4LAWA

Crystal structure analysis of fkbp52, crystal form iii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
235
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lawA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lawA02
3KAHA 5GPGA 4TW7A 2IF4A 2D9FA 2PV2A 4FN2A 3KACA 4GGQA 2MLXA 1ZCNA 3WH0A 2ZR4A 4BF8A 5DIVA 3JXVA 3PRBA 4JFKA 2KFWA 4DRJA 1M5YA 4DRIA 4DT4A 5HW7A 2RUDA 4JFLA 2RUCA 4C02B 3KAGA 4MSPA 1EQ3A 4W9PA 1D7JA 3NI6A 2DG3A 5J6EA 2FAPA 4DH0A 2XP9A 3CGNA 2PV1A 4TW8A 1QZ2A 3MDYB 4O2TA 4G2PA 4J4OA 3EY6A 1J6YA 2UZ5A 3O5DA 1FAPA 3RGCA 3O5OA 3O5RA 2M1IA 2F4EA 2KGJA 2VCDA 2ZQVA 1C9HA 1NMVA 1B6CA 2XP4A 3I6CA 1PBKA 3O5PA 5HW8A 5BXJA 4NNRA 5HUAA 2RSEA 1J4HA 2PPOA 3IHZA 4W9QA 5HWCA 1KT1A 4DRHA 5DIUA 2XPAA 3KZ7A 2MLZA 3KCEA 1FKBA 3RFWA 2KO7A 4DRNA 2MF9A 1P5QA 3FAPA 3KAFA 3O5JA 3UI5A 1FKRA 1A7XA 2RUQA 1EYMA 1Q6UA 1QPFA 3OOBA 3O5LA 3JYMA 4DROA 1QPLA 1NSGA 1W26A 4DZ2A 2KR7A 1U79A 1FKSA 3IK8A 3UF8A 1BKFA 2XP8A 3JYJA 4DZ3A 5HKGA 1T11A 4ODLA 2M2AA 5HW6A 2XP7A 4IPXA 3NRKA 3TCZA 4N19A 3O5EA 1F8AB 4R0XA 4U84A 3TDBA 4QT2A 1JVWA 3KADA 3O5QA 2LGOA 1FKTA 2PPNA 2DG4A 1PINA 1Q6HA 1D6OA 2OFNA 2RQSA 3O5IA 2DG9A 4DRMA 4ODOA 4IQCA 5DITA 1FKIA 2PV3A 4IQ2A 4U85A 4DIPA 3ODKA 4ODMA 5I98A 1JNTA 3UQAA 3O5KA 4TNSA 4J4NA 3UQBA 1D7IA 1F40A 1YW5A 2PPPA 1J4IA 2LJ4A 1J4RA 4ODQA 1FKHA 2Q5AA 2XPBA 4JFJA 3UQIA 2N87A 1BL4A 4TYOA 1FKLA 1Y0OA 2PBCA 2LKNA 3H9RB 2XP3A 1ZK6A 4ODKA 4DRKA 5B8IC 3O5GA 1N1AA 3PRDA 1L1PA 2ZQUA 3PA7A 1HXVA 3B7XA 1FKDA 4JFMA 4LAVA 3IKGA 1FKKA 2MNTA 1TCOC 4W9OA 4ITZA 2M08A 2XP5A 4G50A 1FJDA 3O5FA 4QT3A 5HWBA 1R9HA 4GIVA 4LAYA 3LUOA 2L2SA 3NTPA 1Q1CA 4U86A 1FKGA 3KAIA 2F2DA 4JFIA 1FD9A 1NMWA 1ROUA 3GPKA 4LAXA 4TX0A 5D75A 3UI6A 4FAPA 1FKJA 2KE0A 3KABA 3UI4A 2RURA 4ODPA 1FKFA 5HTGA 2F21A 4MGVA 1YATA 2MLYA 2ZR5A 1KT0A 3O5MA 4TW6A 2LPVA 3VAWA 1D7HA 2JZVA 2KI3A 2FKEA 4DRQA 2ZQSA 1JNSA 2AWGA 4ODRA 2VN1A 4LAWA 2Y78A 2K8IA 4ODNA 2ZQTA 4QIBA 1Q6IA 2ITKA 2MPHA 4JYSA 3TC5A 5HT1A 3CGMA 3IKDA 2ZR6A 2XP6A 1ROTA 4DRPA
chains in the Genus database with same CATH superfamily
3BXWA 1W9PA 1GRJA 2D9FA 1E15A 1FFQA 1E6ZA 3KACA 4FN2A 4L3NA 3CHFA 4BF8A 1ITXA 1EHNA 3ARSA 2DG3A 2FAPA 4TW8A 3MDYB 1E6RA 4O2TA 2G8ZA 1FAPA 4Z2KA 3O5RA 2KGJA 2VCDA 1NMVA 1ZBKA 3I6CA 5GQBA 4NNRA 1J4HA 2PPOA 3IHZA 2XPAA 1FKBA 3ARXA 3RFWA 4DRNA 1NWUA 2MF9A 2PN0A 3O5JA 3WQWA 1A7XA 3JYMA 5HBFA 4DZ2A 1NH6A 1FKSA 2PI6A 1BKFA 2XP8A 2YBUA 3B9AA 2M2AA 4N19A 3AS3A 4R0XA 1JVWA 3O5QA 1FKTA 3RM9A 2DG4A 3O5IA 2OFNA 1O6IA 2RQSA 2AOSA 4U85A 5I98A 4TNSA 4HBEA 4MNJA 3RM4A 3RM8A 2OLHA 3AS1A 1J4IA 2LJ4A 3PRAA 1HJWA 2O9OA 2P4VA 3UQIA 1FKLA 2PBCA 5JH8A 4AY1A 4ZPVR 5B8IC 4DRKA 3PRDA 4W5UA 1HXVA 3B7XA 4JFMA 4P8XA 1FKKA 1NWTA 4LAYA 2L2SA 3WKZA 1Q1CA 4U86A 1GUVA 3KAIA 3WL1A 3GPKA 1KFWA 1W1PA 4HARA 4TX0A 3WD2A 1D2KA 1RD6A 1XRVA 5HTGA 2MLYA 4MNKA 4TW6A 3CZ8A 3B8SA 3FY1A 4DRQA 3ARVA 4ODRA 1UR8A 2VN1A 1JNDA 2ZQTA 2MPHA 4Z2HA 2DPEA 2A3BA 4WKAA 2IF4A 3WH0A 1WNOA 3JXVA 4DT4A 2KFWA 4DRIA 2RUDA 2RUCA 3KAGA 1E44A 3WIJA 2QF8A 4DH0A 2XP9A 3CGNA 4WKFA 4J4OA 4WJXA 4Z2GA 3CHEA 3RGCA 1HKIA 3ARRA 1B6CA 1HKKA 1XHGA 5HWCA 1E6NA 5DIUA 3KZ7A 3ARYA 1W1YA 4P8UA 1Q6UA 3OOBA 1X6NA 4DROA 1QPLA 3AS2A 1U79A 3IK8A 3UF8A 3WD1A 3JYJA 4DZ3A 3G6LA 4ODLA 4IPXA 3TCZA 5GPRA 3O5EA 1F8AB 4U84A 3TDBA 4QT2A 4XAKA 4ODOA 5DITA 4IT4A 4IQ2A 4DIPA 3ODKA 4ODMA 1JNTA 1E6PA 3UQBA 1D7IA 1CTNA 1F40A 3ARWA 4ODQA 4MNMA 2Q5AA 3QOKA 4TYOA 4UDMA 1LQ0A 1ZK6A 4ODKA 2DSZA 1L1PA 3AQUA 3ALGA 4NSBA 4LAVA 4ML4A 4W9OA 1NWSA 5DF0A 2M08A 4QT3A 2B31A 3GU0A 1FKGA 1ZBWA 2F2DA 4JFIA 1LL4A 4LAXA 1ROUA 2DSWA 5D75A 3WQVA 4FAPA 1FKJA 1W1TA 3UI4A 4DWSB 1ZB5A 2ZR5A 1KT0A 1GPFA 3O5MA 3VAWA 2WK2A 1D7HA 2JZVA 3B9EA 3ARTA 3CHCA 4LAWA 3WL0A 4MNLA 2A3EA 4QIBA 1Q6IA 3TC5A 4ZS6A 1EIBA 3AS0A 3CGMA 3IKDA 2ZR6A 2XP6A 4NZCA 5DEZA 4TW7A 2PV2A 2MLXA 4DWSA 1ZCNA 5DIVA 3PRBA 4JFKA 1M5YA 4R5EA 4JFLA 4C02B 1EQ3A 1OWQA 4MPKA 1LL7A 2PV1A 3CH9A 3ARUA 3O5OA 2M1IA 3PR9A 2ZQVA 1C9HA 1PBKA 3O5PA 5BXJA 5HUAA 2RSEA 3KCEA 2KO7A 3RMEA 1P5QA 1FKRA 2KR7A 2ETNA 1W9VA 2DSVA 4ZPWR 1JCHB 4DWSD 2PPNA 4S3KA 1Q6HA 1D6OA 2DG9A 3EIPA 1K9TA 1FKIA 2PV3A 4MAVA 4KR0B 4S3JA 3UQAA 3O5KA 1LL6A 1SR0A 4IT6A 1J4RA 1E9LA 2B5UB 1FKHA 2XPBA 2DT1A 3H9RB 2LKNA 4LGXA 3O5GA 1N1AA 2DT3A 2WLYA 3BMBA 3IKGA 1LG2A 1JNEA 3AROA 5HWBA 1R9HA 4GIVA 3G6MA 4KQZA 4PTMA 3KABA 1FKFA 1YATA 2KI3A 2FKEA 1JNSA 2ZQSA 2AWGA 1OGBA 4JYSA 4Z2LA 3W4RA 5HT1A 1WAWA 2A3CA 4Z2JA 1ROTA 1EDQA 3KAHA 5GPGA 1HJXA 4GGQA 4ZPTR 4L72B 2ZR4A 1HKJA 4DRJA 1W9UA 5HW7A 3CHDA 2WLZA 4MSPA 5DO2A 1WB0A 4W9PA 1D7JA 3NI6A 5J6EA 2F23A 1QZ2A 1ZL1A 1ZBVA 4G2PA 3EY6A 1J6YA 3ARQA 2UZ5A 3O5DA 4P8VA 3GTYX 2F4EA 2DSUA 2XP4A 2WM0A 4WK9A 5HW8A 2YBTA 4Q7NA 4W9QA 1TFVA 1KT1A 4DRHA 1W1VA 1HJVA 2MLZA 1X6LA 3B9DA 3FAPA 3UI5A 1HKMA 3KAFA 2RUQA 1EYMA 1QPFA 3O5LA 1SYTA 1NSGA 1W26A 5HKGA 1FFRA 1T11A 4QZVB 1GOIA 2XP7A 5HW6A 1OGGA 3NRKA 3WD4A 3KADA 2LGOA 1IX5A 1PINA 4DRMA 3WD0A 4Z2IA 4IQCA 1ZBCA 4WKHA 2DT0A 4J4NA 4P8WA 1YW5A 2PPPA 4Q22A 2A3AA 2IUZA 4JFJA 2N87A 1BL4A 1Y0OA 3OA5A 2XP3A 1UR9A 2G41A 1H0IA 4HBOA 2ZQUA 1LG1A 3PA7A 3WD3A 1FKDA 2MNTA 2EULA 1TCOC 4URIA 3ARPA 4ITZA 2XP5A 1LJYA 4G50A 1FJDA 3O5FA 3LUOA 3NTPA 1FD9A 1NMWA 4MTVA 1ZU8A 2ESCA 3UI6A 2KE0A 2RURA 4ODPA 2F21A 4MGVA 3ALFA 2LPVA 1H0GA 3ARZA 2DT2A 1NWRA 2Y78A 2K8IA 4ODNA 1VF8A 2FDMA 4WIWA 2ITKA 4DWSC 3FXYA 2O92A 4DRPA
chains in the Genus database with same CATH topology
3BXWA 1W9PA 2D9FA 1E15A 1FFQA 1E6ZA 3KACA 4FN2A 4L3NA 3CHFA 4BF8A 1ITXA 1EHNA 3ARSA 2DG3A 2FAPA 4TW8A 3MDYB 1E6RA 4O2TA 2G8ZA 1FAPA 4Z2KA 3O5RA 2KGJA 2VCDA 1NMVA 1ZBKA 3I6CA 5GQBA 4NNRA 1J4HA 2PPOA 3IHZA 2XPAA 1FKBA 3ARXA 3RFWA 4DRNA 1NWUA 2MF9A 3O5JA 3WQWA 1A7XA 3JYMA 5HBFA 4DZ2A 1NH6A 1FKSA 2PI6A 1BKFA 2XP8A 2YBUA 3B9AA 2M2AA 4N19A 3AS3A 4R0XA 1JVWA 3O5QA 1FKTA 3RM9A 2DG4A 3O5IA 2OFNA 1O6IA 2RQSA 2AOSA 4U85A 5I98A 4TNSA 4HBEA 4MNJA 3RM4A 3RM8A 2OLHA 3AS1A 1J4IA 2LJ4A 3PRAA 1HJWA 2O9OA 3UQIA 1FKLA 2PBCA 5JH8A 4AY1A 4ZPVR 5B8IC 4DRKA 3PRDA 4W5UA 1HXVA 3B7XA 4JFMA 4P8XA 1FKKA 1NWTA 4LAYA 2L2SA 3WKZA 1Q1CA 4U86A 1GUVA 3KAIA 3WL1A 3GPKA 1KFWA 1W1PA 4HARA 4TX0A 3WD2A 1D2KA 1RD6A 1XRVA 5HTGA 2MLYA 4MNKA 4TW6A 3CZ8A 3B8SA 3FY1A 4DRQA 3ARVA 4ODRA 1UR8A 2VN1A 1JNDA 2ZQTA 2MPHA 4Z2HA 2DPEA 2A3BA 4WKAA 2IF4A 3WH0A 1WNOA 3JXVA 4DT4A 2KFWA 4DRIA 2RUDA 2RUCA 3KAGA 3WIJA 2QF8A 4DH0A 2XP9A 3CGNA 4WKFA 4J4OA 4WJXA 4Z2GA 3CHEA 3RGCA 1HKIA 3ARRA 1B6CA 1HKKA 1XHGA 5HWCA 1E6NA 5DIUA 3KZ7A 3ARYA 1W1YA 4P8UA 1Q6UA 3OOBA 1X6NA 4DROA 1QPLA 3AS2A 1U79A 3IK8A 3UF8A 3WD1A 3JYJA 4DZ3A 3G6LA 4ODLA 4IPXA 3TCZA 5GPRA 3O5EA 1F8AB 4U84A 3TDBA 4QT2A 4XAKA 4ODOA 5DITA 4IT4A 4IQ2A 4DIPA 3ODKA 4ODMA 1JNTA 1E6PA 3UQBA 1D7IA 1CTNA 1F40A 3ARWA 4ODQA 4MNMA 2Q5AA 3QOKA 4TYOA 1LQ0A 1ZK6A 4ODKA 2DSZA 1L1PA 3AQUA 3ALGA 4NSBA 4LAVA 4ML4A 4W9OA 1NWSA 5DF0A 2M08A 4QT3A 2B31A 1FKGA 1ZBWA 2F2DA 4JFIA 1LL4A 4LAXA 1ROUA 2DSWA 5D75A 3WQVA 4FAPA 1FKJA 1W1TA 3UI4A 4DWSB 1ZB5A 2ZR5A 1KT0A 1GPFA 3O5MA 3VAWA 2WK2A 1D7HA 2JZVA 3B9EA 3ARTA 3CHCA 4LAWA 3WL0A 4MNLA 2A3EA 4QIBA 1Q6IA 3TC5A 4ZS6A 1EIBA 3AS0A 3CGMA 3IKDA 2ZR6A 2XP6A 4NZCA 5DEZA 4TW7A 2PV2A 2MLXA 4DWSA 1ZCNA 5DIVA 3PRBA 4JFKA 1M5YA 4R5EA 4JFLA 4C02B 1EQ3A 1OWQA 4MPKA 1LL7A 2PV1A 3CH9A 3ARUA 3O5OA 2M1IA 3PR9A 2ZQVA 1C9HA 1PBKA 3O5PA 5BXJA 5HUAA 2RSEA 3KCEA 2KO7A 3RMEA 1P5QA 1FKRA 2KR7A 1W9VA 2DSVA 4ZPWR 4DWSD 2PPNA 4S3KA 1Q6HA 1D6OA 2DG9A 1K9TA 1FKIA 2PV3A 4MAVA 4KR0B 4S3JA 3UQAA 3O5KA 1LL6A 1SR0A 4IT6A 1J4RA 1E9LA 1FKHA 2XPBA 2DT1A 3H9RB 2LKNA 4LGXA 3O5GA 1N1AA 2DT3A 2WLYA 3IKGA 1LG2A 1JNEA 3AROA 5HWBA 1R9HA 4GIVA 3G6MA 4KQZA 4PTMA 3KABA 1FKFA 1YATA 2KI3A 2FKEA 1JNSA 2ZQSA 2AWGA 1OGBA 4JYSA 4Z2LA 3W4RA 5HT1A 1WAWA 2A3CA 4Z2JA 1ROTA 1EDQA 3KAHA 5GPGA 1HJXA 4GGQA 4ZPTR 4L72B 2ZR4A 1HKJA 4DRJA 1W9UA 5HW7A 3CHDA 2WLZA 4MSPA 5DO2A 1WB0A 4W9PA 1D7JA 3NI6A 5J6EA 1QZ2A 1ZL1A 1ZBVA 4G2PA 3EY6A 1J6YA 3ARQA 2UZ5A 3O5DA 4P8VA 2F4EA 2DSUA 2XP4A 2WM0A 4WK9A 5HW8A 2YBTA 4Q7NA 4W9QA 1TFVA 1KT1A 4DRHA 1W1VA 1HJVA 2MLZA 1X6LA 3B9DA 3FAPA 3UI5A 1HKMA 3KAFA 2RUQA 1EYMA 1QPFA 3O5LA 1SYTA 1NSGA 1W26A 5HKGA 1FFRA 1T11A 4QZVB 1GOIA 2XP7A 5HW6A 1OGGA 3NRKA 3WD4A 3KADA 2LGOA 1IX5A 1PINA 4DRMA 3WD0A 4Z2IA 4IQCA 1ZBCA 4WKHA 2DT0A 4J4NA 4P8WA 1YW5A 2PPPA 4Q22A 2A3AA 2IUZA 4JFJA 2N87A 1BL4A 1Y0OA 3OA5A 2XP3A 1UR9A 2G41A 1H0IA 4HBOA 2ZQUA 1LG1A 3PA7A 3WD3A 1FKDA 2MNTA 1TCOC 4URIA 3ARPA 4ITZA 2XP5A 1LJYA 4G50A 1FJDA 3O5FA 3LUOA 3NTPA 1FD9A 1NMWA 4MTVA 1ZU8A 2ESCA 3UI6A 2KE0A 2RURA 4ODPA 2F21A 4MGVA 3ALFA 2LPVA 1H0GA 3ARZA 2DT2A 1NWRA 2Y78A 2K8IA 4ODNA 1VF8A 2FDMA 4WIWA 2ITKA 4DWSC 3FXYA 2O92A 4DRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAH A;  5GPG A;  4TW7 A;  2IF4 A;  2D9F A;  2PV2 A;  4FN2 A;  3KAC A;  4GGQ A;  2MLX A;  1ZCN A;  3WH0 A;  2ZR4 A;  4BF8 A;  5DIV A;  3JXV A;  3PRB A;  4JFK A;  2KFW A;  4DRJ A;  1M5Y A;  4DRI A;  4DT4 A;  5HW7 A;  2RUD A;  4JFL A;  2RUC A;  4C02 B;  3KAG A;  4MSP A;  1EQ3 A;  4W9P A;  1D7J A;  3NI6 A;  2DG3 A;  5J6E A;  2FAP A;  4DH0 A;  2XP9 A;  3CGN A;  2PV1 A;  4TW8 A;  1QZ2 A;  3MDY B;  4O2T A;  4G2P A;  4J4O A;  3EY6 A;  1J6Y A;  2UZ5 A;  3O5D A;  1FAP A;  3RGC A;  3O5O A;  3O5R A;  2M1I A;  2F4E A;  2KGJ A;  2VCD A;  2ZQV A;  1C9H A;  1NMV A;  1B6C A;  2XP4 A;  3I6C A;  1PBK A;  3O5P A;  5HW8 A;  5BXJ A;  4NNR A;  5HUA A;  2RSE A;  1J4H A;  2PPO A;  3IHZ A;  4W9Q A;  5HWC A;  1KT1 A;  4DRH A;  5DIU A;  2XPA A;  3KZ7 A;  2MLZ A;  3KCE A;  1FKB A;  3RFW A;  2KO7 A;  4DRN A;  2MF9 A;  1P5Q A;  3FAP A;  3KAF A;  3O5J A;  3UI5 A;  1FKR A;  1A7X A;  2RUQ A;  1EYM A;  1Q6U A;  1QPF A;  3OOB A;  3O5L A;  3JYM A;  4DRO A;  1QPL A;  1NSG A;  1W26 A;  4DZ2 A;  2KR7 A;  1U79 A;  1FKS A;  3IK8 A;  3UF8 A;  1BKF A;  2XP8 A;  3JYJ A;  4DZ3 A;  5HKG A;  1T11 A;  4ODL A;  2M2A A;  5HW6 A;  2XP7 A;  4IPX A;  3NRK A;  3TCZ A;  4N19 A;  3O5E A;  1F8A B;  4R0X A;  4U84 A;  3TDB A;  4QT2 A;  1JVW A;  3KAD A;  3O5Q A;  2LGO A;  1FKT A;  2PPN A;  2DG4 A;  1PIN A;  1Q6H A;  1D6O A;  2OFN A;  2RQS A;  3O5I A;  2DG9 A;  4DRM A;  4ODO A;  4IQC A;  5DIT A;  1FKI A;  2PV3 A;  4IQ2 A;  4U85 A;  4DIP A;  3ODK A;  4ODM A;  5I98 A;  1JNT A;  3UQA A;  3O5K A;  4TNS A;  4J4N A;  3UQB A;  1D7I A;  1F40 A;  1YW5 A;  2PPP A;  1J4I A;  2LJ4 A;  1J4R A;  4ODQ A;  1FKH A;  2Q5A A;  2XPB A;  4JFJ A;  3UQI A;  2N87 A;  1BL4 A;  4TYO A;  1FKL A;  1Y0O A;  2PBC A;  2LKN A;  3H9R B;  2XP3 A;  1ZK6 A;  4ODK A;  4DRK A;  5B8I C;  3O5G A;  1N1A A;  3PRD A;  1L1P A;  2ZQU A;  3PA7 A;  1HXV A;  3B7X A;  1FKD A;  4JFM A;  4LAV A;  3IKG A;  1FKK A;  2MNT A;  1TCO C;  4W9O A;  4ITZ A;  2M08 A;  2XP5 A;  4G50 A;  1FJD A;  3O5F A;  4QT3 A;  5HWB A;  1R9H A;  4GIV A;  4LAY A;  3LUO A;  2L2S A;  3NTP A;  1Q1C A;  4U86 A;  1FKG A;  3KAI A;  2F2D A;  4JFI A;  1FD9 A;  1NMW A;  1ROU A;  3GPK A;  4LAX A;  4TX0 A;  5D75 A;  3UI6 A;  4FAP A;  1FKJ A;  2KE0 A;  3KAB A;  3UI4 A;  2RUR A;  4ODP A;  1FKF A;  5HTG A;  2F21 A;  4MGV A;  1YAT A;  2MLY A;  2ZR5 A;  1KT0 A;  3O5M A;  4TW6 A;  2LPV A;  3VAW A;  1D7H A;  2JZV A;  2KI3 A;  2FKE A;  4DRQ A;  2ZQS A;  1JNS A;  2AWG A;  4ODR A;  2VN1 A;  4LAW A;  2Y78 A;  2K8I A;  4ODN A;  2ZQT A;  4QIB A;  1Q6I A;  2ITK A;  2MPH A;  4JYS A;  3TC5 A;  5HT1 A;  3CGM A;  3IKD A;  2ZR6 A;  2XP6 A;  1ROT A;  4DRP A; 
#chains in the Genus database with same CATH topology
 3BXW A;  1W9P A;  1GRJ A;  2D9F A;  1E15 A;  1FFQ A;  1E6Z A;  3KAC A;  4FN2 A;  4L3N A;  3CHF A;  4BF8 A;  1ITX A;  1EHN A;  3ARS A;  2DG3 A;  2FAP A;  4TW8 A;  3MDY B;  1E6R A;  4O2T A;  2G8Z A;  1FAP A;  4Z2K A;  3O5R A;  2KGJ A;  2VCD A;  1NMV A;  1ZBK A;  3I6C A;  5GQB A;  4NNR A;  1J4H A;  2PPO A;  3IHZ A;  2XPA A;  1FKB A;  3ARX A;  3RFW A;  4DRN A;  1NWU A;  2MF9 A;  2PN0 A;  3O5J A;  3WQW A;  1A7X A;  3JYM A;  5HBF A;  4DZ2 A;  1NH6 A;  1FKS A;  2PI6 A;  1BKF A;  2XP8 A;  2YBU A;  3B9A A;  2M2A A;  4N19 A;  3AS3 A;  4R0X A;  1JVW A;  3O5Q A;  1FKT A;  3RM9 A;  2DG4 A;  3O5I A;  2OFN A;  1O6I A;  2RQS A;  2AOS A;  4U85 A;  5I98 A;  4TNS A;  4HBE A;  4MNJ A;  3RM4 A;  3RM8 A;  2OLH A;  3AS1 A;  1J4I A;  2LJ4 A;  3PRA A;  1HJW A;  2O9O A;  2P4V A;  3UQI A;  1FKL A;  2PBC A;  5JH8 A;  4AY1 A;  4ZPV R;  5B8I C;  4DRK A;  3PRD A;  4W5U A;  1HXV A;  3B7X A;  4JFM A;  4P8X A;  1FKK A;  1NWT A;  4LAY A;  2L2S A;  3WKZ A;  1Q1C A;  4U86 A;  1GUV A;  3KAI A;  3WL1 A;  3GPK A;  1KFW A;  1W1P A;  4HAR A;  4TX0 A;  3WD2 A;  1D2K A;  1RD6 A;  1XRV A;  5HTG A;  2MLY A;  4MNK A;  4TW6 A;  3CZ8 A;  3B8S A;  3FY1 A;  4DRQ A;  3ARV A;  4ODR A;  1UR8 A;  2VN1 A;  1JND A;  2ZQT A;  2MPH A;  4Z2H A;  2DPE A;  2A3B A;  4WKA A;  2IF4 A;  3WH0 A;  1WNO A;  3JXV A;  4DT4 A;  2KFW A;  4DRI A;  2RUD A;  2RUC A;  3KAG A;  1E44 A;  3WIJ A;  2QF8 A;  4DH0 A;  2XP9 A;  3CGN A;  4WKF A;  4J4O A;  4WJX A;  4Z2G A;  3CHE A;  3RGC A;  1HKI A;  3ARR A;  1B6C A;  1HKK A;  1XHG A;  5HWC A;  1E6N A;  5DIU A;  3KZ7 A;  3ARY A;  1W1Y A;  4P8U A;  1Q6U A;  3OOB A;  1X6N A;  4DRO A;  1QPL A;  3AS2 A;  1U79 A;  3IK8 A;  3UF8 A;  3WD1 A;  3JYJ A;  4DZ3 A;  3G6L A;  4ODL A;  4IPX A;  3TCZ A;  5GPR A;  3O5E A;  1F8A B;  4U84 A;  3TDB A;  4QT2 A;  4XAK A;  4ODO A;  5DIT A;  4IT4 A;  4IQ2 A;  4DIP A;  3ODK A;  4ODM A;  1JNT A;  1E6P A;  3UQB A;  1D7I A;  1CTN A;  1F40 A;  3ARW A;  4ODQ A;  4MNM A;  2Q5A A;  3QOK A;  4TYO A;  4UDM A;  1LQ0 A;  1ZK6 A;  4ODK A;  2DSZ A;  1L1P A;  3AQU A;  3ALG A;  4NSB A;  4LAV A;  4ML4 A;  4W9O A;  1NWS A;  5DF0 A;  2M08 A;  4QT3 A;  2B31 A;  3GU0 A;  1FKG A;  1ZBW A;  2F2D A;  4JFI A;  1LL4 A;  4LAX A;  1ROU A;  2DSW A;  5D75 A;  3WQV A;  4FAP A;  1FKJ A;  1W1T A;  3UI4 A;  4DWS B;  1ZB5 A;  2ZR5 A;  1KT0 A;  1GPF A;  3O5M A;  3VAW A;  2WK2 A;  1D7H A;  2JZV A;  3B9E A;  3ART A;  3CHC A;  4LAW A;  3WL0 A;  4MNL A;  2A3E A;  4QIB A;  1Q6I A;  3TC5 A;  4ZS6 A;  1EIB A;  3AS0 A;  3CGM A;  3IKD A;  2ZR6 A;  2XP6 A;  4NZC A;  5DEZ A;  4TW7 A;  2PV2 A;  2MLX A;  4DWS A;  1ZCN A;  5DIV A;  3PRB A;  4JFK A;  1M5Y A;  4R5E A;  4JFL A;  4C02 B;  1EQ3 A;  1OWQ A;  4MPK A;  1LL7 A;  2PV1 A;  3CH9 A;  3ARU A;  3O5O A;  2M1I A;  3PR9 A;  2ZQV A;  1C9H A;  1PBK A;  3O5P A;  5BXJ A;  5HUA A;  2RSE A;  3KCE A;  2KO7 A;  3RME A;  1P5Q A;  1FKR A;  2KR7 A;  2ETN A;  1W9V A;  2DSV A;  4ZPW R;  1JCH B;  4DWS D;  2PPN A;  4S3K A;  1Q6H A;  1D6O A;  2DG9 A;  3EIP A;  1K9T A;  1FKI A;  2PV3 A;  4MAV A;  4KR0 B;  4S3J A;  3UQA A;  3O5K A;  1LL6 A;  1SR0 A;  4IT6 A;  1J4R A;  1E9L A;  2B5U B;  1FKH A;  2XPB A;  2DT1 A;  3H9R B;  2LKN A;  4LGX A;  3O5G A;  1N1A A;  2DT3 A;  2WLY A;  3BMB A;  3IKG A;  1LG2 A;  1JNE A;  3ARO A;  5HWB A;  1R9H A;  4GIV A;  3G6M A;  4KQZ A;  4PTM A;  3KAB A;  1FKF A;  1YAT A;  2KI3 A;  2FKE A;  1JNS A;  2ZQS A;  2AWG A;  1OGB A;  4JYS A;  4Z2L A;  3W4R A;  5HT1 A;  1WAW A;  2A3C A;  4Z2J A;  1ROT A;  1EDQ A;  3KAH A;  5GPG A;  1HJX A;  4GGQ A;  4ZPT R;  4L72 B;  2ZR4 A;  1HKJ A;  4DRJ A;  1W9U A;  5HW7 A;  3CHD A;  2WLZ A;  4MSP A;  5DO2 A;  1WB0 A;  4W9P A;  1D7J A;  3NI6 A;  5J6E A;  2F23 A;  1QZ2 A;  1ZL1 A;  1ZBV A;  4G2P A;  3EY6 A;  1J6Y A;  3ARQ A;  2UZ5 A;  3O5D A;  4P8V A;  3GTY X;  2F4E A;  2DSU A;  2XP4 A;  2WM0 A;  4WK9 A;  5HW8 A;  2YBT A;  4Q7N A;  4W9Q A;  1TFV A;  1KT1 A;  4DRH A;  1W1V A;  1HJV A;  2MLZ A;  1X6L A;  3B9D A;  3FAP A;  3UI5 A;  1HKM A;  3KAF A;  2RUQ A;  1EYM A;  1QPF A;  3O5L A;  1SYT A;  1NSG A;  1W26 A;  5HKG A;  1FFR A;  1T11 A;  4QZV B;  1GOI A;  2XP7 A;  5HW6 A;  1OGG A;  3NRK A;  3WD4 A;  3KAD A;  2LGO A;  1IX5 A;  1PIN A;  4DRM A;  3WD0 A;  4Z2I A;  4IQC A;  1ZBC A;  4WKH A;  2DT0 A;  4J4N A;  4P8W A;  1YW5 A;  2PPP A;  4Q22 A;  2A3A A;  2IUZ A;  4JFJ A;  2N87 A;  1BL4 A;  1Y0O A;  3OA5 A;  2XP3 A;  1UR9 A;  2G41 A;  1H0I A;  4HBO A;  2ZQU A;  1LG1 A;  3PA7 A;  3WD3 A;  1FKD A;  2MNT A;  2EUL A;  1TCO C;  4URI A;  3ARP A;  4ITZ A;  2XP5 A;  1LJY A;  4G50 A;  1FJD A;  3O5F A;  3LUO A;  3NTP A;  1FD9 A;  1NMW A;  4MTV A;  1ZU8 A;  2ESC A;  3UI6 A;  2KE0 A;  2RUR A;  4ODP A;  2F21 A;  4MGV A;  3ALF A;  2LPV A;  1H0G A;  3ARZ A;  2DT2 A;  1NWR A;  2Y78 A;  2K8I A;  4ODN A;  1VF8 A;  2FDM A;  4WIW A;  2ITK A;  4DWS C;  3FXY A;  2O92 A;  4DRP A; 
#chains in the Genus database with same CATH homology
 3BXW A;  1W9P A;  2D9F A;  1E15 A;  1FFQ A;  1E6Z A;  3KAC A;  4FN2 A;  4L3N A;  3CHF A;  4BF8 A;  1ITX A;  1EHN A;  3ARS A;  2DG3 A;  2FAP A;  4TW8 A;  3MDY B;  1E6R A;  4O2T A;  2G8Z A;  1FAP A;  4Z2K A;  3O5R A;  2KGJ A;  2VCD A;  1NMV A;  1ZBK A;  3I6C A;  5GQB A;  4NNR A;  1J4H A;  2PPO A;  3IHZ A;  2XPA A;  1FKB A;  3ARX A;  3RFW A;  4DRN A;  1NWU A;  2MF9 A;  3O5J A;  3WQW A;  1A7X A;  3JYM A;  5HBF A;  4DZ2 A;  1NH6 A;  1FKS A;  2PI6 A;  1BKF A;  2XP8 A;  2YBU A;  3B9A A;  2M2A A;  4N19 A;  3AS3 A;  4R0X A;  1JVW A;  3O5Q A;  1FKT A;  3RM9 A;  2DG4 A;  3O5I A;  2OFN A;  1O6I A;  2RQS A;  2AOS A;  4U85 A;  5I98 A;  4TNS A;  4HBE A;  4MNJ A;  3RM4 A;  3RM8 A;  2OLH A;  3AS1 A;  1J4I A;  2LJ4 A;  3PRA A;  1HJW A;  2O9O A;  3UQI A;  1FKL A;  2PBC A;  5JH8 A;  4AY1 A;  4ZPV R;  5B8I C;  4DRK A;  3PRD A;  4W5U A;  1HXV A;  3B7X A;  4JFM A;  4P8X A;  1FKK A;  1NWT A;  4LAY A;  2L2S A;  3WKZ A;  1Q1C A;  4U86 A;  1GUV A;  3KAI A;  3WL1 A;  3GPK A;  1KFW A;  1W1P A;  4HAR A;  4TX0 A;  3WD2 A;  1D2K A;  1RD6 A;  1XRV A;  5HTG A;  2MLY A;  4MNK A;  4TW6 A;  3CZ8 A;  3B8S A;  3FY1 A;  4DRQ A;  3ARV A;  4ODR A;  1UR8 A;  2VN1 A;  1JND A;  2ZQT A;  2MPH A;  4Z2H A;  2DPE A;  2A3B A;  4WKA A;  2IF4 A;  3WH0 A;  1WNO A;  3JXV A;  4DT4 A;  2KFW A;  4DRI A;  2RUD A;  2RUC A;  3KAG A;  3WIJ A;  2QF8 A;  4DH0 A;  2XP9 A;  3CGN A;  4WKF A;  4J4O A;  4WJX A;  4Z2G A;  3CHE A;  3RGC A;  1HKI A;  3ARR A;  1B6C A;  1HKK A;  1XHG A;  5HWC A;  1E6N A;  5DIU A;  3KZ7 A;  3ARY A;  1W1Y A;  4P8U A;  1Q6U A;  3OOB A;  1X6N A;  4DRO A;  1QPL A;  3AS2 A;  1U79 A;  3IK8 A;  3UF8 A;  3WD1 A;  3JYJ A;  4DZ3 A;  3G6L A;  4ODL A;  4IPX A;  3TCZ A;  5GPR A;  3O5E A;  1F8A B;  4U84 A;  3TDB A;  4QT2 A;  4XAK A;  4ODO A;  5DIT A;  4IT4 A;  4IQ2 A;  4DIP A;  3ODK A;  4ODM A;  1JNT A;  1E6P A;  3UQB A;  1D7I A;  1CTN A;  1F40 A;  3ARW A;  4ODQ A;  4MNM A;  2Q5A A;  3QOK A;  4TYO A;  1LQ0 A;  1ZK6 A;  4ODK A;  2DSZ A;  1L1P A;  3AQU A;  3ALG A;  4NSB A;  4LAV A;  4ML4 A;  4W9O A;  1NWS A;  5DF0 A;  2M08 A;  4QT3 A;  2B31 A;  1FKG A;  1ZBW A;  2F2D A;  4JFI A;  1LL4 A;  4LAX A;  1ROU A;  2DSW A;  5D75 A;  3WQV A;  4FAP A;  1FKJ A;  1W1T A;  3UI4 A;  4DWS B;  1ZB5 A;  2ZR5 A;  1KT0 A;  1GPF A;  3O5M A;  3VAW A;  2WK2 A;  1D7H A;  2JZV A;  3B9E A;  3ART A;  3CHC A;  4LAW A;  3WL0 A;  4MNL A;  2A3E A;  4QIB A;  1Q6I A;  3TC5 A;  4ZS6 A;  1EIB A;  3AS0 A;  3CGM A;  3IKD A;  2ZR6 A;  2XP6 A;  4NZC A;  5DEZ A;  4TW7 A;  2PV2 A;  2MLX A;  4DWS A;  1ZCN A;  5DIV A;  3PRB A;  4JFK A;  1M5Y A;  4R5E A;  4JFL A;  4C02 B;  1EQ3 A;  1OWQ A;  4MPK A;  1LL7 A;  2PV1 A;  3CH9 A;  3ARU A;  3O5O A;  2M1I A;  3PR9 A;  2ZQV A;  1C9H A;  1PBK A;  3O5P A;  5BXJ A;  5HUA A;  2RSE A;  3KCE A;  2KO7 A;  3RME A;  1P5Q A;  1FKR A;  2KR7 A;  1W9V A;  2DSV A;  4ZPW R;  4DWS D;  2PPN A;  4S3K A;  1Q6H A;  1D6O A;  2DG9 A;  1K9T A;  1FKI A;  2PV3 A;  4MAV A;  4KR0 B;  4S3J A;  3UQA A;  3O5K A;  1LL6 A;  1SR0 A;  4IT6 A;  1J4R A;  1E9L A;  1FKH A;  2XPB A;  2DT1 A;  3H9R B;  2LKN A;  4LGX A;  3O5G A;  1N1A A;  2DT3 A;  2WLY A;  3IKG A;  1LG2 A;  1JNE A;  3ARO A;  5HWB A;  1R9H A;  4GIV A;  3G6M A;  4KQZ A;  4PTM A;  3KAB A;  1FKF A;  1YAT A;  2KI3 A;  2FKE A;  1JNS A;  2ZQS A;  2AWG A;  1OGB A;  4JYS A;  4Z2L A;  3W4R A;  5HT1 A;  1WAW A;  2A3C A;  4Z2J A;  1ROT A;  1EDQ A;  3KAH A;  5GPG A;  1HJX A;  4GGQ A;  4ZPT R;  4L72 B;  2ZR4 A;  1HKJ A;  4DRJ A;  1W9U A;  5HW7 A;  3CHD A;  2WLZ A;  4MSP A;  5DO2 A;  1WB0 A;  4W9P A;  1D7J A;  3NI6 A;  5J6E A;  1QZ2 A;  1ZL1 A;  1ZBV A;  4G2P A;  3EY6 A;  1J6Y A;  3ARQ A;  2UZ5 A;  3O5D A;  4P8V A;  2F4E A;  2DSU A;  2XP4 A;  2WM0 A;  4WK9 A;  5HW8 A;  2YBT A;  4Q7N A;  4W9Q A;  1TFV A;  1KT1 A;  4DRH A;  1W1V A;  1HJV A;  2MLZ A;  1X6L A;  3B9D A;  3FAP A;  3UI5 A;  1HKM A;  3KAF A;  2RUQ A;  1EYM A;  1QPF A;  3O5L A;  1SYT A;  1NSG A;  1W26 A;  5HKG A;  1FFR A;  1T11 A;  4QZV B;  1GOI A;  2XP7 A;  5HW6 A;  1OGG A;  3NRK A;  3WD4 A;  3KAD A;  2LGO A;  1IX5 A;  1PIN A;  4DRM A;  3WD0 A;  4Z2I A;  4IQC A;  1ZBC A;  4WKH A;  2DT0 A;  4J4N A;  4P8W A;  1YW5 A;  2PPP A;  4Q22 A;  2A3A A;  2IUZ A;  4JFJ A;  2N87 A;  1BL4 A;  1Y0O A;  3OA5 A;  2XP3 A;  1UR9 A;  2G41 A;  1H0I A;  4HBO A;  2ZQU A;  1LG1 A;  3PA7 A;  3WD3 A;  1FKD A;  2MNT A;  1TCO C;  4URI A;  3ARP A;  4ITZ A;  2XP5 A;  1LJY A;  4G50 A;  1FJD A;  3O5F A;  3LUO A;  3NTP A;  1FD9 A;  1NMW A;  4MTV A;  1ZU8 A;  2ESC A;  3UI6 A;  2KE0 A;  2RUR A;  4ODP A;  2F21 A;  4MGV A;  3ALF A;  2LPV A;  1H0G A;  3ARZ A;  2DT2 A;  1NWR A;  2Y78 A;  2K8I A;  4ODN A;  1VF8 A;  2FDM A;  4WIW A;  2ITK A;  4DWS C;  3FXY A;  2O92 A;  4DRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...