5DIUA

The fk1 domain of fkbp51 in complex with the new synthetic ligand 2-(3-((r)-1-((s)-1-((s)-2-cyclohexyl-2-(3,4,5-trimethoxyphenyl)acetyl)piperidine-2-carboxamido)-3-(3,4-dimethoxyphenyl)propyl)phenoxy)acetic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid, Structure-Based Exploration of Pipecolic Acid Amides as Novel Selective Antagonists of the FK506-Binding Protein 51.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5diuA00
3UQAA 3O5DA 2ZQSA 4O2TA 1Q6HA 1N1AA 4GGQA 2JZVA 2XP5A 5DIVA 4DROA 3NTPA 1QZ2A 4U86A 5HT1A 4DRQA 2M2AA 3KABA 4ODMA 4DZ2A 4N19A 4MSPA 2F21A 2PPPA 2ZQTA 1FJDA 4ODKA 5J6EA 2XPAA 1FKRA 2D9FA 2N87A 1FD9A 2RSEA 4G50A 2MPHA 3LUOA 4DRKA 4ODNA 2MNTA 3PRDA 2LKNA 2Q5AA 3KADA 2M1IA 4LAVA 2FAPA 3UQIA 2VN1A 2ZR5A 2LGOA 3H9RB 4J4NA 4ODQA 2PV1A 2MLYA 3O5IA 5D75A 5I98A 4ODPA 2KGJA 1C9HA 2PPNA 1T11A 1QPFA 2XP8A 3IHZA 1FKSA 3KACA 3KCEA 3NI6A 4IQ2A 2F2DA 3I6CA 1NMVA 4W9PA 4DRHA 1J4RA 1JVWA 4GIVA 1BL4A 3B7XA 4TYOA 2PV2A 1D6OA 2ITKA 5HWCA 1ZK6A 2XP3A 2LJ4A 1NMWA 3TDBA 3FAPA 4QIBA 4LAXA 3JXVA 2KE0A 1YATA 1ZCNA 2ZR4A 1FKJA 2XP9A 3JYMA 1D7JA 3O5KA 3ODKA 4JFKA 4MGVA 4DRMA 2PBCA 4TX0A 4W9OA 3KAHA 4ITZA 4TNSA 4TW7A 3TC5A 1EQ3A 4ODLA 3IKGA 1Y0OA 3O5FA 3O5JA 1QPLA 2PV3A 3O5LA 1FKKA 2UZ5A 4QT2A 2DG9A 2L2SA 2XP6A 4J4OA 4DRNA 1JNSA 5HW6A 3IK8A 1HXVA 1F8AB 2K8IA 3O5RA 4U84A 3UF8A 4TW6A 1F40A 2M08A 1KT0A 1EYMA 4LAWA 3MDYB 4JFJA 3NRKA 1FKFA 4U85A 1D7IA 5GPGA 1W26A 2IF4A 3EY6A 3PRBA 4JYSA 2RURA 4ODOA 2RUCA 4LAYA 4DT4A 2PPOA 3OOBA 1B6CA 3UI5A 1D7HA 2KFWA 1FKBA 5HTGA 1M5YA 3O5GA 3O5QA 4ODRA 3IKDA 1U79A 2RQSA 2KO7A 1J6YA 1FAPA 5B8IC 2ZR6A 4DRJA 3KAIA 3GPKA 4DIPA 5HW7A 2ZQVA 4IPXA 4JFLA 4W9QA 3UQBA 1R9HA 2XPBA 4FAPA 2KR7A 2FKEA 4QT3A 5HWBA 2DG3A 4JFMA 1PINA 4R0XA 4BF8A 2DG4A 1KT1A 3UI6A 4C02B 1PBKA 4TW8A 2OFNA 3O5OA 3O5PA 3KAGA 4IQCA 4DRIA 2VCDA 3CGNA 1FKHA 3RGCA 2MLXA 3O5MA 4DZ3A 1ROUA 2RUQA 1Q6IA 5DITA 1TCOC 2AWGA 4NNRA 2MF9A 1ROTA 2ZQUA 2MLZA 4DRPA 1FKTA 5HUAA 2KI3A 1L1PA 3RFWA 1NSGA 1FKDA 2XP7A 4FN2A 1YW5A 2Y78A 3JYJA 3TCZA 3CGMA 1Q1CA 2RUDA 2XP4A 3VAWA 5DIUA 3KZ7A 1JNTA 1BKFA 3PA7A 5BXJA 3KAFA 2LPVA 4DH0A 5HW8A 1A7XA 1J4HA 1FKLA 2F4EA 4G2PA 1FKIA 5HKGA 3O5EA 1J4IA 1Q6UA 1P5QA 1FKGA 3WH0A 4JFIA 3UI4A
chains in the Genus database with same CATH superfamily
1NWRA 1LL6A 2ZQSA 1Q6HA 1N1AA 2DSWA 1E9LA 5DIVA 4DROA 4DRQA 1QZ2A 1LL7A 5HT1A 3KABA 1OGGA 4N19A 1X6LA 2F21A 2PPPA 3RM4A 4WJXA 1FKRA 2D9FA 3ARQA 2RSEA 2MPHA 4Z2LA 1WNOA 2Q5AA 4J4NA 2LGOA 1SR0A 1O6IA 2PV1A 1ITXA 3NI6A 3KCEA 4UDMA 4GIVA 1BL4A 3B7XA 3WL0A 3QOKA 2LJ4A 3ARWA 1LQ0A 4LAXA 2ZR4A 2QF8A 4W9OA 3KAHA 4TNSA 3IKGA 2PV3A 3B9AA 4QT2A 2DG9A 4J4OA 4DRNA 3WL1A 5HW6A 2K8IA 1WAWA 4U84A 4KR0B 4TW6A 3AS2A 2M08A 4LAWA 4WKHA 5HBFA 1EIBA 1HJWA 1W26A 2IF4A 3EY6A 4IT6A 4JYSA 2RURA 4DT4A 2KFWA 5HTGA 1M5YA 2A3EA 3O5QA 4W5UA 1J6YA 1GUVA 2ZR6A 5B8IC 4S3JA 2ZQVA 2O9OA 1XHGA 4MTVA 4R0XA 4JFMA 3OA5A 1PBKA 2OFNA 4HBOA 4DRIA 2VCDA 1FKHA 2MLXA 1ZBWA 3O5MA 4DZ3A 3WD4A 4HARA 2AWGA 1ROTA 2MLZA 4S3KA 2KI3A 3RFWA 1YW5A 2PN0A 3TCZA 4DWSD 3CGMA 4ZPWR 1IX5A 1W9VA 1NWUA 4G2PA 3WD3A 3ARYA 1FKGA 2O92A 3O5DA 1OGBA 2JZVA 2XP5A 2WLZA 2DT2A 3NTPA 4U86A 1E6ZA 2M2AA 3PRAA 1FJDA 4MNMA 5J6EA 1ZB5A 2XPAA 2N87A 3RM8A 4MAVA 3ARSA 4G50A 3LUOA 4ODNA 4KQZA 2LKNA 3ALFA 4LAVA 1W1YA 2VN1A 4ODQA 4P8WA 3RM9A 2MLYA 5D75A 1ZBVA 4WIWA 3AS0A 4ZPVR 2DPEA 3EIPA 1T11A 4AY1A 1FKSA 3AS3A 3KACA 4IQ2A 3I6CA 2G41A 4PTMA 2PV2A 1D6OA 2XP3A 1NMWA 3WQVA 4JFKA 1EQ3A 2PBCA 4TX0A 4ODLA 3O5FA 4URIA 1QPLA 1WB0A 1FKKA 2DT3A 4P8VA 1ZL1A 1K9TA 3O5RA 3UF8A 1KT0A 4Z2IA 2ESCA 3MDYB 3NRKA 5GPGA 4R5EA 2IUZA 3PRBA 2RUCA 4Z2KA 1B6CA 5GQBA 3UI5A 4IT4A 4ODRA 3GU0A 3IKDA 1U79A 1LJYA 3KAIA 3GPKA 5HW7A 3BXWA 4W9QA 1R9HA 4FAPA 5HWBA 2DG3A 1PINA 2DG4A 3WQWA 2WM0A 4IQCA 3CGNA 3RGCA 1ROUA 1H0GA 5DITA 4MNLA 2MF9A 1JNDA 4L3NA 4Z2GA 4FN2A 3JYJA 3CHCA 4MPKA 1Q1CA 1E6NA 2RUDA 2XP4A 3ARVA 5BXJA 3KZ7A 3PA7A 1EHNA 1GPFA 2LPVA 1E6PA 1HJXA 1FKIA 3CH9A 1J4IA 3ARZA 1W9PA 2A3BA 1KFWA 4GGQA 4Z2HA 4ODMA 4DZ2A 2AOSA 3ARTA 1ZU8A 4P8UA 4ODKA 4Q22A 3WKZA 1FD9A 1UR9A 1JCHB 4DRKA 2MNTA 3PRDA 3FXYA 3WD0A 2FAPA 3UQIA 3B9EA 5I98A 2KGJA 1E15A 4XAKA 2PPNA 1QPFA 4W9PA 1W9UA 1HKMA 1NMVA 1XRVA 5JH8A 2B5UB 1J4RA 1RD6A 4TYOA 3WIJA 1ZK6A 4DWSA 3FAPA 3ARRA 1GOIA 1D7JA 2WK2A 3O5KA 3B9DA 1LG2A 4DWSC 1Y0OA 1W1TA 3O5JA 2UZ5A 2L2SA 3IK8A 4HBEA 1HKJA 3FY1A 3CHFA 4P8XA 4MNKA 1FKFA 4U85A 1D7IA 1ZBKA 4DWSB 3CHDA 1LG1A 3AROA 5DEZA 2DSVA 2DT1A 2OLHA 3O5GA 4WK9A 4QZVB 2KO7A 2G8ZA 3BMBA 2EULA 4DRJA 4NSBA 2KR7A 2FKEA 4WKFA 1KT1A 4NZCA 4C02B 3ALGA 4TW8A 3AQUA 2F23A 3KAGA 1NH6A 3B8SA 3ARXA 1ZBCA 3G6MA 2DT0A 1Q6IA 1TCOC 4NNRA 2ZQUA 5HUAA 4LGXA 3WD2A 1FKDA 2XP7A 2Y78A 2YBUA 3VAWA 1HJVA 3KAFA 4DH0A 4ML4A 5HW8A 1NWSA 5HKGA 1Q6UA 1E6RA 4JFIA 4Q7NA 1HKKA 4WKAA 2P4VA 3UI4A 3UQAA 4O2TA 3G6LA 1CTNA 1W1VA 4MNJA 4MSPA 1TFVA 2ZQTA 3CZ8A 1D2KA 2A3AA 3ARPA 2YBTA 3KADA 1SYTA 2M1IA 2ZR5A 3GTYX 3H9RB 3O5IA 3PR9A 4ODPA 1C9HA 3IHZA 2XP8A 4L72B 4DRHA 2F2DA 1JVWA 5HWCA 2FDMA 2ITKA 3RMEA 5DO2A 4Z2JA 3TDBA 1NWTA 1E44A 4ZS6A 4QIBA 3JXVA 2KE0A 1HKIA 1YATA 1ZCNA 2ETNA 1FKJA 2XP9A 3JYMA 3ODKA 4MGVA 4DRMA 4ITZA 4TW7A 3TC5A 2B31A 1H0IA 3O5LA 3W4RA 2XP6A 1W1PA 1X6NA 1JNSA 1HXVA 1F8AB 1F40A 3AS1A 1EYMA 4JFJA 1FFRA 4ODOA 4LAYA 2PPOA 3OOBA 4ZPTR 1D7HA 1FKBA 2RQSA 1GRJA 1FAPA 4DIPA 4IPXA 4JFLA 1FFQA 1UR8A 3UQBA 2XPBA 4QT3A 4BF8A 5GPRA 3UI6A 2PI6A 3O5OA 1LL4A 3O5PA 2WLYA 2RUQA 3WD1A 5DF0A 3CHEA 1OWQA 1VF8A 3ARUA 4DRPA 1FKTA 1L1PA 1NSGA 5DIUA 1JNTA 1BKFA 2A3CA 1JNEA 1A7XA 1J4HA 1FKLA 2F4EA 3O5EA 1P5QA 2DSUA 2DSZA 1EDQA 3WH0A
chains in the Genus database with same CATH topology
1NWRA 1LL6A 2ZQSA 1Q6HA 1N1AA 2DSWA 1E9LA 5DIVA 4DROA 4DRQA 1QZ2A 1LL7A 5HT1A 3KABA 1OGGA 4N19A 1X6LA 2F21A 2PPPA 3RM4A 4WJXA 1FKRA 2D9FA 3ARQA 2RSEA 2MPHA 4Z2LA 1WNOA 2Q5AA 4J4NA 2LGOA 1SR0A 1O6IA 2PV1A 1ITXA 3NI6A 3KCEA 4GIVA 1BL4A 3B7XA 3WL0A 3QOKA 2LJ4A 3ARWA 1LQ0A 4LAXA 2ZR4A 2QF8A 4W9OA 3KAHA 4TNSA 3IKGA 2PV3A 3B9AA 4QT2A 2DG9A 4J4OA 4DRNA 3WL1A 5HW6A 2K8IA 1WAWA 4U84A 4KR0B 4TW6A 3AS2A 2M08A 4LAWA 4WKHA 5HBFA 1EIBA 1HJWA 1W26A 2IF4A 3EY6A 4IT6A 4JYSA 2RURA 4DT4A 2KFWA 5HTGA 1M5YA 2A3EA 3O5QA 4W5UA 1J6YA 1GUVA 2ZR6A 5B8IC 4S3JA 2ZQVA 2O9OA 1XHGA 4MTVA 4R0XA 4JFMA 3OA5A 1PBKA 2OFNA 4HBOA 4DRIA 2VCDA 1FKHA 2MLXA 1ZBWA 3O5MA 4DZ3A 3WD4A 4HARA 2AWGA 1ROTA 2MLZA 4S3KA 2KI3A 3RFWA 1YW5A 3TCZA 4DWSD 3CGMA 4ZPWR 1IX5A 1W9VA 1NWUA 4G2PA 3WD3A 3ARYA 1FKGA 2O92A 3O5DA 1OGBA 2JZVA 2XP5A 2WLZA 2DT2A 3NTPA 4U86A 1E6ZA 2M2AA 3PRAA 1FJDA 4MNMA 5J6EA 1ZB5A 2XPAA 2N87A 3RM8A 4MAVA 3ARSA 4G50A 3LUOA 4ODNA 4KQZA 2LKNA 3ALFA 4LAVA 1W1YA 2VN1A 4ODQA 4P8WA 3RM9A 2MLYA 5D75A 1ZBVA 4WIWA 3AS0A 4ZPVR 2DPEA 4AY1A 1T11A 1FKSA 3AS3A 3KACA 4IQ2A 3I6CA 2G41A 4PTMA 2PV2A 1D6OA 2XP3A 1NMWA 3WQVA 4JFKA 1EQ3A 2PBCA 4TX0A 4ODLA 3O5FA 4URIA 1QPLA 1WB0A 1FKKA 2DT3A 4P8VA 1ZL1A 1K9TA 3O5RA 3UF8A 1KT0A 4Z2IA 2ESCA 3MDYB 3NRKA 5GPGA 4R5EA 2IUZA 3PRBA 2RUCA 4Z2KA 1B6CA 5GQBA 3UI5A 4IT4A 4ODRA 3IKDA 1U79A 1LJYA 3KAIA 3GPKA 5HW7A 3BXWA 4W9QA 1R9HA 4FAPA 5HWBA 2DG3A 1PINA 2DG4A 3WQWA 2WM0A 4IQCA 3CGNA 3RGCA 1ROUA 1H0GA 5DITA 4MNLA 2MF9A 1JNDA 4L3NA 4Z2GA 4FN2A 3JYJA 3CHCA 4MPKA 1Q1CA 1E6NA 2RUDA 2XP4A 3ARVA 5BXJA 3KZ7A 3PA7A 1EHNA 1GPFA 2LPVA 1E6PA 1HJXA 1FKIA 3CH9A 1J4IA 3ARZA 1W9PA 2A3BA 1KFWA 4GGQA 4Z2HA 4ODMA 4DZ2A 2AOSA 3ARTA 1ZU8A 4P8UA 4ODKA 4Q22A 3WKZA 1FD9A 1UR9A 4DRKA 2MNTA 3PRDA 3FXYA 3WD0A 2FAPA 3UQIA 3B9EA 5I98A 2KGJA 1E15A 4XAKA 2PPNA 1QPFA 4W9PA 1W9UA 1HKMA 1NMVA 1XRVA 5JH8A 1J4RA 1RD6A 4TYOA 3WIJA 1ZK6A 4DWSA 3FAPA 3ARRA 1GOIA 1D7JA 2WK2A 3O5KA 3B9DA 1LG2A 4DWSC 1Y0OA 1W1TA 3O5JA 2UZ5A 2L2SA 3IK8A 4HBEA 1HKJA 3FY1A 3CHFA 4P8XA 4MNKA 1FKFA 4U85A 1D7IA 1ZBKA 4DWSB 3CHDA 1LG1A 3AROA 5DEZA 2DSVA 2DT1A 2OLHA 3O5GA 4WK9A 4QZVB 2KO7A 2G8ZA 4DRJA 4NSBA 2KR7A 2FKEA 4WKFA 1KT1A 4NZCA 4C02B 3ALGA 4TW8A 3AQUA 3KAGA 1NH6A 3B8SA 3ARXA 1ZBCA 3G6MA 2DT0A 1Q6IA 1TCOC 4NNRA 2ZQUA 5HUAA 4LGXA 3WD2A 1FKDA 2XP7A 2Y78A 2YBUA 3VAWA 1HJVA 3KAFA 4DH0A 4ML4A 5HW8A 1NWSA 5HKGA 1Q6UA 1E6RA 4JFIA 4Q7NA 1HKKA 4WKAA 3UI4A 3UQAA 4O2TA 3G6LA 1CTNA 1W1VA 4MNJA 4MSPA 1TFVA 2ZQTA 3CZ8A 1D2KA 2A3AA 3ARPA 2YBTA 3KADA 1SYTA 2M1IA 2ZR5A 3H9RB 3O5IA 3PR9A 4ODPA 1C9HA 3IHZA 2XP8A 4L72B 4DRHA 2F2DA 1JVWA 5HWCA 2FDMA 2ITKA 3RMEA 5DO2A 4Z2JA 3TDBA 1NWTA 4ZS6A 4QIBA 3JXVA 2KE0A 1HKIA 1YATA 1ZCNA 1FKJA 2XP9A 3JYMA 3ODKA 4MGVA 4DRMA 4ITZA 4TW7A 3TC5A 2B31A 1H0IA 3O5LA 3W4RA 2XP6A 1W1PA 1X6NA 1JNSA 1HXVA 1F8AB 1F40A 3AS1A 1EYMA 4JFJA 1FFRA 4ODOA 4LAYA 2PPOA 3OOBA 4ZPTR 1D7HA 1FKBA 2RQSA 1FAPA 4DIPA 4IPXA 4JFLA 1FFQA 1UR8A 3UQBA 2XPBA 4QT3A 4BF8A 5GPRA 3UI6A 2PI6A 3O5OA 1LL4A 3O5PA 2WLYA 2RUQA 3WD1A 5DF0A 3CHEA 1OWQA 1VF8A 3ARUA 4DRPA 1FKTA 1L1PA 1NSGA 5DIUA 1JNTA 1BKFA 2A3CA 1JNEA 1A7XA 1J4HA 1FKLA 2F4EA 3O5EA 1P5QA 2DSUA 2DSZA 1EDQA 3WH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQA A;  3O5D A;  2ZQS A;  4O2T A;  1Q6H A;  1N1A A;  4GGQ A;  2JZV A;  2XP5 A;  5DIV A;  4DRO A;  3NTP A;  1QZ2 A;  4U86 A;  5HT1 A;  4DRQ A;  2M2A A;  3KAB A;  4ODM A;  4DZ2 A;  4N19 A;  4MSP A;  2F21 A;  2PPP A;  2ZQT A;  1FJD A;  4ODK A;  5J6E A;  2XPA A;  1FKR A;  2D9F A;  2N87 A;  1FD9 A;  2RSE A;  4G50 A;  2MPH A;  3LUO A;  4DRK A;  4ODN A;  2MNT A;  3PRD A;  2LKN A;  2Q5A A;  3KAD A;  2M1I A;  4LAV A;  2FAP A;  3UQI A;  2VN1 A;  2ZR5 A;  2LGO A;  3H9R B;  4J4N A;  4ODQ A;  2PV1 A;  2MLY A;  3O5I A;  5D75 A;  5I98 A;  4ODP A;  2KGJ A;  1C9H A;  2PPN A;  1T11 A;  1QPF A;  2XP8 A;  3IHZ A;  1FKS A;  3KAC A;  3KCE A;  3NI6 A;  4IQ2 A;  2F2D A;  3I6C A;  1NMV A;  4W9P A;  4DRH A;  1J4R A;  1JVW A;  4GIV A;  1BL4 A;  3B7X A;  4TYO A;  2PV2 A;  1D6O A;  2ITK A;  5HWC A;  1ZK6 A;  2XP3 A;  2LJ4 A;  1NMW A;  3TDB A;  3FAP A;  4QIB A;  4LAX A;  3JXV A;  2KE0 A;  1YAT A;  1ZCN A;  2ZR4 A;  1FKJ A;  2XP9 A;  3JYM A;  1D7J A;  3O5K A;  3ODK A;  4JFK A;  4MGV A;  4DRM A;  2PBC A;  4TX0 A;  4W9O A;  3KAH A;  4ITZ A;  4TNS A;  4TW7 A;  3TC5 A;  1EQ3 A;  4ODL A;  3IKG A;  1Y0O A;  3O5F A;  3O5J A;  1QPL A;  2PV3 A;  3O5L A;  1FKK A;  2UZ5 A;  4QT2 A;  2DG9 A;  2L2S A;  2XP6 A;  4J4O A;  4DRN A;  1JNS A;  5HW6 A;  3IK8 A;  1HXV A;  1F8A B;  2K8I A;  3O5R A;  4U84 A;  3UF8 A;  4TW6 A;  1F40 A;  2M08 A;  1KT0 A;  1EYM A;  4LAW A;  3MDY B;  4JFJ A;  3NRK A;  1FKF A;  4U85 A;  1D7I A;  5GPG A;  1W26 A;  2IF4 A;  3EY6 A;  3PRB A;  4JYS A;  2RUR A;  4ODO A;  2RUC A;  4LAY A;  4DT4 A;  2PPO A;  3OOB A;  1B6C A;  3UI5 A;  1D7H A;  2KFW A;  1FKB A;  5HTG A;  1M5Y A;  3O5G A;  3O5Q A;  4ODR A;  3IKD A;  1U79 A;  2RQS A;  2KO7 A;  1J6Y A;  1FAP A;  5B8I C;  2ZR6 A;  4DRJ A;  3KAI A;  3GPK A;  4DIP A;  5HW7 A;  2ZQV A;  4IPX A;  4JFL A;  4W9Q A;  3UQB A;  1R9H A;  2XPB A;  4FAP A;  2KR7 A;  2FKE A;  4QT3 A;  5HWB A;  2DG3 A;  4JFM A;  1PIN A;  4R0X A;  4BF8 A;  2DG4 A;  1KT1 A;  3UI6 A;  4C02 B;  1PBK A;  4TW8 A;  2OFN A;  3O5O A;  3O5P A;  3KAG A;  4IQC A;  4DRI A;  2VCD A;  3CGN A;  1FKH A;  3RGC A;  2MLX A;  3O5M A;  4DZ3 A;  1ROU A;  2RUQ A;  1Q6I A;  5DIT A;  1TCO C;  2AWG A;  4NNR A;  2MF9 A;  1ROT A;  2ZQU A;  2MLZ A;  4DRP A;  1FKT A;  5HUA A;  2KI3 A;  1L1P A;  3RFW A;  1NSG A;  1FKD A;  2XP7 A;  4FN2 A;  1YW5 A;  2Y78 A;  3JYJ A;  3TCZ A;  3CGM A;  1Q1C A;  2RUD A;  2XP4 A;  3VAW A;  5DIU A;  3KZ7 A;  1JNT A;  1BKF A;  3PA7 A;  5BXJ A;  3KAF A;  2LPV A;  4DH0 A;  5HW8 A;  1A7X A;  1J4H A;  1FKL A;  2F4E A;  4G2P A;  1FKI A;  5HKG A;  3O5E A;  1J4I A;  1Q6U A;  1P5Q A;  1FKG A;  3WH0 A;  4JFI A;  3UI4 A; 
#chains in the Genus database with same CATH topology
 1NWR A;  1LL6 A;  2ZQS A;  1Q6H A;  1N1A A;  2DSW A;  1E9L A;  5DIV A;  4DRO A;  4DRQ A;  1QZ2 A;  1LL7 A;  5HT1 A;  3KAB A;  1OGG A;  4N19 A;  1X6L A;  2F21 A;  2PPP A;  3RM4 A;  4WJX A;  1FKR A;  2D9F A;  3ARQ A;  2RSE A;  2MPH A;  4Z2L A;  1WNO A;  2Q5A A;  4J4N A;  2LGO A;  1SR0 A;  1O6I A;  2PV1 A;  1ITX A;  3NI6 A;  3KCE A;  4UDM A;  4GIV A;  1BL4 A;  3B7X A;  3WL0 A;  3QOK A;  2LJ4 A;  3ARW A;  1LQ0 A;  4LAX A;  2ZR4 A;  2QF8 A;  4W9O A;  3KAH A;  4TNS A;  3IKG A;  2PV3 A;  3B9A A;  4QT2 A;  2DG9 A;  4J4O A;  4DRN A;  3WL1 A;  5HW6 A;  2K8I A;  1WAW A;  4U84 A;  4KR0 B;  4TW6 A;  3AS2 A;  2M08 A;  4LAW A;  4WKH A;  5HBF A;  1EIB A;  1HJW A;  1W26 A;  2IF4 A;  3EY6 A;  4IT6 A;  4JYS A;  2RUR A;  4DT4 A;  2KFW A;  5HTG A;  1M5Y A;  2A3E A;  3O5Q A;  4W5U A;  1J6Y A;  1GUV A;  2ZR6 A;  5B8I C;  4S3J A;  2ZQV A;  2O9O A;  1XHG A;  4MTV A;  4R0X A;  4JFM A;  3OA5 A;  1PBK A;  2OFN A;  4HBO A;  4DRI A;  2VCD A;  1FKH A;  2MLX A;  1ZBW A;  3O5M A;  4DZ3 A;  3WD4 A;  4HAR A;  2AWG A;  1ROT A;  2MLZ A;  4S3K A;  2KI3 A;  3RFW A;  1YW5 A;  2PN0 A;  3TCZ A;  4DWS D;  3CGM A;  4ZPW R;  1IX5 A;  1W9V A;  1NWU A;  4G2P A;  3WD3 A;  3ARY A;  1FKG A;  2O92 A;  3O5D A;  1OGB A;  2JZV A;  2XP5 A;  2WLZ A;  2DT2 A;  3NTP A;  4U86 A;  1E6Z A;  2M2A A;  3PRA A;  1FJD A;  4MNM A;  5J6E A;  1ZB5 A;  2XPA A;  2N87 A;  3RM8 A;  4MAV A;  3ARS A;  4G50 A;  3LUO A;  4ODN A;  4KQZ A;  2LKN A;  3ALF A;  4LAV A;  1W1Y A;  2VN1 A;  4ODQ A;  4P8W A;  3RM9 A;  2MLY A;  5D75 A;  1ZBV A;  4WIW A;  3AS0 A;  4ZPV R;  2DPE A;  3EIP A;  1T11 A;  4AY1 A;  1FKS A;  3AS3 A;  3KAC A;  4IQ2 A;  3I6C A;  2G41 A;  4PTM A;  2PV2 A;  1D6O A;  2XP3 A;  1NMW A;  3WQV A;  4JFK A;  1EQ3 A;  2PBC A;  4TX0 A;  4ODL A;  3O5F A;  4URI A;  1QPL A;  1WB0 A;  1FKK A;  2DT3 A;  4P8V A;  1ZL1 A;  1K9T A;  3O5R A;  3UF8 A;  1KT0 A;  4Z2I A;  2ESC A;  3MDY B;  3NRK A;  5GPG A;  4R5E A;  2IUZ A;  3PRB A;  2RUC A;  4Z2K A;  1B6C A;  5GQB A;  3UI5 A;  4IT4 A;  4ODR A;  3GU0 A;  3IKD A;  1U79 A;  1LJY A;  3KAI A;  3GPK A;  5HW7 A;  3BXW A;  4W9Q A;  1R9H A;  4FAP A;  5HWB A;  2DG3 A;  1PIN A;  2DG4 A;  3WQW A;  2WM0 A;  4IQC A;  3CGN A;  3RGC A;  1ROU A;  1H0G A;  5DIT A;  4MNL A;  2MF9 A;  1JND A;  4L3N A;  4Z2G A;  4FN2 A;  3JYJ A;  3CHC A;  4MPK A;  1Q1C A;  1E6N A;  2RUD A;  2XP4 A;  3ARV A;  5BXJ A;  3KZ7 A;  3PA7 A;  1EHN A;  1GPF A;  2LPV A;  1E6P A;  1HJX A;  1FKI A;  3CH9 A;  1J4I A;  3ARZ A;  1W9P A;  2A3B A;  1KFW A;  4GGQ A;  4Z2H A;  4ODM A;  4DZ2 A;  2AOS A;  3ART A;  1ZU8 A;  4P8U A;  4ODK A;  4Q22 A;  3WKZ A;  1FD9 A;  1UR9 A;  1JCH B;  4DRK A;  2MNT A;  3PRD A;  3FXY A;  3WD0 A;  2FAP A;  3UQI A;  3B9E A;  5I98 A;  2KGJ A;  1E15 A;  4XAK A;  2PPN A;  1QPF A;  4W9P A;  1W9U A;  1HKM A;  1NMV A;  1XRV A;  5JH8 A;  2B5U B;  1J4R A;  1RD6 A;  4TYO A;  3WIJ A;  1ZK6 A;  4DWS A;  3FAP A;  3ARR A;  1GOI A;  1D7J A;  2WK2 A;  3O5K A;  3B9D A;  1LG2 A;  4DWS C;  1Y0O A;  1W1T A;  3O5J A;  2UZ5 A;  2L2S A;  3IK8 A;  4HBE A;  1HKJ A;  3FY1 A;  3CHF A;  4P8X A;  4MNK A;  1FKF A;  4U85 A;  1D7I A;  1ZBK A;  4DWS B;  3CHD A;  1LG1 A;  3ARO A;  5DEZ A;  2DSV A;  2DT1 A;  2OLH A;  3O5G A;  4WK9 A;  4QZV B;  2KO7 A;  2G8Z A;  3BMB A;  2EUL A;  4DRJ A;  4NSB A;  2KR7 A;  2FKE A;  4WKF A;  1KT1 A;  4NZC A;  4C02 B;  3ALG A;  4TW8 A;  3AQU A;  2F23 A;  3KAG A;  1NH6 A;  3B8S A;  3ARX A;  1ZBC A;  3G6M A;  2DT0 A;  1Q6I A;  1TCO C;  4NNR A;  2ZQU A;  5HUA A;  4LGX A;  3WD2 A;  1FKD A;  2XP7 A;  2Y78 A;  2YBU A;  3VAW A;  1HJV A;  3KAF A;  4DH0 A;  4ML4 A;  5HW8 A;  1NWS A;  5HKG A;  1Q6U A;  1E6R A;  4JFI A;  4Q7N A;  1HKK A;  4WKA A;  2P4V A;  3UI4 A;  3UQA A;  4O2T A;  3G6L A;  1CTN A;  1W1V A;  4MNJ A;  4MSP A;  1TFV A;  2ZQT A;  3CZ8 A;  1D2K A;  2A3A A;  3ARP A;  2YBT A;  3KAD A;  1SYT A;  2M1I A;  2ZR5 A;  3GTY X;  3H9R B;  3O5I A;  3PR9 A;  4ODP A;  1C9H A;  3IHZ A;  2XP8 A;  4L72 B;  4DRH A;  2F2D A;  1JVW A;  5HWC A;  2FDM A;  2ITK A;  3RME A;  5DO2 A;  4Z2J A;  3TDB A;  1NWT A;  1E44 A;  4ZS6 A;  4QIB A;  3JXV A;  2KE0 A;  1HKI A;  1YAT A;  1ZCN A;  2ETN A;  1FKJ A;  2XP9 A;  3JYM A;  3ODK A;  4MGV A;  4DRM A;  4ITZ A;  4TW7 A;  3TC5 A;  2B31 A;  1H0I A;  3O5L A;  3W4R A;  2XP6 A;  1W1P A;  1X6N A;  1JNS A;  1HXV A;  1F8A B;  1F40 A;  3AS1 A;  1EYM A;  4JFJ A;  1FFR A;  4ODO A;  4LAY A;  2PPO A;  3OOB A;  4ZPT R;  1D7H A;  1FKB A;  2RQS A;  1GRJ A;  1FAP A;  4DIP A;  4IPX A;  4JFL A;  1FFQ A;  1UR8 A;  3UQB A;  2XPB A;  4QT3 A;  4BF8 A;  5GPR A;  3UI6 A;  2PI6 A;  3O5O A;  1LL4 A;  3O5P A;  2WLY A;  2RUQ A;  3WD1 A;  5DF0 A;  3CHE A;  1OWQ A;  1VF8 A;  3ARU A;  4DRP A;  1FKT A;  1L1P A;  1NSG A;  5DIU A;  1JNT A;  1BKF A;  2A3C A;  1JNE A;  1A7X A;  1J4H A;  1FKL A;  2F4E A;  3O5E A;  1P5Q A;  2DSU A;  2DSZ A;  1EDQ A;  3WH0 A; 
#chains in the Genus database with same CATH homology
 1NWR A;  1LL6 A;  2ZQS A;  1Q6H A;  1N1A A;  2DSW A;  1E9L A;  5DIV A;  4DRO A;  4DRQ A;  1QZ2 A;  1LL7 A;  5HT1 A;  3KAB A;  1OGG A;  4N19 A;  1X6L A;  2F21 A;  2PPP A;  3RM4 A;  4WJX A;  1FKR A;  2D9F A;  3ARQ A;  2RSE A;  2MPH A;  4Z2L A;  1WNO A;  2Q5A A;  4J4N A;  2LGO A;  1SR0 A;  1O6I A;  2PV1 A;  1ITX A;  3NI6 A;  3KCE A;  4GIV A;  1BL4 A;  3B7X A;  3WL0 A;  3QOK A;  2LJ4 A;  3ARW A;  1LQ0 A;  4LAX A;  2ZR4 A;  2QF8 A;  4W9O A;  3KAH A;  4TNS A;  3IKG A;  2PV3 A;  3B9A A;  4QT2 A;  2DG9 A;  4J4O A;  4DRN A;  3WL1 A;  5HW6 A;  2K8I A;  1WAW A;  4U84 A;  4KR0 B;  4TW6 A;  3AS2 A;  2M08 A;  4LAW A;  4WKH A;  5HBF A;  1EIB A;  1HJW A;  1W26 A;  2IF4 A;  3EY6 A;  4IT6 A;  4JYS A;  2RUR A;  4DT4 A;  2KFW A;  5HTG A;  1M5Y A;  2A3E A;  3O5Q A;  4W5U A;  1J6Y A;  1GUV A;  2ZR6 A;  5B8I C;  4S3J A;  2ZQV A;  2O9O A;  1XHG A;  4MTV A;  4R0X A;  4JFM A;  3OA5 A;  1PBK A;  2OFN A;  4HBO A;  4DRI A;  2VCD A;  1FKH A;  2MLX A;  1ZBW A;  3O5M A;  4DZ3 A;  3WD4 A;  4HAR A;  2AWG A;  1ROT A;  2MLZ A;  4S3K A;  2KI3 A;  3RFW A;  1YW5 A;  3TCZ A;  4DWS D;  3CGM A;  4ZPW R;  1IX5 A;  1W9V A;  1NWU A;  4G2P A;  3WD3 A;  3ARY A;  1FKG A;  2O92 A;  3O5D A;  1OGB A;  2JZV A;  2XP5 A;  2WLZ A;  2DT2 A;  3NTP A;  4U86 A;  1E6Z A;  2M2A A;  3PRA A;  1FJD A;  4MNM A;  5J6E A;  1ZB5 A;  2XPA A;  2N87 A;  3RM8 A;  4MAV A;  3ARS A;  4G50 A;  3LUO A;  4ODN A;  4KQZ A;  2LKN A;  3ALF A;  4LAV A;  1W1Y A;  2VN1 A;  4ODQ A;  4P8W A;  3RM9 A;  2MLY A;  5D75 A;  1ZBV A;  4WIW A;  3AS0 A;  4ZPV R;  2DPE A;  4AY1 A;  1T11 A;  1FKS A;  3AS3 A;  3KAC A;  4IQ2 A;  3I6C A;  2G41 A;  4PTM A;  2PV2 A;  1D6O A;  2XP3 A;  1NMW A;  3WQV A;  4JFK A;  1EQ3 A;  2PBC A;  4TX0 A;  4ODL A;  3O5F A;  4URI A;  1QPL A;  1WB0 A;  1FKK A;  2DT3 A;  4P8V A;  1ZL1 A;  1K9T A;  3O5R A;  3UF8 A;  1KT0 A;  4Z2I A;  2ESC A;  3MDY B;  3NRK A;  5GPG A;  4R5E A;  2IUZ A;  3PRB A;  2RUC A;  4Z2K A;  1B6C A;  5GQB A;  3UI5 A;  4IT4 A;  4ODR A;  3IKD A;  1U79 A;  1LJY A;  3KAI A;  3GPK A;  5HW7 A;  3BXW A;  4W9Q A;  1R9H A;  4FAP A;  5HWB A;  2DG3 A;  1PIN A;  2DG4 A;  3WQW A;  2WM0 A;  4IQC A;  3CGN A;  3RGC A;  1ROU A;  1H0G A;  5DIT A;  4MNL A;  2MF9 A;  1JND A;  4L3N A;  4Z2G A;  4FN2 A;  3JYJ A;  3CHC A;  4MPK A;  1Q1C A;  1E6N A;  2RUD A;  2XP4 A;  3ARV A;  5BXJ A;  3KZ7 A;  3PA7 A;  1EHN A;  1GPF A;  2LPV A;  1E6P A;  1HJX A;  1FKI A;  3CH9 A;  1J4I A;  3ARZ A;  1W9P A;  2A3B A;  1KFW A;  4GGQ A;  4Z2H A;  4ODM A;  4DZ2 A;  2AOS A;  3ART A;  1ZU8 A;  4P8U A;  4ODK A;  4Q22 A;  3WKZ A;  1FD9 A;  1UR9 A;  4DRK A;  2MNT A;  3PRD A;  3FXY A;  3WD0 A;  2FAP A;  3UQI A;  3B9E A;  5I98 A;  2KGJ A;  1E15 A;  4XAK A;  2PPN A;  1QPF A;  4W9P A;  1W9U A;  1HKM A;  1NMV A;  1XRV A;  5JH8 A;  1J4R A;  1RD6 A;  4TYO A;  3WIJ A;  1ZK6 A;  4DWS A;  3FAP A;  3ARR A;  1GOI A;  1D7J A;  2WK2 A;  3O5K A;  3B9D A;  1LG2 A;  4DWS C;  1Y0O A;  1W1T A;  3O5J A;  2UZ5 A;  2L2S A;  3IK8 A;  4HBE A;  1HKJ A;  3FY1 A;  3CHF A;  4P8X A;  4MNK A;  1FKF A;  4U85 A;  1D7I A;  1ZBK A;  4DWS B;  3CHD A;  1LG1 A;  3ARO A;  5DEZ A;  2DSV A;  2DT1 A;  2OLH A;  3O5G A;  4WK9 A;  4QZV B;  2KO7 A;  2G8Z A;  4DRJ A;  4NSB A;  2KR7 A;  2FKE A;  4WKF A;  1KT1 A;  4NZC A;  4C02 B;  3ALG A;  4TW8 A;  3AQU A;  3KAG A;  1NH6 A;  3B8S A;  3ARX A;  1ZBC A;  3G6M A;  2DT0 A;  1Q6I A;  1TCO C;  4NNR A;  2ZQU A;  5HUA A;  4LGX A;  3WD2 A;  1FKD A;  2XP7 A;  2Y78 A;  2YBU A;  3VAW A;  1HJV A;  3KAF A;  4DH0 A;  4ML4 A;  5HW8 A;  1NWS A;  5HKG A;  1Q6U A;  1E6R A;  4JFI A;  4Q7N A;  1HKK A;  4WKA A;  3UI4 A;  3UQA A;  4O2T A;  3G6L A;  1CTN A;  1W1V A;  4MNJ A;  4MSP A;  1TFV A;  2ZQT A;  3CZ8 A;  1D2K A;  2A3A A;  3ARP A;  2YBT A;  3KAD A;  1SYT A;  2M1I A;  2ZR5 A;  3H9R B;  3O5I A;  3PR9 A;  4ODP A;  1C9H A;  3IHZ A;  2XP8 A;  4L72 B;  4DRH A;  2F2D A;  1JVW A;  5HWC A;  2FDM A;  2ITK A;  3RME A;  5DO2 A;  4Z2J A;  3TDB A;  1NWT A;  4ZS6 A;  4QIB A;  3JXV A;  2KE0 A;  1HKI A;  1YAT A;  1ZCN A;  1FKJ A;  2XP9 A;  3JYM A;  3ODK A;  4MGV A;  4DRM A;  4ITZ A;  4TW7 A;  3TC5 A;  2B31 A;  1H0I A;  3O5L A;  3W4R A;  2XP6 A;  1W1P A;  1X6N A;  1JNS A;  1HXV A;  1F8A B;  1F40 A;  3AS1 A;  1EYM A;  4JFJ A;  1FFR A;  4ODO A;  4LAY A;  2PPO A;  3OOB A;  4ZPT R;  1D7H A;  1FKB A;  2RQS A;  1FAP A;  4DIP A;  4IPX A;  4JFL A;  1FFQ A;  1UR8 A;  3UQB A;  2XPB A;  4QT3 A;  4BF8 A;  5GPR A;  3UI6 A;  2PI6 A;  3O5O A;  1LL4 A;  3O5P A;  2WLY A;  2RUQ A;  3WD1 A;  5DF0 A;  3CHE A;  1OWQ A;  1VF8 A;  3ARU A;  4DRP A;  1FKT A;  1L1P A;  1NSG A;  5DIU A;  1JNT A;  1BKF A;  2A3C A;  1JNE A;  1A7X A;  1J4H A;  1FKL A;  2F4E A;  3O5E A;  1P5Q A;  2DSU A;  2DSZ A;  1EDQ A;  3WH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...