5DIUA

The fk1 domain of fkbp51 in complex with the new synthetic ligand 2-(3-((r)-1-((s)-1-((s)-2-cyclohexyl-2-(3,4,5-trimethoxyphenyl)acetyl)piperidine-2-carboxamido)-3-(3,4-dimethoxyphenyl)propyl)phenoxy)acetic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid, Structure-Based Exploration of Pipecolic Acid Amides as Novel Selective Antagonists of the FK506-Binding Protein 51.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5diuA00
5HUAA 2KGJA 3TDBA 3PRDA 3O5OA 1FJDA 1TCOC 4ODQA 1NMWA 4LAWA 2F2DA 1T11A 1FKDA 2FAPA 1FKBA 2ZQUA 3O5GA 2PPOA 1NMVA 5HW8A 4W9QA 5J6EA 2XP4A 3KAIA 3O5IA 1PINA 1NSGA 2XP7A 2XPBA 2XPAA 3KAFA 3KAGA 4JFMA 3OOBA 1D7HA 2PV3A 3NTPA 4ODLA 3NI6A 4QT3A 3GPKA 5DIUA 4DRJA 1FKRA 1KT0A 1D7IA 1J4HA 5HT1A 1D6OA 2KI3A 4J4OA 1QZ2A 4GGQA 3UI4A 4DROA 5HKGA 2PPNA 3VAWA 1FKGA 2M1IA 4DRHA 1FKKA 4ODMA 3UI6A 5HW6A 5DITA 1P5QA 2ZQSA 4JFJA 4TW6A 3O5FA 1EQ3A 3ODKA 4DT4A 3RFWA 3O5RA 4QIBA 2RUQA 1R9HA 4ODRA 1ZCNA 3WH0A 2IF4A 3JYMA 1JVWA 3MDYB 3IHZA 5HWBA 1B6CA 2ZR6A 2KE0A 1N1AA 1PBKA 4JFKA 1M5YA 1FKJA 2FKEA 2LJ4A 3JXVA 3NRKA 4ODNA 4C02B 2PBCA 3IK8A 1FD9A 4MSPA 4FAPA 1J6YA 4TW8A 1J4IA 4FN2A 2RUCA 1FKFA 4LAXA 4DRQA 2ZQVA 4TW7A 5HWCA 2XP9A 1C9HA 3UI5A 1U79A 2Y78A 1YATA 2RURA 4JYSA 1F40A 2MPHA 4TX0A 2MLYA 3O5EA 4DH0A 5GPGA 3O5LA 2RQSA 2LGOA 5HW7A 1ZK6A 2DG3A 4LAVA 2XP3A 2KFWA 5I98A 1Q6IA 2RSEA 4R0XA 3UQIA 3KACA 2ZQTA 3H9RB 5HTGA 3O5JA 1FAPA 3UQAA 2DG4A 3B7XA 4G50A 1Q6HA 4ODPA 1HXVA 1Q6UA 3KABA 4J4NA 5DIVA 2M2AA 2F21A 1FKLA 3O5PA 1FKIA 4LAYA 4DRMA 2KO7A 2VN1A 4QT2A 1FKHA 2UZ5A 2PPPA 2ITKA 4IQCA 2L2SA 2AWGA 2VCDA 4ITZA 1FKSA 2KR7A 3O5MA 4G2PA 4W9OA 2ZR5A 2D9FA 5D75A 1ROTA 5BXJA 4U85A 2PV2A 2DG9A 3FAPA 1D7JA 1JNTA 1QPLA 4U86A 2MNTA 4JFLA 3CGNA 4W9PA 3KAHA 1L1PA 1FKTA 2F4EA 1KT1A 1BKFA 1QPFA 1W26A 4DRKA 5B8IC 2MLXA 1YW5A 4DRPA 2XP6A 3O5QA 4IQ2A 2PV1A 3O5DA 3PRBA 4GIVA 4BF8A 3EY6A 1JNSA 2MLZA 1ROUA 4DIPA 2M08A 3KADA 4TYOA 2XP5A 1Q1CA 2N87A 3KCEA 3O5KA 4DZ2A 2LKNA 4O2TA 4TNSA 2XP8A 3KZ7A 4U84A 3JYJA 4DRIA 2OFNA 2JZVA 1F8AB 1J4RA 4DZ3A 3TCZA 3CGMA 4ODKA 4DRNA 2MF9A 2Q5AA 1A7XA 3PA7A 1EYMA 2K8IA 3UQBA 1Y0OA 3LUOA 4ODOA 4MGVA 2RUDA 2LPVA 2ZR4A 4IPXA 1BL4A 3IKDA 3I6CA 4JFIA 3UF8A 3IKGA 4N19A 3TC5A 4NNRA 3RGCA
chains in the Genus database with same CATH superfamily
2KGJA 3WD4A 2DT0A 3CHFA 4Z2JA 2FAPA 1FKBA 2ZQUA 3O5GA 2PPOA 5HW8A 4W9QA 1XRVA 2XPAA 5J6EA 1CTNA 1D7HA 3NTPA 3NI6A 5DIUA 2A3EA 1KT0A 1O6IA 1EIBA 4GGQA 1EDQA 2WM0A 2M1IA 3BXWA 1FKKA 3UI6A 1FFRA 4JFJA 3CH9A 1GUVA 4W5UA 1NWTA 3RFWA 3WH0A 2IF4A 3MDYB 1JVWA 2G41A 1PBKA 3ARSA 2LJ4A 3AS0A 2DT3A 2WLZA 4ODNA 4FAPA 2RUCA 1GRJA 4TW7A 3ARVA 3B9AA 1C9HA 3GTYX 3UI5A 3WIJA 2RURA 2MLYA 4MNLA 3O5LA 2RQSA 5HW7A 2PN0A 2KFWA 1Q6IA 2RSEA 1E6NA 3FXYA 3WQVA 3UQAA 2ESCA 3B7XA 1Q6UA 4J4NA 5DIVA 2M2AA 5GPRA 2F21A 1E6RA 1FKIA 4R5EA 3ARQA 4DRMA 2VN1A 1ZBKA 1W9PA 3AQUA 5HBFA 2PPPA 2ITKA 2L2SA 4W9OA 4P8WA 4DWSC 5BXJA 3PRAA 4U85A 2PV2A 1D7JA 4W9PA 3KAHA 1FKTA 1QPFA 1W26A 3WL1A 5B8IC 4LGXA 1YW5A 3O5QA 3CZ8A 4GIVA 3PRBA 4HBEA 3B8SA 3RMEA 1JNSA 1NWRA 4MNMA 4TYOA 1Q1CA 2N87A 3KCEA 3O5KA 4WKHA 4URIA 4U84A 1OWQA 4DRIA 1HJVA 2OLHA 4L72B 1LL4A 4DRNA 3PA7A 2DSZA 3LUOA 1HKKA 2DSVA 2LPVA 2WLYA 4WIWA 3I6CA 3UF8A 3IKGA 1LL6A 3WQWA 3O5OA 1FJDA 1ZBVA 3WD0A 3ALFA 4ODQA 3CHCA 2B5UB 2F2DA 4Z2KA 1T11A 4IT4A 4ZPTR 1NMVA 3O5IA 3KAIA 1PINA 1NSGA 2XPBA 3KAFA 3ARXA 2A3BA 4JFMA 2PV3A 4P8UA 4HARA 5HT1A 3W4RA 1QZ2A 3UI4A 4DROA 3VAWA 2O92A 1FKGA 3RM4A 2ZQSA 1ITXA 2FDMA 3EIPA 4Q7NA 1R9HA 4DWSB 4ODRA 1ZCNA 2O9OA 3AS1A 3FY1A 5DO2A 4JFKA 1XHGA 1FKJA 2FKEA 2DSUA 1ZB5A 3WD3A 4FN2A 1FKFA 4DRQA 2ZQVA 2Y78A 2A3CA 2EULA 3UQIA 3O5JA 1FAPA 1Q6HA 3KABA 3WKZA 1FKHA 4IQCA 2AWGA 5D75A 1ROTA 3CHDA 1HJXA 1QPLA 4JFLA 3G6MA 2WK2A 2DPEA 1KT1A 4DRPA 4IQ2A 1LJYA 4WKAA 1LG2A 4DIPA 2M08A 5GQBA 2ETNA 1GOIA 2LKNA 2XP8A 1RD6A 2OFNA 2JZVA 2Q5AA 1A7XA 3G6LA 1UR9A 1LG1A 2YBTA 1EYMA 3UQBA 1Y0OA 2RUDA 4NNRA 5HUAA 3AS3A 1TCOC 2A3AA 4ZS6A 1FKDA 4MNJA 2XP7A 4DZ3A 2PI6A 4DRJA 4QT3A 4MTVA 1FKRA 4S3KA 2QF8A 1D7IA 1X6NA 1ZBCA 1D6OA 4J4OA 4HBOA 5HKGA 2F23A 2YBUA 4ODMA 4MAVA 5HW6A 5DITA 1E6ZA 1W1PA 4TW6A 1HJWA 1IX5A 1EQ3A 3O5RA 4QIBA 1JNDA 1OGBA 5HWBA 1FFQA 2ZR6A 1N1AA 3AS2A 4WKFA 4IT6A 3JXVA 3NRKA 4P8XA 2PBCA 5DF0A 5DEZA 4MSPA 1J6YA 4TW8A 4AY1A 1GPFA 4LAXA 2XP9A 1E9LA 3WL0A 1F40A 2MPHA 1LQ0A 5GPGA 1VF8A 1ZK6A 4LAVA 1SR0A 1W1VA 4QZVB 1NH6A 3CHEA 3H9RB 3KACA 3B9DA 1H0GA 1KFWA 4Z2GA 1HXVA 1EHNA 3O5PA 3ARUA 1E44A 4P8VA 4LAYA 1JNEA 2KO7A 4L3NA 1TFVA 2DT2A 1WNOA 2UZ5A 2VCDA 1D2KA 4G2PA 2ZR5A 4ZPWR 2DG9A 3FAPA 4UDMA 3CGNA 1HKIA 1L1PA 2F4EA 4DRKA 1BKFA 1SYTA 1ZL1A 3ARTA 1WB0A 4BF8A 3EY6A 2MLZA 4NZCA 1E15A 2XP5A 3BMBA 3JYJA 1F8AB 3B9EA 3CGMA 4ODKA 3TCZA 2MF9A 1ZBWA 4DWSD 4Z2HA 4MGVA 2ZR4A 1BL4A 4N19A 3TC5A 3RGCA 1UR8A 1X6LA 3TDBA 4XAKA 3PRDA 1NMWA 4LAWA 2DSWA 2P4VA 2AOSA 4PTMA 2XP4A 2DT1A 4ZPVR 4DT4A 1W1TA 3KAGA 4ODLA 3OOBA 1NWUA 3GPKA 3ARRA 1J4HA 1WAWA 2KI3A 2PPNA 1ZU8A 3GU0A 4WJXA 4DRHA 1P5QA 1JCHB 3O5FA 3ODKA 4MPKA 3QOKA 2RUQA 1W9VA 3ARWA 3RM9A 3JYMA 3IHZA 1B6CA 2KE0A 1M5YA 4ML4A 3ALGA 4KQZA 4C02B 5JH8A 3ARZA 3IK8A 1FD9A 1J4IA 3WD1A 4S3JA 5HWCA 1U79A 2IUZA 1YATA 4JYSA 4TX0A 3O5EA 4DH0A 4Q22A 2LGOA 2DG3A 2XP3A 5I98A 3ARPA 4R0XA 5HTGA 4Z2IA 2ZQTA 2DG4A 4G50A 4ODPA 1FKLA 1W9UA 4QT2A 4ITZA 1W1YA 1FKSA 2KR7A 3O5MA 3WD2A 2D9FA 4Z2LA 3ARYA 1HKMA 4U86A 1JNTA 2MNTA 4DWSA 2MLXA 3PR9A 2XP6A 4KR0B 2PV1A 3O5DA 2B31A 2G8ZA 4NSBA 1ROUA 3KADA 4DZ2A 1NWSA 4O2TA 4TNSA 3KZ7A 1H0IA 3RM8A 1LL7A 1J4RA 3AROA 1OGGA 1E6PA 2K8IA 4ODOA 4WK9A 4IPXA 1HKJA 3IKDA 3OA5A 4JFIA 4MNKA 1K9TA
chains in the Genus database with same CATH topology
2KGJA 3WD4A 2DT0A 3CHFA 4Z2JA 2FAPA 1FKBA 2ZQUA 3O5GA 2PPOA 5HW8A 4W9QA 1XRVA 2XPAA 5J6EA 1CTNA 1D7HA 3NTPA 3NI6A 5DIUA 2A3EA 1KT0A 1O6IA 1EIBA 4GGQA 1EDQA 2WM0A 2M1IA 3BXWA 1FKKA 3UI6A 1FFRA 4JFJA 3CH9A 1GUVA 4W5UA 1NWTA 3RFWA 3WH0A 2IF4A 3MDYB 1JVWA 2G41A 1PBKA 3ARSA 2LJ4A 3AS0A 2DT3A 2WLZA 4ODNA 4FAPA 2RUCA 4TW7A 3ARVA 3B9AA 1C9HA 3UI5A 3WIJA 2RURA 2MLYA 4MNLA 3O5LA 2RQSA 5HW7A 2KFWA 1Q6IA 2RSEA 1E6NA 3FXYA 3WQVA 3UQAA 2ESCA 3B7XA 1Q6UA 4J4NA 5DIVA 2M2AA 5GPRA 2F21A 1E6RA 1FKIA 4R5EA 3ARQA 4DRMA 2VN1A 1ZBKA 1W9PA 3AQUA 5HBFA 2PPPA 2ITKA 2L2SA 4W9OA 4P8WA 4DWSC 5BXJA 3PRAA 4U85A 2PV2A 1D7JA 4W9PA 3KAHA 1FKTA 1QPFA 1W26A 3WL1A 5B8IC 4LGXA 1YW5A 3O5QA 3CZ8A 4GIVA 3PRBA 4HBEA 3B8SA 3RMEA 1JNSA 1NWRA 4MNMA 4TYOA 1Q1CA 2N87A 3KCEA 3O5KA 4WKHA 4URIA 4U84A 1OWQA 4DRIA 1HJVA 2OLHA 4L72B 1LL4A 4DRNA 3PA7A 2DSZA 3LUOA 1HKKA 2DSVA 2LPVA 2WLYA 4WIWA 3I6CA 3UF8A 3IKGA 1LL6A 3WQWA 3O5OA 1FJDA 1ZBVA 3WD0A 3ALFA 4ODQA 3CHCA 2F2DA 4Z2KA 1T11A 4IT4A 4ZPTR 1NMVA 3O5IA 3KAIA 1PINA 1NSGA 2XPBA 3KAFA 3ARXA 2A3BA 4JFMA 2PV3A 4P8UA 4HARA 5HT1A 3W4RA 1QZ2A 3UI4A 4DROA 3VAWA 2O92A 1FKGA 3RM4A 2ZQSA 1ITXA 2FDMA 4Q7NA 1R9HA 4DWSB 4ODRA 1ZCNA 2O9OA 3AS1A 3FY1A 5DO2A 4JFKA 1XHGA 1FKJA 2FKEA 2DSUA 1ZB5A 3WD3A 4FN2A 1FKFA 4DRQA 2ZQVA 2Y78A 2A3CA 3UQIA 3O5JA 1FAPA 1Q6HA 3KABA 3WKZA 1FKHA 4IQCA 2AWGA 5D75A 1ROTA 3CHDA 1HJXA 1QPLA 4JFLA 3G6MA 2WK2A 2DPEA 1KT1A 4DRPA 4IQ2A 1LJYA 4WKAA 1LG2A 4DIPA 2M08A 5GQBA 1GOIA 2LKNA 2XP8A 1RD6A 2OFNA 2JZVA 2Q5AA 1A7XA 3G6LA 1UR9A 1LG1A 2YBTA 1EYMA 3UQBA 1Y0OA 2RUDA 4NNRA 5HUAA 3AS3A 1TCOC 2A3AA 4ZS6A 1FKDA 4MNJA 2XP7A 4DZ3A 2PI6A 4DRJA 4QT3A 4MTVA 1FKRA 4S3KA 2QF8A 1D7IA 1X6NA 1ZBCA 1D6OA 4J4OA 4HBOA 5HKGA 2YBUA 4ODMA 4MAVA 5HW6A 5DITA 1E6ZA 1W1PA 4TW6A 1HJWA 1IX5A 1EQ3A 3O5RA 4QIBA 1JNDA 1OGBA 5HWBA 1FFQA 2ZR6A 1N1AA 3AS2A 4WKFA 4IT6A 3JXVA 3NRKA 4P8XA 2PBCA 5DF0A 5DEZA 4MSPA 1J6YA 4TW8A 4AY1A 1GPFA 4LAXA 2XP9A 1E9LA 3WL0A 1F40A 2MPHA 1LQ0A 5GPGA 1VF8A 1ZK6A 4LAVA 1SR0A 1W1VA 4QZVB 1NH6A 3CHEA 3H9RB 3KACA 3B9DA 1H0GA 1KFWA 4Z2GA 1HXVA 1EHNA 3O5PA 3ARUA 4P8VA 4LAYA 1JNEA 2KO7A 4L3NA 1TFVA 2DT2A 1WNOA 2UZ5A 2VCDA 1D2KA 4G2PA 2ZR5A 4ZPWR 2DG9A 3FAPA 3CGNA 1HKIA 1L1PA 2F4EA 4DRKA 1BKFA 1SYTA 1ZL1A 3ARTA 1WB0A 4BF8A 3EY6A 2MLZA 4NZCA 1E15A 2XP5A 3JYJA 1F8AB 3B9EA 3CGMA 4ODKA 3TCZA 2MF9A 1ZBWA 4DWSD 4Z2HA 4MGVA 2ZR4A 1BL4A 4N19A 3TC5A 3RGCA 1UR8A 1X6LA 3TDBA 4XAKA 3PRDA 1NMWA 4LAWA 2DSWA 2AOSA 4PTMA 2XP4A 2DT1A 4ZPVR 4DT4A 1W1TA 3KAGA 4ODLA 3OOBA 1NWUA 3GPKA 3ARRA 1J4HA 1WAWA 2KI3A 2PPNA 1ZU8A 4WJXA 4DRHA 1P5QA 3O5FA 3ODKA 4MPKA 3QOKA 2RUQA 1W9VA 3ARWA 3RM9A 3JYMA 3IHZA 1B6CA 2KE0A 1M5YA 4ML4A 3ALGA 4KQZA 4C02B 5JH8A 3ARZA 3IK8A 1FD9A 1J4IA 3WD1A 4S3JA 5HWCA 1U79A 2IUZA 1YATA 4JYSA 4TX0A 3O5EA 4DH0A 4Q22A 2LGOA 2DG3A 2XP3A 5I98A 3ARPA 4R0XA 5HTGA 4Z2IA 2ZQTA 2DG4A 4G50A 4ODPA 1FKLA 1W9UA 4QT2A 4ITZA 1W1YA 1FKSA 2KR7A 3O5MA 3WD2A 2D9FA 4Z2LA 3ARYA 1HKMA 4U86A 1JNTA 2MNTA 4DWSA 2MLXA 3PR9A 2XP6A 4KR0B 2PV1A 3O5DA 2B31A 2G8ZA 4NSBA 1ROUA 3KADA 4DZ2A 1NWSA 4O2TA 4TNSA 3KZ7A 1H0IA 3RM8A 1LL7A 1J4RA 3AROA 1OGGA 1E6PA 2K8IA 4ODOA 4WK9A 4IPXA 1HKJA 3IKDA 3OA5A 4JFIA 4MNKA 1K9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HUA A;  2KGJ A;  3TDB A;  3PRD A;  3O5O A;  1FJD A;  1TCO C;  4ODQ A;  1NMW A;  4LAW A;  2F2D A;  1T11 A;  1FKD A;  2FAP A;  1FKB A;  2ZQU A;  3O5G A;  2PPO A;  1NMV A;  5HW8 A;  4W9Q A;  5J6E A;  2XP4 A;  3KAI A;  3O5I A;  1PIN A;  1NSG A;  2XP7 A;  2XPB A;  2XPA A;  3KAF A;  3KAG A;  4JFM A;  3OOB A;  1D7H A;  2PV3 A;  3NTP A;  4ODL A;  3NI6 A;  4QT3 A;  3GPK A;  5DIU A;  4DRJ A;  1FKR A;  1KT0 A;  1D7I A;  1J4H A;  5HT1 A;  1D6O A;  2KI3 A;  4J4O A;  1QZ2 A;  4GGQ A;  3UI4 A;  4DRO A;  5HKG A;  2PPN A;  3VAW A;  1FKG A;  2M1I A;  4DRH A;  1FKK A;  4ODM A;  3UI6 A;  5HW6 A;  5DIT A;  1P5Q A;  2ZQS A;  4JFJ A;  4TW6 A;  3O5F A;  1EQ3 A;  3ODK A;  4DT4 A;  3RFW A;  3O5R A;  4QIB A;  2RUQ A;  1R9H A;  4ODR A;  1ZCN A;  3WH0 A;  2IF4 A;  3JYM A;  1JVW A;  3MDY B;  3IHZ A;  5HWB A;  1B6C A;  2ZR6 A;  2KE0 A;  1N1A A;  1PBK A;  4JFK A;  1M5Y A;  1FKJ A;  2FKE A;  2LJ4 A;  3JXV A;  3NRK A;  4ODN A;  4C02 B;  2PBC A;  3IK8 A;  1FD9 A;  4MSP A;  4FAP A;  1J6Y A;  4TW8 A;  1J4I A;  4FN2 A;  2RUC A;  1FKF A;  4LAX A;  4DRQ A;  2ZQV A;  4TW7 A;  5HWC A;  2XP9 A;  1C9H A;  3UI5 A;  1U79 A;  2Y78 A;  1YAT A;  2RUR A;  4JYS A;  1F40 A;  2MPH A;  4TX0 A;  2MLY A;  3O5E A;  4DH0 A;  5GPG A;  3O5L A;  2RQS A;  2LGO A;  5HW7 A;  1ZK6 A;  2DG3 A;  4LAV A;  2XP3 A;  2KFW A;  5I98 A;  1Q6I A;  2RSE A;  4R0X A;  3UQI A;  3KAC A;  2ZQT A;  3H9R B;  5HTG A;  3O5J A;  1FAP A;  3UQA A;  2DG4 A;  3B7X A;  4G50 A;  1Q6H A;  4ODP A;  1HXV A;  1Q6U A;  3KAB A;  4J4N A;  5DIV A;  2M2A A;  2F21 A;  1FKL A;  3O5P A;  1FKI A;  4LAY A;  4DRM A;  2KO7 A;  2VN1 A;  4QT2 A;  1FKH A;  2UZ5 A;  2PPP A;  2ITK A;  4IQC A;  2L2S A;  2AWG A;  2VCD A;  4ITZ A;  1FKS A;  2KR7 A;  3O5M A;  4G2P A;  4W9O A;  2ZR5 A;  2D9F A;  5D75 A;  1ROT A;  5BXJ A;  4U85 A;  2PV2 A;  2DG9 A;  3FAP A;  1D7J A;  1JNT A;  1QPL A;  4U86 A;  2MNT A;  4JFL A;  3CGN A;  4W9P A;  3KAH A;  1L1P A;  1FKT A;  2F4E A;  1KT1 A;  1BKF A;  1QPF A;  1W26 A;  4DRK A;  5B8I C;  2MLX A;  1YW5 A;  4DRP A;  2XP6 A;  3O5Q A;  4IQ2 A;  2PV1 A;  3O5D A;  3PRB A;  4GIV A;  4BF8 A;  3EY6 A;  1JNS A;  2MLZ A;  1ROU A;  4DIP A;  2M08 A;  3KAD A;  4TYO A;  2XP5 A;  1Q1C A;  2N87 A;  3KCE A;  3O5K A;  4DZ2 A;  2LKN A;  4O2T A;  4TNS A;  2XP8 A;  3KZ7 A;  4U84 A;  3JYJ A;  4DRI A;  2OFN A;  2JZV A;  1F8A B;  1J4R A;  4DZ3 A;  3TCZ A;  3CGM A;  4ODK A;  4DRN A;  2MF9 A;  2Q5A A;  1A7X A;  3PA7 A;  1EYM A;  2K8I A;  3UQB A;  1Y0O A;  3LUO A;  4ODO A;  4MGV A;  2RUD A;  2LPV A;  2ZR4 A;  4IPX A;  1BL4 A;  3IKD A;  3I6C A;  4JFI A;  3UF8 A;  3IKG A;  4N19 A;  3TC5 A;  4NNR A;  3RGC A; 
#chains in the Genus database with same CATH topology
 2KGJ A;  3WD4 A;  2DT0 A;  3CHF A;  4Z2J A;  2FAP A;  1FKB A;  2ZQU A;  3O5G A;  2PPO A;  5HW8 A;  4W9Q A;  1XRV A;  2XPA A;  5J6E A;  1CTN A;  1D7H A;  3NTP A;  3NI6 A;  5DIU A;  2A3E A;  1KT0 A;  1O6I A;  1EIB A;  4GGQ A;  1EDQ A;  2WM0 A;  2M1I A;  3BXW A;  1FKK A;  3UI6 A;  1FFR A;  4JFJ A;  3CH9 A;  1GUV A;  4W5U A;  1NWT A;  3RFW A;  3WH0 A;  2IF4 A;  3MDY B;  1JVW A;  2G41 A;  1PBK A;  3ARS A;  2LJ4 A;  3AS0 A;  2DT3 A;  2WLZ A;  4ODN A;  4FAP A;  2RUC A;  1GRJ A;  4TW7 A;  3ARV A;  3B9A A;  1C9H A;  3GTY X;  3UI5 A;  3WIJ A;  2RUR A;  2MLY A;  4MNL A;  3O5L A;  2RQS A;  5HW7 A;  2PN0 A;  2KFW A;  1Q6I A;  2RSE A;  1E6N A;  3FXY A;  3WQV A;  3UQA A;  2ESC A;  3B7X A;  1Q6U A;  4J4N A;  5DIV A;  2M2A A;  5GPR A;  2F21 A;  1E6R A;  1FKI A;  4R5E A;  3ARQ A;  4DRM A;  2VN1 A;  1ZBK A;  1W9P A;  3AQU A;  5HBF A;  2PPP A;  2ITK A;  2L2S A;  4W9O A;  4P8W A;  4DWS C;  5BXJ A;  3PRA A;  4U85 A;  2PV2 A;  1D7J A;  4W9P A;  3KAH A;  1FKT A;  1QPF A;  1W26 A;  3WL1 A;  5B8I C;  4LGX A;  1YW5 A;  3O5Q A;  3CZ8 A;  4GIV A;  3PRB A;  4HBE A;  3B8S A;  3RME A;  1JNS A;  1NWR A;  4MNM A;  4TYO A;  1Q1C A;  2N87 A;  3KCE A;  3O5K A;  4WKH A;  4URI A;  4U84 A;  1OWQ A;  4DRI A;  1HJV A;  2OLH A;  4L72 B;  1LL4 A;  4DRN A;  3PA7 A;  2DSZ A;  3LUO A;  1HKK A;  2DSV A;  2LPV A;  2WLY A;  4WIW A;  3I6C A;  3UF8 A;  3IKG A;  1LL6 A;  3WQW A;  3O5O A;  1FJD A;  1ZBV A;  3WD0 A;  3ALF A;  4ODQ A;  3CHC A;  2B5U B;  2F2D A;  4Z2K A;  1T11 A;  4IT4 A;  4ZPT R;  1NMV A;  3O5I A;  3KAI A;  1PIN A;  1NSG A;  2XPB A;  3KAF A;  3ARX A;  2A3B A;  4JFM A;  2PV3 A;  4P8U A;  4HAR A;  5HT1 A;  3W4R A;  1QZ2 A;  3UI4 A;  4DRO A;  3VAW A;  2O92 A;  1FKG A;  3RM4 A;  2ZQS A;  1ITX A;  2FDM A;  3EIP A;  4Q7N A;  1R9H A;  4DWS B;  4ODR A;  1ZCN A;  2O9O A;  3AS1 A;  3FY1 A;  5DO2 A;  4JFK A;  1XHG A;  1FKJ A;  2FKE A;  2DSU A;  1ZB5 A;  3WD3 A;  4FN2 A;  1FKF A;  4DRQ A;  2ZQV A;  2Y78 A;  2A3C A;  2EUL A;  3UQI A;  3O5J A;  1FAP A;  1Q6H A;  3KAB A;  3WKZ A;  1FKH A;  4IQC A;  2AWG A;  5D75 A;  1ROT A;  3CHD A;  1HJX A;  1QPL A;  4JFL A;  3G6M A;  2WK2 A;  2DPE A;  1KT1 A;  4DRP A;  4IQ2 A;  1LJY A;  4WKA A;  1LG2 A;  4DIP A;  2M08 A;  5GQB A;  2ETN A;  1GOI A;  2LKN A;  2XP8 A;  1RD6 A;  2OFN A;  2JZV A;  2Q5A A;  1A7X A;  3G6L A;  1UR9 A;  1LG1 A;  2YBT A;  1EYM A;  3UQB A;  1Y0O A;  2RUD A;  4NNR A;  5HUA A;  3AS3 A;  1TCO C;  2A3A A;  4ZS6 A;  1FKD A;  4MNJ A;  2XP7 A;  4DZ3 A;  2PI6 A;  4DRJ A;  4QT3 A;  4MTV A;  1FKR A;  4S3K A;  2QF8 A;  1D7I A;  1X6N A;  1ZBC A;  1D6O A;  4J4O A;  4HBO A;  5HKG A;  2F23 A;  2YBU A;  4ODM A;  4MAV A;  5HW6 A;  5DIT A;  1E6Z A;  1W1P A;  4TW6 A;  1HJW A;  1IX5 A;  1EQ3 A;  3O5R A;  4QIB A;  1JND A;  1OGB A;  5HWB A;  1FFQ A;  2ZR6 A;  1N1A A;  3AS2 A;  4WKF A;  4IT6 A;  3JXV A;  3NRK A;  4P8X A;  2PBC A;  5DF0 A;  5DEZ A;  4MSP A;  1J6Y A;  4TW8 A;  4AY1 A;  1GPF A;  4LAX A;  2XP9 A;  1E9L A;  3WL0 A;  1F40 A;  2MPH A;  1LQ0 A;  5GPG A;  1VF8 A;  1ZK6 A;  4LAV A;  1SR0 A;  1W1V A;  4QZV B;  1NH6 A;  3CHE A;  3H9R B;  3KAC A;  3B9D A;  1H0G A;  1KFW A;  4Z2G A;  1HXV A;  1EHN A;  3O5P A;  3ARU A;  1E44 A;  4P8V A;  4LAY A;  1JNE A;  2KO7 A;  4L3N A;  1TFV A;  2DT2 A;  1WNO A;  2UZ5 A;  2VCD A;  1D2K A;  4G2P A;  2ZR5 A;  4ZPW R;  2DG9 A;  3FAP A;  4UDM A;  3CGN A;  1HKI A;  1L1P A;  2F4E A;  4DRK A;  1BKF A;  1SYT A;  1ZL1 A;  3ART A;  1WB0 A;  4BF8 A;  3EY6 A;  2MLZ A;  4NZC A;  1E15 A;  2XP5 A;  3BMB A;  3JYJ A;  1F8A B;  3B9E A;  3CGM A;  4ODK A;  3TCZ A;  2MF9 A;  1ZBW A;  4DWS D;  4Z2H A;  4MGV A;  2ZR4 A;  1BL4 A;  4N19 A;  3TC5 A;  3RGC A;  1UR8 A;  1X6L A;  3TDB A;  4XAK A;  3PRD A;  1NMW A;  4LAW A;  2DSW A;  2P4V A;  2AOS A;  4PTM A;  2XP4 A;  2DT1 A;  4ZPV R;  4DT4 A;  1W1T A;  3KAG A;  4ODL A;  3OOB A;  1NWU A;  3GPK A;  3ARR A;  1J4H A;  1WAW A;  2KI3 A;  2PPN A;  1ZU8 A;  3GU0 A;  4WJX A;  4DRH A;  1P5Q A;  1JCH B;  3O5F A;  3ODK A;  4MPK A;  3QOK A;  2RUQ A;  1W9V A;  3ARW A;  3RM9 A;  3JYM A;  3IHZ A;  1B6C A;  2KE0 A;  1M5Y A;  4ML4 A;  3ALG A;  4KQZ A;  4C02 B;  5JH8 A;  3ARZ A;  3IK8 A;  1FD9 A;  1J4I A;  3WD1 A;  4S3J A;  5HWC A;  1U79 A;  2IUZ A;  1YAT A;  4JYS A;  4TX0 A;  3O5E A;  4DH0 A;  4Q22 A;  2LGO A;  2DG3 A;  2XP3 A;  5I98 A;  3ARP A;  4R0X A;  5HTG A;  4Z2I A;  2ZQT A;  2DG4 A;  4G50 A;  4ODP A;  1FKL A;  1W9U A;  4QT2 A;  4ITZ A;  1W1Y A;  1FKS A;  2KR7 A;  3O5M A;  3WD2 A;  2D9F A;  4Z2L A;  3ARY A;  1HKM A;  4U86 A;  1JNT A;  2MNT A;  4DWS A;  2MLX A;  3PR9 A;  2XP6 A;  4KR0 B;  2PV1 A;  3O5D A;  2B31 A;  2G8Z A;  4NSB A;  1ROU A;  3KAD A;  4DZ2 A;  1NWS A;  4O2T A;  4TNS A;  3KZ7 A;  1H0I A;  3RM8 A;  1LL7 A;  1J4R A;  3ARO A;  1OGG A;  1E6P A;  2K8I A;  4ODO A;  4WK9 A;  4IPX A;  1HKJ A;  3IKD A;  3OA5 A;  4JFI A;  4MNK A;  1K9T A; 
#chains in the Genus database with same CATH homology
 2KGJ A;  3WD4 A;  2DT0 A;  3CHF A;  4Z2J A;  2FAP A;  1FKB A;  2ZQU A;  3O5G A;  2PPO A;  5HW8 A;  4W9Q A;  1XRV A;  2XPA A;  5J6E A;  1CTN A;  1D7H A;  3NTP A;  3NI6 A;  5DIU A;  2A3E A;  1KT0 A;  1O6I A;  1EIB A;  4GGQ A;  1EDQ A;  2WM0 A;  2M1I A;  3BXW A;  1FKK A;  3UI6 A;  1FFR A;  4JFJ A;  3CH9 A;  1GUV A;  4W5U A;  1NWT A;  3RFW A;  3WH0 A;  2IF4 A;  3MDY B;  1JVW A;  2G41 A;  1PBK A;  3ARS A;  2LJ4 A;  3AS0 A;  2DT3 A;  2WLZ A;  4ODN A;  4FAP A;  2RUC A;  4TW7 A;  3ARV A;  3B9A A;  1C9H A;  3UI5 A;  3WIJ A;  2RUR A;  2MLY A;  4MNL A;  3O5L A;  2RQS A;  5HW7 A;  2KFW A;  1Q6I A;  2RSE A;  1E6N A;  3FXY A;  3WQV A;  3UQA A;  2ESC A;  3B7X A;  1Q6U A;  4J4N A;  5DIV A;  2M2A A;  5GPR A;  2F21 A;  1E6R A;  1FKI A;  4R5E A;  3ARQ A;  4DRM A;  2VN1 A;  1ZBK A;  1W9P A;  3AQU A;  5HBF A;  2PPP A;  2ITK A;  2L2S A;  4W9O A;  4P8W A;  4DWS C;  5BXJ A;  3PRA A;  4U85 A;  2PV2 A;  1D7J A;  4W9P A;  3KAH A;  1FKT A;  1QPF A;  1W26 A;  3WL1 A;  5B8I C;  4LGX A;  1YW5 A;  3O5Q A;  3CZ8 A;  4GIV A;  3PRB A;  4HBE A;  3B8S A;  3RME A;  1JNS A;  1NWR A;  4MNM A;  4TYO A;  1Q1C A;  2N87 A;  3KCE A;  3O5K A;  4WKH A;  4URI A;  4U84 A;  1OWQ A;  4DRI A;  1HJV A;  2OLH A;  4L72 B;  1LL4 A;  4DRN A;  3PA7 A;  2DSZ A;  3LUO A;  1HKK A;  2DSV A;  2LPV A;  2WLY A;  4WIW A;  3I6C A;  3UF8 A;  3IKG A;  1LL6 A;  3WQW A;  3O5O A;  1FJD A;  1ZBV A;  3WD0 A;  3ALF A;  4ODQ A;  3CHC A;  2F2D A;  4Z2K A;  1T11 A;  4IT4 A;  4ZPT R;  1NMV A;  3O5I A;  3KAI A;  1PIN A;  1NSG A;  2XPB A;  3KAF A;  3ARX A;  2A3B A;  4JFM A;  2PV3 A;  4P8U A;  4HAR A;  5HT1 A;  3W4R A;  1QZ2 A;  3UI4 A;  4DRO A;  3VAW A;  2O92 A;  1FKG A;  3RM4 A;  2ZQS A;  1ITX A;  2FDM A;  4Q7N A;  1R9H A;  4DWS B;  4ODR A;  1ZCN A;  2O9O A;  3AS1 A;  3FY1 A;  5DO2 A;  4JFK A;  1XHG A;  1FKJ A;  2FKE A;  2DSU A;  1ZB5 A;  3WD3 A;  4FN2 A;  1FKF A;  4DRQ A;  2ZQV A;  2Y78 A;  2A3C A;  3UQI A;  3O5J A;  1FAP A;  1Q6H A;  3KAB A;  3WKZ A;  1FKH A;  4IQC A;  2AWG A;  5D75 A;  1ROT A;  3CHD A;  1HJX A;  1QPL A;  4JFL A;  3G6M A;  2WK2 A;  2DPE A;  1KT1 A;  4DRP A;  4IQ2 A;  1LJY A;  4WKA A;  1LG2 A;  4DIP A;  2M08 A;  5GQB A;  1GOI A;  2LKN A;  2XP8 A;  1RD6 A;  2OFN A;  2JZV A;  2Q5A A;  1A7X A;  3G6L A;  1UR9 A;  1LG1 A;  2YBT A;  1EYM A;  3UQB A;  1Y0O A;  2RUD A;  4NNR A;  5HUA A;  3AS3 A;  1TCO C;  2A3A A;  4ZS6 A;  1FKD A;  4MNJ A;  2XP7 A;  4DZ3 A;  2PI6 A;  4DRJ A;  4QT3 A;  4MTV A;  1FKR A;  4S3K A;  2QF8 A;  1D7I A;  1X6N A;  1ZBC A;  1D6O A;  4J4O A;  4HBO A;  5HKG A;  2YBU A;  4ODM A;  4MAV A;  5HW6 A;  5DIT A;  1E6Z A;  1W1P A;  4TW6 A;  1HJW A;  1IX5 A;  1EQ3 A;  3O5R A;  4QIB A;  1JND A;  1OGB A;  5HWB A;  1FFQ A;  2ZR6 A;  1N1A A;  3AS2 A;  4WKF A;  4IT6 A;  3JXV A;  3NRK A;  4P8X A;  2PBC A;  5DF0 A;  5DEZ A;  4MSP A;  1J6Y A;  4TW8 A;  4AY1 A;  1GPF A;  4LAX A;  2XP9 A;  1E9L A;  3WL0 A;  1F40 A;  2MPH A;  1LQ0 A;  5GPG A;  1VF8 A;  1ZK6 A;  4LAV A;  1SR0 A;  1W1V A;  4QZV B;  1NH6 A;  3CHE A;  3H9R B;  3KAC A;  3B9D A;  1H0G A;  1KFW A;  4Z2G A;  1HXV A;  1EHN A;  3O5P A;  3ARU A;  4P8V A;  4LAY A;  1JNE A;  2KO7 A;  4L3N A;  1TFV A;  2DT2 A;  1WNO A;  2UZ5 A;  2VCD A;  1D2K A;  4G2P A;  2ZR5 A;  4ZPW R;  2DG9 A;  3FAP A;  3CGN A;  1HKI A;  1L1P A;  2F4E A;  4DRK A;  1BKF A;  1SYT A;  1ZL1 A;  3ART A;  1WB0 A;  4BF8 A;  3EY6 A;  2MLZ A;  4NZC A;  1E15 A;  2XP5 A;  3JYJ A;  1F8A B;  3B9E A;  3CGM A;  4ODK A;  3TCZ A;  2MF9 A;  1ZBW A;  4DWS D;  4Z2H A;  4MGV A;  2ZR4 A;  1BL4 A;  4N19 A;  3TC5 A;  3RGC A;  1UR8 A;  1X6L A;  3TDB A;  4XAK A;  3PRD A;  1NMW A;  4LAW A;  2DSW A;  2AOS A;  4PTM A;  2XP4 A;  2DT1 A;  4ZPV R;  4DT4 A;  1W1T A;  3KAG A;  4ODL A;  3OOB A;  1NWU A;  3GPK A;  3ARR A;  1J4H A;  1WAW A;  2KI3 A;  2PPN A;  1ZU8 A;  4WJX A;  4DRH A;  1P5Q A;  3O5F A;  3ODK A;  4MPK A;  3QOK A;  2RUQ A;  1W9V A;  3ARW A;  3RM9 A;  3JYM A;  3IHZ A;  1B6C A;  2KE0 A;  1M5Y A;  4ML4 A;  3ALG A;  4KQZ A;  4C02 B;  5JH8 A;  3ARZ A;  3IK8 A;  1FD9 A;  1J4I A;  3WD1 A;  4S3J A;  5HWC A;  1U79 A;  2IUZ A;  1YAT A;  4JYS A;  4TX0 A;  3O5E A;  4DH0 A;  4Q22 A;  2LGO A;  2DG3 A;  2XP3 A;  5I98 A;  3ARP A;  4R0X A;  5HTG A;  4Z2I A;  2ZQT A;  2DG4 A;  4G50 A;  4ODP A;  1FKL A;  1W9U A;  4QT2 A;  4ITZ A;  1W1Y A;  1FKS A;  2KR7 A;  3O5M A;  3WD2 A;  2D9F A;  4Z2L A;  3ARY A;  1HKM A;  4U86 A;  1JNT A;  2MNT A;  4DWS A;  2MLX A;  3PR9 A;  2XP6 A;  4KR0 B;  2PV1 A;  3O5D A;  2B31 A;  2G8Z A;  4NSB A;  1ROU A;  3KAD A;  4DZ2 A;  1NWS A;  4O2T A;  4TNS A;  3KZ7 A;  1H0I A;  3RM8 A;  1LL7 A;  1J4R A;  3ARO A;  1OGG A;  1E6P A;  2K8I A;  4ODO A;  4WK9 A;  4IPX A;  1HKJ A;  3IKD A;  3OA5 A;  4JFI A;  4MNK A;  1K9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...