3IKGA

Structure-based design of novel pin1 inhibitors (i)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ikgA00
2XP8A 4DIPA 3KABA 3GPKA 3O5QA 2RUDA 1C9HA 4LAXA 2F21A 2RQSA 2XP7A 1L1PA 2D9FA 2PPNA 3JYMA 4IQ2A 5HW8A 1JNTA 1YW5A 2PPPA 3IK8A 4ODNA 4U84A 1Q1CA 5BXJA 3OOBA 1EQ3A 1B6CA 3UQIA 4J4NA 1T11A 4MGVA 3PRBA 2XP3A 4DRIA 4W9PA 2PV3A 1TCOC 3KADA 1P5QA 2KR7A 2LKNA 3IHZA 1JNSA 3IKDA 3UI6A 2DG4A 2XPBA 1FKJA 5D75A 2ZQSA 1R9HA 2Q5AA 2UZ5A 2ZQUA 4DT4A 1D6OA 1NMWA 1FD9A 2M1IA 1NMVA 2XP6A 3KAHA 2FAPA 3ODKA 1QZ2A 5HTGA 1FKRA 3O5IA 1QPLA 4TYOA 1Q6IA 1FAPA 1NSGA 4JFMA 2VN1A 3NI6A 2KI3A 2ITKA 4W9QA 4O2TA 2MPHA 1ROTA 4DRPA 3NTPA 1D7JA 4JFIA 2KGJA 1N1AA 2FKEA 4ODPA 4ODLA 4DROA 3O5JA 4LAVA 3O5PA 1KT1A 2PPOA 3CGMA 3KZ7A 1A7XA 4ODQA 4IPXA 4N19A 3JXVA 5HWCA 1FKBA 3UQBA 5HW7A 2KO7A 2LPVA 5HW6A 2RURA 1JVWA 4W9OA 4R0XA 5J6EA 2RUCA 3PRDA 3NRKA 3UF8A 2K8IA 4GGQA 4GIVA 3CGNA 4MSPA 4U85A 3KAIA 2KFWA 1FKGA 2ZR5A 3RGCA 3IKGA 4DRQA 4ODOA 3O5RA 1U79A 3MDYB 2M2AA 3UQAA 4ODKA 2IF4A 2XP4A 3O5MA 5HKGA 3LUOA 4DZ3A 3KACA 3PA7A 5DIUA 5HWBA 3KAFA 4G50A 1PINA 4ODMA 1FKTA 1Y0OA 2PBCA 2KE0A 3O5DA 3TDBA 1M5YA 1FKFA 2MF9A 2DG3A 1Q6UA 5B8IC 4C02B 2RUQA 3I6CA 1ZCNA 1FKIA 4JFJA 2ZQVA 1FKKA 1W26A 1D7IA 2XPAA 2XP5A 1J6YA 3KCEA 4DRNA 2XP9A 5DITA 2L2SA 4NNRA 4FAPA 4DZ2A 3KAGA 2OFNA 4TW7A 2Y78A 1FKLA 1QPFA 4DH0A 1F40A 1KT0A 5GPGA 2N87A 5HT1A 3TC5A 3O5KA 3O5LA 3O5FA 4TW6A 3O5EA 3VAWA 3O5GA 3WH0A 1YATA 4LAWA 2RSEA 3RFWA 5I98A 2LJ4A 2DG9A 4BF8A 4QIBA 1ZK6A 3TCZA 4DRKA 4QT2A 4TX0A 1F8AB 1FKSA 2MNTA 2LGOA 1J4HA 4JYSA 5DIVA 1FJDA 1ROUA 1J4RA 3FAPA 3JYJA 1FKDA 4J4OA 4DRMA 2AWGA 2JZVA 2MLXA 2F2DA 4DRJA 4DRHA 4LAYA 3O5OA 4TW8A 1BL4A 4U86A 2M08A 3EY6A 1J4IA 4FN2A 2ZR6A 2MLZA 1D7HA 4TNSA 1HXVA 1PBKA 4ODRA 2MLYA 1FKHA 1Q6HA 2ZQTA 2ZR4A 3B7XA 3H9RB 4QT3A 3UI5A 2F4EA 4JFKA 2PV2A 4G2PA 3UI4A 4ITZA 4JFLA 5HUAA 2PV1A 4IQCA 1BKFA 1EYMA 2VCDA
chains in the Genus database with same CATH superfamily
2PPNA 1JNTA 2PPPA 1Q1CA 3WD4A 4HBOA 2DPEA 3AQUA 4S3KA 3KADA 3ARWA 2OLHA 5DO2A 1NMWA 1NWSA 1FD9A 2XP6A 4ZPWR 1LL7A 4KQZA 4R5EA 2A3CA 4MNJA 3GTYX 1ROTA 4WKAA 4ODLA 1OWQA 3O5JA 2DT2A 3KZ7A 1RD6A 1A7XA 4ODQA 3CHDA 4IT4A 1FKBA 2DSWA 3ALGA 4Z2GA 1E15A 2KO7A 2LPVA 3ALFA 5HW6A 2RUCA 3UF8A 4GGQA 4GIVA 3KAIA 1FKGA 4WK9A 3RGCA 3UQAA 3O5RA 1U79A 3MDYB 3O5MA 4DZ3A 2WK2A 1CTNA 2MF9A 1Q6UA 4P8XA 3ARXA 2PN0A 4DWSB 3ARTA 1W9VA 2PI6A 2ZQVA 1FKKA 4WIWA 4Z2LA 2O9OA 3KCEA 2XP9A 5DITA 4FAPA 4S3JA 3AROA 1EIBA 1ZBWA 4DH0A 1FKLA 5GPGA 3O5KA 1H0GA 4TW6A 3O5EA 3O5GA 3WH0A 1YATA 3RFWA 2LJ4A 4MNMA 4MPKA 4TX0A 1FKSA 1HKJA 2LGOA 2F23A 2DT0A 4DWSC 1O6IA 2F2DA 3B9AA 1J4IA 3WL1A 1W1VA 1E6RA 4TNSA 1PBKA 3B7XA 2DSZA 2G41A 1LL6A 2PV2A 1HKIA 1XRVA 4IQCA 4WKHA 2RQSA 2XP7A 4IT6A 4NSBA 4PTMA 2DSVA 4U84A 5BXJA 3IK8A 1EQ3A 1SYTA 2ESCA 1NWUA 3UQIA 3PRBA 4DRIA 1LL4A 1ZL1A 4DWSD 2LKNA 3IKDA 2XPBA 1FKJA 5D75A 2EULA 2M1IA 5HTGA 3ARRA 1W9PA 1SR0A 3WD0A 1FAPA 3ARZA 4JFMA 1UR8A 1E6PA 2B31A 2KI3A 2ITKA 4W9QA 3G6MA 2MPHA 4DROA 4Z2IA 4ODPA 3O5PA 2PPOA 3CGMA 4ZS6A 4IPXA 3CHFA 4URIA 3RM9A 3JXVA 3AS2A 1GOIA 3UQBA 3ARVA 4W9OA 4ML4A 1W1TA 3NRKA 2K8IA 4MTVA 4U85A 2KFWA 4MAVA 3IKGA 1LG2A 4ODOA 2M2AA 3WD3A 5HWBA 2WLYA 3KACA 4G50A 1PINA 2G8ZA 4ODMA 4P8VA 4QZVB 1KFWA 4AY1A 1K9TA 1M5YA 1W9UA 1X6LA 2A3EA 2DT3A 3WQVA 4DWSA 4XAKA 2P4VA 2RUQA 3AS1A 3AS0A 4JFJA 2YBUA 1W26A 1J6YA 4NNRA 2AOSA 3KAGA 2Y78A 1F40A 4Z2HA 1ZU8A 4LAWA 4QIBA 4HBEA 1J4HA 1NWTA 4WKFA 4W5UA 3WD1A 4J4OA 4DRHA 3WIJA 3O5OA 4TW8A 1BL4A 2M08A 3EY6A 4FN2A 2A3BA 3OA5A 2F4EA 5HUAA 3PR9A 1HJWA 2PV1A 1BKFA 4Q7NA 4DIPA 3GPKA 3O5QA 1UR9A 2F21A 3JYMA 5HW8A 1YW5A 1ZBVA 2IUZA 4ZPTR 2A3AA 3B8SA 1B6CA 4J4NA 1T11A 3BXWA 1H0IA 4MGVA 4W9PA 3G6LA 1TCOC 2KR7A 1EDQA 3IHZA 1JNSA 3UI6A 1R9HA 2UZ5A 2ZQUA 1ZB5A 1NMVA 3ODKA 3KAHA 1QZ2A 3O5IA 4TYOA 1Q6IA 4ZPVR 1NSGA 2VN1A 2FDMA 3RMEA 4O2TA 4DRPA 3CZ8A 3NTPA 1W1PA 2KGJA 2FKEA 4LAVA 4MNKA 3WD2A 4N19A 3W4RA 5HW7A 1JNDA 2WLZA 4R0XA 5J6EA 2YBTA 3PRDA 4MSPA 3CGNA 1JNEA 4KR0B 2ZR5A 1ITXA 1XHGA 1OGBA 2B5UB 3ARSA 1JCHB 2IF4A 5HKGA 3LUOA 1E6ZA 1FKTA 1Y0OA 2KE0A 3TDBA 1FKFA 3ARQA 4Z2JA 1W1YA 5B8IC 3CHEA 4C02B 3I6CA 1FKIA 5HBFA 1WAWA 1WNOA 1D7IA 2XPAA 2XP5A 3B9DA 1FFRA 5JH8A 3WL0A 4DZ2A 1E44A 4TW7A 1HJVA 1KT0A 3EIPA 5HT1A 3FXYA 3O5FA 1LJYA 3ARPA 2RSEA 1LQ0A 2DG9A 4BF8A 1ZK6A 3TCZA 4DRKA 1E6NA 5DIVA 1F8AB 1ROUA 1VF8A 1J4RA 3FAPA 1FKDA 2AWGA 2JZVA 4P8WA 2MLXA 4DRJA 1ZBCA 3ARUA 3RM4A 4U86A 3PRAA 1HKMA 3QOKA 2MLZA 1D2KA 5DF0A 2ZR4A 3UI5A 2ZQTA 4JFKA 3RM8A 2XP8A 3KABA 2RUDA 1C9HA 4HARA 1GUVA 4LAXA 1L1PA 2D9FA 4IQ2A 4ODNA 4L72B 3AS3A 3OOBA 2QF8A 2O92A 2XP3A 5GPRA 2PV3A 1LG1A 1P5QA 1X6NA 2DG4A 2ZQSA 2Q5AA 4NZCA 1NWRA 4DT4A 1D6OA 1GPFA 2FAPA 1FKRA 1QPLA 1TFVA 3FY1A 3NI6A 1NH6A 3B9EA 2WM0A 1D7JA 4JFIA 1N1AA 1E9LA 1KT1A 3CHCA 5HWCA 1WB0A 2RURA 1JVWA 1HKKA 1IX5A 3BMBA 4DRQA 4ODKA 1HJXA 2XP4A 3ARYA 3PA7A 5DIUA 3KAFA 2PBCA 3O5DA 3WKZA 2DG3A 4P8UA 1ZCNA 4MNLA 3CH9A 4LGXA 2ETNA 4DRNA 2DT1A 2L2SA 2OFNA 1QPFA 5GQBA 2N87A 2DSUA 3TC5A 3O5LA 1ZBKA 3VAWA 4UDMA 5I98A 5DEZA 1OGGA 4QT2A 1GRJA 2MNTA 1FFQA 4JYSA 1FJDA 3JYJA 3WQWA 4DRMA 4Z2KA 4LAYA 3GU0A 4WJXA 2ZR6A 1D7HA 1HXVA 4ODRA 2MLYA 1FKHA 1Q6HA 4QT3A 4L3NA 3H9RB 3UI4A 4G2PA 4ITZA 4JFLA 4Q22A 1EHNA 1EYMA 2VCDA
chains in the Genus database with same CATH topology
2PPNA 1JNTA 2PPPA 1Q1CA 3WD4A 4HBOA 2DPEA 3AQUA 4S3KA 3KADA 3ARWA 2OLHA 5DO2A 1NMWA 1NWSA 1FD9A 2XP6A 4ZPWR 1LL7A 4KQZA 4R5EA 2A3CA 4MNJA 1ROTA 4WKAA 4ODLA 1OWQA 3O5JA 2DT2A 3KZ7A 1RD6A 1A7XA 4ODQA 3CHDA 4IT4A 1FKBA 2DSWA 3ALGA 4Z2GA 1E15A 2KO7A 2LPVA 3ALFA 5HW6A 2RUCA 3UF8A 4GGQA 4GIVA 3KAIA 1FKGA 4WK9A 3RGCA 3UQAA 3O5RA 1U79A 3MDYB 3O5MA 4DZ3A 2WK2A 1CTNA 2MF9A 1Q6UA 4P8XA 3ARXA 4DWSB 3ARTA 1W9VA 2PI6A 2ZQVA 1FKKA 4WIWA 4Z2LA 2O9OA 3KCEA 2XP9A 5DITA 4FAPA 4S3JA 3AROA 1EIBA 1ZBWA 4DH0A 1FKLA 5GPGA 3O5KA 1H0GA 4TW6A 3O5EA 3O5GA 3WH0A 1YATA 3RFWA 2LJ4A 4MNMA 4MPKA 4TX0A 1FKSA 1HKJA 2LGOA 2DT0A 4DWSC 1O6IA 2F2DA 3B9AA 1J4IA 3WL1A 1W1VA 1E6RA 4TNSA 1PBKA 3B7XA 2DSZA 2G41A 1LL6A 2PV2A 1HKIA 1XRVA 4IQCA 4WKHA 2RQSA 2XP7A 4IT6A 4NSBA 4PTMA 2DSVA 4U84A 5BXJA 3IK8A 1EQ3A 1SYTA 2ESCA 1NWUA 3UQIA 3PRBA 4DRIA 1LL4A 1ZL1A 4DWSD 2LKNA 3IKDA 2XPBA 1FKJA 5D75A 2M1IA 5HTGA 3ARRA 1W9PA 1SR0A 3WD0A 1FAPA 3ARZA 4JFMA 1UR8A 1E6PA 2B31A 2KI3A 2ITKA 4W9QA 3G6MA 2MPHA 4DROA 4Z2IA 4ODPA 3O5PA 2PPOA 3CGMA 4ZS6A 4IPXA 3CHFA 4URIA 3RM9A 3JXVA 3AS2A 1GOIA 3UQBA 3ARVA 4W9OA 4ML4A 1W1TA 3NRKA 2K8IA 4MTVA 4U85A 2KFWA 4MAVA 3IKGA 1LG2A 4ODOA 2M2AA 3WD3A 5HWBA 2WLYA 3KACA 4G50A 1PINA 2G8ZA 4ODMA 4P8VA 4QZVB 1KFWA 4AY1A 1K9TA 1M5YA 1W9UA 1X6LA 2A3EA 2DT3A 3WQVA 4DWSA 4XAKA 2RUQA 3AS1A 3AS0A 4JFJA 2YBUA 1W26A 1J6YA 4NNRA 2AOSA 3KAGA 2Y78A 1F40A 4Z2HA 1ZU8A 4LAWA 4QIBA 4HBEA 1J4HA 1NWTA 4WKFA 4W5UA 3WD1A 4J4OA 4DRHA 3WIJA 3O5OA 4TW8A 1BL4A 2M08A 3EY6A 4FN2A 2A3BA 3OA5A 2F4EA 5HUAA 3PR9A 1HJWA 2PV1A 1BKFA 4Q7NA 4DIPA 3GPKA 3O5QA 1UR9A 2F21A 3JYMA 5HW8A 1YW5A 1ZBVA 2IUZA 4ZPTR 2A3AA 3B8SA 1B6CA 4J4NA 1T11A 3BXWA 1H0IA 4MGVA 4W9PA 3G6LA 1TCOC 2KR7A 1EDQA 3IHZA 1JNSA 3UI6A 1R9HA 2UZ5A 2ZQUA 1ZB5A 1NMVA 3ODKA 3KAHA 1QZ2A 3O5IA 4TYOA 1Q6IA 4ZPVR 1NSGA 2VN1A 2FDMA 3RMEA 4O2TA 4DRPA 3CZ8A 3NTPA 1W1PA 2KGJA 2FKEA 4LAVA 4MNKA 3WD2A 4N19A 3W4RA 5HW7A 1JNDA 2WLZA 4R0XA 5J6EA 2YBTA 3PRDA 4MSPA 3CGNA 1JNEA 4KR0B 2ZR5A 1ITXA 1XHGA 1OGBA 3ARSA 2IF4A 5HKGA 3LUOA 1E6ZA 1FKTA 1Y0OA 2KE0A 3TDBA 1FKFA 3ARQA 4Z2JA 1W1YA 5B8IC 3CHEA 4C02B 3I6CA 1FKIA 5HBFA 1WAWA 1WNOA 1D7IA 2XPAA 2XP5A 3B9DA 1FFRA 5JH8A 3WL0A 4DZ2A 4TW7A 1HJVA 1KT0A 5HT1A 3FXYA 3O5FA 1LJYA 3ARPA 2RSEA 1LQ0A 2DG9A 4BF8A 1ZK6A 3TCZA 4DRKA 1E6NA 5DIVA 1F8AB 1ROUA 1VF8A 1J4RA 3FAPA 1FKDA 2AWGA 2JZVA 4P8WA 2MLXA 4DRJA 1ZBCA 3ARUA 3RM4A 4U86A 3PRAA 1HKMA 3QOKA 2MLZA 1D2KA 5DF0A 2ZR4A 3UI5A 2ZQTA 4JFKA 3RM8A 2XP8A 3KABA 2RUDA 1C9HA 4HARA 1GUVA 4LAXA 1L1PA 2D9FA 4IQ2A 4ODNA 4L72B 3AS3A 3OOBA 2QF8A 2O92A 2XP3A 5GPRA 2PV3A 1LG1A 1P5QA 1X6NA 2DG4A 2ZQSA 2Q5AA 4NZCA 1NWRA 4DT4A 1D6OA 1GPFA 2FAPA 1FKRA 1QPLA 1TFVA 3FY1A 3NI6A 1NH6A 3B9EA 2WM0A 1D7JA 4JFIA 1N1AA 1E9LA 1KT1A 3CHCA 5HWCA 1WB0A 2RURA 1JVWA 1HKKA 1IX5A 4DRQA 4ODKA 1HJXA 2XP4A 3ARYA 3PA7A 5DIUA 3KAFA 2PBCA 3O5DA 3WKZA 2DG3A 4P8UA 1ZCNA 4MNLA 3CH9A 4LGXA 4DRNA 2DT1A 2L2SA 2OFNA 1QPFA 5GQBA 2N87A 2DSUA 3TC5A 3O5LA 1ZBKA 3VAWA 5I98A 5DEZA 1OGGA 4QT2A 2MNTA 1FFQA 4JYSA 1FJDA 3JYJA 3WQWA 4DRMA 4Z2KA 4LAYA 4WJXA 2ZR6A 1D7HA 1HXVA 4ODRA 2MLYA 1FKHA 1Q6HA 4QT3A 4L3NA 3H9RB 3UI4A 4G2PA 4JFLA 4ITZA 4Q22A 1EHNA 1EYMA 2VCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP8 A;  4DIP A;  3KAB A;  3GPK A;  3O5Q A;  2RUD A;  1C9H A;  4LAX A;  2F21 A;  2RQS A;  2XP7 A;  1L1P A;  2D9F A;  2PPN A;  3JYM A;  4IQ2 A;  5HW8 A;  1JNT A;  1YW5 A;  2PPP A;  3IK8 A;  4ODN A;  4U84 A;  1Q1C A;  5BXJ A;  3OOB A;  1EQ3 A;  1B6C A;  3UQI A;  4J4N A;  1T11 A;  4MGV A;  3PRB A;  2XP3 A;  4DRI A;  4W9P A;  2PV3 A;  1TCO C;  3KAD A;  1P5Q A;  2KR7 A;  2LKN A;  3IHZ A;  1JNS A;  3IKD A;  3UI6 A;  2DG4 A;  2XPB A;  1FKJ A;  5D75 A;  2ZQS A;  1R9H A;  2Q5A A;  2UZ5 A;  2ZQU A;  4DT4 A;  1D6O A;  1NMW A;  1FD9 A;  2M1I A;  1NMV A;  2XP6 A;  3KAH A;  2FAP A;  3ODK A;  1QZ2 A;  5HTG A;  1FKR A;  3O5I A;  1QPL A;  4TYO A;  1Q6I A;  1FAP A;  1NSG A;  4JFM A;  2VN1 A;  3NI6 A;  2KI3 A;  2ITK A;  4W9Q A;  4O2T A;  2MPH A;  1ROT A;  4DRP A;  3NTP A;  1D7J A;  4JFI A;  2KGJ A;  1N1A A;  2FKE A;  4ODP A;  4ODL A;  4DRO A;  3O5J A;  4LAV A;  3O5P A;  1KT1 A;  2PPO A;  3CGM A;  3KZ7 A;  1A7X A;  4ODQ A;  4IPX A;  4N19 A;  3JXV A;  5HWC A;  1FKB A;  3UQB A;  5HW7 A;  2KO7 A;  2LPV A;  5HW6 A;  2RUR A;  1JVW A;  4W9O A;  4R0X A;  5J6E A;  2RUC A;  3PRD A;  3NRK A;  3UF8 A;  2K8I A;  4GGQ A;  4GIV A;  3CGN A;  4MSP A;  4U85 A;  3KAI A;  2KFW A;  1FKG A;  2ZR5 A;  3RGC A;  3IKG A;  4DRQ A;  4ODO A;  3O5R A;  1U79 A;  3MDY B;  2M2A A;  3UQA A;  4ODK A;  2IF4 A;  2XP4 A;  3O5M A;  5HKG A;  3LUO A;  4DZ3 A;  3KAC A;  3PA7 A;  5DIU A;  5HWB A;  3KAF A;  4G50 A;  1PIN A;  4ODM A;  1FKT A;  1Y0O A;  2PBC A;  2KE0 A;  3O5D A;  3TDB A;  1M5Y A;  1FKF A;  2MF9 A;  2DG3 A;  1Q6U A;  5B8I C;  4C02 B;  2RUQ A;  3I6C A;  1ZCN A;  1FKI A;  4JFJ A;  2ZQV A;  1FKK A;  1W26 A;  1D7I A;  2XPA A;  2XP5 A;  1J6Y A;  3KCE A;  4DRN A;  2XP9 A;  5DIT A;  2L2S A;  4NNR A;  4FAP A;  4DZ2 A;  3KAG A;  2OFN A;  4TW7 A;  2Y78 A;  1FKL A;  1QPF A;  4DH0 A;  1F40 A;  1KT0 A;  5GPG A;  2N87 A;  5HT1 A;  3TC5 A;  3O5K A;  3O5L A;  3O5F A;  4TW6 A;  3O5E A;  3VAW A;  3O5G A;  3WH0 A;  1YAT A;  4LAW A;  2RSE A;  3RFW A;  5I98 A;  2LJ4 A;  2DG9 A;  4BF8 A;  4QIB A;  1ZK6 A;  3TCZ A;  4DRK A;  4QT2 A;  4TX0 A;  1F8A B;  1FKS A;  2MNT A;  2LGO A;  1J4H A;  4JYS A;  5DIV A;  1FJD A;  1ROU A;  1J4R A;  3FAP A;  3JYJ A;  1FKD A;  4J4O A;  4DRM A;  2AWG A;  2JZV A;  2MLX A;  2F2D A;  4DRJ A;  4DRH A;  4LAY A;  3O5O A;  4TW8 A;  1BL4 A;  4U86 A;  2M08 A;  3EY6 A;  1J4I A;  4FN2 A;  2ZR6 A;  2MLZ A;  1D7H A;  4TNS A;  1HXV A;  1PBK A;  4ODR A;  2MLY A;  1FKH A;  1Q6H A;  2ZQT A;  2ZR4 A;  3B7X A;  3H9R B;  4QT3 A;  3UI5 A;  2F4E A;  4JFK A;  2PV2 A;  4G2P A;  3UI4 A;  4ITZ A;  4JFL A;  5HUA A;  2PV1 A;  4IQC A;  1BKF A;  1EYM A;  2VCD A; 
#chains in the Genus database with same CATH topology
 2PPN A;  1JNT A;  2PPP A;  1Q1C A;  3WD4 A;  4HBO A;  2DPE A;  3AQU A;  4S3K A;  3KAD A;  3ARW A;  2OLH A;  5DO2 A;  1NMW A;  1NWS A;  1FD9 A;  2XP6 A;  4ZPW R;  1LL7 A;  4KQZ A;  4R5E A;  2A3C A;  4MNJ A;  3GTY X;  1ROT A;  4WKA A;  4ODL A;  1OWQ A;  3O5J A;  2DT2 A;  3KZ7 A;  1RD6 A;  1A7X A;  4ODQ A;  3CHD A;  4IT4 A;  1FKB A;  2DSW A;  3ALG A;  4Z2G A;  1E15 A;  2KO7 A;  2LPV A;  3ALF A;  5HW6 A;  2RUC A;  3UF8 A;  4GGQ A;  4GIV A;  3KAI A;  1FKG A;  4WK9 A;  3RGC A;  3UQA A;  3O5R A;  1U79 A;  3MDY B;  3O5M A;  4DZ3 A;  2WK2 A;  1CTN A;  2MF9 A;  1Q6U A;  4P8X A;  3ARX A;  2PN0 A;  4DWS B;  3ART A;  1W9V A;  2PI6 A;  2ZQV A;  1FKK A;  4WIW A;  4Z2L A;  2O9O A;  3KCE A;  2XP9 A;  5DIT A;  4FAP A;  4S3J A;  3ARO A;  1EIB A;  1ZBW A;  4DH0 A;  1FKL A;  5GPG A;  3O5K A;  1H0G A;  4TW6 A;  3O5E A;  3O5G A;  3WH0 A;  1YAT A;  3RFW A;  2LJ4 A;  4MNM A;  4MPK A;  4TX0 A;  1FKS A;  1HKJ A;  2LGO A;  2F23 A;  2DT0 A;  4DWS C;  1O6I A;  2F2D A;  3B9A A;  1J4I A;  3WL1 A;  1W1V A;  1E6R A;  4TNS A;  1PBK A;  3B7X A;  2DSZ A;  2G41 A;  1LL6 A;  2PV2 A;  1HKI A;  1XRV A;  4IQC A;  4WKH A;  2RQS A;  2XP7 A;  4IT6 A;  4NSB A;  4PTM A;  2DSV A;  4U84 A;  5BXJ A;  3IK8 A;  1EQ3 A;  1SYT A;  2ESC A;  1NWU A;  3UQI A;  3PRB A;  4DRI A;  1LL4 A;  1ZL1 A;  4DWS D;  2LKN A;  3IKD A;  2XPB A;  1FKJ A;  5D75 A;  2EUL A;  2M1I A;  5HTG A;  3ARR A;  1W9P A;  1SR0 A;  3WD0 A;  1FAP A;  3ARZ A;  4JFM A;  1UR8 A;  1E6P A;  2B31 A;  2KI3 A;  2ITK A;  4W9Q A;  3G6M A;  2MPH A;  4DRO A;  4Z2I A;  4ODP A;  3O5P A;  2PPO A;  3CGM A;  4ZS6 A;  4IPX A;  3CHF A;  4URI A;  3RM9 A;  3JXV A;  3AS2 A;  1GOI A;  3UQB A;  3ARV A;  4W9O A;  4ML4 A;  1W1T A;  3NRK A;  2K8I A;  4MTV A;  4U85 A;  2KFW A;  4MAV A;  3IKG A;  1LG2 A;  4ODO A;  2M2A A;  3WD3 A;  5HWB A;  2WLY A;  3KAC A;  4G50 A;  1PIN A;  2G8Z A;  4ODM A;  4P8V A;  4QZV B;  1KFW A;  4AY1 A;  1K9T A;  1M5Y A;  1W9U A;  1X6L A;  2A3E A;  2DT3 A;  3WQV A;  4DWS A;  4XAK A;  2P4V A;  2RUQ A;  3AS1 A;  3AS0 A;  4JFJ A;  2YBU A;  1W26 A;  1J6Y A;  4NNR A;  2AOS A;  3KAG A;  2Y78 A;  1F40 A;  4Z2H A;  1ZU8 A;  4LAW A;  4QIB A;  4HBE A;  1J4H A;  1NWT A;  4WKF A;  4W5U A;  3WD1 A;  4J4O A;  4DRH A;  3WIJ A;  3O5O A;  4TW8 A;  1BL4 A;  2M08 A;  3EY6 A;  4FN2 A;  2A3B A;  3OA5 A;  2F4E A;  5HUA A;  3PR9 A;  1HJW A;  2PV1 A;  1BKF A;  4Q7N A;  4DIP A;  3GPK A;  3O5Q A;  1UR9 A;  2F21 A;  3JYM A;  5HW8 A;  1YW5 A;  1ZBV A;  2IUZ A;  4ZPT R;  2A3A A;  3B8S A;  1B6C A;  4J4N A;  1T11 A;  3BXW A;  1H0I A;  4MGV A;  4W9P A;  3G6L A;  1TCO C;  2KR7 A;  1EDQ A;  3IHZ A;  1JNS A;  3UI6 A;  1R9H A;  2UZ5 A;  2ZQU A;  1ZB5 A;  1NMV A;  3ODK A;  3KAH A;  1QZ2 A;  3O5I A;  4TYO A;  1Q6I A;  4ZPV R;  1NSG A;  2VN1 A;  2FDM A;  3RME A;  4O2T A;  4DRP A;  3CZ8 A;  3NTP A;  1W1P A;  2KGJ A;  2FKE A;  4LAV A;  4MNK A;  3WD2 A;  4N19 A;  3W4R A;  5HW7 A;  1JND A;  2WLZ A;  4R0X A;  5J6E A;  2YBT A;  3PRD A;  4MSP A;  3CGN A;  1JNE A;  4KR0 B;  2ZR5 A;  1ITX A;  1XHG A;  1OGB A;  2B5U B;  3ARS A;  1JCH B;  2IF4 A;  5HKG A;  3LUO A;  1E6Z A;  1FKT A;  1Y0O A;  2KE0 A;  3TDB A;  1FKF A;  3ARQ A;  4Z2J A;  1W1Y A;  5B8I C;  3CHE A;  4C02 B;  3I6C A;  1FKI A;  5HBF A;  1WAW A;  1WNO A;  1D7I A;  2XPA A;  2XP5 A;  3B9D A;  1FFR A;  5JH8 A;  3WL0 A;  4DZ2 A;  1E44 A;  4TW7 A;  1HJV A;  1KT0 A;  3EIP A;  5HT1 A;  3FXY A;  3O5F A;  1LJY A;  3ARP A;  2RSE A;  1LQ0 A;  2DG9 A;  4BF8 A;  1ZK6 A;  3TCZ A;  4DRK A;  1E6N A;  5DIV A;  1F8A B;  1ROU A;  1VF8 A;  1J4R A;  3FAP A;  1FKD A;  2AWG A;  2JZV A;  4P8W A;  2MLX A;  4DRJ A;  1ZBC A;  3ARU A;  3RM4 A;  4U86 A;  3PRA A;  1HKM A;  3QOK A;  2MLZ A;  1D2K A;  5DF0 A;  2ZR4 A;  3UI5 A;  2ZQT A;  4JFK A;  3RM8 A;  2XP8 A;  3KAB A;  2RUD A;  1C9H A;  4HAR A;  1GUV A;  4LAX A;  1L1P A;  2D9F A;  4IQ2 A;  4ODN A;  4L72 B;  3AS3 A;  3OOB A;  2QF8 A;  2O92 A;  2XP3 A;  5GPR A;  2PV3 A;  1LG1 A;  1P5Q A;  1X6N A;  2DG4 A;  2ZQS A;  2Q5A A;  4NZC A;  1NWR A;  4DT4 A;  1D6O A;  1GPF A;  2FAP A;  1FKR A;  1QPL A;  1TFV A;  3FY1 A;  3NI6 A;  1NH6 A;  3B9E A;  2WM0 A;  1D7J A;  4JFI A;  1N1A A;  1E9L A;  1KT1 A;  3CHC A;  5HWC A;  1WB0 A;  2RUR A;  1JVW A;  1HKK A;  1IX5 A;  3BMB A;  4DRQ A;  4ODK A;  1HJX A;  2XP4 A;  3ARY A;  3PA7 A;  5DIU A;  3KAF A;  2PBC A;  3O5D A;  3WKZ A;  2DG3 A;  4P8U A;  1ZCN A;  4MNL A;  3CH9 A;  4LGX A;  2ETN A;  4DRN A;  2DT1 A;  2L2S A;  2OFN A;  1QPF A;  5GQB A;  2N87 A;  2DSU A;  3TC5 A;  3O5L A;  1ZBK A;  3VAW A;  4UDM A;  5I98 A;  5DEZ A;  1OGG A;  4QT2 A;  1GRJ A;  2MNT A;  1FFQ A;  4JYS A;  1FJD A;  3JYJ A;  3WQW A;  4DRM A;  4Z2K A;  4LAY A;  3GU0 A;  4WJX A;  2ZR6 A;  1D7H A;  1HXV A;  4ODR A;  2MLY A;  1FKH A;  1Q6H A;  4QT3 A;  4L3N A;  3H9R B;  3UI4 A;  4G2P A;  4ITZ A;  4JFL A;  4Q22 A;  1EHN A;  1EYM A;  2VCD A; 
#chains in the Genus database with same CATH homology
 2PPN A;  1JNT A;  2PPP A;  1Q1C A;  3WD4 A;  4HBO A;  2DPE A;  3AQU A;  4S3K A;  3KAD A;  3ARW A;  2OLH A;  5DO2 A;  1NMW A;  1NWS A;  1FD9 A;  2XP6 A;  4ZPW R;  1LL7 A;  4KQZ A;  4R5E A;  2A3C A;  4MNJ A;  1ROT A;  4WKA A;  4ODL A;  1OWQ A;  3O5J A;  2DT2 A;  3KZ7 A;  1RD6 A;  1A7X A;  4ODQ A;  3CHD A;  4IT4 A;  1FKB A;  2DSW A;  3ALG A;  4Z2G A;  1E15 A;  2KO7 A;  2LPV A;  3ALF A;  5HW6 A;  2RUC A;  3UF8 A;  4GGQ A;  4GIV A;  3KAI A;  1FKG A;  4WK9 A;  3RGC A;  3UQA A;  3O5R A;  1U79 A;  3MDY B;  3O5M A;  4DZ3 A;  2WK2 A;  1CTN A;  2MF9 A;  1Q6U A;  4P8X A;  3ARX A;  4DWS B;  3ART A;  1W9V A;  2PI6 A;  2ZQV A;  1FKK A;  4WIW A;  4Z2L A;  2O9O A;  3KCE A;  2XP9 A;  5DIT A;  4FAP A;  4S3J A;  3ARO A;  1EIB A;  1ZBW A;  4DH0 A;  1FKL A;  5GPG A;  3O5K A;  1H0G A;  4TW6 A;  3O5E A;  3O5G A;  3WH0 A;  1YAT A;  3RFW A;  2LJ4 A;  4MNM A;  4MPK A;  4TX0 A;  1FKS A;  1HKJ A;  2LGO A;  2DT0 A;  4DWS C;  1O6I A;  2F2D A;  3B9A A;  1J4I A;  3WL1 A;  1W1V A;  1E6R A;  4TNS A;  1PBK A;  3B7X A;  2DSZ A;  2G41 A;  1LL6 A;  2PV2 A;  1HKI A;  1XRV A;  4IQC A;  4WKH A;  2RQS A;  2XP7 A;  4IT6 A;  4NSB A;  4PTM A;  2DSV A;  4U84 A;  5BXJ A;  3IK8 A;  1EQ3 A;  1SYT A;  2ESC A;  1NWU A;  3UQI A;  3PRB A;  4DRI A;  1LL4 A;  1ZL1 A;  4DWS D;  2LKN A;  3IKD A;  2XPB A;  1FKJ A;  5D75 A;  2M1I A;  5HTG A;  3ARR A;  1W9P A;  1SR0 A;  3WD0 A;  1FAP A;  3ARZ A;  4JFM A;  1UR8 A;  1E6P A;  2B31 A;  2KI3 A;  2ITK A;  4W9Q A;  3G6M A;  2MPH A;  4DRO A;  4Z2I A;  4ODP A;  3O5P A;  2PPO A;  3CGM A;  4ZS6 A;  4IPX A;  3CHF A;  4URI A;  3RM9 A;  3JXV A;  3AS2 A;  1GOI A;  3UQB A;  3ARV A;  4W9O A;  4ML4 A;  1W1T A;  3NRK A;  2K8I A;  4MTV A;  4U85 A;  2KFW A;  4MAV A;  3IKG A;  1LG2 A;  4ODO A;  2M2A A;  3WD3 A;  5HWB A;  2WLY A;  3KAC A;  4G50 A;  1PIN A;  2G8Z A;  4ODM A;  4P8V A;  4QZV B;  1KFW A;  4AY1 A;  1K9T A;  1M5Y A;  1W9U A;  1X6L A;  2A3E A;  2DT3 A;  3WQV A;  4DWS A;  4XAK A;  2RUQ A;  3AS1 A;  3AS0 A;  4JFJ A;  2YBU A;  1W26 A;  1J6Y A;  4NNR A;  2AOS A;  3KAG A;  2Y78 A;  1F40 A;  4Z2H A;  1ZU8 A;  4LAW A;  4QIB A;  4HBE A;  1J4H A;  1NWT A;  4WKF A;  4W5U A;  3WD1 A;  4J4O A;  4DRH A;  3WIJ A;  3O5O A;  4TW8 A;  1BL4 A;  2M08 A;  3EY6 A;  4FN2 A;  2A3B A;  3OA5 A;  2F4E A;  5HUA A;  3PR9 A;  1HJW A;  2PV1 A;  1BKF A;  4Q7N A;  4DIP A;  3GPK A;  3O5Q A;  1UR9 A;  2F21 A;  3JYM A;  5HW8 A;  1YW5 A;  1ZBV A;  2IUZ A;  4ZPT R;  2A3A A;  3B8S A;  1B6C A;  4J4N A;  1T11 A;  3BXW A;  1H0I A;  4MGV A;  4W9P A;  3G6L A;  1TCO C;  2KR7 A;  1EDQ A;  3IHZ A;  1JNS A;  3UI6 A;  1R9H A;  2UZ5 A;  2ZQU A;  1ZB5 A;  1NMV A;  3ODK A;  3KAH A;  1QZ2 A;  3O5I A;  4TYO A;  1Q6I A;  4ZPV R;  1NSG A;  2VN1 A;  2FDM A;  3RME A;  4O2T A;  4DRP A;  3CZ8 A;  3NTP A;  1W1P A;  2KGJ A;  2FKE A;  4LAV A;  4MNK A;  3WD2 A;  4N19 A;  3W4R A;  5HW7 A;  1JND A;  2WLZ A;  4R0X A;  5J6E A;  2YBT A;  3PRD A;  4MSP A;  3CGN A;  1JNE A;  4KR0 B;  2ZR5 A;  1ITX A;  1XHG A;  1OGB A;  3ARS A;  2IF4 A;  5HKG A;  3LUO A;  1E6Z A;  1FKT A;  1Y0O A;  2KE0 A;  3TDB A;  1FKF A;  3ARQ A;  4Z2J A;  1W1Y A;  5B8I C;  3CHE A;  4C02 B;  3I6C A;  1FKI A;  5HBF A;  1WAW A;  1WNO A;  1D7I A;  2XPA A;  2XP5 A;  3B9D A;  1FFR A;  5JH8 A;  3WL0 A;  4DZ2 A;  4TW7 A;  1HJV A;  1KT0 A;  5HT1 A;  3FXY A;  3O5F A;  1LJY A;  3ARP A;  2RSE A;  1LQ0 A;  2DG9 A;  4BF8 A;  1ZK6 A;  3TCZ A;  4DRK A;  1E6N A;  5DIV A;  1F8A B;  1ROU A;  1VF8 A;  1J4R A;  3FAP A;  1FKD A;  2AWG A;  2JZV A;  4P8W A;  2MLX A;  4DRJ A;  1ZBC A;  3ARU A;  3RM4 A;  4U86 A;  3PRA A;  1HKM A;  3QOK A;  2MLZ A;  1D2K A;  5DF0 A;  2ZR4 A;  3UI5 A;  2ZQT A;  4JFK A;  3RM8 A;  2XP8 A;  3KAB A;  2RUD A;  1C9H A;  4HAR A;  1GUV A;  4LAX A;  1L1P A;  2D9F A;  4IQ2 A;  4ODN A;  4L72 B;  3AS3 A;  3OOB A;  2QF8 A;  2O92 A;  2XP3 A;  5GPR A;  2PV3 A;  1LG1 A;  1P5Q A;  1X6N A;  2DG4 A;  2ZQS A;  2Q5A A;  4NZC A;  1NWR A;  4DT4 A;  1D6O A;  1GPF A;  2FAP A;  1FKR A;  1QPL A;  1TFV A;  3FY1 A;  3NI6 A;  1NH6 A;  3B9E A;  2WM0 A;  1D7J A;  4JFI A;  1N1A A;  1E9L A;  1KT1 A;  3CHC A;  5HWC A;  1WB0 A;  2RUR A;  1JVW A;  1HKK A;  1IX5 A;  4DRQ A;  4ODK A;  1HJX A;  2XP4 A;  3ARY A;  3PA7 A;  5DIU A;  3KAF A;  2PBC A;  3O5D A;  3WKZ A;  2DG3 A;  4P8U A;  1ZCN A;  4MNL A;  3CH9 A;  4LGX A;  4DRN A;  2DT1 A;  2L2S A;  2OFN A;  1QPF A;  5GQB A;  2N87 A;  2DSU A;  3TC5 A;  3O5L A;  1ZBK A;  3VAW A;  5I98 A;  5DEZ A;  1OGG A;  4QT2 A;  2MNT A;  1FFQ A;  4JYS A;  1FJD A;  3JYJ A;  3WQW A;  4DRM A;  4Z2K A;  4LAY A;  4WJX A;  2ZR6 A;  1D7H A;  1HXV A;  4ODR A;  2MLY A;  1FKH A;  1Q6H A;  4QT3 A;  4L3N A;  3H9R B;  3UI4 A;  4G2P A;  4JFL A;  4ITZ A;  4Q22 A;  1EHN A;  1EYM A;  2VCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...