3RMEA

Amcase in complex with compound 5
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rmeA01
1E6XM 5AYIA 4CGTA 4AEFA 1ITCA 4Q22A 3FHQA 3PZVA 5BROA 2DH3A 1VAHA 4ATDA 2NW0A 3ALFA 4BA0A 5E0CA 5HBFA 2J75A 4QDMA 1GQLA 4HZ6A 4GI8A 1PPIA 1XH1A 2JALA 2WLYA 1W9XA 4QCFA 3AS3A 4IPNB 3WNKA 3ZIZA 2Z1SA 1PZ3A 2YKKA 4BZYA 1QBBA 5CLWA 1DHKA 1EDQA 4MNJA 3MUZ1 3AMCA 2G3NA 1H5VA 3ARSA 5ABFB 1TMQA 5BXSA 3UR7A 5JIWA 2DT0A 3CZGA 3L4TA 3AS1A 3SIMA 1HVQA 5C71A 5FOOA 5GNXA 3EYPA 4JZ5A 1D2KA 5D9MA 2XIIA 4CVUA 2J25A 5E09A 2PWFA 5CZKA 1E4NA 4QFUA 4M82A 1K6AA 1B9ZA 5A8NA 4QCEA 3GBDA 4J3TA 2CBUA 3BXWA 4QAWA 4A3YA 2Z1KA 4IISA 2YLLA 4ZE5A 3W6LA 3AHTA 2OLHA 3WD2A 4AZ6A 2PC8A 4UOQA 1NQ6A 1VB9A 1R7OA 4HOWA 1IT0A 2V5CA 3N17A 1QNPA 2W63A 3ARQA 1EQCA 1NM9A 1GJWA 1E4IA 1E71M 1EH9A 3EDEA 3ZO9A 1QW8A 3A4XA 3WMSA 2X09A 2BHZA 3BC9A 4MAZA 3O6AA 1HKIA 2WANA 2ZUTA 2VX4A 3WIJA 1XSIA 2DIEA 3L2LA 3W28A 4EE9A 4OUEA 1HT6A 3VDHA 1XSKA 1J9YA 2AAAA 2EQDA 2PWDA 1MQQA 2V38A 3WDJA 1WZKA 4H2CA 1OD0A 4PTVA 1V02A 2XHYA 3NCOA 4D1JA 1UA7A 4UFIA 5LA1A 3AMDA 1Y7VA 1LF1A 3OZPA 2WNWA 3WD0A 2BXYA 2ZE0A 2VOTA 1N82A 2CEQA 1UH4A 1C8XA 4EKJA 2NSXA 1W1PA 5A6BA 5DT5A 3K4AA 1K9EA 3VVGA 3GNRA 1OIFA 4JFTA 1MQPA 2J7FA 2GJXA 3BLPX 3BMWA 1PIGA 3VTRA 3QOKA 4J3UA 1B31A 1CYGA 5A8OA 1WAWA 3NDYA 3VX0A 4OBRA 2VMFA 2OWXA 2DPEA 3W4RA 1CEOA 1EO5A 2WMIA 3AZSA 2W91A 5BXPA 1RP8A 4AZGA 3FHAA 5CQ1A 4W8LA 2VZSA 1G94A 4AZIA 3CMJA 2V3DA 4CKQA 1W1VA 4D6HA 5BXRA 1C90A 5C70A 3UESA 1CGTA 2ZX7A 3RDKA 1CXLA 1NWTA 4P8VA 3UCQA 5CPQA 5HPCA 1BVNP 4A3HA 4LPCA 1HF6A 1KXVA 3AXXA 4JKMA 3S2CA 3TTSA 2YBTA 4V2XA 4CU6A 4OIFA 1QI5A 3FY1A 1BYDA 1H41A 3VGHA 1MW0A 2EEXA 3IJ9A 2WVTA 4N0RA 3SUSA 7A3HA 2ZWZA 1JXKA 3HN3A 3GM8A 3IAPA 1M04A 1D3CA 2ZXDA 4Z2KA 1ISWA 1XH2A 1ZBKA 1W9VA 1H0GA 1EOMA 2VUYA 1QBAA 1QNRA 3CUIA 5DO8A 3A6OA 2W92A 1MXGA 4CVWA 1HP4A 3NUKA 3ZJ8A 2D24A 1JZ3A 2XSAA 1BYCA 3WBAA 1G01A 4TX6A 1J0KA 4D6CA 2OSYA 2WVSA 3ZJKA 1WO2A 2EPKX 3AMLA 3WQ6A 2WMFA 1VFFA 3TTYA 1VFUA 3AS2A 2XUCA 4WKAA 5I79A 2W67A 3AHYA 4GQRA 4F9DA 1XCXA 4NI3A 2BHUA 1JI2A 1E5NA 2X0HA 5A3HA 1H49A 3SCVA 5FL0A 2WMHA 3T0AA 1W9PA 2C8NA 4CU7A 3SCUA 4MDPA 5TD4A 2O9PA 4M29A 2D2OA 3WDRA 4WJXA 2DSKA 4LGXA 1E70M 1MFVA 4XUYA 2YJQA 2WCGA 2JFEX 1ZJBA 3OLGA 3ALGA 1I1XA 3QGVA 4CD8A 4GQQA 1EOKA 3ZR6A 2ZWYA 3PTQA 3WN6A 1KR1A 4M56A 4J7RA 1X6NA 4WSJA 4KGLA 2JIWA 5GPRA 2VCAA 3GXFA 3RJXA 1UH2A 5EBAA 1V6VA 4PBGA 2BHYA 4PCTA 4GO8A 3AYRA 3N12A 4PUDA 3WNLA 4IM4A 3WH6A 1J0HA 3AMGA 3PZIA 3VGDA 3ZOAA 2PBGA 2DT3A 2BY3A 3AJ7A 1OM0A 1E0XA 1P6WA 2TAAA 4PMVA 3VIKA 3OG2A 1W1TA 2UY2A 3VGFA 2ZUSA 1G1YA 3MMDA 4JL2A 3SEPA 3VMPA 2J47A 5E6YA 3UG5A 3EMQA 3N9KA 3VO0A 1QNQA 4DUWA 4HA4A 1LL6A 5D8WA 1JL8A 3TA9A 4CN6A 2NT1A 3AZRA 3L2MA 1GOWA 2DGAA 1HX0A 3FW6A 2VNCA 1JF5A 3AISA 3VNYA 1WE5A 1MYRA 1VIWA 3F4VA 3CHFA 4JL1A 1R87A 1PX3A 1HJSA 1DEDA 1RP9A 5E6ZA 4KRTA 2QF8A 1JFHA 3KL3A 1NOFA 4EK7A 1UZ1A 1GOOA 3ZMRA 2WZEA 1MQRA 3RO8A 2VL4A 4XZBA 3BAWA 2XSBA 1DWJM 4URIA 1V6UA 3LMYA 2WCAA 4JKKA 4PMDA 3ZSSA 1H11A 5BCAA 4YHGA 4BS0A 2VCBA 1W3KA 2FGLA 4HOZA 1FOBA 4WLCA 2YDQA 5FD0A 4Y7EA 1JAEA 1UKTA 4BQ5A 1J18A 1QHOA 3MUIA 3EMCA 4PEEA 5CGTA 1UWIA 3GXDA 1UD6A 3G6MA 3U5YA 1FH9A 4DUXA 2D23A 1VEMA 1W2PA 1I75A 1PBGA 1OWQA 3LPPA 4AEEA 2BXZA 1EDGA 2Y8VA 2X8RA 3BGAA 3QR3A 3MU7A 4TUFA 1CDGA 2VZOA 2WK2A 2GJPA 1NWSA 2CYGA 5D8ZA 3SUWA 3CZKA 4ZE4A 1U2YA 3DHUA 1UR9A 4D6EA 2A3CA 3WMBA 1J0JA 2J7HA 3RILA 4JFSA 1OB0A 2Y2WA 1Q6GA 1C8QA 3BAYA 3ARYA 1CPUA 1WDSA 2XTKA 1XC6A 4HMCA 3WH7A 1UZ4A 1E6ZA 5A94A 3ARWA 1K9TA 2Y4SA 3WDPP 2WBGA 4L4PA 4TXEA 4DWSD 3WF0A 4QP0A 4OKDA 2GUYA 2GJRA 3BSGA 1E4MM 1VBRA 3SCPA 3BCDA 2A3EA 3GNOA 3WQ5A 4JKLA 1QHPA 3G6LA 1MXDA 1XYFA 2UY5A 1UWSA 5I0DA 4TTUA 1F4AA 3B9AA 3A47A 4AMCA 1CECA 3VIOA 4CD5A 4AZHA 3VDAA 2BFGA 2A3AA 1HP5A 1HKKA 2C7FA 1NARA 3VD5A 3GH5A 1R7AA 1CXIA 2DSWA 1DWFM 2CBJA 3WEMA 1HJUA 1TZ7A 4WF7A 3QOMA 2DT1A 1KGXA 2ZXAA 3E1F1 1JYNA 4J3WA 4P8UA 1J10A 4AW7A 3EBVA 4X9YA 3MSGA 6A3HA 1YHTA 4CD4A 1Q6FA 3K1DA 4Z2GA 1V3HA 3U7BA 3RM4A 2DSVA 4W84A 3VX1A 4GZEA 1JD9A 3WL0A 4W8AA 5JBFA 1NP2A 3SCSA 1R85A 4E2OA 2WHKA 1TVPA 3AICA 1E1FA 5DEZA 4JHZA 4JCLA 2E0PA 3WNOA 3MS8A 5A2AA 1OGSA 2CBIA 4TVCA 1I1WA 1TG7A 3AROA 3VD4A 4J3XA 2PWHA 2CHOA 3IJ8A 1DWAM 5GNYA 1US2A 4MDOA 5CSUA 2NT0A 1C93A 3A4AA 1KQZA 4AD4A 4XB3A 5I24A 5IFTA 4JCMA 1QHZA 1OT1A 1C3FA 2V3EA 3EDJA 3NIYA 4J3VA 3VIMA 3D5HA 1J0IA 2BVDA 4AZ5A 4RE3A 2DSZA 3BAIA 4PRWA 4U33A 3VU2A 3OIHA 1HL9A 2E8YA 5LA0A 1UR2A 2QPSA 4WKFA 1UA3A 2OSWA 1UR8A 4D6IA 2XGBA 1H3GA 4P7OA 1B2YA 3NSMA 3FN9A 4IUGA 2GSJA 4GO9A 1BQCA 2AMGA 4ACZB 3WQWA 4AD3A 4HA3A 2WMJA 1M03A 1FFRA 4C7GA 1VBUA 3W29A 3WF2A 3WNMA 2RGMA 4CU8A 1HKJA 1JZ4A 3VKKA 4BQ2A 5BXTA 1EA9C 1GOQA 3MUY1 1FA2A 2O92A 3CHDA 2UY3A 4MJ2A 1ESWA 2FH8A 1FHDA 4FMVA 2QHAA 3AOFA 1CNVA 1UQYA 2ZUMA 2VRQA 5A95A 1JG9A 2WMKA 1UD3A 4KWUA 2OSXA 3K8LA 2IXUA 4IPLA 1UKSA 2CERA 2OYMA 4ATWA 1JZ5A 1QOXA 2E8ZA 2WZHA 3PN8A 2J7EA 4AZ7A 1HL8A 3ARTA 2WHJA 4UCFA 2VJXA 2WVUA 1PX8A 1LWJA 4DWSA 1B3ZA 4D6JA 1QNSA 3UEQA 5M17A 3F5JA 2D0FA 1QI3A 3OGVA 1W3HA 4MB3A 3MSDA 5JBEA 3UETA 1C7SA 3ARPA 5BRQA 1CENA 2WB5A 2XYLA 4H8VA 3ZR5A 1H4PA 4YPJA 3RCNA 2WC4A 1ISVA 1UYQA 2PWGA 2J7DA 1XHGA 2JEQA 3ZJ7A 1WZLA 3PTKA 5A1AA 1G9HA 1A3HA 2G41A 4OOZA 4LYRA 2Q8XA 4AZBA 3GXIA 1GUVA 2XJ7A 2ZUNA 4XV0A 1VJZA 1WDPA 3VDBA 2DH2A 4PUEA 1WNOA 4JFVA 1US3A 3VD7A 2CXGA 4ACYA 4U31A 1ZJAA 1GPFA 2WXDM 4UQ9A 1BYAA 5CLTA 2XM1A 1V0NA 2DSUA 2WYSA 4D6DA 1K9DA 3MUAA 2ZUUA 2GDVA 1W9DM 2EPLX 3GTNA 2ZX6A 4C7FA 2FH6A 3VIFA 3ARZA 1WPCA 4Z2IA 1W32A 4PMYA 4LYPA 1GQKA 4LX4A 2VC9A 2VQUA 3W81A 4P7RA 2J4GA 1R86A 3SCNA 2XM2A 1HNYA 4W93A 1UWUA 3VM7A 2XFFA 3N15A 1W91A 3OLEA 1BGAA 5A8PA 3KEHA 3S6TA 3THCA 2VVSA 4AD0A 1VJSA 4B3KA 4FF5A 3CUJA 4GZIA 1UOKA 4MNKA 2DT2A 1Q6DA 4A4AA 2W4XA 4PMQA 5I23A 1TUXA 5HXMA 1WDQA 2J77A 2CHNA 2ZX5A 2YL5A 1UWRA 4AD2A 4HPHA 1ITXA 5E9AA 1G0CA 5A69A 3CUGA 4FLRA 5KEZA 3BLKA 4W7VA 2EBNA 2GJXB 4KMQA 2VZVA 2XIBA 1JNEA 2ZICA 4NF7A 3WENA 1CWYA 1SMAA 1OBAA 4H41A 4M1RA 1V3MA 3BAJA 5E0FA 3OA5A 4NSBA 1ZBVA 2Y24A 1GZJA 3W25A 4S3JA 4HZ7A 5HDRA 4JFWA 1JDDA 3B9EA 5CPTA 2X05A 5I78A 2VO5A 2WMIB 1CGWA 4AY1A 4WK9A 3WUEA 1XSJA 1J0ZA 1JAKA 1KCKA 1JZ6A 4DM2A 3WH9A 4LQ1A 1EHAA 1JYWA 1B0IA 1CGXA 3RMEA 4C7DA 5LYRA 1V0KA 3AFBA 5IDIA 1B3WA 1CZ1A 1JI1A 1V0MA 2X2YA 3CHEA 3DHPA 4H04A 4KGJA 5A6LA 1TR1A 1AQ0A 2D0HA 1J11A 1BYBA 1KWGA 1Z32X 4M81A 4AIEA 3PZTA 4BQ3A 1FH7A 2CPUA 3AS0A 2FHCA 4YHEA 1E9LA 3T0BA 4B9YA 3CHCA 4PMUA 2ZIDA 4W88A 4MNMA 2B31A 1BTCA 1G5AA 1ZL1A 4P8WA 4RL3A 1BG9A 2JEPA 1QW9A 3HJEA 1HKMA 2QLYA 4PMOA 3W53A 1OSEA 1E0VA 2ZXQA 4ZFMA 2VR5A 4HMDA 2EJ1A 3OGSA 1KBKA 3PZQA 4UTFA 1V0LA 4CUCA 3WD3A 2D20A 2YLAA 4MNLA 3WEZA 1QI2A 1TA3A 1WZMA 3EDFA 4AZCA 4UR9A 4FLOA 5M5DA 3VIGA 3AIEA 3WELA 1J0YA 4GKLA 4PSRA 4K68A 3AXHA 3RJYA 2HVMA 1ZS2A 2CESA 3O9NA 2HISA 4PMXA 5JUVA 4L4OA 3AYSA 3KZSA 4LXFA 4U2ZA 4M8UA 4CD7A 2V5DA 3UG3A 1GW1A 1KFWA 1NH6A 1B1YA 5D9PA 3RPMA 2WSPA 3FAXA 4M80A 1UH3A 1FP8A 3W82A 3ARXA 2FHBA 1E1EA 5DF0A 5CPSA 1UD2A 3SUTA 4HP5A 3CIVA 4UFJA 1JDAA 2UWFA 3WH8A 1RH9A 4X0NA 4CN1A 2AOSA 1E3XA 1CXFA 2WLZA 4R27A 4NZCA 5I2UA 3CUFA 1IZKA 1KQYA 3RIKA 2D1ZA 2VURA 1JZ8A 1ISXA 1O6IA 4UQAA 2VX7A 1JYXA 1TA3B 1ODUA 2GK1A 4HU0A 4P8XA 2RGLA 3GXMA 1KGUA 4WIWA 3VD9A 4UOJA 4UNIA 1HVXA 3KL0A 4RE2A 5ABGA 4P7NA 3VILA 1E6PA 2D3NA 2V3GA 2WWCA 5E70A 5A6MA 4Q7NA 4JFUA 2QV4A 2CCRA 1CBGA 4XX6A 4CCEA 1LG2A 1E40A 1MW1A 3VIHA 1E43A 1CXKA 3W27A 1EHNA 4FLQA 2YIHA 2XWDA 4DUVA 5A8QA 1O7AA 4PMNA 1Q6CA 3W26A 2VX5A 1OT2A 2QMJA 3KE0A 1TVNA 5JH8A 1NP0A 2WCSA 4M24A 4D1IA 5DFAA 2UY4A 3CTTA 2IUZA 3CZ8A 4W7WA 1E4LA 3PZUA 2OWWA 4U3AA 3NYDA 2PB1A 2YDSA 4GINA 2E3ZA 3L4YA 2WVVA 5AY7A 3VIJA 3K8KA 5A6KA 3M46A 3DECA 3CUHA 4H7VA 3L4ZA 1L8NA 3L4WA 3WD4A 4EANA 5AC4A 5CGMA 3WQVA 3VINA 1KCLA 4YN5A 1E55A 3BSHA 2YA2A 3WNNA 1CGUA 1HN1A 4CD6A 2WWDA 3SCRA 3VDCA 1M53A 3B8SA 3BMVA 3PZNA 1E73M 3WKZA 5HPOA 1B30A 4UQDA 3MV11 2CKRA 3VM5A 3CZEA 3BAKA 5FL1A 4PMZA 3N11A 3WQ4A 2GVYA 5HOSA 3SUUA 1HJWA 3UERA 3EDKA 3LPFA 3WBEA 1ZB5A 4F9JA 3TTQA 5BYWA 4H8UA 3TOPA 3WH5A 3II1A 2GDUA 3IJ7A 1E3ZA 3CZLA 1NOUA 3VGEA 2XVKA 1JGIA 4KH2A 1E15A 3GNPA 8A3HA 4U5KA 3AI0A 1NOWA 1EIBA 1FH8A 4MTVA 1V3JA 5A2BA 4P7LA 2VI0A 2E40A 2PBOA 2BNJA 3W6MA 5CG0A 3IAQA 5EFFA 1VEPA 3T08A 4TVUA 4W5UA 1UG6A 2WW5A 3CO4A 2JIEA 5ABEA 1UR0A 4AIUA 3THDA 1H09A 2YBUA 2J7GA 2W62A 5AC5A 5ABFA 2CIPA 3ARRA 1OIMA 3OZOA 5FCZA 1E0WA 1V6XA 2F2HA 3WEOA 1MW3A 1LWHA 3L4VA 1QI4A 2FDMA 4XZWA 6TAAA 2BV9A 2G3MA 4U3CA 1CIUA 3JUGA 4Z2LA 2DEPA 1EXPA 3AHZA 4AISA 1ISZA 3W38A 4JAWA 3CZJA 3DYOA 4CN4A 3DYPA 4J3SA 2CKSA 3I3DA 3MMWA 1V03A 2BY0A 3VD3A 1M7XA 1UHVA 4GXPA 1AMYA 1JF6A 3U57A 1IV8A 1R8LA 4MB4A 1E6SM 4HPGA 1GQIA 4PYSA 3EDDA 2X1IA 2JF6A 1GOKA 4GI6A 3K4DA 2A3BA 3NDZA 5FKYA 3KWXA 1UUQA 4N42A 4ZENA 2W61A 1JZ2A 3NSXA 1UD4A 5M03A 4E8CA 4F79A 2ZUWA 1V3KA 1PZ2A 1KGWA 1S46A 3ZJ6A 2XG9A 5I77A 3POCA 3B9DA 1NWRA 2WKLA 4HOXA 2W66A 4PTXA 1KXQA 1AQMA 1MWOA 7TAAA 4UFMA 3SUVA 4PSPA 1J12A 3OBAA 3ECQA 1BSIA 1JD7A 1EO7A 1EDTA 1V08A 2CBVA 1GJUA 3CH9A 4UZSA 2EPMX 2FGZA 5HNNA 5D4YA 1E6RA 1XD0A 1MFUA 1QI0A 2GFTA 2YA1A 3U7VA 3AQUA 4J28A 3AXIA 3M6DA 1OCQA 1V02E 3AHXA 4B15A 2E9MA 5JBDA 3RM9A 1AVAA 2OWCA 4HTYA 2XVPA 1C92A 1F4HA 3MO4A 1JNDA 3OB8A 1ISYA 3VIPA 1V6YA 3N1AA 3WUBA 4UFLA 2WBKA 3VUPA 1W1YA 3WF1A 3GH7A 5DMYA 3T2QA 3APGA 3L4XA 1HJVA 3GZAA 2J62A 1JXJA 1B3XA 3ZT7A 4R5EA 2EXOA 1BAGA 2G8ZA 2X0YA 1A47A 1KBBA 4D6GA 1TFVA 5FIPA 5CJ5A 3WL1A 1XYZA 3AIQA 2D22A 3VMNA 1DP0A 5KZ6A 3ZT5A 2WMGA 1H1NA 2EPOA 4MADA 1JZ7A 1KB3A 1VF8A 4GZJA 4HMEA 7CGTA 5BRPA 3OGRA 2IXVA 1D7FA 4D71A 4ZXLA 3M7SA 4DWSB 1E5JA 1CXHA 3BH4A 1B3VA 5CSYA 1FFQA 1B3YA 2C0HA 3ARUA 1TE1A 2OYLA 3RM8A 2J7CA 1GORA 2D3LA 4BCEA 1QVBA 3IK2A 1HJQA 4ATLA 2WHMA 3CPUA 3TONA 3WY1A 5EB8A 4UQCA 1PX4A 1ECEA 2J8FA 4KRUA 2OYKA 3J7HA 3ZT6A 5C8BB 1CGYA 1OINA 1SFSA 2VRJA 3WDHA 2BVTA 3DC0A 5EMYA 3LPGA 3T0DA 4PMRA 4WKHA 1W9UA 2ZOXA 3AMKA 3ZM8A 1LG1A 1PJ9A 1QPKA 3GYCA 5D9NA 1NWUA 1UWQA 1V3LA 4GPNA 1Q6EA 4AYSA 2VZUA 1K9FA 3CMGA 1SMDA 3BAXA 2BY1A 2QPUA 4Z2JA 1MVYA 1VFOA 1W2VA 3MMUA 1DTUA 1GHRA 2W5FA 3OLIA 4JHOA 5F7UA 2BY2A 2F61A 4PN2A 5IXEA 1VFMA 4UFKA 2BVYA 1OD8A 2XVLA 2CITA 3FNDA 2E9BA 1GONA 3VPLA 5A6SA 4JIEA 6CGTA 2WAGA 2CETA 1GVIA 1EQPA 2D0GA 4OJYA 3AIWA 3O2LA 3CGTA 1UKPA 4P7QA 4HU8A 3GBEA 1IZJA 3PZMA 4MB5A 4AC1X 3AZTA 2YL8A 5A2CA 2O9OA 1GVYA 4GI9A 5EFDA 4RE4A 3F5KA 1FP9A 5I3DA 1UD8A 3WD1A 2VT0A 3HU7A 1CGVA 3L4UA 4W87A 2J78A 1JYVA 4TX8A 3IANA 4UOZA 2XGIA 1U33A 4AXNA 2DDXA 1WDRA 4W89A 5A8MA 1YQ2A 4BF7A 2DQXA 4DM1A 4U5IA 1RPKA 3WF3A 3WUGA 3N18A 2V3FA 1GQJA 1BHGA 2WHLA 2G4FA 4CCDA 3OLDA 3MV01 5IHSA 3ZQ9A 3QHOA 3K46A 3PBGA 4S3KA 1L0PA 2VZTA 3KL5A 1XGZA 5ABHA 2E4TA 3PZOA 2J7BA 5GQBA 1UR4A 3TTOA 4LYQA 1BGGA 4NRRA 2JE8A 1H0IA 1BFNA 1JIBA 5AYBA 3VGGA 1LL7A 1DWHM 4U2YA 1OGGA 1PIFA 2YL6A 3AIVA 4F66A 4B9ZA 1OGBA 5I5RA 1KXHA 3T2PA 3PZ9A 1B90A 3VOCA 1XCWA 3WF4A 3TP4A 3WQ8A 2VR4A 1BVZA 1CLXA 3T09A 1TCMA 1VRXA 1U30A 3PTMA 4PTMA 4TVDA 3UR8A 2QMKA 5JIPA 1XD1A 2YOCA 1SR0A 2O9TA 3F5LA 3QHMA 4UFHA 5LA2A 2VRKA 5BWFA 4QLLA 2EO7A 3QHNA 1WZAA 4OOUA 5D9OA 4UQBA 3SCOA 1WP6A 3U5UA 3VNZA 1MW2A 1UQZA 2ZXBA 1LJYA 1UD5A 3CLWA 3ZSTA 4Z2HA 3GH4A 1W9BM 4OZOA 3W0KA 2CNCA 1XRVA 4AZCB 3WDIA 3WSUA 1BF2A 2Y5EA 2WPGA 1H2JA 4QLJA 4UQEA 3BCFA 4NRSA 1C91A 3K8MA 1GCYA 4MPKA 1SYTA 1C8YA 1W3LA 4AIOA 3DYMA 4W7UA 3GDBA 2ZX9A 3SCTA 2WM0A 4D72A 3M07A 1E56A 4J27A 1BPLB 3NJ3A 4UZUA 1VEOA 1PAMA 4FLSA 1AQHA 2G3JA 3I3BA 4PCSA 5I6SA 4V27A 1JFXA 1GOIA 2WC7A 4PTWA 2XFRA 2EPNA 2VQTA 3PZGA 2Y8KA 2WC3A 3POHA 3AIBA 3WUFA 5ECUA 1W3JA 1VENA 2XPKA 1LL4A 1KXTA 4ZXOA 3HMCA 5M3WA 4AD5A 4B16A 1DWIM 4F8XA 1WKYA 1BLIA 3ARVA 1GNXA 1QNOA 1UKOA 1ZU8A 1CTNA 4GIAA 4B3LA 2ESCA 2PF0A 3AIRA 1ZBCA 1FHLA 4AD1A 3WFLA 2GK1B 2WSKA 3WMCA 2BS9A 4MJ4A 1LQ0A 2ZX8A 3T2OA 3N13A 2XVNA 3MKKA 4TOQA 8CGTA 2XVGA 1HXJA 3VGBA 2PI6A 1GHSA 5GNZA 3VIIA 1ODZA 3PHAA 2VCCA 4V28A 3FAWA 4ZEPA 2WZIA 2A3HA 3CBWA 3AIUA 3WDQA 1BG4A 4HA1A 4D6FA 1HIZA 1E6QM 2YDRA 1X6LA 4W86A 9CGTA 4X0VA 1WB0A 2XFYA 1XV8A 2MANA 2XWEA 3SCWA 1UKQA 2VX6A 1DWGM 4OBSA 4W5ZA 3A4WA 5A6JA 4HZ8A 3NSNA 1E72M 3SCQA 1V6WA 3SURA 3WFZA 1V3IA 4WSKA 2JF7A 1GOMA 1PEZA 1X1NA 4W85A 2J8GA 5A6BD 1LLOA 1UR1A 1CLVA 1EGZA 1KR0A 2FHFA 4E4PA 5A6AA 4E8DA 3D3AA 4ACZA 1CXEA 4MAVA 2VTFA 2J74A 2O9RA 2WVVB 2YL9A 3A3HA 3AHVA 1KWKA 1Q4NX 4QLKA 2E9LA 5CXPA 4TTGA 4ML4A 2VVNA 3EMZA 4DWSC 2PWEA 1ZBWA 3W24A 4FK9A 3MANA 2F8QA 5IHRA 1E6NA 2J79A 4BQ4A 2G3IA 1RD6A 4AWEA 4EAMA 3LPOA 1JDCA 1J01A 1WCGA 3FXYA 2YA0A 3UG4A 1UWTA 2ZUVA 4W8BA 1XH0A 3WNPA 5DT7A 3W37A 1HJXA 5IFPA 2DIJA 2WKGA 4H8HA 3I3EA 1C7TA 4MB1A 3VMOA 4CCCA 3N04A 1M01A
chains in the Genus database with same CATH superfamily
5AYIA 1W56A 4CGTA 4JYFA 4MVAA 5JH2A 4AF0B 3U0HA 4PL2A 1XISA 1VAHA 2PZNA 3IV8A 1F74A 2E67A 2QAPA 1R0MA 3SFKA 5LNSA 3DX5A 1GQLA 4EP8C 4GI8A 1XH1A 3O5MA 2PDPA 1FJDA 2FLIA 4MWAC 4I9AA 3WNKA 3BTNA 2I16A 3RXZA 4BZYA 1YDNA 1DHKA 2C3ZA 3VDGA 2PFHA 1DQUA 2G3NA 3M64A 3OHIA 1I2PA 1TMQA 3OVQA 1OX6A 5BU6A 5JIWA 2DT0A 4JYSA 2ZZ4A 1PUDA 4JX4A 5GNXA 3EYPA 1D2KA 4CVUA 1RBAA 5E09A 3PVFA 4BI7A 1B9ZA 5A8NA 1DYSA 4QCEA 3GBDA 3APTA 1X96A 3CEPA 1J5TA 3V4BA 4IISA 4ZE5A 1AFSA 3QXBA 3AHTA 2OLHA 4LRSA 1JNSA 2ACUA 1JPDX 1S2UA 2R1NA 5IOBA 1FWNA 4DRPA 1R7OA 3UVIA 2V5CA 3FYYA 3JZEA 1D3HA 3PBVA 3C0SA 3W1TA 4H83A 1YE4A 4G1NA 3ZO9A 1QW8A 1EIXA 3KTXA 4BR1A 2BHZA 3PP7A 5C55A 2ON3A 3NL3A 1KM4A 2WANA 1CT5A 5F4XA 4NKCA 1S2AA 1XSIA 2DIEA 3L2LA 4EE9A 5K9DA 1AH3A 1HT6A 3VDHA 7REQA 1S5WA 2FJUB 2PWDA 5AFDA 3KCEA 2V38A 4UNKA 4MUZA 2POZA 3O16A 4LUJA 3GTHA 1OD0A 4O11A 4PTVA 5LA1A 3ITCA 2QCEA 1LF1A 3OZPA 1Q8JA 2OT0A 3V5CA 1N82A 3W1PA 1C8VA 3UT0A 3KDNA 2Z4GA 1O1HA 4LY8A 5DT5A 4Y8EA 3K4AA 2RDTA 1IGWA 3RMJA 1Z6KA 3VVGA 3TC5A 1OX4B 4A3RA 1PIGA 2ZRVA 4J3UA 3M0XA 2X1UA 1CYGA 5A8OA 3CTLA 3NDYA 2DUZA 1SO3A 3BOFA 4PGLA 3W4RA 1RALA 1DE5A 2W91A 2QJMA 3LHUA 4ZCWA 3FHAA 5CQ1A 5G1TA 4W8LA 3O5JA 1OCBA 4JR5A 1W3NA 3CMJA 1YTEA 4KFNA 5BXRA 5C70A 1CGTA 2ZX7A 3SM0A 2IPJA 4JIQA 3C2YA 4P8VA 4O14A 1BVNP 3GTIA 3TR9A 1HF6A 2POTA 1KXVA 4JKMA 2DZBA 3TTSA 3H2CA 2YDAA 1QI5A 1BYDA 2IW0A 3CV1A 4HIBA 3VGHA 4G7FA 4FR1A 3URBA 2EEXA 3QSTA 4EF8A 4I5RA 3SUSA 1JXKA 3HN3A 3IGSA 3GM8A 1REQA 3EX2A 3BSMA 1CB7B 4GQBA 1ZBKA 4TW6A 1YPFA 3UP8A 2HK1A 3P8JA 1JDFA 3UF8A 2ZVRA 1W1B1 1MXGA 3WQPA 1SFLA 4UTTC 2DG9A 4HPJA 1CX9A 3WBAA 1G01A 1J0KA 1SGJA 1NDYA 2ATMA 4D6CA 2EPKX 1YXCA 3EB4A 2NUWA 4B91A 1QW7A 3TTYA 1VFUA 3AS2A 2VENA 5H1WA 4M6PA 2W67A 3AHYA 4F9DA 3HGJA 3TKFA 1E5NA 3K2GA 5FL0A 1Y65A 4CU7A 2P53A 5REQA 5TD4A 2O9PA 1PTAA 4M29A 2D73A 3S8HA 3R8RA 4NQ1A 2V5LA 1T0OA 1PIIA 3VKCA 1E70M 1J96A 2WCGA 1FXQA 2JFEX 3VOGA 1TR9A 2HTMA 1LUCB 1TIWA 2M1IA 2Z1XA 3NDOA 2GWGA 3CIWA 3T0TA 3T81A 3NURA 3LEPA 4LBUA 3WN6A 4Q4KA 2GQAA 1V6VA 5DCDA 3K5XA 3WNLA 4UWMA 3W74A 4YYFA 1H63A 1KM5A 1RPXA 3UG8A 2PBGA 3W2NA 3Q4DA 1TKKA 2PP1A 3G1DA 3W1UA 4PMVA 3QFWA 3VIKA 3OG2A 1M5WA 1TWIA 2UY2A 1J6YA 5A5WA 2BSLA 3BLLA 4AVFA 2ZTKA 3OJGA 3VMPA 3GHSA 4GUHA 5E6YA 4CQCA 3VO0A 1QNQA 2VGGA 4E8GA 2Y8UA 3RF9A 1JL8A 3TA9A 3PFRA 3O5GA 4H9XA 2E5BA 4NYUA 4GCAA 1MO0A 1FWDC 1VIWA 1TRDA 4JL1A 5G4EA 1XUUA 1HJSA 1DJQA 1RP9A 1QTWA 2ZA2A 5E6ZA 3JRKA 1NOFA 4EK7A 2XU2A 3W1AA 5C9XA 3D3FA 2VL4A 1BRLA 3TW7A 1U1JA 4XZBA 3BAWA 4IXHA 1DWJM 4M3PA 2QS8A 4JKKA 1FWEC 1IXPA 1IXNA 3ZSSA 3ZVIA 4H7ZA 4FB7A 3HTWA 1FOBA 3OG3A 1O68A 1I2NA 1J93A 3KOWA 4N02A 3RUBL 1UKTA 4BQ5A 1O5RA 1NFPA 1UWIA 2RAGA 3UZYA 3LM7A 2ODOA 2IF4A 5JQ9A 4XIAA 1UD6A 1LLWA 3P74A 4TW8A 4DUXA 4JFLA 2D23A 1PBGA 1EA0A 3LCXA 2YB4A 3BGAA 3ZFHA 3MU7A 1CDGA 2WK2A 3O6CA 4FEZA 5EMLA 5EGRA 4JGDA 3DHUA 1IEXA 1XDLA 4H9MA 4BWLC 5K3VA 2NWRA 1UIOA 2DU2A 1NU5A 5A8GA 3ZYZA 1Q6GA 2NLYA 3V5OA 3BAYA 1CPUA 3ATYA 3OHMB 4WJEA 4Y96A 5CJMA 1FKDA 1XC6A 1E6ZA 5CZTA 1E1CB 2OLAA 3B4YA 2Y4SA 2R1MA 5HWCA 2WBGA 4TXEA 4PRTA 4OKDA 3S5YA 2GJRA 1VBRA 4FHAA 3GNOA 3WQ5A 3EKLA 1XYFA 5FJRA 3P14A 3ZWSA 1F4AA 3A47A 3U48A 3VIOA 4Z1CA 4CD5A 1HP5A 1HKKA 4DBEA 4JD4A 3CAQA 1R7AA 1A4LA 2PBCA 2DSWA 1HJUA 2DJLA 3MSYA 2OFNA 2P0IA 4PB4A 2ICSA 3STFA 1W8SA 4J3WA 4PCNA 2QCMA 3MSGA 1YHTA 4LV4A 5E93A 5T8GA 4G1KA 1JUBA 3V1HA 3UYCA 2Z2AA 4KWOA 2TODA 3TYDA 3VX1A 3T07A 4A3QA 3UA3A 1M1BA 3TQKA 2QUUA 4YCOA 4FPSA 3O5LA 4GIVA 3W23A 5JBFA 4TMCA 3H24A 1R85A 2WHKA 3AICA 1TO3A 4E3VA 5DEZA 3KRSA 4JHZA 4EPEC 4GFIA 3R79A 1RJPA 3WNOA 3MS8A 5A2AA 2CBIA 4N9CA 5HR7A 3U4AA 4M7TA 3VD4A 1QDSA 1PV8A 4I6KA 2CHOA 3FEQA 3WZ0E 1DWAM 4H9VA 2RFGA 4KKXA 2JBMA 2NQ5A 1F2JA 4NP7A 1C93A 3A4AA 4QS6A 2GQ8A 3I68A 4HJFA 3OOQA 1ZNNA 3PAOA 3B3DA 4AZ5A 2DSZA 3HJZA 4LJ3A 3VU2A 2HZGA 2E8YA 5LA0A 3FOKA 2QPSA 3QZEA 1N1AA 5DN1A 3H23A 1KBIA 3E12A 2OSWA 1Q63A 4TU1A 2MNTA 2GYIA 2WJZA 4GA8A 4P7OA 1B2YA 2GSJA 4GO9A 5AZ1A 3OIXA 1G7VA 4CU8A 4US5D 1JZ4A 3WLNA 1R9ZA 1XIMA 4MSSA 4BQ2A 1FWRA 3M0MA 1R3RA 5BXTA 2UZ5A 1XLFA 3MUY1 4AX7A 3DFTA 1FA2A 4DZ2A 2O92A 1OG6A 5HUPA 4MY8A 2HWGA 2Y78A 3M43A 3W1RA 3BUVA 4UIOA 2VRQA 5A95A 1WBJA 3VKJA 2OSXA 3K8LA 4DO6A 1RVGA 2BGQA 3WJXA 4QS5A 1JZ5A 3PR2A 4HSNA 3V3WA 1OF6A 3G8RA 2WZHA 4AZ7A 5C0QA 5JH1A 3T55A 1QNSA 3UEQA 5M17A 2IKJA 4LS2A 3F5JA 4O1CA 3W7DA 1QI3A 3OGVA 4FNUA 2Y85A 3T4WA 1R9HA 1CENA 2TRSA 2WB5A 1I60A 4INFA 2XYLA 3ZR5A 2ZQTA 1ZJIA 4YPJA 1RSCA 5CBBA 1ISVA 1UYQA 3OBKA 5G2IA 1XHGA 2JEQA 3P0XA 3PTKA 2Q8XA 3L5MA 3MUXA 2XJ7A 1H1ZA 3M4HA 2ZUNA 1VJZA 3NQGA 2KGJA 3VDBA 2DH2A 3U3HA 3WQGA 2EGZA 2CXGA 4ACYA 3BLDA 1IXOA 3BGGA 3M0VA 4I90A 1S38A 4UQ9A 2CZ5A 3H54A 1V0NA 3MA8A 1K9DA 5TAOA 2ZUUA 3PJXA 1NMVA 2EPLX 3QPZA 2FH6A 3ARZA 1WPCA 4WR3A 4Z2IA 1W32A 4I8YA 3SDOA 3W81A 4J3ZA 3NAVA 3V0UA 1RQEA 4P7RA 3E0WA 2OZ8A 2XM2A 2DVUA 3VM7A 1UWAA 1W91A 3OLEA 4C65A 2VC5A 3KEHA 3NRKA 3S6TA 4UDMA 4AD0A 4ODPA 4FF5A 5DMMA 3CUJA 1OG0A 1SZFA 3EXSA 3WLIA 3IUHA 1YLVA 4MNKA 2DT2A 3T40A 2RKXA 1IEIA 1S3HA 4N4QA 4D8AA 4C6MA 3DDMA 1R9XA 1VYRA 1WDQA 2J77A 2HK0A 1NJJA 1A5BA 3UA4A 4ZOCA 4AD2A 1VRDA 2QJHA 2ZRUA 4PCPA 4ADTA 1SW3A 5KEZA 1W3TA 3TDFA 1C9WA 3CT7A 4RX0A 4DIPA 1NDVA 4GI4A 3NYZA 4NF7A 3G3DA 4H41A 3BAJA 1BQGA 3M0JA 3OA5A 5MKGB 3W1QA 1ZBVA 1AW5A 3GK0A 4N6FA 4S3JA 4RPPA 3C86A 3PRAA 3B9EA 5CPTA 1XF0A 2WMIB 1CGWA 1ICSA 1XSJA 1JAKA 1JZ6A 2X2GA 5SWUA 4DM2A 3WH9A 1KM6A 1CGXA 3RMEA 4FXJA 4C7DA 1V0KA 4ZBCA 3FK4A 1E0TA 1B3WA 2ETNA 5H8PA 4ZR8A 4E4UA 4REQB 1AQ0A 5D2YA 2VELA 3QPYA 5LHFA 1KWGA 2Q01A 3XISA 3AU2A 3PZTA 4BQ3A 5KMYA 2C14A 2ATSA 2DZAA 3T0BA 5HQLA 1J5SA 3DU0A 5D03A 4W88A 2C91A 2B31A 2YXXA 4BFAA 2PDWA 3W7HA 4ALDA 3W7MA 3HJEA 1LP6A 4GG9A 4PMOA 3IJIA 1E0VA 3OGSA 5CC6A 4XZNX 1KBKA 4JTLA 3PZQA 3PJTA 1R3YA 1RCXB 3KCJA 2EPHA 3EDFA 4GH1A 4UR9A 1TJRA 4ZQNA 5K2ZA 1EUAA 1KRBC 4J9JA 2A79A 3B7XA 4GKLA 3MCNA 5HMEA 4AHOA 4PFMA 4NAEB 2BOEX 2VEFA 1EBHA 2HISA 2YFNA 4RDVA 2D2JA 3MW7A 4L4OA 3CQ0A 3GS6A 3AYSA 4Z0JA 1IGSA 4LXFA 4ZZ9A 4FALA 1O12A 1KM0A 2V5DA 1HW6A 3GPKA 5D9PA 4LUSB 2QUVA 2NV1A 3CASA 3FAXA 3LHVA 5U7SA 3LMZA 3IV3A 3IJQA 3N2TA 3W82A 2FHBA 1E1EA 4J2PA 5I06A 4U85A 2C79A 3CIVA 1JDAA 2A7PA 1TPFA 1RH9A 2PGRA 2AOSA 1E3XA 1TB3A 5HULA 1VQTA 3PBWA 4LU0A 1IZKA 1QATA 3RIKA 1DIKA 1BXBA 4IMAA 1ISXA 2FAPA 1LM1A 1E44A 4MGVA 2FTYA 2DORA 4Y9OA 1Q3NA 1KGUA 4WIWA 1GYMA 3E38A 3ZS4A 2YCEA 1HVXA 1X8FA 4QT2A 3KL0A 5JVLA 4RE2A 3B4UA 4MHBA 4P7NA 1E6PA 3CK5A 4KQNA 3NQFA 1T6MA 1M41A 3NQ6A 3OVRA 1FWWA 3C2FA 4GUIA 1TYGA 4JFUA 4FF7A 4NJGA 1LG2A 1E40A 4HK7A 4PTNA 3MP3A 3LZ5A 1I4NA 3W26A 5CPNA 2XH2A 3TYCA 1OT2A 5LZLA 5JH8A 1X6UA 3CLMA 3DKLA 2A5HA 1NDZA 2RJHA 4K2SA 4D1IA 5DFAA 5FJUA 3CTTA 1TIMA 1TTPA 4W7WA 3U2ZA 4QX4A 2H3BA 1LOQA 3INPA 4U3AA 5LKYA 5J8LA 2E3ZA 2RDUA 2WVVA 1PKLA 4ZO6A 3DECA 3FDKA 3GU9A 5G4WA 1AW1A 4YN5A 3BSHA 3N4FA 1H5YA 4JTGA 3QV6A 4H9TA 2WWDA 3ITYA 3H12A 3GNNA 1NIUA 3IUDA 2CFFA 1OC7A 2Z7GA 3DESA 5BMWA 2VP8A 2Z7KA 4M7SA 4HK5A 4PMZA 5FAJA 3UW6A 1GWJA 2B0MA 5HOSA 3RCYA 5DY3A 3WBEA 3IK8A 1UBPC 3A5VA 4H8UA 1F8AB 3EA1A 3H6OA 3II1A 3TFXA 1TV2A 1XP3A 1JGIA 4XKYB 1PB0A 1H7OA 5AZ0A 4U5KA 5BOOA 1ONRA 4ZFCA 3EX1A 1NOWA 4RXFA 1EIBA 2PDYA 3KHJA 1FH8A 1V3JA 3EPOA 4Q4SA 5FJIA 3C6CA 1FHVA 2PBOA 3ITGA 2AAMA 5CG0A 2HS6A 5EFFA 4PBFA 4OBTA 2WW5A 1VBJA 3CO4A 2VM8A 1YBQA 4IP4A 1FWSA 5ABFA 1X7IA 2OT1A 1E0WA 1NEYA 2F2HA 1MW3A 5CH9A 4US6A 4A3UA 4JN8A 4TV5A 4NZFA 2ITKA 1QI4A 5FAGA 4HNTA 1PVNA 4DHGA 4GACA 1CIUA 3JUGA 1DBTA 2FZ8A 1EXPA 3P80A 3FA3A 3W38A 1EYEA 4PC8A 3DYPA 4J3SA 2CKSA 3I3DA 3MMWA 1U1HA 1VLWA 3QJAA 3E49A 2CLPA 3PC0A 1IZCA 4L56A 3KAIA 3U57A 1BD0A 1T8QA 4H00A 4EXBA 1GOXA 2H6RA 2VFHA 1KBLA 1OFAA 1XIFA 4QJ5B 2W61A 2VDHA 3IUIA 3NSXA 5M03A 3QF0A 2ZUWA 4RPQA 4UB9A 4JYDA 3POCA 1D8CA 2E25A 1QPLA 1BL4A 2WKLA 4AB4A 4HOXA 2O55A 3BGJA 4NAFA 2YCJA 2A6LA 4AWUA 5G5IA 4NJIA 1JD7A 1EDTA 1U1UA 1GJUA 3UGRA 2VD8A 3NTYA 2C1HA 5HATA 4UZSA 2EPMX 4DPQA 1XD0A 3BW2A 2GFTA 3FGCB 3A12A 3M6DA 1QNVA 4GGBA 4PUNA 2E9MA 1VFHA 4UTHA 2XZ7A 2XPBA 4XD6A 2AL1A 1AVAA 3I65A 1C92A 4NG3A 5EMUA 4UTWA 4N6EA 1ISYA 3O5RA 3WUBA 3W2JA 3C56A 3VUPA 1B6CA 4IIFA 4ZA0A 3QLLA 6REQA 2D2HA 5DMYA 1FKIA 3S47A 2ZDSA 2ISSA 1Q4WA 4UMBA 4ZODA 2J62A 1H62A 1AH4A 1DIOA 2Z2UA 4DRKA 1EJSC 3WLKX 1GK8A 1LT8A 1XYZA 3QN3A 4C6BA 4E2DA 3LCLA 1H1YA 2INFA 3VMNA 1DP0A 2O7SA 3ZT5A 3ZLHA 3HG5A 3K13A 1HTIA 2BLEA 2WNNA 3H4WA 3IRDA 4GZJA 4HMEA 7CGTA 3BCJA 4IGMA 2YXOA 3SSZA 1P0KA 5AECA 1WUFA 3REQA 3SQSA 5HAOA 3E96A 4DWSB 1CXHA 1S5MA 4MFDA 5D2VA 1TRIA 4ZOBA 3UNTA 3ARUA 3VC6A 3W2KA 4DBWA 3PBMA 1F9CA 2P5NA 5G4HC 2D3LA 3M47A 4LW7A 4G50A 4ATLA 2NX3A 2WHMA 5EB8A 4ODMA 1NFBA 1PX4A 1ECEA 4IX0A 4NX0A 6REQB 3E2RA 3JVAA 1ZGDA 4NIRA 1G69A 3J7HA 4GHRA 1LT7A 1CGYA 4PR4A 1OINA 1W5MA 2H8XA 5AYZA 3DC0A 3LPGA 4Q8TA 5FA5A 4WKHA 4YXGA 1FKSA 3HFTA 4MZ1A 1QPKA 4GX9A 1IX5A 2PGWA 1JNTA 1SMDA 3R94A 3GUGA 1PWLA 2EULA 3TJLA 5KTLA 5D2WA 2VEIA 3UQIA 1E9ZB 1VFOA 2ZFAA 4E38A 3GSMA 2GJLA 3IKGA 1KCZA 1GHRA 3G24A 3D0CA 2IQ0A 2W5FA 2Y88A 5CC7A 2F9RA 4JICA 3TN5A 5F7UA 4XZMX 4PN2A 5IXEA 3MP4A 1VFMA 4UFKA 2PPPA 3DZ1A 2BVYA 1V5XA 1FBAA 3LI1A 5F2LA 4HNOA 2CETA 2GQ9A 3VYLA 3IVUA 2D0GA 4OJYA 4GXWA 3AIWA 2PCQA 2V82A 2Y5JA 3GBEA 1F76A 4AC1X 3AZTA 4NY2A 3KTCA 3WO8A 4Q8UA 4CQBA 1R47A 4GI9A 1Z41A 3WD1A 3NL5A 3ABRA 4W87A 3NGFA 5L9FA 1JYVA 4TX8A 4K8EA 1IEWA 1XL9A 1ML1A 2XGIA 3B03A 5DXXA 2DDXA 1WDRA 3AWNA 3OYXA 4PA8A 3T7VA 4HNUA 4IMEA 3W1NA 2V8ZA 4BF7A 2VHLA 1UJQA 3LCGA 3CMFA 1RPKA 2VFGA 2LPVA 1WXJA 2WZTA 1L8PA 3NL2A 1JGMA 4EIVA 3MV01 1JCJA 2BDQA 5IHSA 4ZOEA 3ZQ9A 3TW6A 4LF2A 5FI8A 2J6XA 3W7OA 3CC1A 5FF0A 2XZ9A 1FKBA 2PTWA 4Q3MA 1L0PA 1XGZA 3EX6A 4HCDA 5ABHA 2B7OA 2KI3A 2J7BA 2INZA 1Q7MA 3NQCA 1OABA 4RKAA 4H6RA 4WJ8A 3W7NA 4JQ2A 2VN1A 3N4AA 4LYQA 1KTNA 3KABA 1H0IA 2V63A 3VGGA 5AYBA 4U2YA 2ACRA 3B9NA 4F2TA 3STGA 1XIEA 5I5RA 4XBKA 3LTSA 3PZ9A 1B90A 4Y9PA 1OX5A 3NTPA 3VOCA 1XCWA 2BBFA 3WQ8A 3EA3A 4NVTA 1VRXA 5RUBA 1EB3A 4GUFA 3QKZA 1Q13A 2XIOA 2YOCA 1SR0A 2O9TA 4RZ5A 4UFHA 1POKA 3OEXA 4N19A 2ZZ5A 1WZAA 4OOUA 3KHDA 1NF7A 4NXSA 4CQDA 1LJYA 3HM7A 4A8IA 3BLFA 2MUCA 1HFBA 3I6CA 3NNTA 2PODA 3WSUA 1FKWA 1OZMA 2WPGA 3TUUA 3WX7A 4BHYA 4NRSA 2ABAA 3ZWTA 1SZGA 1MSSA 3LRLA 3DYMA 1T11A 2QJIA 3GDBA 1R30A 2ZX9A 1BPLB 1NF0A 3NJ3A 4WVXA 6ALDA 1PAMA 4KFOA 2VEGA 2FMOA 1W5PA 4V27A 1JFXA 1GOIA 3SGGA 2EPNA 3PZGA 3P2VA 2FZBA 3FYOA 5F4SA 2SFPA 3TN4A 3WUFA 3L2IA 1W3JA 4M51A 4NU7A 4KCWA 4V1YA 2VEKA 3RAOA 4F0RA 4RW5A 4B16A 2YCLB 4R3UA 5FACA 3TR2A 2QCHA 2XP7A 2ZRZA 2H8ZA 4CNNA 3M0KA 5CZ0A 4H3DA 3LK6A 2ESCA 3FVMA 3AIRA 4GISA 2GK1B 1N7KA 2BS9A 5D37A 2ZX8A 3NFUA 2YCIX 4TOQA 4ZB0A 5HQEA 1GHSA 5HWNA 3NA8A 5GNZA 1TX0A 3LB0A 3H2OA 3PHAA 3PULA 3VNIA 4ZEPA 2A3HA 2W6RA 1X1OA 3CBWA 5I02A 2GDQA 1BG4A 4D6FA 4W86A 1W54A 2MANA 3CL7A 2GL5A 1DWGM 3A4WA 3GXTA 3U6WA 1Q1CA 3NSNA 1E72M 4J4OA 3ATZA 5AHNA 2GLKA 3LSCA 3CQHA 3GU2A 5F2MA 4WSKA 2PPOA 3M41A 1KFLA 3S1UA 1VR6A 3QFEA 1TV4A 1FKLA 1D8WA 3MVTA 3HPZA 1QO2A 7ODCA 4E8DA 3W7KA 2VTFA 3BZJA 3T8QA 2J74A 4LB3A 3BMXA 3V0TA 3AHVA 3R43A 1XXXA 1DKWA 5CXPA 2J9ZA 3WQEA 4U86A 1S39A 3EMZA 5E0KA 5D75A 3W24A 3TLLA 2GSEA 3MP5A 4O15A 3HPSA 4BJHA 4AWEA 2CU0A 1P5BA 9XIAA 5BRBA 2P76A 1WCGA 1UWTA 1XH0A 3RO6A 5DT7A 4L1XA 1L6FA 3EIPA 2DIJA 4H8HA 3I3EA 4MZ8A 1C7TA 3TH6A 3C2OA 1R2RA 4CCCA 3N04A 3PR9A 3SN4A 5CBJA 1M01A 2PRLA 1TTQA 4JTHA 1E6XM 4MSPA 4LS0A 2MLYA 3UVAA 3PA7A 3ZXWA 5AC7A 2FMNA 5DLCA 3OBEA 2DH3A 4ATDA 2NW0A 2PPNA 1L2UA 4GYPC 2J75A 3DOPA 4HZ6A 3GWQA 1BKSA 3GW3A 1WX0A 3TWAA 4LV9A 4M0XA 4GY7A 3UQAA 3VNKA 2Z1SA 3MUZ1 2OOGA 5C9WA 1FDYA 2O4QA 5FSEC 3CQKA 3N3MA 3UR7A 3AS1A 1JPHA 2B7QA 4XD5A 2XIIA 4Z08A 2J25A 2XH7A 4JTFA 5CZKA 4QFUA 4H1ZA 4KIEA 3IJLA 4L61A 3BXWA 4A3YA 1W6TA 2YLLA 4G6CA 4Y8FA 8TIMA 4AZ6A 3H9RB 5CPOA 4UOQA 3O1NA 3L9CA 1QASA 2V81A 1OK4A 2W63A 3ZLGA 3RX2A 1E71M 1FKTA 4H6QA 2ISWA 1K8CA 1KM3A 1GVRA 4MAZA 1GGOA 5CAKA 4GLEA 2ZUTA 1T96A 4JN6A 5LXEA 1NMWA 2N87A 3IGHX 2ZR4A 1ME8A 3TQPA 3N3TA 1XRTA 2EQDA 4IPJA 3N9SA 3WDJA 1DJYA 3S46A 3IWPA 3W7GA 5C9UA 1UA7A 3QRHA 4UFIA 3W00A 3H53A 1W26A 2ZADA 1Y7VA 1YMYA 2WNWA 4TQTA 2FDSA 3WD0A 2ZE0A 3CGNA 1IR1A 2CEQA 5BW6A 3D47A 1Q85A 3GC2A 3GVVA 4QSHA 4C6FA 3GNRA 2ONEA 3PRDA 3BLPX 3VTRA 3OVPA 3C0QA 2HEJA 3FX4A 4S3AA 2PTXA 4N9EA 4B2DA 1WAWA 5G1YA 2VMFA 4XAPA 4LC8A 2DPEA 5IBXA 1ITQA 1PZ0A 4K7YA 2PLCA 3UY7A 5CZSA 4KEZA 1JCXA 1N8FA 2EG7A 3CHVA 1R9YA 1FWJC 1IEQA 3DERA 3WLHA 2G97A 3RDKA 1KV8A 3UCQA 4L4LA 5CPQA 2HE8A 1WOBA 2GVEA 3ZVHA 4XUGA 3S2CA 2QXWA 3FY1A 4GCXA 1H41A 3USBA 4U4MA 3O5OA 2P10A 4XD3A 3C8FA 3I4KA 1M04A 2ZXDA 3N19B 2Q6ZA 3O07A 1EOMA 3CV7A 1QNRA 3NEHA 8RUCA 4JFJA 3NUKA 1BWVA 2A21A 2HVNA 3W84A 5M2FX 2XSAA 3QMSA 1BYCA 3LHZA 3UJ2A 4F0LA 2Z00A 4YTRA 1XIBA 2OSYA 2ABBA 3SECA 3ZJKA 3N34A 3BJTA 4YWIA 2R9RA 2WMFA 1VFFA 3O05A 4JY9A 3SW6A 2WV8A 2INEA 4FOJA 1XRSA 5I79A 4ZB5A 2WOQA 1E51A 4IXXA 3LTPA 2YGYA 2X0HA 1G6CA 2KZHA 4IQEA 4EACA 1O5XA 3C8NA 2CWXA 2AKMA 3M1ZA 4N2YA 1K6WA 3B8VA 1JEZA 1X98A 4WZHA 3TYEA 3IJDA 3HFYA 3S2NA 3B40A 4WJXA 1T40A 2DSKA 4XUYA 1NY1A 4BY3A 4FAMA 2YJQA 4LAWA 1ZJBA 3B8DA 3PB2A 3TYZA 3V0SA 3ALGA 4CD8A 4FI4A 4GQQA 1EOKA 3TSDA 3ZR6A 4X61A 3PTQA 4PFHA 1KR1A 1O5QA 4M56A 4J7RA 4LFYA 4WSJA 2JIWA 4GNJA 3GXFA 2Y89A 2BHYA 2V2DA 3N12A 1AL8A 4IM4A 1W5NA 3WH6A 4GOAA 4B5VA 2GGHA 3ITXA 3AMGA 2GGJA 2I5QA 1ZCCA 3ZOAA 4H9ZA 2PDUA 4I9JA 1W1TA 4YIWA 1F61A 1W5OA 3UBPC 4DUWA 4HU3A 3C0JA 4C6EA 1Q2SA 2O56A 4XVEA 2NT1A 3AZRA 3UZWA 2DGAA 3S3GA 1HX0A 3FW6A 4S38A 2R82A 3THAA 1P7TB 2JKAA 5EMJA 3Q58A 1R87A 1DEDA 4G2DA 1F3WA 3AXMA 2QF8A 1JFHA 1GOOA 1TJ0A 2FGBA 2OXNA 3QV7A 5DBUA 4ZPTR 1MQRA 3RO8A 1RAKA 3RLHA 5MF5A 2PDJA 3DAQA 2NLIA 1R3VA 4XO6A 4AIBA 1CCWB 3NQMA 2XP9A 3F2DA 4YHGA 3EWBX 1Z3NA 2VCBA 3LCFA 1W3KA 2FGLA 3O5FA 3W7IA 7XIMA 5FD0A 3M5ZA 3MUIA 3UWEA 5CGTA 4AHQA 1XG3A 4GJ1A 3T4CA 1J79A 4KT2A 3QTGA 4M6QA 3U5YA 4TV6A 2NVCA 3CB8A 1W2PA 5XIAA 1I75A 1XWYA 5D05A 4B3ZA 3WLTA 2X8RA 4JFMA 3O5EA 2PURA 3QR3A 4LYKA 4TUFA 2J88A 3STCA 1KM1A 2CYGA 5D8ZA 1JDEA 1RLDA 3ANYA 3B0PA 3SQLA 1VIZA 2VWSA 4M19A 4IG2A 1U2YA 4D6EA 1FWIC 3R25A 1Q66A 2QDHA 4AXKA 4JFSA 2YW4A 2ZZ3A 4A8RA 4DYJA 1C8QA 1ITUA 3ARYA 2ACSA 4OWGA 4JTKA 3UJEA 2XTKA 4PL1A 4HMCA 3WH7A 1UZ4A 3GU1A 3ARWA 8XIMA 6ENLA 1LQ2A 3WDPP 3R10A 4L4PA 3WF0A 4YTUA 3SCPA 1E4MM 2E6YA 3BCDA 2PU0A 3G0XA 5DELA 3AUOA 1MXDA 1UWSA 1FWBC 4TTUA 3BO9A 1HXVA 4AMCA 1XUZA 1CECA 4AZHA 1EWEA 2A3AA 4HBKA 1P0DA 4UNLA 4ODLA 4HU4A 3R4IA 1DWFM 3WEMA 3B06A 4WF7A 3QOMA 3ORWA 3KBJA 2NZLA 5H6HA 2LJ4A 2DJXA 3BLEA 1I0DA 1J10A 3P81A 4AW7A 3UJSA 1HGWA 3EBVA 1QJWA 1XLDA 2FB3A 4R9OA 4GZ7A 3JU2A 3K1DA 1AD4A 1F6KA 4IIDA 1V3HA 5I3KA 2PD5A 2DSVA 1PO9A 3LSBA 3O6DA 1QXLA 4GZEA 4RZBA 1NP2A 1DJWA 3SCSA 4PUMA 4E2OA 4ZGYA 3S5ZA 4Y6GA 3H2FA 3DBPA 3UXIA 4JCLA 2E0PA 4AVOA 4L9XA 3UWVA 3AO0A 1OGSA 1EBGA 1SO5A 4GE8A 4TVCA 4PMJA 1D7IA 1N55A 4KIRA 4TO8A 4PUKA 4J3XA 3IJ8A 3FDGA 3PBUA 4MDOA 2DUAA 4YTSA 2NT0A 4RR4A 2BVWA 2E6DA 5IFTA 3M0IA 4JCMA 1OT1A 5PTDA 3CH0A 2V3EA 1U83A 3UZXA 2AQOA 3BAIA 4RE3A 2QV5A 3NM3A 4U33A 1TMLA 3O5PA 3GVWA 1CLKA 1UR2A 4TIMA 4PCFA 1XI3A 3EWCA 2P88A 3IIOA 2HXUA 4HCLA 1LBLA 1P0BA 2XGBA 3URNA 1WAUA 3NSMA 3FN9A 4IUGA 1BQCA 4EXAA 1DJNA 2DW7A 2J6VA 4G9PA 4X22A 1IXQA 1M03A 1OHLA 1M65A 3V18A 4C7GA 3NL6A 1VBUA 1UUMA 1PCKA 3WF2A 2RGMA 4D9PA 1HKJA 4FP1A 1ZJHA 3GRIA 1OY0A 4UBPC 1EA9C 4GWEA 2Q3RA 3E9AA 4HB7A 4DI8A 3H2NA 4H8NA 5KZEA 2UY3A 2OOFA 1QCWA 4Q8OA 2OX1A 4KWVA 3LY0A 7PTDA 3NZRA 3SY1A 1UQYA 5BOEA 1KT1A 1KNWA 2M2AA 1KTBA 1UKSA 2CZEA 2CHRA 3AWOA 4QXIA 1TELA 1K7FA 2VGBA 2J7EA 2VEMA 5F1UA 4L5ZA 1D7HA 3QY6A 2DFAA 5BU9A 3GAKA 1YXDA 2WVUA 1LWJA 1A5UA 3C2VA 2NXHA 2BP1A 4MLRA 4QNWA 2D0FA 3E74A 3GDRA 3SRHA 2FPYA 1Q5MA 3KM8A 3HOJA 1AK5A 1EF3A 1C7SA 3A3WA 1XBZA 1H4PA 4HNNA 1XDMA 2WC4A 1YPIA 4WY0B 3NOYA 2CWNA 1WZLA 5A1AA 4ZVJA 3DFNA 4ODNA 3UNDA 2GQ3A 4LYRA 4AZBA 3KP1A 2ZDRA 3O63A 1N2VA 2R14A 1X7FA 1SO4A 2Y1HA 4R7WA 1US3A 4QIUA 1DQWA 1Q6RA 1ZJAA 2NWSA 1THFD 2WXDM 1BYAA 5CLTA 2IPWA 4UUIA 3VFLA 1VBHA 2Q8ZA 4A8NA 1P5QA 3WJSA 3LGDA 1XJBA 3DI0A 3H4GA 4GGQA 2ZX6A 4C7FA 2X0SA 1PS9A 5H8MA 1XLIA 4DJFC 3TSBA 4PMYA 1GQKA 4LX4A 2VC9A 1J4RA 5DRCA 3S4TA 3R6IA 1G4SA 1FD9A 4W93A 5LIUX 4DROA 4NZ5A 3P8IA 2H3DA 5A8PA 2XISA 4DB7A 4B3KA 2E68A 3BLOA 1YTKA 1UZDA 4IH3A 4MKSA 4HNCA 4A4AA 3BWWA 4PMQA 3E0FA 4ORMA 3T44A 4LF1A 1TUXA 4GBDA 4IHCA 4ILSA 3GXNA 2QW5A 2YL5A 5JXQA 4HPHA 1TTIA 5A69A 3CUGA 2PDKA 1M3UA 3VC5A 3E3HA 3BLKA 1QT1A 4W7VA 2GJXB 2XIBA 2FFIA 2W9MA 1CWYA 1OVDA 1OBAA 1V3MA 4B4FA 2I5IA 4UTUA 2E77A 3HGRA 2WNQA 1GZJA 4O28A 1R3QA 3LENA 1Q6HA 4HZ7A 4GQ0A 4JFWA 5I78A 1VD6A 2VO5A 3LBMA 1J0ZA 1KCKA 4N7QA 2BG5A 2PU1A 1EJRC 2AL2A 4LQ1A 1B0IA 4H4IA 4O1FA 4GVIA 1FXPA 3AFBA 3TK7A 5HUOA 4IQCA 1CZ1A 1JI1A 3Q45A 5EKYA 4I9TA 3CAWA 2Y7FA 1DORA 4L64A 4EWJA 4E2VA 2D0HA 1J11A 3RLVA 3S9IA 2ADAA 1Z32X 4FR6A 4M81A 4AIEA 4DJEC 2NV2A 3S42A 1TZZA 3A13A 3G2GA 4MF4A 1VP5A 1P1XA 1AUSL 3AS0A 2QUNA 2FHCA 3TU9A 4YHEA 4K1GA 1E9LA 4KEVA 3M7WA 4C1NB 1H7XA 4DJFA 5M1TA 1KT0A 3TX9A 2WO5A 3E02A 3WQFA 3AYTA 3HF3A 3PBYA 4HCHA 2ZQUA 3HV8A 2FPTA 2EJ1A 1XW8A 3A9BA 4H7CA 2X42A 4IQLA 1V0LA 1GYNA 4B4HA 1VFTA 4MNLA 4FX7A 4O13A 1NDWA 4FLOA 3TWBA 4XWUA 2OQYA 4IQDA 3WELA 3UWUA 4G56A 1I9CB 3HA1A 5I00A 1UOZA 3COTA 3WLSA 3RJYA 4GJIA 2A3LA 1ZS2A 2CESA 3W85A 4PMXA 3GIPA 4YS1A 2VOMA 3HB9A 4LWWA 4WSHA 1I0BA 4IMFA 1O5KA 4I5XA 2VEPA 4AC7C 3V36A 4M80A 2PSNA 3VKDA 2YSWA 5I3JA 3P60A 4JNZA 5DF0A 1FKJA 2XFWA 3SUTA 1RA5A 4UFJA 3ANVA 3R58A 3TAOA 4EWND 4UTMA 1TPB1 4RW3A 4Q8PA 5I2UA 3CUFA 4CQ9A 2X7WA 3GKAA 1JZ8A 5AVHA 1GZ1A 4S39A 4UQAA 2KO7A 2MPHA 1JYXA 1ODUA 3ENLA 3S1GA 3T78A 6PTDA 2RGLA 3GXMA 4O4VA 4O16A 3FV9A 1AJ2A 4K8GA 4DJEA 2QCFA 3CL6A 3N2BA 4UNIA 3V1PA 4XAKA 1JPKA 4GGHA 3WLJA 1EP3A 5A6MA 5FJOA 3MCMA 4Q7NA 3WBWA 2F7FA 5HW6A 4CCEA 3VIHA 2NX1A 3TQVA 3W27A 1EHNA 2XWDA 1O7AA 4MIMA 3MWAA 2E1WA 3LXBA 4GJJA 1D9EA 2EG8A 3TXZA 1XX1A 1TVNA 3GIYA 4GKTA 3IEBA 4QG8A 3Q2DA 2LLEA 4DNMA 4M24A 1AL7A 4EPKA 5AHFA 3UY8A 1C9HA 3DH7A 3PZUA 3KOXA 1Z42A 4LAXA 2PB1A 2YDSA 4GINA 4AUBA 4GUJA 2V68A 1VYPX 3VIJA 4ZQOA 2ZQSA 1K8XA 3VOFA 3ODKA 1L8NA 3WD4A 3IARA 3W72A 1UP0A 3KUMA 5HNTA 5BXJA 4A22A 2QCCA 1DTNA 3B04A 3S2MA 3NPVA 3C52A 1CGUA 1FY6A 1WKFA 4CD6A 3NZGA 3SCRA 3VDCA 3DHDA 3FCPA 3BMVA 3PZNA 3N29A 3WKZA 1B30A 4UQDA 3MV11 5A6TC 4RNJA 2QCDA 2QPXA 3BAKA 4Y9MA 1JQXA 2GVYA 1D7KA 1GEHA 3UERA 1ZB5A 1YKWA 4B5SA 5BYWA 4GYKA 3TOPA 3KRUA 3GFZA 4C6IA 1I8JA 3LNPA 3APYA 3JW7A 4KFPA 4HSOA 3CZLA 4H19A 4DNHA 2XVKA 2BWGA 4QJ3B 3HO8A 3SBFA 8A3HA 1QO5A 2PS2A 3O15A 3SRFA 4IOTA 3U2OA 5A2BA 4P7LA 2VI0A 3PPCA 1FCQA 2QJNA 3WMLA 3IAQA 5BOFA 5GVJA 1B54A 3T08A 3EKZA 3VE9A 2JIEA 4XQ6A 4LVGA 4WX2A 3A23A 5ABEA 1UR0A 3THDA 1G4EA 1LQAA 2YBUA 2J7GA 5AC5A 4OT7A 1VFLA 1ZFJA 4RDYA 4G7EB 3MDWA 4XZWA 4DN1A 6TAAA 2G3MA 4UCGA 1GKQA 4Z2LA 2DEPA 3AHZA 1ISZA 2QCDB 3CZJA 2PWVA 4J2MA 1ALDA 3U4FA 3CWOX 1ZP4A 5TF0A 3ZLFA 1IV8A 1R8LA 2W79A 4B5TA 1GQIA 2I7GA 2ASHA 3EDDA 4LAZA 3DFPA 4U84A 5AC8A 4GI6A 3NDZA 5H91A 3KWXA 3E2QA 3BICA 1XIJA 3M6YA 2YFOA 1PZ2A 1KGWA 1OFEA 1S46A 4QEEA 1AMKA 3HQ1A 3WBXA 1NWRA 4Q8NA 4UMCA 2AWGA 2A2IA 2YYTA 4XZ9A 1WYIA 4PTXA 4XZHA 5I3FA 3EZ4A 4HNLA 1AQMA 3P84A 3TC7A 4UFMA 3MI3A 4PSPA 3NR0A 3KXQA 3DXIA 1EO7A 1TWWA 1MNSA 3W2LA 1SM9A 1EL3A 3GB6A 3TV8A 2HVOA 1K1DA 1LYXA 3M0LA 3THQA 3AXIA 3N2MA 1GQNA 3AHXA 2HCVA 1OYBA 5JBDA 4JS3A 1OX4A 1F3TA 1TPC1 5AOUA 3AXKA 4GD0A 1F4HA 3M0YA 3MO4A 4IJRA 1V6YA 4C6JA 3N1AA 2WBKA 1W1YA 2XINA 1PTDA 3WF1A 3ES7A 1OQFA 4PBEA 2WPBA 3OQEA 1XPYA 2OELA 1ICQA 1HJVA 3GZAA 4IT4A 1JXJA 3ZT7A 5DMNA 3OO2A 1XLGA 4R5EA 4JTSA 4DRQA 1S5NA 2IS7A 4I6VA 2GGIA 3TC3A 3ICJA 3GDLA 3NO1A 5FIPA 5CJ5A 3U8GA 3AIQA 4AYGA 2ZRXA 4IJCA 3EX4A 3QYQA 5KZ6A 1BWKA 1KM2A 3BURA 2WMGA 1H1NA 2EPOA 4BF9A 3W07A 4B5WA 4O19A 1D7FA 4E2BA 3L65A 2NQJA 1E5JA 4IIHA 3W6YA 3BH4A 1B3VA 3QQ1A 4LH8A 2YR1A 3RM8A 1DJZA 1QPNA 2NVDA 4ES4A 5F2GA 3BQ5A 2X1RA 3W88A 1EEPA 5FSDC 2YCKX 3LBCA 3MUCA 5AHIA 2H90A 1OJXA 3TONA 2TSYA 3BV7A 4DUOA 3AUJA 4DZ3A 1A3WA 3BL3A 3LLXA 4F0HA 2J8FA 4GY0A 1A5AA 3QMTA 1NAL1 3PNUA 2OYKA 1XQKA 3SY5A 1FWAC 3MKCA 3ZT6A 3S6OA 1YEYA 3TEVA 1SFSA 2VRJA 3IIXA 2BVTA 3OA3A 1SSGA 4V33A 3VNDA 5EMYA 4L6OA 4PMRA 3NQ8A 3VKAA 2WJFA 4X2RA 1W9UA 2ZOXA 2YZ5A 3UI4A 1PJ9A 5D9NA 3DFOA 1TWZA 3HIJA 1KFJA 4GPNA 1Q6EA 5AHMA 3PJWA 2VZUA 4DRIA 4L4MA 3BAXA 2PDHA 2QPUA 1GVSA 1K8ZA 1IIHA 3BDKA 1TPH1 2CLKA 1W2VA 2OGYA 1LUCA 1NSJA 1UP3A 4A05A 4NT0A 3P7YA 4HN8A 4RUBA 3SN0A 1VCGA 2BGSA 1PKMA 2PEVA 1OD8A 4IT6A 2DZPA 2OO0A 2CLEA 1FRBA 3CGTA 1UKPA 3E2VA 4HPXA 1IZJA 1QK2A 2XIQA 1K4GA 5A2CA 3NVDA 3NQVA 4LUTB 3F4NA 1Y0OA 4QR6A 5EFDA 3VABA 3F5KA 4Q7BA 4O8AA 5D2XA 2HXTA 5HUAA 1CGVA 1FKGA 1LLZA 1H7PA 3IANA 4IUOA 1VYSX 1KKRA 5F4WA 1S2CA 3CV6A 4FNSA 3LXCA 1RZMA 4DM1A 4U5IA 2F2DA 1WDDA 3N18A 3GTXA 2FPVA 5CC5A 4UR7A 2WHLA 3ABSA 2G4FA 4DZHA 1SFJA 3PRBA 4JTJA 3OLDA 4YWSA 4ZO8A 3PS7A 3QHOA 4JFIA 3KCLA 4K1WA 3PBGA 4ZPVR 1FAPA 1MUCA 3K4WA 1ME9A 1YNPA 5GQBA 1JVWA 1UR4A 1SJCA 4RNFA 4A2SA 2QCGA 3NQ7A 1H7NA 1BGGA 3I6EA 2QR6A 4LS1A 1EFZA 2YL6A 5C9RA 3GVGA 4B9ZA 5FESA 2NX9A 4DWDA 1KXHA 1GZGA 2VR4A 3GDMA 1TCMA 3O0FA 2F84A 4GVHA 1TJ1A 4J40A 4GYJA 3B8IA 4FXFA 3T42A 3GNDA 4Z42C 3UR8A 5JIPA 3JXVA 3F5LA 2PDGA 4UR8A 4WCJA 3G1SA 4WXYA 2ZXBA 2XGZA 5KITA 5D32A 3ZSTA 4Z2HA 2Z1WA 1W9BM 1GVOA 1V6TA 4AZCB 5LNUA 3M9YA 1XS2A 3BJFA 5HA7A 1H50A 2GGEA 4QLJA 1PWMA 1QFEA 3RX3A 1E1CA 4P61A 5LGXA 5TBOA 3RGCA 1C8YA 2H9AA 1EJVC 1Z69A 2FZDA 1XLJA 4E3TA 2HROA 2HJPA 3SCTA 4D72A 4Y9NA 3EOSA 1E56A 3CXOA 3GO2A 1CW2A 2X40A 3ZR4A 3MBFA 1J2BA 1X38A 1AQHA 1XCFA 2G3JA 3L68A 4PCSA 4R34A 1XYBA 4WUIA 4CLMA 4C1LA 4PTWA 1VLIA 2WJDA 2XFRA 4K39A 2VQTA 1MUWA 3PG8A 5G1MA 5I3GA 3NZQA 3KBSA 3E2SA 4JTAA 2I9UA 4J35A 2XPKA 1KXTA 3HMCA 5E1QA 5DBTA 4AD5A 5M3WA 3KVJA 1US0A 4DLFA 1TPDA 3ARVA 3GVQA 2V5JA 1GNXA 1FWFC 2OLSA 1ZU8A 1CTNA 4GIAA 3RPDA 1FHLA 2WSKA 4AH7A 2G3FA 3W83A 3S1VA 4DZAA 3GR4A 2H9AB 3MKKA 4EXQA 3NZPA 3QC3A 1HXJA 2VUNA 3QYSA 4LSBA 2PI6A 1LOSA 1HKWA 4JQAA 1KO0A 4JIRA 1Q8AA 3A3XA 4M5PA 3RFAA 3FJ4A 2WZIA 2X1TA 4HA1A 1Z9AA 2R8WA 4IGNA 9CGTA 3AAMA 2XWEA 1MEIA 4H6KA 1E9IA 4NJHA 4ZPWR 3WK1A 1B4EA 3TJIA 4QJ4B 3CT2A 2W0UA 4K3ZA 2PWUA 1FWGC 1BEUA 1PEZA 2J8GA 1BKHA 3V75A 2PDBA 4O8RA 1LLOA 1CLVA 1KR0A 3WLLA 5LNWA 3E6EA 4E4PA 3D3AA 4MAVA 3HG2A 3CPGA 3TZNA 2HS8A 4KS0A 3E0IA 3SAZA 1WXYA 2BX7A 4B2DD 2ACQA 4CNPA 1MI3A 2WSYA 1XLMA 4FK9A 3CAVA 4AWTA 2UZ9A 1E6NA 2Y0FA 4HHLA 2J79A 4PEKA 2G3IA 4C6NA 1W1IE 5CC3A 1EJWC 3UR5A 1J01A 2FTWA 3FXYA 1XLBA 2HSAA 1UP2A 2Z24A 3FLUA 3NO3A 1GVFA 3HPXA 4LNCA 1FWTA 1DHPA 3NPWA 3V7PA 4AEFA 3FIGA 3VKBA 3FHQA 3MHFA 9RUBA 5BROA 3TC6A 4N9DA 3ALFA 4BA0A 3UJRA 5E0CA 3GG8A 4PUJA 4QDMA 5FEXA 1UJPA 2ZZ1A 1RVKA 1H60A 5IDZA 5I3HA 1PPIA 2WLYA 1ZSXA 1W9XA 3AS3A 3BPWA 4IPNB 2DVTA 3ZIZA 1KTCA 1PZ3A 2YKKA 4DPPA 3IJ6A 5CLWA 1EDQA 3VE7A 4MNJA 3L5AA 1NELA 2GOKA 1WOAA 3PSWA 1JCLA 3CZGA 3VK5A 2JKEA 3SIMA 2A4AA 4KCVA 1EPVA 1YDYA 3G18A 4PB5A 4QZVB 2PWFA 4MJZA 4M82A 1K6AA 2J66A 2PTDA 3PM6A 5K7JA 4D2JA 2Z1KA 3W9ZA 3KCOA 4RV8A 3W6LA 2PC8A 1K02A 1NQ6A 1OK6A 1P6BA 4RDZA 4IZGA 3B8TA 2LGOA 5CGQA 1ZLPA 1QNPA 2P4VA 4J5NA 3URAA 1EQCA 3CNYA 3DUGA 1EH9A 2HPMA 3EWUA 2P1FA 3WMSA 4QAIA 1O95A 4R88A 3BC9A 1A0EA 5TNVA 1H61A 4DT4A 4YVPA 2EAWA 2VX4A 1OF8A 3NGJA 3RNDA 3P0WA 4HARA 4OUEA 4L72B 2PPGA 4MWAE 1PXGA 3NG3A 5HWBA 3O7UA 4YVXA 4WDXA 2AQVA 3AMDA 1XBXA 3RHGA 3G0UA 1S3TC 2BXYA 3C2RA 4IF2A 2FKEA 1PTGA 2Y63A 3OOBA 2NSXA 3IK4A 1F3XA 3NO5A 4NNBA 2GJNA 1K9EA 3AC0A 4ZO7A 3G3MA 4JFTA 1MQPA 1U5HA 2ZRWA 4FXRA 3QOKA 1U5VA 4QHRA 2P0OA 5MKGA 1B31A 4QE5A 4D8LA 3UI6A 4OBRA 3HGSA 4C6LA 5BMXA 2OWXA 2JGQA 1CEOA 1EO5A 1EPXA 2WMIA 3AZSA 5BXPA 1RP8A 1T7LA 4F4RA 1WDWA 4BI6A 1LBMA 1G94A 4AZIA 2NQLA 3S6DA 4Q4MA 7ENLA 1W1VA 1JRCA 1OFBA 1XLLA 4F0SA 1H7WA 3UR2A 4EPBC 4HSHA 3W02A 1FWCC 1IWAA 3HPAA 1W37A 1CXLA 3MPGA 4LPCA 3NOEA 3IS4A 4LAVA 4CU6A 3USZA 4WD0A 3ME3A 4REQA 4HTBA 4AMAA 5EMKA 3IJ9A 4N0RA 3H2AA 1IYXA 3EWZA 7A3HA 2ZWZA 1TV3A 1I2RA 3IAPA 1D3CA 2VGIA 2VFIA 4Z2KA 3IIZA 1ISWA 3SN1A 4YTTA 1XH2A 3TXVA 1W9VA 1H0GA 2CXEA 4S3EA 3A6OA 3BW4A 2W92A 2PA6A 3ZJ8A 1AQFA 2D24A 4JHMA 3B0XA 4O1DA 4EX4A 4TX6A 4HD5A 3G1FA 3GYEA 2CLIA 1PZ1A 3LGGA 1WO2A 4XAGA 3KRZA 5K4ZA 3AMLA 3WQ6A 1FWHC 3G77A 1ONEA 2XUCA 3G1VA 4HHMA 1RCOB 3RGTA 3SI9A 3R12A 1XCXA 2WZMA 3NPXA 2BHUA 1MDRA 1JI2A 1FVPA 3U9IA 5A3HA 1H49A 4JQ3A 3SCVA 1OFQA 4OU1A 4NAEA 3R2GA 4QIBA 3UQBA 1RR2A 2C8NA 3SCUA 5B80A 1TVLA 4JTRA 4V15A 2D2OA 3WDRA 4W4QA 3CEUA 4ORIA 4AG0A 4LGXA 5C7VA 4LUSA 4GH3A 4DXKA 3OLGA 1Z48A 4NNCA 1I1XA 3QGVA 4NL1A 1TPWA 1EF2A 1QPQA 3WLOA 1X6NA 2VCAA 5GPRA 2Z0IA 4Q8WA 1UH2A 3RJXA 1L2QA 3I4EA 3FJLA 4PCTA 4GO8A 3AYRA 3W01A 1XQLA 2QUMA 4PUDA 1ADSA 4K36A 2DT3A 3AJ7A 1E0XA 1P6WA 3RRAA 4ZMGA 2ZUSA 4GK8A 4S3CA 2IMRA 1G1YA 3MMDA 4JL2A 4WOQA 1KRMA 3SEPA 2J47A 3G0SA 6TIMA 3N9KA 1Q6UA 3QY8A 3H7RA 2JGYA 4HA4A 5D8WA 4XAYA 2AGKA 1SJBA 4A29A 4CN6A 3L2MA 3KLKA 1GOWA 3G1XA 1A49A 4HYVA 2V67A 1WE5A 3H2EA 3KVKA 3F4VA 4HMNA 2PDQA 3CHFA 2Q3OA 1PX3A 1VC4A 2GVGA 2C0AA 3KBWA 5L6UA 4WDWA 3WQOA 2X1SA 2WZEA 2XP6A 2X7VA 1F3EA 2XSBA 4QG6A 1EX1A 1PSCA 1V6UA 3LMYA 2WCAA 1AZ1A 4O17A 4Q6XA 1WKDA 4KF1A 1KBJA 4BS0A 4R9XA 2Z28A 3I7SA 4RJEA 4LT9A 3LA4A 3A24A 3LX9A 2Z6JA 1QHOA 2P8CA 4RZ4A 3GHUA 3ONCA 3GXDA 1MEWA 5AVNA 1FH9A 4UMAA 5ECVA 1VEMA 3BG5A 1IF2A 1OWQA 2BXZA 1R3SA 3V16A 4LAUA 2XP3A 4NZ1A 3QVQA 2VZOA 5ENLA 3KZPA 5AB3A 4F40A 3W7LA 2PP0A 1R46A 3UPBA 3GFXA 2R24A 3CO8A 4W9TA 1UR9A 2NQHA 3OU8A 3WMBA 2Z25A 1EC7A 5G2HA 1J0JA 3RILA 4ASTA 1POJA 2DUXA 3OYZA 2OO6A 1MNZA 1EYMA 1XBYA 5D04C 2OX4A 5JMUA 4XKYA 1R6WA 3H8AA 3DGBA 3UXKA 4JKLA 1QHPA 1OFPA 3B9AA 4LUIA 3VDAA 4TR9A 3B8UA 1NARA 1Y5WA 3VD5A 4HHPA 3GH5A 3KWSA 1CXIA 3A64A 2CBJA 2ZA1A 5KETA 1G67A 3XINA 4QJ1A 3TROA 1KGXA 2ZXAA 3E1F1 3NVTA 3R0KA 5FJJA 4A6GA 1FDJA 4IQJA 1O60A 4TNSA 2BB0A 1RY8A 5HINA 4CNTA 1QOPA 3PUOA 2OTDA 3U7BA 3OZMA 5AYYA 3WG6A 2YYUA 4OE7A 3R0UA 1JD9A 4W8AA 2UV8G 4H01A 5IRPA 2OQLA 3EEZA 4N9BA 1TVPA 1TMHA 1CB2A 1X39A 1E1FA 4QQ3A 1ZENA 4UTLA 2GOUA 2QDDA 1TG7A 3FJ6A 3AROA 2WKJA 2PWHA 1A5MC 2G50A 3GIQA 4H9UA 4UTWC 4TX0A 2QJJA 3BJSA 2V2HA 3GDTA 1KQZA 4XB3A 5I24A 1FX6A 4GVFA 1QHZA 3EDJA 1YTDA 3NIYA 4DRHA 3D5HA 2BVDA 4PRWA 1AH0A 4DELA 2R1LA 3W1XA 5LNRA 4Q8MA 1X97A 4N4PA 1HL9A 3LLFA 3IVSA 1A7XA 4WKFA 1XYAA 2HBXA 3MQTA 1SFTA 2B7NA 1P4CA 4D6IA 3FGCA 1GVQA 4EF9A 1H3GA 3BOLA 4C5YA 3LN3A 4ACZB 4DJDA 3FA4A 3WCZA 4HA3A 2Y70A 3OODA 3GFYA 2FVKA 3LHYA 2XIJA 3AALA 5GJPA 1XFCA 3WNMA 3BLIA 5J6EA 1LDCA 5CEWA 2Y6ZA 3W22A 4TYOA 2ISVA 1GOQA 2PAJA 3H55A 2I14A 4Z17A 4XBJA 2FH8A 1FHDA 4FMVA 3KFTA 1AJZA 2QHAA 5FJPA 3AOFA 2VFDA 1CNVA 1OEPA 3CS2A 1XM3A 3TYBA 2FVMA 1HZYA 1JG9A 1XLEA 2WMKA 1UD3A 5DY2A 1DXIA 1Z89A 3ITTA 1REQB 4IPLA 1OFRA 1QMLA 2OYMA 2FJKA 4ATWA 1QOXA 2E8ZA 4V1XA 3S5OA 3VCRA 3NEVA 4L65A 2QEZA 1HL8A 2XH0A 3N4EA 4UCFA 1PX8A 4DWSA 1B3ZA 4Q4QA 4D6JA 4K37A 3MHGA 4DJFD 2BOFX 2QKFA 5HWJA 3UETA 3ARPA 5BRQA 2E6FA 4H8VA 1O94A 3T8LA 1B4KA 3W1LA 2J7DA 4KRZA 2P3ZA 3ZJ7A 2Z1BA 1PL9A 1G9HA 4GQGA 2G41A 2RHGA 1LRTA 3GXPA 4KEUA 4MOZA 4HVXA 1RHCA 5G2WA 3GXIA 1YADA 4DRNA 3FKRA 4XV0A 1WDPA 4NUWA 4PTDA 3DG3A 3GHTA 4PUEA 1TJ2A 3QEZA 2OZTA 5I7GA 4XAFA 3T0CA 2QDEA 4U31A 1GPFA 1YPXA 2VYOA 1RXOB 3KVMA 1MZRA 4D6DA 3W71A 3MUAA 3PG9A 4WOZA 2GDVA 4MWAA 3GZ3A 3GTNA 4DAFA 3MBDA 5K9CA 1IIGA 4Y9AA 3VIFA 2Q71A 4KPLA 2VQUA 1C29A 2V0TA 1Y8BA 7REQB 3SCNA 3ITOA 4CEUC 1XFBA 2EF9A 3S2JA 3THCA 2VVSA 1R2TA 1VZWA 3IIPA 4J4KA 4OV4A 3NQAA 4LEQA 3G5EA 1UOKA 2QJGA 1Q6DA 2RQSA 1XINA 5I23A 2OPJA 5HXMA 4JDYA 2CHNA 2ZX5A 4L9ZA 1FCUA 1KCXA 2MNRA 4DJED 1ITXA 3WK0A 1ECQA 4DXXA 5J04A 2BODX 5E9AA 3PPGA 1I2QA