5DIUA

The fk1 domain of fkbp51 in complex with the new synthetic ligand 2-(3-((r)-1-((s)-1-((s)-2-cyclohexyl-2-(3,4,5-trimethoxyphenyl)acetyl)piperidine-2-carboxamido)-3-(3,4-dimethoxyphenyl)propyl)phenoxy)acetic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rapid, Structure-Based Exploration of Pipecolic Acid Amides as Novel Selective Antagonists of the FK506-Binding Protein 51.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5diuA00
3TCZA 5B8IC 3KCEA 1FKRA 5HTGA 4G50A 2XPAA 2AWGA 2LGOA 3O5OA 4FN2A 4MGVA 1D7JA 4O2TA 4QT3A 4DH0A 4W9PA 2MNTA 2DG4A 1Q6HA 2PPNA 1FKDA 2PPOA 3RGCA 1FKLA 1N1AA 1M5YA 2LJ4A 1ROTA 2XP8A 4GGQA 4JFLA 4U84A 1KT1A 3NRKA 1D6OA 2JZVA 3EY6A 5HW7A 2ZQUA 1J4IA 4TNSA 1FJDA 2MLXA 4R0XA 3B7XA 5HW6A 5HW8A 3JYJA 1FKFA 1FD9A 4BF8A 1PBKA 4G2PA 3UF8A 2PV1A 4ODLA 1J4HA 2MF9A 4DROA 4LAXA 1EYMA 1Q1CA 1Y0OA 2ZQTA 3IKDA 4GIVA 4JFIA 3PRDA 4DIPA 2DG3A 1EQ3A 2RUQA 2M1IA 2RSEA 1BL4A 1QPLA 2IF4A 4ITZA 2LKNA 1JNTA 2UZ5A 2XPBA 4W9OA 1JNSA 5HWCA 2F21A 1BKFA 1ZCNA 5HWBA 2N87A 5I98A 1ZK6A 3KAHA 1FAPA 4TYOA 4U85A 1JVWA 5DIUA 2Q5AA 2XP9A 2VN1A 2MLYA 2ZQVA 3TC5A 2K8IA 1C9HA 2MLZA 1D7HA 3FAPA 3NI6A 3OOBA 4IQ2A 2LPVA 4TX0A 4DZ2A 4TW7A 4LAVA 1FKKA 2KR7A 1W26A 2Y78A 5HKGA 3O5FA 3O5MA 4MSPA 3IK8A 3WH0A 3ODKA 4N19A 3KABA 1YATA 2ZR5A 3O5IA 4JFMA 4DRJA 4LAWA 1FKSA 2ZQSA 1TCOC 3O5DA 3O5GA 5D75A 1YW5A 4DRNA 3CGMA 2D9FA 4DRKA 2VCDA 3PRBA 3IKGA 3JXVA 4TW6A 3O5QA 4U86A 3UI6A 1Q6IA 2DG9A 2RUCA 3VAWA 3JYMA 5GPGA 4IPXA 1F8AB 2XP7A 5HT1A 4DZ3A 1ROUA 1U79A 4JFKA 1J6YA 2F2DA 2KGJA 1FKIA 3LUOA 4DRIA 4DT4A 3NTPA 3KAGA 2XP5A 2ZR6A 1F40A 5DITA 2KI3A 4FAPA 1FKJA 4ODRA 4IQCA 1D7IA 2ITKA 2OFNA 4DRQA 3UQBA 2PV3A 3O5JA 1FKGA 2MPHA 4JFJA 3RFWA 1B6CA 2FAPA 4DRMA 3UI5A 1NMWA 1R9HA 2PPPA 3CGNA 1QZ2A 3TDBA 4LAYA 1T11A 1QPFA 3KZ7A 2KFWA 2RURA 4TW8A 1P5QA 3IHZA 2XP6A 4J4NA 4ODNA 4C02B 1FKTA 2ZR4A 3MDYB 3O5EA 3GPKA 4JYSA 2L2SA 3O5LA 1FKHA 4QT2A 2PV2A 4ODOA 5J6EA 1HXVA 5DIVA 3UQIA 2RUDA 4QIBA 2KE0A 3UQAA 1KT0A 3O5PA 4W9QA 2M08A 2KO7A 2XP4A 2F4EA 3H9RB 4NNRA 1FKBA 4ODQA 1Q6UA 2M2AA 4DRPA 3KAIA 2PBCA 1NSGA 5BXJA 3PA7A 2RQSA 3O5KA 1L1PA 1A7XA 4J4OA 3I6CA 3UI4A 4ODKA 4DRHA 2XP3A 3KACA 1J4RA 3KADA 3O5RA 4ODMA 1PINA 3KAFA 4ODPA 1NMVA 5HUAA 2FKEA
chains in the Genus database with same CATH superfamily
3TCZA 1ZBVA 2DT1A 1LL7A 3CHFA 2AWGA 2LGOA 2B5UB 4FN2A 4MGVA 4O2TA 4W5UA 4Z2GA 1HKIA 4Q22A 3AS2A 2PPNA 5GQBA 4U84A 2LJ4A 1TFVA 1ROTA 4ZPVR 1D6OA 5HW7A 3ARWA 4IT6A 1W1VA 1FFQA 1E6ZA 4Z2JA 2MF9A 1LL6A 1HJVA 1NWTA 1Y0OA 2ZQTA 3GTYX 3IKDA 3PRDA 3ARZA 4DIPA 2DG3A 2RUQA 2WLYA 5DO2A 2M1IA 3OA5A 1BKFA 5HWBA 1ZK6A 1FAPA 1JVWA 4Z2HA 2ZQVA 2K8IA 3OOBA 4DZ2A 4DWSB 4TW7A 1GRJA 3ODKA 3QOKA 2ZQSA 3O5GA 2D9FA 2VCDA 3IKGA 4TW6A 1O6IA 4IPXA 1W9VA 1OWQA 1ROUA 3PRAA 1U79A 2F2DA 2KGJA 4DRIA 3KAGA 2XP5A 3RM9A 2YBUA 1NWUA 5DITA 4MAVA 1FKJA 1WNOA 4ODRA 2WLZA 4IQCA 2ITKA 1FKGA 2MPHA 2OLHA 5JH8A 1NMWA 3AS0A 2A3AA 2RURA 2DT2A 1E15A 4S3KA 1OGBA 2PV2A 4ODOA 4MNMA 3ARXA 4W9QA 3H9RB 4MPKA 2QF8A 1Q6UA 4ZPWR 1E9LA 3AS3A 5BXJA 1L1PA 3WD2A 1A7XA 4ODKA 4DRHA 3WD3A 4URIA 4WIWA 3O5RA 4DWSC 3W4RA 2DT3A 4L72B 3O5OA 1LG1A 2P4VA 4DH0A 2MNTA 1Q6HA 1X6NA 2AOSA 1FKLA 3G6MA 4GGQA 2JZVA 3EY6A 3PR9A 2ZQUA 1J4IA 1LG2A 3JYJA 4BF8A 1HJWA 1SR0A 3UF8A 4ODLA 1J4HA 4DROA 1Q1CA 4GIVA 4Z2IA 2YBTA 1BL4A 4ITZA 2XPBA 2WK2A 5DF0A 4MNJA 2F21A 2A3BA 3KAHA 4TYOA 4PTMA 2XP9A 5GPRA 2MLYA 3ALGA 4IQ2A 4TX0A 4MNLA 1FKKA 3GU0A 4KR0B 4MSPA 3WQVA 3KABA 1HKMA 1ZB5A 2F23A 1TCOC 1ZBKA 1E44A 5D75A 3CGMA 3B9AA 2G41A 4WK9A 3WD1A 4ML4A 3UI6A 1UR8A 2RUCA 4HBOA 1JNEA 3ARYA 1F8AB 1W1TA 2DSZA 3CHCA 3LUOA 3NTPA 4P8UA 4NZCA 2ZR6A 4HARA 1FFRA 1EHNA 4DWSD 2PV3A 3ARPA 3O5JA 4JFJA 1B6CA 4DRMA 2IUZA 1EIBA 1QZ2A 4LAYA 1T11A 2O9OA 1HKJA 1P5QA 3IHZA 4J4NA 4ODNA 3WIJA 3O5EA 4HBEA 2O92A 4QT2A 1SYTA 4Z2KA 3UQIA 1OGGA 1EDQA 1ZL1A 2KO7A 2XP4A 2F4EA 3ARRA 4ODQA 2M2AA 4NSBA 4DRPA 2B31A 3KAIA 5HBFA 1NWSA 1ZU8A 4J4OA 1GPFA 2XP3A 2G8ZA 4Q7NA 4ODMA 1FKRA 3KCEA 3RM4A 1D7JA 3WL1A 1WAWA 4W9PA 1LQ0A 1FKDA 2PPOA 3RGCA 4WKFA 1N1AA 1XHGA 3NRKA 4XAKA 1FJDA 2MLXA 4P8VA 4R0XA 5HW6A 1FD9A 1PBKA 4G2PA 1LL4A 3B9DA 1EYMA 2WM0A 1EQ3A 2RSEA 1QPLA 4W9OA 1JNSA 1UR9A 2LKNA 1JNTA 5HWCA 1ZCNA 3ARVA 4WKHA 2EULA 4U85A 5DIUA 2Q5AA 2VN1A 3WD0A 3TC5A 1K9TA 1C9HA 3FAPA 1ZBCA 2LPVA 3AS1A 2KR7A 3O5FA 2DT0A 4JFMA 1YATA 2ZR5A 3O5IA 4DRJA 3G6LA 1FKSA 3O5DA 3ARTA 4AY1A 2A3EA 1D2KA 3PRBA 3JXVA 2XP7A 4DZ3A 1E6NA 4JFKA 4IT4A 2ESCA 1JCHB 3B9EA 1NH6A 3WKZA 1H0IA 4FAPA 2DSUA 1F40A 2OFNA 4DRQA 4ZS6A 3CHEA 1R9HA 3CGNA 3WL0A 3TDBA 4S3JA 1JNDA 4TW8A 3BXWA 1FKTA 2ZR4A 3MDYB 4JYSA 1FKHA 1W1YA 1LJYA 5DIVA 2RUDA 2KE0A 3ARQA 1KT0A 3O5PA 3FY1A 4KQZA 2RQSA 3O5KA 2PI6A 4QZVB 1WB0A 3KACA 3KADA 1PINA 5HT1A 4ODPA 1W9UA 1NMVA 5HKGA 2FKEA 4WJXA 5HUAA 5B8IC 5HTGA 2DSWA 4G50A 2XPAA 4Z2LA 4QT3A 3RM8A 4DWSA 2DG4A 1IX5A 4JFLA 1M5YA 2XP8A 1GUVA 1KT1A 3CHDA 4TNSA 4ZPTR 5HW8A 3B7XA 1FKFA 3ARUA 2PV1A 4LAXA 3AQUA 4R5EA 4JFIA 2DSVA 2A3CA 4MNKA 2IF4A 4MTVA 2UZ5A 5I98A 2N87A 1W9PA 2ETNA 1E6RA 1CTNA 2MLZA 1D7HA 3NI6A 5DEZA 4LAVA 1W26A 2Y78A 3O5MA 3IK8A 3WH0A 4N19A 1E6PA 1KFWA 4LAWA 4L3NA 1YW5A 4DRNA 4DRKA 4UDMA 3WQWA 4U86A 3O5QA 1Q6IA 2DG9A 3VAWA 3JYMA 4P8WA 5GPGA 2DPEA 3AROA 1J6YA 1VF8A 1H0GA 1FKIA 4DT4A 3BMBA 2KI3A 1D7IA 1X6LA 3UQBA 3RFWA 1ZBWA 2FAPA 3UI5A 2PPPA 4LGXA 3KZ7A 1QPFA 2KFWA 1NWRA 2XP6A 4C02B 4WKAA 1HKKA 1W1PA 3GPKA 2L2SA 3CH9A 3O5LA 1ITXA 3RMEA 1XRVA 3WD4A 1HXVA 5J6EA 1HJXA 4QIBA 3UQAA 3ALFA 1RD6A 2M08A 4NNRA 1FKBA 2PN0A 2PBCA 1GOIA 4P8XA 1NSGA 3PA7A 3EIPA 3FXYA 3I6CA 2FDMA 3UI4A 3ARSA 1J4RA 3KAFA 3B8SA 3CZ8A
chains in the Genus database with same CATH topology
3TCZA 1ZBVA 2DT1A 1LL7A 3CHFA 2AWGA 2LGOA 4FN2A 4MGVA 4O2TA 4W5UA 4Z2GA 1HKIA 4Q22A 3AS2A 2PPNA 5GQBA 4U84A 2LJ4A 1TFVA 1ROTA 4ZPVR 1D6OA 5HW7A 3ARWA 4IT6A 1W1VA 1FFQA 1E6ZA 4Z2JA 2MF9A 1LL6A 1HJVA 1NWTA 1Y0OA 2ZQTA 3IKDA 3PRDA 3ARZA 4DIPA 2DG3A 2RUQA 2WLYA 5DO2A 2M1IA 3OA5A 1BKFA 5HWBA 1ZK6A 1FAPA 1JVWA 4Z2HA 2ZQVA 2K8IA 3OOBA 4DZ2A 4DWSB 4TW7A 3ODKA 3QOKA 2ZQSA 3O5GA 2D9FA 2VCDA 3IKGA 4TW6A 1O6IA 4IPXA 1W9VA 1OWQA 1ROUA 3PRAA 1U79A 2F2DA 2KGJA 4DRIA 3KAGA 2XP5A 3RM9A 2YBUA 1NWUA 5DITA 4MAVA 1FKJA 1WNOA 4ODRA 2WLZA 4IQCA 2ITKA 1FKGA 2MPHA 2OLHA 5JH8A 1NMWA 3AS0A 2A3AA 2RURA 2DT2A 1E15A 4S3KA 1OGBA 2PV2A 4ODOA 4MNMA 3ARXA 4W9QA 3H9RB 4MPKA 2QF8A 1Q6UA 4ZPWR 1E9LA 3AS3A 5BXJA 1L1PA 3WD2A 1A7XA 4ODKA 4DRHA 3WD3A 4URIA 4WIWA 3O5RA 4DWSC 3W4RA 2DT3A 4L72B 3O5OA 1LG1A 4DH0A 2MNTA 1Q6HA 1X6NA 2AOSA 1FKLA 3G6MA 4GGQA 2JZVA 3EY6A 3PR9A 2ZQUA 1J4IA 1LG2A 3JYJA 4BF8A 1HJWA 1SR0A 3UF8A 4ODLA 1J4HA 4DROA 1Q1CA 4GIVA 4Z2IA 2YBTA 1BL4A 4ITZA 2XPBA 2WK2A 5DF0A 4MNJA 2F21A 2A3BA 3KAHA 4TYOA 4PTMA 2XP9A 5GPRA 2MLYA 3ALGA 4IQ2A 4TX0A 4MNLA 1FKKA 4KR0B 4MSPA 3WQVA 3KABA 1HKMA 1ZB5A 1TCOC 1ZBKA 5D75A 3CGMA 3B9AA 2G41A 4WK9A 3WD1A 4ML4A 3UI6A 1UR8A 2RUCA 4HBOA 1JNEA 3ARYA 1F8AB 1W1TA 2DSZA 3CHCA 3LUOA 3NTPA 4P8UA 4NZCA 2ZR6A 4HARA 1FFRA 1EHNA 4DWSD 2PV3A 3ARPA 3O5JA 4JFJA 1B6CA 4DRMA 2IUZA 1EIBA 1QZ2A 4LAYA 1T11A 2O9OA 1HKJA 1P5QA 3IHZA 4J4NA 4ODNA 3WIJA 3O5EA 4HBEA 2O92A 4QT2A 1SYTA 4Z2KA 3UQIA 1OGGA 1EDQA 1ZL1A 2KO7A 2XP4A 2F4EA 3ARRA 4ODQA 2M2AA 4NSBA 4DRPA 2B31A 3KAIA 5HBFA 1NWSA 1ZU8A 4J4OA 1GPFA 2XP3A 2G8ZA 4Q7NA 4ODMA 1FKRA 3KCEA 3RM4A 1D7JA 3WL1A 1WAWA 4W9PA 1LQ0A 1FKDA 2PPOA 3RGCA 4WKFA 1N1AA 1XHGA 3NRKA 4XAKA 1FJDA 2MLXA 4P8VA 4R0XA 5HW6A 1FD9A 1PBKA 4G2PA 1LL4A 3B9DA 1EYMA 2WM0A 1EQ3A 2RSEA 1QPLA 4W9OA 1JNSA 1UR9A 2LKNA 1JNTA 5HWCA 1ZCNA 3ARVA 4WKHA 4U85A 5DIUA 2Q5AA 2VN1A 3WD0A 3TC5A 1K9TA 1C9HA 3FAPA 1ZBCA 2LPVA 3AS1A 2KR7A 3O5FA 2DT0A 4JFMA 1YATA 2ZR5A 3O5IA 4DRJA 3G6LA 1FKSA 3O5DA 3ARTA 4AY1A 2A3EA 1D2KA 3PRBA 3JXVA 2XP7A 4DZ3A 1E6NA 4JFKA 4IT4A 2ESCA 3B9EA 1NH6A 3WKZA 1H0IA 4FAPA 2DSUA 1F40A 2OFNA 4DRQA 4ZS6A 3CHEA 1R9HA 3CGNA 3WL0A 3TDBA 4S3JA 1JNDA 4TW8A 3BXWA 1FKTA 2ZR4A 3MDYB 4JYSA 1FKHA 1W1YA 1LJYA 5DIVA 2RUDA 2KE0A 3ARQA 1KT0A 3O5PA 3FY1A 4KQZA 2RQSA 3O5KA 2PI6A 4QZVB 1WB0A 3KACA 3KADA 1PINA 5HT1A 4ODPA 1W9UA 1NMVA 5HKGA 2FKEA 4WJXA 5HUAA 5B8IC 5HTGA 2DSWA 4G50A 2XPAA 4Z2LA 4QT3A 3RM8A 4DWSA 2DG4A 1IX5A 4JFLA 1M5YA 2XP8A 1GUVA 1KT1A 3CHDA 4TNSA 4ZPTR 5HW8A 3B7XA 1FKFA 3ARUA 2PV1A 4LAXA 3AQUA 4R5EA 4JFIA 2DSVA 2A3CA 4MNKA 2IF4A 4MTVA 2UZ5A 5I98A 2N87A 1W9PA 1E6RA 1CTNA 2MLZA 1D7HA 3NI6A 5DEZA 4LAVA 1W26A 2Y78A 3O5MA 3IK8A 3WH0A 4N19A 1E6PA 1KFWA 4LAWA 4L3NA 1YW5A 4DRNA 4DRKA 3WQWA 4U86A 3O5QA 1Q6IA 2DG9A 3VAWA 3JYMA 4P8WA 5GPGA 2DPEA 3AROA 1J6YA 1VF8A 1H0GA 1FKIA 4DT4A 2KI3A 1D7IA 1X6LA 3UQBA 3RFWA 1ZBWA 2FAPA 3UI5A 2PPPA 4LGXA 3KZ7A 1QPFA 2KFWA 1NWRA 2XP6A 4C02B 4WKAA 1HKKA 1W1PA 3GPKA 2L2SA 3CH9A 3O5LA 1ITXA 3RMEA 1XRVA 3WD4A 1HXVA 5J6EA 1HJXA 4QIBA 3UQAA 3ALFA 1RD6A 2M08A 4NNRA 1FKBA 4P8XA 2PBCA 1GOIA 1NSGA 3PA7A 3FXYA 3I6CA 2FDMA 3UI4A 3ARSA 1J4RA 3KAFA 3B8SA 3CZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCZ A;  5B8I C;  3KCE A;  1FKR A;  5HTG A;  4G50 A;  2XPA A;  2AWG A;  2LGO A;  3O5O A;  4FN2 A;  4MGV A;  1D7J A;  4O2T A;  4QT3 A;  4DH0 A;  4W9P A;  2MNT A;  2DG4 A;  1Q6H A;  2PPN A;  1FKD A;  2PPO A;  3RGC A;  1FKL A;  1N1A A;  1M5Y A;  2LJ4 A;  1ROT A;  2XP8 A;  4GGQ A;  4JFL A;  4U84 A;  1KT1 A;  3NRK A;  1D6O A;  2JZV A;  3EY6 A;  5HW7 A;  2ZQU A;  1J4I A;  4TNS A;  1FJD A;  2MLX A;  4R0X A;  3B7X A;  5HW6 A;  5HW8 A;  3JYJ A;  1FKF A;  1FD9 A;  4BF8 A;  1PBK A;  4G2P A;  3UF8 A;  2PV1 A;  4ODL A;  1J4H A;  2MF9 A;  4DRO A;  4LAX A;  1EYM A;  1Q1C A;  1Y0O A;  2ZQT A;  3IKD A;  4GIV A;  4JFI A;  3PRD A;  4DIP A;  2DG3 A;  1EQ3 A;  2RUQ A;  2M1I A;  2RSE A;  1BL4 A;  1QPL A;  2IF4 A;  4ITZ A;  2LKN A;  1JNT A;  2UZ5 A;  2XPB A;  4W9O A;  1JNS A;  5HWC A;  2F21 A;  1BKF A;  1ZCN A;  5HWB A;  2N87 A;  5I98 A;  1ZK6 A;  3KAH A;  1FAP A;  4TYO A;  4U85 A;  1JVW A;  5DIU A;  2Q5A A;  2XP9 A;  2VN1 A;  2MLY A;  2ZQV A;  3TC5 A;  2K8I A;  1C9H A;  2MLZ A;  1D7H A;  3FAP A;  3NI6 A;  3OOB A;  4IQ2 A;  2LPV A;  4TX0 A;  4DZ2 A;  4TW7 A;  4LAV A;  1FKK A;  2KR7 A;  1W26 A;  2Y78 A;  5HKG A;  3O5F A;  3O5M A;  4MSP A;  3IK8 A;  3WH0 A;  3ODK A;  4N19 A;  3KAB A;  1YAT A;  2ZR5 A;  3O5I A;  4JFM A;  4DRJ A;  4LAW A;  1FKS A;  2ZQS A;  1TCO C;  3O5D A;  3O5G A;  5D75 A;  1YW5 A;  4DRN A;  3CGM A;  2D9F A;  4DRK A;  2VCD A;  3PRB A;  3IKG A;  3JXV A;  4TW6 A;  3O5Q A;  4U86 A;  3UI6 A;  1Q6I A;  2DG9 A;  2RUC A;  3VAW A;  3JYM A;  5GPG A;  4IPX A;  1F8A B;  2XP7 A;  5HT1 A;  4DZ3 A;  1ROU A;  1U79 A;  4JFK A;  1J6Y A;  2F2D A;  2KGJ A;  1FKI A;  3LUO A;  4DRI A;  4DT4 A;  3NTP A;  3KAG A;  2XP5 A;  2ZR6 A;  1F40 A;  5DIT A;  2KI3 A;  4FAP A;  1FKJ A;  4ODR A;  4IQC A;  1D7I A;  2ITK A;  2OFN A;  4DRQ A;  3UQB A;  2PV3 A;  3O5J A;  1FKG A;  2MPH A;  4JFJ A;  3RFW A;  1B6C A;  2FAP A;  4DRM A;  3UI5 A;  1NMW A;  1R9H A;  2PPP A;  3CGN A;  1QZ2 A;  3TDB A;  4LAY A;  1T11 A;  1QPF A;  3KZ7 A;  2KFW A;  2RUR A;  4TW8 A;  1P5Q A;  3IHZ A;  2XP6 A;  4J4N A;  4ODN A;  4C02 B;  1FKT A;  2ZR4 A;  3MDY B;  3O5E A;  3GPK A;  4JYS A;  2L2S A;  3O5L A;  1FKH A;  4QT2 A;  2PV2 A;  4ODO A;  5J6E A;  1HXV A;  5DIV A;  3UQI A;  2RUD A;  4QIB A;  2KE0 A;  3UQA A;  1KT0 A;  3O5P A;  4W9Q A;  2M08 A;  2KO7 A;  2XP4 A;  2F4E A;  3H9R B;  4NNR A;  1FKB A;  4ODQ A;  1Q6U A;  2M2A A;  4DRP A;  3KAI A;  2PBC A;  1NSG A;  5BXJ A;  3PA7 A;  2RQS A;  3O5K A;  1L1P A;  1A7X A;  4J4O A;  3I6C A;  3UI4 A;  4ODK A;  4DRH A;  2XP3 A;  3KAC A;  1J4R A;  3KAD A;  3O5R A;  4ODM A;  1PIN A;  3KAF A;  4ODP A;  1NMV A;  5HUA A;  2FKE A; 
#chains in the Genus database with same CATH topology
 3TCZ A;  1ZBV A;  2DT1 A;  1LL7 A;  3CHF A;  2AWG A;  2LGO A;  2B5U B;  4FN2 A;  4MGV A;  4O2T A;  4W5U A;  4Z2G A;  1HKI A;  4Q22 A;  3AS2 A;  2PPN A;  5GQB A;  4U84 A;  2LJ4 A;  1TFV A;  1ROT A;  4ZPV R;  1D6O A;  5HW7 A;  3ARW A;  4IT6 A;  1W1V A;  1FFQ A;  1E6Z A;  4Z2J A;  2MF9 A;  1LL6 A;  1HJV A;  1NWT A;  1Y0O A;  2ZQT A;  3GTY X;  3IKD A;  3PRD A;  3ARZ A;  4DIP A;  2DG3 A;  2RUQ A;  2WLY A;  5DO2 A;  2M1I A;  3OA5 A;  1BKF A;  5HWB A;  1ZK6 A;  1FAP A;  1JVW A;  4Z2H A;  2ZQV A;  2K8I A;  3OOB A;  4DZ2 A;  4DWS B;  4TW7 A;  1GRJ A;  3ODK A;  3QOK A;  2ZQS A;  3O5G A;  2D9F A;  2VCD A;  3IKG A;  4TW6 A;  1O6I A;  4IPX A;  1W9V A;  1OWQ A;  1ROU A;  3PRA A;  1U79 A;  2F2D A;  2KGJ A;  4DRI A;  3KAG A;  2XP5 A;  3RM9 A;  2YBU A;  1NWU A;  5DIT A;  4MAV A;  1FKJ A;  1WNO A;  4ODR A;  2WLZ A;  4IQC A;  2ITK A;  1FKG A;  2MPH A;  2OLH A;  5JH8 A;  1NMW A;  3AS0 A;  2A3A A;  2RUR A;  2DT2 A;  1E15 A;  4S3K A;  1OGB A;  2PV2 A;  4ODO A;  4MNM A;  3ARX A;  4W9Q A;  3H9R B;  4MPK A;  2QF8 A;  1Q6U A;  4ZPW R;  1E9L A;  3AS3 A;  5BXJ A;  1L1P A;  3WD2 A;  1A7X A;  4ODK A;  4DRH A;  3WD3 A;  4URI A;  4WIW A;  3O5R A;  4DWS C;  3W4R A;  2DT3 A;  4L72 B;  3O5O A;  1LG1 A;  2P4V A;  4DH0 A;  2MNT A;  1Q6H A;  1X6N A;  2AOS A;  1FKL A;  3G6M A;  4GGQ A;  2JZV A;  3EY6 A;  3PR9 A;  2ZQU A;  1J4I A;  1LG2 A;  3JYJ A;  4BF8 A;  1HJW A;  1SR0 A;  3UF8 A;  4ODL A;  1J4H A;  4DRO A;  1Q1C A;  4GIV A;  4Z2I A;  2YBT A;  1BL4 A;  4ITZ A;  2XPB A;  2WK2 A;  5DF0 A;  4MNJ A;  2F21 A;  2A3B A;  3KAH A;  4TYO A;  4PTM A;  2XP9 A;  5GPR A;  2MLY A;  3ALG A;  4IQ2 A;  4TX0 A;  4MNL A;  1FKK A;  3GU0 A;  4KR0 B;  4MSP A;  3WQV A;  3KAB A;  1HKM A;  1ZB5 A;  2F23 A;  1TCO C;  1ZBK A;  1E44 A;  5D75 A;  3CGM A;  3B9A A;  2G41 A;  4WK9 A;  3WD1 A;  4ML4 A;  3UI6 A;  1UR8 A;  2RUC A;  4HBO A;  1JNE A;  3ARY A;  1F8A B;  1W1T A;  2DSZ A;  3CHC A;  3LUO A;  3NTP A;  4P8U A;  4NZC A;  2ZR6 A;  4HAR A;  1FFR A;  1EHN A;  4DWS D;  2PV3 A;  3ARP A;  3O5J A;  4JFJ A;  1B6C A;  4DRM A;  2IUZ A;  1EIB A;  1QZ2 A;  4LAY A;  1T11 A;  2O9O A;  1HKJ A;  1P5Q A;  3IHZ A;  4J4N A;  4ODN A;  3WIJ A;  3O5E A;  4HBE A;  2O92 A;  4QT2 A;  1SYT A;  4Z2K A;  3UQI A;  1OGG A;  1EDQ A;  1ZL1 A;  2KO7 A;  2XP4 A;  2F4E A;  3ARR A;  4ODQ A;  2M2A A;  4NSB A;  4DRP A;  2B31 A;  3KAI A;  5HBF A;  1NWS A;  1ZU8 A;  4J4O A;  1GPF A;  2XP3 A;  2G8Z A;  4Q7N A;  4ODM A;  1FKR A;  3KCE A;  3RM4 A;  1D7J A;  3WL1 A;  1WAW A;  4W9P A;  1LQ0 A;  1FKD A;  2PPO A;  3RGC A;  4WKF A;  1N1A A;  1XHG A;  3NRK A;  4XAK A;  1FJD A;  2MLX A;  4P8V A;  4R0X A;  5HW6 A;  1FD9 A;  1PBK A;  4G2P A;  1LL4 A;  3B9D A;  1EYM A;  2WM0 A;  1EQ3 A;  2RSE A;  1QPL A;  4W9O A;  1JNS A;  1UR9 A;  2LKN A;  1JNT A;  5HWC A;  1ZCN A;  3ARV A;  4WKH A;  2EUL A;  4U85 A;  5DIU A;  2Q5A A;  2VN1 A;  3WD0 A;  3TC5 A;  1K9T A;  1C9H A;  3FAP A;  1ZBC A;  2LPV A;  3AS1 A;  2KR7 A;  3O5F A;  2DT0 A;  4JFM A;  1YAT A;  2ZR5 A;  3O5I A;  4DRJ A;  3G6L A;  1FKS A;  3O5D A;  3ART A;  4AY1 A;  2A3E A;  1D2K A;  3PRB A;  3JXV A;  2XP7 A;  4DZ3 A;  1E6N A;  4JFK A;  4IT4 A;  2ESC A;  1JCH B;  3B9E A;  1NH6 A;  3WKZ A;  1H0I A;  4FAP A;  2DSU A;  1F40 A;  2OFN A;  4DRQ A;  4ZS6 A;  3CHE A;  1R9H A;  3CGN A;  3WL0 A;  3TDB A;  4S3J A;  1JND A;  4TW8 A;  3BXW A;  1FKT A;  2ZR4 A;  3MDY B;  4JYS A;  1FKH A;  1W1Y A;  1LJY A;  5DIV A;  2RUD A;  2KE0 A;  3ARQ A;  1KT0 A;  3O5P A;  3FY1 A;  4KQZ A;  2RQS A;  3O5K A;  2PI6 A;  4QZV B;  1WB0 A;  3KAC A;  3KAD A;  1PIN A;  5HT1 A;  4ODP A;  1W9U A;  1NMV A;  5HKG A;  2FKE A;  4WJX A;  5HUA A;  5B8I C;  5HTG A;  2DSW A;  4G50 A;  2XPA A;  4Z2L A;  4QT3 A;  3RM8 A;  4DWS A;  2DG4 A;  1IX5 A;  4JFL A;  1M5Y A;  2XP8 A;  1GUV A;  1KT1 A;  3CHD A;  4TNS A;  4ZPT R;  5HW8 A;  3B7X A;  1FKF A;  3ARU A;  2PV1 A;  4LAX A;  3AQU A;  4R5E A;  4JFI A;  2DSV A;  2A3C A;  4MNK A;  2IF4 A;  4MTV A;  2UZ5 A;  5I98 A;  2N87 A;  1W9P A;  2ETN A;  1E6R A;  1CTN A;  2MLZ A;  1D7H A;  3NI6 A;  5DEZ A;  4LAV A;  1W26 A;  2Y78 A;  3O5M A;  3IK8 A;  3WH0 A;  4N19 A;  1E6P A;  1KFW A;  4LAW A;  4L3N A;  1YW5 A;  4DRN A;  4DRK A;  4UDM A;  3WQW A;  4U86 A;  3O5Q A;  1Q6I A;  2DG9 A;  3VAW A;  3JYM A;  4P8W A;  5GPG A;  2DPE A;  3ARO A;  1J6Y A;  1VF8 A;  1H0G A;  1FKI A;  4DT4 A;  3BMB A;  2KI3 A;  1D7I A;  1X6L A;  3UQB A;  3RFW A;  1ZBW A;  2FAP A;  3UI5 A;  2PPP A;  4LGX A;  3KZ7 A;  1QPF A;  2KFW A;  1NWR A;  2XP6 A;  4C02 B;  4WKA A;  1HKK A;  1W1P A;  3GPK A;  2L2S A;  3CH9 A;  3O5L A;  1ITX A;  3RME A;  1XRV A;  3WD4 A;  1HXV A;  5J6E A;  1HJX A;  4QIB A;  3UQA A;  3ALF A;  1RD6 A;  2M08 A;  4NNR A;  1FKB A;  2PN0 A;  2PBC A;  1GOI A;  4P8X A;  1NSG A;  3PA7 A;  3EIP A;  3FXY A;  3I6C A;  2FDM A;  3UI4 A;  3ARS A;  1J4R A;  3KAF A;  3B8S A;  3CZ8 A; 
#chains in the Genus database with same CATH homology
 3TCZ A;  1ZBV A;  2DT1 A;  1LL7 A;  3CHF A;  2AWG A;  2LGO A;  4FN2 A;  4MGV A;  4O2T A;  4W5U A;  4Z2G A;  1HKI A;  4Q22 A;  3AS2 A;  2PPN A;  5GQB A;  4U84 A;  2LJ4 A;  1TFV A;  1ROT A;  4ZPV R;  1D6O A;  5HW7 A;  3ARW A;  4IT6 A;  1W1V A;  1FFQ A;  1E6Z A;  4Z2J A;  2MF9 A;  1LL6 A;  1HJV A;  1NWT A;  1Y0O A;  2ZQT A;  3IKD A;  3PRD A;  3ARZ A;  4DIP A;  2DG3 A;  2RUQ A;  2WLY A;  5DO2 A;  2M1I A;  3OA5 A;  1BKF A;  5HWB A;  1ZK6 A;  1FAP A;  1JVW A;  4Z2H A;  2ZQV A;  2K8I A;  3OOB A;  4DZ2 A;  4DWS B;  4TW7 A;  3ODK A;  3QOK A;  2ZQS A;  3O5G A;  2D9F A;  2VCD A;  3IKG A;  4TW6 A;  1O6I A;  4IPX A;  1W9V A;  1OWQ A;  1ROU A;  3PRA A;  1U79 A;  2F2D A;  2KGJ A;  4DRI A;  3KAG A;  2XP5 A;  3RM9 A;  2YBU A;  1NWU A;  5DIT A;  4MAV A;  1FKJ A;  1WNO A;  4ODR A;  2WLZ A;  4IQC A;  2ITK A;  1FKG A;  2MPH A;  2OLH A;  5JH8 A;  1NMW A;  3AS0 A;  2A3A A;  2RUR A;  2DT2 A;  1E15 A;  4S3K A;  1OGB A;  2PV2 A;  4ODO A;  4MNM A;  3ARX A;  4W9Q A;  3H9R B;  4MPK A;  2QF8 A;  1Q6U A;  4ZPW R;  1E9L A;  3AS3 A;  5BXJ A;  1L1P A;  3WD2 A;  1A7X A;  4ODK A;  4DRH A;  3WD3 A;  4URI A;  4WIW A;  3O5R A;  4DWS C;  3W4R A;  2DT3 A;  4L72 B;  3O5O A;  1LG1 A;  4DH0 A;  2MNT A;  1Q6H A;  1X6N A;  2AOS A;  1FKL A;  3G6M A;  4GGQ A;  2JZV A;  3EY6 A;  3PR9 A;  2ZQU A;  1J4I A;  1LG2 A;  3JYJ A;  4BF8 A;  1HJW A;  1SR0 A;  3UF8 A;  4ODL A;  1J4H A;  4DRO A;  1Q1C A;  4GIV A;  4Z2I A;  2YBT A;  1BL4 A;  4ITZ A;  2XPB A;  2WK2 A;  5DF0 A;  4MNJ A;  2F21 A;  2A3B A;  3KAH A;  4TYO A;  4PTM A;  2XP9 A;  5GPR A;  2MLY A;  3ALG A;  4IQ2 A;  4TX0 A;  4MNL A;  1FKK A;  4KR0 B;  4MSP A;  3WQV A;  3KAB A;  1HKM A;  1ZB5 A;  1TCO C;  1ZBK A;  5D75 A;  3CGM A;  3B9A A;  2G41 A;  4WK9 A;  3WD1 A;  4ML4 A;  3UI6 A;  1UR8 A;  2RUC A;  4HBO A;  1JNE A;  3ARY A;  1F8A B;  1W1T A;  2DSZ A;  3CHC A;  3LUO A;  3NTP A;  4P8U A;  4NZC A;  2ZR6 A;  4HAR A;  1FFR A;  1EHN A;  4DWS D;  2PV3 A;  3ARP A;  3O5J A;  4JFJ A;  1B6C A;  4DRM A;  2IUZ A;  1EIB A;  1QZ2 A;  4LAY A;  1T11 A;  2O9O A;  1HKJ A;  1P5Q A;  3IHZ A;  4J4N A;  4ODN A;  3WIJ A;  3O5E A;  4HBE A;  2O92 A;  4QT2 A;  1SYT A;  4Z2K A;  3UQI A;  1OGG A;  1EDQ A;  1ZL1 A;  2KO7 A;  2XP4 A;  2F4E A;  3ARR A;  4ODQ A;  2M2A A;  4NSB A;  4DRP A;  2B31 A;  3KAI A;  5HBF A;  1NWS A;  1ZU8 A;  4J4O A;  1GPF A;  2XP3 A;  2G8Z A;  4Q7N A;  4ODM A;  1FKR A;  3KCE A;  3RM4 A;  1D7J A;  3WL1 A;  1WAW A;  4W9P A;  1LQ0 A;  1FKD A;  2PPO A;  3RGC A;  4WKF A;  1N1A A;  1XHG A;  3NRK A;  4XAK A;  1FJD A;  2MLX A;  4P8V A;  4R0X A;  5HW6 A;  1FD9 A;  1PBK A;  4G2P A;  1LL4 A;  3B9D A;  1EYM A;  2WM0 A;  1EQ3 A;  2RSE A;  1QPL A;  4W9O A;  1JNS A;  1UR9 A;  2LKN A;  1JNT A;  5HWC A;  1ZCN A;  3ARV A;  4WKH A;  4U85 A;  5DIU A;  2Q5A A;  2VN1 A;  3WD0 A;  3TC5 A;  1K9T A;  1C9H A;  3FAP A;  1ZBC A;  2LPV A;  3AS1 A;  2KR7 A;  3O5F A;  2DT0 A;  4JFM A;  1YAT A;  2ZR5 A;  3O5I A;  4DRJ A;  3G6L A;  1FKS A;  3O5D A;  3ART A;  4AY1 A;  2A3E A;  1D2K A;  3PRB A;  3JXV A;  2XP7 A;  4DZ3 A;  1E6N A;  4JFK A;  4IT4 A;  2ESC A;  3B9E A;  1NH6 A;  3WKZ A;  1H0I A;  4FAP A;  2DSU A;  1F40 A;  2OFN A;  4DRQ A;  4ZS6 A;  3CHE A;  1R9H A;  3CGN A;  3WL0 A;  3TDB A;  4S3J A;  1JND A;  4TW8 A;  3BXW A;  1FKT A;  2ZR4 A;  3MDY B;  4JYS A;  1FKH A;  1W1Y A;  1LJY A;  5DIV A;  2RUD A;  2KE0 A;  3ARQ A;  1KT0 A;  3O5P A;  3FY1 A;  4KQZ A;  2RQS A;  3O5K A;  2PI6 A;  4QZV B;  1WB0 A;  3KAC A;  3KAD A;  1PIN A;  5HT1 A;  4ODP A;  1W9U A;  1NMV A;  5HKG A;  2FKE A;  4WJX A;  5HUA A;  5B8I C;  5HTG A;  2DSW A;  4G50 A;  2XPA A;  4Z2L A;  4QT3 A;  3RM8 A;  4DWS A;  2DG4 A;  1IX5 A;  4JFL A;  1M5Y A;  2XP8 A;  1GUV A;  1KT1 A;  3CHD A;  4TNS A;  4ZPT R;  5HW8 A;  3B7X A;  1FKF A;  3ARU A;  2PV1 A;  4LAX A;  3AQU A;  4R5E A;  4JFI A;  2DSV A;  2A3C A;  4MNK A;  2IF4 A;  4MTV A;  2UZ5 A;  5I98 A;  2N87 A;  1W9P A;  1E6R A;  1CTN A;  2MLZ A;  1D7H A;  3NI6 A;  5DEZ A;  4LAV A;  1W26 A;  2Y78 A;  3O5M A;  3IK8 A;  3WH0 A;  4N19 A;  1E6P A;  1KFW A;  4LAW A;  4L3N A;  1YW5 A;  4DRN A;  4DRK A;  3WQW A;  4U86 A;  3O5Q A;  1Q6I A;  2DG9 A;  3VAW A;  3JYM A;  4P8W A;  5GPG A;  2DPE A;  3ARO A;  1J6Y A;  1VF8 A;  1H0G A;  1FKI A;  4DT4 A;  2KI3 A;  1D7I A;  1X6L A;  3UQB A;  3RFW A;  1ZBW A;  2FAP A;  3UI5 A;  2PPP A;  4LGX A;  3KZ7 A;  1QPF A;  2KFW A;  1NWR A;  2XP6 A;  4C02 B;  4WKA A;  1HKK A;  1W1P A;  3GPK A;  2L2S A;  3CH9 A;  3O5L A;  1ITX A;  3RME A;  1XRV A;  3WD4 A;  1HXV A;  5J6E A;  1HJX A;  4QIB A;  3UQA A;  3ALF A;  1RD6 A;  2M08 A;  4NNR A;  1FKB A;  4P8X A;  2PBC A;  1GOI A;  1NSG A;  3PA7 A;  3FXY A;  3I6C A;  2FDM A;  3UI4 A;  3ARS A;  1J4R A;  3KAF A;  3B8S A;  3CZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...