZ A;  1PIN A;  1O6I A;  1FJD A;  1BKF A;  2ZR4 A;  2Q5A A;  2G8Z A;  3GU0 A;  4ODL A;  1HJX A;  4N19 A;  3PA7 A;  1FKG A;  4PTM A;  3IKG A;  4MNJ A;  3KAG A;  2DT1 A;  1J6Y A;  5GPR A;  1QPF A;  4G50 A;  1WAW A;  2PBC A;  2LGO A;  1J4R A;  2XPB A;  4Q22 A;  1Q6H A;  3H9R B;  5HUA A;  2PPO A;  1QZ2 A;  2B5U B;  2WK2 A;  1W1P A;  4FN2 A;  4S3K A;  1FKI A;  1FKL A;  4Q7N A;  2PV1 A;  3KAI A;  4Z2L A;  4JFL A;  3O5Q A;  2AOS A;  4DWS A;  4DRH A;  3ARV A;  3FAP A;  4WKF A;  5D75 A;  1GRJ A;  1R9H A;  3B8S A;  2DSV A;  1W1Y A;  3WIJ A;  4QZV B;  3TC5 A;  1FFQ A;  2MF9 A;  1A7X A;  4W9Q A;  2XP9 A;  2FKE A;  1NWR A;  1JND A;  1FFR A;  4DZ2 A;  4Z2J A;  1ZL1 A;  3AS2 A;  3KAB A;  2MLX A;  1FAP A;  4W9P A;  4P8V A;  1FKB A;  1J4H A;  3JYM A;  2PV3 A;  3O5R A;  2PV2 A;  3VAW A;  1Q6U A;  3KCE A;  3UF8 A;  4DRP A;  3PR9 A;  4TX0 A;  4QT3 A;  1FKT A;  2JZV A;  1P5Q A;  1W1T A;  4P8W A;  3ARS A;  3FXY A;  1KT1 A;  2EUL A;  2ITK A;  3AS0 A;  3GTY X;  2A3B A;  3O5G A;  5HTG A;  2RSE A;  3B7X A;  1JCH B;  4FAP A;  1FKD A;  2F23 A;  4DWS D;  4ZPT R;  2F21 A;  3ART A;  3JXV A;  4IT6 A;  4O2T A;  4DRO A;  3CZ8 A;  4WJX A;  2MNT A;  5DEZ A;  1M5Y A;  4IQC A;  4IPX A;  1HKM A;  1YAT A;  1WB0 A;  5DIT A;  1CTN A;  2MLY A;  4DRM A;  2ETN A;  4UDM A;  3NRK A;  2WLZ A;  1E6P A;  3PRA A;  2ZR6 A;  3FY1 A;  4TNS A;  1J4I A;  4KQZ A;  1K9T A;  1HKJ A;  1W1V A;  1F40 A;  1E44 A;  1EDQ A;  1EYM A;  1D6O A;  1PBK A;  1QPL A;  3NTP A;  4NZC A;  1ZCN A;  4ODK A;  4ODM A;  3WQW A;  1UR8 A;  2DG4 A;  5I98 A;  2DSZ A;  4Z2G A;  2AWG A;  2PI6 A;  5DF0 A;  2O92 A;  3WH0 A;  4C02 B;  4G2P A;  1D7H A;  2RUR A;  2FAP A;  2PN0 A;  3IHZ A;  2XP3 A;  2ZQT A;  3W4R A;  3B9A A;  1GOI A;  4MPK A;  4GIV A;  3O5K A;  4LAV A;  4WKH A;  1TFV A;  1ZBK A;  1YW5 A;  2A3A A;  3BMB A;  4TW8 A;  4Z2H A;  2XP6 A;  3MDY B;  4LGX A;  5HWC A;  4Z2I A;  2B31 A;  2L2S A;  3TCZ A;  4R0X A;  3O5P A;  1B6C A;  1HKK A;  3UQB A;  3CH9 A;  4ODP A;  4DRJ A;  5J6E A;  1W9P A;  3ODK A;  3IK8 A;  2MLZ A;  1KFW A;  3ARX A;  3O5E A;  4TW7 A;  1NWS A;  1H0I A;  1JNT A;  1XHG A;  3GPK A;  3WD2 A;  1EIB A;  4DRQ A;  3O5F A;  1E6R A;  1NH6 A;  2Y78 A;  1FKR A;  5DIU A;  2G41 A;  3TDB A;  3ARW A;  1W26 A;  2XP5 A;  3RM9 A;  3ALG A;  2F2D A;  2KI3 A;  2A3E A;  4ODN A;  1C9H A;  4JFI A;  1NMV A;  1UR9 A;  1XRV A;  2MPH A;  1Q1C A;  4KR0 B;  4TYO A;  2M2A A;  3WL0 A;  3CHD A;  3PRD A;  3QOK A;  5HW6 A;  4ZS6 A;  2P4V A;  4DIP A;  1N1A A;  4P8X A;  2XPA A;  1ZBW A;  4DH0 A;  2KFW A;  3RFW A;  4DWS C;  3RME A;  1Y0O A;  3AQU A;  4IQ2 A;  1FKJ A;  4ODQ A;  3BXW A;  2LJ4 A;  3CHC A;  3LUO A;  4LAW A;  5HW7 A;  3WD1 A;  3KAC A;  1LL6 A;  2IF4 A;  1HKI A;  2A3C A;  1KT0 A;  1EQ3 A;  3UQA A;  4ODO A;  1SYT A;  2VCD A;  2QF8 A;  4ML4 A;  4L3N A;  4WK9 A;  3JYJ A;  4MTV A;  1JVW A;  4ZPW R;  2N87 A;  1E6Z A;  2PPN A;  1H0G A;  4IT4 A;  1JNE A;  2XP4 A;  3ARZ A;  1NMW A;  3CHE A;  2F4E A;  3KAF A;  4HBE A;  2WM0 A;  4W9O A;  2ZQS A;  4DRI A;  3G6M A;  3O5J A;  1Q6I A;  2XP8 A;  4NNR A;  2D9F A;  3AS3 A;  3O5I A;  1LL7 A;  3RM8 A;  2ZQV A;  1ITX A;  1GUV A;  1LJY A;  1ZK6 A;  3IKD A;  2M08 A;  4TW6 A;  4MGV A;  2YBU A;  3CGN A;  4URI A;  1GPF A;  2DSU A;  1FKS A;  1JNS A;  1ZB5 A;  1W9U A;  2FDM A;  1EHN A;  2OLH A;  2DG9 A;  3WD0 A;  5HBF A;  1NSG A;  3UI6 A;  1VF8 A;  2OFN A;  2DPE A;  1FKF A;  2LKN A;  5DO2 A;  2KR7 A;  2KGJ A;  2PPP A;  5GQB A;  1E9L A;  1FKH A;  3OOB A;  2DG3 A;  4QIB A;  1LQ0 A;  1HXV A;  1NWT A;  2ZR5 A;  2KO7 A;  4P8U A;  2XP7 A;  3O5D A;  5HKG A;  1LG1 A;  4MNK A;  4ODR A;  1ROT A;  1NWU A;  3ARR A;  2O9O A;  4R5E A;  5DIV A;  3WKZ A; 
#chains in the Genus database with same CATH homology
 4ZPV R;  1ROU A;  2DT2 A;  3WD4 A;  3ARU A;  1ZBV A;  2LPV A;  1LG2 A;  3O5M A;  3O5L A;  2VN1 A;  2RUQ A;  3UQI A;  1F8A B;  4BF8 A;  2DSW A;  4U86 A;  2DT3 A;  4HBO A;  1TCO C;  4JFM A;  1D2K A;  4U84 A;  1SR0 A;  3KAD A;  3ARY A;  4JYS A;  1X6N A;  4J4N A;  5HT1 A;  4L72 B;  1T11 A;  1D7J A;  3ARP A;  1IX5 A;  4J4O A;  1ZU8 A;  3UI5 A;  2RUC A;  1HJV A;  3ARO A;  3B9D A;  4MAV A;  1WNO A;  3WL1 A;  1E15 A;  2KE0 A;  1ZBC A;  1HJW A;  4WIW A;  4LAX A;  2WLY A;  3RGC A;  4Z2K A;  4DWS B;  3CGM A;  4DT4 A;  3PRB A;  4JFJ A;  2ESC A;  3EY6 A;  5GPG A;  4MSP A;  1L1P A;  4DRN A;  4AY1 A;  1X6L A;  2M1I A;  3ALF A;  3B9E A;  3I6C A;  3OA5 A;  4QT2 A;  2ZQU A;  4WKA A;  3NI6 A;  4DRK A;  1OGB A;  2UZ5 A;  4U85 A;  1FD9 A;  2YBT A;  4DZ3 A;  1E6N A;  4ITZ A;  4NSB A;  5JH8 A;  3UI4 A;  1LL4 A;  1U79 A;  3AS1 A;  1OWQ A;  4GGQ A;  2RQS A;  3RM4 A;  1BL4 A;  4S3J A;  1OGG A;  4XAK A;  3G6L A;  5HW8 A;  4LAY A;  5B8I C;  1RD6 A;  4MNL A;  3WD3 A;  3O5O A;  3KZ7 A;  5BXJ A;  1FKK A;  3ARQ A;  2RUD A;  5HWB A;  3WQV A;  4HAR A;  4W5U A;  2DT0 A;  3CHF A;  3KAH A;  2K8I A;  4MNM A;  1W9V A;  1D7I A;  4JFK A;  2IUZ A;  1PIN A;  1O6I A;  1FJD A;  1BKF A;  2ZR4 A;  2Q5A A;  2G8Z A;  4ODL A;  1HJX A;  4N19 A;  3PA7 A;  1FKG A;  4PTM A;  3IKG A;  4MNJ A;  3KAG A;  2DT1 A;  1J6Y A;  5GPR A;  1QPF A;  4G50 A;  1WAW A;  2PBC A;  2LGO A;  1J4R A;  2XPB A;  4Q22 A;  1Q6H A;  3H9R B;  5HUA A;  2PPO A;  1QZ2 A;  2WK2 A;  1W1P A;  4FN2 A;  4S3K A;  1FKI A;  1FKL A;  4Q7N A;  2PV1 A;  3KAI A;  4Z2L A;  4JFL A;  3O5Q A;  2AOS A;  4DWS A;  4DRH A;  3ARV A;  3FAP A;  4WKF A;  5D75 A;  1R9H A;  3B8S A;  2DSV A;  1W1Y A;  3WIJ A;  4QZV B;  3TC5 A;  1FFQ A;  2MF9 A;  1A7X A;  4W9Q A;  2XP9 A;  2FKE A;  1NWR A;  1JND A;  1FFR A;  4DZ2 A;  4Z2J A;  1ZL1 A;  3AS2 A;  3KAB A;  2MLX A;  1FAP A;  4W9P A;  4P8V A;  1FKB A;  1J4H A;  3JYM A;  2PV3 A;  3O5R A;  2PV2 A;  3VAW A;  1Q6U A;  3KCE A;  3UF8 A;  4DRP A;  3PR9 A;  4TX0 A;  4QT3 A;  1FKT A;  2JZV A;  1P5Q A;  1W1T A;  4P8W A;  3ARS A;  3FXY A;  1KT1 A;  2ITK A;  3AS0 A;  2A3B A;  3O5G A;  5HTG A;  2RSE A;  3B7X A;  4FAP A;  1FKD A;  4DWS D;  4ZPT R;  2F21 A;  3ART A;  3JXV A;  4IT6 A;  4O2T A;  4DRO A;  3CZ8 A;  4WJX A;  2MNT A;  5DEZ A;  1M5Y A;  4IQC A;  4IPX A;  1HKM A;  1YAT A;  1WB0 A;  5DIT A;  1CTN A;  2MLY A;  4DRM A;  3NRK A;  2WLZ A;  1E6P A;  3PRA A;  2ZR6 A;  3FY1 A;  4TNS A;  1J4I A;  4KQZ A;  1K9T A;  1HKJ A;  1W1V A;  1F40 A;  1EDQ A;  1EYM A;  1D6O A;  1PBK A;  1QPL A;  3NTP A;  4NZC A;  1ZCN A;  4ODK A;  4ODM A;  3WQW A;  1UR8 A;  2DG4 A;  5I98 A;  2DSZ A;  4Z2G A;  2AWG A;  2PI6 A;  5DF0 A;  2O92 A;  3WH0 A;  4C02 B;  4G2P A;  1D7H A;  2RUR A;  2FAP A;  3IHZ A;  2XP3 A;  2ZQT A;  3W4R A;  3B9A A;  1GOI A;  4MPK A;  4GIV A;  3O5K A;  4LAV A;  4WKH A;  1TFV A;  1ZBK A;  1YW5 A;  2A3A A;  4TW8 A;  4Z2H A;  2XP6 A;  3MDY B;  4LGX A;  5HWC A;  4Z2I A;  2B31 A;  2L2S A;  3TCZ A;  4R0X A;  3O5P A;  1B6C A;  1HKK A;  3UQB A;  3CH9 A;  4ODP A;  4DRJ A;  5J6E A;  1W9P A;  3ODK A;  3IK8 A;  2MLZ A;  1KFW A;  3ARX A;  3O5E A;  4TW7 A;  1NWS A;  1H0I A;  1JNT A;  1XHG A;  3GPK A;  3WD2 A;  1EIB A;  4DRQ A;  3O5F A;  1E6R A;  1NH6 A;  2Y78 A;  1FKR A;  5DIU A;  2G41 A;  3TDB A;  3ARW A;  1W26 A;  2XP5 A;  3RM9 A;  3ALG A;  2F2D A;  2KI3 A;  2A3E A;  4ODN A;  1C9H A;  4JFI A;  1NMV A;  1UR9 A;  1XRV A;  2MPH A;  1Q1C A;  4KR0 B;  4TYO A;  2M2A A;  3WL0 A;  3CHD A;  3PRD A;  3QOK A;  5HW6 A;  4ZS6 A;  4DIP A;  1N1A A;  4P8X A;  2XPA A;  1ZBW A;  4DH0 A;  2KFW A;  3RFW A;  4DWS C;  3RME A;  1Y0O A;  3AQU A;  4IQ2 A;  1FKJ A;  4ODQ A;  3BXW A;  2LJ4 A;  3CHC A;  3LUO A;  4LAW A;  5HW7 A;  3WD1 A;  3KAC A;  1LL6 A;  2IF4 A;  1HKI A;  2A3C A;  1KT0 A;  1EQ3 A;  3UQA A;  4ODO A;  1SYT A;  2VCD A;  2QF8 A;  4ML4 A;  4L3N A;  4WK9 A;  3JYJ A;  4MTV A;  1JVW A;  4ZPW R;  2N87 A;  1E6Z A;  2PPN A;  1H0G A;  4IT4 A;  1JNE A;  2XP4 A;  3ARZ A;  1NMW A;  3CHE A;  2F4E A;  3KAF A;  4HBE A;  2WM0 A;  4W9O A;  2ZQS A;  4DRI A;  3G6M A;  3O5J A;  1Q6I A;  2XP8 A;  4NNR A;  2D9F A;  3AS3 A;  3O5I A;  1LL7 A;  3RM8 A;  2ZQV A;  1ITX A;  1GUV A;  1LJY A;  1ZK6 A;  3IKD A;  2M08 A;  4TW6 A;  4MGV A;  2YBU A;  3CGN A;  4URI A;  1GPF A;  2DSU A;  1FKS A;  1JNS A;  1ZB5 A;  1W9U A;  2FDM A;  1EHN A;  2OLH A;  2DG9 A;  3WD0 A;  5HBF A;  1NSG A;  3UI6 A;  1VF8 A;  2OFN A;  2DPE A;  1FKF A;  2LKN A;  5DO2 A;  2KR7 A;  2KGJ A;  2PPP A;  5GQB A;  1E9L A;  1FKH A;  3OOB A;  2DG3 A;  4QIB A;  1LQ0 A;  1HXV A;  1NWT A;  2ZR5 A;  2KO7 A;  4P8U A;  2XP7 A;  3O5D A;  5HKG A;  1LG1 A;  4MNK A;  4ODR A;  1ROT A;  1NWU A;  3ARR A;  2O9O A;  4R5E A;  5DIV A;  3WKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...