4LAWA

Crystal structure analysis of fkbp52, crystal form iii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
235
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
total genus 56
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lawA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4lawA02
2FAPA 5HWBA 4N19A 2PPOA 4DRIA 1FKLA 5HTGA 2D9FA 2ITKA 3PA7A 5HKGA 5DITA 3EY6A 1JNTA 2K8IA 4IQCA 4DRMA 3B7XA 1EYMA 5D75A 2Q5AA 2XP4A 4LAWA 2KFWA 2DG9A 3CGMA 1FJDA 1L1PA 3O5FA 3ODKA 4U84A 3UQAA 1FKBA 3H9RB 1FKRA 4JFIA 3O5DA 1FKFA 1FD9A 1FKTA 3JYMA 4DRJA 2ZQTA 3O5JA 3KAHA 3IKDA 4ODLA 3I6CA 5HT1A 2ZR4A 3IKGA 4JFJA 2XP8A 4GIVA 2KI3A 2RUQA 4TW6A 2DG3A 4ODKA 1ZCNA 2M08A 4ODOA 1J4RA 2PBCA 2LGOA 4QT2A 3KAGA 1N1AA 3UQBA 2RSEA 3KAFA 1NMWA 1HXVA 2OFNA 1FKHA 2AWGA 1QPFA 5HW7A 2UZ5A 1D7HA 2N87A 3JXVA 5HWCA 5HUAA 1ZK6A 2KGJA 4FAPA 1EQ3A 1FKKA 1NSGA 4JFMA 4JYSA 3PRBA 1ROTA 2PPNA 3NTPA 2MLYA 4JFKA 1BL4A 5HW8A 1FKGA 2ZR5A 2KR7A 4QIBA 1JVWA 3FAPA 4QT3A 2M1IA 3O5MA 5HW6A 2DG4A 3GPKA 1R9HA 4LAXA 2FKEA 3KCEA 2MF9A 4O2TA 2XPAA 1D6OA 3TCZA 1W26A 4BF8A 5B8IC 3CGNA 3KACA 4JFLA 3IHZA 1PINA 2MNTA 3IK8A 3O5QA 3KABA 4TX0A 2IF4A 5BXJA 1C9HA 4TW7A 3OOBA 1D7IA 2XP9A 3TC5A 2VN1A 2KO7A 2ZR6A 2LPVA 1BKFA 2KE0A 4TW8A 3O5RA 3JYJA 3KAIA 2MPHA 1KT0A 1Q6HA 5GPGA 3RFWA 3O5GA 2JZVA 5J6EA 3UI4A 1M5YA 2LKNA 4IPXA 2RQSA 3PRDA 4GGQA 3UQIA 2XPBA 4R0XA 1YATA 4DZ2A 3KADA 1J6YA 2F4EA 4W9PA 4DRHA 1F8AB 1FAPA 4DZ3A 1J4IA 4C02B 1FKJA 1FKIA 1Q6IA 3O5LA 2RURA 3O5IA 3O5EA 1F40A 4LAVA 1YW5A 1FKSA 1Q1CA 4U86A 4G50A 4ITZA 4J4OA 4ODMA 4MGVA 2F2DA 3UI6A 2Y78A 1P5QA 1Y0OA 3KZ7A 4J4NA 1JNSA 3O5PA 4ODNA 3LUOA 2M2AA 4W9OA 1J4HA 1B6CA 4U85A 2RUDA 4ODRA 4DRKA 2XP7A 4DRPA 2VCDA 5DIVA 4ODPA 1KT1A 2LJ4A 4MSPA 1D7JA 1U79A 2PV3A 2XP5A 2ZQVA 4LAYA 4TYOA 4DROA 1TCOC 4DIPA 4DT4A 2PV2A 3NRKA 4IQ2A 2F21A 2ZQUA 4FN2A 4ODQA 4DH0A 1T11A 2MLZA 3MDYB 5I98A 4NNRA 4TNSA 2XP6A 1A7XA 1Q6UA 1QZ2A 4W9QA 4DRNA 1NMVA 3RGCA 4DRQA 3VAWA 3UF8A 1FKDA 3O5OA 1QPLA 3UI5A 2PPPA 1ROUA 3O5KA 1PBKA 2MLXA 3TDBA 2ZQSA 2PV1A 4G2PA 5DIUA 3WH0A 2RUCA 2XP3A 2L2SA 3NI6A
chains in the Genus database with same CATH superfamily
2FAPA 1E9LA 2A3CA 3ARXA 1ITXA 3EY6A 1SYTA 3AS1A 1HJXA 1L1PA 1FFQA 3O5DA 3JYMA 4QZVB 3W4RA 3O5JA 3PRAA 4ODLA 3ARRA 5HT1A 2ZR4A 1TFVA 2XP8A 4GIVA 5DEZA 4TW6A 4NSBA 2WK2A 1W1VA 1UR8A 3WQVA 2PBCA 3KAGA 3UQBA 2RSEA 1D2KA 1JNDA 2DSZA 5HW7A 5HUAA 5HWCA 4ML4A 1ZK6A 1ZBCA 1W9UA 4R5EA 3WD1A 1JNEA 3NTPA 1BL4A 3AS0A 5HW8A 1LG1A 2ZR5A 3FAPA 2M1IA 2PN0A 3KCEA 1K9TA 1D6OA 3TCZA 4BF8A 3KACA 3IHZA 1PINA 3O5QA 4P8WA 3KABA 1C9HA 3FXYA 3OA5A 2VN1A 4Z2LA 2KE0A 2OLHA 3O5RA 3WL1A 3CHCA 1KT0A 5GPGA 3RMEA 1E6NA 1M5YA 2LKNA 4MTVA 2XPBA 4R0XA 2A3BA 4DZ2A 1ZBKA 4C02B 4WKAA 1FKIA 1Q6IA 3O5EA 1KFWA 1LL6A 4ITZA 3AS3A 2Y78A 1P5QA 3KZ7A 3O5PA 1HKIA 4U85A 2RUDA 5DF0A 2AOSA 4ZS6A 4DRKA 4DWSB 4ODPA 1KT1A 1D7JA 2PV3A 4WIWA 1OWQA 4NZCA 1ZBWA 1ZB5A 3WKZA 3ALFA 3MDYB 4P8VA 4NNRA 1NWUA 4DRNA 1EHNA 1NMVA 3VAWA 3UF8A 1ZL1A 4L72B 3TDBA 3WQWA 2ZQSA 2ETNA 3CHEA 2RUCA 4IT4A 2PPOA 4DRIA 2ITKA 3PA7A 2K8IA 3ARYA 3B9AA 4MNLA 2XP4A 3FY1A 3CGMA 3PR9A 4W5UA 3ODKA 3H9RB 1FKRA 3RM8A 1FKTA 4DRJA 2ZQTA 1E6PA 4JFJA 1W1PA 2KI3A 1FFRA 1XRVA 2DT3A 1GOIA 4QT2A 2G41A 1N1AA 3ARWA 1NMWA 1HXVA 1QPFA 2UZ5A 2KGJA 4JFMA 4JYSA 3PRBA 2O9OA 1FKGA 1E6ZA 3CHFA 4QIBA 1LJYA 2YBTA 5HW6A 3GPKA 1R9HA 2FKEA 4HBOA 1X6NA 2XPAA 1W26A 1W1YA 1ZBVA 2DPEA 4MAVA 4MNKA 4TW8A 4S3KA 1W9VA 1WAWA 3KAIA 3RFWA 1Q6HA 1VF8A 1HJWA 3GTYX 2JZVA 1EIBA 3UQIA 3B9DA 4GGQA 2EULA 3KADA 2ESCA 4W9PA 4DZ3A 3CHDA 1WB0A 1JCHB 4ZPVR 4LAVA 1FKSA 1GRJA 4WK9A 4J4OA 1O6IA 2FDMA 3BXWA 1JNSA 5JH8A 2B5UB 2WLYA 1J4HA 4URIA 4W9OA 2XP7A 2DT0A 4DRPA 1GPFA 4MSPA 4S3JA 1U79A 2ZQVA 2PV2A 3NRKA 1T11A 2MLZA 5I98A 4TNSA 1A7XA 1QZ2A 1NH6A 4WKHA 1FKDA 1QPLA 2PPPA 3NI6A 4XAKA 5HWBA 4N19A 1FKLA 2D9FA 3WD0A 4DWSC 4Z2KA 1EYMA 5D75A 4Z2JA 2Q5AA 5GPRA 4LAWA 2DT2A 2DG9A 2KFWA 4U84A 3UQAA 1FKBA 5HBFA 4JFIA 1FKFA 2B31A 3KAHA 3I6CA 2DT1A 2M08A 4ZPTR 1SR0A 2LGOA 4MNJA 4DWSA 4KQZA 3KAFA 3ARPA 1FKHA 2AWGA 3GU0A 1CTNA 3JXVA 1D7HA 1OGBA 3WD2A 1EQ3A 1ROTA 2PPNA 2MLYA 4JFKA 4MPKA 1E15A 2KR7A 5DO2A 4QT3A 3O5MA 1EDQA 4LAXA 4P8UA 2MF9A 5GQBA 5B8IC 3CGNA 4JFLA 3IK8A 2PI6A 5BXJA 3RM4A 3QOKA 1D7IA 2XP9A 2ZR6A 3JYJA 2MPHA 5J6EA 3UI4A 4IPXA 1YATA 4LGXA 1J6YA 3ARVA 1FAPA 1FKJA 1RD6A 2IUZA 1UR9A 4Z2GA 3O5LA 1H0IA 1F40A 1Q1CA 4U86A 4G50A 4MGVA 2F2DA 1XHGA 4P8XA 4J4NA 2G8ZA 1HKMA 4ODNA 3LUOA 3WD4A 2DSVA 4ODRA 2YBUA 2VCDA 5DIVA 4Q7NA 2LJ4A 3B8SA 4Z2HA 1WNOA 1IX5A 4DROA 4DIPA 4IQ2A 2F21A 4ODQA 4DH0A 2QF8A 2DSWA 1Q6UA 4W9QA 1LQ0A 2WLZA 3RGCA 4DRQA 3O5OA 1ZU8A 3CH9A 1PBKA 2MLXA 2PV1A 4G2PA 2F23A 3WH0A 2XP3A 3G6LA 4L3NA 2L2SA 3EIPA 5HTGA 3BMBA 1HKJA 5HKGA 5DITA 1JNTA 4KR0B 4IQCA 4DRMA 3B7XA 3RM9A 1FJDA 1E6RA 3O5FA 1FD9A 1OGGA 3IKDA 3IKGA 4UDMA 2RUQA 2DG3A 1W9PA 1H0GA 4ODKA 4HBEA 1ZCNA 2O92A 4ODOA 1J4RA 3ARZA 4ZPWR 2OFNA 4MNMA 2N87A 4FAPA 1GUVA 1FKKA 1NSGA 3ARTA 4WKFA 2P4VA 2A3EA 1LL4A 1NWRA 1JVWA 3CZ8A 2DG4A 3AQUA 4O2TA 1X6LA 1NWTA 4TX0A 2MNTA 2IF4A 4TW7A 3OOBA 3G6MA 3TC5A 2KO7A 2LPVA 1BKFA 3WD3A 3O5GA 2RQSA 3PRDA 3ALGA 2F4EA 3WIJA 4DRHA 1F8AB 1NWSA 1J4IA 4DWSD 3O5IA 2RURA 2WM0A 3ARQA 1YW5A 3AROA 3AS2A 4ODMA 4Q22A 3UI6A 1LG2A 1W1TA 1Y0OA 1LL7A 4AY1A 2M2AA 3ARUA 1B6CA 1E44A 2XP5A 4Z2IA 4LAYA 4TYOA 1TCOC 4WJXA 4DT4A 3ARSA 2ZQUA 4FN2A 3WL0A 4IT6A 2XP6A 2DSUA 3B9EA 3UI5A 4HARA 1ROUA 3O5KA 1HKKA 5DIUA 2A3AA 4PTMA 1HJVA
chains in the Genus database with same CATH topology
2FAPA 1E9LA 2A3CA 3ARXA 1ITXA 3EY6A 1SYTA 3AS1A 1HJXA 1L1PA 1FFQA 3O5DA 3JYMA 4QZVB 3W4RA 3O5JA 3PRAA 4ODLA 3ARRA 5HT1A 2ZR4A 1TFVA 2XP8A 4GIVA 5DEZA 4TW6A 4NSBA 2WK2A 1W1VA 1UR8A 3WQVA 2PBCA 3KAGA 3UQBA 2RSEA 1D2KA 1JNDA 2DSZA 5HW7A 5HUAA 5HWCA 4ML4A 1ZK6A 1ZBCA 1W9UA 4R5EA 3WD1A 1JNEA 3NTPA 1BL4A 3AS0A 5HW8A 1LG1A 2ZR5A 3FAPA 2M1IA 3KCEA 1K9TA 1D6OA 3TCZA 4BF8A 3KACA 3IHZA 1PINA 3O5QA 4P8WA 3KABA 1C9HA 3FXYA 3OA5A 2VN1A 4Z2LA 2KE0A 2OLHA 3O5RA 3WL1A 3CHCA 1KT0A 5GPGA 3RMEA 1E6NA 1M5YA 2LKNA 4MTVA 2XPBA 4R0XA 2A3BA 4DZ2A 1ZBKA 4C02B 4WKAA 1FKIA 1Q6IA 3O5EA 1KFWA 1LL6A 4ITZA 3AS3A 2Y78A 1P5QA 3KZ7A 3O5PA 1HKIA 4U85A 2RUDA 5DF0A 2AOSA 4ZS6A 4DRKA 4DWSB 4ODPA 1KT1A 1D7JA 2PV3A 4WIWA 1OWQA 4NZCA 1ZBWA 1ZB5A 3WKZA 3ALFA 3MDYB 4P8VA 4NNRA 1NWUA 4DRNA 1EHNA 1NMVA 3VAWA 3UF8A 1ZL1A 4L72B 3TDBA 3WQWA 2ZQSA 3CHEA 2RUCA 4IT4A 2PPOA 4DRIA 2ITKA 3PA7A 2K8IA 3ARYA 3B9AA 4MNLA 2XP4A 3FY1A 3CGMA 3PR9A 4W5UA 3ODKA 3H9RB 1FKRA 3RM8A 1FKTA 4DRJA 2ZQTA 1E6PA 4JFJA 1W1PA 2KI3A 1FFRA 1XRVA 2DT3A 1GOIA 4QT2A 2G41A 1N1AA 3ARWA 1NMWA 1HXVA 1QPFA 2UZ5A 2KGJA 4JFMA 4JYSA 3PRBA 2O9OA 1FKGA 1E6ZA 3CHFA 4QIBA 1LJYA 2YBTA 5HW6A 3GPKA 1R9HA 2FKEA 4HBOA 1X6NA 2XPAA 1W26A 1W1YA 1ZBVA 2DPEA 4MAVA 4MNKA 4TW8A 4S3KA 1W9VA 1WAWA 3KAIA 3RFWA 1Q6HA 1VF8A 1HJWA 2JZVA 1EIBA 3UQIA 3B9DA 4GGQA 3KADA 2ESCA 4W9PA 4DZ3A 3CHDA 1WB0A 4ZPVR 4LAVA 1FKSA 4WK9A 4J4OA 1O6IA 2FDMA 3BXWA 1JNSA 5JH8A 2WLYA 1J4HA 4URIA 4W9OA 2XP7A 2DT0A 4DRPA 1GPFA 4MSPA 4S3JA 1U79A 2ZQVA 2PV2A 3NRKA 1T11A 2MLZA 5I98A 4TNSA 1A7XA 1QZ2A 1NH6A 4WKHA 1FKDA 1QPLA 2PPPA 3NI6A 4XAKA 5HWBA 4N19A 1FKLA 2D9FA 3WD0A 4DWSC 4Z2KA 1EYMA 5D75A 4Z2JA 2Q5AA 5GPRA 4LAWA 2DT2A 2DG9A 2KFWA 4U84A 3UQAA 1FKBA 5HBFA 4JFIA 1FKFA 2B31A 3KAHA 3I6CA 2DT1A 2M08A 4ZPTR 1SR0A 2LGOA 4MNJA 4DWSA 4KQZA 3KAFA 3ARPA 1FKHA 2AWGA 1CTNA 3JXVA 1D7HA 1OGBA 3WD2A 1EQ3A 1ROTA 2PPNA 2MLYA 4JFKA 4MPKA 1E15A 2KR7A 5DO2A 4QT3A 3O5MA 1EDQA 4LAXA 4P8UA 2MF9A 5GQBA 5B8IC 3CGNA 4JFLA 3IK8A 2PI6A 5BXJA 3RM4A 3QOKA 1D7IA 2XP9A 2ZR6A 3JYJA 2MPHA 5J6EA 3UI4A 4IPXA 1YATA 4LGXA 1J6YA 3ARVA 1FAPA 1FKJA 1RD6A 2IUZA 1UR9A 4Z2GA 3O5LA 1H0IA 1F40A 1Q1CA 4U86A 4G50A 4MGVA 2F2DA 1XHGA 4P8XA 4J4NA 2G8ZA 1HKMA 4ODNA 3LUOA 3WD4A 2DSVA 4ODRA 2YBUA 2VCDA 5DIVA 4Q7NA 2LJ4A 3B8SA 4Z2HA 1WNOA 1IX5A 4DROA 4DIPA 4IQ2A 2F21A 4ODQA 4DH0A 2QF8A 2DSWA 1Q6UA 4W9QA 1LQ0A 2WLZA 3RGCA 4DRQA 3O5OA 1ZU8A 3CH9A 1PBKA 2MLXA 2PV1A 4G2PA 3WH0A 2XP3A 3G6LA 4L3NA 2L2SA 5HTGA 1HKJA 5HKGA 5DITA 1JNTA 4KR0B 4IQCA 4DRMA 3B7XA 3RM9A 1FJDA 1E6RA 3O5FA 1FD9A 1OGGA 3IKDA 3IKGA 2RUQA 2DG3A 1W9PA 1H0GA 4ODKA 4HBEA 1ZCNA 2O92A 4ODOA 1J4RA 3ARZA 4ZPWR 2OFNA 4MNMA 2N87A 4FAPA 1GUVA 1FKKA 1NSGA 3ARTA 4WKFA 2A3EA 1LL4A 1NWRA 1JVWA 3CZ8A 2DG4A 3AQUA 4O2TA 1X6LA 1NWTA 4TX0A 2MNTA 2IF4A 4TW7A 3OOBA 3G6MA 3TC5A 2KO7A 2LPVA 1BKFA 3WD3A 3O5GA 2RQSA 3PRDA 3ALGA 2F4EA 3WIJA 4DRHA 1F8AB 1NWSA 1J4IA 4DWSD 3O5IA 2RURA 2WM0A 3ARQA 1YW5A 3AROA 3AS2A 4ODMA 4Q22A 3UI6A 1LG2A 1W1TA 1Y0OA 1LL7A 4AY1A 2M2AA 3ARUA 1B6CA 2XP5A 4Z2IA 4LAYA 4TYOA 1TCOC 4WJXA 4DT4A 3ARSA 2ZQUA 4FN2A 3WL0A 4IT6A 2XP6A 2DSUA 3B9EA 3UI5A 4HARA 1ROUA 3O5KA 1HKKA 5DIUA 2A3AA 4PTMA 1HJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  5HWB A;  4N19 A;  2PPO A;  4DRI A;  1FKL A;  5HTG A;  2D9F A;  2ITK A;  3PA7 A;  5HKG A;  5DIT A;  3EY6 A;  1JNT A;  2K8I A;  4IQC A;  4DRM A;  3B7X A;  1EYM A;  5D75 A;  2Q5A A;  2XP4 A;  4LAW A;  2KFW A;  2DG9 A;  3CGM A;  1FJD A;  1L1P A;  3O5F A;  3ODK A;  4U84 A;  3UQA A;  1FKB A;  3H9R B;  1FKR A;  4JFI A;  3O5D A;  1FKF A;  1FD9 A;  1FKT A;  3JYM A;  4DRJ A;  2ZQT A;  3O5J A;  3KAH A;  3IKD A;  4ODL A;  3I6C A;  5HT1 A;  2ZR4 A;  3IKG A;  4JFJ A;  2XP8 A;  4GIV A;  2KI3 A;  2RUQ A;  4TW6 A;  2DG3 A;  4ODK A;  1ZCN A;  2M08 A;  4ODO A;  1J4R A;  2PBC A;  2LGO A;  4QT2 A;  3KAG A;  1N1A A;  3UQB A;  2RSE A;  3KAF A;  1NMW A;  1HXV A;  2OFN A;  1FKH A;  2AWG A;  1QPF A;  5HW7 A;  2UZ5 A;  1D7H A;  2N87 A;  3JXV A;  5HWC A;  5HUA A;  1ZK6 A;  2KGJ A;  4FAP A;  1EQ3 A;  1FKK A;  1NSG A;  4JFM A;  4JYS A;  3PRB A;  1ROT A;  2PPN A;  3NTP A;  2MLY A;  4JFK A;  1BL4 A;  5HW8 A;  1FKG A;  2ZR5 A;  2KR7 A;  4QIB A;  1JVW A;  3FAP A;  4QT3 A;  2M1I A;  3O5M A;  5HW6 A;  2DG4 A;  3GPK A;  1R9H A;  4LAX A;  2FKE A;  3KCE A;  2MF9 A;  4O2T A;  2XPA A;  1D6O A;  3TCZ A;  1W26 A;  4BF8 A;  5B8I C;  3CGN A;  3KAC A;  4JFL A;  3IHZ A;  1PIN A;  2MNT A;  3IK8 A;  3O5Q A;  3KAB A;  4TX0 A;  2IF4 A;  5BXJ A;  1C9H A;  4TW7 A;  3OOB A;  1D7I A;  2XP9 A;  3TC5 A;  2VN1 A;  2KO7 A;  2ZR6 A;  2LPV A;  1BKF A;  2KE0 A;  4TW8 A;  3O5R A;  3JYJ A;  3KAI A;  2MPH A;  1KT0 A;  1Q6H A;  5GPG A;  3RFW A;  3O5G A;  2JZV A;  5J6E A;  3UI4 A;  1M5Y A;  2LKN A;  4IPX A;  2RQS A;  3PRD A;  4GGQ A;  3UQI A;  2XPB A;  4R0X A;  1YAT A;  4DZ2 A;  3KAD A;  1J6Y A;  2F4E A;  4W9P A;  4DRH A;  1F8A B;  1FAP A;  4DZ3 A;  1J4I A;  4C02 B;  1FKJ A;  1FKI A;  1Q6I A;  3O5L A;  2RUR A;  3O5I A;  3O5E A;  1F40 A;  4LAV A;  1YW5 A;  1FKS A;  1Q1C A;  4U86 A;  4G50 A;  4ITZ A;  4J4O A;  4ODM A;  4MGV A;  2F2D A;  3UI6 A;  2Y78 A;  1P5Q A;  1Y0O A;  3KZ7 A;  4J4N A;  1JNS A;  3O5P A;  4ODN A;  3LUO A;  2M2A A;  4W9O A;  1J4H A;  1B6C A;  4U85 A;  2RUD A;  4ODR A;  4DRK A;  2XP7 A;  4DRP A;  2VCD A;  5DIV A;  4ODP A;  1KT1 A;  2LJ4 A;  4MSP A;  1D7J A;  1U79 A;  2PV3 A;  2XP5 A;  2ZQV A;  4LAY A;  4TYO A;  4DRO A;  1TCO C;  4DIP A;  4DT4 A;  2PV2 A;  3NRK A;  4IQ2 A;  2F21 A;  2ZQU A;  4FN2 A;  4ODQ A;  4DH0 A;  1T11 A;  2MLZ A;  3MDY B;  5I98 A;  4NNR A;  4TNS A;  2XP6 A;  1A7X A;  1Q6U A;  1QZ2 A;  4W9Q A;  4DRN A;  1NMV A;  3RGC A;  4DRQ A;  3VAW A;  3UF8 A;  1FKD A;  3O5O A;  1QPL A;  3UI5 A;  2PPP A;  1ROU A;  3O5K A;  1PBK A;  2MLX A;  3TDB A;  2ZQS A;  2PV1 A;  4G2P A;  5DIU A;  3WH0 A;  2RUC A;  2XP3 A;  2L2S A;  3NI6 A; 
#chains in the Genus database with same CATH topology
 2FAP A;  1E9L A;  2A3C A;  3ARX A;  1ITX A;  3EY6 A;  1SYT A;  3AS1 A;  1HJX A;  1L1P A;  1FFQ A;  3O5D A;  3JYM A;  4QZV B;  3W4R A;  3O5J A;  3PRA A;  4ODL A;  3ARR A;  5HT1 A;  2ZR4 A;  1TFV A;  2XP8 A;  4GIV A;  5DEZ A;  4TW6 A;  4NSB A;  2WK2 A;  1W1V A;  1UR8 A;  3WQV A;  2PBC A;  3KAG A;  3UQB A;  2RSE A;  1D2K A;  1JND A;  2DSZ A;  5HW7 A;  5HUA A;  5HWC A;  4ML4 A;  1ZK6 A;  1ZBC A;  1W9U A;  4R5E A;  3WD1 A;  1JNE A;  3NTP A;  1BL4 A;  3AS0 A;  5HW8 A;  1LG1 A;  2ZR5 A;  3FAP A;  2M1I A;  2PN0 A;  3KCE A;  1K9T A;  1D6O A;  3TCZ A;  4BF8 A;  3KAC A;  3IHZ A;  1PIN A;  3O5Q A;  4P8W A;  3KAB A;  1C9H A;  3FXY A;  3OA5 A;  2VN1 A;  4Z2L A;  2KE0 A;  2OLH A;  3O5R A;  3WL1 A;  3CHC A;  1KT0 A;  5GPG A;  3RME A;  1E6N A;  1M5Y A;  2LKN A;  4MTV A;  2XPB A;  4R0X A;  2A3B A;  4DZ2 A;  1ZBK A;  4C02 B;  4WKA A;  1FKI A;  1Q6I A;  3O5E A;  1KFW A;  1LL6 A;  4ITZ A;  3AS3 A;  2Y78 A;  1P5Q A;  3KZ7 A;  3O5P A;  1HKI A;  4U85 A;  2RUD A;  5DF0 A;  2AOS A;  4ZS6 A;  4DRK A;  4DWS B;  4ODP A;  1KT1 A;  1D7J A;  2PV3 A;  4WIW A;  1OWQ A;  4NZC A;  1ZBW A;  1ZB5 A;  3WKZ A;  3ALF A;  3MDY B;  4P8V A;  4NNR A;  1NWU A;  4DRN A;  1EHN A;  1NMV A;  3VAW A;  3UF8 A;  1ZL1 A;  4L72 B;  3TDB A;  3WQW A;  2ZQS A;  2ETN A;  3CHE A;  2RUC A;  4IT4 A;  2PPO A;  4DRI A;  2ITK A;  3PA7 A;  2K8I A;  3ARY A;  3B9A A;  4MNL A;  2XP4 A;  3FY1 A;  3CGM A;  3PR9 A;  4W5U A;  3ODK A;  3H9R B;  1FKR A;  3RM8 A;  1FKT A;  4DRJ A;  2ZQT A;  1E6P A;  4JFJ A;  1W1P A;  2KI3 A;  1FFR A;  1XRV A;  2DT3 A;  1GOI A;  4QT2 A;  2G41 A;  1N1A A;  3ARW A;  1NMW A;  1HXV A;  1QPF A;  2UZ5 A;  2KGJ A;  4JFM A;  4JYS A;  3PRB A;  2O9O A;  1FKG A;  1E6Z A;  3CHF A;  4QIB A;  1LJY A;  2YBT A;  5HW6 A;  3GPK A;  1R9H A;  2FKE A;  4HBO A;  1X6N A;  2XPA A;  1W26 A;  1W1Y A;  1ZBV A;  2DPE A;  4MAV A;  4MNK A;  4TW8 A;  4S3K A;  1W9V A;  1WAW A;  3KAI A;  3RFW A;  1Q6H A;  1VF8 A;  1HJW A;  3GTY X;  2JZV A;  1EIB A;  3UQI A;  3B9D A;  4GGQ A;  2EUL A;  3KAD A;  2ESC A;  4W9P A;  4DZ3 A;  3CHD A;  1WB0 A;  1JCH B;  4ZPV R;  4LAV A;  1FKS A;  1GRJ A;  4WK9 A;  4J4O A;  1O6I A;  2FDM A;  3BXW A;  1JNS A;  5JH8 A;  2B5U B;  2WLY A;  1J4H A;  4URI A;  4W9O A;  2XP7 A;  2DT0 A;  4DRP A;  1GPF A;  4MSP A;  4S3J A;  1U79 A;  2ZQV A;  2PV2 A;  3NRK A;  1T11 A;  2MLZ A;  5I98 A;  4TNS A;  1A7X A;  1QZ2 A;  1NH6 A;  4WKH A;  1FKD A;  1QPL A;  2PPP A;  3NI6 A;  4XAK A;  5HWB A;  4N19 A;  1FKL A;  2D9F A;  3WD0 A;  4DWS C;  4Z2K A;  1EYM A;  5D75 A;  4Z2J A;  2Q5A A;  5GPR A;  4LAW A;  2DT2 A;  2DG9 A;  2KFW A;  4U84 A;  3UQA A;  1FKB A;  5HBF A;  4JFI A;  1FKF A;  2B31 A;  3KAH A;  3I6C A;  2DT1 A;  2M08 A;  4ZPT R;  1SR0 A;  2LGO A;  4MNJ A;  4DWS A;  4KQZ A;  3KAF A;  3ARP A;  1FKH A;  2AWG A;  3GU0 A;  1CTN A;  3JXV A;  1D7H A;  1OGB A;  3WD2 A;  1EQ3 A;  1ROT A;  2PPN A;  2MLY A;  4JFK A;  4MPK A;  1E15 A;  2KR7 A;  5DO2 A;  4QT3 A;  3O5M A;  1EDQ A;  4LAX A;  4P8U A;  2MF9 A;  5GQB A;  5B8I C;  3CGN A;  4JFL A;  3IK8 A;  2PI6 A;  5BXJ A;  3RM4 A;  3QOK A;  1D7I A;  2XP9 A;  2ZR6 A;  3JYJ A;  2MPH A;  5J6E A;  3UI4 A;  4IPX A;  1YAT A;  4LGX A;  1J6Y A;  3ARV A;  1FAP A;  1FKJ A;  1RD6 A;  2IUZ A;  1UR9 A;  4Z2G A;  3O5L A;  1H0I A;  1F40 A;  1Q1C A;  4U86 A;  4G50 A;  4MGV A;  2F2D A;  1XHG A;  4P8X A;  4J4N A;  2G8Z A;  1HKM A;  4ODN A;  3LUO A;  3WD4 A;  2DSV A;  4ODR A;  2YBU A;  2VCD A;  5DIV A;  4Q7N A;  2LJ4 A;  3B8S A;  4Z2H A;  1WNO A;  1IX5 A;  4DRO A;  4DIP A;  4IQ2 A;  2F21 A;  4ODQ A;  4DH0 A;  2QF8 A;  2DSW A;  1Q6U A;  4W9Q A;  1LQ0 A;  2WLZ A;  3RGC A;  4DRQ A;  3O5O A;  1ZU8 A;  3CH9 A;  1PBK A;  2MLX A;  2PV1 A;  4G2P A;  2F23 A;  3WH0 A;  2XP3 A;  3G6L A;  4L3N A;  2L2S A;  3EIP A;  5HTG A;  3BMB A;  1HKJ A;  5HKG A;  5DIT A;  1JNT A;  4KR0 B;  4IQC A;  4DRM A;  3B7X A;  3RM9 A;  1FJD A;  1E6R A;  3O5F A;  1FD9 A;  1OGG A;  3IKD A;  3IKG A;  4UDM A;  2RUQ A;  2DG3 A;  1W9P A;  1H0G A;  4ODK A;  4HBE A;  1ZCN A;  2O92 A;  4ODO A;  1J4R A;  3ARZ A;  4ZPW R;  2OFN A;  4MNM A;  2N87 A;  4FAP A;  1GUV A;  1FKK A;  1NSG A;  3ART A;  4WKF A;  2P4V A;  2A3E A;  1LL4 A;  1NWR A;  1JVW A;  3CZ8 A;  2DG4 A;  3AQU A;  4O2T A;  1X6L A;  1NWT A;  4TX0 A;  2MNT A;  2IF4 A;  4TW7 A;  3OOB A;  3G6M A;  3TC5 A;  2KO7 A;  2LPV A;  1BKF A;  3WD3 A;  3O5G A;  2RQS A;  3PRD A;  3ALG A;  2F4E A;  3WIJ A;  4DRH A;  1F8A B;  1NWS A;  1J4I A;  4DWS D;  3O5I A;  2RUR A;  2WM0 A;  3ARQ A;  1YW5 A;  3ARO A;  3AS2 A;  4ODM A;  4Q22 A;  3UI6 A;  1LG2 A;  1W1T A;  1Y0O A;  1LL7 A;  4AY1 A;  2M2A A;  3ARU A;  1B6C A;  1E44 A;  2XP5 A;  4Z2I A;  4LAY A;  4TYO A;  1TCO C;  4WJX A;  4DT4 A;  3ARS A;  2ZQU A;  4FN2 A;  3WL0 A;  4IT6 A;  2XP6 A;  2DSU A;  3B9E A;  3UI5 A;  4HAR A;  1ROU A;  3O5K A;  1HKK A;  5DIU A;  2A3A A;  4PTM A;  1HJV A; 
#chains in the Genus database with same CATH homology
 2FAP A;  1E9L A;  2A3C A;  3ARX A;  1ITX A;  3EY6 A;  1SYT A;  3AS1 A;  1HJX A;  1L1P A;  1FFQ A;  3O5D A;  3JYM A;  4QZV B;  3W4R A;  3O5J A;  3PRA A;  4ODL A;  3ARR A;  5HT1 A;  2ZR4 A;  1TFV A;  2XP8 A;  4GIV A;  5DEZ A;  4TW6 A;  4NSB A;  2WK2 A;  1W1V A;  1UR8 A;  3WQV A;  2PBC A;  3KAG A;  3UQB A;  2RSE A;  1D2K A;  1JND A;  2DSZ A;  5HW7 A;  5HUA A;  5HWC A;  4ML4 A;  1ZK6 A;  1ZBC A;  1W9U A;  4R5E A;  3WD1 A;  1JNE A;  3NTP A;  1BL4 A;  3AS0 A;  5HW8 A;  1LG1 A;  2ZR5 A;  3FAP A;  2M1I A;  3KCE A;  1K9T A;  1D6O A;  3TCZ A;  4BF8 A;  3KAC A;  3IHZ A;  1PIN A;  3O5Q A;  4P8W A;  3KAB A;  1C9H A;  3FXY A;  3OA5 A;  2VN1 A;  4Z2L A;  2KE0 A;  2OLH A;  3O5R A;  3WL1 A;  3CHC A;  1KT0 A;  5GPG A;  3RME A;  1E6N A;  1M5Y A;  2LKN A;  4MTV A;  2XPB A;  4R0X A;  2A3B A;  4DZ2 A;  1ZBK A;  4C02 B;  4WKA A;  1FKI A;  1Q6I A;  3O5E A;  1KFW A;  1LL6 A;  4ITZ A;  3AS3 A;  2Y78 A;  1P5Q A;  3KZ7 A;  3O5P A;  1HKI A;  4U85 A;  2RUD A;  5DF0 A;  2AOS A;  4ZS6 A;  4DRK A;  4DWS B;  4ODP A;  1KT1 A;  1D7J A;  2PV3 A;  4WIW A;  1OWQ A;  4NZC A;  1ZBW A;  1ZB5 A;  3WKZ A;  3ALF A;  3MDY B;  4P8V A;  4NNR A;  1NWU A;  4DRN A;  1EHN A;  1NMV A;  3VAW A;  3UF8 A;  1ZL1 A;  4L72 B;  3TDB A;  3WQW A;  2ZQS A;  3CHE A;  2RUC A;  4IT4 A;  2PPO A;  4DRI A;  2ITK A;  3PA7 A;  2K8I A;  3ARY A;  3B9A A;  4MNL A;  2XP4 A;  3FY1 A;  3CGM A;  3PR9 A;  4W5U A;  3ODK A;  3H9R B;  1FKR A;  3RM8 A;  1FKT A;  4DRJ A;  2ZQT A;  1E6P A;  4JFJ A;  1W1P A;  2KI3 A;  1FFR A;  1XRV A;  2DT3 A;  1GOI A;  4QT2 A;  2G41 A;  1N1A A;  3ARW A;  1NMW A;  1HXV A;  1QPF A;  2UZ5 A;  2KGJ A;  4JFM A;  4JYS A;  3PRB A;  2O9O A;  1FKG A;  1E6Z A;  3CHF A;  4QIB A;  1LJY A;  2YBT A;  5HW6 A;  3GPK A;  1R9H A;  2FKE A;  4HBO A;  1X6N A;  2XPA A;  1W26 A;  1W1Y A;  1ZBV A;  2DPE A;  4MAV A;  4MNK A;  4TW8 A;  4S3K A;  1W9V A;  1WAW A;  3KAI A;  3RFW A;  1Q6H A;  1VF8 A;  1HJW A;  2JZV A;  1EIB A;  3UQI A;  3B9D A;  4GGQ A;  3KAD A;  2ESC A;  4W9P A;  4DZ3 A;  3CHD A;  1WB0 A;  4ZPV R;  4LAV A;  1FKS A;  4WK9 A;  4J4O A;  1O6I A;  2FDM A;  3BXW A;  1JNS A;  5JH8 A;  2WLY A;  1J4H A;  4URI A;  4W9O A;  2XP7 A;  2DT0 A;  4DRP A;  1GPF A;  4MSP A;  4S3J A;  1U79 A;  2ZQV A;  2PV2 A;  3NRK A;  1T11 A;  2MLZ A;  5I98 A;  4TNS A;  1A7X A;  1QZ2 A;  1NH6 A;  4WKH A;  1FKD A;  1QPL A;  2PPP A;  3NI6 A;  4XAK A;  5HWB A;  4N19 A;  1FKL A;  2D9F A;  3WD0 A;  4DWS C;  4Z2K A;  1EYM A;  5D75 A;  4Z2J A;  2Q5A A;  5GPR A;  4LAW A;  2DT2 A;  2DG9 A;  2KFW A;  4U84 A;  3UQA A;  1FKB A;  5HBF A;  4JFI A;  1FKF A;  2B31 A;  3KAH A;  3I6C A;  2DT1 A;  2M08 A;  4ZPT R;  1SR0 A;  2LGO A;  4MNJ A;  4DWS A;  4KQZ A;  3KAF A;  3ARP A;  1FKH A;  2AWG A;  1CTN A;  3JXV A;  1D7H A;  1OGB A;  3WD2 A;  1EQ3 A;  1ROT A;  2PPN A;  2MLY A;  4JFK A;  4MPK A;  1E15 A;  2KR7 A;  5DO2 A;  4QT3 A;  3O5M A;  1EDQ A;  4LAX A;  4P8U A;  2MF9 A;  5GQB A;  5B8I C;  3CGN A;  4JFL A;  3IK8 A;  2PI6 A;  5BXJ A;  3RM4 A;  3QOK A;  1D7I A;  2XP9 A;  2ZR6 A;  3JYJ A;  2MPH A;  5J6E A;  3UI4 A;  4IPX A;  1YAT A;  4LGX A;  1J6Y A;  3ARV A;  1FAP A;  1FKJ A;  1RD6 A;  2IUZ A;  1UR9 A;  4Z2G A;  3O5L A;  1H0I A;  1F40 A;  1Q1C A;  4U86 A;  4G50 A;  4MGV A;  2F2D A;  1XHG A;  4P8X A;  4J4N A;  2G8Z A;  1HKM A;  4ODN A;  3LUO A;  3WD4 A;  2DSV A;  4ODR A;  2YBU A;  2VCD A;  5DIV A;  4Q7N A;  2LJ4 A;  3B8S A;  4Z2H A;  1WNO A;  1IX5 A;  4DRO A;  4DIP A;  4IQ2 A;  2F21 A;  4ODQ A;  4DH0 A;  2QF8 A;  2DSW A;  1Q6U A;  4W9Q A;  1LQ0 A;  2WLZ A;  3RGC A;  4DRQ A;  3O5O A;  1ZU8 A;  3CH9 A;  1PBK A;  2MLX A;  2PV1 A;  4G2P A;  3WH0 A;  2XP3 A;  3G6L A;  4L3N A;  2L2S A;  5HTG A;  1HKJ A;  5HKG A;  5DIT A;  1JNT A;  4KR0 B;  4IQC A;  4DRM A;  3B7X A;  3RM9 A;  1FJD A;  1E6R A;  3O5F A;  1FD9 A;  1OGG A;  3IKD A;  3IKG A;  2RUQ A;  2DG3 A;  1W9P A;  1H0G A;  4ODK A;  4HBE A;  1ZCN A;  2O92 A;  4ODO A;  1J4R A;  3ARZ A;  4ZPW R;  2OFN A;  4MNM A;  2N87 A;  4FAP A;  1GUV A;  1FKK A;  1NSG A;  3ART A;  4WKF A;  2A3E A;  1LL4 A;  1NWR A;  1JVW A;  3CZ8 A;  2DG4 A;  3AQU A;  4O2T A;  1X6L A;  1NWT A;  4TX0 A;  2MNT A;  2IF4 A;  4TW7 A;  3OOB A;  3G6M A;  3TC5 A;  2KO7 A;  2LPV A;  1BKF A;  3WD3 A;  3O5G A;  2RQS A;  3PRD A;  3ALG A;  2F4E A;  3WIJ A;  4DRH A;  1F8A B;  1NWS A;  1J4I A;  4DWS D;  3O5I A;  2RUR A;  2WM0 A;  3ARQ A;  1YW5 A;  3ARO A;  3AS2 A;  4ODM A;  4Q22 A;  3UI6 A;  1LG2 A;  1W1T A;  1Y0O A;  1LL7 A;  4AY1 A;  2M2A A;  3ARU A;  1B6C A;  2XP5 A;  4Z2I A;  4LAY A;  4TYO A;  1TCO C;  4WJX A;  4DT4 A;  3ARS A;  2ZQU A;  4FN2 A;  3WL0 A;  4IT6 A;  2XP6 A;  2DSU A;  3B9E A;  3UI5 A;  4HAR A;  1ROU A;  3O5K A;  1HKK A;  5DIU A;  2A3A A;  4PTM A;  1HJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...