3IKGA

Structure-based design of novel pin1 inhibitors (i)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ikgA00
1B6CA 2FAPA 2PV1A 4JFKA 4BF8A 1Q6UA 2PV3A 3UQBA 2ZQTA 5DIUA 1HXVA 4DZ2A 1FKKA 2MLXA 3KCEA 5HTGA 1FKDA 2KO7A 2VN1A 3KAHA 3LUOA 3TDBA 2D9FA 2LPVA 5HW8A 4IPXA 1TCOC 3KAFA 3O5KA 1J6YA 2F21A 4DIPA 2KE0A 1FKFA 1PBKA 2RUCA 1ROUA 2KI3A 2PPOA 1FKJA 4GIVA 4DRMA 4TW8A 4W9OA 3UI6A 3PRDA 2F4EA 1PINA 2MNTA 5D75A 3UQIA 1D7IA 4QT2A 2RURA 4DROA 1T11A 1JNSA 4DRNA 2XP7A 1NSGA 4ODKA 1YATA 2ITKA 2VCDA 4DRPA 3KADA 4DZ3A 2XP6A 2ZQSA 4R0XA 2L2SA 2XP9A 4TW7A 2N87A 2LKNA 2M1IA 3O5QA 4NNRA 5HW6A 1QPFA 4TW6A 3UI4A 3O5EA 4JYSA 1Q1CA 4U84A 1FAPA 2KGJA 3O5GA 1A7XA 3NRKA 2ZQVA 4ODOA 1F40A 4QT3A 3UQAA 3FAPA 4W9QA 1R9HA 3UF8A 3VAWA 3GPKA 3O5OA 3TCZA 3PRBA 2RSEA 4LAWA 3RFWA 1FKBA 1YW5A 2ZR5A 5HW7A 4LAVA 4DRIA 1BL4A 3KABA 2ZR4A 1M5YA 3JXVA 1JNTA 5HUAA 4ITZA 5HT1A 4FN2A 1FKHA 3KZ7A 1D6OA 2XP3A 2OFNA 2ZQUA 1FKRA 2PPPA 3NTPA 3KAGA 2UZ5A 1FKTA 5J6EA 1NMWA 3I6CA 2RUQA 4G2PA 1Y0OA 4DRHA 2LGOA 3CGNA 3O5RA 1NMVA 3JYJA 1QZ2A 4TNSA 2M2AA 4IQCA 3EY6A 2RQSA 1ROTA 3OOBA 4LAYA 2XP4A 5DITA 4DRQA 2Y78A 4J4OA 1J4IA 3IKDA 4ODLA 2FKEA 4MSPA 4W9PA 3IHZA 4C02B 1Q6HA 1BKFA 4JFJA 1C9HA 3O5FA 2MF9A 5BXJA 2IF4A 4FAPA 4JFLA 5HWCA 1JVWA 2ZR6A 4U85A 2K8IA 4G50A 2MPHA 5GPGA 1Q6IA 3O5DA 2AWGA 1W26A 2F2DA 3KACA 4LAXA 4DRKA 3JYMA 3NI6A 2DG3A 4ODRA 2DG9A 3B7XA 3MDYB 1EQ3A 3ODKA 1QPLA 4ODPA 4ODMA 5HKGA 1FJDA 3O5MA 4TYOA 1FKSA 1FKGA 3O5PA 4IQ2A 3O5LA 3PA7A 2PBCA 1U79A 2MLZA 3IK8A 1D7HA 1KT1A 5HWBA 1P5QA 2XP5A 4U86A 2PV2A 1N1AA 1ZCNA 2KFWA 5DIVA 2LJ4A 3TC5A 1J4RA 1F8AB 2KR7A 2M08A 2PPNA 2XPAA 4GGQA 3O5IA 4J4NA 2MLYA 3UI5A 4DRJA 1J4HA 3IKGA 4N19A 3KAIA 4TX0A 4DT4A 1FKLA 1FD9A 5I98A 4MGVA 3WH0A 1EYMA 1FKIA 4JFMA 4DH0A 2RUDA 2XPBA 1ZK6A 2Q5AA 2JZVA 4QIBA 3H9RB 3O5JA 2XP8A 3CGMA 4JFIA 4ODQA 2DG4A 1L1PA 3RGCA 1D7JA 4ODNA 1KT0A 5B8IC 4O2TA
chains in the Genus database with same CATH superfamily
4BF8A 1Q6UA 1SR0A 2PV3A 1W9UA 2QF8A 2WLZA 3UQBA 4R5EA 4DZ2A 1FKKA 1FKDA 4Z2LA 3KAHA 3LUOA 5HW8A 5GQBA 2F21A 3ARRA 1HJWA 4W9OA 3UI6A 1KFWA 4MNKA 1OGGA 2RURA 4DRNA 4ODKA 1GPFA 1YATA 4DRPA 4DZ3A 4R0XA 3AROA 1UR9A 1HJXA 2DSVA 4NZCA 4MAVA 2A3CA 3O5EA 4JYSA 2KGJA 4ML4A 4P8VA 3AQUA 3UQAA 4W9QA 1LG1A 2PN0A 3VAWA 3FXYA 3GPKA 4ZPVR 3RFWA 1LL6A 1YW5A 4P8WA 2ZR5A 3CZ8A 2ZR4A 1JNDA 3CHEA 4IT4A 1NWRA 3ARXA 4ITZA 2O92A 1FKHA 1D6OA 2ZQUA 2PPPA 3NTPA 1O6IA 2UZ5A 4PTMA 5J6EA 2RUQA 4DRHA 4P8UA 2LGOA 2M2AA 4ZPTR 4IQCA 2DSZA 3EY6A 4LAYA 2XP4A 3AS1A 2Y78A 4Q7NA 1J4IA 3IHZA 1Q6HA 5BXJA 2MF9A 3QOKA 2IF4A 5HWCA 1JVWA 4G50A 3RMEA 1Q6IA 1WB0A 1UR8A 4MTVA 3MDYB 1NWSA 3B7XA 1QPLA 2YBUA 3ALGA 3O5MA 4TYOA 4DWSB 3CHCA 4IQ2A 1WAWA 2MLZA 3AS3A 4U86A 2KFWA 5DIVA 1NH6A 2PPNA 4GGQA 3O5IA 3WKZA 1XHGA 1J4HA 5I98A 1FKLA 1W9PA 1E44A 1LL7A 2ETNA 1LG2A 3AS0A 1LQ0A 2RUDA 2Q5AA 2AOSA 2XP8A 3CGMA 4ODQA 1VF8A 1B6CA 2PV1A 3WD4A 1E9LA 2MLXA 3KCEA 2FDMA 2KO7A 2VN1A 5DEZA 4W5UA 4DWSA 4IPXA 1TCOC 3O5KA 3ARWA 4MNLA 2RUCA 3WL0A 2PPOA 1FKJA 4TW8A 3PRDA 1GOIA 3RM9A 1D7IA 4AY1A 2XP7A 2A3AA 2ITKA 2VCDA 1D2KA 1E6NA 3KADA 2L2SA 4MNJA 2N87A 3B9EA 5HW6A 2B31A 1HKKA 2M1IA 3O5QA 1QPFA 4NNRA 4TW6A 1NWUA 4S3JA 1FAPA 3O5GA 1F40A 4QT3A 1K9TA 1SYTA 2PI6A 1WNOA 3CHFA 3UF8A 1NWTA 2WM0A 3ARSA 1ZB5A 2P4VA 4LAVA 3JXVA 1RD6A 1JNTA 1IX5A 3ALFA 3KZ7A 3B8SA 3KAGA 1FKTA 3I6CA 2B5UB 3PRAA 3O5RA 4ZS6A 3G6MA 4W9PA 4MSPA 2DT2A 3WD1A 1C9HA 4FAPA 4Z2JA 1W1TA 5HBFA 1HKMA 3W4RA 4Z2HA 2AWGA 4DRKA 2WK2A 4KQZA 1EQ3A 5HKGA 1HKJA 1EIBA 4HBOA 2XP5A 2PV2A 3OA5A 1F8AB 4DRJA 4J4NA 2G8ZA 4TX0A 4DT4A 3WH0A 1FKIA 1ZU8A 3H9RB 1L1PA 5DF0A 1ZL1A 1D7JA 1KT0A 2FAPA 3ARPA 3ARYA 5DIUA 5HTGA 4MPKA 4P8XA 3WQVA 1W1VA 3TDBA 2LPVA 4DWSD 4HARA 1J6YA 3EIPA 2KE0A 1FKFA 1PBKA 2G41A 1ROUA 1GUVA 2KI3A 4DRMA 4NSBA 2F4EA 3PR9A 2MNTA 2F23A 3B9DA 1T11A 3ARZA 4WKFA 2DT0A 3WD0A 3AS2A 2XP6A 2XP9A 1EHNA 4MNMA 3UI4A 1ZBVA 1E15A 4U84A 3NRKA 2ZQVA 4ODOA 1W1PA 3FAPA 1W9VA 3O5OA 3TCZA 1E6PA 3PRBA 2RSEA 1TFVA 5GPRA 1JCHB 1BL4A 5DO2A 1M5YA 3WL1A 5JH8A 4Z2GA 1NMWA 1HJVA 3BMBA 1Y0OA 3CGNA 1NMVA 3JYJA 1ROTA 2DT1A 2FKEA 4C02B 4JFJA 3O5FA 1E6ZA 4KR0B 1ZBCA 2ZR6A 1X6LA 4U85A 5GPGA 3O5DA 2F2DA 3NI6A 4WIWA 1ITXA 4HBEA 2WLYA 2IUZA 3ODKA 1FJDA 3ARVA 1FKSA 3WQWA 1W1YA 2OLHA 3BXWA 2PBCA 3ARUA 1D7HA 1KT1A 1J4RA 4JFIA 3KAIA 1FD9A 4MGVA 1EYMA 4UDMA 4WK9A 4JFMA 2DSUA 4DH0A 2A3BA 4WKHA 1ZK6A 2YBTA 4QIBA 2DG4A 4DWSC 1HKIA 4JFKA 2DPEA 1LL4A 2ZQTA 3WIJA 1HXVA 3ARQA 3ARTA 2A3EA 2D9FA 3KAFA 4DIPA 3GTYX 1GRJA 1XRVA 4GIVA 5D75A 1PINA 3UQIA 4QT2A 4DROA 1JNSA 3G6LA 1EDQA 1NSGA 4LGXA 2ZQSA 3WD2A 4TW7A 2LKNA 1Q1CA 1E6RA 1LJYA 1A7XA 1OGBA 1R9HA 4LAWA 1FKBA 5HW7A 4DRIA 4ZPWR 3KABA 3CH9A 5HUAA 5HT1A 4FN2A 4S3KA 4WKAA 3RM4A 2XP3A 2OFNA 1FKRA 1H0GA 4G2PA 3WD3A 4TNSA 1QZ2A 1FFRA 1FFQA 4Q22A 3OOBA 2RQSA 3B9AA 4XAKA 5DITA 4DRQA 4L3NA 4J4OA 3IKDA 4ODLA 2DT3A 1BKFA 1X6NA 4JFLA 4L72B 1H0IA 4QZVB 2K8IA 2MPHA 1W26A 4LAXA 3KACA 4URIA 4Z2IA 3JYMA 4IT6A 3RM8A 3CHDA 2DG3A 4ODRA 2DG9A 3GU0A 4ODPA 4ODMA 3O5PA 1FKGA 3O5LA 2O9OA 3PA7A 4Z2KA 1JNEA 1U79A 3IK8A 5HWBA 1P5QA 1N1AA 1ZCNA 2ESCA 2LJ4A 3TC5A 1CTNA 2KR7A 2M08A 3UI5A 2XPAA 2MLYA 3IKGA 4N19A 2DSWA 1ZBWA 3FY1A 2XPBA 1ZBKA 4WJXA 2JZVA 1OWQA 2EULA 3O5JA 3RGCA 4ODNA 5B8IC 4O2TA
chains in the Genus database with same CATH topology
4BF8A 1Q6UA 1SR0A 2PV3A 1W9UA 2QF8A 2WLZA 3UQBA 4R5EA 4DZ2A 1FKKA 1FKDA 4Z2LA 3KAHA 3LUOA 5HW8A 5GQBA 2F21A 3ARRA 1HJWA 4W9OA 3UI6A 1KFWA 4MNKA 1OGGA 2RURA 4DRNA 4ODKA 1GPFA 1YATA 4DRPA 4DZ3A 4R0XA 3AROA 1UR9A 1HJXA 2DSVA 4NZCA 4MAVA 2A3CA 3O5EA 4JYSA 2KGJA 4ML4A 4P8VA 3AQUA 3UQAA 4W9QA 1LG1A 3VAWA 3FXYA 3GPKA 4ZPVR 3RFWA 1LL6A 1YW5A 4P8WA 2ZR5A 3CZ8A 2ZR4A 1JNDA 3CHEA 4IT4A 1NWRA 3ARXA 4ITZA 2O92A 1FKHA 1D6OA 2ZQUA 2PPPA 3NTPA 1O6IA 2UZ5A 4PTMA 5J6EA 2RUQA 4DRHA 4P8UA 2LGOA 2M2AA 4ZPTR 4IQCA 2DSZA 3EY6A 4LAYA 2XP4A 3AS1A 2Y78A 4Q7NA 1J4IA 3IHZA 1Q6HA 5BXJA 2MF9A 3QOKA 2IF4A 5HWCA 1JVWA 4G50A 3RMEA 1Q6IA 1WB0A 1UR8A 4MTVA 3MDYB 1NWSA 3B7XA 1QPLA 2YBUA 3ALGA 3O5MA 4TYOA 4DWSB 3CHCA 4IQ2A 1WAWA 2MLZA 3AS3A 4U86A 2KFWA 5DIVA 1NH6A 2PPNA 4GGQA 3O5IA 3WKZA 1XHGA 1J4HA 5I98A 1FKLA 1W9PA 1LL7A 1LG2A 3AS0A 1LQ0A 2RUDA 2Q5AA 2AOSA 2XP8A 3CGMA 4ODQA 1VF8A 1B6CA 2PV1A 3WD4A 1E9LA 2MLXA 3KCEA 2FDMA 2KO7A 2VN1A 5DEZA 4W5UA 4DWSA 4IPXA 1TCOC 3O5KA 3ARWA 4MNLA 2RUCA 3WL0A 2PPOA 1FKJA 4TW8A 3PRDA 1GOIA 3RM9A 1D7IA 4AY1A 2XP7A 2A3AA 2ITKA 2VCDA 1D2KA 1E6NA 3KADA 2L2SA 4MNJA 2N87A 3B9EA 5HW6A 2B31A 1HKKA 2M1IA 3O5QA 1QPFA 4NNRA 4TW6A 1NWUA 4S3JA 1FAPA 3O5GA 1F40A 4QT3A 1K9TA 1SYTA 2PI6A 1WNOA 3CHFA 3UF8A 1NWTA 2WM0A 3ARSA 1ZB5A 4LAVA 3JXVA 1RD6A 1JNTA 1IX5A 3ALFA 3KZ7A 3B8SA 3KAGA 1FKTA 3I6CA 3PRAA 3O5RA 4ZS6A 3G6MA 4W9PA 4MSPA 2DT2A 3WD1A 1C9HA 4FAPA 4Z2JA 1W1TA 5HBFA 1HKMA 3W4RA 4Z2HA 2AWGA 4DRKA 2WK2A 4KQZA 1EQ3A 5HKGA 1HKJA 1EIBA 4HBOA 2XP5A 2PV2A 3OA5A 1F8AB 4DRJA 4J4NA 2G8ZA 4TX0A 4DT4A 3WH0A 1FKIA 1ZU8A 3H9RB 1L1PA 5DF0A 1ZL1A 1D7JA 1KT0A 2FAPA 3ARPA 3ARYA 5DIUA 5HTGA 4MPKA 4P8XA 3WQVA 1W1VA 3TDBA 2LPVA 4DWSD 4HARA 1J6YA 2KE0A 1FKFA 1PBKA 2G41A 1ROUA 1GUVA 2KI3A 4DRMA 4NSBA 2F4EA 3PR9A 2MNTA 3B9DA 1T11A 3ARZA 4WKFA 2DT0A 3WD0A 3AS2A 2XP6A 2XP9A 1EHNA 4MNMA 3UI4A 1ZBVA 1E15A 4U84A 3NRKA 2ZQVA 4ODOA 1W1PA 3FAPA 1W9VA 3O5OA 3TCZA 1E6PA 3PRBA 2RSEA 1TFVA 5GPRA 1BL4A 5DO2A 1M5YA 3WL1A 5JH8A 4Z2GA 1NMWA 1HJVA 1Y0OA 3CGNA 1NMVA 3JYJA 1ROTA 2DT1A 2FKEA 4C02B 4JFJA 3O5FA 1E6ZA 4KR0B 1ZBCA 2ZR6A 1X6LA 4U85A 5GPGA 3O5DA 2F2DA 3NI6A 4WIWA 1ITXA 4HBEA 2WLYA 2IUZA 3ODKA 1FJDA 3ARVA 1FKSA 3WQWA 1W1YA 2OLHA 3BXWA 2PBCA 3ARUA 1D7HA 1KT1A 1J4RA 4JFIA 3KAIA 1FD9A 4MGVA 1EYMA 4WK9A 4JFMA 2DSUA 4DH0A 2A3BA 4WKHA 1ZK6A 2YBTA 4QIBA 2DG4A 4DWSC 1HKIA 4JFKA 2DPEA 1LL4A 2ZQTA 3WIJA 1HXVA 3ARQA 3ARTA 2A3EA 2D9FA 3KAFA 4DIPA 1XRVA 4GIVA 5D75A 1PINA 3UQIA 4QT2A 4DROA 1JNSA 3G6LA 1EDQA 1NSGA 4LGXA 2ZQSA 3WD2A 4TW7A 2LKNA 1Q1CA 1E6RA 1LJYA 1A7XA 1OGBA 1R9HA 4LAWA 1FKBA 5HW7A 4DRIA 4ZPWR 3KABA 3CH9A 5HUAA 5HT1A 4FN2A 4S3KA 4WKAA 3RM4A 2XP3A 2OFNA 1FKRA 1H0GA 4G2PA 3WD3A 4TNSA 1QZ2A 1FFRA 1FFQA 4Q22A 3OOBA 2RQSA 3B9AA 4XAKA 5DITA 4DRQA 4L3NA 4J4OA 3IKDA 4ODLA 2DT3A 1BKFA 1X6NA 4JFLA 4L72B 1H0IA 4QZVB 2K8IA 2MPHA 1W26A 4LAXA 3KACA 4URIA 4Z2IA 3JYMA 4IT6A 3RM8A 3CHDA 2DG3A 4ODRA 2DG9A 4ODPA 4ODMA 3O5PA 1FKGA 3O5LA 2O9OA 3PA7A 4Z2KA 1JNEA 1U79A 3IK8A 5HWBA 1P5QA 1N1AA 1ZCNA 2ESCA 2LJ4A 3TC5A 1CTNA 2KR7A 2M08A 3UI5A 2XPAA 2MLYA 3IKGA 4N19A 2DSWA 1ZBWA 3FY1A 2XPBA 1ZBKA 4WJXA 2JZVA 1OWQA 3O5JA 3RGCA 4ODNA 5B8IC 4O2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6C A;  2FAP A;  2PV1 A;  4JFK A;  4BF8 A;  1Q6U A;  2PV3 A;  3UQB A;  2ZQT A;  5DIU A;  1HXV A;  4DZ2 A;  1FKK A;  2MLX A;  3KCE A;  5HTG A;  1FKD A;  2KO7 A;  2VN1 A;  3KAH A;  3LUO A;  3TDB A;  2D9F A;  2LPV A;  5HW8 A;  4IPX A;  1TCO C;  3KAF A;  3O5K A;  1J6Y A;  2F21 A;  4DIP A;  2KE0 A;  1FKF A;  1PBK A;  2RUC A;  1ROU A;  2KI3 A;  2PPO A;  1FKJ A;  4GIV A;  4DRM A;  4TW8 A;  4W9O A;  3UI6 A;  3PRD A;  2F4E A;  1PIN A;  2MNT A;  5D75 A;  3UQI A;  1D7I A;  4QT2 A;  2RUR A;  4DRO A;  1T11 A;  1JNS A;  4DRN A;  2XP7 A;  1NSG A;  4ODK A;  1YAT A;  2ITK A;  2VCD A;  4DRP A;  3KAD A;  4DZ3 A;  2XP6 A;  2ZQS A;  4R0X A;  2L2S A;  2XP9 A;  4TW7 A;  2N87 A;  2LKN A;  2M1I A;  3O5Q A;  4NNR A;  5HW6 A;  1QPF A;  4TW6 A;  3UI4 A;  3O5E A;  4JYS A;  1Q1C A;  4U84 A;  1FAP A;  2KGJ A;  3O5G A;  1A7X A;  3NRK A;  2ZQV A;  4ODO A;  1F40 A;  4QT3 A;  3UQA A;  3FAP A;  4W9Q A;  1R9H A;  3UF8 A;  3VAW A;  3GPK A;  3O5O A;  3TCZ A;  3PRB A;  2RSE A;  4LAW A;  3RFW A;  1FKB A;  1YW5 A;  2ZR5 A;  5HW7 A;  4LAV A;  4DRI A;  1BL4 A;  3KAB A;  2ZR4 A;  1M5Y A;  3JXV A;  1JNT A;  5HUA A;  4ITZ A;  5HT1 A;  4FN2 A;  1FKH A;  3KZ7 A;  1D6O A;  2XP3 A;  2OFN A;  2ZQU A;  1FKR A;  2PPP A;  3NTP A;  3KAG A;  2UZ5 A;  1FKT A;  5J6E A;  1NMW A;  3I6C A;  2RUQ A;  4G2P A;  1Y0O A;  4DRH A;  2LGO A;  3CGN A;  3O5R A;  1NMV A;  3JYJ A;  1QZ2 A;  4TNS A;  2M2A A;  4IQC A;  3EY6 A;  2RQS A;  1ROT A;  3OOB A;  4LAY A;  2XP4 A;  5DIT A;  4DRQ A;  2Y78 A;  4J4O A;  1J4I A;  3IKD A;  4ODL A;  2FKE A;  4MSP A;  4W9P A;  3IHZ A;  4C02 B;  1Q6H A;  1BKF A;  4JFJ A;  1C9H A;  3O5F A;  2MF9 A;  5BXJ A;  2IF4 A;  4FAP A;  4JFL A;  5HWC A;  1JVW A;  2ZR6 A;  4U85 A;  2K8I A;  4G50 A;  2MPH A;  5GPG A;  1Q6I A;  3O5D A;  2AWG A;  1W26 A;  2F2D A;  3KAC A;  4LAX A;  4DRK A;  3JYM A;  3NI6 A;  2DG3 A;  4ODR A;  2DG9 A;  3B7X A;  3MDY B;  1EQ3 A;  3ODK A;  1QPL A;  4ODP A;  4ODM A;  5HKG A;  1FJD A;  3O5M A;  4TYO A;  1FKS A;  1FKG A;  3O5P A;  4IQ2 A;  3O5L A;  3PA7 A;  2PBC A;  1U79 A;  2MLZ A;  3IK8 A;  1D7H A;  1KT1 A;  5HWB A;  1P5Q A;  2XP5 A;  4U86 A;  2PV2 A;  1N1A A;  1ZCN A;  2KFW A;  5DIV A;  2LJ4 A;  3TC5 A;  1J4R A;  1F8A B;  2KR7 A;  2M08 A;  2PPN A;  2XPA A;  4GGQ A;  3O5I A;  4J4N A;  2MLY A;  3UI5 A;  4DRJ A;  1J4H A;  3IKG A;  4N19 A;  3KAI A;  4TX0 A;  4DT4 A;  1FKL A;  1FD9 A;  5I98 A;  4MGV A;  3WH0 A;  1EYM A;  1FKI A;  4JFM A;  4DH0 A;  2RUD A;  2XPB A;  1ZK6 A;  2Q5A A;  2JZV A;  4QIB A;  3H9R B;  3O5J A;  2XP8 A;  3CGM A;  4JFI A;  4ODQ A;  2DG4 A;  1L1P A;  3RGC A;  1D7J A;  4ODN A;  1KT0 A;  5B8I C;  4O2T A; 
#chains in the Genus database with same CATH topology
 4BF8 A;  1Q6U A;  1SR0 A;  2PV3 A;  1W9U A;  2QF8 A;  2WLZ A;  3UQB A;  4R5E A;  4DZ2 A;  1FKK A;  1FKD A;  4Z2L A;  3KAH A;  3LUO A;  5HW8 A;  5GQB A;  2F21 A;  3ARR A;  1HJW A;  4W9O A;  3UI6 A;  1KFW A;  4MNK A;  1OGG A;  2RUR A;  4DRN A;  4ODK A;  1GPF A;  1YAT A;  4DRP A;  4DZ3 A;  4R0X A;  3ARO A;  1UR9 A;  1HJX A;  2DSV A;  4NZC A;  4MAV A;  2A3C A;  3O5E A;  4JYS A;  2KGJ A;  4ML4 A;  4P8V A;  3AQU A;  3UQA A;  4W9Q A;  1LG1 A;  2PN0 A;  3VAW A;  3FXY A;  3GPK A;  4ZPV R;  3RFW A;  1LL6 A;  1YW5 A;  4P8W A;  2ZR5 A;  3CZ8 A;  2ZR4 A;  1JND A;  3CHE A;  4IT4 A;  1NWR A;  3ARX A;  4ITZ A;  2O92 A;  1FKH A;  1D6O A;  2ZQU A;  2PPP A;  3NTP A;  1O6I A;  2UZ5 A;  4PTM A;  5J6E A;  2RUQ A;  4DRH A;  4P8U A;  2LGO A;  2M2A A;  4ZPT R;  4IQC A;  2DSZ A;  3EY6 A;  4LAY A;  2XP4 A;  3AS1 A;  2Y78 A;  4Q7N A;  1J4I A;  3IHZ A;  1Q6H A;  5BXJ A;  2MF9 A;  3QOK A;  2IF4 A;  5HWC A;  1JVW A;  4G50 A;  3RME A;  1Q6I A;  1WB0 A;  1UR8 A;  4MTV A;  3MDY B;  1NWS A;  3B7X A;  1QPL A;  2YBU A;  3ALG A;  3O5M A;  4TYO A;  4DWS B;  3CHC A;  4IQ2 A;  1WAW A;  2MLZ A;  3AS3 A;  4U86 A;  2KFW A;  5DIV A;  1NH6 A;  2PPN A;  4GGQ A;  3O5I A;  3WKZ A;  1XHG A;  1J4H A;  5I98 A;  1FKL A;  1W9P A;  1E44 A;  1LL7 A;  2ETN A;  1LG2 A;  3AS0 A;  1LQ0 A;  2RUD A;  2Q5A A;  2AOS A;  2XP8 A;  3CGM A;  4ODQ A;  1VF8 A;  1B6C A;  2PV1 A;  3WD4 A;  1E9L A;  2MLX A;  3KCE A;  2FDM A;  2KO7 A;  2VN1 A;  5DEZ A;  4W5U A;  4DWS A;  4IPX A;  1TCO C;  3O5K A;  3ARW A;  4MNL A;  2RUC A;  3WL0 A;  2PPO A;  1FKJ A;  4TW8 A;  3PRD A;  1GOI A;  3RM9 A;  1D7I A;  4AY1 A;  2XP7 A;  2A3A A;  2ITK A;  2VCD A;  1D2K A;  1E6N A;  3KAD A;  2L2S A;  4MNJ A;  2N87 A;  3B9E A;  5HW6 A;  2B31 A;  1HKK A;  2M1I A;  3O5Q A;  1QPF A;  4NNR A;  4TW6 A;  1NWU A;  4S3J A;  1FAP A;  3O5G A;  1F40 A;  4QT3 A;  1K9T A;  1SYT A;  2PI6 A;  1WNO A;  3CHF A;  3UF8 A;  1NWT A;  2WM0 A;  3ARS A;  1ZB5 A;  2P4V A;  4LAV A;  3JXV A;  1RD6 A;  1JNT A;  1IX5 A;  3ALF A;  3KZ7 A;  3B8S A;  3KAG A;  1FKT A;  3I6C A;  2B5U B;  3PRA A;  3O5R A;  4ZS6 A;  3G6M A;  4W9P A;  4MSP A;  2DT2 A;  3WD1 A;  1C9H A;  4FAP A;  4Z2J A;  1W1T A;  5HBF A;  1HKM A;  3W4R A;  4Z2H A;  2AWG A;  4DRK A;  2WK2 A;  4KQZ A;  1EQ3 A;  5HKG A;  1HKJ A;  1EIB A;  4HBO A;  2XP5 A;  2PV2 A;  3OA5 A;  1F8A B;  4DRJ A;  4J4N A;  2G8Z A;  4TX0 A;  4DT4 A;  3WH0 A;  1FKI A;  1ZU8 A;  3H9R B;  1L1P A;  5DF0 A;  1ZL1 A;  1D7J A;  1KT0 A;  2FAP A;  3ARP A;  3ARY A;  5DIU A;  5HTG A;  4MPK A;  4P8X A;  3WQV A;  1W1V A;  3TDB A;  2LPV A;  4DWS D;  4HAR A;  1J6Y A;  3EIP A;  2KE0 A;  1FKF A;  1PBK A;  2G41 A;  1ROU A;  1GUV A;  2KI3 A;  4DRM A;  4NSB A;  2F4E A;  3PR9 A;  2MNT A;  2F23 A;  3B9D A;  1T11 A;  3ARZ A;  4WKF A;  2DT0 A;  3WD0 A;  3AS2 A;  2XP6 A;  2XP9 A;  1EHN A;  4MNM A;  3UI4 A;  1ZBV A;  1E15 A;  4U84 A;  3NRK A;  2ZQV A;  4ODO A;  1W1P A;  3FAP A;  1W9V A;  3O5O A;  3TCZ A;  1E6P A;  3PRB A;  2RSE A;  1TFV A;  5GPR A;  1JCH B;  1BL4 A;  5DO2 A;  1M5Y A;  3WL1 A;  5JH8 A;  4Z2G A;  1NMW A;  1HJV A;  3BMB A;  1Y0O A;  3CGN A;  1NMV A;  3JYJ A;  1ROT A;  2DT1 A;  2FKE A;  4C02 B;  4JFJ A;  3O5F A;  1E6Z A;  4KR0 B;  1ZBC A;  2ZR6 A;  1X6L A;  4U85 A;  5GPG A;  3O5D A;  2F2D A;  3NI6 A;  4WIW A;  1ITX A;  4HBE A;  2WLY A;  2IUZ A;  3ODK A;  1FJD A;  3ARV A;  1FKS A;  3WQW A;  1W1Y A;  2OLH A;  3BXW A;  2PBC A;  3ARU A;  1D7H A;  1KT1 A;  1J4R A;  4JFI A;  3KAI A;  1FD9 A;  4MGV A;  1EYM A;  4UDM A;  4WK9 A;  4JFM A;  2DSU A;  4DH0 A;  2A3B A;  4WKH A;  1ZK6 A;  2YBT A;  4QIB A;  2DG4 A;  4DWS C;  1HKI A;  4JFK A;  2DPE A;  1LL4 A;  2ZQT A;  3WIJ A;  1HXV A;  3ARQ A;  3ART A;  2A3E A;  2D9F A;  3KAF A;  4DIP A;  3GTY X;  1GRJ A;  1XRV A;  4GIV A;  5D75 A;  1PIN A;  3UQI A;  4QT2 A;  4DRO A;  1JNS A;  3G6L A;  1EDQ A;  1NSG A;  4LGX A;  2ZQS A;  3WD2 A;  4TW7 A;  2LKN A;  1Q1C A;  1E6R A;  1LJY A;  1A7X A;  1OGB A;  1R9H A;  4LAW A;  1FKB A;  5HW7 A;  4DRI A;  4ZPW R;  3KAB A;  3CH9 A;  5HUA A;  5HT1 A;  4FN2 A;  4S3K A;  4WKA A;  3RM4 A;  2XP3 A;  2OFN A;  1FKR A;  1H0G A;  4G2P A;  3WD3 A;  4TNS A;  1QZ2 A;  1FFR A;  1FFQ A;  4Q22 A;  3OOB A;  2RQS A;  3B9A A;  4XAK A;  5DIT A;  4DRQ A;  4L3N A;  4J4O A;  3IKD A;  4ODL A;  2DT3 A;  1BKF A;  1X6N A;  4JFL A;  4L72 B;  1H0I A;  4QZV B;  2K8I A;  2MPH A;  1W26 A;  4LAX A;  3KAC A;  4URI A;  4Z2I A;  3JYM A;  4IT6 A;  3RM8 A;  3CHD A;  2DG3 A;  4ODR A;  2DG9 A;  3GU0 A;  4ODP A;  4ODM A;  3O5P A;  1FKG A;  3O5L A;  2O9O A;  3PA7 A;  4Z2K A;  1JNE A;  1U79 A;  3IK8 A;  5HWB A;  1P5Q A;  1N1A A;  1ZCN A;  2ESC A;  2LJ4 A;  3TC5 A;  1CTN A;  2KR7 A;  2M08 A;  3UI5 A;  2XPA A;  2MLY A;  3IKG A;  4N19 A;  2DSW A;  1ZBW A;  3FY1 A;  2XPB A;  1ZBK A;  4WJX A;  2JZV A;  1OWQ A;  2EUL A;  3O5J A;  3RGC A;  4ODN A;  5B8I C;  4O2T A; 
#chains in the Genus database with same CATH homology
 4BF8 A;  1Q6U A;  1SR0 A;  2PV3 A;  1W9U A;  2QF8 A;  2WLZ A;  3UQB A;  4R5E A;  4DZ2 A;  1FKK A;  1FKD A;  4Z2L A;  3KAH A;  3LUO A;  5HW8 A;  5GQB A;  2F21 A;  3ARR A;  1HJW A;  4W9O A;  3UI6 A;  1KFW A;  4MNK A;  1OGG A;  2RUR A;  4DRN A;  4ODK A;  1GPF A;  1YAT A;  4DRP A;  4DZ3 A;  4R0X A;  3ARO A;  1UR9 A;  1HJX A;  2DSV A;  4NZC A;  4MAV A;  2A3C A;  3O5E A;  4JYS A;  2KGJ A;  4ML4 A;  4P8V A;  3AQU A;  3UQA A;  4W9Q A;  1LG1 A;  3VAW A;  3FXY A;  3GPK A;  4ZPV R;  3RFW A;  1LL6 A;  1YW5 A;  4P8W A;  2ZR5 A;  3CZ8 A;  2ZR4 A;  1JND A;  3CHE A;  4IT4 A;  1NWR A;  3ARX A;  4ITZ A;  2O92 A;  1FKH A;  1D6O A;  2ZQU A;  2PPP A;  3NTP A;  1O6I A;  2UZ5 A;  4PTM A;  5J6E A;  2RUQ A;  4DRH A;  4P8U A;  2LGO A;  2M2A A;  4ZPT R;  4IQC A;  2DSZ A;  3EY6 A;  4LAY A;  2XP4 A;  3AS1 A;  2Y78 A;  4Q7N A;  1J4I A;  3IHZ A;  1Q6H A;  5BXJ A;  2MF9 A;  3QOK A;  2IF4 A;  5HWC A;  1JVW A;  4G50 A;  3RME A;  1Q6I A;  1WB0 A;  1UR8 A;  4MTV A;  3MDY B;  1NWS A;  3B7X A;  1QPL A;  2YBU A;  3ALG A;  3O5M A;  4TYO A;  4DWS B;  3CHC A;  4IQ2 A;  1WAW A;  2MLZ A;  3AS3 A;  4U86 A;  2KFW A;  5DIV A;  1NH6 A;  2PPN A;  4GGQ A;  3O5I A;  3WKZ A;  1XHG A;  1J4H A;  5I98 A;  1FKL A;  1W9P A;  1LL7 A;  1LG2 A;  3AS0 A;  1LQ0 A;  2RUD A;  2Q5A A;  2AOS A;  2XP8 A;  3CGM A;  4ODQ A;  1VF8 A;  1B6C A;  2PV1 A;  3WD4 A;  1E9L A;  2MLX A;  3KCE A;  2FDM A;  2KO7 A;  2VN1 A;  5DEZ A;  4W5U A;  4DWS A;  4IPX A;  1TCO C;  3O5K A;  3ARW A;  4MNL A;  2RUC A;  3WL0 A;  2PPO A;  1FKJ A;  4TW8 A;  3PRD A;  1GOI A;  3RM9 A;  1D7I A;  4AY1 A;  2XP7 A;  2A3A A;  2ITK A;  2VCD A;  1D2K A;  1E6N A;  3KAD A;  2L2S A;  4MNJ A;  2N87 A;  3B9E A;  5HW6 A;  2B31 A;  1HKK A;  2M1I A;  3O5Q A;  1QPF A;  4NNR A;  4TW6 A;  1NWU A;  4S3J A;  1FAP A;  3O5G A;  1F40 A;  4QT3 A;  1K9T A;  1SYT A;  2PI6 A;  1WNO A;  3CHF A;  3UF8 A;  1NWT A;  2WM0 A;  3ARS A;  1ZB5 A;  4LAV A;  3JXV A;  1RD6 A;  1JNT A;  1IX5 A;  3ALF A;  3KZ7 A;  3B8S A;  3KAG A;  1FKT A;  3I6C A;  3PRA A;  3O5R A;  4ZS6 A;  3G6M A;  4W9P A;  4MSP A;  2DT2 A;  3WD1 A;  1C9H A;  4FAP A;  4Z2J A;  1W1T A;  5HBF A;  1HKM A;  3W4R A;  4Z2H A;  2AWG A;  4DRK A;  2WK2 A;  4KQZ A;  1EQ3 A;  5HKG A;  1HKJ A;  1EIB A;  4HBO A;  2XP5 A;  2PV2 A;  3OA5 A;  1F8A B;  4DRJ A;  4J4N A;  2G8Z A;  4TX0 A;  4DT4 A;  3WH0 A;  1FKI A;  1ZU8 A;  3H9R B;  1L1P A;  5DF0 A;  1ZL1 A;  1D7J A;  1KT0 A;  2FAP A;  3ARP A;  3ARY A;  5DIU A;  5HTG A;  4MPK A;  4P8X A;  3WQV A;  1W1V A;  3TDB A;  2LPV A;  4DWS D;  4HAR A;  1J6Y A;  2KE0 A;  1FKF A;  1PBK A;  2G41 A;  1ROU A;  1GUV A;  2KI3 A;  4DRM A;  4NSB A;  2F4E A;  3PR9 A;  2MNT A;  3B9D A;  1T11 A;  3ARZ A;  4WKF A;  2DT0 A;  3WD0 A;  3AS2 A;  2XP6 A;  2XP9 A;  1EHN A;  4MNM A;  3UI4 A;  1ZBV A;  1E15 A;  4U84 A;  3NRK A;  2ZQV A;  4ODO A;  1W1P A;  3FAP A;  1W9V A;  3O5O A;  3TCZ A;  1E6P A;  3PRB A;  2RSE A;  1TFV A;  5GPR A;  1BL4 A;  5DO2 A;  1M5Y A;  3WL1 A;  5JH8 A;  4Z2G A;  1NMW A;  1HJV A;  1Y0O A;  3CGN A;  1NMV A;  3JYJ A;  1ROT A;  2DT1 A;  2FKE A;  4C02 B;  4JFJ A;  3O5F A;  1E6Z A;  4KR0 B;  1ZBC A;  2ZR6 A;  1X6L A;  4U85 A;  5GPG A;  3O5D A;  2F2D A;  3NI6 A;  4WIW A;  1ITX A;  4HBE A;  2WLY A;  2IUZ A;  3ODK A;  1FJD A;  3ARV A;  1FKS A;  3WQW A;  1W1Y A;  2OLH A;  3BXW A;  2PBC A;  3ARU A;  1D7H A;  1KT1 A;  1J4R A;  4JFI A;  3KAI A;  1FD9 A;  4MGV A;  1EYM A;  4WK9 A;  4JFM A;  2DSU A;  4DH0 A;  2A3B A;  4WKH A;  1ZK6 A;  2YBT A;  4QIB A;  2DG4 A;  4DWS C;  1HKI A;  4JFK A;  2DPE A;  1LL4 A;  2ZQT A;  3WIJ A;  1HXV A;  3ARQ A;  3ART A;  2A3E A;  2D9F A;  3KAF A;  4DIP A;  1XRV A;  4GIV A;  5D75 A;  1PIN A;  3UQI A;  4QT2 A;  4DRO A;  1JNS A;  3G6L A;  1EDQ A;  1NSG A;  4LGX A;  2ZQS A;  3WD2 A;  4TW7 A;  2LKN A;  1Q1C A;  1E6R A;  1LJY A;  1A7X A;  1OGB A;  1R9H A;  4LAW A;  1FKB A;  5HW7 A;  4DRI A;  4ZPW R;  3KAB A;  3CH9 A;  5HUA A;  5HT1 A;  4FN2 A;  4S3K A;  4WKA A;  3RM4 A;  2XP3 A;  2OFN A;  1FKR A;  1H0G A;  4G2P A;  3WD3 A;  4TNS A;  1QZ2 A;  1FFR A;  1FFQ A;  4Q22 A;  3OOB A;  2RQS A;  3B9A A;  4XAK A;  5DIT A;  4DRQ A;  4L3N A;  4J4O A;  3IKD A;  4ODL A;  2DT3 A;  1BKF A;  1X6N A;  4JFL A;  4L72 B;  1H0I A;  4QZV B;  2K8I A;  2MPH A;  1W26 A;  4LAX A;  3KAC A;  4URI A;  4Z2I A;  3JYM A;  4IT6 A;  3RM8 A;  3CHD A;  2DG3 A;  4ODR A;  2DG9 A;  4ODP A;  4ODM A;  3O5P A;  1FKG A;  3O5L A;  2O9O A;  3PA7 A;  4Z2K A;  1JNE A;  1U79 A;  3IK8 A;  5HWB A;  1P5Q A;  1N1A A;  1ZCN A;  2ESC A;  2LJ4 A;  3TC5 A;  1CTN A;  2KR7 A;  2M08 A;  3UI5 A;  2XPA A;  2MLY A;  3IKG A;  4N19 A;  2DSW A;  1ZBW A;  3FY1 A;  2XPB A;  1ZBK A;  4WJX A;  2JZV A;  1OWQ A;  3O5J A;  3RGC A;  4ODN A;  5B8I C;  4O2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...