2MNTA

Solution structure of the ppiase domain of tbpar42
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
PTERHFYHVLVKHKDVRRPSSLAPRNKGEKITRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDGDLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords TbPar42
publication title Solution structure of TbPar42
rcsb
source organism Trypanosoma brucei brucei
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2mntA00
4ITZA 4J4NA 1FKBA 2ZQSA 1Q6HA 3KACA 3O5IA 2ZQVA 1EYMA 1JNSA 4JYSA 4DZ2A 2XP8A 3UI5A 4DRMA 5HW6A 2KR7A 3RFWA 2XPAA 3PA7A 3IKGA 3UI4A 3JYMA 5BXJA 3NRKA 4LAVA 2XP3A 2XP6A 2PV2A 3O5PA 1Q6IA 2PPNA 1M5YA 1YATA 2XP5A 3OOBA 4J4OA 4GGQA 5HKGA 3KZ7A 5DIVA 5I98A 4DRQA 2RUQA 3PRDA 4DH0A 5HWBA 4O2TA 2F4EA 2F21A 2ZR6A 1HXVA 2XPBA 3KAGA 3O5DA 1FKHA 2DG4A 1Q1CA 2KE0A 1BKFA 3KABA 4QT2A 4GIVA 3O5QA 4BF8A 3IHZA 2RQSA 4TYOA 3UI6A 1J6YA 2MPHA 4U86A 5DITA 4C02B 1FKLA 3B7XA 4JFKA 1YW5A 4ODKA 4ODRA 4G50A 4TNSA 1J4IA 5HW8A 1KT0A 2VCDA 1FD9A 1D7HA 2IF4A 2KO7A 3O5EA 4DIPA 1ZK6A 2Q5AA 4LAYA 2RSEA 2XP7A 4DRHA 3KADA 2DG9A 2PBCA 3LUOA 3MDYB 3TDBA 3TC5A 1D7JA 2UZ5A 4IQ2A 1FKJA 4U84A 1QPFA 1R9HA 3NTPA 1FKFA 2LKNA 1JNTA 2PV3A 4W9OA 1FKIA 5HUAA 1U79A 5D75A 4DRJA 1P5QA 1NMWA 2RUDA 3VAWA 1QPLA 2M08A 3RGCA 2AWGA 4MSPA 2JZVA 1KT1A 3O5MA 2ITKA 2ZQTA 1Q6UA 1D7IA 2N87A 3FAPA 3NI6A 2VN1A 3H9RB 3UQBA 5DIUA 3ODKA 2DG3A 1A7XA 1PBKA 3KAHA 4ODLA 4DT4A 2M2AA 4DRKA 3JYJA 5HT1A 1NMVA 2LPVA 1JVWA 1D6OA 3IKDA 1W26A 2FKEA 2FAPA 4FN2A 4ODPA 3O5FA 4R0XA 3TCZA 2ZR4A 5HW7A 4DZ3A 1BL4A 4NNRA 2PPOA 3O5JA 1ZCNA 4IQCA 4JFIA 3WH0A 4ODNA 4ODMA 3UF8A 2RUCA 2MLXA 4LAWA 4QIBA 2PV1A 4FAPA 1FJDA 5HWCA 1ROTA 2OFNA 4G2PA 2PPPA 2KFWA 1J4RA 1FKKA 1PINA 1TCOC 2MF9A 3IK8A 3PRBA 4IPXA 4TW7A 4TX0A 2L2SA 4U85A 4DRIA 2D9FA 2RURA 1EQ3A 2KGJA 1J4HA 3GPKA 1QZ2A 1ROUA 2MNTA 2MLYA 2LJ4A 3O5GA 4ODOA 2F2DA 4JFLA 2LGOA 1F40A 4TW8A 4JFMA 5GPGA 1T11A 5B8IC 3JXVA 1F8AB 2M1IA 4DROA 3O5OA 1Y0OA 2MLZA 4W9QA 4TW6A 2KI3A 4LAXA 5HTGA 3UQIA 3CGMA 1L1PA 1B6CA 2ZR5A 3O5KA 4MGVA 1FKRA 4QT3A 4W9PA 2ZQUA 3KAFA 5J6EA 2K8IA 1C9HA 2XP9A 3KAIA 4JFJA 1NSGA 3CGNA 4DRNA 1FKGA 3O5RA 1FKDA 1FKTA 2Y78A 4DRPA 3EY6A 4N19A 4ODQA 2XP4A 3O5LA 3KCEA 1FKSA 3UQAA 3I6CA 1N1AA 1FAPA
chains in the Genus database with same CATH superfamily
4ITZA 2DSUA 4J4NA 2ZQSA 1Q6HA 3RM4A 2XP8A 3UI5A 2A3CA 3EIPA 1LL4A 2KR7A 3RFWA 5HW6A 5BXJA 2PI6A 2XP6A 2OLHA 2PV2A 4WIWA 5HKGA 3KZ7A 5HWBA 2F4EA 4UDMA 2XPBA 1RD6A 3KABA 3AS1A 4GIVA 4BF8A 2RQSA 3B7XA 4ODRA 4TNSA 5HW8A 2VCDA 1ZK6A 3KADA 3LUOA 3MDYB 3AS3A 1D7JA 1E6ZA 1FKJA 2B5UB 1R9HA 4Z2HA 3ARSA 1U79A 2DT3A 5D75A 1HJXA 4DRJA 5GPRA 3RGCA 1KT1A 1OWQA 1FFRA 2VN1A 3H9RB 4MAVA 1TFVA 1NWUA 3ARWA 1A7XA 2M2AA 4R5EA 1JVWA 3WL0A 4ODPA 3FXYA 4R0XA 3TCZA 1UR8A 4P8VA 4WKFA 4Z2LA 1W1VA 1HKKA 4FAPA 1ZBWA 1ROTA 2ESCA 4IT6A 3IK8A 2MF9A 2L2SA 2D9FA 1J4HA 4WKHA 3GPKA 2MLYA 4ODOA 1X6LA 1ZU8A 2LGOA 1GRJA 4JFMA 4DWSA 3JXVA 3CHEA 1Y0OA 4W9QA 3ALGA 3G6LA 4TW6A 1FKRA 2ZQUA 3KAFA 4L3NA 5J6EA 1EHNA 2XP9A 3KAIA 1HKJA 3PRAA 4JFJA 4L72B 3WD3A 1W1PA 2G41A 1FKDA 1SYTA 1JCHB 3EY6A 2XP4A 3B9DA 3QOKA 1WNOA 1ITXA 1SR0A 2ZQVA 4DZ2A 2WLYA 4ML4A 4DRMA 1NWSA 3PA7A 3ARPA 2A3AA 3ARYA 1YATA 1EDQA 5I98A 4Q22A 4DH0A 1E44A 2YBTA 1GUVA 3KAGA 1FKHA 2KE0A 1Q1CA 4TYOA 3UI6A 4NSBA 5DITA 1YW5A 2QF8A 4G50A 1J4IA 1FD9A 2IF4A 2KO7A 1UR9A 1ZBVA 4LAYA 2XP7A 1HKMA 4DRHA 1GPFA 4U84A 1QPFA 4W9OA 1FKIA 2F23A 3WD4A 2RUDA 4MNKA 2M08A 1HJWA 2AWGA 4MSPA 2ITKA 4P8UA 3RM9A 3B9EA 2N87A 1NH6A 3AS0A 5DIUA 2DG3A 1EIBA 1O6IA 4WK9A 2AOSA 3RM8A 5HT1A 2LPVA 3AQUA 3WKZA 3IKDA 3OA5A 4MNLA 4DZ3A 1ZCNA 4ODMA 3ALFA 3UF8A 4NZCA 2MLXA 2A3BA 1FJDA 4Z2JA 3CZ8A 4WKAA 2KFWA 1PINA 4U85A 3ARXA 2DT1A 1GOIA 3CHCA 1QZ2A 1ROUA 1KFWA 2DT0A 2LJ4A 2F2DA 4JFLA 5GPGA 3FY1A 1F8AB 2M1IA 3O5OA 3AS2A 5HTGA 3UQIA 3CGMA 1B6CA 3GU0A 2K8IA 3O5RA 1FKTA 2DSVA 4N19A 1LG1A 2B31A 3O5LA 4HBEA 2YBUA 4WJXA 1FKSA 3I6CA 5DO2A 4MPKA 2DPEA 1LG2A 1K9TA 3O5IA 5DEZA 1EYMA 4Z2IA 2XPAA 3UI4A 3NRKA 3O5PA 1Q6IA 2PPNA 1M5YA 3PRDA 2DSZA 4O2TA 1CTNA 3PR9A 4DWSD 2DG4A 1BKFA 3ARZA 1HKIA 3O5QA 3WL1A 3WD1A 4URIA 2MPHA 4U86A 1FKLA 4JFKA 4QZVB 4ODKA 1OGBA 3BMBA 2FDMA 1KT0A 2O9OA 1D7HA 2EULA 3O5EA 4HARA 4DIPA 2G8ZA 2RSEA 1W1TA 2DG9A 3W4RA 3TDBA 4IQ2A 4AY1A 3NTPA 3ARUA 1E6RA 2LKNA 4ZPTR 1IX5A 4ZS6A 2A3EA 1W9VA 1P5QA 1QPLA 5DF0A 2WLZA 2JZVA 1LL7A 3NI6A 3KAHA 1HJVA 4DRKA 3JYJA 1W26A 2FAPA 4FN2A 1BL4A 2DT2A 3BXWA 4S3KA 2PPOA 3O5JA 4IQCA 4JFIA 1NWRA 4ODNA 1LQ0A 2RUCA 1ZBKA 3ARTA 3ARRA 2PV1A 4LAWA 4ZPWR 1XHGA 4G2PA 1J4RA 1FKKA 1TCOC 3B8SA 4IPXA 4TW7A 2RURA 1EQ3A 2WK2A 3O5GA 1VF8A 4KR0B 4TW8A 4MNJA 1ZB5A 4MNMA 5GQBA 2MLZA 3GTYX 2KI3A 1NWTA 4LAXA 1H0GA 3WD0A 3O5KA 4QT3A 4W9PA 1C9HA 4DRNA 3CGNA 1FKGA 1OGGA 3CHFA 4S3JA 2Y78A 1W9UA 4ODQA 1E9LA 1FKBA 1LL6A 3KACA 1JNSA 4DWSB 4JYSA 3RMEA 1E6PA 2ETNA 3IKGA 3JYMA 2O92A 2WM0A 4LAVA 2XP3A 4LGXA 2XP5A 3OOBA 4J4OA 4GGQA 5DIVA 4DRQA 2RUQA 1JNDA 2F21A 2ZR6A 1HXVA 4DT4A 4QT2A 3O5DA 3CH9A 1X6NA 3IHZA 1LJYA 1J6YA 4C02B 4P8WA 1ZL1A 4Z2KA 2P4VA 2Q5AA 3AROA 3TC5A 2PBCA 2UZ5A 1E6NA 3CHDA 1FKFA 2PV3A 1JNTA 5HUAA 4XAKA 1NMWA 1W9PA 4IT4A 3VAWA 3ARVA 3O5MA 2ZQTA 1Q6UA 1D7IA 1WB0A 3FAPA 4HBOA 3UQBA 1XRVA 3ODKA 1PBKA 3WQWA 4ODLA 2DSWA 2IUZA 1FFQA 2PN0A 1NMVA 4Q7NA 1D6OA 2FKEA 1ZBCA 3O5FA 4DWSC 4Z2GA 2ZR4A 3WIJA 5HW7A 1W1YA 4W5UA 4NNRA 3WH0A 4MTVA 3ARQA 4QIBA 5HWCA 2OFNA 2PPPA 4TX0A 4DRIA 3PRBA 3WD2A 4ZPVR 2KGJA 4P8XA 2MNTA 3WQVA 1F40A 5B8IC 1T11A 1WAWA 4DROA 3G6MA 5HBFA 4KQZA 4PTMA 1L1PA 2ZR5A 4MGVA 1JNEA 3B9AA 1NSGA 1D2KA 4DRPA 3KCEA 5JH8A 1H0IA 3UQAA 1E15A 1N1AA 1FAPA
chains in the Genus database with same CATH topology
4ITZA 2DSUA 4J4NA 2ZQSA 1Q6HA 3RM4A 2XP8A 3UI5A 2A3CA 5HW6A 1LL4A 2KR7A 3RFWA 5BXJA 2PI6A 2XP6A 2OLHA 2PV2A 4WIWA 5HKGA 3KZ7A 5HWBA 2F4EA 2XPBA 1RD6A 3KABA 3AS1A 4GIVA 4BF8A 2RQSA 3B7XA 4ODRA 4TNSA 5HW8A 2VCDA 1ZK6A 3KADA 3LUOA 3MDYB 3AS3A 1D7JA 1E6ZA 1FKJA 1R9HA 4Z2HA 3ARSA 1U79A 2DT3A 5D75A 1HJXA 4DRJA 5GPRA 3RGCA 1KT1A 1OWQA 1FFRA 2VN1A 3H9RB 4MAVA 1TFVA 1NWUA 3ARWA 1A7XA 2M2AA 4R5EA 1JVWA 3WL0A 4ODPA 3FXYA 4R0XA 3TCZA 1UR8A 4P8VA 4WKFA 4Z2LA 1W1VA 1HKKA 4FAPA 1ZBWA 1ROTA 2ESCA 4IT6A 3IK8A 2MF9A 2L2SA 2D9FA 1J4HA 4WKHA 3GPKA 2MLYA 4ODOA 1X6LA 1ZU8A 2LGOA 4JFMA 4DWSA 3JXVA 3CHEA 1Y0OA 4W9QA 3ALGA 3G6LA 4TW6A 1FKRA 2ZQUA 3KAFA 4L3NA 5J6EA 1EHNA 2XP9A 3KAIA 1HKJA 3PRAA 4JFJA 4L72B 3WD3A 1W1PA 2G41A 1FKDA 1SYTA 3EY6A 2XP4A 3B9DA 3QOKA 1WNOA 1ITXA 1SR0A 2ZQVA 4DZ2A 2WLYA 4ML4A 4DRMA 1NWSA 3PA7A 3ARPA 2A3AA 3ARYA 1YATA 1EDQA 5I98A 4Q22A 4DH0A 2YBTA 1GUVA 3KAGA 1FKHA 2KE0A 1Q1CA 4TYOA 3UI6A 4NSBA 5DITA 1YW5A 2QF8A 4G50A 1J4IA 1FD9A 2IF4A 2KO7A 1UR9A 1ZBVA 4LAYA 2XP7A 1HKMA 4DRHA 1GPFA 4U84A 1QPFA 4W9OA 1FKIA 3WD4A 2RUDA 4MNKA 2M08A 1HJWA 2AWGA 4MSPA 2ITKA 4P8UA 3RM9A 3B9EA 2N87A 1NH6A 3AS0A 5DIUA 2DG3A 1EIBA 1O6IA 4WK9A 2AOSA 3RM8A 5HT1A 2LPVA 3AQUA 3WKZA 3IKDA 3OA5A 4MNLA 4DZ3A 1ZCNA 4ODMA 3ALFA 3UF8A 4NZCA 2MLXA 2A3BA 1FJDA 4Z2JA 3CZ8A 4WKAA 2KFWA 1PINA 4U85A 3ARXA 2DT1A 1GOIA 3CHCA 1QZ2A 1ROUA 1KFWA 2DT0A 2LJ4A 2F2DA 4JFLA 5GPGA 3FY1A 1F8AB 2M1IA 3O5OA 3AS2A 5HTGA 3UQIA 3CGMA 1B6CA 2K8IA 3O5RA 1FKTA 2DSVA 4N19A 1LG1A 2B31A 3O5LA 4HBEA 2YBUA 4WJXA 1FKSA 3I6CA 5DO2A 4MPKA 2DPEA 1LG2A 1K9TA 3O5IA 5DEZA 1EYMA 4Z2IA 2XPAA 3UI4A 3NRKA 3O5PA 1Q6IA 2PPNA 1M5YA 3PRDA 2DSZA 4O2TA 1CTNA 3PR9A 4DWSD 2DG4A 1BKFA 3ARZA 1HKIA 3O5QA 3WL1A 3WD1A 4URIA 2MPHA 4U86A 1FKLA 4JFKA 4QZVB 4ODKA 1OGBA 2FDMA 1KT0A 2O9OA 1D7HA 3O5EA 4HARA 4DIPA 2G8ZA 2RSEA 1W1TA 2DG9A 3W4RA 3TDBA 4IQ2A 4AY1A 3NTPA 3ARUA 1E6RA 2LKNA 4ZPTR 1IX5A 4ZS6A 2A3EA 1W9VA 1P5QA 1QPLA 5DF0A 2WLZA 2JZVA 1LL7A 3NI6A 3KAHA 1HJVA 4DRKA 3JYJA 1W26A 2FAPA 4FN2A 1BL4A 2DT2A 3BXWA 4S3KA 2PPOA 3O5JA 4IQCA 4JFIA 1NWRA 4ODNA 1LQ0A 2RUCA 1ZBKA 3ARTA 3ARRA 2PV1A 4LAWA 4ZPWR 1XHGA 4G2PA 1J4RA 1FKKA 1TCOC 3B8SA 4IPXA 4TW7A 2RURA 1EQ3A 2WK2A 3O5GA 1VF8A 4KR0B 4TW8A 4MNJA 1ZB5A 4MNMA 5GQBA 2MLZA 2KI3A 1NWTA 4LAXA 1H0GA 3WD0A 3O5KA 4QT3A 4W9PA 1C9HA 4DRNA 3CGNA 1FKGA 1OGGA 3CHFA 4S3JA 2Y78A 1W9UA 4ODQA 1E9LA 1FKBA 1LL6A 3KACA 1JNSA 4DWSB 4JYSA 3RMEA 1E6PA 3IKGA 3JYMA 2O92A 2WM0A 4LAVA 2XP3A 4LGXA 2XP5A 3OOBA 4J4OA 4GGQA 5DIVA 4DRQA 2RUQA 1JNDA 2F21A 2ZR6A 1HXVA 4DT4A 4QT2A 3O5DA 3CH9A 1X6NA 3IHZA 1LJYA 1J6YA 4C02B 4P8WA 1ZL1A 4Z2KA 2Q5AA 3AROA 3TC5A 2PBCA 2UZ5A 1E6NA 3CHDA 1FKFA 2PV3A 1JNTA 5HUAA 4XAKA 1NMWA 1W9PA 4IT4A 3VAWA 3ARVA 3O5MA 2ZQTA 1Q6UA 1D7IA 1WB0A 3FAPA 4HBOA 3UQBA 1XRVA 3ODKA 1PBKA 3WQWA 4ODLA 2DSWA 2IUZA 1FFQA 1NMVA 4Q7NA 1D6OA 2FKEA 1ZBCA 3O5FA 4DWSC 4Z2GA 2ZR4A 3WIJA 5HW7A 1W1YA 4W5UA 4NNRA 3WH0A 4MTVA 3ARQA 4QIBA 5HWCA 2OFNA 2PPPA 4TX0A 4DRIA 3PRBA 3WD2A 4ZPVR 2KGJA 4P8XA 2MNTA 3WQVA 1F40A 5B8IC 1T11A 1WAWA 4DROA 3G6MA 5HBFA 4KQZA 4PTMA 1L1PA 2ZR5A 4MGVA 1JNEA 3B9AA 1NSGA 1D2KA 4DRPA 3KCEA 5JH8A 1H0IA 3UQAA 1E15A 1N1AA 1FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITZ A;  4J4N A;  1FKB A;  2ZQS A;  1Q6H A;  3KAC A;  3O5I A;  2ZQV A;  1EYM A;  1JNS A;  4JYS A;  4DZ2 A;  2XP8 A;  3UI5 A;  4DRM A;  5HW6 A;  2KR7 A;  3RFW A;  2XPA A;  3PA7 A;  3IKG A;  3UI4 A;  3JYM A;  5BXJ A;  3NRK A;  4LAV A;  2XP3 A;  2XP6 A;  2PV2 A;  3O5P A;  1Q6I A;  2PPN A;  1M5Y A;  1YAT A;  2XP5 A;  3OOB A;  4J4O A;  4GGQ A;  5HKG A;  3KZ7 A;  5DIV A;  5I98 A;  4DRQ A;  2RUQ A;  3PRD A;  4DH0 A;  5HWB A;  4O2T A;  2F4E A;  2F21 A;  2ZR6 A;  1HXV A;  2XPB A;  3KAG A;  3O5D A;  1FKH A;  2DG4 A;  1Q1C A;  2KE0 A;  1BKF A;  3KAB A;  4QT2 A;  4GIV A;  3O5Q A;  4BF8 A;  3IHZ A;  2RQS A;  4TYO A;  3UI6 A;  1J6Y A;  2MPH A;  4U86 A;  5DIT A;  4C02 B;  1FKL A;  3B7X A;  4JFK A;  1YW5 A;  4ODK A;  4ODR A;  4G50 A;  4TNS A;  1J4I A;  5HW8 A;  1KT0 A;  2VCD A;  1FD9 A;  1D7H A;  2IF4 A;  2KO7 A;  3O5E A;  4DIP A;  1ZK6 A;  2Q5A A;  4LAY A;  2RSE A;  2XP7 A;  4DRH A;  3KAD A;  2DG9 A;  2PBC A;  3LUO A;  3MDY B;  3TDB A;  3TC5 A;  1D7J A;  2UZ5 A;  4IQ2 A;  1FKJ A;  4U84 A;  1QPF A;  1R9H A;  3NTP A;  1FKF A;  2LKN A;  1JNT A;  2PV3 A;  4W9O A;  1FKI A;  5HUA A;  1U79 A;  5D75 A;  4DRJ A;  1P5Q A;  1NMW A;  2RUD A;  3VAW A;  1QPL A;  2M08 A;  3RGC A;  2AWG A;  4MSP A;  2JZV A;  1KT1 A;  3O5M A;  2ITK A;  2ZQT A;  1Q6U A;  1D7I A;  2N87 A;  3FAP A;  3NI6 A;  2VN1 A;  3H9R B;  3UQB A;  5DIU A;  3ODK A;  2DG3 A;  1A7X A;  1PBK A;  3KAH A;  4ODL A;  4DT4 A;  2M2A A;  4DRK A;  3JYJ A;  5HT1 A;  1NMV A;  2LPV A;  1JVW A;  1D6O A;  3IKD A;  1W26 A;  2FKE A;  2FAP A;  4FN2 A;  4ODP A;  3O5F A;  4R0X A;  3TCZ A;  2ZR4 A;  5HW7 A;  4DZ3 A;  1BL4 A;  4NNR A;  2PPO A;  3O5J A;  1ZCN A;  4IQC A;  4JFI A;  3WH0 A;  4ODN A;  4ODM A;  3UF8 A;  2RUC A;  2MLX A;  4LAW A;  4QIB A;  2PV1 A;  4FAP A;  1FJD A;  5HWC A;  1ROT A;  2OFN A;  4G2P A;  2PPP A;  2KFW A;  1J4R A;  1FKK A;  1PIN A;  1TCO C;  2MF9 A;  3IK8 A;  3PRB A;  4IPX A;  4TW7 A;  4TX0 A;  2L2S A;  4U85 A;  4DRI A;  2D9F A;  2RUR A;  1EQ3 A;  2KGJ A;  1J4H A;  3GPK A;  1QZ2 A;  1ROU A;  2MNT A;  2MLY A;  2LJ4 A;  3O5G A;  4ODO A;  2F2D A;  4JFL A;  2LGO A;  1F40 A;  4TW8 A;  4JFM A;  5GPG A;  1T11 A;  5B8I C;  3JXV A;  1F8A B;  2M1I A;  4DRO A;  3O5O A;  1Y0O A;  2MLZ A;  4W9Q A;  4TW6 A;  2KI3 A;  4LAX A;  5HTG A;  3UQI A;  3CGM A;  1L1P A;  1B6C A;  2ZR5 A;  3O5K A;  4MGV A;  1FKR A;  4QT3 A;  4W9P A;  2ZQU A;  3KAF A;  5J6E A;  2K8I A;  1C9H A;  2XP9 A;  3KAI A;  4JFJ A;  1NSG A;  3CGN A;  4DRN A;  1FKG A;  3O5R A;  1FKD A;  1FKT A;  2Y78 A;  4DRP A;  3EY6 A;  4N19 A;  4ODQ A;  2XP4 A;  3O5L A;  3KCE A;  1FKS A;  3UQA A;  3I6C A;  1N1A A;  1FAP A; 
#chains in the Genus database with same CATH topology
 4ITZ A;  2DSU A;  4J4N A;  2ZQS A;  1Q6H A;  3RM4 A;  2XP8 A;  3UI5 A;  2A3C A;  3EIP A;  1LL4 A;  2KR7 A;  3RFW A;  5HW6 A;  5BXJ A;  2PI6 A;  2XP6 A;  2OLH A;  2PV2 A;  4WIW A;  5HKG A;  3KZ7 A;  5HWB A;  2F4E A;  4UDM A;  2XPB A;  1RD6 A;  3KAB A;  3AS1 A;  4GIV A;  4BF8 A;  2RQS A;  3B7X A;  4ODR A;  4TNS A;  5HW8 A;  2VCD A;  1ZK6 A;  3KAD A;  3LUO A;  3MDY B;  3AS3 A;  1D7J A;  1E6Z A;  1FKJ A;  2B5U B;  1R9H A;  4Z2H A;  3ARS A;  1U79 A;  2DT3 A;  5D75 A;  1HJX A;  4DRJ A;  5GPR A;  3RGC A;  1KT1 A;  1OWQ A;  1FFR A;  2VN1 A;  3H9R B;  4MAV A;  1TFV A;  1NWU A;  3ARW A;  1A7X A;  2M2A A;  4R5E A;  1JVW A;  3WL0 A;  4ODP A;  3FXY A;  4R0X A;  3TCZ A;  1UR8 A;  4P8V A;  4WKF A;  4Z2L A;  1W1V A;  1HKK A;  4FAP A;  1ZBW A;  1ROT A;  2ESC A;  4IT6 A;  3IK8 A;  2MF9 A;  2L2S A;  2D9F A;  1J4H A;  4WKH A;  3GPK A;  2MLY A;  4ODO A;  1X6L A;  1ZU8 A;  2LGO A;  1GRJ A;  4JFM A;  4DWS A;  3JXV A;  3CHE A;  1Y0O A;  4W9Q A;  3ALG A;  3G6L A;  4TW6 A;  1FKR A;  2ZQU A;  3KAF A;  4L3N A;  5J6E A;  1EHN A;  2XP9 A;  3KAI A;  1HKJ A;  3PRA A;  4JFJ A;  4L72 B;  3WD3 A;  1W1P A;  2G41 A;  1FKD A;  1SYT A;  1JCH B;  3EY6 A;  2XP4 A;  3B9D A;  3QOK A;  1WNO A;  1ITX A;  1SR0 A;  2ZQV A;  4DZ2 A;  2WLY A;  4ML4 A;  4DRM A;  1NWS A;  3PA7 A;  3ARP A;  2A3A A;  3ARY A;  1YAT A;  1EDQ A;  5I98 A;  4Q22 A;  4DH0 A;  1E44 A;  2YBT A;  1GUV A;  3KAG A;  1FKH A;  2KE0 A;  1Q1C A;  4TYO A;  3UI6 A;  4NSB A;  5DIT A;  1YW5 A;  2QF8 A;  4G50 A;  1J4I A;  1FD9 A;  2IF4 A;  2KO7 A;  1UR9 A;  1ZBV A;  4LAY A;  2XP7 A;  1HKM A;  4DRH A;  1GPF A;  4U84 A;  1QPF A;  4W9O A;  1FKI A;  2F23 A;  3WD4 A;  2RUD A;  4MNK A;  2M08 A;  1HJW A;  2AWG A;  4MSP A;  2ITK A;  4P8U A;  3RM9 A;  3B9E A;  2N87 A;  1NH6 A;  3AS0 A;  5DIU A;  2DG3 A;  1EIB A;  1O6I A;  4WK9 A;  2AOS A;  3RM8 A;  5HT1 A;  2LPV A;  3AQU A;  3WKZ A;  3IKD A;  3OA5 A;  4MNL A;  4DZ3 A;  1ZCN A;  4ODM A;  3ALF A;  3UF8 A;  4NZC A;  2MLX A;  2A3B A;  1FJD A;  4Z2J A;  3CZ8 A;  4WKA A;  2KFW A;  1PIN A;  4U85 A;  3ARX A;  2DT1 A;  1GOI A;  3CHC A;  1QZ2 A;  1ROU A;  1KFW A;  2DT0 A;  2LJ4 A;  2F2D A;  4JFL A;  5GPG A;  3FY1 A;  1F8A B;  2M1I A;  3O5O A;  3AS2 A;  5HTG A;  3UQI A;  3CGM A;  1B6C A;  3GU0 A;  2K8I A;  3O5R A;  1FKT A;  2DSV A;  4N19 A;  1LG1 A;  2B31 A;  3O5L A;  4HBE A;  2YBU A;  4WJX A;  1FKS A;  3I6C A;  5DO2 A;  4MPK A;  2DPE A;  1LG2 A;  1K9T A;  3O5I A;  5DEZ A;  1EYM A;  4Z2I A;  2XPA A;  3UI4 A;  3NRK A;  3O5P A;  1Q6I A;  2PPN A;  1M5Y A;  3PRD A;  2DSZ A;  4O2T A;  1CTN A;  3PR9 A;  4DWS D;  2DG4 A;  1BKF A;  3ARZ A;  1HKI A;  3O5Q A;  3WL1 A;  3WD1 A;  4URI A;  2MPH A;  4U86 A;  1FKL A;  4JFK A;  4QZV B;  4ODK A;  1OGB A;  3BMB A;  2FDM A;  1KT0 A;  2O9O A;  1D7H A;  2EUL A;  3O5E A;  4HAR A;  4DIP A;  2G8Z A;  2RSE A;  1W1T A;  2DG9 A;  3W4R A;  3TDB A;  4IQ2 A;  4AY1 A;  3NTP A;  3ARU A;  1E6R A;  2LKN A;  4ZPT R;  1IX5 A;  4ZS6 A;  2A3E A;  1W9V A;  1P5Q A;  1QPL A;  5DF0 A;  2WLZ A;  2JZV A;  1LL7 A;  3NI6 A;  3KAH A;  1HJV A;  4DRK A;  3JYJ A;  1W26 A;  2FAP A;  4FN2 A;  1BL4 A;  2DT2 A;  3BXW A;  4S3K A;  2PPO A;  3O5J A;  4IQC A;  4JFI A;  1NWR A;  4ODN A;  1LQ0 A;  2RUC A;  1ZBK A;  3ART A;  3ARR A;  2PV1 A;  4LAW A;  4ZPW R;  1XHG A;  4G2P A;  1J4R A;  1FKK A;  1TCO C;  3B8S A;  4IPX A;  4TW7 A;  2RUR A;  1EQ3 A;  2WK2 A;  3O5G A;  1VF8 A;  4KR0 B;  4TW8 A;  4MNJ A;  1ZB5 A;  4MNM A;  5GQB A;  2MLZ A;  3GTY X;  2KI3 A;  1NWT A;  4LAX A;  1H0G A;  3WD0 A;  3O5K A;  4QT3 A;  4W9P A;  1C9H A;  4DRN A;  3CGN A;  1FKG A;  1OGG A;  3CHF A;  4S3J A;  2Y78 A;  1W9U A;  4ODQ A;  1E9L A;  1FKB A;  1LL6 A;  3KAC A;  1JNS A;  4DWS B;  4JYS A;  3RME A;  1E6P A;  2ETN A;  3IKG A;  3JYM A;  2O92 A;  2WM0 A;  4LAV A;  2XP3 A;  4LGX A;  2XP5 A;  3OOB A;  4J4O A;  4GGQ A;  5DIV A;  4DRQ A;  2RUQ A;  1JND A;  2F21 A;  2ZR6 A;  1HXV A;  4DT4 A;  4QT2 A;  3O5D A;  3CH9 A;  1X6N A;  3IHZ A;  1LJY A;  1J6Y A;  4C02 B;  4P8W A;  1ZL1 A;  4Z2K A;  2P4V A;  2Q5A A;  3ARO A;  3TC5 A;  2PBC A;  2UZ5 A;  1E6N A;  3CHD A;  1FKF A;  2PV3 A;  1JNT A;  5HUA A;  4XAK A;  1NMW A;  1W9P A;  4IT4 A;  3VAW A;  3ARV A;  3O5M A;  2ZQT A;  1Q6U A;  1D7I A;  1WB0 A;  3FAP A;  4HBO A;  3UQB A;  1XRV A;  3ODK A;  1PBK A;  3WQW A;  4ODL A;  2DSW A;  2IUZ A;  1FFQ A;  2PN0 A;  1NMV A;  4Q7N A;  1D6O A;  2FKE A;  1ZBC A;  3O5F A;  4DWS C;  4Z2G A;  2ZR4 A;  3WIJ A;  5HW7 A;  1W1Y A;  4W5U A;  4NNR A;  3WH0 A;  4MTV A;  3ARQ A;  4QIB A;  5HWC A;  2OFN A;  2PPP A;  4TX0 A;  4DRI A;  3PRB A;  3WD2 A;  4ZPV R;  2KGJ A;  4P8X A;  2MNT A;  3WQV A;  1F40 A;  5B8I C;  1T11 A;  1WAW A;  4DRO A;  3G6M A;  5HBF A;  4KQZ A;  4PTM A;  1L1P A;  2ZR5 A;  4MGV A;  1JNE A;  3B9A A;  1NSG A;  1D2K A;  4DRP A;  3KCE A;  5JH8 A;  1H0I A;  3UQA A;  1E15 A;  1N1A A;  1FAP A; 
#chains in the Genus database with same CATH homology
 4ITZ A;  2DSU A;  4J4N A;  2ZQS A;  1Q6H A;  3RM4 A;  2XP8 A;  3UI5 A;  2A3C A;  5HW6 A;  1LL4 A;  2KR7 A;  3RFW A;  5BXJ A;  2PI6 A;  2XP6 A;  2OLH A;  2PV2 A;  4WIW A;  5HKG A;  3KZ7 A;  5HWB A;  2F4E A;  2XPB A;  1RD6 A;  3KAB A;  3AS1 A;  4GIV A;  4BF8 A;  2RQS A;  3B7X A;  4ODR A;  4TNS A;  5HW8 A;  2VCD A;  1ZK6 A;  3KAD A;  3LUO A;  3MDY B;  3AS3 A;  1D7J A;  1E6Z A;  1FKJ A;  1R9H A;  4Z2H A;  3ARS A;  1U79 A;  2DT3 A;  5D75 A;  1HJX A;  4DRJ A;  5GPR A;  3RGC A;  1KT1 A;  1OWQ A;  1FFR A;  2VN1 A;  3H9R B;  4MAV A;  1TFV A;  1NWU A;  3ARW A;  1A7X A;  2M2A A;  4R5E A;  1JVW A;  3WL0 A;  4ODP A;  3FXY A;  4R0X A;  3TCZ A;  1UR8 A;  4P8V A;  4WKF A;  4Z2L A;  1W1V A;  1HKK A;  4FAP A;  1ZBW A;  1ROT A;  2ESC A;  4IT6 A;  3IK8 A;  2MF9 A;  2L2S A;  2D9F A;  1J4H A;  4WKH A;  3GPK A;  2MLY A;  4ODO A;  1X6L A;  1ZU8 A;  2LGO A;  4JFM A;  4DWS A;  3JXV A;  3CHE A;  1Y0O A;  4W9Q A;  3ALG A;  3G6L A;  4TW6 A;  1FKR A;  2ZQU A;  3KAF A;  4L3N A;  5J6E A;  1EHN A;  2XP9 A;  3KAI A;  1HKJ A;  3PRA A;  4JFJ A;  4L72 B;  3WD3 A;  1W1P A;  2G41 A;  1FKD A;  1SYT A;  3EY6 A;  2XP4 A;  3B9D A;  3QOK A;  1WNO A;  1ITX A;  1SR0 A;  2ZQV A;  4DZ2 A;  2WLY A;  4ML4 A;  4DRM A;  1NWS A;  3PA7 A;  3ARP A;  2A3A A;  3ARY A;  1YAT A;  1EDQ A;  5I98 A;  4Q22 A;  4DH0 A;  2YBT A;  1GUV A;  3KAG A;  1FKH A;  2KE0 A;  1Q1C A;  4TYO A;  3UI6 A;  4NSB A;  5DIT A;  1YW5 A;  2QF8 A;  4G50 A;  1J4I A;  1FD9 A;  2IF4 A;  2KO7 A;  1UR9 A;  1ZBV A;  4LAY A;  2XP7 A;  1HKM A;  4DRH A;  1GPF A;  4U84 A;  1QPF A;  4W9O A;  1FKI A;  3WD4 A;  2RUD A;  4MNK A;  2M08 A;  1HJW A;  2AWG A;  4MSP A;  2ITK A;  4P8U A;  3RM9 A;  3B9E A;  2N87 A;  1NH6 A;  3AS0 A;  5DIU A;  2DG3 A;  1EIB A;  1O6I A;  4WK9 A;  2AOS A;  3RM8 A;  5HT1 A;  2LPV A;  3AQU A;  3WKZ A;  3IKD A;  3OA5 A;  4MNL A;  4DZ3 A;  1ZCN A;  4ODM A;  3ALF A;  3UF8 A;  4NZC A;  2MLX A;  2A3B A;  1FJD A;  4Z2J A;  3CZ8 A;  4WKA A;  2KFW A;  1PIN A;  4U85 A;  3ARX A;  2DT1 A;  1GOI A;  3CHC A;  1QZ2 A;  1ROU A;  1KFW A;  2DT0 A;  2LJ4 A;  2F2D A;  4JFL A;  5GPG A;  3FY1 A;  1F8A B;  2M1I A;  3O5O A;  3AS2 A;  5HTG A;  3UQI A;  3CGM A;  1B6C A;  2K8I A;  3O5R A;  1FKT A;  2DSV A;  4N19 A;  1LG1 A;  2B31 A;  3O5L A;  4HBE A;  2YBU A;  4WJX A;  1FKS A;  3I6C A;  5DO2 A;  4MPK A;  2DPE A;  1LG2 A;  1K9T A;  3O5I A;  5DEZ A;  1EYM A;  4Z2I A;  2XPA A;  3UI4 A;  3NRK A;  3O5P A;  1Q6I A;  2PPN A;  1M5Y A;  3PRD A;  2DSZ A;  4O2T A;  1CTN A;  3PR9 A;  4DWS D;  2DG4 A;  1BKF A;  3ARZ A;  1HKI A;  3O5Q A;  3WL1 A;  3WD1 A;  4URI A;  2MPH A;  4U86 A;  1FKL A;  4JFK A;  4QZV B;  4ODK A;  1OGB A;  2FDM A;  1KT0 A;  2O9O A;  1D7H A;  3O5E A;  4HAR A;  4DIP A;  2G8Z A;  2RSE A;  1W1T A;  2DG9 A;  3W4R A;  3TDB A;  4IQ2 A;  4AY1 A;  3NTP A;  3ARU A;  1E6R A;  2LKN A;  4ZPT R;  1IX5 A;  4ZS6 A;  2A3E A;  1W9V A;  1P5Q A;  1QPL A;  5DF0 A;  2WLZ A;  2JZV A;  1LL7 A;  3NI6 A;  3KAH A;  1HJV A;  4DRK A;  3JYJ A;  1W26 A;  2FAP A;  4FN2 A;  1BL4 A;  2DT2 A;  3BXW A;  4S3K A;  2PPO A;  3O5J A;  4IQC A;  4JFI A;  1NWR A;  4ODN A;  1LQ0 A;  2RUC A;  1ZBK A;  3ART A;  3ARR A;  2PV1 A;  4LAW A;  4ZPW R;  1XHG A;  4G2P A;  1J4R A;  1FKK A;  1TCO C;  3B8S A;  4IPX A;  4TW7 A;  2RUR A;  1EQ3 A;  2WK2 A;  3O5G A;  1VF8 A;  4KR0 B;  4TW8 A;  4MNJ A;  1ZB5 A;  4MNM A;  5GQB A;  2MLZ A;  2KI3 A;  1NWT A;  4LAX A;  1H0G A;  3WD0 A;  3O5K A;  4QT3 A;  4W9P A;  1C9H A;  4DRN A;  3CGN A;  1FKG A;  1OGG A;  3CHF A;  4S3J A;  2Y78 A;  1W9U A;  4ODQ A;  1E9L A;  1FKB A;  1LL6 A;  3KAC A;  1JNS A;  4DWS B;  4JYS A;  3RME A;  1E6P A;  3IKG A;  3JYM A;  2O92 A;  2WM0 A;  4LAV A;  2XP3 A;  4LGX A;  2XP5 A;  3OOB A;  4J4O A;  4GGQ A;  5DIV A;  4DRQ A;  2RUQ A;  1JND A;  2F21 A;  2ZR6 A;  1HXV A;  4DT4 A;  4QT2 A;  3O5D A;  3CH9 A;  1X6N A;  3IHZ A;  1LJY A;  1J6Y A;  4C02 B;  4P8W A;  1ZL1 A;  4Z2K A;  2Q5A A;  3ARO A;  3TC5 A;  2PBC A;  2UZ5 A;  1E6N A;  3CHD A;  1FKF A;  2PV3 A;  1JNT A;  5HUA A;  4XAK A;  1NMW A;  1W9P A;  4IT4 A;  3VAW A;  3ARV A;  3O5M A;  2ZQT A;  1Q6U A;  1D7I A;  1WB0 A;  3FAP A;  4HBO A;  3UQB A;  1XRV A;  3ODK A;  1PBK A;  3WQW A;  4ODL A;  2DSW A;  2IUZ A;  1FFQ A;  1NMV A;  4Q7N A;  1D6O A;  2FKE A;  1ZBC A;  3O5F A;  4DWS C;  4Z2G A;  2ZR4 A;  3WIJ A;  5HW7 A;  1W1Y A;  4W5U A;  4NNR A;  3WH0 A;  4MTV A;  3ARQ A;  4QIB A;  5HWC A;  2OFN A;  2PPP A;  4TX0 A;  4DRI A;  3PRB A;  3WD2 A;  4ZPV R;  2KGJ A;  4P8X A;  2MNT A;  3WQV A;  1F40 A;  5B8I C;  1T11 A;  1WAW A;  4DRO A;  3G6M A;  5HBF A;  4KQZ A;  4PTM A;  1L1P A;  2ZR5 A;  4MGV A;  1JNE A;  3B9A A;  1NSG A;  1D2K A;  4DRP A;  3KCE A;  5JH8 A;  1H0I A;  3UQA A;  1E15 A;  1N1A A;  1FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...