2MNTA

Solution structure of the ppiase domain of tbpar42
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
PTERHFYHVLVKHKDVRRPSSLAPRNKGEKITRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of TbPar42
rcsb
source organism Trypanosoma brucei brucei
molecule tags Isomerase
molecule keywords TbPar42
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2mntA00
3TCZA 3UQBA 4ODRA 1FKJA 2LKNA 4LAYA 1QPFA 2XP5A 1M5YA 2D9FA 1J6YA 1FKBA 1FKTA 3ODKA 3KCEA 3PRBA 3O5LA 4TW8A 4U86A 5B8IC 5I98A 4DRHA 5D75A 1FKKA 2F21A 3RFWA 1J4RA 5HWBA 1JNSA 2AWGA 4TX0A 2ZR5A 4DRMA 1U79A 4ODOA 4QT3A 3UF8A 3O5OA 1FJDA 4JFLA 2PPNA 4ODKA 1F8AB 3PA7A 4GIVA 1FAPA 2FKEA 4MGVA 4DROA 1W26A 2F2DA 2MPHA 5DIUA 1TCOC 5GPGA 2LPVA 4BF8A 1ZCNA 4IPXA 4LAWA 1C9HA 5HTGA 1FKGA 2MF9A 2LJ4A 1FKDA 3IKDA 1Q6IA 3KAGA 4U84A 1D7JA 1FKRA 2PPOA 3O5MA 1KT0A 1BKFA 1NMVA 4QIBA 4U85A 5HUAA 2VN1A 4ODPA 4DIPA 3FAPA 4G2PA 2PV3A 3NRKA 4TW6A 2DG4A 3MDYB 3O5RA 3RGCA 3O5EA 3KAIA 4G50A 1ROUA 5HWCA 1NMWA 1D7HA 4MSPA 2ZR4A 4LAXA 1FD9A 3TDBA 2VCDA 2M1IA 2Y78A 3OOBA 2UZ5A 4R0XA 1QZ2A 3O5DA 1J4HA 1PBKA 3JYJA 2KO7A 4ODQA 5HT1A 3UI6A 2DG3A 1Q1CA 1L1PA 5DITA 3KAFA 2XP6A 1FKIA 4O2TA 1F40A 1KT1A 1BL4A 2RUCA 1N1AA 2KI3A 5J6EA 1Y0OA 1Q6UA 1QPLA 3JXVA 3O5QA 1FKLA 3B7XA 1P5QA 2RUDA 2JZVA 2XP7A 1J4IA 2KFWA 1FKSA 3UI4A 4C02B 3GPKA 3TC5A 2MLYA 2RURA 3O5JA 4GGQA 3KADA 1D7IA 1ZK6A 4DRNA 1JNTA 3JYMA 4DRQA 2ZR6A 4JFIA 4J4NA 2XPAA 2XP4A 4N19A 2K8IA 2XP9A 4J4OA 4FAPA 1EQ3A 5BXJA 3O5GA 2PV1A 3NI6A 2IF4A 5DIVA 2FAPA 1FKHA 1ROTA 2ZQUA 3KABA 1EYMA 1HXVA 3KAHA 3I6CA 4IQ2A 4W9QA 2Q5AA 3IK8A 4IQCA 5HW8A 4JFJA 1R9HA 3UQAA 3CGMA 2MNTA 3KACA 4W9OA 3CGNA 4QT2A 1D6OA 4JYSA 4DRKA 4W9PA 3IKGA 2KR7A 3O5KA 1A7XA 1T11A 4ITZA 5HKGA 4ODNA 2RQSA 3VAWA 4TW7A 2RUQA 2F4EA 2KE0A 2MLZA 3PRDA 4DRIA 3KZ7A 1JVWA 1B6CA 2XPBA 3H9RB 2DG9A 4DRJA 2L2SA 2M08A 4DRPA 2RSEA 5HW7A 1NSGA 1YATA 2XP8A 2PPPA 4JFKA 2ZQSA 4DZ3A 2LGOA 4ODLA 4DT4A 4LAVA 1FKFA 4TNSA 2PV2A 4DZ2A 3NTPA 3UQIA 2N87A 4FN2A 2ZQVA 2ZQTA 4DH0A 4ODMA 1Q6HA 2KGJA 4NNRA 5HW6A 2MLXA 1YW5A 3LUOA 2M2AA 2XP3A 4TYOA 3EY6A 3IHZA 3O5PA 3O5FA 3WH0A 3UI5A 3O5IA 1PINA 2ITKA 4JFMA 2OFNA 2PBCA
chains in the Genus database with same CATH superfamily
3UQBA 2F23A 3O5LA 5B8IC 4MNJA 4HARA 1JNSA 4TX0A 1WAWA 2ZR5A 3FY1A 4ODOA 4QT3A 3WD2A 1FJDA 4ODKA 1F8AB 4DROA 1FAPA 1UR9A 2F2DA 2LPVA 4ML4A 1SR0A 3B9DA 5HTGA 2MF9A 3CHCA 3KAGA 4U84A 1Q6IA 1D7JA 3ARZA 3O5MA 5HUAA 3ARQA 1H0GA 3FAPA 4G2PA 2PV3A 1D2KA 2DT1A 3RGCA 4MSPA 1FD9A 2VCDA 3B9AA 4ODQA 3WKZA 5HT1A 3WL0A 4MNMA 1HJXA 1E9LA 1N1AA 1Q6UA 1QPLA 3JXVA 3ARYA 2RUDA 1J4IA 3UI4A 4DWSA 2DPEA 4Z2GA 3CHFA 2RURA 4GGQA 3KADA 5GPRA 3WL1A 4P8WA 1FFRA 1JNTA 4J4NA 3WD4A 4NSBA 2P4VA 5DO2A 5DIVA 2FAPA 1FKHA 1ROTA 3AS2A 4IQ2A 3I6CA 1NWRA 3WD1A 1W1YA 5HW8A 1F40A 1FFQA 2MNTA 3KACA 1LG2A 4JYSA 2DSZA 2ETNA 2KR7A 3O5KA 2O92A 4ODNA 4TW7A 2RUQA 2F4EA 3PRDA 3KZ7A 1B6CA 2O9OA 1HKKA 4JFKA 4ODLA 4LAVA 1HKMA 1FKFA 1OGGA 3NTPA 2PN0A 2N87A 1E6ZA 2ZQTA 3AS1A 2DSUA 3LUOA 2M2AA 4TYOA 3O5PA 3GTYX 1KFWA 3TCZA 1FKJA 3ARUA 4Z2HA 1M5YA 1EDQA 4Z2IA 3EIPA 1H0IA 3KCEA 4TW8A 5HWBA 3PRAA 4DRMA 3O5OA 1ZBVA 1K9TA 3PA7A 2FKEA 1W26A 4LAWA 4DWSD 4HBOA 2LJ4A 1FKDA 3ARRA 3IKDA 4U85A 4DIPA 2A3AA 2ESCA 4TW6A 3WD3A 1LJYA 4G50A 1ROUA 4HBEA 4IT4A 1NMWA 2ZR4A 4LAXA 1ITXA 3RM4A 4MTVA 4R0XA 3TDBA 3AQUA 3OOBA 1WB0A 2UZ5A 1J4HA 2KO7A 3UI6A 1HKJA 4URIA 1ZL1A 3KAFA 1BL4A 2A3CA 4MAVA 4WIWA 1FKLA 3B7XA 2YBTA 4WKFA 4ZPWR 1W9UA 4Z2LA 2WLYA 1E44A 3AROA 1ZK6A 4DRNA 1ZBKA 1LL6A 3G6LA 4N19A 3WQVA 3O5GA 3ALGA 2PV1A 3KAHA 1R9HA 1NWUA 5DF0A 3CGNA 3RM9A 3WIJA 1D6OA 4DRKA 4LGXA 4WJXA 3CHDA 3RMEA 2DT0A 3VAWA 2A3EA 3G6MA 2KE0A 4DRIA 1JVWA 2L2SA 2M08A 2RSEA 1NSGA 2XP8A 2PPPA 4DZ3A 2ZQSA 2LGOA 1W9PA 4DT4A 5HBFA 2PV2A 2WM0A 1XHGA 4DH0A 4NNRA 5HW6A 1E6NA 3ARVA 3EY6A 4R5EA 1W1PA 3UI5A 3O5IA 1PINA 2ITKA 4DWSC 2DT3A 4ODRA 1GRJA 1QPFA 1ZBWA 4QZVB 2XP5A 1NWTA 4DWSB 3GU0A 3ARXA 1IX5A 5I98A 3AS3A 4Q22A 4DRHA 1FKKA 3RFWA 4UDMA 4JFLA 1E6RA 5DIUA 2MPHA 2IUZA 2AOSA 5GPGA 1ZCNA 1FKRA 3ARWA 2PPOA 1BKFA 4WK9A 4ODPA 4KQZA 2DSWA 2DG4A 3MDYB 3KAIA 5HWCA 1GPFA 1VF8A 1TFVA 3CHEA 4ZPVR 3WD0A 2M1IA 1QZ2A 3O5DA 1PBKA 4Z2JA 1E6PA 2DG3A 1L1PA 3ARPA 1FKIA 1KT1A 2RUCA 2KI3A 3BMBA 1Y0OA 3O5QA 2XP7A 4NZCA 1JNDA 3GPKA 1W1VA 3TC5A 2MLYA 3O5JA 1D7IA 1RD6A 4W5UA 3JYMA 2XP4A 4J4OA 1EQ3A 5BXJA 3NI6A 1LL4A 3OA5A 1EYMA 1HKIA 3UQAA 1W9VA 3IK8A 4IQCA 4Q7NA 4JFJA 3CGMA 1HJWA 4L72B 4W9OA 2B5UB 4QT2A 4WKAA 1O6IA 4W9PA 1T11A 4ITZA 3CH9A 5HKGA 1GOIA 2PI6A 3ARTA 2MLZA 1X6LA 4DRJA 3H9RB 4DRPA 2OLHA 4ZS6A 3CZ8A 3B9EA 4MNLA 4DZ2A 3UQIA 4FN2A 2ZQVA 2KGJA 4WKHA 2MLXA 2B31A 2XP3A 3IHZA 3RM8A 2PBCA 2LKNA 4LAYA 4P8XA 1E15A 2D9FA 1J6YA 1FKBA 1FKTA 3ODKA 3PRBA 3B8SA 4U86A 4ZPTR 3ALFA 5D75A 2F21A 4IT6A 1J4RA 3PR9A 2AWGA 1LG1A 4MPKA 1U79A 3UF8A 1GUVA 2PPNA 4GIVA 4MGVA 3WQWA 1TCOC 1WNOA 4MNKA 4Z2KA 4BF8A 4IPXA 1C9HA 4PTMA 1FKGA 2A3BA 3BXWA 1KT0A 4QIBA 1NMVA 2VN1A 3NRKA 1NH6A 3O5RA 3O5EA 4XAKA 1D7HA 2QF8A 4AY1A 2Y78A 5JH8A 3JYJA 1JNEA 4S3JA 1Q1CA 1HJVA 1OGBA 1JCHB 1EHNA 5DITA 2XP6A 4O2TA 2FDMA 4L3NA 1ZB5A 1OWQA 5J6EA 4KR0B 4S3KA 1UR8A 1P5QA 2JZVA 2KFWA 4C02B 1FKSA 1XRVA 3W4RA 1ZBCA 1CTNA 2DT2A 2G8ZA 1LL7A 1LQ0A 4P8UA 4DRQA 1X6NA 2ZR6A 4JFIA 2XPAA 2K8IA 3FXYA 4P8VA 2XP9A 4FAPA 2IF4A 2ZQUA 3KABA 1HXVA 4W9QA 2Q5AA 3ARSA 2G41A 3IKGA 3QOKA 1A7XA 1W1TA 2RQSA 1ZU8A 2XPBA 2DG9A 5HW7A 1SYTA 1YATA 5GQBA 2WLZA 4TNSA 2DSVA 4ODMA 1Q6HA 2WK2A 5DEZA 1NWSA 2YBUA 1YW5A 2EULA 3AS0A 1EIBA 3O5FA 3WH0A 4JFMA 2OFNA
chains in the Genus database with same CATH topology
3UQBA 3O5LA 5B8IC 4MNJA 4HARA 1JNSA 4TX0A 1WAWA 2ZR5A 3FY1A 4ODOA 4QT3A 3WD2A 1FJDA 4ODKA 1F8AB 4DROA 1FAPA 1UR9A 2F2DA 2LPVA 4ML4A 1SR0A 3B9DA 5HTGA 2MF9A 3CHCA 3KAGA 4U84A 1Q6IA 1D7JA 3ARZA 3O5MA 5HUAA 3ARQA 1H0GA 3FAPA 4G2PA 2PV3A 1D2KA 2DT1A 3RGCA 4MSPA 1FD9A 2VCDA 3B9AA 4ODQA 3WKZA 5HT1A 3WL0A 4MNMA 1HJXA 1E9LA 1N1AA 1Q6UA 1QPLA 3JXVA 3ARYA 2RUDA 1J4IA 3UI4A 4DWSA 2DPEA 4Z2GA 3CHFA 2RURA 4GGQA 3KADA 5GPRA 3WL1A 4P8WA 1FFRA 1JNTA 4J4NA 3WD4A 4NSBA 5DO2A 5DIVA 2FAPA 1FKHA 1ROTA 3AS2A 4IQ2A 3I6CA 1NWRA 3WD1A 1W1YA 5HW8A 1F40A 1FFQA 2MNTA 3KACA 1LG2A 4JYSA 2DSZA 2KR7A 3O5KA 2O92A 4ODNA 4TW7A 2RUQA 2F4EA 3PRDA 3KZ7A 1B6CA 2O9OA 1HKKA 4JFKA 4ODLA 4LAVA 1HKMA 1FKFA 1OGGA 3NTPA 2N87A 1E6ZA 2ZQTA 3AS1A 2DSUA 3LUOA 2M2AA 4TYOA 3O5PA 1KFWA 3TCZA 1FKJA 3ARUA 4Z2HA 1M5YA 1EDQA 4Z2IA 1H0IA 3KCEA 4TW8A 5HWBA 3PRAA 4DRMA 3O5OA 1ZBVA 1K9TA 3PA7A 2FKEA 1W26A 4LAWA 4DWSD 4HBOA 2LJ4A 1FKDA 3ARRA 3IKDA 4U85A 4DIPA 2A3AA 2ESCA 4TW6A 3WD3A 1LJYA 4G50A 1ROUA 4HBEA 4IT4A 1NMWA 2ZR4A 4LAXA 1ITXA 3RM4A 4MTVA 4R0XA 3TDBA 3AQUA 3OOBA 1WB0A 2UZ5A 1J4HA 2KO7A 3UI6A 1HKJA 4URIA 1ZL1A 3KAFA 1BL4A 2A3CA 4MAVA 4WIWA 1FKLA 3B7XA 2YBTA 4WKFA 4ZPWR 1W9UA 4Z2LA 2WLYA 3AROA 1ZK6A 4DRNA 1ZBKA 1LL6A 3G6LA 4N19A 3WQVA 3O5GA 3ALGA 2PV1A 3KAHA 1R9HA 1NWUA 5DF0A 3CGNA 3RM9A 3WIJA 1D6OA 4DRKA 4LGXA 4WJXA 3CHDA 3RMEA 2DT0A 3VAWA 2A3EA 3G6MA 2KE0A 4DRIA 1JVWA 2L2SA 2M08A 2RSEA 1NSGA 2XP8A 2PPPA 4DZ3A 2ZQSA 2LGOA 1W9PA 4DT4A 5HBFA 2PV2A 2WM0A 1XHGA 4DH0A 4NNRA 5HW6A 1E6NA 3ARVA 3EY6A 4R5EA 1W1PA 3UI5A 3O5IA 1PINA 2ITKA 4DWSC 2DT3A 4ODRA 1ZBWA 1QPFA 4QZVB 2XP5A 1NWTA 4DWSB 3ARXA 1IX5A 5I98A 3AS3A 4Q22A 4DRHA 1FKKA 3RFWA 4JFLA 1E6RA 5DIUA 2MPHA 2IUZA 2AOSA 5GPGA 1ZCNA 1FKRA 3ARWA 2PPOA 1BKFA 4WK9A 4ODPA 4KQZA 2DSWA 2DG4A 3MDYB 3KAIA 5HWCA 1GPFA 1VF8A 1TFVA 3CHEA 4ZPVR 3WD0A 2M1IA 1QZ2A 3O5DA 1PBKA 4Z2JA 1E6PA 2DG3A 1L1PA 3ARPA 1FKIA 1KT1A 2RUCA 2KI3A 1Y0OA 3O5QA 2XP7A 4NZCA 1JNDA 3GPKA 1W1VA 3TC5A 2MLYA 3O5JA 1D7IA 1RD6A 4W5UA 3JYMA 2XP4A 4J4OA 1EQ3A 5BXJA 3NI6A 1LL4A 3OA5A 1EYMA 1HKIA 3UQAA 1W9VA 3IK8A 4IQCA 4Q7NA 4JFJA 3CGMA 1HJWA 4L72B 4W9OA 4QT2A 4WKAA 1O6IA 4W9PA 1T11A 4ITZA 3CH9A 5HKGA 1GOIA 2PI6A 3ARTA 2MLZA 1X6LA 4DRJA 3H9RB 4DRPA 2OLHA 4ZS6A 3CZ8A 3B9EA 4MNLA 4DZ2A 3UQIA 4FN2A 2ZQVA 2KGJA 4WKHA 2MLXA 2B31A 2XP3A 3IHZA 3RM8A 2PBCA 2LKNA 4LAYA 4P8XA 1E15A 2D9FA 1J6YA 1FKBA 1FKTA 3ODKA 3PRBA 3B8SA 4U86A 4ZPTR 3ALFA 5D75A 2F21A 4IT6A 1J4RA 3PR9A 2AWGA 1LG1A 4MPKA 1U79A 3UF8A 1GUVA 2PPNA 4GIVA 4MGVA 3WQWA 1TCOC 1WNOA 4MNKA 4Z2KA 4BF8A 4IPXA 1C9HA 4PTMA 1FKGA 2A3BA 3BXWA 1KT0A 4QIBA 1NMVA 2VN1A 3NRKA 1NH6A 3O5RA 3O5EA 4XAKA 1D7HA 2QF8A 4AY1A 2Y78A 5JH8A 3JYJA 1JNEA 4S3JA 1Q1CA 1HJVA 1OGBA 1EHNA 5DITA 2XP6A 4O2TA 2FDMA 4L3NA 1ZB5A 1OWQA 5J6EA 4KR0B 4S3KA 1UR8A 1P5QA 2JZVA 2KFWA 4C02B 1FKSA 1XRVA 3W4RA 1ZBCA 1CTNA 2DT2A 2G8ZA 1LL7A 1LQ0A 4P8UA 4DRQA 1X6NA 2ZR6A 4JFIA 2XPAA 2K8IA 3FXYA 4P8VA 2XP9A 4FAPA 2IF4A 2ZQUA 3KABA 1HXVA 4W9QA 2Q5AA 3ARSA 2G41A 3IKGA 3QOKA 1A7XA 1W1TA 2RQSA 1ZU8A 2XPBA 2DG9A 5HW7A 1SYTA 1YATA 5GQBA 2WLZA 4TNSA 2DSVA 4ODMA 1Q6HA 2WK2A 5DEZA 1NWSA 2YBUA 1YW5A 3AS0A 1EIBA 3O5FA 3WH0A 4JFMA 2OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCZ A;  3UQB A;  4ODR A;  1FKJ A;  2LKN A;  4LAY A;  1QPF A;  2XP5 A;  1M5Y A;  2D9F A;  1J6Y A;  1FKB A;  1FKT A;  3ODK A;  3KCE A;  3PRB A;  3O5L A;  4TW8 A;  4U86 A;  5B8I C;  5I98 A;  4DRH A;  5D75 A;  1FKK A;  2F21 A;  3RFW A;  1J4R A;  5HWB A;  1JNS A;  2AWG A;  4TX0 A;  2ZR5 A;  4DRM A;  1U79 A;  4ODO A;  4QT3 A;  3UF8 A;  3O5O A;  1FJD A;  4JFL A;  2PPN A;  4ODK A;  1F8A B;  3PA7 A;  4GIV A;  1FAP A;  2FKE A;  4MGV A;  4DRO A;  1W26 A;  2F2D A;  2MPH A;  5DIU A;  1TCO C;  5GPG A;  2LPV A;  4BF8 A;  1ZCN A;  4IPX A;  4LAW A;  1C9H A;  5HTG A;  1FKG A;  2MF9 A;  2LJ4 A;  1FKD A;  3IKD A;  1Q6I A;  3KAG A;  4U84 A;  1D7J A;  1FKR A;  2PPO A;  3O5M A;  1KT0 A;  1BKF A;  1NMV A;  4QIB A;  4U85 A;  5HUA A;  2VN1 A;  4ODP A;  4DIP A;  3FAP A;  4G2P A;  2PV3 A;  3NRK A;  4TW6 A;  2DG4 A;  3MDY B;  3O5R A;  3RGC A;  3O5E A;  3KAI A;  4G50 A;  1ROU A;  5HWC A;  1NMW A;  1D7H A;  4MSP A;  2ZR4 A;  4LAX A;  1FD9 A;  3TDB A;  2VCD A;  2M1I A;  2Y78 A;  3OOB A;  2UZ5 A;  4R0X A;  1QZ2 A;  3O5D A;  1J4H A;  1PBK A;  3JYJ A;  2KO7 A;  4ODQ A;  5HT1 A;  3UI6 A;  2DG3 A;  1Q1C A;  1L1P A;  5DIT A;  3KAF A;  2XP6 A;  1FKI A;  4O2T A;  1F40 A;  1KT1 A;  1BL4 A;  2RUC A;  1N1A A;  2KI3 A;  5J6E A;  1Y0O A;  1Q6U A;  1QPL A;  3JXV A;  3O5Q A;  1FKL A;  3B7X A;  1P5Q A;  2RUD A;  2JZV A;  2XP7 A;  1J4I A;  2KFW A;  1FKS A;  3UI4 A;  4C02 B;  3GPK A;  3TC5 A;  2MLY A;  2RUR A;  3O5J A;  4GGQ A;  3KAD A;  1D7I A;  1ZK6 A;  4DRN A;  1JNT A;  3JYM A;  4DRQ A;  2ZR6 A;  4JFI A;  4J4N A;  2XPA A;  2XP4 A;  4N19 A;  2K8I A;  2XP9 A;  4J4O A;  4FAP A;  1EQ3 A;  5BXJ A;  3O5G A;  2PV1 A;  3NI6 A;  2IF4 A;  5DIV A;  2FAP A;  1FKH A;  1ROT A;  2ZQU A;  3KAB A;  1EYM A;  1HXV A;  3KAH A;  3I6C A;  4IQ2 A;  4W9Q A;  2Q5A A;  3IK8 A;  4IQC A;  5HW8 A;  4JFJ A;  1R9H A;  3UQA A;  3CGM A;  2MNT A;  3KAC A;  4W9O A;  3CGN A;  4QT2 A;  1D6O A;  4JYS A;  4DRK A;  4W9P A;  3IKG A;  2KR7 A;  3O5K A;  1A7X A;  1T11 A;  4ITZ A;  5HKG A;  4ODN A;  2RQS A;  3VAW A;  4TW7 A;  2RUQ A;  2F4E A;  2KE0 A;  2MLZ A;  3PRD A;  4DRI A;  3KZ7 A;  1JVW A;  1B6C A;  2XPB A;  3H9R B;  2DG9 A;  4DRJ A;  2L2S A;  2M08 A;  4DRP A;  2RSE A;  5HW7 A;  1NSG A;  1YAT A;  2XP8 A;  2PPP A;  4JFK A;  2ZQS A;  4DZ3 A;  2LGO A;  4ODL A;  4DT4 A;  4LAV A;  1FKF A;  4TNS A;  2PV2 A;  4DZ2 A;  3NTP A;  3UQI A;  2N87 A;  4FN2 A;  2ZQV A;  2ZQT A;  4DH0 A;  4ODM A;  1Q6H A;  2KGJ A;  4NNR A;  5HW6 A;  2MLX A;  1YW5 A;  3LUO A;  2M2A A;  2XP3 A;  4TYO A;  3EY6 A;  3IHZ A;  3O5P A;  3O5F A;  3WH0 A;  3UI5 A;  3O5I A;  1PIN A;  2ITK A;  4JFM A;  2OFN A;  2PBC A; 
#chains in the Genus database with same CATH topology
 3UQB A;  2F23 A;  3O5L A;  5B8I C;  4MNJ A;  4HAR A;  1JNS A;  4TX0 A;  1WAW A;  2ZR5 A;  3FY1 A;  4ODO A;  4QT3 A;  3WD2 A;  1FJD A;  4ODK A;  1F8A B;  4DRO A;  1FAP A;  1UR9 A;  2F2D A;  2LPV A;  4ML4 A;  1SR0 A;  3B9D A;  5HTG A;  2MF9 A;  3CHC A;  3KAG A;  4U84 A;  1Q6I A;  1D7J A;  3ARZ A;  3O5M A;  5HUA A;  3ARQ A;  1H0G A;  3FAP A;  4G2P A;  2PV3 A;  1D2K A;  2DT1 A;  3RGC A;  4MSP A;  1FD9 A;  2VCD A;  3B9A A;  4ODQ A;  3WKZ A;  5HT1 A;  3WL0 A;  4MNM A;  1HJX A;  1E9L A;  1N1A A;  1Q6U A;  1QPL A;  3JXV A;  3ARY A;  2RUD A;  1J4I A;  3UI4 A;  4DWS A;  2DPE A;  4Z2G A;  3CHF A;  2RUR A;  4GGQ A;  3KAD A;  5GPR A;  3WL1 A;  4P8W A;  1FFR A;  1JNT A;  4J4N A;  3WD4 A;  4NSB A;  2P4V A;  5DO2 A;  5DIV A;  2FAP A;  1FKH A;  1ROT A;  3AS2 A;  4IQ2 A;  3I6C A;  1NWR A;  3WD1 A;  1W1Y A;  5HW8 A;  1F40 A;  1FFQ A;  2MNT A;  3KAC A;  1LG2 A;  4JYS A;  2DSZ A;  2ETN A;  2KR7 A;  3O5K A;  2O92 A;  4ODN A;  4TW7 A;  2RUQ A;  2F4E A;  3PRD A;  3KZ7 A;  1B6C A;  2O9O A;  1HKK A;  4JFK A;  4ODL A;  4LAV A;  1HKM A;  1FKF A;  1OGG A;  3NTP A;  2PN0 A;  2N87 A;  1E6Z A;  2ZQT A;  3AS1 A;  2DSU A;  3LUO A;  2M2A A;  4TYO A;  3O5P A;  3GTY X;  1KFW A;  3TCZ A;  1FKJ A;  3ARU A;  4Z2H A;  1M5Y A;  1EDQ A;  4Z2I A;  3EIP A;  1H0I A;  3KCE A;  4TW8 A;  5HWB A;  3PRA A;  4DRM A;  3O5O A;  1ZBV A;  1K9T A;  3PA7 A;  2FKE A;  1W26 A;  4LAW A;  4DWS D;  4HBO A;  2LJ4 A;  1FKD A;  3ARR A;  3IKD A;  4U85 A;  4DIP A;  2A3A A;  2ESC A;  4TW6 A;  3WD3 A;  1LJY A;  4G50 A;  1ROU A;  4HBE A;  4IT4 A;  1NMW A;  2ZR4 A;  4LAX A;  1ITX A;  3RM4 A;  4MTV A;  4R0X A;  3TDB A;  3AQU A;  3OOB A;  1WB0 A;  2UZ5 A;  1J4H A;  2KO7 A;  3UI6 A;  1HKJ A;  4URI A;  1ZL1 A;  3KAF A;  1BL4 A;  2A3C A;  4MAV A;  4WIW A;  1FKL A;  3B7X A;  2YBT A;  4WKF A;  4ZPW R;  1W9U A;  4Z2L A;  2WLY A;  1E44 A;  3ARO A;  1ZK6 A;  4DRN A;  1ZBK A;  1LL6 A;  3G6L A;  4N19 A;  3WQV A;  3O5G A;  3ALG A;  2PV1 A;  3KAH A;  1R9H A;  1NWU A;  5DF0 A;  3CGN A;  3RM9 A;  3WIJ A;  1D6O A;  4DRK A;  4LGX A;  4WJX A;  3CHD A;  3RME A;  2DT0 A;  3VAW A;  2A3E A;  3G6M A;  2KE0 A;  4DRI A;  1JVW A;  2L2S A;  2M08 A;  2RSE A;  1NSG A;  2XP8 A;  2PPP A;  4DZ3 A;  2ZQS A;  2LGO A;  1W9P A;  4DT4 A;  5HBF A;  2PV2 A;  2WM0 A;  1XHG A;  4DH0 A;  4NNR A;  5HW6 A;  1E6N A;  3ARV A;  3EY6 A;  4R5E A;  1W1P A;  3UI5 A;  3O5I A;  1PIN A;  2ITK A;  4DWS C;  2DT3 A;  4ODR A;  1GRJ A;  1QPF A;  1ZBW A;  4QZV B;  2XP5 A;  1NWT A;  4DWS B;  3GU0 A;  3ARX A;  1IX5 A;  5I98 A;  3AS3 A;  4Q22 A;  4DRH A;  1FKK A;  3RFW A;  4UDM A;  4JFL A;  1E6R A;  5DIU A;  2MPH A;  2IUZ A;  2AOS A;  5GPG A;  1ZCN A;  1FKR A;  3ARW A;  2PPO A;  1BKF A;  4WK9 A;  4ODP A;  4KQZ A;  2DSW A;  2DG4 A;  3MDY B;  3KAI A;  5HWC A;  1GPF A;  1VF8 A;  1TFV A;  3CHE A;  4ZPV R;  3WD0 A;  2M1I A;  1QZ2 A;  3O5D A;  1PBK A;  4Z2J A;  1E6P A;  2DG3 A;  1L1P A;  3ARP A;  1FKI A;  1KT1 A;  2RUC A;  2KI3 A;  3BMB A;  1Y0O A;  3O5Q A;  2XP7 A;  4NZC A;  1JND A;  3GPK A;  1W1V A;  3TC5 A;  2MLY A;  3O5J A;  1D7I A;  1RD6 A;  4W5U A;  3JYM A;  2XP4 A;  4J4O A;  1EQ3 A;  5BXJ A;  3NI6 A;  1LL4 A;  3OA5 A;  1EYM A;  1HKI A;  3UQA A;  1W9V A;  3IK8 A;  4IQC A;  4Q7N A;  4JFJ A;  3CGM A;  1HJW A;  4L72 B;  4W9O A;  2B5U B;  4QT2 A;  4WKA A;  1O6I A;  4W9P A;  1T11 A;  4ITZ A;  3CH9 A;  5HKG A;  1GOI A;  2PI6 A;  3ART A;  2MLZ A;  1X6L A;  4DRJ A;  3H9R B;  4DRP A;  2OLH A;  4ZS6 A;  3CZ8 A;  3B9E A;  4MNL A;  4DZ2 A;  3UQI A;  4FN2 A;  2ZQV A;  2KGJ A;  4WKH A;  2MLX A;  2B31 A;  2XP3 A;  3IHZ A;  3RM8 A;  2PBC A;  2LKN A;  4LAY A;  4P8X A;  1E15 A;  2D9F A;  1J6Y A;  1FKB A;  1FKT A;  3ODK A;  3PRB A;  3B8S A;  4U86 A;  4ZPT R;  3ALF A;  5D75 A;  2F21 A;  4IT6 A;  1J4R A;  3PR9 A;  2AWG A;  1LG1 A;  4MPK A;  1U79 A;  3UF8 A;  1GUV A;  2PPN A;  4GIV A;  4MGV A;  3WQW A;  1TCO C;  1WNO A;  4MNK A;  4Z2K A;  4BF8 A;  4IPX A;  1C9H A;  4PTM A;  1FKG A;  2A3B A;  3BXW A;  1KT0 A;  4QIB A;  1NMV A;  2VN1 A;  3NRK A;  1NH6 A;  3O5R A;  3O5E A;  4XAK A;  1D7H A;  2QF8 A;  4AY1 A;  2Y78 A;  5JH8 A;  3JYJ A;  1JNE A;  4S3J A;  1Q1C A;  1HJV A;  1OGB A;  1JCH B;  1EHN A;  5DIT A;  2XP6 A;  4O2T A;  2FDM A;  4L3N A;  1ZB5 A;  1OWQ A;  5J6E A;  4KR0 B;  4S3K A;  1UR8 A;  1P5Q A;  2JZV A;  2KFW A;  4C02 B;  1FKS A;  1XRV A;  3W4R A;  1ZBC A;  1CTN A;  2DT2 A;  2G8Z A;  1LL7 A;  1LQ0 A;  4P8U A;  4DRQ A;  1X6N A;  2ZR6 A;  4JFI A;  2XPA A;  2K8I A;  3FXY A;  4P8V A;  2XP9 A;  4FAP A;  2IF4 A;  2ZQU A;  3KAB A;  1HXV A;  4W9Q A;  2Q5A A;  3ARS A;  2G41 A;  3IKG A;  3QOK A;  1A7X A;  1W1T A;  2RQS A;  1ZU8 A;  2XPB A;  2DG9 A;  5HW7 A;  1SYT A;  1YAT A;  5GQB A;  2WLZ A;  4TNS A;  2DSV A;  4ODM A;  1Q6H A;  2WK2 A;  5DEZ A;  1NWS A;  2YBU A;  1YW5 A;  2EUL A;  3AS0 A;  1EIB A;  3O5F A;  3WH0 A;  4JFM A;  2OFN A; 
#chains in the Genus database with same CATH homology
 3UQB A;  3O5L A;  5B8I C;  4MNJ A;  4HAR A;  1JNS A;  4TX0 A;  1WAW A;  2ZR5 A;  3FY1 A;  4ODO A;  4QT3 A;  3WD2 A;  1FJD A;  4ODK A;  1F8A B;  4DRO A;  1FAP A;  1UR9 A;  2F2D A;  2LPV A;  4ML4 A;  1SR0 A;  3B9D A;  5HTG A;  2MF9 A;  3CHC A;  3KAG A;  4U84 A;  1Q6I A;  1D7J A;  3ARZ A;  3O5M A;  5HUA A;  3ARQ A;  1H0G A;  3FAP A;  4G2P A;  2PV3 A;  1D2K A;  2DT1 A;  3RGC A;  4MSP A;  1FD9 A;  2VCD A;  3B9A A;  4ODQ A;  3WKZ A;  5HT1 A;  3WL0 A;  4MNM A;  1HJX A;  1E9L A;  1N1A A;  1Q6U A;  1QPL A;  3JXV A;  3ARY A;  2RUD A;  1J4I A;  3UI4 A;  4DWS A;  2DPE A;  4Z2G A;  3CHF A;  2RUR A;  4GGQ A;  3KAD A;  5GPR A;  3WL1 A;  4P8W A;  1FFR A;  1JNT A;  4J4N A;  3WD4 A;  4NSB A;  5DO2 A;  5DIV A;  2FAP A;  1FKH A;  1ROT A;  3AS2 A;  4IQ2 A;  3I6C A;  1NWR A;  3WD1 A;  1W1Y A;  5HW8 A;  1F40 A;  1FFQ A;  2MNT A;  3KAC A;  1LG2 A;  4JYS A;  2DSZ A;  2KR7 A;  3O5K A;  2O92 A;  4ODN A;  4TW7 A;  2RUQ A;  2F4E A;  3PRD A;  3KZ7 A;  1B6C A;  2O9O A;  1HKK A;  4JFK A;  4ODL A;  4LAV A;  1HKM A;  1FKF A;  1OGG A;  3NTP A;  2N87 A;  1E6Z A;  2ZQT A;  3AS1 A;  2DSU A;  3LUO A;  2M2A A;  4TYO A;  3O5P A;  1KFW A;  3TCZ A;  1FKJ A;  3ARU A;  4Z2H A;  1M5Y A;  1EDQ A;  4Z2I A;  1H0I A;  3KCE A;  4TW8 A;  5HWB A;  3PRA A;  4DRM A;  3O5O A;  1ZBV A;  1K9T A;  3PA7 A;  2FKE A;  1W26 A;  4LAW A;  4DWS D;  4HBO A;  2LJ4 A;  1FKD A;  3ARR A;  3IKD A;  4U85 A;  4DIP A;  2A3A A;  2ESC A;  4TW6 A;  3WD3 A;  1LJY A;  4G50 A;  1ROU A;  4HBE A;  4IT4 A;  1NMW A;  2ZR4 A;  4LAX A;  1ITX A;  3RM4 A;  4MTV A;  4R0X A;  3TDB A;  3AQU A;  3OOB A;  1WB0 A;  2UZ5 A;  1J4H A;  2KO7 A;  3UI6 A;  1HKJ A;  4URI A;  1ZL1 A;  3KAF A;  1BL4 A;  2A3C A;  4MAV A;  4WIW A;  1FKL A;  3B7X A;  2YBT A;  4WKF A;  4ZPW R;  1W9U A;  4Z2L A;  2WLY A;  3ARO A;  1ZK6 A;  4DRN A;  1ZBK A;  1LL6 A;  3G6L A;  4N19 A;  3WQV A;  3O5G A;  3ALG A;  2PV1 A;  3KAH A;  1R9H A;  1NWU A;  5DF0 A;  3CGN A;  3RM9 A;  3WIJ A;  1D6O A;  4DRK A;  4LGX A;  4WJX A;  3CHD A;  3RME A;  2DT0 A;  3VAW A;  2A3E A;  3G6M A;  2KE0 A;  4DRI A;  1JVW A;  2L2S A;  2M08 A;  2RSE A;  1NSG A;  2XP8 A;  2PPP A;  4DZ3 A;  2ZQS A;  2LGO A;  1W9P A;  4DT4 A;  5HBF A;  2PV2 A;  2WM0 A;  1XHG A;  4DH0 A;  4NNR A;  5HW6 A;  1E6N A;  3ARV A;  3EY6 A;  4R5E A;  1W1P A;  3UI5 A;  3O5I A;  1PIN A;  2ITK A;  4DWS C;  2DT3 A;  4ODR A;  1ZBW A;  1QPF A;  4QZV B;  2XP5 A;  1NWT A;  4DWS B;  3ARX A;  1IX5 A;  5I98 A;  3AS3 A;  4Q22 A;  4DRH A;  1FKK A;  3RFW A;  4JFL A;  1E6R A;  5DIU A;  2MPH A;  2IUZ A;  2AOS A;  5GPG A;  1ZCN A;  1FKR A;  3ARW A;  2PPO A;  1BKF A;  4WK9 A;  4ODP A;  4KQZ A;  2DSW A;  2DG4 A;  3MDY B;  3KAI A;  5HWC A;  1GPF A;  1VF8 A;  1TFV A;  3CHE A;  4ZPV R;  3WD0 A;  2M1I A;  1QZ2 A;  3O5D A;  1PBK A;  4Z2J A;  1E6P A;  2DG3 A;  1L1P A;  3ARP A;  1FKI A;  1KT1 A;  2RUC A;  2KI3 A;  1Y0O A;  3O5Q A;  2XP7 A;  4NZC A;  1JND A;  3GPK A;  1W1V A;  3TC5 A;  2MLY A;  3O5J A;  1D7I A;  1RD6 A;  4W5U A;  3JYM A;  2XP4 A;  4J4O A;  1EQ3 A;  5BXJ A;  3NI6 A;  1LL4 A;  3OA5 A;  1EYM A;  1HKI A;  3UQA A;  1W9V A;  3IK8 A;  4IQC A;  4Q7N A;  4JFJ A;  3CGM A;  1HJW A;  4L72 B;  4W9O A;  4QT2 A;  4WKA A;  1O6I A;  4W9P A;  1T11 A;  4ITZ A;  3CH9 A;  5HKG A;  1GOI A;  2PI6 A;  3ART A;  2MLZ A;  1X6L A;  4DRJ A;  3H9R B;  4DRP A;  2OLH A;  4ZS6 A;  3CZ8 A;  3B9E A;  4MNL A;  4DZ2 A;  3UQI A;  4FN2 A;  2ZQV A;  2KGJ A;  4WKH A;  2MLX A;  2B31 A;  2XP3 A;  3IHZ A;  3RM8 A;  2PBC A;  2LKN A;  4LAY A;  4P8X A;  1E15 A;  2D9F A;  1J6Y A;  1FKB A;  1FKT A;  3ODK A;  3PRB A;  3B8S A;  4U86 A;  4ZPT R;  3ALF A;  5D75 A;  2F21 A;  4IT6 A;  1J4R A;  3PR9 A;  2AWG A;  1LG1 A;  4MPK A;  1U79 A;  3UF8 A;  1GUV A;  2PPN A;  4GIV A;  4MGV A;  3WQW A;  1TCO C;  1WNO A;  4MNK A;  4Z2K A;  4BF8 A;  4IPX A;  1C9H A;  4PTM A;  1FKG A;  2A3B A;  3BXW A;  1KT0 A;  4QIB A;  1NMV A;  2VN1 A;  3NRK A;  1NH6 A;  3O5R A;  3O5E A;  4XAK A;  1D7H A;  2QF8 A;  4AY1 A;  2Y78 A;  5JH8 A;  3JYJ A;  1JNE A;  4S3J A;  1Q1C A;  1HJV A;  1OGB A;  1EHN A;  5DIT A;  2XP6 A;  4O2T A;  2FDM A;  4L3N A;  1ZB5 A;  1OWQ A;  5J6E A;  4KR0 B;  4S3K A;  1UR8 A;  1P5Q A;  2JZV A;  2KFW A;  4C02 B;  1FKS A;  1XRV A;  3W4R A;  1ZBC A;  1CTN A;  2DT2 A;  2G8Z A;  1LL7 A;  1LQ0 A;  4P8U A;  4DRQ A;  1X6N A;  2ZR6 A;  4JFI A;  2XPA A;  2K8I A;  3FXY A;  4P8V A;  2XP9 A;  4FAP A;  2IF4 A;  2ZQU A;  3KAB A;  1HXV A;  4W9Q A;  2Q5A A;  3ARS A;  2G41 A;  3IKG A;  3QOK A;  1A7X A;  1W1T A;  2RQS A;  1ZU8 A;  2XPB A;  2DG9 A;  5HW7 A;  1SYT A;  1YAT A;  5GQB A;  2WLZ A;  4TNS A;  2DSV A;  4ODM A;  1Q6H A;  2WK2 A;  5DEZ A;  1NWS A;  2YBU A;  1YW5 A;  3AS0 A;  1EIB A;  3O5F A;  3WH0 A;  4JFM A;  2OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...