5DIUA

The fk1 domain of fkbp51 in complex with the new synthetic ligand 2-(3-((r)-1-((s)-1-((s)-2-cyclohexyl-2-(3,4,5-trimethoxyphenyl)acetyl)piperidine-2-carboxamido)-3-(3,4-dimethoxyphenyl)propyl)phenoxy)acetic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rapid, Structure-Based Exploration of Pipecolic Acid Amides as Novel Selective Antagonists of the FK506-Binding Protein 51.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5diuA00
1FD9A 2PBCA 2XP7A 5BXJA 3PRDA 2RQSA 1Q6HA 2AWGA 4ODLA 2PPNA 1FKHA 3UI4A 4IPXA 3UQAA 4DRIA 5J6EA 2ZQUA 4TW8A 1J4HA 1PINA 3O5RA 3WH0A 4ODPA 4JYSA 2FAPA 1T11A 1FKDA 1JNTA 4DRJA 5HW7A 1FAPA 1D6OA 2KI3A 2KFWA 3B7XA 3FAPA 3GPKA 4TW6A 4U84A 2XP3A 3JYJA 4GGQA 1J4IA 2XP6A 2ZQVA 4JFIA 2ZQTA 1TCOC 3KAHA 1FKTA 2MLYA 2UZ5A 5HW6A 1HXVA 3O5JA 4BF8A 2XPBA 4ODNA 5HUAA 2KO7A 1KT1A 4IQCA 5GPGA 1ROTA 2F4EA 4MGVA 4LAXA 4ODKA 4DZ2A 1EYMA 2PV1A 4LAYA 3CGMA 3IK8A 5DIUA 3O5LA 2RSEA 4TX0A 1ROUA 4G50A 2KGJA 2XP5A 4GIVA 1R9HA 2DG9A 1KT0A 1ZK6A 3PRBA 4ITZA 1F40A 1Y0OA 3UQIA 2KR7A 2F2DA 2DG4A 2JZVA 3ODKA 1BL4A 1N1AA 1PBKA 2KE0A 2RUCA 4LAVA 1U79A 1YATA 4O2TA 2PV2A 4TNSA 5HWBA 5HWCA 2IF4A 2DG3A 3KCEA 2ZR5A 3KACA 4ODQA 4JFMA 1NMVA 2FKEA 3NTPA 3O5FA 4JFKA 1L1PA 1B6CA 4FN2A 2M08A 5HTGA 4NNRA 2Y78A 3O5OA 2MLXA 2XPAA 3H9RB 3KAGA 1Q6UA 2MNTA 4IQ2A 4QIBA 2Q5AA 1A7XA 5DIVA 4DROA 2VN1A 2MPHA 1C9HA 2XP9A 1NMWA 1FKRA 3UI5A 4DT4A 4C02B 1YW5A 2MF9A 4N19A 4DRPA 3O5KA 3TC5A 4W9OA 5B8IC 1JVWA 3OOBA 3VAWA 5I98A 2LGOA 2LPVA 2M1IA 3NI6A 2L2SA 3O5MA 5HT1A 1D7JA 2VCDA 3MDYB 1EQ3A 2MLZA 3O5IA 2F21A 1FKGA 1Q1CA 3O5GA 2RUQA 3O5PA 4G2PA 1P5QA 2PV3A 3UF8A 3RFWA 4ODOA 3EY6A 4ODMA 5DITA 5HKGA 1D7HA 3TCZA 1FJDA 3JXVA 3O5QA 1ZCNA 1JNSA 1BKFA 4R0XA 2XP8A 1FKKA 1M5YA 1D7IA 2RUDA 4DRHA 3I6CA 3IKDA 3O5EA 4DZ3A 2ITKA 1QPFA 4MSPA 4W9PA 2ZR4A 4DRMA 1FKLA 1F8AB 2PPOA 4FAPA 4DRKA 4TW7A 1J4RA 3JYMA 3KAFA 1QZ2A 1QPLA 1FKJA 2K8IA 2N87A 4U86A 4U85A 1J6YA 4DH0A 2LKNA 3KADA 4DRNA 1FKFA 4J4NA 3KZ7A 2PPPA 3RGCA 3CGNA 5D75A 1FKIA 4DIPA 2OFNA 2XP4A 3IKGA 1W26A 4QT3A 2D9FA 2RURA 2LJ4A 3IHZA 3KAIA 4JFJA 5HW8A 1Q6IA 3UI6A 4ODRA 3KABA 4TYOA 4JFLA 1NSGA 3UQBA 2ZQSA 3O5DA 4W9QA 4J4OA 3LUOA 1FKSA 1FKBA 4QT2A 4DRQA 3NRKA 2M2AA 4LAWA 2ZR6A 3PA7A 3TDBA
chains in the Genus database with same CATH superfamily
2DPEA 2XP7A 3PRDA 2RQSA 2AWGA 4L3NA 3WD2A 1FKHA 2ZQUA 3O5RA 1HKJA 1W9PA 4MAVA 4ODPA 1T11A 1JNTA 1WAWA 3B7XA 1KFWA 2KFWA 3FAPA 1W1YA 4WKFA 3ARTA 1NWTA 1TCOC 3KAHA 2MLYA 1HXVA 4Z2KA 1ZBWA 4ZPWR 1EDQA 5HUAA 4ODKA 1ZBCA 2P4VA 1ROUA 3ARXA 4DWSD 1VF8A 2KGJA 2XP5A 2A3AA 1UR9A 4IT4A 5DEZA 1FFRA 4TNSA 1U79A 2PV2A 5HWCA 2IF4A 4LGXA 3KCEA 3KACA 2FKEA 1JCHB 1H0GA 1LG2A 2Y78A 4QIBA 3H9RB 5DIVA 5HW6A 3UI5A 1NWUA 2WLYA 4DRPA 3B8SA 5B8IC 5JH8A 4Z2IA 4MNKA 3ALFA 3VAWA 4MNJA 3NI6A 2L2SA 2VCDA 3MDYB 4Z2HA 3ALGA 3CHEA 3RFWA 1W9VA 4ODOA 1ZBVA 4Q7NA 4P8XA 3O5QA 1NWSA 4R0XA 2XP8A 1RD6A 3I6CA 4DZ3A 3O5EA 1QPFA 4FAPA 1JNDA 4DRMA 1FKLA 3PR9A 4MNMA 1D2KA 1J4RA 4TW7A 3KAFA 1QPLA 4U85A 2FDMA 4J4NA 1ZU8A 2PPPA 3PRAA 3RGCA 3ARUA 5D75A 1FKIA 4HARA 3WD3A 2D9FA 2LJ4A 3KAIA 1GRJA 4J4OA 3LUOA 3WIJA 4LAWA 2B5UB 4ZS6A 3WD4A 2O9OA 1HKMA 1UR8A 3AS1A 1E6RA 3UQAA 4S3JA 4TW8A 1J4HA 1PINA 3WH0A 2DSZA 1FKDA 2F23A 4DRJA 1GOIA 5HW7A 1D6OA 4TW6A 2XP3A 4GGQA 4KR0B 2ZQVA 1FKTA 1W1PA 1E44A 3O5JA 4BF8A 1JNEA 4IQCA 1ROTA 4DZ2A 3CGMA 3QOKA 1CTNA 1R9HA 2DG9A 3PRBA 3UQIA 2KR7A 3ODKA 1PBKA 1NH6A 2DG3A 1ZBKA 4ODQA 3NTPA 3O5FA 4R5EA 4AY1A 4XAKA 4FN2A 5HTGA 4NNRA 3O5OA 4IQ2A 1HJVA 3KAGA 3WL0A 1Q6UA 2MNTA 4ZPTR 2XP9A 1NMWA 3ARRA 3BXWA 2YBTA 3AS2A 1ITXA 4PTMA 1LQ0A 3O5KA 3TC5A 3OOBA 2LGOA 2LPVA 3O5MA 1LG1A 2WLZA 5HT1A 1D7JA 2F21A 1Q1CA 1SR0A 3O5PA 1E6ZA 5DITA 1E6NA 4ODMA 1OGGA 2OLHA 1W1VA 3WD1A 1D7IA 1WNOA 4ZPVR 4HBOA 3IKDA 4MSPA 2ZR4A 2DT3A 2K8IA 2EULA 3KADA 3CGNA 3G6MA 2XP4A 1Q6IA 3KABA 4TYOA 3OA5A 4URIA 3CH9A 1ZB5A 4DWSA 1FKBA 4DRQA 3NRKA 4S3KA 1O6IA 3TDBA 1FD9A 2PBCA 1XRVA 1Q6HA 3ARVA 1LL4A 1OGBA 4IPXA 2QF8A 4MTVA 4P8VA 1IX5A 1E9LA 4JYSA 2FAPA 1OWQA 3RM8A 1W9UA 3GPKA 2XP6A 4JFIA 2ZQTA 3CHDA 2XPBA 2KO7A 1KT1A 5GPGA 3ARPA 2F4EA 4LAXA 4UDMA 1EYMA 2PV1A 4LAYA 3IK8A 4NZCA 1W1TA 5DIUA 2DT0A 3O5LA 4G50A 1ZK6A 4ITZA 1F40A 1Y0OA 2F2DA 2DG4A 5GQBA 1BL4A 2RUCA 1H0IA 1YATA 2WK2A 2AOSA 2ZR5A 4JFMA 2WM0A 2O92A 2M08A 1TFVA 2MLXA 2XPAA 4DROA 2DSVA 2VN1A 4WK9A 2MPHA 2DT2A 1C9HA 3B9AA 2ESCA 1FKRA 4P8WA 4WKAA 4DT4A 2B31A 1YW5A 4N19A 4Z2GA 4W9OA 1K9TA 2PN0A 5I98A 2M1IA 3EIPA 1EQ3A 3O5IA 2DSUA 2RUQA 2YBUA 4G2PA 1P5QA 1LL7A 3G6LA 3CHCA 3EY6A 5HKGA 3CZ8A 3RMEA 4MPKA 3RM9A 3TCZA 3JXVA 3FY1A 1BKFA 1HKIA 3RM4A 4DWSC 4DRHA 2ITKA 4W9PA 1F8AB 4DRKA 3JYMA 1J6YA 1FKJA 2N87A 4U86A 4DH0A 4DWSB 3ARQA 2A3CA 5DF0A 4P8UA 4DIPA 2G41A 3IKGA 1W26A 4QT3A 2RURA 4Q22A 1E6PA 3B9DA 3UI6A 3GU0A 3AROA 3GTYX 2IUZA 3UQBA 1HKKA 3AS0A 4W9QA 1FKSA 4QT2A 1LJYA 2M2AA 4NSBA 2ZR6A 1EIBA 5BXJA 1NWRA 4ODLA 2PPNA 3UI4A 1FFQA 4DRIA 5J6EA 4W5UA 4WKHA 1FAPA 2KI3A 4U84A 3JYJA 1XHGA 1J4IA 4ML4A 2UZ5A 2DSWA 4ODNA 4MGVA 3WQVA 4MNLA 5DO2A 3BMBA 2RSEA 4TX0A 3WL1A 3WQWA 4GIVA 1KT0A 1X6NA 1E15A 2JZVA 1N1AA 2KE0A 4LAVA 4O2TA 3B9EA 5HWBA 2G8ZA 4KQZA 1NMVA 2DT1A 2A3EA 3AQUA 4JFKA 1L1PA 1B6CA 1WB0A 1LL6A 3AS3A 2Q5AA 1A7XA 3ARZA 4L72B 4C02B 2MF9A 4WJXA 3ARYA 1JVWA 5GPRA 4QZVB 1SYTA 5HBFA 2ETNA 2MLZA 1FKGA 3O5GA 2PV3A 3UF8A 1ZL1A 1X6LA 1D7HA 3FXYA 4WIWA 1FJDA 1HJXA 1ZCNA 1JNSA 3WKZA 1FKKA 1M5YA 2RUDA 3ARSA 2PPOA 3CHFA 4IT6A 4Z2JA 1QZ2A 2LKNA 4DRNA 1FKFA 3KZ7A 2PI6A 1HJWA 2OFNA 3WD0A 1EHNA 3IHZA 4JFJA 3ARWA 5HW8A 4ODRA 4JFLA 1NSGA 2ZQSA 3O5DA 2A3BA 1GPFA 4HBEA 1GUVA 3W4RA 3PA7A 4Z2LA
chains in the Genus database with same CATH topology
2DPEA 2XP7A 3PRDA 2RQSA 2AWGA 4L3NA 3WD2A 1FKHA 2ZQUA 3O5RA 1HKJA 1W9PA 4MAVA 4ODPA 1T11A 1JNTA 1WAWA 3B7XA 1KFWA 2KFWA 3FAPA 1W1YA 4WKFA 3ARTA 1NWTA 1TCOC 3KAHA 2MLYA 1HXVA 4Z2KA 1ZBWA 4ZPWR 1EDQA 5HUAA 4ODKA 1ZBCA 1ROUA 3ARXA 4DWSD 1VF8A 2KGJA 2XP5A 2A3AA 1UR9A 4IT4A 5DEZA 1FFRA 4TNSA 1U79A 2PV2A 5HWCA 2IF4A 4LGXA 3KCEA 3KACA 2FKEA 1H0GA 1LG2A 2Y78A 4QIBA 3H9RB 5DIVA 5HW6A 3UI5A 1NWUA 2WLYA 4DRPA 3B8SA 5B8IC 5JH8A 4Z2IA 4MNKA 3ALFA 3VAWA 4MNJA 3NI6A 2L2SA 2VCDA 3MDYB 4Z2HA 3ALGA 3CHEA 3RFWA 1W9VA 4ODOA 1ZBVA 4Q7NA 4P8XA 3O5QA 1NWSA 4R0XA 2XP8A 1RD6A 3I6CA 4DZ3A 3O5EA 1QPFA 4FAPA 1JNDA 4DRMA 1FKLA 3PR9A 4MNMA 1D2KA 1J4RA 4TW7A 3KAFA 1QPLA 4U85A 2FDMA 4J4NA 1ZU8A 2PPPA 3PRAA 3RGCA 3ARUA 5D75A 1FKIA 4HARA 3WD3A 2D9FA 2LJ4A 3KAIA 4J4OA 3LUOA 3WIJA 4LAWA 4ZS6A 3WD4A 2O9OA 1HKMA 1UR8A 3AS1A 1E6RA 3UQAA 4S3JA 4TW8A 1J4HA 1PINA 3WH0A 2DSZA 1FKDA 4DRJA 1GOIA 5HW7A 1D6OA 4TW6A 2XP3A 4GGQA 4KR0B 2ZQVA 1FKTA 1W1PA 3O5JA 4BF8A 1JNEA 4IQCA 1ROTA 4DZ2A 3CGMA 3QOKA 1CTNA 1R9HA 2DG9A 3PRBA 3UQIA 2KR7A 3ODKA 1PBKA 1NH6A 2DG3A 1ZBKA 4ODQA 3NTPA 3O5FA 4R5EA 4AY1A 4XAKA 4FN2A 5HTGA 4NNRA 3O5OA 4IQ2A 1HJVA 3KAGA 3WL0A 1Q6UA 2MNTA 4ZPTR 2XP9A 1NMWA 3ARRA 3BXWA 2YBTA 3AS2A 1ITXA 4PTMA 1LQ0A 3O5KA 3TC5A 3OOBA 2LGOA 2LPVA 3O5MA 1LG1A 2WLZA 5HT1A 1D7JA 2F21A 1Q1CA 1SR0A 3O5PA 1E6ZA 5DITA 1E6NA 4ODMA 1OGGA 2OLHA 1W1VA 3WD1A 1D7IA 1WNOA 4ZPVR 4HBOA 3IKDA 4MSPA 2ZR4A 2DT3A 2K8IA 3KADA 3CGNA 3G6MA 2XP4A 1Q6IA 3KABA 4TYOA 3OA5A 4URIA 3CH9A 1ZB5A 4DWSA 1FKBA 4DRQA 3NRKA 4S3KA 1O6IA 3TDBA 1FD9A 2PBCA 1XRVA 1Q6HA 3ARVA 1LL4A 1OGBA 4IPXA 2QF8A 4MTVA 4P8VA 1IX5A 1E9LA 4JYSA 2FAPA 1OWQA 3RM8A 1W9UA 3GPKA 2XP6A 4JFIA 2ZQTA 3CHDA 2XPBA 2KO7A 1KT1A 5GPGA 3ARPA 2F4EA 4LAXA 1EYMA 2PV1A 4LAYA 3IK8A 4NZCA 1W1TA 5DIUA 2DT0A 3O5LA 4G50A 1ZK6A 4ITZA 1F40A 1Y0OA 2F2DA 2DG4A 5GQBA 1BL4A 2RUCA 1H0IA 1YATA 2WK2A 2AOSA 2ZR5A 4JFMA 2WM0A 2O92A 2M08A 1TFVA 2MLXA 2XPAA 4DROA 2DSVA 2VN1A 4WK9A 2MPHA 2DT2A 1C9HA 3B9AA 2ESCA 1FKRA 4P8WA 4WKAA 4DT4A 2B31A 1YW5A 4N19A 4Z2GA 4W9OA 1K9TA 5I98A 2M1IA 1EQ3A 3O5IA 2DSUA 2RUQA 2YBUA 4G2PA 1P5QA 1LL7A 3G6LA 3CHCA 3EY6A 5HKGA 3CZ8A 3RMEA 4MPKA 3RM9A 3TCZA 3JXVA 3FY1A 1BKFA 1HKIA 3RM4A 4DWSC 4DRHA 2ITKA 4W9PA 1F8AB 4DRKA 3JYMA 1J6YA 1FKJA 2N87A 4U86A 4DH0A 4DWSB 3ARQA 2A3CA 5DF0A 4P8UA 4DIPA 2G41A 3IKGA 1W26A 4QT3A 2RURA 4Q22A 1E6PA 3B9DA 3UI6A 3AROA 2IUZA 3UQBA 1HKKA 3AS0A 4W9QA 1FKSA 4QT2A 1LJYA 2M2AA 4NSBA 2ZR6A 1EIBA 5BXJA 1NWRA 4ODLA 2PPNA 3UI4A 1FFQA 4DRIA 5J6EA 4W5UA 4WKHA 1FAPA 2KI3A 4U84A 3JYJA 1XHGA 1J4IA 4ML4A 2UZ5A 2DSWA 4ODNA 4MGVA 3WQVA 4MNLA 5DO2A 2RSEA 4TX0A 3WL1A 3WQWA 4GIVA 1KT0A 1X6NA 1E15A 2JZVA 1N1AA 2KE0A 4LAVA 4O2TA 3B9EA 5HWBA 2G8ZA 4KQZA 1NMVA 2DT1A 2A3EA 3AQUA 4JFKA 1L1PA 1B6CA 1WB0A 1LL6A 3AS3A 2Q5AA 1A7XA 3ARZA 4L72B 4C02B 2MF9A 4WJXA 3ARYA 1JVWA 5GPRA 4QZVB 1SYTA 5HBFA 2MLZA 1FKGA 3O5GA 2PV3A 3UF8A 1ZL1A 1X6LA 1D7HA 3FXYA 4WIWA 1FJDA 1HJXA 1ZCNA 1JNSA 3WKZA 1FKKA 1M5YA 2RUDA 3ARSA 2PPOA 3CHFA 4IT6A 4Z2JA 1QZ2A 2LKNA 4DRNA 1FKFA 3KZ7A 2PI6A 1HJWA 2OFNA 3WD0A 1EHNA 3IHZA 4JFJA 3ARWA 5HW8A 4ODRA 4JFLA 1NSGA 2ZQSA 3O5DA 2A3BA 1GPFA 4HBEA 1GUVA 3W4RA 3PA7A 4Z2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD9 A;  2PBC A;  2XP7 A;  5BXJ A;  3PRD A;  2RQS A;  1Q6H A;  2AWG A;  4ODL A;  2PPN A;  1FKH A;  3UI4 A;  4IPX A;  3UQA A;  4DRI A;  5J6E A;  2ZQU A;  4TW8 A;  1J4H A;  1PIN A;  3O5R A;  3WH0 A;  4ODP A;  4JYS A;  2FAP A;  1T11 A;  1FKD A;  1JNT A;  4DRJ A;  5HW7 A;  1FAP A;  1D6O A;  2KI3 A;  2KFW A;  3B7X A;  3FAP A;  3GPK A;  4TW6 A;  4U84 A;  2XP3 A;  3JYJ A;  4GGQ A;  1J4I A;  2XP6 A;  2ZQV A;  4JFI A;  2ZQT A;  1TCO C;  3KAH A;  1FKT A;  2MLY A;  2UZ5 A;  5HW6 A;  1HXV A;  3O5J A;  4BF8 A;  2XPB A;  4ODN A;  5HUA A;  2KO7 A;  1KT1 A;  4IQC A;  5GPG A;  1ROT A;  2F4E A;  4MGV A;  4LAX A;  4ODK A;  4DZ2 A;  1EYM A;  2PV1 A;  4LAY A;  3CGM A;  3IK8 A;  5DIU A;  3O5L A;  2RSE A;  4TX0 A;  1ROU A;  4G50 A;  2KGJ A;  2XP5 A;  4GIV A;  1R9H A;  2DG9 A;  1KT0 A;  1ZK6 A;  3PRB A;  4ITZ A;  1F40 A;  1Y0O A;  3UQI A;  2KR7 A;  2F2D A;  2DG4 A;  2JZV A;  3ODK A;  1BL4 A;  1N1A A;  1PBK A;  2KE0 A;  2RUC A;  4LAV A;  1U79 A;  1YAT A;  4O2T A;  2PV2 A;  4TNS A;  5HWB A;  5HWC A;  2IF4 A;  2DG3 A;  3KCE A;  2ZR5 A;  3KAC A;  4ODQ A;  4JFM A;  1NMV A;  2FKE A;  3NTP A;  3O5F A;  4JFK A;  1L1P A;  1B6C A;  4FN2 A;  2M08 A;  5HTG A;  4NNR A;  2Y78 A;  3O5O A;  2MLX A;  2XPA A;  3H9R B;  3KAG A;  1Q6U A;  2MNT A;  4IQ2 A;  4QIB A;  2Q5A A;  1A7X A;  5DIV A;  4DRO A;  2VN1 A;  2MPH A;  1C9H A;  2XP9 A;  1NMW A;  1FKR A;  3UI5 A;  4DT4 A;  4C02 B;  1YW5 A;  2MF9 A;  4N19 A;  4DRP A;  3O5K A;  3TC5 A;  4W9O A;  5B8I C;  1JVW A;  3OOB A;  3VAW A;  5I98 A;  2LGO A;  2LPV A;  2M1I A;  3NI6 A;  2L2S A;  3O5M A;  5HT1 A;  1D7J A;  2VCD A;  3MDY B;  1EQ3 A;  2MLZ A;  3O5I A;  2F21 A;  1FKG A;  1Q1C A;  3O5G A;  2RUQ A;  3O5P A;  4G2P A;  1P5Q A;  2PV3 A;  3UF8 A;  3RFW A;  4ODO A;  3EY6 A;  4ODM A;  5DIT A;  5HKG A;  1D7H A;  3TCZ A;  1FJD A;  3JXV A;  3O5Q A;  1ZCN A;  1JNS A;  1BKF A;  4R0X A;  2XP8 A;  1FKK A;  1M5Y A;  1D7I A;  2RUD A;  4DRH A;  3I6C A;  3IKD A;  3O5E A;  4DZ3 A;  2ITK A;  1QPF A;  4MSP A;  4W9P A;  2ZR4 A;  4DRM A;  1FKL A;  1F8A B;  2PPO A;  4FAP A;  4DRK A;  4TW7 A;  1J4R A;  3JYM A;  3KAF A;  1QZ2 A;  1QPL A;  1FKJ A;  2K8I A;  2N87 A;  4U86 A;  4U85 A;  1J6Y A;  4DH0 A;  2LKN A;  3KAD A;  4DRN A;  1FKF A;  4J4N A;  3KZ7 A;  2PPP A;  3RGC A;  3CGN A;  5D75 A;  1FKI A;  4DIP A;  2OFN A;  2XP4 A;  3IKG A;  1W26 A;  4QT3 A;  2D9F A;  2RUR A;  2LJ4 A;  3IHZ A;  3KAI A;  4JFJ A;  5HW8 A;  1Q6I A;  3UI6 A;  4ODR A;  3KAB A;  4TYO A;  4JFL A;  1NSG A;  3UQB A;  2ZQS A;  3O5D A;  4W9Q A;  4J4O A;  3LUO A;  1FKS A;  1FKB A;  4QT2 A;  4DRQ A;  3NRK A;  2M2A A;  4LAW A;  2ZR6 A;  3PA7 A;  3TDB A; 
#chains in the Genus database with same CATH topology
 2DPE A;  2XP7 A;  3PRD A;  2RQS A;  2AWG A;  4L3N A;  3WD2 A;  1FKH A;  2ZQU A;  3O5R A;  1HKJ A;  1W9P A;  4MAV A;  4ODP A;  1T11 A;  1JNT A;  1WAW A;  3B7X A;  1KFW A;  2KFW A;  3FAP A;  1W1Y A;  4WKF A;  3ART A;  1NWT A;  1TCO C;  3KAH A;  2MLY A;  1HXV A;  4Z2K A;  1ZBW A;  4ZPW R;  1EDQ A;  5HUA A;  4ODK A;  1ZBC A;  2P4V A;  1ROU A;  3ARX A;  4DWS D;  1VF8 A;  2KGJ A;  2XP5 A;  2A3A A;  1UR9 A;  4IT4 A;  5DEZ A;  1FFR A;  4TNS A;  1U79 A;  2PV2 A;  5HWC A;  2IF4 A;  4LGX A;  3KCE A;  3KAC A;  2FKE A;  1JCH B;  1H0G A;  1LG2 A;  2Y78 A;  4QIB A;  3H9R B;  5DIV A;  5HW6 A;  3UI5 A;  1NWU A;  2WLY A;  4DRP A;  3B8S A;  5B8I C;  5JH8 A;  4Z2I A;  4MNK A;  3ALF A;  3VAW A;  4MNJ A;  3NI6 A;  2L2S A;  2VCD A;  3MDY B;  4Z2H A;  3ALG A;  3CHE A;  3RFW A;  1W9V A;  4ODO A;  1ZBV A;  4Q7N A;  4P8X A;  3O5Q A;  1NWS A;  4R0X A;  2XP8 A;  1RD6 A;  3I6C A;  4DZ3 A;  3O5E A;  1QPF A;  4FAP A;  1JND A;  4DRM A;  1FKL A;  3PR9 A;  4MNM A;  1D2K A;  1J4R A;  4TW7 A;  3KAF A;  1QPL A;  4U85 A;  2FDM A;  4J4N A;  1ZU8 A;  2PPP A;  3PRA A;  3RGC A;  3ARU A;  5D75 A;  1FKI A;  4HAR A;  3WD3 A;  2D9F A;  2LJ4 A;  3KAI A;  1GRJ A;  4J4O A;  3LUO A;  3WIJ A;  4LAW A;  2B5U B;  4ZS6 A;  3WD4 A;  2O9O A;  1HKM A;  1UR8 A;  3AS1 A;  1E6R A;  3UQA A;  4S3J A;  4TW8 A;  1J4H A;  1PIN A;  3WH0 A;  2DSZ A;  1FKD A;  2F23 A;  4DRJ A;  1GOI A;  5HW7 A;  1D6O A;  4TW6 A;  2XP3 A;  4GGQ A;  4KR0 B;  2ZQV A;  1FKT A;  1W1P A;  1E44 A;  3O5J A;  4BF8 A;  1JNE A;  4IQC A;  1ROT A;  4DZ2 A;  3CGM A;  3QOK A;  1CTN A;  1R9H A;  2DG9 A;  3PRB A;  3UQI A;  2KR7 A;  3ODK A;  1PBK A;  1NH6 A;  2DG3 A;  1ZBK A;  4ODQ A;  3NTP A;  3O5F A;  4R5E A;  4AY1 A;  4XAK A;  4FN2 A;  5HTG A;  4NNR A;  3O5O A;  4IQ2 A;  1HJV A;  3KAG A;  3WL0 A;  1Q6U A;  2MNT A;  4ZPT R;  2XP9 A;  1NMW A;  3ARR A;  3BXW A;  2YBT A;  3AS2 A;  1ITX A;  4PTM A;  1LQ0 A;  3O5K A;  3TC5 A;  3OOB A;  2LGO A;  2LPV A;  3O5M A;  1LG1 A;  2WLZ A;  5HT1 A;  1D7J A;  2F21 A;  1Q1C A;  1SR0 A;  3O5P A;  1E6Z A;  5DIT A;  1E6N A;  4ODM A;  1OGG A;  2OLH A;  1W1V A;  3WD1 A;  1D7I A;  1WNO A;  4ZPV R;  4HBO A;  3IKD A;  4MSP A;  2ZR4 A;  2DT3 A;  2K8I A;  2EUL A;  3KAD A;  3CGN A;  3G6M A;  2XP4 A;  1Q6I A;  3KAB A;  4TYO A;  3OA5 A;  4URI A;  3CH9 A;  1ZB5 A;  4DWS A;  1FKB A;  4DRQ A;  3NRK A;  4S3K A;  1O6I A;  3TDB A;  1FD9 A;  2PBC A;  1XRV A;  1Q6H A;  3ARV A;  1LL4 A;  1OGB A;  4IPX A;  2QF8 A;  4MTV A;  4P8V A;  1IX5 A;  1E9L A;  4JYS A;  2FAP A;  1OWQ A;  3RM8 A;  1W9U A;  3GPK A;  2XP6 A;  4JFI A;  2ZQT A;  3CHD A;  2XPB A;  2KO7 A;  1KT1 A;  5GPG A;  3ARP A;  2F4E A;  4LAX A;  4UDM A;  1EYM A;  2PV1 A;  4LAY A;  3IK8 A;  4NZC A;  1W1T A;  5DIU A;  2DT0 A;  3O5L A;  4G50 A;  1ZK6 A;  4ITZ A;  1F40 A;  1Y0O A;  2F2D A;  2DG4 A;  5GQB A;  1BL4 A;  2RUC A;  1H0I A;  1YAT A;  2WK2 A;  2AOS A;  2ZR5 A;  4JFM A;  2WM0 A;  2O92 A;  2M08 A;  1TFV A;  2MLX A;  2XPA A;  4DRO A;  2DSV A;  2VN1 A;  4WK9 A;  2MPH A;  2DT2 A;  1C9H A;  3B9A A;  2ESC A;  1FKR A;  4P8W A;  4WKA A;  4DT4 A;  2B31 A;  1YW5 A;  4N19 A;  4Z2G A;  4W9O A;  1K9T A;  2PN0 A;  5I98 A;  2M1I A;  3EIP A;  1EQ3 A;  3O5I A;  2DSU A;  2RUQ A;  2YBU A;  4G2P A;  1P5Q A;  1LL7 A;  3G6L A;  3CHC A;  3EY6 A;  5HKG A;  3CZ8 A;  3RME A;  4MPK A;  3RM9 A;  3TCZ A;  3JXV A;  3FY1 A;  1BKF A;  1HKI A;  3RM4 A;  4DWS C;  4DRH A;  2ITK A;  4W9P A;  1F8A B;  4DRK A;  3JYM A;  1J6Y A;  1FKJ A;  2N87 A;  4U86 A;  4DH0 A;  4DWS B;  3ARQ A;  2A3C A;  5DF0 A;  4P8U A;  4DIP A;  2G41 A;  3IKG A;  1W26 A;  4QT3 A;  2RUR A;  4Q22 A;  1E6P A;  3B9D A;  3UI6 A;  3GU0 A;  3ARO A;  3GTY X;  2IUZ A;  3UQB A;  1HKK A;  3AS0 A;  4W9Q A;  1FKS A;  4QT2 A;  1LJY A;  2M2A A;  4NSB A;  2ZR6 A;  1EIB A;  5BXJ A;  1NWR A;  4ODL A;  2PPN A;  3UI4 A;  1FFQ A;  4DRI A;  5J6E A;  4W5U A;  4WKH A;  1FAP A;  2KI3 A;  4U84 A;  3JYJ A;  1XHG A;  1J4I A;  4ML4 A;  2UZ5 A;  2DSW A;  4ODN A;  4MGV A;  3WQV A;  4MNL A;  5DO2 A;  3BMB A;  2RSE A;  4TX0 A;  3WL1 A;  3WQW A;  4GIV A;  1KT0 A;  1X6N A;  1E15 A;  2JZV A;  1N1A A;  2KE0 A;  4LAV A;  4O2T A;  3B9E A;  5HWB A;  2G8Z A;  4KQZ A;  1NMV A;  2DT1 A;  2A3E A;  3AQU A;  4JFK A;  1L1P A;  1B6C A;  1WB0 A;  1LL6 A;  3AS3 A;  2Q5A A;  1A7X A;  3ARZ A;  4L72 B;  4C02 B;  2MF9 A;  4WJX A;  3ARY A;  1JVW A;  5GPR A;  4QZV B;  1SYT A;  5HBF A;  2ETN A;  2MLZ A;  1FKG A;  3O5G A;  2PV3 A;  3UF8 A;  1ZL1 A;  1X6L A;  1D7H A;  3FXY A;  4WIW A;  1FJD A;  1HJX A;  1ZCN A;  1JNS A;  3WKZ A;  1FKK A;  1M5Y A;  2RUD A;  3ARS A;  2PPO A;  3CHF A;  4IT6 A;  4Z2J A;  1QZ2 A;  2LKN A;  4DRN A;  1FKF A;  3KZ7 A;  2PI6 A;  1HJW A;  2OFN A;  3WD0 A;  1EHN A;  3IHZ A;  4JFJ A;  3ARW A;  5HW8 A;  4ODR A;  4JFL A;  1NSG A;  2ZQS A;  3O5D A;  2A3B A;  1GPF A;  4HBE A;  1GUV A;  3W4R A;  3PA7 A;  4Z2L A; 
#chains in the Genus database with same CATH homology
 2DPE A;  2XP7 A;  3PRD A;  2RQS A;  2AWG A;  4L3N A;  3WD2 A;  1FKH A;  2ZQU A;  3O5R A;  1HKJ A;  1W9P A;  4MAV A;  4ODP A;  1T11 A;  1JNT A;  1WAW A;  3B7X A;  1KFW A;  2KFW A;  3FAP A;  1W1Y A;  4WKF A;  3ART A;  1NWT A;  1TCO C;  3KAH A;  2MLY A;  1HXV A;  4Z2K A;  1ZBW A;  4ZPW R;  1EDQ A;  5HUA A;  4ODK A;  1ZBC A;  1ROU A;  3ARX A;  4DWS D;  1VF8 A;  2KGJ A;  2XP5 A;  2A3A A;  1UR9 A;  4IT4 A;  5DEZ A;  1FFR A;  4TNS A;  1U79 A;  2PV2 A;  5HWC A;  2IF4 A;  4LGX A;  3KCE A;  3KAC A;  2FKE A;  1H0G A;  1LG2 A;  2Y78 A;  4QIB A;  3H9R B;  5DIV A;  5HW6 A;  3UI5 A;  1NWU A;  2WLY A;  4DRP A;  3B8S A;  5B8I C;  5JH8 A;  4Z2I A;  4MNK A;  3ALF A;  3VAW A;  4MNJ A;  3NI6 A;  2L2S A;  2VCD A;  3MDY B;  4Z2H A;  3ALG A;  3CHE A;  3RFW A;  1W9V A;  4ODO A;  1ZBV A;  4Q7N A;  4P8X A;  3O5Q A;  1NWS A;  4R0X A;  2XP8 A;  1RD6 A;  3I6C A;  4DZ3 A;  3O5E A;  1QPF A;  4FAP A;  1JND A;  4DRM A;  1FKL A;  3PR9 A;  4MNM A;  1D2K A;  1J4R A;  4TW7 A;  3KAF A;  1QPL A;  4U85 A;  2FDM A;  4J4N A;  1ZU8 A;  2PPP A;  3PRA A;  3RGC A;  3ARU A;  5D75 A;  1FKI A;  4HAR A;  3WD3 A;  2D9F A;  2LJ4 A;  3KAI A;  4J4O A;  3LUO A;  3WIJ A;  4LAW A;  4ZS6 A;  3WD4 A;  2O9O A;  1HKM A;  1UR8 A;  3AS1 A;  1E6R A;  3UQA A;  4S3J A;  4TW8 A;  1J4H A;  1PIN A;  3WH0 A;  2DSZ A;  1FKD A;  4DRJ A;  1GOI A;  5HW7 A;  1D6O A;  4TW6 A;  2XP3 A;  4GGQ A;  4KR0 B;  2ZQV A;  1FKT A;  1W1P A;  3O5J A;  4BF8 A;  1JNE A;  4IQC A;  1ROT A;  4DZ2 A;  3CGM A;  3QOK A;  1CTN A;  1R9H A;  2DG9 A;  3PRB A;  3UQI A;  2KR7 A;  3ODK A;  1PBK A;  1NH6 A;  2DG3 A;  1ZBK A;  4ODQ A;  3NTP A;  3O5F A;  4R5E A;  4AY1 A;  4XAK A;  4FN2 A;  5HTG A;  4NNR A;  3O5O A;  4IQ2 A;  1HJV A;  3KAG A;  3WL0 A;  1Q6U A;  2MNT A;  4ZPT R;  2XP9 A;  1NMW A;  3ARR A;  3BXW A;  2YBT A;  3AS2 A;  1ITX A;  4PTM A;  1LQ0 A;  3O5K A;  3TC5 A;  3OOB A;  2LGO A;  2LPV A;  3O5M A;  1LG1 A;  2WLZ A;  5HT1 A;  1D7J A;  2F21 A;  1Q1C A;  1SR0 A;  3O5P A;  1E6Z A;  5DIT A;  1E6N A;  4ODM A;  1OGG A;  2OLH A;  1W1V A;  3WD1 A;  1D7I A;  1WNO A;  4ZPV R;  4HBO A;  3IKD A;  4MSP A;  2ZR4 A;  2DT3 A;  2K8I A;  3KAD A;  3CGN A;  3G6M A;  2XP4 A;  1Q6I A;  3KAB A;  4TYO A;  3OA5 A;  4URI A;  3CH9 A;  1ZB5 A;  4DWS A;  1FKB A;  4DRQ A;  3NRK A;  4S3K A;  1O6I A;  3TDB A;  1FD9 A;  2PBC A;  1XRV A;  1Q6H A;  3ARV A;  1LL4 A;  1OGB A;  4IPX A;  2QF8 A;  4MTV A;  4P8V A;  1IX5 A;  1E9L A;  4JYS A;  2FAP A;  1OWQ A;  3RM8 A;  1W9U A;  3GPK A;  2XP6 A;  4JFI A;  2ZQT A;  3CHD A;  2XPB A;  2KO7 A;  1KT1 A;  5GPG A;  3ARP A;  2F4E A;  4LAX A;  1EYM A;  2PV1 A;  4LAY A;  3IK8 A;  4NZC A;  1W1T A;  5DIU A;  2DT0 A;  3O5L A;  4G50 A;  1ZK6 A;  4ITZ A;  1F40 A;  1Y0O A;  2F2D A;  2DG4 A;  5GQB A;  1BL4 A;  2RUC A;  1H0I A;  1YAT A;  2WK2 A;  2AOS A;  2ZR5 A;  4JFM A;  2WM0 A;  2O92 A;  2M08 A;  1TFV A;  2MLX A;  2XPA A;  4DRO A;  2DSV A;  2VN1 A;  4WK9 A;  2MPH A;  2DT2 A;  1C9H A;  3B9A A;  2ESC A;  1FKR A;  4P8W A;  4WKA A;  4DT4 A;  2B31 A;  1YW5 A;  4N19 A;  4Z2G A;  4W9O A;  1K9T A;  5I98 A;  2M1I A;  1EQ3 A;  3O5I A;  2DSU A;  2RUQ A;  2YBU A;  4G2P A;  1P5Q A;  1LL7 A;  3G6L A;  3CHC A;  3EY6 A;  5HKG A;  3CZ8 A;  3RME A;  4MPK A;  3RM9 A;  3TCZ A;  3JXV A;  3FY1 A;  1BKF A;  1HKI A;  3RM4 A;  4DWS C;  4DRH A;  2ITK A;  4W9P A;  1F8A B;  4DRK A;  3JYM A;  1J6Y A;  1FKJ A;  2N87 A;  4U86 A;  4DH0 A;  4DWS B;  3ARQ A;  2A3C A;  5DF0 A;  4P8U A;  4DIP A;  2G41 A;  3IKG A;  1W26 A;  4QT3 A;  2RUR A;  4Q22 A;  1E6P A;  3B9D A;  3UI6 A;  3ARO A;  2IUZ A;  3UQB A;  1HKK A;  3AS0 A;  4W9Q A;  1FKS A;  4QT2 A;  1LJY A;  2M2A A;  4NSB A;  2ZR6 A;  1EIB A;  5BXJ A;  1NWR A;  4ODL A;  2PPN A;  3UI4 A;  1FFQ A;  4DRI A;  5J6E A;  4W5U A;  4WKH A;  1FAP A;  2KI3 A;  4U84 A;  3JYJ A;  1XHG A;  1J4I A;  4ML4 A;  2UZ5 A;  2DSW A;  4ODN A;  4MGV A;  3WQV A;  4MNL A;  5DO2 A;  2RSE A;  4TX0 A;  3WL1 A;  3WQW A;  4GIV A;  1KT0 A;  1X6N A;  1E15 A;  2JZV A;  1N1A A;  2KE0 A;  4LAV A;  4O2T A;  3B9E A;  5HWB A;  2G8Z A;  4KQZ A;  1NMV A;  2DT1 A;  2A3E A;  3AQU A;  4JFK A;  1L1P A;  1B6C A;  1WB0 A;  1LL6 A;  3AS3 A;  2Q5A A;  1A7X A;  3ARZ A;  4L72 B;  4C02 B;  2MF9 A;  4WJX A;  3ARY A;  1JVW A;  5GPR A;  4QZV B;  1SYT A;  5HBF A;  2MLZ A;  1FKG A;  3O5G A;  2PV3 A;  3UF8 A;  1ZL1 A;  1X6L A;  1D7H A;  3FXY A;  4WIW A;  1FJD A;  1HJX A;  1ZCN A;  1JNS A;  3WKZ A;  1FKK A;  1M5Y A;  2RUD A;  3ARS A;  2PPO A;  3CHF A;  4IT6 A;  4Z2J A;  1QZ2 A;  2LKN A;  4DRN A;  1FKF A;  3KZ7 A;  2PI6 A;  1HJW A;  2OFN A;  3WD0 A;  1EHN A;  3IHZ A;  4JFJ A;  3ARW A;  5HW8 A;  4ODR A;  4JFL A;  1NSG A;  2ZQS A;  3O5D A;  2A3B A;  1GPF A;  4HBE A;  1GUV A;  3W4R A;  3PA7 A;  4Z2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...