5DIUA

The fk1 domain of fkbp51 in complex with the new synthetic ligand 2-(3-((r)-1-((s)-1-((s)-2-cyclohexyl-2-(3,4,5-trimethoxyphenyl)acetyl)piperidine-2-carboxamido)-3-(3,4-dimethoxyphenyl)propyl)phenoxy)acetic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rapid, Structure-Based Exploration of Pipecolic Acid Amides as Novel Selective Antagonists of the FK506-Binding Protein 51.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5diuA00
4ODQA 1ZK6A 1W26A 2PV1A 2XP9A 3KCEA 4DRKA 1T11A 3O5IA 1NMVA 3TC5A 5HW7A 4DIPA 5HUAA 5HT1A 2M2AA 2VCDA 4R0XA 4TX0A 3O5EA 1L1PA 1KT1A 5I98A 1BL4A 1FKSA 5HWCA 1FKJA 2KE0A 1NMWA 4U85A 2XP5A 2FKEA 3KAFA 4N19A 5GPGA 1Q6UA 2F2DA 2LPVA 2LKNA 2F4EA 3O5PA 4ODOA 3UI5A 3VAWA 1FKFA 3O5QA 2XP3A 1A7XA 4ODPA 1QPLA 3KAIA 3MDYB 2XPAA 3O5DA 4ODNA 1FKLA 4BF8A 1N1AA 3IK8A 4ODKA 2DG4A 1D7HA 2M08A 2XP7A 5HW6A 2KI3A 3KACA 4W9PA 1JNTA 1FKBA 1J6YA 1FKTA 3NRKA 2ZR5A 1B6CA 1F8AB 2K8IA 4TYOA 4DH0A 4ODLA 3O5MA 2IF4A 1PBKA 2RUCA 3O5KA 4DT4A 1PINA 2ZQSA 2MLXA 3OOBA 3UQBA 4JYSA 1D6OA 2AWGA 4O2TA 3UQAA 3O5RA 3O5GA 4ODMA 1FKHA 3KAHA 3UI6A 2PV2A 4TNSA 4JFMA 1J4HA 3IKGA 3B7XA 2RSEA 3RFWA 2MLZA 1ROTA 1J4RA 1FD9A 1Y0OA 4DRNA 2XP6A 3EY6A 4IPXA 1JNSA 4DROA 3H9RB 2DG9A 1FJDA 2MLYA 2ZQTA 4JFIA 1ZCNA 5D75A 4W9OA 1Q6HA 3IHZA 1D7JA 4DZ2A 3O5JA 4TW7A 4C02B 1FAPA 4LAYA 1Q1CA 3ODKA 2RUDA 3JYJA 3FAPA 4U86A 2XP4A 5J6EA 4LAVA 2D9FA 4LAXA 4ODRA 4U84A 3KAGA 3RGCA 2VN1A 2RUQA 2ZQVA 1Q6IA 3PRDA 2ITKA 2L2SA 3PA7A 4ITZA 5DIVA 2KO7A 4QT3A 4DRJA 1C9HA 1JVWA 5HW8A 2N87A 1D7IA 1NSGA 3KABA 2JZVA 1ROUA 3JXVA 3UI4A 2KFWA 2LJ4A 3O5LA 2FAPA 4TW8A 5DIUA 4QIBA 2MPHA 2PPPA 3JYMA 2RQSA 1R9HA 4IQCA 4DRMA 4JFKA 2PBCA 4FN2A 1M5YA 3NTPA 4QT2A 2RURA 1EQ3A 1BKFA 3O5OA 4GGQA 1HXVA 4G50A 4J4OA 1YATA 1FKKA 2Q5AA 2XPBA 1J4IA 4LAWA 2ZR4A 2KR7A 2MNTA 4GIVA 2OFNA 2PPNA 3GPKA 4MGVA 5HWBA 1QPFA 3LUOA 2KGJA 1EYMA 3IKDA 1KT0A 3TCZA 4FAPA 2PPOA 2LGOA 3O5FA 4DZ3A 4DRHA 5HTGA 5BXJA 5HKGA 3KADA 2Y78A 4DRIA 2XP8A 2PV3A 2ZQUA 3UQIA 4G2PA 1U79A 3NI6A 5B8IC 3TDBA 2M1IA 1FKIA 1QZ2A 3CGNA 3KZ7A 5DITA 1FKDA 4IQ2A 2MF9A 3UF8A 2F21A 1FKRA 1FKGA 2UZ5A 2DG3A 4TW6A 2ZR6A 1F40A 4DRQA 3CGMA 1P5QA 4JFLA 4J4NA 4DRPA 3I6CA 4NNRA 4W9QA 3WH0A 3PRBA 4MSPA 4JFJA 1TCOC 1YW5A
chains in the Genus database with same CATH superfamily
1W1PA 1W26A 2XP9A 2DSVA 3TC5A 4R0XA 1X6NA 3CHDA 1SR0A 3ARYA 1FKJA 4N19A 2F2DA 2WK2A 2LKNA 2F4EA 3B9AA 1A7XA 1ZU8A 4W5UA 1W1YA 3ALFA 4BF8A 2WLYA 4ZPVR 2G41A 1TFVA 4DWSA 2ZR5A 3AS3A 4Z2LA 2MLXA 3UQBA 1D6OA 2FDMA 3O5RA 4PTMA 5GPRA 1FKHA 3KAHA 3AS2A 3B7XA 1Y0OA 4MNKA 2DT2A 2MLYA 5D75A 1VF8A 2O92A 1ZBVA 3JYJA 4U86A 3WQVA 2O9OA 4LAVA 2D9FA 2PN0A 4S3KA 3QOKA 2A3BA 4DRJA 3RM4A 1D7IA 2KFWA 4QIBA 4R5EA 2MPHA 4FN2A 2IUZA 1BKFA 3O5OA 5DEZA 1YATA 1ZL1A 1FFQA 2Q5AA 2P4VA 2KR7A 4MNMA 3GPKA 4MTVA 1QPFA 1KFWA 3LUOA 2KGJA 3IKDA 1KT0A 1ZBKA 4FAPA 2DT1A 1UR9A 3KADA 2Y78A 4DRIA 2XP8A 1OWQA 4MAVA 2PV3A 2ZQUA 4G2PA 1U79A 3NI6A 4Q7NA 3CGNA 1FKRA 5DITA 2YBUA 2UZ5A 1OGGA 3ARUA 4TW6A 1IX5A 3PRAA 4DRPA 2F23A 4NNRA 4UDMA 3WH0A 4KR0B 4HBOA 4ODQA 1ZK6A 3WL1A 4DRKA 5HUAA 1ITXA 3O5EA 3FY1A 5I98A 5HWCA 1E6PA 4ZPTR 1XHGA 2FKEA 3G6MA 4Z2HA 2LPVA 4ODOA 1OGBA 1JNEA 1FKFA 4Z2KA 1QPLA 3MDYB 4ODNA 1HKMA 1WNOA 4ODKA 2M08A 1LG1A 5HW6A 4W9PA 1LJYA 1J6YA 1B6CA 4TYOA 3O5MA 1PBKA 2RUCA 4DT4A 1NWSA 3PR9A 3ARVA 1D2KA 3GU0A 1GOIA 1E44A 4ODMA 4AY1A 5JH8A 3B9DA 3UI6A 4TNSA 4JFMA 1J4HA 3IKGA 3ARSA 3RFWA 1HJVA 1J4RA 1K9TA 4Q22A 4IPXA 3W4RA 4Z2IA 4URIA 1UR8A 1ZCNA 1Q6HA 4DZ2A 4TW7A 2YBTA 3ODKA 2DPEA 3CHFA 5J6EA 4LAXA 3RGCA 2ETNA 2VN1A 1ZBCA 2ZQVA 5DF0A 2L2SA 3AQUA 1W9PA 1RD6A 1W1VA 1WB0A 3WIJA 3UI4A 3ARQA 2FAPA 2G8ZA 2RQSA 1R9HA 1ZBWA 3BMBA 4DWSD 4QT2A 2RURA 1EQ3A 3CH9A 3OA5A 2XPBA 1W9UA 2A3AA 2DT3A 3BXWA 4GIVA 4MGVA 2PPNA 2QF8A 1HKKA 3CZ8A 3EIPA 1E6ZA 2PPOA 1HKJA 1CTNA 5BXJA 1XRVA 3UQIA 1H0GA 3UF8A 1FKDA 1FKGA 2DG3A 4S3JA 2ZR6A 2B5UB 4DRQA 1P5QA 1W9VA 4J4NA 4W9QA 4P8XA 1TCOC 1YW5A 4Z2GA 1FFRA 2PV1A 1T11A 3O5IA 4NSBA 4TX0A 1L1PA 1FKSA 2DSUA 2KE0A 4MNJA 1EHNA 2XP5A 4QZVB 1JCHB 1LG2A 3O5PA 1EDQA 4L72B 3O5QA 4Z2JA 3KAIA 2XPAA 1E15A 1FKLA 1N1AA 3IK8A 1HKIA 1ZB5A 2DG4A 2KI3A 1JNTA 3WD0A 3NRKA 1JNDA 4DWSB 1GRJA 2IF4A 3O5KA 4ML4A 3ARRA 1PINA 2ZQSA 3ARTA 1E6NA 4P8UA 4O2TA 2AWGA 4HBEA 2AOSA 4P8VA 1ROTA 3ARZA 1NWRA 2XP6A 3EY6A 3H9RB 2DG9A 1FJDA 1GUVA 4JFIA 4W9OA 3ARWA 1D7JA 4C02B 4WKAA 4WKFA 3WD2A 4L3NA 4ODRA 3B9EA 3KAGA 1LL7A 2RUQA 1Q6IA 3PRDA 3G6LA 1GPFA 3PA7A 3WQWA 1E9LA 2N87A 5HBFA 1NSGA 3KABA 1LQ0A 1ROUA 2LJ4A 4P8WA 4TW8A 4DWSC 4IQCA 2ESCA 4KQZA 1M5YA 3AROA 4GGQA 1X6LA 4G50A 1J4IA 4LAWA 2ZR4A 4WJXA 2MNTA 1E6RA 1NWTA 4IT4A 4MNLA 3O5FA 2WM0A 4DZ3A 4DRHA 1EIBA 2M1IA 1QZ2A 4IQ2A 1F40A 3CGMA 4JFLA 5GQBA 2A3CA 1H0IA 3PRBA 3WKZA 4MSPA 4MPKA 4JFJA 3ARPA 3KCEA 1NMVA 5HW7A 4DIPA 2EULA 5HT1A 2M2AA 2VCDA 3WL0A 3AS1A 1O6IA 1KT1A 3B8SA 1BL4A 1NMWA 4U85A 4WK9A 2DSWA 2DSZA 4ZPWR 3KAFA 5GPGA 1Q6UA 4NZCA 3VAWA 3UI5A 4ODPA 2XP3A 3O5DA 1D7HA 2XP7A 4XAKA 2WLZA 3KACA 1FKBA 3WD4A 1FKTA 2PI6A 1F8AB 2K8IA 4DH0A 4ODLA 4WKHA 3OOBA 4JYSA 3UQAA 3CHEA 3O5GA 2PV2A 4HARA 2RSEA 1HJWA 2MLZA 1FD9A 4DRNA 1JNSA 3ARXA 4DROA 3ALGA 2DT0A 2ZQTA 3IHZA 1WAWA 3O5JA 1FAPA 4LAYA 1Q1CA 2RUDA 1NWUA 3RM8A 3FAPA 3WD1A 2XP4A 4U84A 1NH6A 4IT6A 2ITKA 4ITZA 5DIVA 2KO7A 4QT3A 1C9HA 1JVWA 3GTYX 1W1TA 4ZS6A 5HW8A 5DO2A 2B31A 3RMEA 2JZVA 3JXVA 3O5LA 5DIUA 2PPPA 3JYMA 4DRMA 4JFKA 2PBCA 1LL6A 1SYTA 3NTPA 1HXVA 4J4OA 1HJXA 1FKKA 4LGXA 4WIWA 2OFNA 2A3EA 5HWBA 3AS0A 3RM9A 1EYMA 3TCZA 2LGOA 3WD3A 5HTGA 5HKGA 3FXYA 5B8IC 3TDBA 1FKIA 3KZ7A 2MF9A 2F21A 3CHCA 3I6CA 1LL4A 2OLHA
chains in the Genus database with same CATH topology
1W1PA 1W26A 2XP9A 2DSVA 3TC5A 4R0XA 1X6NA 3CHDA 1SR0A 3ARYA 1FKJA 4N19A 2F2DA 2WK2A 2LKNA 2F4EA 3B9AA 1A7XA 1ZU8A 4W5UA 1W1YA 3ALFA 4BF8A 2WLYA 4ZPVR 2G41A 1TFVA 4DWSA 2ZR5A 3AS3A 4Z2LA 2MLXA 3UQBA 1D6OA 2FDMA 3O5RA 4PTMA 5GPRA 1FKHA 3KAHA 3AS2A 3B7XA 1Y0OA 4MNKA 2DT2A 2MLYA 5D75A 1VF8A 2O92A 1ZBVA 3JYJA 4U86A 3WQVA 2O9OA 4LAVA 2D9FA 4S3KA 3QOKA 2A3BA 4DRJA 3RM4A 1D7IA 2KFWA 4QIBA 4R5EA 2MPHA 4FN2A 2IUZA 1BKFA 3O5OA 5DEZA 1YATA 1ZL1A 1FFQA 2Q5AA 2KR7A 4MNMA 3GPKA 4MTVA 1QPFA 1KFWA 3LUOA 2KGJA 3IKDA 1KT0A 1ZBKA 4FAPA 2DT1A 1UR9A 3KADA 2Y78A 4DRIA 2XP8A 1OWQA 4MAVA 2PV3A 2ZQUA 4G2PA 1U79A 3NI6A 4Q7NA 3CGNA 1FKRA 5DITA 2YBUA 2UZ5A 1OGGA 3ARUA 4TW6A 1IX5A 3PRAA 4DRPA 4NNRA 3WH0A 4KR0B 4HBOA 4ODQA 1ZK6A 3WL1A 4DRKA 5HUAA 1ITXA 3O5EA 3FY1A 5I98A 5HWCA 1E6PA 4ZPTR 1XHGA 2FKEA 3G6MA 4Z2HA 2LPVA 4ODOA 1OGBA 1JNEA 1FKFA 4Z2KA 1QPLA 3MDYB 4ODNA 1HKMA 1WNOA 4ODKA 2M08A 1LG1A 5HW6A 4W9PA 1LJYA 1J6YA 1B6CA 4TYOA 3O5MA 1PBKA 2RUCA 4DT4A 1NWSA 3PR9A 3ARVA 1D2KA 1GOIA 4ODMA 4AY1A 5JH8A 3B9DA 3UI6A 4TNSA 4JFMA 1J4HA 3IKGA 3ARSA 3RFWA 1HJVA 1J4RA 1K9TA 4Q22A 4IPXA 3W4RA 4Z2IA 4URIA 1UR8A 1ZCNA 1Q6HA 4DZ2A 4TW7A 2YBTA 3ODKA 2DPEA 3CHFA 5J6EA 4LAXA 3RGCA 2VN1A 1ZBCA 2ZQVA 5DF0A 2L2SA 3AQUA 1W9PA 1RD6A 1W1VA 1WB0A 3WIJA 3UI4A 3ARQA 2FAPA 2G8ZA 2RQSA 1R9HA 1ZBWA 4DWSD 4QT2A 2RURA 1EQ3A 3CH9A 3OA5A 2XPBA 1W9UA 2A3AA 2DT3A 3BXWA 4GIVA 4MGVA 2PPNA 2QF8A 1HKKA 3CZ8A 1E6ZA 2PPOA 1HKJA 1CTNA 5BXJA 1XRVA 3UQIA 1H0GA 3UF8A 1FKDA 1FKGA 2DG3A 4S3JA 2ZR6A 4DRQA 1P5QA 1W9VA 4J4NA 4W9QA 4P8XA 1TCOC 1YW5A 4Z2GA 1FFRA 2PV1A 1T11A 3O5IA 4NSBA 4TX0A 1L1PA 1FKSA 2DSUA 2KE0A 4MNJA 1EHNA 2XP5A 4QZVB 1LG2A 3O5PA 1EDQA 4L72B 3O5QA 4Z2JA 3KAIA 2XPAA 1E15A 1FKLA 1N1AA 3IK8A 1HKIA 1ZB5A 2DG4A 2KI3A 1JNTA 3WD0A 3NRKA 1JNDA 4DWSB 2IF4A 3O5KA 4ML4A 3ARRA 1PINA 2ZQSA 3ARTA 1E6NA 4P8UA 4O2TA 2AWGA 4HBEA 2AOSA 4P8VA 1ROTA 3ARZA 1NWRA 2XP6A 3EY6A 3H9RB 2DG9A 1FJDA 1GUVA 4JFIA 4W9OA 3ARWA 1D7JA 4C02B 4WKAA 4WKFA 3WD2A 4L3NA 4ODRA 3B9EA 3KAGA 1LL7A 2RUQA 1Q6IA 3PRDA 3G6LA 1GPFA 3PA7A 3WQWA 1E9LA 2N87A 5HBFA 1NSGA 3KABA 1LQ0A 1ROUA 2LJ4A 4P8WA 4TW8A 4DWSC 4IQCA 2ESCA 4KQZA 1M5YA 3AROA 4GGQA 1X6LA 4G50A 1J4IA 4LAWA 2ZR4A 4WJXA 2MNTA 1E6RA 1NWTA 4IT4A 4MNLA 3O5FA 2WM0A 4DZ3A 4DRHA 1EIBA 2M1IA 1QZ2A 4IQ2A 1F40A 3CGMA 4JFLA 5GQBA 2A3CA 1H0IA 3PRBA 3WKZA 4MSPA 4MPKA 4JFJA 3ARPA 3KCEA 1NMVA 5HW7A 4DIPA 5HT1A 2M2AA 2VCDA 3WL0A 3AS1A 1O6IA 1KT1A 3B8SA 1BL4A 1NMWA 4U85A 4WK9A 2DSWA 2DSZA 4ZPWR 3KAFA 5GPGA 1Q6UA 4NZCA 3VAWA 3UI5A 4ODPA 2XP3A 3O5DA 1D7HA 2XP7A 4XAKA 2WLZA 3KACA 1FKBA 3WD4A 1FKTA 2PI6A 1F8AB 2K8IA 4DH0A 4ODLA 4WKHA 3OOBA 4JYSA 3UQAA 3CHEA 3O5GA 2PV2A 4HARA 2RSEA 1HJWA 2MLZA 1FD9A 4DRNA 1JNSA 3ARXA 4DROA 3ALGA 2DT0A 2ZQTA 3IHZA 1WAWA 3O5JA 1FAPA 4LAYA 1Q1CA 2RUDA 1NWUA 3RM8A 3FAPA 3WD1A 2XP4A 4U84A 1NH6A 4IT6A 2ITKA 4ITZA 5DIVA 2KO7A 4QT3A 1C9HA 1JVWA 5HW8A 1W1TA 4ZS6A 5DO2A 2B31A 3RMEA 2JZVA 3JXVA 3O5LA 5DIUA 2PPPA 3JYMA 4DRMA 4JFKA 2PBCA 1LL6A 1SYTA 3NTPA 1HXVA 4J4OA 1HJXA 1FKKA 4LGXA 4WIWA 2OFNA 2A3EA 5HWBA 3AS0A 3RM9A 1EYMA 3TCZA 2LGOA 3WD3A 5HTGA 5HKGA 3FXYA 5B8IC 3TDBA 1FKIA 3KZ7A 2MF9A 2F21A 3CHCA 3I6CA 1LL4A 2OLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODQ A;  1ZK6 A;  1W26 A;  2PV1 A;  2XP9 A;  3KCE A;  4DRK A;  1T11 A;  3O5I A;  1NMV A;  3TC5 A;  5HW7 A;  4DIP A;  5HUA A;  5HT1 A;  2M2A A;  2VCD A;  4R0X A;  4TX0 A;  3O5E A;  1L1P A;  1KT1 A;  5I98 A;  1BL4 A;  1FKS A;  5HWC A;  1FKJ A;  2KE0 A;  1NMW A;  4U85 A;  2XP5 A;  2FKE A;  3KAF A;  4N19 A;  5GPG A;  1Q6U A;  2F2D A;  2LPV A;  2LKN A;  2F4E A;  3O5P A;  4ODO A;  3UI5 A;  3VAW A;  1FKF A;  3O5Q A;  2XP3 A;  1A7X A;  4ODP A;  1QPL A;  3KAI A;  3MDY B;  2XPA A;  3O5D A;  4ODN A;  1FKL A;  4BF8 A;  1N1A A;  3IK8 A;  4ODK A;  2DG4 A;  1D7H A;  2M08 A;  2XP7 A;  5HW6 A;  2KI3 A;  3KAC A;  4W9P A;  1JNT A;  1FKB A;  1J6Y A;  1FKT A;  3NRK A;  2ZR5 A;  1B6C A;  1F8A B;  2K8I A;  4TYO A;  4DH0 A;  4ODL A;  3O5M A;  2IF4 A;  1PBK A;  2RUC A;  3O5K A;  4DT4 A;  1PIN A;  2ZQS A;  2MLX A;  3OOB A;  3UQB A;  4JYS A;  1D6O A;  2AWG A;  4O2T A;  3UQA A;  3O5R A;  3O5G A;  4ODM A;  1FKH A;  3KAH A;  3UI6 A;  2PV2 A;  4TNS A;  4JFM A;  1J4H A;  3IKG A;  3B7X A;  2RSE A;  3RFW A;  2MLZ A;  1ROT A;  1J4R A;  1FD9 A;  1Y0O A;  4DRN A;  2XP6 A;  3EY6 A;  4IPX A;  1JNS A;  4DRO A;  3H9R B;  2DG9 A;  1FJD A;  2MLY A;  2ZQT A;  4JFI A;  1ZCN A;  5D75 A;  4W9O A;  1Q6H A;  3IHZ A;  1D7J A;  4DZ2 A;  3O5J A;  4TW7 A;  4C02 B;  1FAP A;  4LAY A;  1Q1C A;  3ODK A;  2RUD A;  3JYJ A;  3FAP A;  4U86 A;  2XP4 A;  5J6E A;  4LAV A;  2D9F A;  4LAX A;  4ODR A;  4U84 A;  3KAG A;  3RGC A;  2VN1 A;  2RUQ A;  2ZQV A;  1Q6I A;  3PRD A;  2ITK A;  2L2S A;  3PA7 A;  4ITZ A;  5DIV A;  2KO7 A;  4QT3 A;  4DRJ A;  1C9H A;  1JVW A;  5HW8 A;  2N87 A;  1D7I A;  1NSG A;  3KAB A;  2JZV A;  1ROU A;  3JXV A;  3UI4 A;  2KFW A;  2LJ4 A;  3O5L A;  2FAP A;  4TW8 A;  5DIU A;  4QIB A;  2MPH A;  2PPP A;  3JYM A;  2RQS A;  1R9H A;  4IQC A;  4DRM A;  4JFK A;  2PBC A;  4FN2 A;  1M5Y A;  3NTP A;  4QT2 A;  2RUR A;  1EQ3 A;  1BKF A;  3O5O A;  4GGQ A;  1HXV A;  4G50 A;  4J4O A;  1YAT A;  1FKK A;  2Q5A A;  2XPB A;  1J4I A;  4LAW A;  2ZR4 A;  2KR7 A;  2MNT A;  4GIV A;  2OFN A;  2PPN A;  3GPK A;  4MGV A;  5HWB A;  1QPF A;  3LUO A;  2KGJ A;  1EYM A;  3IKD A;  1KT0 A;  3TCZ A;  4FAP A;  2PPO A;  2LGO A;  3O5F A;  4DZ3 A;  4DRH A;  5HTG A;  5BXJ A;  5HKG A;  3KAD A;  2Y78 A;  4DRI A;  2XP8 A;  2PV3 A;  2ZQU A;  3UQI A;  4G2P A;  1U79 A;  3NI6 A;  5B8I C;  3TDB A;  2M1I A;  1FKI A;  1QZ2 A;  3CGN A;  3KZ7 A;  5DIT A;  1FKD A;  4IQ2 A;  2MF9 A;  3UF8 A;  2F21 A;  1FKR A;  1FKG A;  2UZ5 A;  2DG3 A;  4TW6 A;  2ZR6 A;  1F40 A;  4DRQ A;  3CGM A;  1P5Q A;  4JFL A;  4J4N A;  4DRP A;  3I6C A;  4NNR A;  4W9Q A;  3WH0 A;  3PRB A;  4MSP A;  4JFJ A;  1TCO C;  1YW5 A; 
#chains in the Genus database with same CATH topology
 1W1P A;  1W26 A;  2XP9 A;  2DSV A;  3TC5 A;  4R0X A;  1X6N A;  3CHD A;  1SR0 A;  3ARY A;  1FKJ A;  4N19 A;  2F2D A;  2WK2 A;  2LKN A;  2F4E A;  3B9A A;  1A7X A;  1ZU8 A;  4W5U A;  1W1Y A;  3ALF A;  4BF8 A;  2WLY A;  4ZPV R;  2G41 A;  1TFV A;  4DWS A;  2ZR5 A;  3AS3 A;  4Z2L A;  2MLX A;  3UQB A;  1D6O A;  2FDM A;  3O5R A;  4PTM A;  5GPR A;  1FKH A;  3KAH A;  3AS2 A;  3B7X A;  1Y0O A;  4MNK A;  2DT2 A;  2MLY A;  5D75 A;  1VF8 A;  2O92 A;  1ZBV A;  3JYJ A;  4U86 A;  3WQV A;  2O9O A;  4LAV A;  2D9F A;  2PN0 A;  4S3K A;  3QOK A;  2A3B A;  4DRJ A;  3RM4 A;  1D7I A;  2KFW A;  4QIB A;  4R5E A;  2MPH A;  4FN2 A;  2IUZ A;  1BKF A;  3O5O A;  5DEZ A;  1YAT A;  1ZL1 A;  1FFQ A;  2Q5A A;  2P4V A;  2KR7 A;  4MNM A;  3GPK A;  4MTV A;  1QPF A;  1KFW A;  3LUO A;  2KGJ A;  3IKD A;  1KT0 A;  1ZBK A;  4FAP A;  2DT1 A;  1UR9 A;  3KAD A;  2Y78 A;  4DRI A;  2XP8 A;  1OWQ A;  4MAV A;  2PV3 A;  2ZQU A;  4G2P A;  1U79 A;  3NI6 A;  4Q7N A;  3CGN A;  1FKR A;  5DIT A;  2YBU A;  2UZ5 A;  1OGG A;  3ARU A;  4TW6 A;  1IX5 A;  3PRA A;  4DRP A;  2F23 A;  4NNR A;  4UDM A;  3WH0 A;  4KR0 B;  4HBO A;  4ODQ A;  1ZK6 A;  3WL1 A;  4DRK A;  5HUA A;  1ITX A;  3O5E A;  3FY1 A;  5I98 A;  5HWC A;  1E6P A;  4ZPT R;  1XHG A;  2FKE A;  3G6M A;  4Z2H A;  2LPV A;  4ODO A;  1OGB A;  1JNE A;  1FKF A;  4Z2K A;  1QPL A;  3MDY B;  4ODN A;  1HKM A;  1WNO A;  4ODK A;  2M08 A;  1LG1 A;  5HW6 A;  4W9P A;  1LJY A;  1J6Y A;  1B6C A;  4TYO A;  3O5M A;  1PBK A;  2RUC A;  4DT4 A;  1NWS A;  3PR9 A;  3ARV A;  1D2K A;  3GU0 A;  1GOI A;  1E44 A;  4ODM A;  4AY1 A;  5JH8 A;  3B9D A;  3UI6 A;  4TNS A;  4JFM A;  1J4H A;  3IKG A;  3ARS A;  3RFW A;  1HJV A;  1J4R A;  1K9T A;  4Q22 A;  4IPX A;  3W4R A;  4Z2I A;  4URI A;  1UR8 A;  1ZCN A;  1Q6H A;  4DZ2 A;  4TW7 A;  2YBT A;  3ODK A;  2DPE A;  3CHF A;  5J6E A;  4LAX A;  3RGC A;  2ETN A;  2VN1 A;  1ZBC A;  2ZQV A;  5DF0 A;  2L2S A;  3AQU A;  1W9P A;  1RD6 A;  1W1V A;  1WB0 A;  3WIJ A;  3UI4 A;  3ARQ A;  2FAP A;  2G8Z A;  2RQS A;  1R9H A;  1ZBW A;  3BMB A;  4DWS D;  4QT2 A;  2RUR A;  1EQ3 A;  3CH9 A;  3OA5 A;  2XPB A;  1W9U A;  2A3A A;  2DT3 A;  3BXW A;  4GIV A;  4MGV A;  2PPN A;  2QF8 A;  1HKK A;  3CZ8 A;  3EIP A;  1E6Z A;  2PPO A;  1HKJ A;  1CTN A;  5BXJ A;  1XRV A;  3UQI A;  1H0G A;  3UF8 A;  1FKD A;  1FKG A;  2DG3 A;  4S3J A;  2ZR6 A;  2B5U B;  4DRQ A;  1P5Q A;  1W9V A;  4J4N A;  4W9Q A;  4P8X A;  1TCO C;  1YW5 A;  4Z2G A;  1FFR A;  2PV1 A;  1T11 A;  3O5I A;  4NSB A;  4TX0 A;  1L1P A;  1FKS A;  2DSU A;  2KE0 A;  4MNJ A;  1EHN A;  2XP5 A;  4QZV B;  1JCH B;  1LG2 A;  3O5P A;  1EDQ A;  4L72 B;  3O5Q A;  4Z2J A;  3KAI A;  2XPA A;  1E15 A;  1FKL A;  1N1A A;  3IK8 A;  1HKI A;  1ZB5 A;  2DG4 A;  2KI3 A;  1JNT A;  3WD0 A;  3NRK A;  1JND A;  4DWS B;  1GRJ A;  2IF4 A;  3O5K A;  4ML4 A;  3ARR A;  1PIN A;  2ZQS A;  3ART A;  1E6N A;  4P8U A;  4O2T A;  2AWG A;  4HBE A;  2AOS A;  4P8V A;  1ROT A;  3ARZ A;  1NWR A;  2XP6 A;  3EY6 A;  3H9R B;  2DG9 A;  1FJD A;  1GUV A;  4JFI A;  4W9O A;  3ARW A;  1D7J A;  4C02 B;  4WKA A;  4WKF A;  3WD2 A;  4L3N A;  4ODR A;  3B9E A;  3KAG A;  1LL7 A;  2RUQ A;  1Q6I A;  3PRD A;  3G6L A;  1GPF A;  3PA7 A;  3WQW A;  1E9L A;  2N87 A;  5HBF A;  1NSG A;  3KAB A;  1LQ0 A;  1ROU A;  2LJ4 A;  4P8W A;  4TW8 A;  4DWS C;  4IQC A;  2ESC A;  4KQZ A;  1M5Y A;  3ARO A;  4GGQ A;  1X6L A;  4G50 A;  1J4I A;  4LAW A;  2ZR4 A;  4WJX A;  2MNT A;  1E6R A;  1NWT A;  4IT4 A;  4MNL A;  3O5F A;  2WM0 A;  4DZ3 A;  4DRH A;  1EIB A;  2M1I A;  1QZ2 A;  4IQ2 A;  1F40 A;  3CGM A;  4JFL A;  5GQB A;  2A3C A;  1H0I A;  3PRB A;  3WKZ A;  4MSP A;  4MPK A;  4JFJ A;  3ARP A;  3KCE A;  1NMV A;  5HW7 A;  4DIP A;  2EUL A;  5HT1 A;  2M2A A;  2VCD A;  3WL0 A;  3AS1 A;  1O6I A;  1KT1 A;  3B8S A;  1BL4 A;  1NMW A;  4U85 A;  4WK9 A;  2DSW A;  2DSZ A;  4ZPW R;  3KAF A;  5GPG A;  1Q6U A;  4NZC A;  3VAW A;  3UI5 A;  4ODP A;  2XP3 A;  3O5D A;  1D7H A;  2XP7 A;  4XAK A;  2WLZ A;  3KAC A;  1FKB A;  3WD4 A;  1FKT A;  2PI6 A;  1F8A B;  2K8I A;  4DH0 A;  4ODL A;  4WKH A;  3OOB A;  4JYS A;  3UQA A;  3CHE A;  3O5G A;  2PV2 A;  4HAR A;  2RSE A;  1HJW A;  2MLZ A;  1FD9 A;  4DRN A;  1JNS A;  3ARX A;  4DRO A;  3ALG A;  2DT0 A;  2ZQT A;  3IHZ A;  1WAW A;  3O5J A;  1FAP A;  4LAY A;  1Q1C A;  2RUD A;  1NWU A;  3RM8 A;  3FAP A;  3WD1 A;  2XP4 A;  4U84 A;  1NH6 A;  4IT6 A;  2ITK A;  4ITZ A;  5DIV A;  2KO7 A;  4QT3 A;  1C9H A;  1JVW A;  3GTY X;  1W1T A;  4ZS6 A;  5HW8 A;  5DO2 A;  2B31 A;  3RME A;  2JZV A;  3JXV A;  3O5L A;  5DIU A;  2PPP A;  3JYM A;  4DRM A;  4JFK A;  2PBC A;  1LL6 A;  1SYT A;  3NTP A;  1HXV A;  4J4O A;  1HJX A;  1FKK A;  4LGX A;  4WIW A;  2OFN A;  2A3E A;  5HWB A;  3AS0 A;  3RM9 A;  1EYM A;  3TCZ A;  2LGO A;  3WD3 A;  5HTG A;  5HKG A;  3FXY A;  5B8I C;  3TDB A;  1FKI A;  3KZ7 A;  2MF9 A;  2F21 A;  3CHC A;  3I6C A;  1LL4 A;  2OLH A; 
#chains in the Genus database with same CATH homology
 1W1P A;  1W26 A;  2XP9 A;  2DSV A;  3TC5 A;  4R0X A;  1X6N A;  3CHD A;  1SR0 A;  3ARY A;  1FKJ A;  4N19 A;  2F2D A;  2WK2 A;  2LKN A;  2F4E A;  3B9A A;  1A7X A;  1ZU8 A;  4W5U A;  1W1Y A;  3ALF A;  4BF8 A;  2WLY A;  4ZPV R;  2G41 A;  1TFV A;  4DWS A;  2ZR5 A;  3AS3 A;  4Z2L A;  2MLX A;  3UQB A;  1D6O A;  2FDM A;  3O5R A;  4PTM A;  5GPR A;  1FKH A;  3KAH A;  3AS2 A;  3B7X A;  1Y0O A;  4MNK A;  2DT2 A;  2MLY A;  5D75 A;  1VF8 A;  2O92 A;  1ZBV A;  3JYJ A;  4U86 A;  3WQV A;  2O9O A;  4LAV A;  2D9F A;  4S3K A;  3QOK A;  2A3B A;  4DRJ A;  3RM4 A;  1D7I A;  2KFW A;  4QIB A;  4R5E A;  2MPH A;  4FN2 A;  2IUZ A;  1BKF A;  3O5O A;  5DEZ A;  1YAT A;  1ZL1 A;  1FFQ A;  2Q5A A;  2KR7 A;  4MNM A;  3GPK A;  4MTV A;  1QPF A;  1KFW A;  3LUO A;  2KGJ A;  3IKD A;  1KT0 A;  1ZBK A;  4FAP A;  2DT1 A;  1UR9 A;  3KAD A;  2Y78 A;  4DRI A;  2XP8 A;  1OWQ A;  4MAV A;  2PV3 A;  2ZQU A;  4G2P A;  1U79 A;  3NI6 A;  4Q7N A;  3CGN A;  1FKR A;  5DIT A;  2YBU A;  2UZ5 A;  1OGG A;  3ARU A;  4TW6 A;  1IX5 A;  3PRA A;  4DRP A;  4NNR A;  3WH0 A;  4KR0 B;  4HBO A;  4ODQ A;  1ZK6 A;  3WL1 A;  4DRK A;  5HUA A;  1ITX A;  3O5E A;  3FY1 A;  5I98 A;  5HWC A;  1E6P A;  4ZPT R;  1XHG A;  2FKE A;  3G6M A;  4Z2H A;  2LPV A;  4ODO A;  1OGB A;  1JNE A;  1FKF A;  4Z2K A;  1QPL A;  3MDY B;  4ODN A;  1HKM A;  1WNO A;  4ODK A;  2M08 A;  1LG1 A;  5HW6 A;  4W9P A;  1LJY A;  1J6Y A;  1B6C A;  4TYO A;  3O5M A;  1PBK A;  2RUC A;  4DT4 A;  1NWS A;  3PR9 A;  3ARV A;  1D2K A;  1GOI A;  4ODM A;  4AY1 A;  5JH8 A;  3B9D A;  3UI6 A;  4TNS A;  4JFM A;  1J4H A;  3IKG A;  3ARS A;  3RFW A;  1HJV A;  1J4R A;  1K9T A;  4Q22 A;  4IPX A;  3W4R A;  4Z2I A;  4URI A;  1UR8 A;  1ZCN A;  1Q6H A;  4DZ2 A;  4TW7 A;  2YBT A;  3ODK A;  2DPE A;  3CHF A;  5J6E A;  4LAX A;  3RGC A;  2VN1 A;  1ZBC A;  2ZQV A;  5DF0 A;  2L2S A;  3AQU A;  1W9P A;  1RD6 A;  1W1V A;  1WB0 A;  3WIJ A;  3UI4 A;  3ARQ A;  2FAP A;  2G8Z A;  2RQS A;  1R9H A;  1ZBW A;  4DWS D;  4QT2 A;  2RUR A;  1EQ3 A;  3CH9 A;  3OA5 A;  2XPB A;  1W9U A;  2A3A A;  2DT3 A;  3BXW A;  4GIV A;  4MGV A;  2PPN A;  2QF8 A;  1HKK A;  3CZ8 A;  1E6Z A;  2PPO A;  1HKJ A;  1CTN A;  5BXJ A;  1XRV A;  3UQI A;  1H0G A;  3UF8 A;  1FKD A;  1FKG A;  2DG3 A;  4S3J A;  2ZR6 A;  4DRQ A;  1P5Q A;  1W9V A;  4J4N A;  4W9Q A;  4P8X A;  1TCO C;  1YW5 A;  4Z2G A;  1FFR A;  2PV1 A;  1T11 A;  3O5I A;  4NSB A;  4TX0 A;  1L1P A;  1FKS A;  2DSU A;  2KE0 A;  4MNJ A;  1EHN A;  2XP5 A;  4QZV B;  1LG2 A;  3O5P A;  1EDQ A;  4L72 B;  3O5Q A;  4Z2J A;  3KAI A;  2XPA A;  1E15 A;  1FKL A;  1N1A A;  3IK8 A;  1HKI A;  1ZB5 A;  2DG4 A;  2KI3 A;  1JNT A;  3WD0 A;  3NRK A;  1JND A;  4DWS B;  2IF4 A;  3O5K A;  4ML4 A;  3ARR A;  1PIN A;  2ZQS A;  3ART A;  1E6N A;  4P8U A;  4O2T A;  2AWG A;  4HBE A;  2AOS A;  4P8V A;  1ROT A;  3ARZ A;  1NWR A;  2XP6 A;  3EY6 A;  3H9R B;  2DG9 A;  1FJD A;  1GUV A;  4JFI A;  4W9O A;  3ARW A;  1D7J A;  4C02 B;  4WKA A;  4WKF A;  3WD2 A;  4L3N A;  4ODR A;  3B9E A;  3KAG A;  1LL7 A;  2RUQ A;  1Q6I A;  3PRD A;  3G6L A;  1GPF A;  3PA7 A;  3WQW A;  1E9L A;  2N87 A;  5HBF A;  1NSG A;  3KAB A;  1LQ0 A;  1ROU A;  2LJ4 A;  4P8W A;  4TW8 A;  4DWS C;  4IQC A;  2ESC A;  4KQZ A;  1M5Y A;  3ARO A;  4GGQ A;  1X6L A;  4G50 A;  1J4I A;  4LAW A;  2ZR4 A;  4WJX A;  2MNT A;  1E6R A;  1NWT A;  4IT4 A;  4MNL A;  3O5F A;  2WM0 A;  4DZ3 A;  4DRH A;  1EIB A;  2M1I A;  1QZ2 A;  4IQ2 A;  1F40 A;  3CGM A;  4JFL A;  5GQB A;  2A3C A;  1H0I A;  3PRB A;  3WKZ A;  4MSP A;  4MPK A;  4JFJ A;  3ARP A;  3KCE A;  1NMV A;  5HW7 A;  4DIP A;  5HT1 A;  2M2A A;  2VCD A;  3WL0 A;  3AS1 A;  1O6I A;  1KT1 A;  3B8S A;  1BL4 A;  1NMW A;  4U85 A;  4WK9 A;  2DSW A;  2DSZ A;  4ZPW R;  3KAF A;  5GPG A;  1Q6U A;  4NZC A;  3VAW A;  3UI5 A;  4ODP A;  2XP3 A;  3O5D A;  1D7H A;  2XP7 A;  4XAK A;  2WLZ A;  3KAC A;  1FKB A;  3WD4 A;  1FKT A;  2PI6 A;  1F8A B;  2K8I A;  4DH0 A;  4ODL A;  4WKH A;  3OOB A;  4JYS A;  3UQA A;  3CHE A;  3O5G A;  2PV2 A;  4HAR A;  2RSE A;  1HJW A;  2MLZ A;  1FD9 A;  4DRN A;  1JNS A;  3ARX A;  4DRO A;  3ALG A;  2DT0 A;  2ZQT A;  3IHZ A;  1WAW A;  3O5J A;  1FAP A;  4LAY A;  1Q1C A;  2RUD A;  1NWU A;  3RM8 A;  3FAP A;  3WD1 A;  2XP4 A;  4U84 A;  1NH6 A;  4IT6 A;  2ITK A;  4ITZ A;  5DIV A;  2KO7 A;  4QT3 A;  1C9H A;  1JVW A;  5HW8 A;  1W1T A;  4ZS6 A;  5DO2 A;  2B31 A;  3RME A;  2JZV A;  3JXV A;  3O5L A;  5DIU A;  2PPP A;  3JYM A;  4DRM A;  4JFK A;  2PBC A;  1LL6 A;  1SYT A;  3NTP A;  1HXV A;  4J4O A;  1HJX A;  1FKK A;  4LGX A;  4WIW A;  2OFN A;  2A3E A;  5HWB A;  3AS0 A;  3RM9 A;  1EYM A;  3TCZ A;  2LGO A;  3WD3 A;  5HTG A;  5HKG A;  3FXY A;  5B8I C;  3TDB A;  1FKI A;  3KZ7 A;  2MF9 A;  2F21 A;  3CHC A;  3I6C A;  1LL4 A;  2OLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...