3RMEA

Amcase in complex with compound 5
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
total genus 131
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rmeA01
2GFTA 4U2YA 1IT0A 1UKOA 5D9MA 3B9DA 5D9OA 3UG3A 2CBIA 1NP2A 3W25A 2BVDA 4E2OA 3EMCA 1DWGM 3AHXA 3GH7A 3CHFA 3HMCA 4CUCA 3BAYA 4W89A 5ABFA 1BVNP 2CNCA 2OYKA 2ZX8A 1CZ1A 4ML4A 1M03A 1SMAA 1KGXA 1VFFA 3VNYA 1RD6A 4F8XA 5GNXA 3CZEA 4GIAA 4E4PA 4H7VA 3I3EA 3LPPA 2VZUA 2UY5A 1XD1A 4S3JA 5A8PA 4JFVA 1C93A 3RJYA 3GBEA 4UFMA 4BQ4A 3VX1A 4IUGA 1B3XA 3IAPA 3PBGA 2PWDA 2WMIA 3VDCA 1MW0A 3AQUA 3MUZ1 3VGDA 1H41A 1HVXA 5CPQA 1GJWA 4TUFA 5C70A 1EDTA 1W9UA 2ZX5A 3AI0A 1E15A 3CMJA 6TAAA 3W38A 5GNYA 1KXVA 3PZIA 3PTKA 4M80A 5F7UA 5I0DA 1E4NA 5HPOA 1QVBA 3T08A 1J0ZA 1J0HA 2O9OA 3VIJA 2WLYA 1O6IA 1JXJA 1KXHA 4PMXA 1OBAA 1EO5A 2DSUA 2EPOA 1ZBCA 3A6OA 1GUVA 3TA9A 3FAXA 4W7WA 2XSBA 1SR0A 1HXJA 5M17A 2VX6A 1XV8A 2CKRA 1QNRA 5E9AA 3TTSA 3AMDA 2WMJA 5BXPA 3L4UA 5DT7A 5JIWA 3ARQA 2WZEA 2WYSA 4PYSA 3VNZA 2WVTA 4U5KA 1E4MM 4UTFA 3VINA 2FHFA 1UHVA 3MANA 4DM1A 4CU7A 1WB0A 4UFHA 4BQ3A 3WDQA 3T0DA 3SCWA 4Z2GA 1ODUA 2Q8XA 3QHOA 3G6LA 3WH5A 4AC1X 2EBNA 3IAQA 3RIKA 3ZT6A 3RM9A 2WXDM 2C8NA 2YL5A 3WQWA 3AMCA 2VR4A 3ZQ9A 1M04A 4GZJA 2XIBA 4PEEA 4OKDA 2XIIA 2VRKA 1Q6DA 1JZ4A 1J0KA 3VD5A 3AYRA 4H2CA 4M24A 2E9MA 1XH2A 3W82A 4AD2A 4W86A 1XH0A 3ZR5A 3W29A 1UWTA 1BF2A 2X2YA 4W5UA 2GJXA 4PBGA 4YN5A 4AZ6A 3IK2A 3VILA 2VCBA 1OCQA 4CN4A 1W3JA 2F8QA 1E71M 4MDOA 3UESA 1H0GA 1UR4A 4ZE5A 1CGVA 4P8WA 5BWFA 3NDYA 5HPCA 3KWXA 5C8BB 1US3A 1W3KA 3AYSA 2WSPA 1VBRA 1EXPA 2DIJA 4HMDA 2W67A 5DF0A 4M29A 4UNIA 4B15A 2WHJA 2EPKX 1VB9A 2BV9A 2VT0A 2DSWA 4WKFA 2VTFA 1UR8A 5LA2A 4AIUA 5A8QA 3PZGA 2V5CA 2CHNA 3THDA 4EE9A 4OIFA 2QV4A 3AHZA 2YDRA 2G3MA 4LQ1A 2ZUMA 4HMCA 3GH5A 2BHUA 4EK7A 4HOZA 1MYRA 1ISXA 4JKLA 3NSXA 1JXKA 3N04A 4R27A 3KL0A 2VL4A 1W2PA 4IPNB 4PSPA 3B8SA 3CH9A 1VENA 4C7DA 1DEDA 2YBTA 4AD0A 1JG9A 2ZICA 5IFPA 1EGZA 4F79A 2TAAA 3MSGA 4RE2A 2D22A 3POHA 1XSJA 1XCWA 1WE5A 5ABHA 2J25A 4ZXLA 1HN1A 1TUXA 4HTYA 2J7EA 5E70A 5A6BD 5BROA 1MXDA 3VGHA 3ARRA 4MAVA 3BGAA 2ZXDA 2WVSA 4D6IA 3K8LA 1U33A 1QNSA 4CCCA 1V0MA 2BY0A 2EEXA 5AY7A 3PZNA 4WJXA 4GI9A 1L8NA 3NJ3A 2AOSA 2ZUWA 1GCYA 2WLZA 5CSYA 3OA5A 2ZX7A 1HF6A 3CHEA 3RJXA 4TVUA 1QHZA 1GORA 5LA1A 1EQCA 2XWEA 1LG1A 3WL0A 2D3NA 3GDBA 5FIPA 3KEHA 2QMKA 2G3NA 4PMOA 1QHOA 4PMQA 4CN6A 3GXIA 4AXNA 1RH9A 4U3AA 1GQJA 1A47A 2YDQA 1ITXA 2JEPA 3BSHA 2JFEX 1BYCA 3T09A 1W9PA 4H8HA 3BC9A 4D6DA 4QP0A 3QOMA 1W9DM 2ZOXA 2G41A 2IXVA 4NI3A 4LYRA 3CGTA 4FLQA 2YJQA 4GI6A 3OLDA 2WHMA 1C90A 3VIGA 4QLLA 3O9NA 4PUEA 2BXYA 2XGBA 5HXMA 2VC9A 2AAAA 3SURA 2GSJA 4PCSA 1GQLA 5GQBA 1LF1A 2YL6A 1TR1A 3OGSA 2DPEA 4AD1A 3MO4A 1KR0A 2VCAA 2J7GA 1PX3A 1HX0A 4EAMA 1PX8A 3IJ9A 4B3LA 4MNLA 3MS8A 3PZUA 1B3YA 2V3GA 4V28A 3A4AA 4QLJA 3WUBA 3TTYA 1BYBA 3POCA 3L4YA 2WVVB 5I6SA 3WUGA 1H1NA 2WCGA 3L4TA 1BFNA 2RGLA 1JDCA 1G1YA 1QW9A 4BZYA 3BXWA 1PZ2A 3D3AA 4C7FA 3U5UA 3WQ8A 1WDSA 3WDIA 2WVVA 2VRQA 2YIHA 3W81A 4H41A 1CWYA 1V02A 3M6DA 2XM2A 3WQ6A 2YKKA 5A2BA 3VU2A 4D6GA 1WPCA 4D6EA 4HU8A 5A95A 4HA1A 3LPOA 3MSDA 2G8ZA 2W4XA 3RDKA 2YA2A 3EDKA 1NWUA 1Q6GA 5A3HA 2ZXBA 3AS3A 2W91A 2X09A 5GNZA 4QFUA 3A4XA 2DT0A 4PMZA 1CGYA 4N42A 4Y7EA 3F5KA 4XV0A 2XHYA 2BY3A 1EQPA 4CD5A 2VJXA 2VZSA 3WF1A 1IZJA 5ABGA 1J18A 1E40A 1PPIA 3W53A 1KXTA 3N12A 4MNJA 2WAGA 3RPMA 3UG4A 3M7SA 4PMRA 5BXRA 4AW7A 1KGUA 1KQZA 2G4FA 3WNPA 2DH2A 3CZKA 5E09A 1B1YA 2PB1A 1HP4A 2WBGA 3KZSA 3WD3A 4WF7A 4KRUA 1Q6CA 1TMQA 4P8VA 3ZJ7A 1GOOA 3NUKA 2CBVA 2JF6A 3RILA 5E0CA 3PZOA 3N15A 3AHTA 4F9DA 5ABEA 1TE1A 1AQMA 3W24A 5FKYA 3UG5A 3T2QA 1JD9A 3AS0A 2QLYA 3AIWA 1E72M 1FFQA 3VD9A 2WB5A 3WD2A 2E3ZA 1RP8A 3EDFA 2Y8KA 4OOUA 3HU7A 1PX4A 2G3JA 4H8UA 2V38A 4K68A 2A3AA 3OBAA 3BAKA 1R85A 3VOCA 4PMNA 2J74A 1HJVA 3W0KA 3B9AA 1OWQA 1Y7VA 5IDIA 1X6LA 2Y2WA 4UCFA 1ZU8A 4D6FA 3FW6A 1OGSA 3CIVA 3ZOAA 2EPLX 3L2LA 1UH3A 2XFFA 3DECA 5CPSA 4D6JA 1BHGA 1CPUA 1HVQA 4BQ2A 4B9YA 4W7VA 3WDRA 3GNOA 3FY1A 1ODZA 2X05A 4CKQA 5AC4A 2ZUTA 3N9KA 1TZ7A 5A69A 2VQTA 5A8OA 2J7DA 1OGGA 2DT3A 2EQDA 1OD0A 2XGIA 3AXHA 3WDHA 4DWSD 3GBDA 1UKSA 3VD4A 2BVTA 1GQKA 3IJ8A 2VUYA 4M82A 4GPNA 4GQRA 4S3KA 2VI0A 5I5RA 4Z2JA 4JL1A 1GQIA 2XUCA 1V0NA 1CGXA 4FK9A 2PI6A 2W66A 3VVGA 3ZR6A 1QI4A 4AZGA 1BAGA 1OIMA 4FF5A 3SIMA 3CLWA 1W1PA 4JKKA 1VRXA 2WMHA 1CXLA 4WIWA 2V3EA 2DDXA 3MMWA 3MUAA 4AY1A 3FN9A 1JI2A 2BS9A 3A3HA 3CMGA 4WSJA 3WBAA 2JALA 4AD4A 1RPKA 1E4LA 2YBUA 2QMJA 3TOPA 1Q6FA 3GXDA 4GXPA 1CGUA 4WLCA 1TFVA 1JZ8A 2DQXA 2Y4SA 1QOXA 1HKKA 1O7AA 1XD0A 4M56A 4JFTA 1CXKA 2X8RA 5CLWA 4AD5A 1DWFM 3D5HA 4J28A 1PAMA 3SUWA 4AWEA 3NYDA 4Z2KA 1XSKA 2OSYA 4MB4A 2WHLA 4X0VA 3VD3A 1B9ZA 2QPSA 5AC5A 2EO7A 4W8AA 1CLXA 3PZMA 3VM7A 5TD4A 1CXIA 3K46A 2UY2A 2JF7A 4HPHA 6A3HA 4W85A 2VX7A 4PTMA 3SEPA 1OT1A 3OGVA 1M53A 1X6NA 1DTUA 4UFLA 4AYSA 2CEQA 4HA3A 2YA1A 2IXUA 1I1WA 2VX5A 2OYMA 5M03A 1E6QM 3BLKA 4X9YA 1CIUA 1NOWA 4WSKA 4U31A 4MTVA 4N0RA 3ZJKA 2VOTA 2WCSA 4DWSC 5BCAA 4FMVA 2Y24A 2ZUNA 1XCXA 4XX6A 3O6AA 4ATLA 1B30A 5CG0A 3VD7A 2VMFA 3NCOA 3O2LA 5LA0A 1QBAA 1UA7A 3WKZA 1JNEA 1FHDA 3AHVA 3AHYA 1F4HA 5D9PA 3WH8A 2GUYA 2JE8A 2Z1SA 1EHAA 1EO7A 3WDJA 4UQDA 4AD3A 3VDBA 1GOWA 1HNYA 2V3DA 3VIIA 1J12A 1LLOA 1W32A 3RM8A 1QI3A 3SCNA 4B9ZA 4XZBA 1LJYA 1UH2A 3L4ZA 1JZ3A 1QW8A 3OZOA 2XVPA 2O9TA 3WUFA 4TVDA 4CVUA 1UWSA 1V6YA 1W91A 4UZUA 3AZRA 1JZ2A 1JZ7A 3EDJA 1WDQA 5CXPA 3NIYA 5BYWA 2A3BA 2OLHA 5EBAA 3B9EA 2DSZA 4D72A 1W9VA 2ZX9A 2O92A 1JYVA 4J3UA 4CU8A 1CXEA 3QOKA 2PBOA 1VFMA 4TTUA 4P7NA 1AQHA 2WMGA 1AQ0A 3K1DA 3AOFA 5IFTA 2QF8A 2C0HA 4ZFMA 2XWDA 5I23A 4ZEPA 1ZL1A 1LL7A 4OBSA 3TTOA 3WQ4A 2OWCA 4UQAA 4PCTA 2DH3A 4TX6A 4YHGA 1H49A 3HN3A 1GOMA 1E6PA 4BA0A 4E8CA 3OG2A 4KH2A 4A4AA 2BVYA 3WFLA 5IXEA 1AMYA 3I3BA 1CGWA 3CUJA 1CYGA 3BAWA 1JNDA 1FP9A 4PTXA 4W8LA 3F5JA 1XH1A 2GDVA 3WF2A 1QI0A 2XVKA 3ARXA 2C7FA 3UEQA 4RL3A 1FP8A 4B3KA 2VVSA 2B31A 3VGGA 2J8GA 1OIFA 1M01A 1IZKA 1PEZA 1JFXA 5LYRA 2CIPA 4H8VA 5CPTA 1B0IA 2WBKA 3QGVA 2NW0A 3MU7A 5A6JA 2GK1B 1GZJA 4NRSA 1U30A 2VX4A 1KWKA 1CECA 3TTQA 3BH4A 2X0YA 1W1YA 3WH6A 1CLVA 2E9LA 5JBDA 5FOOA 4JFUA 2BNJA 2D3LA 1W1TA 4DWSB 1JF6A 5CJ5A 1UR0A 2QPUA 5CQ1A 3ZO9A 2PWHA 3S6TA 1YHTA 1UD8A 3VIPA 3A4WA 1E0VA 1UR9A 4FLSA 2YL9A 4GO9A 3GNPA 4GQQA 2E8YA 1K9DA 4P7LA 3ARWA 3DHPA 1UD3A 3WENA 4JFSA 2J62A 1QI5A 3AZTA 1PIFA 1MQQA 4UOJA 3L4XA 1XC6A 3AIQA 1UOKA 5CGTA 4EANA 3CZ8A 3WEOA 3MMUA 4E8DA 3CUFA 4U33A 4UR9A 1JFHA 3F5LA 1VBUA 5I77A 4HMEA 2J79A 1V3LA 1ISYA 1NM9A 3BAIA 4BCEA 1BQCA 3PHAA 3CBWA 4HPGA 3BMWA 4HZ8A 2WC3A 3RMEA 6CGTA 5HBFA 2CPUA 3DYPA 5I3DA 2V3FA 3WQ5A 1ISWA 3AIRA 3TP4A 2F2HA 4J3TA 5AYIA 1WP6A 1R7AA 4EKJA 2DT1A 1NWRA 4KMQA 5BXSA 2BFGA 1LG2A 1B90A 1HKIA 3SUVA 3CZLA 4CGTA 1JDDA 2MANA 4TX8A 3BMVA 7CGTA 1C8XA 1J01A 3W26A 4RE4A 1WZKA 2JIEA 1J9YA 1OM0A 4FLOA 4H04A 1FA2A 3OLEA 2VRJA 2CBJA 4AZCB 4QAWA 4QDMA 1OINA 2VURA 4W84A 3QHMA 1J0JA 4TXEA 3CTTA 1BLIA 4Z2LA 3ZT5A 4L4OA 1KBBA 2J77A 5EMYA 4B16A 1QPKA 2YLLA 5A6MA 5I78A 1L0PA 3GYCA 1UZ4A 3K4AA 3SUTA 3VX0A 3VIOA 3AXXA 1H4PA 4JCMA 3VIKA 4YPJA 3RCNA 1HJXA 2D0FA 3K8MA 4J3SA 1FH9A 5CLTA 3BLPX 3BSGA 1ZJBA 1V3JA 3KL3A 3CHCA 2BHZA 2EXOA 1E56A 3AICA 2W5FA 4PTWA 1UWQA 1TA3B 4KGLA 2J47A 1UD2A 1H11A 1E3ZA 3W4RA 1WDPA 3AISA 2XG9A 2AMGA 1VF8A 3VPLA 5D8WA 3W27A 2XPKA 2E40A 2OYLA 2BHYA 3LPFA 1W1VA 4HOWA 3AJ7A 5BXTA 7A3HA 3S2CA 2FGZA 2V5DA 3DYMA 1E1FA 2JEQA 2E0PA 1P6WA 4JKMA 1V0LA 4F66A 2A3CA 5D8ZA 2VO5A 1DHKA 3CUIA 1VIWA 4JIEA 3TONA 2ZWZA 1ZS2A 4XZWA 3WNKA 1CTNA 3EYPA 1CBGA 2WMKA 1E70M 5FL1A 3EDDA 4JAWA 4PMYA 4PSRA 1JYXA 5HOSA 1G9HA 4LYQA 5A6SA 1BG4A 4GZIA 1OSEA 1E6ZA 4AISA 8A3HA 2XFYA 2FH6A 5CGMA 1OGBA 3T0AA 2PWEA 2NT1A 2ZUVA 3SCPA 2XM1A 3KL5A 2PBGA 4IM4A 7TAAA 2PWGA 1UH4A 5A2CA 3QHNA 4A3YA 1V02E 1CXFA 4X0NA 4PRWA 1WO2A 3AFBA 4OBRA 4AMCA 1H5VA 3KE0A 3LPGA 3VMPA 2FDMA 2XSAA 3NSNA 4ZENA 5FL0A 3ZIZA 3ZSTA 1R86A 1VAHA 4Q22A 4CD6A 2J4GA 2O9PA 3AMLA 1R7OA 2J7FA 2UY4A 1ITCA 1BVZA 1UUQA 1VFOA 3A47A 4UZSA 5A8NA 1WZAA 1WDRA 2ZXQA 4CCDA 1MXGA 1W3HA 1SMDA 4KGJA 3ARUA 5BRPA 4IISA 2NSXA 1ZB5A 3WFZA 1K9TA 1G0CA 1UWUA 3ARTA 1C8YA 1Q6EA 4W88A 5ECUA 2G3IA 4URIA 2ZUUA 2E4TA 5I79A 1TVNA 1NARA 4KWUA 2XJ7A 4CU6A 5E6ZA 1EDQA 1K9FA 1E3XA 3E1F1 4UFJA 3AMKA 2WANA 3EDEA 5HNNA 3HJEA 1CXHA 2Y8VA 1GJUA 3L4VA 2PWFA 4CCEA 3APGA 3PTMA 4LGXA 1UQZA 2VNCA 1V03A 1HKJA 2VR5A 3SUSA 1AVAA 1HT6A 2CCRA 2WSKA 1C3FA 1V0KA 1E5JA 4A3HA 4LPCA 2YLAA 1XRVA 4R5EA 4UOQA 4UOZA 3PTQA 1DWHM 1VEOA 3WD4A 1KCLA 1VJSA 2YA0A 3PZVA 5I2UA 1H3GA 3WN6A 1D3CA 2CYGA 1E9LA 1GVIA 3UR8A 3OLGA 3PN8A 3OB8A 4DUWA 1E6RA 5D4YA 1UG6A 1K6AA 1C8QA 4D1JA 4PTVA 2XVNA 4FLRA 1F4AA 4D71A 1GNXA 5A2AA 1VEPA 4IPLA 3NDZA 3I3DA 4MNMA 4MB3A 5A94A 1NOFA 4MB1A 4J3VA 2F61A 5DO8A 1MQRA 3OIHA 1MFVA 3WD1A 1J11A 1JF5A 2EPNA 3VDAA 1FFRA 4F9JA 1EA9C 2OWWA 4P7RA 4AZ7A 1PIGA 3VM5A 2VZVA 2XTKA 3N17A 1ZBKA 2J7HA 4UQBA 3SCTA 3ALFA 5E6YA 3GXMA 4CD7A 4LX4A 3GNRA 1HJUA 2DGAA 3ZT7A 5FCZA 1QNOA 2WWCA 1VFUA 1S46A 1JZ6A 1V3KA 4AZIA 2W92A 1V6WA 1UD4A 3L4WA 1MW2A 1J0YA 3ARSA 2GVYA 3DHUA 3SCRA 3W37A 1BGAA 4W87A 2CERA 4HZ7A 1DWJM 2FHCA 2CBUA 2WZHA 4P7QA 3WF4A 1ZBWA 1BPLB 3WF0A 3U57A 5DMYA 1NOUA 1MQPA 5M5DA 2BXZA 5BRQA 1E0XA 2WC7A 3CZGA 1KGWA 3FHQA 1K9EA 1MWOA 3VUPA 2VCCA 3GM8A 1GONA 3N11A 2D23A 4ACZA 4WK9A 4AEFA 2WPGA 4JZ5A 3WBEA 3MUIA 3IANA 2QHAA 2WWDA 3ARPA 4PMUA 4MDPA 2OWXA 4P7OA 2D24A 1JGIA 3SCVA 3WMBA 1PZ3A 2ZE0A 2CXGA 4XUYA 5EB8A 5IHRA 2CESA 4ACZB 1WZMA 1SFSA 4U5IA 3WEZA 4PMDA 5DT5A 3WQVA 3L2MA 1UD6A 3CUHA 1B2YA 4MPKA 1FOBA 3VGBA 4QCEA 3VDHA 4NF7A 3VKKA 1W2VA 1G94A 3BAJA 3MV11 2XFRA 3THCA 2ZXAA 2WNWA 4W5ZA 2VZOA 1W3LA 5CZKA 1X1NA 1UA3A 3WD0A 1MFUA 3N13A 1KWGA 1PBGA 1C91A 3RO8A 3CUGA 5HDRA 4TTGA 1ESWA 1I75A 4Q7NA 1Z32X 4MAZA 1DWAM 4J7RA 4OJYA 4D6CA 1HJSA 3EMZA 1B31A 3N1AA 1V08A 3ALGA 4M1RA 4NSBA 3AZSA 5A1AA 2WM0A 2ZUSA 4CD4A 2D0GA 5C71A 4V2XA 3ZSSA 1E55A 2D20A 1A3HA 1UD5A 2UWFA 1G01A 1D2KA 2WKGA 1R8LA 1GPFA 1KFWA 2CKSA 1NP0A 1J10A 1XSIA 1TVPA 5I24A 2CHOA 1ISVA 3U7VA 4HP5A 3FNDA 1PJ9A 4AZBA 3WSUA 1HIZA 2XVGA 3AIVA 3LMYA 1JYNA 2ESCA 1E1EA 4ATWA 1JAEA 4TOQA 3K8KA 4ZE4A 2YDSA 1CNVA 5AYBA 3NSMA 1TCMA 1UQYA 2XVLA 4DUVA 2A3HA 4YHEA 1ZBVA 1ECEA 2PC8A 5D9NA 2E8ZA 1OB0A 1E4IA 1LL6A 2YL8A 1BYAA 2W63A 2D0HA 4HZ6A 1JAKA 4BS0A 1EDGA 1UKPA 2GJXB 4UQ9A 4OOZA 3K4DA 3AS1A 1HL8A 1UKTA 3U5YA 1E0WA 1XGZA 4CVWA 2J7CA 4JL2A 3AIUA 2D2OA 1V6VA 3U7BA 4JHOA 3GZAA 1TG7A 1H2JA 1LWJA 4J3XA 3OZPA 1XYZA 1UWRA 5JBFA 3FXYA 1WKYA 8CGTA 5A8MA 1V6XA 1OD8A 3FAWA 1BG9A 3SUUA 4HA4A 1W9XA 3MUY1 1BYDA 1JDAA 2DSKA 2BY1A 1V3HA 5E0FA 1I1XA 1UR2A 4D1IA 3WUEA 2RGMA 3T0BA 4TVCA 4AEEA 3IJ7A 3CZJA 4NRRA 3ECQA 3BCDA 2NT0A 9CGTA 1BTCA 5JH8A 3T2PA 1CDGA 2J7BA 2UY3A 4DUXA 4OZOA 3UCQA 1Q4NX 1C7TA 5A6LA 4W93A 1GOKA 1GVYA 1VEMA 5KEZA 5KZ6A 4OUEA 1J0IA 1WCGA 2ZX6A 3VGFA 1V3MA 2EJ1A 1UKQA 1E6SM 1B3ZA 3WH7A 3J7HA 4V27A 4Z2IA 2Y5EA 3VMNA 4GO8A 3M46A 2DSVA 4AIOA 4MJ2A 1ISZA 1UZ1A 2WMIB 3VGEA 4AZHA 2WC4A 2WW5A 1XHGA 2WVUA 4J3WA 3ARZA 1B3VA 1BGGA 1R87A 1FHLA 2WMFA 1GHSA 3WNNA 2WCAA 4U2ZA 2A3EA 4CN1A 4WKAA 3DC0A 1HP5A 4Z2HA 1V3IA 3WDPP 1H09A 1GOQA 2DIEA 4C7GA 1LL4A 2DT2A 1JL8A 4PN2A 1CENA 1FH7A 2EPMX 1SYTA 5ABFB 2YOCA 3VIFA 2FGLA 2OSXA 3MKKA 1GOIA 1CGTA 3VIMA 5M3WA 1NH6A 2JIWA 1B3WA 5CSUA 1QNQA 3ZMRA 2D1ZA 1E73M 3MV01 4QCFA 1EOMA 1NWTA 2GDUA 2J78A 4PUDA 3W28A 2W62A 5A6KA 4CD8A 1DP0A 2VVNA 2O9RA 4GKLA 4MNKA 4BQ5A 4GINA 5DFAA 1TA3A 3AS2A 4GZEA 3WMSA 1U2YA 1C7SA 1FH8A 2J75A 5JUVA 3RM4A 1DWIM 1US2A 3BAXA 1HL9A 1GW1A 3ZJ8A 3SCUA 1KR1A 3VMOA 4ZXOA 3AROA 1HJWA 2HISA 1BSIA 1M7XA 3PZTA 1C92A 4GI8A 4KRTA 3VIHA 3UETA 2ZIDA 3WNOA 5EFDA 2CITA 1KBKA 3CO4A 1NQ6A 2FH8A 3WNLA 2PF0A 4RE3A 1LQ0A 4MJ4A 2OSWA 3T2OA 4AZCA 1RP9A 2DEPA 3N18A 5EFFA 4UQEA 4J27A 2WHKA 4HOXA 3WELA 1KCKA 4MB5A 3AMGA 4D6HA 4UFKA 1JYWA 4U3CA 1UR1A 1GHRA 2ZWYA 1IV8A 1JD7A 4AIEA 3WMCA 3WEMA 3G6MA 3M07A 4QLKA 1UWIA 3II1A 2WKLA 3MMDA 3UERA 4NZCA 2IUZA 3OGRA 4PMVA 3EMQA 5A6AA 3WNMA 1WZLA 1UYQA 2WK2A 1EOKA 1VJZA 1EIBA 2GJRA 1V6UA 5IHSA 3DYOA 1QBBA 1KXQA 4JHZA 2E9BA 4P8UA 1CEOA 1EHNA 3EBVA 3ZJ6A 3W6MA 4LXFA 2FHBA 2WZIA 3GH4A 2X1IA 4AZ5A 3GTNA 1OT2A 1EH9A 3UR7A 1LWHA 2GJPA 3ZM8A 1WNOA 4W7UA 3AIEA 4ACYA 1ZJAA 4MADA 3F4VA 1E6NA 3JUGA 5GPRA 4JFWA 1HJQA 3OLIA 1QNPA 3VTRA 2VQUA 1JIBA 1W9BM 4L4PA 2XYLA 4DWSA 3W6LA 1E43A 3SCSA 1E6XM 1KQYA 3VO0A 3SCOA 4ATDA 4UQCA 5A6BA 3WL1A 3GXFA 3PZ9A 4JCLA 1D7FA 3AXIA 4BF7A 5DEZA 2GK1A 4DM2A 1XYFA 4M81A 3QR3A 1G5AA 4WKHA 1MW1A 3FHAA 2CETA 1E5NA 1JI1A 4W8BA 1QI2A 3CPUA 1MW3A 4M8UA 2X0HA 2HVMA 3WIJA 3ARYA 2W61A 3ARVA 1WAWA 1H0IA 5FD0A 2BY2A 3BCFA 1QHPA 1JZ5A 5JIPA 4P8XA 4HU0A 3WH9A 1MVYA 3WF3A 4UFIA 3WY1A 3PZQA 1N82A 5JBEA 3CHDA 2VZTA 2Z1KA 4LYPA 1KB3A 1YQ2A 3AIBA 1NWSA 1HKMA 3SCQA 2J8FA 4XB3A
chains in the Genus database with same CATH superfamily
1T99A 3VCCA 4JOMA 5D9MA 3B9DA 5D9OA 4QRNA 3W25A 1OK6A 2PP0A 4N02A 1DWGM 2GUUA 3GH7A 3HMCA 4CUCA 3BAYA 3LHWA 4AVNA 4F2BA 2H9AA 2AL2A 3UI5A 2C0AA 3N6QA 2F38A 1FX6A 4A05A 1SMAA 1P0NA 4G56A 3GFZA 4HD5A 1DJIA 2GQ3A 3CZEA 3E96A 4GIAA 4E4PA 1TPWA 5B7YA 2DZPA 5AHIA 3R8RA 3I6RA 5FJIA 3B0XA 4KWWA 5A8PA 3APTA 4AMAA 2VKZG 4N9CA 1IEIA 4FA3A 7PTDA 3IAPA 3VAWA 4ICCX 4QXIA 4JNZA 3HG2A 1XW8A 3BL3A 1HVXA 3KVMA 1P6BA 1H62A 5C70A 1VPXA 4XZNX 1F74A 3AI0A 1ICQA 1E15A 3W38A 4KEMA 1UP2A 1UROA 5GNYA 4DF0A 1K02A 2D2GA 4R85A 4N9BA 1TSIA 2ACQA 3DFOA 1X7IA 1T0OA 4K2SA 4IIEA 1J0HA 2O9OA 2YGYA 4JTSA 4Y9MA 1OBAA 2Y7EA 1EO5A 3BW4A 1DL3A 3FEQA 2DSUA 3QYSA 1B6CA 3W75A 3HIJA 3TA9A 1FWFC 2ITKA 1SR0A 5XINA 3NR0A 1QOQA 3W2MA 4NILA 1XV8A 4RW3A 4MY1A 2CKRA 1QNRA 1QOPA 1EKOA 3W86A 3TTSA 2BSLA 2PDMA 2PFHA 4GYKA 3N9RA 1SO5A 3ARQA 4BWLA 4PYSA 4N4QA 3FVDA 3ABZA 1UHVA 4MM1A 1FKSA 1XPGA 4BQ3A 3WDQA 4JFIA 4H9TA 1FWIC 2GYIA 3KOZA 4Z2GA 2Q8XA 3G6LA 1UP3A 3WG6A 1FHUA 2C8NA 3WQWA 3O05A 2VR4A 2NQHA 4Q33A 2ZKMX 4Q8UA 3TNOA 2XIIA 2G97A 3VD5A 1AD1A 4ENLA 2E9MA 1HL2A 2VFEA 2X42A 1XH0A 1RQEA 2X2YA 2C18A 2ZTJA 2V67A 4S1FA 2P8BA 2JKAA 2VCBA 1W3JA 4M6QA 2F8QA 2Y7FA 1E71M 1KM5A 1F3TA 5D05A 3A24A 4P8WA 1OG0A 4DBSA 3PSVA 4L6HA 2X1RA 4UTLA 3AYSA 1VBRA 5I03A 1SPQA 1WKFA 3NG3A 3U6WA 3EWBX 3IK4A 1YNPA 3G1HA 3HPFA 1UC5A 1KFEA 3HPXA 1VB9A 4H2HA 3UU0A 3H9RB 2DSWA 1WX0A 3JXVA 4ZO9A 4WKFA 3N2TA 7XIMA 5LA2A 3DFQA 3OOBA 3PZGA 5FJOA 3GXNA 1ZJHA 2QV4A 3AHZA 1K03A 4OIFA 3FAPA 3JW7A 3NA8A 1FHVA 2ZUMA 4HMCA 2DVXA 5ENLA 3SB0A 2DVUA 4LAOA 1Q8AA 1JXKA 1LDCA 5J8LA 3RR1A 5I07A 4Q6XA 3QF0A 6XIAA 3WK3A 3UNTA 3S2LA 2VEFA 2FB2A 4GVGA 4F79A 2V2DA 3QLLA 4RE2A 3FOKA 5G4WA 1LOLA 3D0CA 3TIMA 4FX6M 3N9SA 2J25A 4DZ3A 4ZXLA 3S8HA 3IVUA 2PZ0A 1TV8A 5A6BD 3KAOA 3USZA 5TBOA 2ZXDA 3NQGA 3PRAA 4EPDC 1QNSA 3DGBA 4JX4A 5AY7A 2EEXA 3UWWA 3ABRA 1UMYA 4IT6A 1L8NA 3NJ3A 3N2CA 4NNBA 3TAOA 4B2DA 2IPFA 2WLZA 5DANA 3CQKA 2OODA 5AVNA 9RUBA 3UJFA 3TMLA 1QDSA 3LENA 2PZNA 4TVUA 4IL0A 2C1GA 3LGGA 4FZIA 5HKGA 5I00A 1LG1A 5FIPA 4NZ3A 3KEHA 1A5UA 1OF8A 1XIBA 4PMQA 4WDXA 3GXIA 3E49A 1ZQ5A 1GQJA 1A47A 2JEPA 3BSHA 1MEIA 2JFEX 1BYCA 3T09A 4QZVB 4W9PA 4G2DA 1W9PA 2Q09A 4H8HA 1X1OA 4FOKA 4WEVX 5IOBA 4YU1A 4QP0A 3C2VA 3GXTA 1AH3A 3AU2A 4FLQA 3VIGA 1AW2A 4A8LA 3JZUA 1RR2A 5D2XA 3SURA 1ZLPA 3HQNA 1L6FA 4JTHA 4Q32A 4A22A 3STGA 3ITVA 5FF4A 3WJXA 1KR0A 4DT4A 1PX3A 4L3NA 4US5D 1PX8A 1XC4A 1KW1A 1K7XA 1PS9A 3IHZA 2O56A 5XIAA 3TFCA 2V3GA 4O0ZA 4IG2A 1KFKA 3MY9A 3WK1A 4AY8A 5LGZA 1V7YA 3POCA 3L4YA 3L4TA 4LAYA 4Y8EA 1W37A 4ZTYA 4L6OA 3G24A 1G1YA 2FDSA 2BOFX 4E8GA 3A12A 2ZZ2A 3P7YA 2XPBA 3W81A 2BWGA 3E6EA 4TW6A 1QCWA 1CWYA 3QM3A 4QBXA 3UVIA 5A2BA 2P1FA 4D6EA 3LA4A 4WCJA 4JEJA 3MSDA 3M5VA 4CNTA 2G8ZA 2GGGA 3GO2A 4UDMA 3QKEA 3VZXA 3A4XA 4JXCA 2WQDA 3WLIA 3PRBA 4XV0A 1FXPA 2BY3A 2POTA 4PTNA 2O7SA 2VZSA 2F23A 5A5WA 1ICPA 2CU0A 3R0UA 1PPIA 2VCDA 2CZDA 2WAGA 3RPMA 4ML9A 2ZA3A 3W76A 2PBCA 3UA3A 4AW7A 3TW6A 1KGUA 2G4FA 3WNPA 2DH2A 1XLEA 1XIFA 3HOJA 3M43A 2HEJA 4JQ3A 1Q6CA 3UGVA 5DMMA 5HW7A 5DBTA 3STPA 4MWAB 2GJLA 3B4YA 2V8ZA 4WXYA 4F2UA 1AQMA 1TPC1 4A29A 1IX5A 4HPXA 2WB5A 1Z41A 5D30A 5CPMA 2ZQVA 4OOUA 1XUZA 4H8UA 1V4YA 4K68A 4DRMA 2FB3A 4DF2A 3N4EA 2HVNA 3ZXWA 3FCPA 2TSYA 1RALA 3LCHA 3SFKA 4PA8A 4F0RA 4ZL1A 3W0KA 3LMZA 1XIEA 4DO4A 2ATMA 2KI3A 3Q2DA 2G95A 2VP8A 3GDKA 4YNGA 2PWUA 2QULA 1CPUA 1GVSA 5FJPA 3EB3A 3VFCA 3LD5A 1V8EA 3GNOA 2R82A 4PB4A 3HB9A 4UTUA 3FY1A 1ODZA 3N9KA 4NP7A 2VQTA 3NQFA 4ODQA 5EMLA 2YB1A 2EQDA 3CL8A 4WSHA 1OD0A 3AXHA 4GISA 2NQ9A 3GBDA 1UKSA 1WKEA 2SFPA 3QMRA 3O07A 4HSOA 4XVEA 3VZZA 5IDZA 1KRCC 3QGKC 3DI1A 4NZ4A 4LS0A 5U4NA 2OOFA 2FFIA 4QX4A 5E1QA 5I5RA 5FF3A 4FNSA 4LBSA 2XUCA 1N8IA 3LCWA 1V0NA 2W66A 5KINA 4MYXA 3CAVA 4FF5A 3SIMA 3GVRA 4DZIA 1W1PA 3B9OA 1VRXA 4E2DA 1CXLA 1V5XA 2V3EA 4JEQA 3O63A 3UXKA 3MMWA 3K1GA 3PUDA 2BS9A 4IQDA 1E51A 3QN3A 2JALA 4F0LA 4AD4A 1IQ8A 1RPKA 1E4LA 4L4LA 3TOPA 3GXDA 3VYLA 4HNVA 3RPTA 3P61A 1YW5A 1SO3A 1QOXA 1RVGA 3B4UA 4M56A 1FCQA 1U5JA 2Q3RA 2V81A 2WNZA 3D5HA 1ELSA 3SUWA 2VFDA 3T8QA 2OSYA 2QDGA 4MB4A 2DJXA 3VD3A 3CTLA 4EPBC 5AC5A 4RDWA 2J24A 3PTDA 2OTDA 5I3HA 3PF3A 1N8FA 1Z3NA 3PZMA 3K5XA 3KLKA 3K46A 2UY2A 1P43A 2JF7A 1FD9A 1JDEA 1H7OA 3SEPA 1OT1A 1RHCA 1XINA 2YA1A 3G2GA 2REQB 3TX9A 2QJHA 3D46A 1E6QM 4AVFA 2HQAA 1HO1A 5DBUA 4AWSA 3MKCA 3FA5A 4KEVA 1A0CA 2VENA 4M6PA 3SSZA 3VNLA 1DQWA 3DG3A 3N29A 4DWSC 3OP2A 2RDTA 4LNCA 1TTJA 2EAWA 2W0UA 3BV7A 3MI6A 4OV9A 1QBAA 3C6CA 4R3UA 3NURA 4A6GA 3WKZA 4E2BA 2YZRA 4O19A 5HQLA 1MRQA 3AHVA 2G96A 3VKAA 3CHVA 3AUJA 3LX9A 5D9PA 5CBIA 1Q2RA 4Q8OA 1GOWA 1NQKA 1HNYA 1DE5A 5CG7A 2A1YA 4JTJA 1OX4A 3UWEA 1HKWA 1LRQA 3L5MA 4ZFCA 3AWOA 4HNCA 3SCNA 3K13A 4XZBA 5HJXA 5K9CA 5HT1A 3IGHX 1AMKA 5BU9A 1VC4A 4UZUA 3TA6A 3AZRA 5AC7A 5CXPA 3I6EA 3W7CA 3S2MA 1ONRA 3B9EA 2DSZA 3EWZA 4D72A 1W9VA 3UR2A 1H51A 4CU8A 4H6KA 1CXEA 3QOKA 1GYMA 4P7NA 1SFTA 2R1KA 4HKPA 3O5MA 4PB3A 5IFTA 2FTWA 1SO6A 2F7FA 4INFA 1QZ2A 1M7JA 2XWDA 3WQ4A 1WBHA 4PCTA 3W85A 3PR9A 3HN3A 3RLUA 4BA0A 4QT3A 1L6GA 3OG2A 3GDMA 4A4AA 2NVAA 3WFLA 4BF5A 3LZ5A 2VWSA 3I3BA 1VZWA 3BANA 3T7VA 1CYGA 2BGSA 1R3TA 4PTXA 4W8LA 3F5JA 1XH1A 2GDVA 3GDRA 1O5XA 4YLWA 4B5SA 2C7FA 3UEQA 1P7TA 1ZCNA 2B31A 3R6IA 2C19A 4LEFA 1RQBA 3XISA 3QFEA 3TDBA 1IZKA 3OW1A 1RJRA 4NASA 2CIPA 4H8VA 2CC0A 5CPTA 3KS6A 3MU7A 3B0PA 4PUWA 4NRSA 1KWKA 1WXZA 1W1YA 1CLVA 4MFDA 2ICSA 4LNYA 2ZVRA 4GE8A 4U84A 3KDOA 4XK2A 3EGJA 3PULA 4IXHA 3EIPA 5CJ5A 4AAJA 2CW6A 4Y9PA 3IVSA 3S6TA 3VIPA 3W1XA 4I90A 2YL9A 1XIJA 3R58A 4GO9A 5TQLA 5LIKX 4MFEA 3G8RA 3SRFA 3CV2A 1MQQA 1KBJA 1XC6A 1UOKA 1GYLA 3PAOA 3MVTA 3WEOA 4K36A 1I0DA 1A7XA 4QNEA 2QGYA 4U33A 2DZBA 1XS2A 1V3LA 4Q3MA 2PV1A 1BQCA 4HZ8A 2WC3A 3WJWA 3RMEA 4QTGA 5HBFA 5I3DA 3WQ5A 3CGMA 3TP4A 4J3TA 5AYIA 4JN8A 2HROA 2ZRYA 1R7AA 4KMQA 1LG2A 3B97A 3CZLA 4CGTA 2E67A 3DERA 2ACSA 4TX8A 4QSFA 7CGTA 1D7JA 2ZZ1A 5DIUA 3AC0A 2CBJA 3THQA 4QAWA 1KD0A 2VURA 2REQA 2QUNA 4TXEA 3CTTA 3WQCA 2DUAA 1KBBA 2J77A 4GIRA 1VYSX 3VFLA 3BE7A 1X98A 4KWVA 3MI2A 3VNDA 1L0PA 2XP9A 4PGLA 3GYCA 1R3RA 3H24A 1UZ4A 3H23A 3SUTA 1ZTVA 5DN1A 3VX0A 5GVJA 1EP3A 4ZBCA 3MC5A 3EKZA 4KFNA 4YPJA 4IPPA 3RCNA 1H1ZA 1QPFA 5CAKA 1W5QA 3CV7A 1OC5A 4QJ3B 4IMDA 2IPGA 2MLXA 3BLPX 2E6FA 3TW7A 3PBVA 4MMWA 2W5FA 3BLDA 4PTWA 4ZQPA 2ALRA 2J47A 1UD2A 2CZFA 1XKYA 1WDPA 3IGSA 1FRBA 2OELA 2AMGA 3P3BA 2FPYA 2E40A 1W56A 4CEXC 1XXXA 2IS7A 1SW7A 3QY8A 1TWSA 3LV5A 1VFLA 5BXTA 1SJBA 2INZA 1X96A 5H1WA 1FWEC 5AHLA 5JU6A 4OT7A 1E1FA 2VEGA 2I5QA 2OVLA 4JKMA 1MEHA 3EPMA 3F4CA 1FKIA 1DYSA 2OJPA 4KFOA 4DJDD 1CTNA 2AGKA 2A4AA 4UNKA 1E70M 1DPMA 3V5FA 3NYZA 2WO5A 1JYXA 2VC6A 4GCAA 1GEHA 1OSEA 4AISA 2E1WA 2XFYA 3SCPA 2XM1A 3KL5A 4Q8NA 2PWGA 1UH4A 3T78A 2ZZ3A 3GU9A 1OFBA 4PRWA 1WO2A 4HYVA 1RLDA 1IXPA 3KE0A 3NRKA 3HM7A 2XSAA 1K8YA 3ZIZA 3WLNA 6ALDA 4FIRA 4JIHA 2P4VA 2NSOA 2J4GA 3AMLA 5J5DA 4GUIA 2DY3A 4LUSB 1EBHA 2FMOA 3MKVA 4D9PA 1LCOA 1XDMA 2BLEA 1EJ7L 2ZXQA 3F03K 3SGGA 1MXGA 1VBJA 1ZB5A 3WFZA 1G0CA 1Y65A 3GHTA 4O10A 3ARTA 3IIXA 2Q02A 3ZYZA 1K8ZA 1XLGA 2PV2A 4ZB0A 1DJYA 1TVNA 1DJQA 4KWUA 3IWPA 2QCCA 3E02A 4CU6A 4IGHA 4HTBA 5E6ZA 4GH1A 3KS5A 3W6YA 4G1KA 2WPBA 3AMKA 2ZC8A 4AX7A 1ZAIA 3NI6A 1NDZA 3G1VA 3V16A 3APGA 1EL3A 4LGXA 4M0XA 3GQYA 4RW5A 1L9WA 4GVFA 1JCNA 1LT8A 1HT6A 4CNUA 3SM0A 3QTPA 5F2GA 4V33A 1V0KA 3RX2A 4YMZA 4Z0JA 4IOTA 4CNSA 1DWHM 1OYBA 1G69A 5E5CA 4ERIA 4DBEA 4OU1A 1KCLA 3PZVA 4NNRA 3WN6A 5F4WA 4ZA0A 4YS1A 4DUWA 4KF1A 4D1JA 1C8QA 4WXZA 2WZMA 4LAZA 1GNXA 2WJEA 4IPLA 1A5SA 3B8UA 1NOFA 1AZ2A 1SJDA 1PL9A 4HSHA 3CM4A 1EWEA 1J11A 1JF5A 4LB3A 1IEQA 1J4HA 3VNMA 1KA9F 3GS6A 4PUNA 1TO3A 3LYEA 3NM1A 3A5FA 2VZVA 2J7HA 3TN3A 1R5YA 4PL1A 5G2HA 3S1WA 1NMWA 4IG2B 5E6YA 4XAPA 5G1MA 2Q71A 3B05A 3GW0A 4NNCA 5KZDA 4LX4A 3ZT7A 3YPIA 2V63A 4ILSA 5FF2A 1V3KA 3WK2A 2W92A 1V6WA 1UD4A 3L4WA 1XYCA 5F4XA 1MW2A 3W3OA 4JBRA 1J0YA 5LNVA 3DHUA 3SCRA 5CSSA 3GNXA 2CERA 4D8LA 4E3TA 1GVEA 4HZ7A 2FIQA 4S3AA 5L6UA 4DLFA 5IM51 3MP3A 4JQ1A 5E0KA 2PD9A 4S3CA 3U57A 1PB0A 5DMYA 1NOUA 4D8AA 2PRHA 3BLIA 5BRQA 4QS6A 1KGWA 4L1GA 2ISDA 1DORA 4A2RA 2H8XA 4ZVJA 3VUPA 4L80A 3R43A 1AFSA 2J9ZA 3N11A 1EX1A 4MIMA 5FJTA 4DYJA 4TW8A 4O11A 4J5NA 2ZZ5A 4AEFA 4FX7A 1A80A 3UJ2A 4ODRA 4JTUA 4PCPA 3ARPA 4RLIA 3S5YA 4HIBA 4LYKA 2IKHA 1JGIA 2KZHA 1U79A 4ACZB 1WZMA 1Z44A 1RCXB 2NQZA 1OCJA 2PDCA 1UD6A 3CUHA 3PPHA 1W5NA 3TSMA 4NF7A 4GGHA 4RE0A 3CIXA 2YXGA 3CGNA 2X16A 2V30A 2ZXAA 2VZOA 3H2CA 2RURA 1T11A 3NZGA 2WNQA 5CZKA 2P53A 3R10A 5EBUA 4C6NA 5BOEA 4O50A 2B81A 1F07A 3CUGA 4IT4A 3VE9A 4Q7NA 1ME7A 3OU8A 1HJSA 1B31A 1PCWA 3F1QA 2WKJA 3TOYA 2VFIA 1SSDA 4IMFA 3AZSA 3KOXA 4GMEA 1M65A 4GY7A 2Z27A 2D0GA 5C71A 3N73A 3WQOA 3W71A 2OX4A 1UD5A 3VOJA 1G01A 1VYRA 2AAMA 3DAQA 1R8LA 3UXDA 2FJKA 5I02A 2NLIA 2FGBA 5I24A 2CHOA 2XP3A 2YFNA 2F2KA 4MGVA 4HP5A 3FNDA 4MYAA 5D03A 3RU8X 1AZ1A 3WSUA 3CV1A 3LERA 1XLHA 3ABSA 3OIXA 3JVAA 2Y70A 4GKTA 1Q45A 2Y89A 3NVTA 3B06A 4ZE4A 2YDSA 4K7VA 2HBXA 4ZQNA 1CNVA 3KACA 1OVDA 3EEZA 2UV8G 3M7WA 2A3HA 3P84A 3N14A 4WD0A 4E2VA 2PC8A 1OB0A 1UBPC 4IIDA 5EMJA 1LL6A 2YL8A 3M0IA 4GIVA 4R34A 1JAKA 3W7HA 1I6NA 3W74A 4OOZA 3K4DA 4MF4A 3L68A 2V2CA 4O14A 3UGRA 1E0WA 4GLEA 1JVWA 2J7CA 4YL2A 1V6VA 3U7BA 4B2DD 4JHOA 2HNHA 3GAKA 2PN0A 5CC7A 2QT3A 1LWJA 3CS2A 5HAOA 3P82A 5IRPA 3MSYA 1FXQA 3N3TA 1KLYA 2ASHA 3WBWA 5FF7A 5E0FA 4DJDC 3O0FA 1DIDA 3WUEA 4A3RA 3P6LA 3LN3A 5G2WA 3IJ7A 4HCLA 4ZS6A 1XBVA 3BGJA 3T2PA 1NF7A 3D6NA 2ZQ0A 1CDGA 3QKZA 1U1JA 4WDUA 3S4TA 4K8GA 2IPJA 1XYLA 5CZSA 5KEZA 4OUEA 3V5OA 1QTWA 4RNFA 1MDRA 4MKVA 4WDWA 3ZLGA 3WH7A 4LUYA 2NX9A 1UUMA 1ZCCA 4Q4SA 3RX3A 2Y5EA 5C9ZA 3M46A 2CHRA 1J79A 3AYTA 3LSBA 3S0CA 3XINA 3ITXA 1EP2A 2Z0IA 1Q7ZA 2Z6JA 5FAJA 2C13A 3HPZA 1FCUA 1KKOA 1YTKA 2HMCA 1EQ3A 4DAFA 2WMFA 1GHSA 4U2ZA 5HWCA 4R9XA 4Z2HA 4O1AA 3FA4A 3WDPP 5G1TA 5TNVA 2FMNA 2ZRXA 2DIEA 2A21A 4DPQA 3VNIA 1LL4A 4A3QA 4IGMA 2DT2A 1BXCA 3QY7A 1CENA 3A22A 2H9AB 1SYTA 1H60A 2YOCA 1KM4A 2WM1A 2OQHA 3MKKA 1GOIA 3VIMA 1NH6A 2JIWA 2Y5JA 3V35A 1QNQA 2D1ZA 3W2LA 1E73M 1PSCA 2P10A 2KR7A 1UZHA 2GDUA 4CD8A 2O9RA 4GKLA 2NUXA 1AJ0A 4G6CA 3VOGA 4ADUA 1F3EA 5DFAA 1TA3A 3WMSA 4K8HA 4O0KA 4QAIA 3FGCB 3GU1A 3CL7A 1DWIM 1HL9A 3EZ4A 1P0DA 3SCUA 2Q6ZA 3VMOA 4I5UA 3N34A 1ZENA 4S3BA 3C2OA 2I14A 3AXMA 4J40A 1X6UA 2ZFAA 1L2QA 3VIHA 3UETA 3WNOA 1RQHA 2CITA 3OVRA 1S5NA 4RE3A 3QRHA 1LQ0A 4MJ4A 1LQAA 5CPNA 4AZCA 3N18A 5EFFA 3E2QA 4PUKA 4J27A 3LI0A 3GU2A 4TO8A 4HOXA 1KCKA 4MB5A 4IHCA 3AMGA 1JYWA 3TC5A 2FJUB 5IBXC 1PINA 1PZ1A 3WMCA 4JPGA 2ZRWA 3G6MA 1R3SA 3M07A 2EJAA 5DCBA 3OGRA 2YSWA 4PMVA 1KC7A 5A6AA 3B3DA 5I06A 2WK2A 5GPGA 1I2PA 2H90A 3DYOA 2YW4A 1I4NA 4L61A 2E9BA 4P8UA 1EHNA 3EBVA 4M1BA 3W6MA 2FHBA 3GY1A 3KZ7A 4BK9A 3W7RA 3NGJA 1OT2A 1EH9A 3UR7A 1EX5A 3ITCA 3NZRA 4ERAA 1WNOA 1J2BA 3KCEA 1NIUA 2YDAA 4IJCA 3QJAA 3ES7A 1E6NA 1HJQA 1QNPA 3VTRA 4L4PA 2XYLA 4Z1YA 4Q8WA 4TQTA 4W9QA 3SCOA 4UQCA 4UTIA 4BEUA 5TF0A 2HPMA 1R2RA 1RK5A 5DEZA 1XYFA 4Q4RA 3QR3A 1G5AA 4YCPA 1W8GA 2C3ZA 2CETA 4S3EA 1QI2A 1DOSA 2CLMA 3CPUA 2LJ4A 3H70A 3GUWA 1C9HA 1DV7A 2HVMA 4WUIA 3BG3A 4WDTA 5K9XA 3CT7A 1ME9A 1T7LA 3R5EA 4HK5A 3BCFA 4AH7A 2PUZA 3S46A 2RJHA 1DVJA 1MVYA 4UFIA 5C2XA 3QQ0A 3UBPC 3WY1A 1E9YB 1KTBA 1P0BA 4LYPA 2Z1KA 3OO2A 2HVOA 1W1ZA 1HKMA 1O68A 2DIKA 2CBIA 3KBJA 3S3GA 4MZYA 1BWKA 3EMCA 3TFXA 3M0XA 4O13A 2M1IA 1D9EA 2H3DA 3GG7A 4W89A 2CWXA 5K7JA 5ABFA 3WK0A 1PWMA 4O4WA 3FA3A 2LGOA 1M03A 1KT1A 3FIGA 4JYFA 3LNPA 1RD6A 5GNXA 4N2YA 3LPPA 3TYCA 3R2GA 4DJEA 5JH1A 1TKKA 4BI6A 4JFVA 1BTMA 5C55A 5CC3A 4PE8A 3VX1A 3RAOA 3PBGA 4IFKA 1A4LA 2HDJA 5CEWA 4IH3A 3VDCA 1MW0A 3VGDA 1H41A 3W02A 1SM9A 4AG0A 1GJWA 2QUUA 4TUFA 5LKYA 1EDTA 1W9UA 2WZTA 2ZX5A 1XUUA 3CMJA 3SW6A 4I8YA 3BJSA 4FIQA 3W1TA 1G4SA 3T08A 3S1VA 1J0ZA 2PD5A 1G67A 3KVLA 4PMXA 1Q1CA 1BQGA 3C2RA 3FEMA 1GUVA 3G0SA 4I6KA 3FAXA 3KAGA 1HXJA 5DMLA 2VX6A 1VPQA 2VGIA 1SFLA 4IP5A 4QJ4B 1B57A 2XN1A 2ZTKA 3GDTA 4GNVA 4XZLX 3PC0A 3APYA 3P80A 3AJXA 2WYSA 4Q4KA 4UR7A 2WVTA 3BDKA 4U5KA 1E4MM 4ZPTR 2FHFA 3KRZA 4CU7A 2UBPC 1NEYA 1QNVA 3QHOA 4AC1X 3TKFA 3OA3A 2QCEA 3NQMA 2YL5A 4U86A 3NL6A 4GZJA 2XIBA 4PEEA 5C9XA 5DLCA 5HWJA 1Q6DA 1J0KA 1FWAC 2CLFA 2TMDA 1TMHA 1T5AA 3W29A 1UWTA 1BF2A 3FYPA 1EYWA 3C0QA 3VILA 1BL4A 1OCQA 2XINA 3QYQA 4RUBA 4US6A 4R33A 5BWFA 3RMJA 3NDYA 4LY4A 5HPCA 1W3IA 1US3A 1W3KA 2WSPA 4XO7A 4G5DA 3T05A 1EXPA 3M5ZA 4LUTA 4REQB 3SGZA 2LLEA 3W7QA 4DYEA 1TMLA 2VT0A 3BVJA 2OEKA 2VTFA 3NAVA 3C0JA 4GYJA 5A8QA 3I6CA 2A6NA 4LSBA 2V5CA 5BZAA 1XLDA 3I6TA 2YDRA 4H7ZA 3RXZA 1XWYA 4IFRA 3GU0A 3ABXA 2BHUA 4C6JA 1W54A 5K3VA 3TYDA 1MYRA 2DW6A 4ZOAA 3H2AA 3NSXA 3N04A 4R27A 2PDQA 3KL0A 4DEFA 3NQ8A 3LEPA 5J6EA 1NY1A 3UJRA 3CH9A 3SN1A 2BDQA 3PG8A 1CI1A 3QW3A 3GIYA 1ZGDA 3TCEA 4I3GA 3POHA 4GX8A 1IXOA 1XSJA 4L9XA 4IJRA 3UP8A 1WE5A 2VD9A 3ITGA 4HTYA 1MXDA 2P76A 3HQPA 4MAVA 1UPMB 2PU1A 2A0NA 3K8LA 2MLZA 1U33A 1BF6A 4BJHA 3ENLA 4L6DA 3IJLA 3DFHA 2J6XA 4LC8A 2ZX7A 2R94A 1HF6A 5MKGB 3RJXA 1G7VA 2PDXA 1QHZA 1EQCA 2XWEA 3WL0A 3GDBA 1YPXA 3PB0A 2G3NA 3HV8A 4GCXA 4AXNA 3LOTA 1RH9A 3KM8A 1UW9A 2YDQA 3HJZA 3ES8A 1X38A 3N6JA 2OG9A 3LSCA 3EA1A 1HFBA 4Y2WA 4XVDA 4IP7A 3BC9A 1LWIA 4D6DA 3NL5A 2G41A 4LYRA 1O1HA 1JVNA 2RKXA 4TIMA 2WHMA 2CLHA 1MEWA 2KO7A 3PA7A 3O9NA 4PUEA 1XLAA 3OHMB 1AH0A 2R1LA 1ZSXA 2YL6A 2DPEA 4NJJA 1R9XA 4HQVA 3G22A 3MO4A 4C6LA 1EJUC 2J7GA 4C1KA 2G4JA 3A64A 6ENLA 5E93A 3MI3A 4XAGA 4GJ1A 4JTLA 1KV8A 4V28A 2A6LA 4UTMA 3MMTA 3NTPA 3TTYA 4AHPA 2HJPA 2WVVB 5I6SA 3WUGA 1H1NA 2WCGA 2RGLA 1JDCA 3FJ6A 3D3AA 2DUXA 3REQB 3U5UA 3WQ8A 3WDIA 2WVVA 3O1NA 4H41A 3P0XA 2G5WA 5FSDC 4I9MA 3WQ6A 3QZAA 3W1NA 4P5UA 5H2ZA 3WJZA 4AEOA 1K1DA 2NXGA 4LBRA 3EX1A 3P67A 3VNKA 3PG9A 3RDKA 2YA2A 5A3HA 1Q6GA 4Q4MA 2ZXBA 4NAEB 4XZHA 6REQA 3LHZA 5GNZA 3EEGA 3NL2A 4DXVA 4N42A 2VM8A 2XHYA 4FS9A 1EQPA 4HB7A 1VCFA 2VJXA 1IZJA 5ABGA 4PMJA 3O6YX 1EXBA 4L64A 3P8JA 1E40A 5REQA 4GABA 3UG4A 3M7SA 4PMRA 4J4KA 5BXRA 3LM3A 3UWYA 3WBYA 3CZKA 5E09A 4UMBA 1ZP4A 4ROQA 4GUHA 1NMVA 4EACA 4KRUA 4P8VA 1EUAA 1XYBA 3ZJ7A 4IX0A 3NUKA 2CBVA 3RILA 2XFWA 1PKMA 3O5OA 1FKFA 4FX8A 1DTNA 4X9SA 4F9DA 3RG6A 1UMLA 3W24A 3W7OA 1W5MA 3UG5A 3AS0A 3AIWA 5DCDA 5DY2A 3P93A 4F40A 1EUNA 3L0NA 2OZTA 2AKMA 4H01A 4EPEC 5AC6A 4P2VA 1RP8A 2NQLA 3EDFA 1FDZA 5LIWX 2V38A 1LT7A 2A3AA 2C1HA 3O5FA 4DUOA 3OBAA 3DESA 4KT2A 4ODNA 4PMNA 3VOCA 5KETA 3NVDA 2B4GA 1MNZA 2DP3A 2Y5SA 4DRJA 1OWQA 1SJAA 1Y7VA 1JRBA 2RFGA 4UCFA 1D7KA 1ZU8A 3SJ3A 4NUWA 4D6FA 2DZWA 4DQWA 3LZ3A 2XFFA 3L2LA 4WHBA 4KQZA 3M64A 3NWRA 3SJNA 1HVQA 1XBZA 3CK5A 2D73A 2ZUTA 3SECA 3FK4A 2DT3A 1FWCC 3H2FA 3TUUA 1ZJIA 1TREA 4CQBA 4QE5A 3VKJA 3TC6A 3W72A 2BVTA 4ZQCA 4XSMA 4M82A 2BOGX 1Q5MA 4GQRA 3A3XA 3DEQA 4GQGA 2WQPA 4Z2JA 2PE4A 3C86A 1GQIA 1ZCOA 2DORA 4DRSA 3ZR6A 3M47A 4GD0A 4JHMA 1BAGA 4O28A 2H8ZA 2GDQA 3T42A 4XBJA 3VA8A 1TTPA 3ZWSA 4LUTB 1YPFA 3N6HA 2DDXA 3F7JA 4C6EA 2R6OA 4H00A 3CMGA 4WSJA 3OVGA 3FV9A 3QEZA 1F8MA 4LV4A 3DGRA 1W0MA 4PBEA 1C29A 2Y4SA 1N55A 2IQDA 4O57A 2E77A 3QVQA 4JFTA 4OV4A 5CLWA 2VDGA 3CWOX 1AODA 1DWFM 3GB6A 3BICA 2X2GA 4Z2KA 4Z08A 4GHRA 5HMDA 3VOHA 3V5CA 2WHLA 2PP1A 2EO7A 1QJWA 2Y6ZA 4W8AA 1U5HA 3SI9A 4AHOA 1F40A 3I10A 3MYPA 1FKTA 3QFWA 1Y8BA 3W7IA 3W7KA 4JN7A 2CLLA 1TR9A 4PTMA 2VX7A 3LLDA 1C8VA 3OGVA 1M53A 1N2VA 8TIMA 1DTUA 2GQ8A 4ZGYA 3CLMA 3ZLFA 1XIGA 2CEQA 3QV7A 2VX5A 5M03A 4X9YA 1CIUA 1OFEA 1YXCA 3TQPA 4N7QA 1S39A 2PTZA 3LHVA 2Y24A 4O12A 2ZUNA 1XCXA 4FOJA 1MUCA 3O6AA 2XP7A 3OPSA 5CG0A 4DPPA 3VD7A 2VMFA 1PYFA 1AQFA 3NCOA 3O2LA 5D2VA 3G0UA 1QPOA 4HNTA 1CW2A 2QXWA 1E0TA 1O66A 2X1TA 3CJPA 3BOXA 2W3ZA 3FXGA 5HNUA 4NZJA 4XZMX 1EHAA 1EO7A 1JUBA 4DIPA 4I5RA 2OGYA 2VC7A 2L5HA 4AD3A 4NX5A 3VDBA 4IMCA 3KOWA 3W00A 4KQNA 4ZCWA 1LLOA 1W32A 4G7EB 3LCIA 1F61A 4Q8PA 1UH2A 3WUFA 4XIAA 3UZYA 3D47A 2ISVA 1L6WA 2X40A 1F2JA 1JZ2A 1JZ7A 4C6PA 3FDKA 2OLHA 2CLOA 2ZX9A 2O92A 3W1MA 3GNDA 3W07A 4TTUA 4X61A 4C1LA 1AQHA 2WMGA 4CNPA 1AQ0A 2ABBA 3E3HA 2XDFA 3AOFA 4QT2A 5HNTA 2EKGA 2C0HA 3NPUA 4ZFMA 3S2NA 3TTOA 1HTIA 2DH3A 1GKQA 4TX6A 3SRKA 1WDDA 1JCLA 2E09A 3M44A 4KH2A 2J9XA 2BVYA 3C52A 4WY0A 5IXEA 4ASTA 1AMYA 2F2DA 5CBBA 1XLCA 1JNDA 3HMJG 1OEPA 1QI0A 2ADAA 2INFA 4RL3A 4QG8A 4N6FA 2VC5A 3UG8A 2VVSA 3VGGA 3BQ6A 3TVAA 1OIFA 3EB4A 1PHWA 3TYZA 2E5DA 1NAL1 2CZEA 3BG9A 3MJYA 2R1MA 1XDJA 2P50A 3BPWA 1KFBA 3PWIA 1CECA 3EWDA 3TTQA 2X0YA 3WH6A 5JBDA 1FQ0A 3EPOA 1G4EA 3VCRA 4JFUA 4PODA 2BNJA 4WRHA 2D3LA 1W1TA 4DRIA 4LS2A 1UR0A 2QPUA 3ZO9A 4WGHA 5BMXA 3E9AA 4K37A 3GFYA 3GX9A 2QJNA 1M6JA 3UQNA 3CV6A 5BRBA 4FF7A 2RDXA 3MHGA 1LORA 5CGTA 4LW7A 4QSHA 4EANA 1H7NA 3G3MA 4E8DA 1NSJA 4HMEA 4CLMA 3SR7A 1BVWA 4G8TA 1ISYA 2I1OA 3BAIA 3W7LA 2C91A 2YYTA 3PHAA 4BCEA 5D32A 3B8WA 4JTGA 6CGTA 2CPUA 3DYPA 2V3FA 3AIRA 2AMXA 2XU2A 1WP6A 3T40A 4EKJA 2DT1A 1JPKA 4LAVA 2Y1HA 2C6QA 3E38A 3QV9A 2MANA 4LEQA 3BMVA 1GWJA 3DBPA 2RUCA 2XN0A 3F4DA 1EWDA 4H04A 3EX4A 2VRJA 4RNIA 4AZCB 1Q6IA 2ZQTA 2XPAA 3ZT5A 5HANA 3GIQA 3HFYA 4DBUA 1AJZA 1YE4A 1M1BA 1QMLA 1XBYA 2BOEX 3S1UA 1H4PA 4KCUA 1SVDA 4ODPA 4Q4QA 1W6TA 4FNUA 4Z42C 4PCNA 1DKWA 3TQVA 2FPTA 3HV9A 1KCXA 3R25A 3KL3A 1RJQA 1PIIA 1E56A 4L65A 1MO0A 2QCHA 4IMEA 5CPLA 4GXMA 1TA3B 2ZC1A 3H2NA 3W4RA 2HNEA 3AISA 4JR5A 2OQLA 2ZE3A 3VPLA 1SO4A 3W27A 2OYLA 1IXQA 3LPFA 2FZ9A 3AJ7A 1Z7AA 2Z29A 2QEZA 3UCCA 3IKGA 1M68A 3S2CA 2YYUA 3LCLA 1XG3A 2UZ5A 2V5DA 1XLKA 4RV3A 3W7NA 1DQUA 2PC4A 2VO5A 3ISIX 3VNJA 4DZ5A 3TONA 2ZWZA 1ZS2A 3Q67A 3WNKA 1CT5A 2B7NA 3BQ5A 1VPYA 3N4AA 5KZMA 4PMYA 1KV5A 1S1RA 1DXEA 5HOSA 4C02B 3WCZA 1TPH1 3IARA 4ZOBA 1V7AA 2KGJA 1QFEA 1OGBA 3WQPA 1POJA 2NT1A 4F48A 4CNOA 2HXUA 2OFNA 1EC9A 5AN7A 2A85A 5CZTA 1VHCA 2BBFA 4A3YA 5C7VA 2HS6A 4OBRA 4JFLA 1LBLA 4FNQA 2X7WA 1H5VA 3LPGA 3VMPA 1F76A 4ZENA 1XR2A 1R86A 3H53A 3PSWA 2CLKA 3KX6A 3C2EA 1VAHA 4Q22A 3HBLA 4CD6A 1J6PA 3O5JA 5JQ9A 1J4EA 4DRQA 4EXBA 3L9CA 3LBCA 4X22A 3TWBA 3VKDA 3L65A 1E9ZB 1UUQA 1Q13A 3PAJA 4MKSA 4M6UA 3KABA 1TZ9A 2QAPA 4LRSA 4HNNA 3DKLA 4DJFC 3G1DA 4HJWA 5A8NA 1WZAA 8XIMA 4CCDA 2PURA 2QIIA 1SMDA 4JX6A 5BRPA 1K9TA 1UWUA 2EG8A 4W88A 1LYXA 5H8UA 1ROUA 5LZLA 1DJHA 5ECUA 2G3IA 4URIA 1UP0A 2E4TA 1EJTC 2GJNA 1NARA 3TE9A 3E0FA 3UI4A 3L0KA 1EDQA 2VGBA 1YTDA 5HQMA 3E1F1 2YFOA 4UFJA 2WANA 1UIOA 4I7WA 3L4VA 2PTDA 3QPEA 5CC6A 1UQZA 2VNCA 2PDFA 2VUNA 4UMAA 3OYZA 1P4CA 3CPGA 3VDGA 1F3WA 2VR5A 3SUSA 1AVAA 1JQVA 3E2SA 4AB4A 3H4XA 2WSKA 1C3FA 1XLBA 3DZ1A 3LB0A 4LPCA 4CQAA 5I3KA 3B40A 3GG0A 2YLAA 2WJFA 3QV8A 3PTQA 2YXXA 4ADSA 1PHQA 1XIDA 4Q8MA 4GUFA 2CYGA 2RQSA 3UR8A 2RDWA 2Y61A 1F8AB 4FP1A 1K6AA 4PTVA 1SZEA 2XVNA 1L8PA 1JCTA 1F4AA 3GK0A 4ITZA 1B54A 3MTWA 1J4IA 1S5VA 5A94A 4MB1A 4PUMA 2F61A 2WSQA 1MQRA 1MFVA 3WD1A 1EZ2A 1XL9A 2EPNA 2HE5A 3KBNA 2OWWA 4W4QA 3S2JA 2XTKA 3N17A 4UQBA 5HMSA 1JJKA 1YPIA 3VZYA 1C9WA 1IWPA 2PDKA 5TAOA 1YXDA 4E4UA 3GNRA 2A7PA 3U2OA 3W1LA 1VFUA 1JZ6A 1QPNA 1UASA 3JR2A 3ARSA 1OK4A 4LVDA 2J9YA 3M41A 5T9BG 1M41A 3EWCA 2FHCA 3BURA 4Z1DA 2X0SA 3BLOA 1KFLA 1ZBWA 3C3UA 3TU9A 4RDZA 2OEMA 2BXZA 1IEXA 3CZGA 3I7RA 1FDYA 4LAXA 1MWOA 4C6DA 1Y5WA 1P5BA 1GONA 3G77A 1FKKA 3HURA 4ACZA 1UUOA 1F05A 4C91A 3M0YA 1DIOA 3NQ6A 3UZZA 4JZ5A 5F1UA 2HBVA 2WWDA 4MDPA 4Q7IA 7ENLA 4O15A 2D24A 2M2AA 1T6MA 1PZ3A 2CXGA 1VCGA 1BEUA 3GHUA 5IHRA 3TQKA 1SFJA 1SFSA 3WEZA 4PMDA 5DT5A 4Z1CA 1MI3A 1FKWA 1KM3A 3NOYA 5AHEA 4GNKB 3VDHA 1HGWA 3LHYA 3VUSA 1LBFA 5FJRA 3BAJA 3MV11 4MLJA 4PFMA 3TN5A 4KERA 3H4WA 3KADA 4OECA 4J9JA 5HWBA 3R1ZA 2CWNA 1I2QA 1X1NA 4IMGA 4DNHA 1G7UA 4C6MA 1UA3A 1MFUA 4IWWA 3GZ3A 2NQJA 1AD4A 4F0SA 4PH6A 5HDRA 3B0UX 4C5YA 2XZ9A 3RCMA 3OBKA 4JY9A 4OJYA 4LH8A 3T6CA 3EMZA 1E0UA 3NEHA 1AA1B 4M1RA 4GI4A 1DQXA 5D2TA 2ZUSA 5AYYA 2I17A 2OFJA 4UWMA 3V0TA 3BK0A 1A3HA 1LUCB 2PGRA 3VKCA 3DCPA 1PDZA 1KFWA 4U28A 2CKSA 2Q8ZA 1W3TA 1TVPA 2PGWA 3WLSA 4H6QA 1UZDA 2X30A 4BWLC 2Q3OA 3TEVA 9XIMA 2FZ8A 4NJKA 2VELA 4ERGA 3CWNA 4ZQMA 4PUJA 1JCXA 1T41A 1PWLA 1QUMA 3O5GA 2XSXA 2Q5AA 1KT0A 1E1EA 1X39A 4ATWA 4O4VA 5JXQA 1JAEA 4JD4A 3W88A 3G1RA 1FJDA 5AYBA 2TODA 3NQCA 2HPIA 4GH3A 5D9NA 3ABQA 2MNTA 4HZ6A 2XISA 4RR4A 3UW6A 4KPLA 4GOAA 3WQDA 1UJPA 2QQ6A 3FJNA 1HL8A 3U5YA 2JGYA 4B91A 3LBMA 3B04A 4TV5A 4JL2A 1UBSA 1W3NA 3GZAA 2ZRUA 2XH4A 5DY3A 2NZLA 4DO5A 1H2JA 2PTWA 4O52A 3BMBA 1KFCA 4HARA 1XYZA 1UWRA 3TYAA 4DXXA 3S5NA 4K6AA 2I56A 4C6QA 4IPXA 4B5TA 1OD8A 4ALDA 3FAWA 4PRRA 1BG9A 3GHSA 2NUWA 1W9XA 2Z00A 5I7GA 3I4KA 2DSKA 2BY1A 1OCNA 3WFAA 3T0BA 5DO2A 4AEEA 3CZJA 3RLHA 4LUSA 3KTCA 4N9EA 9CGTA 2ZZ4A 5JH8A 4OBTA 2UY3A 3MCMA 1Q4NX 5FEWA 1RVKA 1IGSA 3NDOA 4DZAA 6XIMA 1J0IA 3G1XA 1DHPA 1VLWA 4LV9A 2V2HA 1WCGA 1KRBC 3IRDA 4HGXA 1U1UA 5K9DA 2GGIA 4DELA 2ACRA 4PR4A 5G1YA 3VABA 1AK5A 4R9OA 4IICA 3J7HA 5HQEA 4Z2IA 1KLZA 4GO8A 3P5ZA 3VGEA 1Q6UA 2WW5A 1XHGA 2WVUA 2PDUA 2YCLB 1M5WA 3ARZA 3M0MA 3VC5A 4KFPA 1EP1A 5A6TC 3HTWA 2EULA 4WKAA 1HP5A 3S6DA 1V3IA 3CC1A 1VR6A 2XIMA 4FNPA 3FSUA 3CQ0A 9XIAA 1OZQA 2QV5A 3H8AA 1VKFA 3L0GA 1JL8A 2PGEA 1FH7A 2EPMX 2FGLA 2OSXA 3E0IA 3UVAA 5M3WA 5HWMA 5BW6A 3EPNA 1TRDA 2D9FA 3ZMRA 3RO6A 1NWTA 3EA3A 3W28A 1DP0A 4V1XA 1J93A 4MNKA 3HGJA 5AYZA 2VYOA 4GINA 5CSRA 4DWDA 2NV1A 1P0EA 2CLPA 5CJMA 4KCTA 2OZ0A 2Q8LA 2NXIA 4HMNA 1LROA 5JUVA 4HBOA 1KM0A 2CXEA 4F0HA 3BAXA 1W5OA 3V1PA 3ZJ8A 4NJHA 3W7PA 4QE1A 3TWAA 1V77A 3AROA 1HJWA 1H7WA 3ICJA 4IIFA 2HISA 4OUIA 4QITA 1XRSA 3UQIA 5IBXA 1ADSA 4S3GA 1C92A 4ZB5A 4GI8A 2X41A 4GVIA 3CO4A 1NQ6A 1Q8JA 4XD3A 3CH0A 1FKGA 2FZBA 1FKJA 2R1NA 3RITA 2OSWA 2DG9A 4FR6A 1H5YA 4JIRA 3I4EA 2VEKA 1X8CA 4LAMA 2YX0A 3W1UA 1IXNA 1ML1A 1IV8A 1JPMA 4L9YA 4DJFD 1Q6OA 1UC4A 3T1GA 4AUBA 4F0KA 2XH7A 1UWIA 3ORWA 3TW9A 2FYMA 2FZMA 4GZ7A 1QPLA 3GUGA 2Z1VA 2GLKA 4RDYA 1KFJA 5IHSA 1QBBA 1I2RA 2EHHA 2G50A 5FF0A 4CQDA 3OQEA 4QROA 6TIMA 5HTGA 3GTNA 3QC3A 4RJEA 2GJPA 3CUXA 1ZJAA 3F4VA 3S47A 1RUSA 4JFWA 3VC6A 1S5WA 4ZO7A 3W6LA 2BGQA 1E43A 4MVAA 3SSJA 1TV2A 5D2WA 3VO0A 4ATDA 3NEVA 1QK0A 4LU0A 3IIOA 3LNMA 2Z6IA 2HRWA 3DHDA 3O5RA 1D7FA 3AXIA 4L5ZA 4N4PA 4A35A 4BF7A 1XRFA 4M81A 4RZ6A 2ONEA 4DZ2A 2OXNA 4W8BA 1JI1A 4C6IA 1NFGA 4RZ4A 2X0HA 1GRJA 3WIJA 4KRZA 2QDEA 3ARVA 1WAWA 1H0IA 3UNDA 2AGTA 4O8AA 1J6YA 1P7TB 3OOQA 4E5TA 5JIPA 1JZ5A 4WJEA 3GKFA 2ABAA 3MPGA 4KESA 4MG4A 5FA5A 5JBEA 2B7PA 1WXYA 2OKTA 3PUGA 3IIPA 1PXGA 1GZ1A 4ZOEA 3H7VA 4QIBA 4OTKA 2FKEA 4XB3A 3M1ZA 1K7EA 5HW8A 4GC3A 4NAFB 1LOSA 3QZEA 3KP1A 3UG3A 2AKZA 1B4KA 1RPXA 3GVVA 2BVDA 2E1DA 4E2OA 1XDLA 2V5KA 4ZTXA 4V15A 3CHFA 1TPVA 1TVLA 2VEMA 1EBGA 4RPQA 1BVNP 1KM1A 2CNCA 3F2BA 3QQWA 1CZ1A 2E6DA 2VXNA 3H21A 3ITLA 3W1QA 4B4FA 2ZCGA 4YTUA 1EYEA 3PBMA 3I3EA 5G4EA 2VZUA 1OX5A 3G18A 5CZJA 2UY5A 3C3NA 4OE7A 1XD1A 4S3JA 1C93A 3CL6A 3HGOA 4GBUA 2OOGA 1XX1A 3RJYA 1W26A 3T4CA 2WMIA 4HN4A 5HJYA 3PY2A 5HA7A 4H9XA 4R88A 3T8LA 1P0KA 2C15A 1FKHA 1A4MA 2R1PA 2OR2A 1OX4B 3EWYA 3R13A 5C9RA 4R7JA 1KXVA 3RRXA 3PTKA 3LCFA 4XTDA 1GPWA 4NL1A 5I0DA 1E4NA 1FDJA 5HPOA 2WLYA 1O6IA 4HHPA 1JXJA 4ONVA 1KXHA 1EJXC 3W7EA 4RDVA 1ICSA 3RPDA 1F73A 3A6OA 1JQXA 1IWBA 3AO0A 5TIMA 4UIOA 1O1ZA 5M17A 3R94A 1B5TA 4BR1A 1QT1A 3AMDA 5I09A 2WMJA 3L4UA 5DT7A 4GVHA 3LGDA 5JIWA 2WZEA 1TX0A 5F1VA 4WQ6A 4NKCA 4DM1A 1NDYA 3NQEA 1KBLA 3WJYA 1SZFA 4DI8A 3KP0A 4QE4A 1LLZA 2HSAA 3SCWA 3BO9A 4JTIA 2EBNA 3IAQA 4XD4A 3BUVA 3ZT6A 3RM9A 1M04A 1J6OA 4D2JA 2RUDA 2V5LA 3N19B 4OKDA 3TLLA 1JPDX 1JZ4A 2Y78A 4MPQA 5EGRA 3KLLA 3CEPA 3AYRA 4M24A 3KVJA 1XH2A 4UTWC 1POKA 3ITOA 1IEWA 4W5UA 2GJXA 4YTQA 3HGRA 4PBGA 4YN5A 2PEVA 3QR0A 5AB3A 2PDYA 3IK2A 1D6OA 4MDOA 3UESA 4HA0A 2Y7DA 3DG7A 2Z26A 3TROA 3KWXA 5C8BB 3BOFA 1AG1O 2OKOA 2DIJA 1JPIA 4EAYA 5DF0A 5C9UA 3SRDA 1Y0EA 1YEYA 2WHJA 1BKFA 2EPKX 4Y6GA 5EMMA 4OQVA 3UCDA 2CZ5A 4J1OA 3ANUA 3VE7A 4H8NA 3THDA 3TCZA 1R9HA 3FKKA 3OEXA 5BXJA 3O6CA 4FHAA 3RCYA 1W5PA 1BD0A 2V6AA 5D33A 3XIMA 3GH5A 3H55A 4EK7A 2G37A 4IP4A 1EZWA 2PTYA 2IPWA 1ISXA 3LQLA 4HK6A 1H63A 3QY6A 2VL4A 4PSPA 4LANA 5HUAA 1W1B1 2A7NA 1RA0A 4AD0A 3PPCA 5EU9A 5IFPA 7TIMA 3MSGA 1G4PA 2D22A 3DBNA 2MUCA 4J3ZA 1VHNA 1XCWA 5K4XA 2NVDA 4DO6A 2PP3A 4O1EA 3FKRA 4DB7A 2WJDA 5ABHA 5LNUA 1TUXA 2PDGA 5BNKA 2J7EA 5AFDA 3SBFA 5BROA 4MSSA 1NELA 3ARRA 4PC8A 1XGDA 3BGAA 3NQ7A 3T9PA 4G50A 2OZ8A 3PS7A 3R12A 4H9YA 1S3TC 4WJXA 2E5BA 3CQIA 3KCOA 1GK8A 2AOSA 5MF5A 2ZUWA 4NXSA 4QQUA 3RYSA 5CSYA 3NQ2A 1GORA 1JR1A 3KAHA 4IQLA 4WGXA 2D3NA 3PJUA 1IR1A 4XBKA 4MWAC 2PF8A 2QMKA 1ENUA 2OZ3A 1HQTA 4PMOA 4O1BA 4LJ3A 1TWDA 4UMCA 5LIXX 2E68A 3B8IA 1SUXA 4MWAA 4U3AA 4KWOA 4WOZA 1ITXA 4XTIA 1XQKA 3PJWA 4XWUA 4ROPA 1Z42A 4NIRA 4NXKA 3B0YA 8RUCA 3TR2A 2J88A 1T40A 3B8DA 3QOMA 3UWZA 1W9DM 1JGMA 4DJFA 3LUTA 2N87A 2AWGA 3S9YA 4GI6A 1VBGA 4IIBA 2BXYA 4NVTA 2XGBA 5HXMA 1GT8A 4LFYA 2AAAA 2GSJA 2NUYA 1GQLA 3BJTA 5GQBA 1LF1A 4R53A 1U83A 2ANUA 4AXKA 1Q7MA 3OGSA 4AD1A 1IZCA 1TIWA 3GG8A 4P61A 5D2YA 3G1SA 2V9DA 2VCAA 2YCJA 1HX0A 4QG9A 1IYXA 3UQBA 1QATA 3LV6A 1FKRA 4MNLA 3MS8A 3PZUA 1B3YA 3TLQA 4DJDA 1FWTA 4HSNA 1OABA 1PE1A 4JQ2A 2RAGA 1TIMA 3M0KA 2A7RA 4EIVA 3MUXA 3GPKA 2HTMA 1ONXA 4O1CA 2PPOA 4BZYA 1G6CA 4L9ZA 4C7FA 1WDSA 1Z48A 2YIHA 4J2PA 3GC4A 2NVCA 1GKPA 4O54A 3BZGA 4JTFA 1OFDA 3RU6A 1PV8A 2J6VA 2YKKA 4D6GA 1RSCA 1SZRA 2ZA2A 3A4JA 1MSSA 4NNAA 4HA1A 1O5KA 3EDKA 4FPSA 1WBJA 3W7DA 4G2PA 2W91A 4XG1A 2X09A 5CH9A 2DZSA 2DT0A 4QS5A 1CGYA 2W6RA 4Q8QA 3SIZA 3F5KA 3S5OA 4DHGA 4DRPA 3WF1A 2PDLA 5AZ0A 4UR8A 3TJ4A 1I9CB 2QKFA 3R8GA 2ZA1A 1KXTA 3N12A 1OF6A 4MNJA 1S1PA 4GNJA 2QCDA 2QCNA 2MNRA 4BI5A 2FKPA 2PU0A 4JYEA 4O53A 4TMCA 4XD5A 1KQZA 3V7PA 1RLCL 3IIZA 2PB1A 1HP4A 3BW2A 3WD3A 1GW9A 1TMQA 3EWUA 4IQCA 2RHGA 2JF6A 5E0CA 4KCVA 1M7OA 3CUZA 2I9EA 3AHTA 4HYRA 3GXPA 5EMKA 3LHUA 3NO1A 5ABEA 3T81A 3EAUA 3P0WA 5FKYA 3T2QA 2WNNA 1FFQA 3EXTA 2INEA 4O2TA 2PTXA 3WD2A 1YBQB 2OLSA 2O4MA 2E3ZA 2Y8KA 4ZPVR 3HU7A 5GJPA 2OX1A 4LCQA 1PX4A 4EF9A 3PNUA 2VGGA 3KOFA 4ZODA 1KBIA 3GWQA 3Q58A 5FEXA 2J74A 3TTEA 3B9AA 1YX1A 2BG5A 1X7FA 5CCZA 4TV6A 4Q4OA 3CU2A 1OGSA 2Y62A 3CIVA 1V79A 1TX2A 2EPLX 2PMQA 1UH3A 5CPSA 2F4EA 2FQIA 5G2IA 1S2VA 2QUVA 2L2SA 2ODOA 1O5RA 4W7VA 4M51A 4CKQA 5AC4A 3GVGA 1H7RA 5A69A 4LAUA 4J4OA 2Z24A 4RX0A 4M6VA 4XQ6A 1EA0A 1DJGA 5D38A 3R4IA 3WDHA 4XSLA 3UT0A 3C0SA 1EPVA 1WDWA 1GQKA 2VUYA 1QAPA 2EF9A 2I5GA 2W79A 3A3WA 3U2EA 1U22A 3HG3A 1EC7A 3M0LA 1CGXA 3VVGA 4AZGA 2XP5A 3GD6A 4DRHA 3BJFA 4JX5A 3UZWA 3NL3A 3CLWA 1Q6RA 4JKKA 2F21A 1F9CA 4JIPA 3A9IA 4WIWA 1Q6HA 4BI7A 3E74A 4FAPA 3MUAA 4B5VA 3U3HA 3WMLA 3A3HA 3IJDA 4XUGA 1R9ZA 4Q7BA 2KX9A 1YDYA 1CGUA 4WLCA 1TFVA 3NPWA 1JZ8A 4X60A 2PCQA 1O7AA 3HGSA 5PTDA 1XD0A 1G4TA 1Z89A 3MO7A 4QJ1A 1CXKA 2VD8A 1ROTA 2X8RA 1XBXA 5T8GA 3KRSA 3C2FA 1R46A 4RXGA 3NFUA 4DZHA 4LOCA 1XSKA 4UTHA 3V0UA 4X0VA 1B9ZA 5FI8A 2PLKA 3K30A 4OGZA 1CXIA 2ZDRA 1J5TA 2IKGA 4RXFA 6A3HA 5F2IA 3BOLA 3H26A 3W22A 1TCOC 4G9PA 3UZ5A 1X6NA 4UFLA 4AYSA 5K4ZA 2IXUA 1D8CA 1GOXA 2OYMA 3BLKA 1XG4A 1NF0A 4B5XA 1NOWA 4WSKA 4ZZ9A 4OHQA 4HJFA 1YIXA 4N0RA 3LY0A 2XZ7A 1JNSA 2E5CA 2WCSA 1NTHA 4XX6A 3K2GA 4O0QA 4ATLA 4C6BA 1B30A 3BGGA 2R91A 3DFNA 2XIQA 1W8SA 5LA0A 2HCVA 1UA7A 4HNUA 4ZQRA 4ZSUA 4LVAA 2O55A 4GFSA 3PM6A 2ZR4A 3L5AA 3UZJA 3AHYA 1F4HA 4K1GA 3R0KA 1M9HA 3CAKA 3Q65A 3WH8A 1JRCA 3NNTA 3O15A 4UQDA 1N7KA 2HV5A 4TR9A 3VIIA 4JTAA 1FWNA 1U5VA 4NZ5A 1QI3A 2JKEA 4RZBA 4F4RA 4B9ZA 4UC5A 1BWLA 4B5WA 1LJYA 3CQJA 4C6FA 1QW8A 3DX5A 3OZOA 2O9TA 4CVUA 3STCA 1UWSA 1AJ2A 2OQYA 1XIIA 3M0JA 3NIYA 4JTEA 1L2UA 3NQBA 2JKPA 2A3BA 3NZ1A 4PL2A 3THUA 3FSTA 2Z28A 4QNWA 4ORIA 1JYVA 1VFTA 4J3UA 3LUOA 2PBOA 1VFMA 1PKYA 3O7UA 1H61A 2AL2B 3MHFA 1XI3A 4GA8A 1FAPA 4UBPC 2QF8A 4JTQA 3UD6A 1ZK6A 4ZR8A 3R7MA 2AQVA 4GJJA 5I23A 4ZEPA 3UZXA 1ZL1A 1LL7A 4OBSA 2OWCA 4UQAA 4YHGA 4JQ4A 1H49A 4AQLA 3TN4A 4Q6JA 4E8CA 5EA9A 2ALDA 4LS1A 3CUJA 4RK8A 1FP9A 1OJXA 4I9JA 5C5YA 1SR9A 2A79A<