5DIUA

The fk1 domain of fkbp51 in complex with the new synthetic ligand 2-(3-((r)-1-((s)-1-((s)-2-cyclohexyl-2-(3,4,5-trimethoxyphenyl)acetyl)piperidine-2-carboxamido)-3-(3,4-dimethoxyphenyl)propyl)phenoxy)acetic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rapid, Structure-Based Exploration of Pipecolic Acid Amides as Novel Selective Antagonists of the FK506-Binding Protein 51.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5diuA00
1ZCNA 3IK8A 3O5IA 4MSPA 1QPFA 4DROA 2ZQUA 2PPNA 4W9PA 5J6EA 5HT1A 4JFKA 3IKDA 2L2SA 2XPAA 2XP9A 3O5KA 3PA7A 4N19A 3TC5A 1J4IA 3O5QA 1EQ3A 1FJDA 1FAPA 2MLXA 4TW7A 2KR7A 5D75A 2LPVA 3O5RA 4DRMA 1FKRA 4ODKA 1Q6UA 4W9QA 2LGOA 2VN1A 3KAFA 3ODKA 5DITA 3JYMA 4O2TA 3UQAA 1U79A 3PRDA 3EY6A 1Y0OA 2RURA 3UI6A 4DRNA 2F4EA 3O5MA 2F21A 4TW8A 4TNSA 4C02B 1NMWA 4DRJA 4ODQA 4DH0A 3B7XA 1FKGA 1Q1CA 2KFWA 2MF9A 4G50A 2RUCA 4QT2A 4U86A 1ROTA 4DIPA 5HKGA 3KACA 1F40A 1HXVA 1R9HA 4TW6A 5HW8A 1C9HA 2KI3A 4JYSA 1FKDA 3IHZA 2JZVA 4J4NA 2RSEA 4U84A 1FKIA 1JVWA 2VCDA 4ODRA 4QT3A 1ZK6A 4LAYA 2D9FA 2DG3A 5BXJA 2K8IA 3O5DA 2XP6A 2KO7A 1PINA 2XP7A 3OOBA 2ZR4A 1M5YA 4IPXA 1FKHA 4ODLA 2M2AA 3O5LA 4GIVA 3FAPA 4MGVA 1TCOC 1BL4A 3VAWA 3UI5A 2Q5AA 1NMVA 2PV3A 1FKBA 3JYJA 3NRKA 3H9RB 2F2DA 2ITKA 4R0XA 4BF8A 4GGQA 2M1IA 2RQSA 2PV2A 3KABA 5I98A 4LAWA 2MLYA 2PPPA 4TX0A 5DIVA 1D7JA 5HW6A 4NNRA 1FKFA 1YATA 1KT0A 3KAGA 1A7XA 4ODPA 3O5EA 3NI6A 4J4OA 4TYOA 4ITZA 4LAVA 5GPGA 4DRKA 4FAPA 4DRPA 5B8IC 1JNSA 1N1AA 2RUQA 4DRHA 5HW7A 3TDBA 4W9OA 1YW5A 2MPHA 1QPLA 2ZQVA 1D7IA 1EYMA 3LUOA 5HTGA 1P5QA 3KADA 4DRQA 2XP4A 4DZ2A 5HUAA 2PV1A 3UQBA 5HWCA 2FAPA 4JFLA 2DG9A 1D6OA 1FKTA 2LKNA 2PBCA 1NSGA 4IQ2A 4U85A 5DIUA 1J6YA 3KCEA 2M08A 3MDYB 4ODNA 1F8AB 2XPBA 4IQCA 1Q6HA 3CGNA 3RGCA 4ODOA 1J4RA 1D7HA 1J4HA 1ROUA 3JXVA 3GPKA 3I6CA 3KAHA 3UF8A 3UQIA 2XP5A 1L1PA 3KZ7A 1KT1A 2LJ4A 2KE0A 1T11A 3IKGA 2OFNA 3O5JA 3O5OA 3O5FA 2UZ5A 1FKLA 2DG4A 3KAIA 3NTPA 3O5PA 4G2PA 4JFIA 2KGJA 3PRBA 4DZ3A 1BKFA 2XP8A 2ZR5A 1Q6IA 4QIBA 3UI4A 2N87A 4DT4A 1FKSA 1FKJA 4ODMA 3TCZA 1JNTA 5HWBA 1FD9A 3O5GA 1W26A 3WH0A 2ZQTA 4DRIA 1B6CA 3CGMA 1FKKA 2MNTA 3RFWA 2FKEA 1PBKA 2ZQSA 4JFJA 2XP3A 2RUDA 4LAXA 2PPOA 1QZ2A 4JFMA 2AWGA 2IF4A 2MLZA 4FN2A 2Y78A 2ZR6A
chains in the Genus database with same CATH superfamily
2DT3A 3O5IA 3ARTA 4W9PA 5J6EA 2A3CA 2XP9A 2DT2A 2ESCA 3CHCA 1OWQA 1FJDA 2MLXA 4P8UA 3O5RA 4DRMA 4ODKA 2PN0A 2G41A 4S3KA 3KAFA 3ODKA 4O2TA 3QOKA 3UQAA 1W9UA 1Y0OA 3ARUA 4DRNA 1NWSA 4Z2IA 4TNSA 4DRJA 1FKGA 4DIPA 4G50A 3WD4A 4S3JA 4TW6A 5HW8A 2DSZA 2KI3A 4U84A 1FKIA 4LAYA 3OOBA 2KO7A 1M5YA 4IPXA 1FKHA 1HKKA 4GIVA 1TCOC 2DSVA 2OLHA 3UI5A 1NMVA 2PV3A 5DEZA 3JYJA 2F2DA 3WKZA 4Z2LA 1OGBA 1FKFA 1KT0A 4TYOA 1XHGA 4DRKA 4FAPA 1LL4A 5HW7A 1UR9A 1QPLA 2DSUA 2PI6A 1D7IA 3BXWA 3KADA 2PV1A 5HWCA 4MNLA 4IQ2A 1HJWA 1W1TA 4MTVA 1ROUA 3GPKA 3ARZA 3WL0A 1E44A 3OA5A 4G2PA 2F23A 1EIBA 4WJXA 1Q6IA 1ZB5A 4AY1A 5HWBA 3ARXA 3WH0A 3RFWA 1HJXA 4JFJA 2O9OA 1QZ2A 2ZR6A 1ZCNA 3ARWA 3IK8A 1JCHB 5GPRA 4JFKA 3IKDA 2XPAA 3PA7A 3O5KA 1W9VA 5D75A 1GRJA 1ZBCA 2LGOA 2VN1A 3JYMA 1U79A 2YBUA 5DO2A 4ZS6A 1OGGA 1ZU8A 3ARPA 4ZPWR 4DWSA 5HW6A 3FY1A 4U86A 2RUCA 1F40A 3FXYA 3WIJA 4IT4A 1C9HA 2B5UB 4JYSA 4Z2GA 1SR0A 2RSEA 1JVWA 4QT3A 3AS0A 2DG3A 1PINA 2ZR4A 3B9AA 3O5LA 4MNKA 4Q7NA 3VAWA 4MPKA 2QF8A 1FKBA 3NRKA 2M1IA 2RQSA 1FFRA 4LAWA 3G6LA 1NWTA 4TX0A 1YATA 4WKAA 4ODPA 3O5EA 3NI6A 4J4OA 1N1AA 2RUQA 1FFQA 2WM0A 4DRHA 3AS2A 3B8SA 1YW5A 2MPHA 2ZQVA 4DWSB 1P5QA 4DRQA 5HTGA 2ETNA 3UQBA 4JFLA 1LJYA 2PBCA 1X6NA 3W4RA 2M08A 3MDYB 3AS1A 2XPBA 1Q6HA 1EHNA 4KQZA 1D7HA 3JXVA 4PTMA 2XP5A 1W9PA 2LJ4A 2KE0A 3CHFA 3IKGA 3O5FA 2YBTA 3KAIA 4MNJA 3PRBA 2A3AA 3UI4A 2DT0A 1CTNA 4XAKA 4MAVA 2WLYA 1D2KA 2ZQTA 1E6ZA 4ZPVR 1B6CA 2MNTA 1HKJA 2RUDA 2PPOA 3CHDA 4JFMA 2IF4A 3WD3A 5HBFA 4URIA 4MSPA 3BMBA 3WD0A 1LL7A 3AS3A 2DSWA 2FDMA 2L2SA 4N19A 4Q22A 1J4IA 3O5QA 5JH8A 4TW7A 1LG2A 2IUZA 2KR7A 2LPVA 1FKRA 1Q6UA 1GPFA 4IT6A 1IX5A 1NWRA 2A3BA 4Z2JA 1ZBVA 3O5MA 2F21A 4TW8A 1NWUA 1NMWA 4ODQA 4DH0A 3B7XA 1Q1CA 2KFWA 2MF9A 1HXVA 5HKGA 3KACA 3WD2A 1R9HA 1JNDA 1K9TA 2WLZA 2JZVA 4P8WA 1HKIA 2VCDA 4NZCA 2D9FA 5BXJA 3O5DA 3GU0A 2XP6A 1O6IA 2M2AA 4ODLA 4MGVA 1BL4A 4KR0B 2Q5AA 2ITKA 4BF8A 4WKFA 3KABA 5I98A 2MLYA 4HARA 2PPPA 4R5EA 1LG1A 1VF8A 1A7XA 4ITZA 4LAVA 1WNOA 5GPGA 3CZ8A 4W9OA 4P8XA 1GUVA 1EYMA 3LUOA 5HUAA 2XP4A 4HBOA 1HKMA 2FAPA 1E15A 1H0IA 4P8VA 3ARYA 1E6PA 1FKTA 4UDMA 3B9DA 4L3NA 3KCEA 1F8AB 4IQCA 4ODOA 1J4HA 3AROA 3I6CA 3KAHA 3UF8A 3KZ7A 1KT1A 1ZBKA 3ARSA 1T11A 3O5JA 3O5OA 1EDQA 1FKLA 1RD6A 2KGJA 4DZ3A 4QIBA 2ZR5A 4HBEA 4DT4A 3ALFA 3ALGA 3G6MA 1FKJA 4ODMA 3TCZA 1FD9A 3O5GA 2WK2A 4DRIA 2O92A 1FKKA 1PBKA 4ZPTR 4ML4A 3WQVA 1XRVA 1E9LA 3CH9A 3WD1A 4DWSC 1SYTA 3ARQA 2AWGA 2EULA 5DF0A 2MLZA 4FN2A 3GTYX 2Y78A 1QPFA 4DROA 2ZQUA 2PPNA 3ARRA 2P4VA 5HT1A 1ITXA 3TC5A 1EQ3A 1FAPA 3ARVA 1GOIA 4W9QA 5DITA 3EIPA 3EY6A 3UI6A 2RURA 2F4EA 1UR8A 4C02B 3PRAA 4WK9A 4QT2A 1ROTA 3PR9A 1FKDA 3IHZA 4ODRA 2G8ZA 1ZK6A 2K8IA 4QZVB 2XP7A 5DIUA 1LQ0A 3FAPA 3H9RB 4R0XA 4GGQA 2PV2A 4W5UA 5DIVA 1D7JA 4NNRA 1E6RA 3KAGA 4WKHA 4L72B 4Z2KA 3B9EA 3RM8A 5B8IC 4MNMA 4DRPA 1JNSA 1W1PA 3RMEA 1NH6A 3TDBA 4DWSD 4Z2HA 1TFVA 3CHEA 4LGXA 2DG9A 1D6OA 2LKNA 3WL1A 1NSGA 4U85A 2DPEA 1J6YA 4ODNA 3RGCA 3CGNA 1J4RA 4NSBA 3UQIA 1L1PA 3RM9A 1ZL1A 2OFNA 2UZ5A 2DG4A 1JNEA 3NTPA 3O5PA 4JFIA 3WQWA 2B31A 1BKFA 2XP8A 1KFWA 2N87A 1X6LA 2A3EA 1FKSA 1WB0A 1E6NA 1JNTA 1W26A 4WIWA 1W1YA 3AQUA 3CGMA 3RM4A 1W1VA 2FKEA 2DT1A 2ZQSA 2AOSA 2XP3A 5GQBA 1LL6A 4LAXA 1ZBWA 1H0GA 1HJVA 1WAWA 3PRDA 4J4NA 4DZ2A
chains in the Genus database with same CATH topology
2DT3A 3O5IA 3ARTA 4W9PA 5J6EA 2A3CA 2XP9A 2DT2A 2ESCA 3CHCA 1OWQA 1FJDA 2MLXA 4P8UA 3O5RA 4DRMA 4ODKA 2G41A 4S3KA 3KAFA 3ODKA 4O2TA 3QOKA 3UQAA 1W9UA 1Y0OA 3ARUA 4DRNA 1NWSA 4Z2IA 4TNSA 4DRJA 1FKGA 4DIPA 4G50A 3WD4A 4S3JA 4TW6A 5HW8A 2DSZA 2KI3A 4U84A 1FKIA 4LAYA 3OOBA 2KO7A 1M5YA 4IPXA 1FKHA 1HKKA 4GIVA 1TCOC 2DSVA 2OLHA 3UI5A 1NMVA 2PV3A 5DEZA 3JYJA 2F2DA 3WKZA 4Z2LA 1OGBA 1FKFA 1KT0A 4TYOA 1XHGA 4DRKA 4FAPA 1LL4A 5HW7A 1UR9A 1QPLA 2DSUA 2PI6A 1D7IA 3BXWA 3KADA 2PV1A 5HWCA 4MNLA 4IQ2A 1HJWA 1W1TA 4MTVA 1ROUA 3GPKA 3ARZA 3WL0A 3OA5A 4G2PA 1EIBA 4WJXA 1Q6IA 1ZB5A 4AY1A 5HWBA 3ARXA 3WH0A 3RFWA 1HJXA 4JFJA 2O9OA 1QZ2A 2ZR6A 1ZCNA 3ARWA 3IK8A 5GPRA 4JFKA 3IKDA 2XPAA 3PA7A 3O5KA 1W9VA 5D75A 1ZBCA 2LGOA 2VN1A 3JYMA 1U79A 2YBUA 5DO2A 4ZS6A 1OGGA 1ZU8A 3ARPA 4ZPWR 4DWSA 5HW6A 3FY1A 4U86A 2RUCA 1F40A 3FXYA 3WIJA 4IT4A 1C9HA 4JYSA 4Z2GA 1SR0A 2RSEA 1JVWA 4QT3A 3AS0A 2DG3A 1PINA 2ZR4A 3B9AA 3O5LA 4MNKA 4Q7NA 3VAWA 4MPKA 2QF8A 1FKBA 3NRKA 2M1IA 2RQSA 1FFRA 4LAWA 3G6LA 1NWTA 4TX0A 1YATA 4WKAA 4ODPA 3O5EA 3NI6A 4J4OA 1N1AA 2RUQA 1FFQA 2WM0A 4DRHA 3AS2A 3B8SA 1YW5A 2MPHA 2ZQVA 4DWSB 1P5QA 4DRQA 5HTGA 3UQBA 4JFLA 1LJYA 2PBCA 1X6NA 3W4RA 2M08A 3MDYB 3AS1A 2XPBA 1Q6HA 1EHNA 4KQZA 1D7HA 3JXVA 4PTMA 2XP5A 1W9PA 2LJ4A 2KE0A 3CHFA 3IKGA 3O5FA 2YBTA 3KAIA 4MNJA 3PRBA 2A3AA 3UI4A 2DT0A 1CTNA 4XAKA 4MAVA 2WLYA 1D2KA 2ZQTA 1E6ZA 4ZPVR 1B6CA 2MNTA 1HKJA 2RUDA 2PPOA 3CHDA 4JFMA 2IF4A 3WD3A 5HBFA 4URIA 4MSPA 3WD0A 1LL7A 3AS3A 2DSWA 2FDMA 2L2SA 4N19A 4Q22A 1J4IA 3O5QA 5JH8A 4TW7A 1LG2A 2IUZA 2KR7A 2LPVA 1FKRA 1Q6UA 1GPFA 4IT6A 1IX5A 1NWRA 2A3BA 4Z2JA 1ZBVA 3O5MA 2F21A 4TW8A 1NWUA 1NMWA 4ODQA 4DH0A 3B7XA 1Q1CA 2KFWA 2MF9A 1HXVA 5HKGA 3KACA 3WD2A 1R9HA 1JNDA 1K9TA 2WLZA 2JZVA 4P8WA 1HKIA 2VCDA 4NZCA 2D9FA 5BXJA 3O5DA 2XP6A 1O6IA 2M2AA 4ODLA 4MGVA 1BL4A 4KR0B 2Q5AA 2ITKA 4BF8A 4WKFA 3KABA 5I98A 2MLYA 4HARA 2PPPA 4R5EA 1LG1A 1VF8A 1A7XA 4ITZA 4LAVA 1WNOA 5GPGA 3CZ8A 4W9OA 4P8XA 1GUVA 1EYMA 3LUOA 5HUAA 2XP4A 4HBOA 1HKMA 2FAPA 1E15A 1H0IA 4P8VA 3ARYA 1E6PA 1FKTA 3B9DA 4L3NA 3KCEA 1F8AB 4IQCA 4ODOA 1J4HA 3AROA 3I6CA 3KAHA 3UF8A 3KZ7A 1KT1A 1ZBKA 3ARSA 1T11A 3O5JA 3O5OA 1EDQA 1FKLA 1RD6A 2KGJA 4DZ3A 4QIBA 2ZR5A 4HBEA 4DT4A 3ALFA 3ALGA 3G6MA 1FKJA 4ODMA 3TCZA 1FD9A 3O5GA 2WK2A 4DRIA 2O92A 1FKKA 1PBKA 4ZPTR 4ML4A 3WQVA 1XRVA 1E9LA 3CH9A 3WD1A 4DWSC 1SYTA 3ARQA 2AWGA 5DF0A 2MLZA 4FN2A 2Y78A 1QPFA 4DROA 2ZQUA 2PPNA 3ARRA 5HT1A 1ITXA 3TC5A 1EQ3A 1FAPA 3ARVA 1GOIA 4W9QA 5DITA 3EY6A 3UI6A 2RURA 2F4EA 1UR8A 4C02B 3PRAA 4WK9A 4QT2A 1ROTA 3PR9A 1FKDA 3IHZA 4ODRA 2G8ZA 1ZK6A 2K8IA 4QZVB 2XP7A 5DIUA 1LQ0A 3FAPA 3H9RB 4R0XA 4GGQA 2PV2A 4W5UA 5DIVA 1D7JA 4NNRA 1E6RA 3KAGA 4WKHA 4L72B 4Z2KA 3B9EA 3RM8A 5B8IC 4MNMA 4DRPA 1JNSA 1W1PA 3RMEA 1NH6A 3TDBA 4DWSD 4Z2HA 1TFVA 3CHEA 4LGXA 2DG9A 1D6OA 2LKNA 3WL1A 1NSGA 4U85A 2DPEA 1J6YA 4ODNA 3RGCA 3CGNA 1J4RA 4NSBA 3UQIA 1L1PA 3RM9A 1ZL1A 2OFNA 2UZ5A 2DG4A 1JNEA 3NTPA 3O5PA 4JFIA 3WQWA 2B31A 1BKFA 2XP8A 1KFWA 2N87A 1X6LA 2A3EA 1FKSA 1WB0A 1E6NA 1JNTA 1W26A 4WIWA 1W1YA 3AQUA 3CGMA 3RM4A 1W1VA 2FKEA 2DT1A 2ZQSA 2AOSA 2XP3A 5GQBA 1LL6A 4LAXA 1ZBWA 1H0GA 1HJVA 1WAWA 3PRDA 4J4NA 4DZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  3IK8 A;  3O5I A;  4MSP A;  1QPF A;  4DRO A;  2ZQU A;  2PPN A;  4W9P A;  5J6E A;  5HT1 A;  4JFK A;  3IKD A;  2L2S A;  2XPA A;  2XP9 A;  3O5K A;  3PA7 A;  4N19 A;  3TC5 A;  1J4I A;  3O5Q A;  1EQ3 A;  1FJD A;  1FAP A;  2MLX A;  4TW7 A;  2KR7 A;  5D75 A;  2LPV A;  3O5R A;  4DRM A;  1FKR A;  4ODK A;  1Q6U A;  4W9Q A;  2LGO A;  2VN1 A;  3KAF A;  3ODK A;  5DIT A;  3JYM A;  4O2T A;  3UQA A;  1U79 A;  3PRD A;  3EY6 A;  1Y0O A;  2RUR A;  3UI6 A;  4DRN A;  2F4E A;  3O5M A;  2F21 A;  4TW8 A;  4TNS A;  4C02 B;  1NMW A;  4DRJ A;  4ODQ A;  4DH0 A;  3B7X A;  1FKG A;  1Q1C A;  2KFW A;  2MF9 A;  4G50 A;  2RUC A;  4QT2 A;  4U86 A;  1ROT A;  4DIP A;  5HKG A;  3KAC A;  1F40 A;  1HXV A;  1R9H A;  4TW6 A;  5HW8 A;  1C9H A;  2KI3 A;  4JYS A;  1FKD A;  3IHZ A;  2JZV A;  4J4N A;  2RSE A;  4U84 A;  1FKI A;  1JVW A;  2VCD A;  4ODR A;  4QT3 A;  1ZK6 A;  4LAY A;  2D9F A;  2DG3 A;  5BXJ A;  2K8I A;  3O5D A;  2XP6 A;  2KO7 A;  1PIN A;  2XP7 A;  3OOB A;  2ZR4 A;  1M5Y A;  4IPX A;  1FKH A;  4ODL A;  2M2A A;  3O5L A;  4GIV A;  3FAP A;  4MGV A;  1TCO C;  1BL4 A;  3VAW A;  3UI5 A;  2Q5A A;  1NMV A;  2PV3 A;  1FKB A;  3JYJ A;  3NRK A;  3H9R B;  2F2D A;  2ITK A;  4R0X A;  4BF8 A;  4GGQ A;  2M1I A;  2RQS A;  2PV2 A;  3KAB A;  5I98 A;  4LAW A;  2MLY A;  2PPP A;  4TX0 A;  5DIV A;  1D7J A;  5HW6 A;  4NNR A;  1FKF A;  1YAT A;  1KT0 A;  3KAG A;  1A7X A;  4ODP A;  3O5E A;  3NI6 A;  4J4O A;  4TYO A;  4ITZ A;  4LAV A;  5GPG A;  4DRK A;  4FAP A;  4DRP A;  5B8I C;  1JNS A;  1N1A A;  2RUQ A;  4DRH A;  5HW7 A;  3TDB A;  4W9O A;  1YW5 A;  2MPH A;  1QPL A;  2ZQV A;  1D7I A;  1EYM A;  3LUO A;  5HTG A;  1P5Q A;  3KAD A;  4DRQ A;  2XP4 A;  4DZ2 A;  5HUA A;  2PV1 A;  3UQB A;  5HWC A;  2FAP A;  4JFL A;  2DG9 A;  1D6O A;  1FKT A;  2LKN A;  2PBC A;  1NSG A;  4IQ2 A;  4U85 A;  5DIU A;  1J6Y A;  3KCE A;  2M08 A;  3MDY B;  4ODN A;  1F8A B;  2XPB A;  4IQC A;  1Q6H A;  3CGN A;  3RGC A;  4ODO A;  1J4R A;  1D7H A;  1J4H A;  1ROU A;  3JXV A;  3GPK A;  3I6C A;  3KAH A;  3UF8 A;  3UQI A;  2XP5 A;  1L1P A;  3KZ7 A;  1KT1 A;  2LJ4 A;  2KE0 A;  1T11 A;  3IKG A;  2OFN A;  3O5J A;  3O5O A;  3O5F A;  2UZ5 A;  1FKL A;  2DG4 A;  3KAI A;  3NTP A;  3O5P A;  4G2P A;  4JFI A;  2KGJ A;  3PRB A;  4DZ3 A;  1BKF A;  2XP8 A;  2ZR5 A;  1Q6I A;  4QIB A;  3UI4 A;  2N87 A;  4DT4 A;  1FKS A;  1FKJ A;  4ODM A;  3TCZ A;  1JNT A;  5HWB A;  1FD9 A;  3O5G A;  1W26 A;  3WH0 A;  2ZQT A;  4DRI A;  1B6C A;  3CGM A;  1FKK A;  2MNT A;  3RFW A;  2FKE A;  1PBK A;  2ZQS A;  4JFJ A;  2XP3 A;  2RUD A;  4LAX A;  2PPO A;  1QZ2 A;  4JFM A;  2AWG A;  2IF4 A;  2MLZ A;  4FN2 A;  2Y78 A;  2ZR6 A; 
#chains in the Genus database with same CATH topology
 2DT3 A;  3O5I A;  3ART A;  4W9P A;  5J6E A;  2A3C A;  2XP9 A;  2DT2 A;  2ESC A;  3CHC A;  1OWQ A;  1FJD A;  2MLX A;  4P8U A;  3O5R A;  4DRM A;  4ODK A;  2PN0 A;  2G41 A;  4S3K A;  3KAF A;  3ODK A;  4O2T A;  3QOK A;  3UQA A;  1W9U A;  1Y0O A;  3ARU A;  4DRN A;  1NWS A;  4Z2I A;  4TNS A;  4DRJ A;  1FKG A;  4DIP A;  4G50 A;  3WD4 A;  4S3J A;  4TW6 A;  5HW8 A;  2DSZ A;  2KI3 A;  4U84 A;  1FKI A;  4LAY A;  3OOB A;  2KO7 A;  1M5Y A;  4IPX A;  1FKH A;  1HKK A;  4GIV A;  1TCO C;  2DSV A;  2OLH A;  3UI5 A;  1NMV A;  2PV3 A;  5DEZ A;  3JYJ A;  2F2D A;  3WKZ A;  4Z2L A;  1OGB A;  1FKF A;  1KT0 A;  4TYO A;  1XHG A;  4DRK A;  4FAP A;  1LL4 A;  5HW7 A;  1UR9 A;  1QPL A;  2DSU A;  2PI6 A;  1D7I A;  3BXW A;  3KAD A;  2PV1 A;  5HWC A;  4MNL A;  4IQ2 A;  1HJW A;  1W1T A;  4MTV A;  1ROU A;  3GPK A;  3ARZ A;  3WL0 A;  1E44 A;  3OA5 A;  4G2P A;  2F23 A;  1EIB A;  4WJX A;  1Q6I A;  1ZB5 A;  4AY1 A;  5HWB A;  3ARX A;  3WH0 A;  3RFW A;  1HJX A;  4JFJ A;  2O9O A;  1QZ2 A;  2ZR6 A;  1ZCN A;  3ARW A;  3IK8 A;  1JCH B;  5GPR A;  4JFK A;  3IKD A;  2XPA A;  3PA7 A;  3O5K A;  1W9V A;  5D75 A;  1GRJ A;  1ZBC A;  2LGO A;  2VN1 A;  3JYM A;  1U79 A;  2YBU A;  5DO2 A;  4ZS6 A;  1OGG A;  1ZU8 A;  3ARP A;  4ZPW R;  4DWS A;  5HW6 A;  3FY1 A;  4U86 A;  2RUC A;  1F40 A;  3FXY A;  3WIJ A;  4IT4 A;  1C9H A;  2B5U B;  4JYS A;  4Z2G A;  1SR0 A;  2RSE A;  1JVW A;  4QT3 A;  3AS0 A;  2DG3 A;  1PIN A;  2ZR4 A;  3B9A A;  3O5L A;  4MNK A;  4Q7N A;  3VAW A;  4MPK A;  2QF8 A;  1FKB A;  3NRK A;  2M1I A;  2RQS A;  1FFR A;  4LAW A;  3G6L A;  1NWT A;  4TX0 A;  1YAT A;  4WKA A;  4ODP A;  3O5E A;  3NI6 A;  4J4O A;  1N1A A;  2RUQ A;  1FFQ A;  2WM0 A;  4DRH A;  3AS2 A;  3B8S A;  1YW5 A;  2MPH A;  2ZQV A;  4DWS B;  1P5Q A;  4DRQ A;  5HTG A;  2ETN A;  3UQB A;  4JFL A;  1LJY A;  2PBC A;  1X6N A;  3W4R A;  2M08 A;  3MDY B;  3AS1 A;  2XPB A;  1Q6H A;  1EHN A;  4KQZ A;  1D7H A;  3JXV A;  4PTM A;  2XP5 A;  1W9P A;  2LJ4 A;  2KE0 A;  3CHF A;  3IKG A;  3O5F A;  2YBT A;  3KAI A;  4MNJ A;  3PRB A;  2A3A A;  3UI4 A;  2DT0 A;  1CTN A;  4XAK A;  4MAV A;  2WLY A;  1D2K A;  2ZQT A;  1E6Z A;  4ZPV R;  1B6C A;  2MNT A;  1HKJ A;  2RUD A;  2PPO A;  3CHD A;  4JFM A;  2IF4 A;  3WD3 A;  5HBF A;  4URI A;  4MSP A;  3BMB A;  3WD0 A;  1LL7 A;  3AS3 A;  2DSW A;  2FDM A;  2L2S A;  4N19 A;  4Q22 A;  1J4I A;  3O5Q A;  5JH8 A;  4TW7 A;  1LG2 A;  2IUZ A;  2KR7 A;  2LPV A;  1FKR A;  1Q6U A;  1GPF A;  4IT6 A;  1IX5 A;  1NWR A;  2A3B A;  4Z2J A;  1ZBV A;  3O5M A;  2F21 A;  4TW8 A;  1NWU A;  1NMW A;  4ODQ A;  4DH0 A;  3B7X A;  1Q1C A;  2KFW A;  2MF9 A;  1HXV A;  5HKG A;  3KAC A;  3WD2 A;  1R9H A;  1JND A;  1K9T A;  2WLZ A;  2JZV A;  4P8W A;  1HKI A;  2VCD A;  4NZC A;  2D9F A;  5BXJ A;  3O5D A;  3GU0 A;  2XP6 A;  1O6I A;  2M2A A;  4ODL A;  4MGV A;  1BL4 A;  4KR0 B;  2Q5A A;  2ITK A;  4BF8 A;  4WKF A;  3KAB A;  5I98 A;  2MLY A;  4HAR A;  2PPP A;  4R5E A;  1LG1 A;  1VF8 A;  1A7X A;  4ITZ A;  4LAV A;  1WNO A;  5GPG A;  3CZ8 A;  4W9O A;  4P8X A;  1GUV A;  1EYM A;  3LUO A;  5HUA A;  2XP4 A;  4HBO A;  1HKM A;  2FAP A;  1E15 A;  1H0I A;  4P8V A;  3ARY A;  1E6P A;  1FKT A;  4UDM A;  3B9D A;  4L3N A;  3KCE A;  1F8A B;  4IQC A;  4ODO A;  1J4H A;  3ARO A;  3I6C A;  3KAH A;  3UF8 A;  3KZ7 A;  1KT1 A;  1ZBK A;  3ARS A;  1T11 A;  3O5J A;  3O5O A;  1EDQ A;  1FKL A;  1RD6 A;  2KGJ A;  4DZ3 A;  4QIB A;  2ZR5 A;  4HBE A;  4DT4 A;  3ALF A;  3ALG A;  3G6M A;  1FKJ A;  4ODM A;  3TCZ A;  1FD9 A;  3O5G A;  2WK2 A;  4DRI A;  2O92 A;  1FKK A;  1PBK A;  4ZPT R;  4ML4 A;  3WQV A;  1XRV A;  1E9L A;  3CH9 A;  3WD1 A;  4DWS C;  1SYT A;  3ARQ A;  2AWG A;  2EUL A;  5DF0 A;  2MLZ A;  4FN2 A;  3GTY X;  2Y78 A;  1QPF A;  4DRO A;  2ZQU A;  2PPN A;  3ARR A;  2P4V A;  5HT1 A;  1ITX A;  3TC5 A;  1EQ3 A;  1FAP A;  3ARV A;  1GOI A;  4W9Q A;  5DIT A;  3EIP A;  3EY6 A;  3UI6 A;  2RUR A;  2F4E A;  1UR8 A;  4C02 B;  3PRA A;  4WK9 A;  4QT2 A;  1ROT A;  3PR9 A;  1FKD A;  3IHZ A;  4ODR A;  2G8Z A;  1ZK6 A;  2K8I A;  4QZV B;  2XP7 A;  5DIU A;  1LQ0 A;  3FAP A;  3H9R B;  4R0X A;  4GGQ A;  2PV2 A;  4W5U A;  5DIV A;  1D7J A;  4NNR A;  1E6R A;  3KAG A;  4WKH A;  4L72 B;  4Z2K A;  3B9E A;  3RM8 A;  5B8I C;  4MNM A;  4DRP A;  1JNS A;  1W1P A;  3RME A;  1NH6 A;  3TDB A;  4DWS D;  4Z2H A;  1TFV A;  3CHE A;  4LGX A;  2DG9 A;  1D6O A;  2LKN A;  3WL1 A;  1NSG A;  4U85 A;  2DPE A;  1J6Y A;  4ODN A;  3RGC A;  3CGN A;  1J4R A;  4NSB A;  3UQI A;  1L1P A;  3RM9 A;  1ZL1 A;  2OFN A;  2UZ5 A;  2DG4 A;  1JNE A;  3NTP A;  3O5P A;  4JFI A;  3WQW A;  2B31 A;  1BKF A;  2XP8 A;  1KFW A;  2N87 A;  1X6L A;  2A3E A;  1FKS A;  1WB0 A;  1E6N A;  1JNT A;  1W26 A;  4WIW A;  1W1Y A;  3AQU A;  3CGM A;  3RM4 A;  1W1V A;  2FKE A;  2DT1 A;  2ZQS A;  2AOS A;  2XP3 A;  5GQB A;  1LL6 A;  4LAX A;  1ZBW A;  1H0G A;  1HJV A;  1WAW A;  3PRD A;  4J4N A;  4DZ2 A; 
#chains in the Genus database with same CATH homology
 2DT3 A;  3O5I A;  3ART A;  4W9P A;  5J6E A;  2A3C A;  2XP9 A;  2DT2 A;  2ESC A;  3CHC A;  1OWQ A;  1FJD A;  2MLX A;  4P8U A;  3O5R A;  4DRM A;  4ODK A;  2G41 A;  4S3K A;  3KAF A;  3ODK A;  4O2T A;  3QOK A;  3UQA A;  1W9U A;  1Y0O A;  3ARU A;  4DRN A;  1NWS A;  4Z2I A;  4TNS A;  4DRJ A;  1FKG A;  4DIP A;  4G50 A;  3WD4 A;  4S3J A;  4TW6 A;  5HW8 A;  2DSZ A;  2KI3 A;  4U84 A;  1FKI A;  4LAY A;  3OOB A;  2KO7 A;  1M5Y A;  4IPX A;  1FKH A;  1HKK A;  4GIV A;  1TCO C;  2DSV A;  2OLH A;  3UI5 A;  1NMV A;  2PV3 A;  5DEZ A;  3JYJ A;  2F2D A;  3WKZ A;  4Z2L A;  1OGB A;  1FKF A;  1KT0 A;  4TYO A;  1XHG A;  4DRK A;  4FAP A;  1LL4 A;  5HW7 A;  1UR9 A;  1QPL A;  2DSU A;  2PI6 A;  1D7I A;  3BXW A;  3KAD A;  2PV1 A;  5HWC A;  4MNL A;  4IQ2 A;  1HJW A;  1W1T A;  4MTV A;  1ROU A;  3GPK A;  3ARZ A;  3WL0 A;  3OA5 A;  4G2P A;  1EIB A;  4WJX A;  1Q6I A;  1ZB5 A;  4AY1 A;  5HWB A;  3ARX A;  3WH0 A;  3RFW A;  1HJX A;  4JFJ A;  2O9O A;  1QZ2 A;  2ZR6 A;  1ZCN A;  3ARW A;  3IK8 A;  5GPR A;  4JFK A;  3IKD A;  2XPA A;  3PA7 A;  3O5K A;  1W9V A;  5D75 A;  1ZBC A;  2LGO A;  2VN1 A;  3JYM A;  1U79 A;  2YBU A;  5DO2 A;  4ZS6 A;  1OGG A;  1ZU8 A;  3ARP A;  4ZPW R;  4DWS A;  5HW6 A;  3FY1 A;  4U86 A;  2RUC A;  1F40 A;  3FXY A;  3WIJ A;  4IT4 A;  1C9H A;  4JYS A;  4Z2G A;  1SR0 A;  2RSE A;  1JVW A;  4QT3 A;  3AS0 A;  2DG3 A;  1PIN A;  2ZR4 A;  3B9A A;  3O5L A;  4MNK A;  4Q7N A;  3VAW A;  4MPK A;  2QF8 A;  1FKB A;  3NRK A;  2M1I A;  2RQS A;  1FFR A;  4LAW A;  3G6L A;  1NWT A;  4TX0 A;  1YAT A;  4WKA A;  4ODP A;  3O5E A;  3NI6 A;  4J4O A;  1N1A A;  2RUQ A;  1FFQ A;  2WM0 A;  4DRH A;  3AS2 A;  3B8S A;  1YW5 A;  2MPH A;  2ZQV A;  4DWS B;  1P5Q A;  4DRQ A;  5HTG A;  3UQB A;  4JFL A;  1LJY A;  2PBC A;  1X6N A;  3W4R A;  2M08 A;  3MDY B;  3AS1 A;  2XPB A;  1Q6H A;  1EHN A;  4KQZ A;  1D7H A;  3JXV A;  4PTM A;  2XP5 A;  1W9P A;  2LJ4 A;  2KE0 A;  3CHF A;  3IKG A;  3O5F A;  2YBT A;  3KAI A;  4MNJ A;  3PRB A;  2A3A A;  3UI4 A;  2DT0 A;  1CTN A;  4XAK A;  4MAV A;  2WLY A;  1D2K A;  2ZQT A;  1E6Z A;  4ZPV R;  1B6C A;  2MNT A;  1HKJ A;  2RUD A;  2PPO A;  3CHD A;  4JFM A;  2IF4 A;  3WD3 A;  5HBF A;  4URI A;  4MSP A;  3WD0 A;  1LL7 A;  3AS3 A;  2DSW A;  2FDM A;  2L2S A;  4N19 A;  4Q22 A;  1J4I A;  3O5Q A;  5JH8 A;  4TW7 A;  1LG2 A;  2IUZ A;  2KR7 A;  2LPV A;  1FKR A;  1Q6U A;  1GPF A;  4IT6 A;  1IX5 A;  1NWR A;  2A3B A;  4Z2J A;  1ZBV A;  3O5M A;  2F21 A;  4TW8 A;  1NWU A;  1NMW A;  4ODQ A;  4DH0 A;  3B7X A;  1Q1C A;  2KFW A;  2MF9 A;  1HXV A;  5HKG A;  3KAC A;  3WD2 A;  1R9H A;  1JND A;  1K9T A;  2WLZ A;  2JZV A;  4P8W A;  1HKI A;  2VCD A;  4NZC A;  2D9F A;  5BXJ A;  3O5D A;  2XP6 A;  1O6I A;  2M2A A;  4ODL A;  4MGV A;  1BL4 A;  4KR0 B;  2Q5A A;  2ITK A;  4BF8 A;  4WKF A;  3KAB A;  5I98 A;  2MLY A;  4HAR A;  2PPP A;  4R5E A;  1LG1 A;  1VF8 A;  1A7X A;  4ITZ A;  4LAV A;  1WNO A;  5GPG A;  3CZ8 A;  4W9O A;  4P8X A;  1GUV A;  1EYM A;  3LUO A;  5HUA A;  2XP4 A;  4HBO A;  1HKM A;  2FAP A;  1E15 A;  1H0I A;  4P8V A;  3ARY A;  1E6P A;  1FKT A;  3B9D A;  4L3N A;  3KCE A;  1F8A B;  4IQC A;  4ODO A;  1J4H A;  3ARO A;  3I6C A;  3KAH A;  3UF8 A;  3KZ7 A;  1KT1 A;  1ZBK A;  3ARS A;  1T11 A;  3O5J A;  3O5O A;  1EDQ A;  1FKL A;  1RD6 A;  2KGJ A;  4DZ3 A;  4QIB A;  2ZR5 A;  4HBE A;  4DT4 A;  3ALF A;  3ALG A;  3G6M A;  1FKJ A;  4ODM A;  3TCZ A;  1FD9 A;  3O5G A;  2WK2 A;  4DRI A;  2O92 A;  1FKK A;  1PBK A;  4ZPT R;  4ML4 A;  3WQV A;  1XRV A;  1E9L A;  3CH9 A;  3WD1 A;  4DWS C;  1SYT A;  3ARQ A;  2AWG A;  5DF0 A;  2MLZ A;  4FN2 A;  2Y78 A;  1QPF A;  4DRO A;  2ZQU A;  2PPN A;  3ARR A;  5HT1 A;  1ITX A;  3TC5 A;  1EQ3 A;  1FAP A;  3ARV A;  1GOI A;  4W9Q A;  5DIT A;  3EY6 A;  3UI6 A;  2RUR A;  2F4E A;  1UR8 A;  4C02 B;  3PRA A;  4WK9 A;  4QT2 A;  1ROT A;  3PR9 A;  1FKD A;  3IHZ A;  4ODR A;  2G8Z A;  1ZK6 A;  2K8I A;  4QZV B;  2XP7 A;  5DIU A;  1LQ0 A;  3FAP A;  3H9R B;  4R0X A;  4GGQ A;  2PV2 A;  4W5U A;  5DIV A;  1D7J A;  4NNR A;  1E6R A;  3KAG A;  4WKH A;  4L72 B;  4Z2K A;  3B9E A;  3RM8 A;  5B8I C;  4MNM A;  4DRP A;  1JNS A;  1W1P A;  3RME A;  1NH6 A;  3TDB A;  4DWS D;  4Z2H A;  1TFV A;  3CHE A;  4LGX A;  2DG9 A;  1D6O A;  2LKN A;  3WL1 A;  1NSG A;  4U85 A;  2DPE A;  1J6Y A;  4ODN A;  3RGC A;  3CGN A;  1J4R A;  4NSB A;  3UQI A;  1L1P A;  3RM9 A;  1ZL1 A;  2OFN A;  2UZ5 A;  2DG4 A;  1JNE A;  3NTP A;  3O5P A;  4JFI A;  3WQW A;  2B31 A;  1BKF A;  2XP8 A;  1KFW A;  2N87 A;  1X6L A;  2A3E A;  1FKS A;  1WB0 A;  1E6N A;  1JNT A;  1W26 A;  4WIW A;  1W1Y A;  3AQU A;  3CGM A;  3RM4 A;  1W1V A;  2FKE A;  2DT1 A;  2ZQS A;  2AOS A;  2XP3 A;  5GQB A;  1LL6 A;  4LAX A;  1ZBW A;  1H0G A;  1HJV A;  1WAW A;  3PRD A;  4J4N A;  4DZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...