3RMEA

Amcase in complex with compound 5
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
total genus 131
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rmeA01
3BXWA 1XH0A 3D3AA 1VIWA 1FOBA 2GJPA 2J62A 1US2A 3EBVA 4MAVA 4WSJA 4UFHA 1FHDA 3ZT7A 5FOOA 1C7SA 4AMCA 3POCA 5A6SA 4TTUA 3SCWA 2GUYA 3AICA 1MXDA 1V3IA 2QV4A 3T0AA 3WUBA 2JIEA 3KL5A 4BCEA 3ZR5A 1EXPA 2OSXA 4OOZA 1WDSA 1C8XA 2WBKA 3VIGA 1FHLA 2WXDM 3N9KA 3EYPA 2W92A 1VFOA 1Q6DA 2EO7A 3WNPA 2WZEA 3SUWA 2WMFA 1NWTA 2G3MA 2QHAA 3SIMA 2XWDA 1EHNA 1M7XA 3WH5A 4H8UA 3MO4A 1H49A 2G4FA 5DT5A 3GXMA 4UZUA 3WD3A 5BROA 2XGIA 1GJWA 4B16A 4D6HA 4XV0A 1XD0A 3PTKA 1OINA 1WZKA 1UWTA 5E0FA 2BY0A 3W6MA 2VQTA 1G1YA 2EBNA 2WMKA 2D0GA 4W7VA 4D6CA 2XM1A 2CESA 3KL0A 1V08A 1PJ9A 2WKGA 2XVNA 1HT6A 3DYPA 4PCTA 3ZSSA 4RE2A 2J7CA 2VO5A 4PMDA 3N15A 3RM4A 4CD4A 3VD9A 4H8HA 3SCNA 2PBOA 2CCRA 2OWWA 5A94A 3AXIA 3VIJA 1I1WA 5CJ5A 1NP2A 4E4PA 3O2LA 1OGBA 3MKKA 2ZXQA 4P7QA 1LL6A 2VRKA 2J8GA 2XFYA 1W3JA 3RCNA 2WK2A 3U5UA 1CXKA 3B9DA 4PMUA 4UQEA 3K8MA 1C8YA 2XYLA 3M6DA 4OBRA 2JF6A 1HKKA 1EDQA 1E5NA 1BGGA 4LQ1A 1O7AA 4WKAA 1XC6A 3VMNA 1HP5A 3E1F1 3RMEA 2ZUSA 1VFUA 3UETA 4AZ5A 5D4YA 4UOZA 3L4ZA 3CGTA 1PBGA 2W61A 2DPEA 3L2MA 4GI6A 4CN4A 1E72M 2EPLX 1JIBA 1TCMA 5IDIA 1HJSA 4MB1A 2VR5A 4MAZA 2V3GA 4BZYA 3MSGA 1MWOA 3BGAA 2X8RA 1RP8A 4P7NA 2FH8A 1V6YA 2QMJA 3BAKA 1H4PA 5JBDA 1J0KA 3GNPA 1JI2A 1Q6GA 2ZXDA 4IPLA 1EO5A 4UCFA 1BSIA 3ZO9A 4HPGA 2IXUA 4CCDA 2IUZA 1HJWA 4MNKA 1MVYA 2BY3A 3AHTA 4YHGA 1CWYA 4OBSA 2WMHA 3K4AA 1UD4A 2E9BA 3NDYA 2WCSA 1VENA 1OD0A 4H7VA 3GH7A 4UQ9A 3VDHA 1CIUA 4PBGA 2J8FA 4KGLA 5M5DA 1EOKA 1WCGA 3QHMA 1GJUA 1QI0A 4OKDA 4GINA 1J12A 1JNDA 4U2ZA 1NWSA 2XVLA 3U57A 3U7VA 4GPNA 3W6LA 3WQWA 1E3ZA 5EBAA 1E6XM 3CZGA 4CUCA 3GXDA 3ZJ7A 3LMYA 2J7EA 2J77A 3SUSA 1V03A 3MMWA 4M56A 2PWEA 1HKIA 5DEZA 1B3VA 3AZSA 1B9ZA 2WANA 3VM7A 3N1AA 2OSWA 1HL8A 3QGVA 2J7GA 1M01A 4U3CA 4GO9A 2DDXA 3AI0A 4PCSA 1L8NA 3QOMA 2X0YA 4AWEA 1A3HA 2XHYA 1V0LA 4GZEA 5E6ZA 3RJYA 3SCPA 4HA4A 3B9EA 3CBWA 2VOTA 2WMGA 4XX6A 3VD7A 4CN6A 2WPGA 2Y8KA 4PUDA 1JYXA 4ATLA 3CHDA 1UWIA 3AIUA 3W25A 2WBGA 3VIFA 1TE1A 2WW5A 4PMRA 3EDFA 3PHAA 5I5RA 2JIWA 4LPCA 1JGIA 2VRQA 3RO8A 1NH6A 2WVTA 1VBRA 3MMDA 3N04A 3DECA 5I79A 3VIHA 2BHZA 1H0IA 3M46A 1HNYA 3L4UA 4JHZA 4XUYA 3RM8A 3AIBA 3OLEA 1VB9A 1I75A 1NQ6A 4IPNB 4ATDA 3VPLA 2WC3A 1G5AA 1QPKA 4X0VA 5HXMA 1JZ3A 1GVIA 3GNOA 5GNXA 1E6ZA 1TR1A 2OYLA 3N18A 3ZOAA 2CNCA 1XYFA 3VIKA 1PZ3A 2E3ZA 1YHTA 1MQPA 2J74A 3HN3A 3K1DA 1F4AA 4JKLA 4UFLA 1E1EA 3CZ8A 3T0BA 3VIMA 1MXGA 1AMYA 3BAIA 4CGTA 3VGHA 3ZQ9A 5ABFB 1CGXA 4AD0A 2VMFA 1XSJA 4V28A 3VUPA 2FHFA 2V3FA 6A3HA 2PC8A 3CZJA 3WH9A 1E6QM 1KQYA 2WC4A 4J3XA 4NRSA 3LPGA 5I24A 1XSIA 1E73M 1KR0A 1HP4A 3UR7A 2WHKA 4CCCA 2VX6A 4J3SA 4FF5A 1GQKA 2Y5EA 1VEPA 3WQ4A 1V6UA 1WP6A 3CUGA 1ZJBA 2ZX7A 4QDMA 2CYGA 1W9DM 1K9EA 2WVVB 3UCQA 4CD7A 4AZGA 1GOWA 4AZ6A 3W26A 1H1NA 4N0RA 2WLYA 1QHOA 4URIA 4D1JA 2V38A 3MV01 3WF1A 3QR3A 4U5IA 1X1NA 1ZJAA 1JF5A 9CGTA 2VCAA 4DUXA 2CKRA 2XIIA 3VX1A 4A4AA 1UD5A 5CQ1A 3BAJA 3WKZA 4H2CA 1LJYA 4A3YA 1PIFA 3AS3A 5A6AA 5JBEA 3MUAA 4IM4A 2XIBA 3W38A 1GQJA 3T2PA 1E0VA 5BCAA 8A3HA 5A6LA 1CLXA 2PB1A 1XH2A 4JL2A 1NOUA 3EDJA 4X9YA 4AZCB 5E6YA 1U33A 2EEXA 3KWXA 5I77A 3FN9A 4HOZA 1VFMA 1ZB5A 1R7OA 2FGLA 2Y2WA 4R27A 2NSXA 1GPFA 4WKHA 4TVDA 3N12A 5ABGA 4MDOA 1UH4A 3AISA 3WMSA 3ARTA 1WAWA 3TTOA 3A4AA 1QBBA 2ZWYA 1BG4A 1GOMA 4P7RA 2GJRA 3M07A 4FLOA 1J0YA 3OGVA 1AVAA 1HJXA 1WNOA 1LF1A 1GZJA 1HIZA 4PSPA 1AQMA 1E4NA 3T08A 5M03A 4CVUA 1E4LA 3F4VA 1HF6A 1TMQA 3GXFA 1R7AA 3WNMA 4HA3A 2G41A 2VZTA 5CPSA 4U5KA 4CD8A 4MB3A 4EANA 2GK1B 5CG0A 4JFWA 2W62A 5DT7A 4AXNA 2CBVA 1KXTA 2GJXB 4FLQA 3WD4A 4JHOA 4XZBA 5IXEA 3L4VA 5A6BD 5A8MA 1PPIA 1KQZA 3VGFA 3WNKA 2YA2A 3AZRA 4GI8A 4Z2IA 2WNWA 3T0DA 1DWIM 1PX8A 4S3JA 2C0HA 3WNOA 2A3HA 4AZBA 2WWDA 1F4HA 5CGTA 4OIFA 2CHOA 3BLKA 4CVWA 3WDRA 1E1FA 1HX0A 3CO4A 5A95A 4C7GA 1MW3A 5JUVA 5FL0A 1OCQA 4PEEA 3AS2A 1JZ7A 1E71M 4Z2KA 4HZ7A 5D9NA 4GZIA 2DQXA 4DM2A 1XGZA 1D2KA 3U5YA 1XYZA 3GNRA 3AJ7A 2DT2A 1LLOA 1NM9A 1B90A 2Q8XA 5IHRA 2XFFA 1V0MA 1EDGA 1EO7A 3EDKA 2J47A 1MFUA 2PWFA 5KEZA 2J7BA 2ZE0A 1E56A 3AMCA 2X09A 2XG9A 3VGDA 2VX5A 3DC0A 3B9AA 1KB3A 1E9LA 4FLRA 4V2XA 5D8ZA 1B3ZA 3SEPA 1BGAA 1GONA 1UR1A 1EDTA 3BMWA 1TVPA 3IJ8A 1CEOA 1BHGA 1E0WA 3THCA 1CZ1A 1IZJA 2D20A 5M3WA 4TX6A 1UR0A 1L0PA 2OYMA 3EMQA 4JKKA 4QP0A 4UR9A 4D6IA 1V6VA 2VVSA 1JL8A 5D8WA 4PTVA 2O9PA 1OM0A 2V3EA 1DHKA 3K4DA 1J9YA 3AHXA 4UFKA 2O92A 1NWUA 2ZWZA 1WKYA 2J25A 5FIPA 1CECA 2XGBA 1JYNA 3HMCA 1GOQA 3AYRA 1QNQA 1YQ2A 3RM9A 3AHVA 4KRTA 4UQAA 4ZENA 2X05A 1BPLB 5A2BA 1RH9A 1QHZA 2PBGA 3AIRA 3PBGA 1VJSA 1ITCA 1C3FA 1UWQA 2YL8A 3VNYA 1UD2A 3RILA 2QLYA 7TAAA 3BLPX 1ISYA 2XSAA 1JF6A 1KCLA 4AEEA 5CSYA 2PWDA 4MJ4A 2WVUA 2FHCA 1CGYA 4W93A 4WF7A 3VO0A 1ISVA 4P8UA 3AIWA 3GYCA 2EXOA 4LGXA 3ARRA 1ODUA 1BQCA 1KWKA 2WC7A 3W82A 3AHZA 2DGAA 3AROA 3VD5A 3W27A 5A2AA 2BVTA 3CPUA 3A47A 1WZLA 2XM2A 3VTRA 2YBTA 3OBAA 1LL4A 4RE4A 2PF0A 3WELA 5F7UA 2YDRA 1HXJA 4DWSB 2UY4A 4PUEA 3WH6A 3HJEA 3CUIA 1NP0A 1A47A 2CEQA 3JUGA 1WDQA 4PMQA 3DYMA 2A3CA 2WSPA 4BQ5A 4CU6A 4K68A 1WDPA 3FY1A 3WFLA 5GNYA 4BQ4A 1KXVA 5I2UA 3PZGA 3IANA 2Y8VA 1QI2A 3TONA 3VMPA 3VGBA 4ZE4A 1W2VA 3LPFA 4J27A 3EMZA 3CMGA 3ZR6A 4NI3A 1PX3A 3WH8A 1V3HA 4F9DA 1I1XA 1HJQA 1JFHA 4WK9A 3FAWA 1J0IA 2DSUA 1WZAA 2DT3A 2YL6A 2VCBA 1J0HA 3TA9A 1R85A 1E4MM 1UH2A 2VT0A 1SMDA 1M53A 1UH3A 4UOJA 1MYRA 1OT2A 3IAPA 2W67A 2ZUVA 3WDQA 1KFWA 1CXHA 2E9MA 4UTFA 3MMUA 2WVVA 1G94A 4UFMA 4ACZA 4V27A 5CPQA 3ZIZA 3NSXA 2YLAA 2OWCA 4OUEA 1J0JA 4Q22A 5A6BA 1CYGA 5C70A 5D9PA 1J11A 3UESA 1ZBWA 1H5VA 4HU8A 2E0PA 3A4WA 1E55A 2IXVA 1UKPA 1LWHA 3AHYA 4CCEA 4JCLA 3II1A 4DWSD 1UA3A 1WB0A 4YPJA 2ZIDA 4E8CA 3PZNA 3MUIA 4NF7A 4UOQA 4U3AA 2JF7A 4AZCA 1JZ5A 2YJQA 4AD3A 1LL7A 4TVUA 3WH7A 2ESCA 3MV11 1XSKA 1QI4A 3AIVA 4CU8A 3VD3A 4WIWA 4ZXOA 1KWGA 4PTXA 1ITXA 4JFVA 1CGUA 1UR9A 4M1RA 1W9PA 3ALGA 2CETA 3KE0A 3WQ5A 4Z2GA 4XZWA 2J4GA 3GBDA 1HVXA 2J7FA 5JH8A 4UQCA 4W7UA 4UQBA 1OGGA 1Q6FA 4AD2A 3APGA 4M24A 2AAAA 3SCOA 3WF3A 5E09A 4WJXA 3AMDA 4MPKA 3ECQA 1OB0A 1KGUA 3VIIA 1GQLA 3WD1A 3FHAA 1ZU8A 1ECEA 5DFAA 2BHYA 3WF0A 1H09A 3N13A 4MDPA 2W4XA 3O9NA 1E70M 3WQ6A 4BQ2A 2NW0A 4PMYA 1E6RA 5EFFA 1VBUA 2ZXAA 3MU7A 2DSWA 3CZLA 3O6AA 3CHEA 1WE5A 4RL3A 2PI6A 1JXKA 1X6NA 1WZMA 4MADA 4CKQA 4YN5A 1E43A 1BFNA 4JL1A 1VEOA 1BTCA 4F66A 3IK2A 1FP8A 1E3XA 3MS8A 4J28A 5A8NA 3CUJA 1RP9A 1VRXA 3WN6A 1X6LA 1EHAA 3OA5A 3PZIA 5IFPA 4P8VA 2ZX9A 5C8BB 1GCYA 3WUFA 5A8PA 2BS9A 3ZJKA 3T09A 4E8DA 1GW1A 4CD6A 4HMDA 1UUQA 2DSKA 2VTFA 2QPUA 4PYSA 2DEPA 4PSRA 2WHLA 2NT0A 4DM1A 5C71A 2FHBA 3A6OA 3MANA 4F8XA 3KEHA 4ZXLA 1CGVA 5TD4A 1LG2A 2DIJA 1CXEA 3SUTA 2VZUA 2VRJA 4GI9A 1JZ4A 5LA1A 2XWEA 3SCSA 4FLSA 2WAGA 2UY3A 5HPCA 3RDKA 4W8AA 3GM8A 3D5HA 1KBKA 3WMBA 1US3A 1Y7VA 4DWSC 1R87A 1WPCA 1OIFA 1V3MA 4UFIA 4XB3A 1EOMA 3WEZA 3RIKA 4UQDA 3VVGA 4HOWA 2FGZA 3VKKA 2C7FA 3WDPP 4BQ3A 1C91A 3S2CA 1KR1A 2BXYA 2EPKX 5DMYA 1K9FA 5A6KA 2WVSA 2YA0A 1GHRA 1MFVA 4CN1A 2RGMA 3PZOA 3ZSTA 3WDHA 1MW0A 4BF7A 4TX8A 2V5CA 1W9BM 3N17A 3AYSA 2VZSA 2FDMA 4B9ZA 1C92A 1HJVA 1JDDA 1QW9A 2CBIA 3PZTA 2E40A 2WB5A 1UA7A 1Q6EA 4WSKA 2V3DA 1EQCA 1W2PA 4PTMA 4W88A 1JNEA 3BCFA 1B3XA 1BYBA 2J78A 1UR2A 2JEPA 4MB4A 1V02E 1GHSA 3W0KA 3WBEA 2OLHA 4HTYA 5LA0A 4WKFA 3OZOA 2ZXBA 1UHVA 4D1IA 1XV8A 5A69A 5JIPA 5ABHA 4AIUA 2BY2A 5BYWA 3AIEA 4HPHA 1JDCA 1QOXA 1E0XA 1H3GA 1KCKA 4J3WA 1V3LA 1J01A 4U33A 5HBFA 3PZQA 5JIWA 1JZ6A 4W89A 5I6SA 3CUFA 4D6DA 2V5DA 1JXJA 3UERA 1PAMA 4DWSA 3WMCA 5BXPA 5E70A 2O9TA 3OG2A 1D7FA 4FK9A 1H2JA 1XCXA 4D71A 3T2QA 4GKLA 2WMJA 3SURA 2XVPA 4ML4A 4W85A 3BSHA 4M80A 1QNOA 4KWUA 4AD5A 3NCOA 1UKSA 1EIBA 4PMVA 4D6FA 5BWFA 4D72A 2XPKA 2E8ZA 3AXXA 2WWCA 1VFFA 4TVCA 4F79A 3VIOA 3DHPA 4IUGA 3HU7A 5I78A 1QNSA 1UR4A 3FXYA 4R5EA 2PWHA 3PZ9A 3WEMA 3CH9A 5A3HA 5GPRA 1QHPA 1CGTA 1JAKA 5HNNA 3I3BA 5BXSA 2ZX8A 1BVNP 5BRQA 2QMKA 1K9DA 1RD6A 1DTUA 4TOQA 1UQZA 2G3NA 2BXZA 3NYDA 2JE8A 5FKYA 5HPOA 3VU2A 1H0GA 3W4RA 2XFRA 3L4XA 2BV9A 1TA3B 1E5JA 4B3KA 2BVYA 4D6JA 1JD9A 3LPOA 3VOCA 3T2OA 3NSMA 1KXHA 1PEZA 3WF2A 2O9RA 2A3EA 1UKTA 1FFRA 3ARWA 2YL9A 3VDCA 1DEDA 3DYOA 4DUVA 3AZTA 4KGJA 5EB8A 1FA2A 1FH7A 1UZ4A 1D3CA 2ZUMA 3OZPA 1FH9A 5EMYA 1W9VA 5IHSA 4EE9A 1KBBA 1DP0A 3GBEA 1V3JA 5BRPA 2J7HA 4RE3A 1E15A 2Y4SA 6TAAA 3OGRA 1UYQA 3L4TA 5KZ6A 4AD1A 3MSDA 4X0NA 2D3NA 2VVNA 3ARQA 2VX7A 3W29A 4AZIA 1CTNA 3WENA 2E9LA 4H8VA 4KRUA 3WFZA 2G8ZA 3GH5A 4PMZA 5E9AA 1SMAA 1MW1A 5A8QA 1W1YA 3FW6A 3ARUA 3G6MA 2CIPA 2VZVA 1M04A 4AIOA 5BXTA 3OIHA 1G9HA 1BG9A 1ISWA 2G3IA 3VDBA 2YDSA 5DF0A 4LXFA 1OT1A 3ZT6A 1KGWA 1BLIA 1Q6CA 2WCAA 1C90A 1HN1A 1CLVA 2Y24A 3AMGA 2D23A 4J3TA 1XH1A 1HKMA 3G6LA 2WZHA 1PIGA 3CHCA 1RPKA 1Z32X 4PRWA 1QI5A 4DUWA 4MJ2A 3QHOA 1FH8A 5DO8A 4LYPA 5A8OA 4MNLA 5FL1A 1CBGA 1NOFA 1PZ2A 3NJ3A 4ZEPA 1UD8A 5CSUA 2CPUA 3CIVA 3ZMRA 3SCQA 3K8KA 1CXFA 4NRRA 4HZ6A 1E6SM 4P8XA 2VR4A 2CBJA 1CXIA 3WL1A 3VIPA 5CLWA 3PTQA 4P7OA 5A6MA 3EDEA 2J75A 5I3DA 1NARA 1UQYA 3WSUA 3EDDA 3WEOA 1IV8A 1AQ0A 1V6XA 4C7DA 3PTMA 2D1ZA 1CENA 2VC9A 5E0CA 2YBUA 3EMCA 4B9YA 1B3WA 3ZT5A 3WDJA 2VQUA 3A4XA 3K46A 2VCCA 4HU0A 1WDRA 4J3UA 3BAYA 3BCDA 2D0FA 3IAQA 1E4IA 3CLWA 2YDQA 1B0IA 7CGTA 2OSYA 4CD5A 1GQIA 3U7BA 1J10A 3QHNA 3WBAA 4NZCA 3AS0A 1TG7A 4C7FA 3VM5A 4IISA 2DT0A 1W91A 3PZUA 1HL9A 2UY2A 3F5KA 5IFTA 4U2YA 3RPMA 1JYVA 1BAGA 2ZUTA 2ZICA 2F61A 1B1YA 1MQRA 8CGTA 2VJXA 4HMEA 1JDAA 1QW8A 4UZSA 5ABFA 2RGLA 1HJUA 2WMIB 1OIMA 3SUUA 2ZUNA 1TZ7A 1QNRA 4H04A 1ESWA 3BMVA 2AMGA 2G3JA 1E6NA 1UZ1A 2X0HA 4UFJA 3NSNA 3KZSA 1DWHM 1ZL1A 5FD0A 4GXPA 4PMOA 4PTWA 4W8LA 3VD4A 5AYBA 5I0DA 4L4PA 1WO2A 5A2CA 3BAXA 3ALFA 4NSBA 1XD1A 1V3KA 3NIYA 3B8SA 5EFDA 2HISA 4QCEA 4QLLA 5AC5A 2VUYA 3WF4A 4P7LA 3ARPA 1QI3A 3VDAA 4MNJA 1SYTA 5JBFA 2X2YA 3UG5A 3DHUA 3M7SA 2BHUA 3WUGA 5HOSA 4W8BA 2A3BA 1O6IA 2D22A 3CMJA 4QCFA 1QBAA 3GH4A 2MANA 4P8WA 3PZMA 1VF8A 4GQQA 2YKKA 4EAMA 2BNJA 1UWSA 5CGMA 4BS0A 1JZ2A 2F8QA 1W3LA 3THDA 4QAWA 1LQ0A 1OWQA 3VMOA 1ODZA 2FH6A 4MNMA 1DWJM 4JCMA 4AISA 1JI1A 3MUY1 1BVZA 1IT0A 4TXEA 4AYSA 2J7DA 4UNIA 1R86A 4H41A 2JFEX 2CXGA 1J18A 3AMLA 3WD2A 2VZOA 4OOUA 3AIQA 3SCRA 2OWXA 1N82A 3OLGA 2WCGA 3W81A 1W9UA 2WHJA 4JKMA 4HP5A 3ZJ6A 1W3KA 1XCWA 4D6EA 2XUCA 3PZVA 4QLJA 5M17A 4W87A 1GVYA 3FNDA 4TUFA 3FAXA 2GDUA 1V6WA 2ZX6A 3OLIA 1W1VA 2BY1A 2DSZA 4JIEA 4AD4A 1OSEA 3GZAA 4ZFMA 1PX4A 5CPTA 1UD3A 4W86A 2GK1A 3CUHA 3VGEA 3AXHA 1BYCA 1UR8A 3I3DA 1GNXA 2GDVA 1B3YA 2GJXA 3L2LA 2VNCA 4WLCA 1U2YA 1CNVA 2E8YA 1TUXA 3NDZA 2E4TA 3S6TA 1QVBA 1M03A 2CITA 1V0NA 3AOFA 5A1AA 1GORA 3VNZA 4W5ZA 3WQ8A 3A3HA 1UKQA 1E6PA 3WY1A 2TAAA 1C7TA 2EJ1A 2DH2A 4KMQA 1CPUA 2YA1A 5CZKA 4JFSA 3ZJ8A 2C8NA 2CHNA 1W32A 2DIEA 3BC9A 1G0CA 1TA3A 1C93A 1GOOA 1G01A 3CTTA 1OD8A 2PWGA 5D9MA 2EQDA 3UG4A 1CXLA 1SFSA 3VINA 3CZKA 4LX4A 2QPSA 1DWGM 3ARZA 5HDRA 1UD6A 4QFUA 3ARYA 1J0ZA 1S46A 3AFBA 1H41A 1V0KA 1C8QA 1UG6A 2AOSA 4EK7A 4FMVA 2ZOXA 3POHA 4KH2A 3AMKA 1JFXA 2YLLA 3WDIA 2DSVA 3GXIA 1QNPA 5LYRA 2B31A 3IJ9A 1LG1A 1ZS2A 2BVDA 1ZBCA 2Z1KA 1KXQA 4CU7A 2DT1A 1JZ8A 4AEFA 1EH9A 5ABEA 1Q4NX 4OJYA 5I23A 3GTNA 1R8LA 2JEQA 1E40A 1U30A 4LYRA 4PMXA 2XSBA 1JG9A 2DH3A 3F5LA 3TP4A 1W1TA 1BF2A 3W24A 4J3VA 4JFUA 3OGSA 4Z2JA 2VX4A 2QF8A 4B3LA 4S3KA 4J7RA 3UR8A 3K8LA 2WKLA 1BYDA 5D9OA 3WD0A 3TTYA 1EGZA 4BA0A 2O9OA 3UEQA 3AS1A 2Z1SA 4ACZB 2JALA 4ATWA 2EPOA 3NUKA 3PN8A 4JFTA 1HKJA 2WSKA 2D24A 1VJZA 1MQQA 1ZBVA 5FCZA 4AW7A 3ARSA 2CKSA 2WLZA 2GFTA 3LPPA 4Q7NA 4OZOA 2WM0A 2D2OA 4E2OA 2D0HA 3RJXA 4F9JA 1H11A 1W3HA 2D3LA 4A3HA 3WQVA 1UOKA 2XVGA 1NWRA 5CXPA 4HA1A 1LWJA 4Z2LA 1JYWA 1K6AA 1MW2A 1UKOA 3FHQA 3VGGA 4JZ5A 2GVYA 5AC4A 4HMCA 3OB8A 1DWFM 2GSJA 3BAWA 3BH4A 1FP9A 1EQPA 5AYIA 3ZM8A 3AQUA 1ZBKA 4GZJA 1W1PA 4QLKA 3QOKA 3I3EA 4AZ7A 3L4WA 4HOXA 1W9XA 3J7HA 3VILA 3W53A 1B30A 5BXRA 5LA2A 4B15A 4W7WA 3TTQA 2CERA 5AY7A 4TTGA 4HZ8A 3F5JA 6CGTA 2XTKA 4M29A 1B31A 4PMNA 1ISXA 2ZUUA 2VURA 5GNZA 1JAEA 4M81A 2VL4A 3CHFA 3SCTA 4L4OA 4ACYA 4EKJA 1GUVA 2WMIA 1XHGA 2YL5A 4MTVA 2W91A 4D6GA 3TTSA 2YIHA 4GIAA 1EA9C 4GO8A 3SCVA 3WNNA 2HVMA 5GQBA 1K9TA 3SCUA 1NOWA 1HVQA 3SUVA 3L4YA 4N42A 1XRVA 3W37A 2XVKA 1CGWA 4U31A 2UY5A 4W5UA 2EPMX 4AZHA 1BYAA 2UWFA 2W63A 4AIEA 3VX0A 3OLDA 4PN2A 3W28A 1OGSA 2CBUA 2WHMA 1FFQA 1AQHA 2X1IA 1TFVA 1P6WA 4YHEA 3TOPA 3ARVA 2F2HA 1V02A 4AY1A 1JD7A 1IZKA 4MB5A 5CLTA 3WIJA 1OBAA 2W66A 4AC1X 4Y7EA 4Z2HA 2BFGA 3UG3A 3ARXA 3BSGA 2ZUWA 5ECUA 1UWRA 1DWAM 2WZIA 2A3AA 2VI0A 5A6JA 1CDGA 2J79A 3WL0A 1VAHA 7A3HA 2WYSA 1KGXA 3WNLA 4LYQA 3N11A 1UWUA 3MUZ1 2YOCA 4JAWA 2NT1A 3WUEA 3CZEA 2OYKA 3KL3A 2W5FA 1GOKA 1ISZA 1TVNA 4GQRA 3IJ7A 1SR0A 4ZE5A 4M82A 1GOIA 2EPNA 2XJ7A 4M8UA 1B2YA 3GDBA 2ZX5A 4W84A 1VEMA
chains in the Genus database with same CATH superfamily
3A3XA 1VIWA 5T8GA 3R8GA 1EBHA 2NX3A 4LVFA 1FHDA 1P4CA 1C7SA 1XBXA 4GC4A 3POCA 2GUYA 2IQ0A 5AOUA 1KM1A 2JIEA 1CB2A 2Q71A 2R91A 4OOZA 4NZJA 4A8LA 4DAFA 3SIZA 4YXGA 3W7KA 1O66A 2W92A 1VFOA 4RXGA 3RYSA 4OWGA 1V79A 5KZDA 3C61A 2WMFA 1H7NA 2G3MA 3C5QA 1EHNA 1ECQA 1M7XA 1P1XA 4H8UA 4YTQA 1VFHA 2CW6A 2G4FA 3GXMA 3OVPA 4D6HA 1XD0A 1FDZA 5E0FA 3W6MA 1G1YA 2EBNA 2D0GA 2TODA 2OOFA 2PP0A 2J9YA 4R9OA 3TSMA 4ZMGA 4L9ZA 3T0CA 4RCXA 5HA7A 1IEXA 1UIPA 3CT7A 2PBOA 2A7RA 2OWWA 1ROTA 5DCDA 1QNVA 4TQTA 4Y6GA 2EULA 5CJ5A 3O2LA 2ZXQA 4DIPA 3NDOA 3PK7A 5DMNA 4HZMA 1ROUA 4RXFA 4XSLA 5U7SA 5LZLA 4ICNA 4H9VA 1VGAA 3W86A 3U5UA 2A21A 3ITCA 3H53A 1J4HA 5CC6A 1F6KA 4LFYA 1HQTA 1C8YA 1IXNA 3FOKA 1XLAA 4IXXA 3CL8A 4OBRA 1EGMA 5HW6A 1FHUA 4EXQA 4XZ9A 5EU9A 4AVNA 4LAXA 2Z1WA 2QDGA 1DIKA 1EF3A 4J1OA 4S38A 3S1UA 2ZA2A 4QQUA 3UETA 4UUIA 5JU6A 3L4ZA 3F4NA 4O17A 3HPFA 2W61A 4GI6A 2X1UA 4CN4A 5CC5A 3WLPA 3NZGA 4NL1A 1TCMA 5EMLA 4QE4A 3G0XA 5IDIA 1HJSA 3MSGA 2GOUA 3BGAA 3UJEA 1VBJA 1TTPA 1XLMA 4HTBA 2P50A 4J40A 3Q4DA 4L4MA 3ZWTA 3C0QA 2QMJA 3QH2A 4UMAA 4E0CA 1H4PA 3A5FA 1KA9F 4MWAE 2PP3A 2V2DA 1ME9A 1TX2A 5KITA 4XQ6A 1MO0A 1BSIA 4CCDA 3ES8A 2BY3A 3AHTA 3GIPA 4H9XA 4NAEA 1R38A 1OFAA 1I0BA 3NDYA 1TJ1A 1OFDA 1VENA 2XP4A 2Z27A 3ZLGA 4FA3A 3VDHA 1EOKA 1J4RA 2CZFA 3QHMA 5BRBA 1GJUA 1QI0A 1J12A 4GIVA 3KAIA 3BV4A 4MFEA 1O5QA 1NWSA 5FJRA 3CUZA 4DX3A 1YLVA 3LA4A 1E3ZA 2RUCA 3GHTA 1B54A 1BKHA 2V5BA 7REQB 4HJFA 3OYZA 1ZRQA 1M01A 3KRSA 2NQZA 3V1PA 2PGEA 1TV4A 4DRSA 4GZEA 4F2UA 4ODKA 1U83A 3CHVA 4JY8A 3CIWA 3SCPA 1ZHAA 1RHCA 1PB0A 4BI6A 4N4QA 2G96A 3VD7A 2WPGA 5IDZA 1OX5A 2A5HA 4PCNA 5AHNA 5C54A 2Y61A 1FWIC 1N8WA 3TE9A 3E49A 4IT1A 2HWGA 5I5RA 5HNRA 3LENA 1Q85A 1JGIA 1Y0OA 4B5UA 2WVTA 3GK0A 6PTDA 3M64A 2BHZA 3BICA 3HM7A 1VLIA 3AIBA 3OLEA 4O4VA 1FAPA 2ZRZA 6REQA 4IPNB 1SW3A 3VPLA 5HXMA 5GNXA 1FD9A 2FVLA 3QBUA 1PZ1A 1TJ2A 4HT3A 4FIQA 2J88A 3BARA 4GMEA 2OYLA 3GUWA 4TW6A 2ZZ2A 3B0PA 4YVXA 3QKEA 1YHTA 3V1HA 2J74A 3K1DA 2FZDA 1H7PA 1D8CA 4JKLA 2KZHA 1VIZA 2G95A 3T0BA 2E6DA 1EC8A 6ENLA 1PTAA 3C2EA 4LY4A 3TJLA 4CQCA 3VGHA 1OX4B 3S3GA 1OQFA 1T0OA 2VMFA 4V28A 2VEIA 3ZLHA 6A3HA 2PC8A 3MKVA 3WH9A 1E6QM 3BOLA 3DN5A 3ZWSA 4E6MA 4O8RA 1J8VA 3ELFA 2PP1A 1XSIA 3PWIA 3D47A 1HP4A 1WAUA 2NX1A 3TLLA 2WHKA 1C9DA 4PUWA 3T07A 5BMXA 1FDYA 5FESA 3S2MA 1GQKA 4ZBCA 5FJOA 4LF2A 3CUGA 4QDMA 2CYGA 4A35A 3C3UA 4LAMA 4CNTA 2WVVB 4K7YA 1H1NA 4DBDA 4XKYA 1JVNA 3MV01 4X3ZA 2DG3A 2DG9A 5F1VA 2V2HA 1ZJAA 1JF5A 3TCEA 3TYBA 3EAUA 2QAPA 3BW3A 4IIHA 3BAJA 3P81A 1Z41A 3W1XA 1S5WA 5TAOA 2NX9A 4A3YA 5A6AA 3QMRA 3R1ZA 5CAHA 1GOXA 5JBEA 1E0VA 4MY1A 2HS8A 3SDOA 4HK6A 3WBYA 4DLMA 4JL2A 4X9YA 3QQWA 2YCKX 3ABXA 1U33A 4Z17A 3KWXA 3TCZA 3GDKA 1UPMB 3FN9A 1VFMA 2Y2WA 2NSXA 4N9BA 2J66A 4DF2A 4NP7A 2GQ9A 1FKKA 5ABGA 4PTDA 4TMCA 3KM8A 2ZR6A 3AISA 2HZGA 3S1VA 1FWEC 3EB3A 3A4AA 1QBBA 3B4YA 4Y90A 1W3TA 3N4FA 4FLOA 3OGVA 1D7HA 3CYJA 1HJXA 4EP8C 1UB3A 4PSPA 4DELA 4KKXA 3MP3A 3OPSA 1JDEA 2QZRA 4YU1A 3DFOA 3GXFA 3NQ7A 4QJ1A 1UZHA 4L65A 3BSMA 1XBYA 2G41A 5I3KA 2DQWA 1VH7A 1PHWA 3TQVA 5G4WA 2E6AA 5A8GA 1V93A 4ROQA 5EMMA 4JFWA 3L23A 2W62A 3REQA 5DT7A 4EVZA 2CBVA 3H55A 1KXTA 2GJXB 4OGZA 1Y5WA 1QZ2A 2CWNA 3DERA 2NXGA 1S2WA 4MWAB 4JN7A 3PY2A 3U8GA 3N6HA 3AZRA 1ZLPA 2DVXA 4Z2IA 5H8MA 2C0HA 1FJDA 1FKFA 2Q6ZA 3OOQA 1QCWA 3Q67A 2FB2A 3VAWA 2YZRA 1CI1A 3QGKC 1HX0A 3CO4A 3P5ZA 5K4ZA 5JUVA 1O4UA 3EPNA 2XN1A 4BI5A 4PEEA 3QPYA 4AYGA 2RDTA 3PJUA 3BQ6A 4L5ZA 2BMBA 2DQXA 4DM2A 3SW6A 1XGZA 4PODA 2E77A 3GNRA 1GZ1A 1V0MA 1JRCA 2FPTA 5ECVA 5BOFA 3FJ4A 4KR0B 3NOEA 2X09A 2XG9A 1E0TA 1Q65A 3ENLA 1IXPA 4ZQRA 4R7OA 4W9TA 1K4GA 3F7JA 3B9OA 3W1LA 1E9LA 4V2XA 1X8FA 2OPJA 5D8ZA 3KLKA 2SFPA 2DUAA 3SEPA 3UXAA 3BGGA 4R9XA 3ABZA 1XP3A 3ATZA 3BMWA 3IJ8A 1A5KC 1CZ1A 4I7WA 1UR0A 3WLOA 4NJJA 3EMQA 1XLBA 4M6PA 1JCXA 4NHVA 5AHEA 1V6VA 2VVSA 1XBVA 1U1JA 4KCTA 3H7RA 4O12A 4LY8A 2CLEA 3NM3A 1NWUA 4Q8PA 2I9EA 5C7HA 1W5MA 5CH9A 3FYOA 4GUFA 4WY0F 3XISA 2X30A 3FK4A 3AHVA 3UNDA 1FWBC 2O4MA 5HANA 1QHZA 2QUVA 3LNMA 3H26A 1VJSA 3TXVA 1ITCA 3JZEA 1C3FA 5MKGB 3RILA 3BLPX 5E93A 4DPPA 3D3FA 4IQCA 2EG8A 1XQKA 4FS9A 4MGGA 5CSYA 2PWDA 5FEWA 4GK8A 3M16A 4BEQA 1MNZA 1EX1A 1E1CB 3LHZA 3GYCA 4IMGA 3SGUA 3LQLA 5E5CA 3AHZA 2DGAA 5CEWA 3VD5A 3W1NA 1HW6A 2ZRWA 2OB3A 1K8CA 2BVTA 3MSYA 2M2AA 4O1DA 5FACA 2PGRA 3CYVA 3VTRA 2YBTA 1XGEA 4RE4A 4TU1A 3WELA 2YDRA 4GX8A 4Z42C 8XIAA 1A47A 3LCIA 4MUPA 3B7XA 2I17A 5GNYA 5HINA 4X60A 2Y8VA 3DCPA 2WPBA 3VGBA 2JKPA 3LPFA 4J27A 3EMZA 1CLKA 1JJKA 4REQB 4GY7A 1V3HA 3NPWA 1I1XA 1EF2A 4ODOA 1W1B1 1RLCL 2HE8A 1HJQA 4WK9A 2F6UA 3I7QA 4AHQA 1BF6A 2DT3A 2QCMA 3VNJA 3GTXA 3GVRA 4GISA 4JYSA 1E4MM 4C1KA 1SMDA 4NJGA 4QZVB 3M0KA 2BOFX 2Z4GA 3QXBA 1CXHA 3MMUA 3DGRA 1G94A 1QO2A 3ZIZA 3L65A 1RSCA 4P2VA 4I7VA 4DBUA 5DLCA 3LCWA 4OUEA 3BLLA 4Q22A 1FWFC 1CYGA 5C70A 4Q7BA 4D2JA 5DY3A 4MWAC 3A4WA 5BU6A 3MCMA 3TW6A 5AC7A 4F0RA 4F0LA 4V15A 1XUUA 1JCMP 1WB0A 1UC4A 3MW7A 2OKTA 4E8CA 4ODLA 5T9CE 4KFOA 4UOQA 5CZJA 1PZ0A 1TCOC 1B3OA 2YJQA 4AD3A 3WH7A 2ESCA 3B8TA 4DO7A 1CX9A 4PC8A 1XSKA 1WUEA 2POTA 1O60A 3VD3A 1C9HA 4WIWA 4PTXA 3ZXWA 3IRSA 1W9PA 3HGRA 1SZEA 5T9BG 4IGNA 4CQ9A 4Z2GA 4QDPA 2X0SA 3GBDA 3ZVHB 4G7FA 4W7UA 3E0LA 4K2SA 3CO8A 4O1FA 2C6QA 2FTYA 5I3HA 4M24A 1HO4A 1VPQA 2H6RA 4K39A 1JQXA 3L7RA 3M0VA 3MWCA 4DJFD 3A5VA 1MRAA 4GH3A 1ECEA 2BHYA 3TZFA 5I02A 1GVRA 2PPGA 1TPVA 1EZWA 3MC5A 4XAKA 4PMYA 4GUJA 1E6RA 1VBUA 3T1GA 2DSWA 3CHEA 1XDMA 2BLEA 1X6NA 1QTWA 4CKQA 1E43A 4ZO9A 4A8RA 4JL1A 5K3VA 7ENLA 2YCJA 2POZA 2XFWA 3V4BA 1X1OA 4UBPC 1RP9A 3CUJA 5FI8A 2O55A 1X6LA 2BGNE 3OU8A 3OA5A 3IKDA 2VFIA 3APTA 3DFSA 1NJJA 3N3TA 5IFPA 3EWZA 3UY7A 3H21A 1DJIA 1LBMA 3THAA 4E8DA 5HATA 4CD6A 4B5NA 4HMDA 2XP7A 2GQAA 4PYSA 1FQ0A 1C29A 3KW3A 2NT0A 4AVFA 3L68A 3KEHA 3QTPA 4LV9A 4K36A 4NILA 3NG3A 4L7ZA 4N6EA 3TROA 1LG2A 1ZCOA 2DIJA 1RVKA 3I6CA 2ZZ3A 4LUSB 2VZUA 4ZR8A 4K1GA 5LA1A 1XIIA 3TEVA 3N2TA 3HZ3A 2OZ8A 3SCSA 4KWSA 4GNJA 4FLSA 2MNRA 2UY3A 1GGOA 3HV9A 2YXGA 2XGZA 4W8AA 4ADSA 3D5HA 5HAOA 5B7ZA 1R87A 3E0IA 3TR2A 2P1FA 2FQIA 3N29A 4XB3A 5HNTA 1ZP3A 3BOFA 1TPEA 3B05A 3BLDA 3IVTA 3VVGA 4EF8A 4MPQA 2G4JA 4C6NA 4X9SA 2C7FA 3WDPP 3S2CA 1BQGA 2BXYA 1VKFA 5DMYA 5AYYA 2WVSA 4L4LA 3I6TA 2YA0A 1GHRA 4KWWA 2RGMA 2IKJA 4MYXA 3URBA 4BF7A 1W9BM 3AYSA 3DG7A 3GW3A 2C79A 1EFZA 3IWPA 3W7HA 3DOPA 4YTUA 1ZGDA 1Q6EA 3UG8A 4WSKA 4EF9A 1GJPA 3LCHA 3GTHA 4RZ6A 3S2LA 3T9PA 4IMFA 4MB4A 4HTYA 4I5XA 4WKFA 4N19A 3W1TA 2J9XA 4AIUA 2BY2A 5BYWA 4HPHA 1JDCA 3EEGA 2AL2A 3FGCA 1J01A 3PWAA 3CV1A 5JIWA 1JZ6A 2DP3A 3B03A 2QNEA 1BXCA 3NZQA 1M41A 1D7FA 4C6CA 3PVFA 3H54A 3W7MA 4W85A 2V81A 4M80A 1QNOA 4KWUA 3NCOA 4PMVA 3GIQA 2XPKA 3HG5A 4ADUA 2E8ZA 1TWZA 3AXXA 2KR7A 3CC1A 2WWCA 3TAKA 4TVCA 1YW1A 2JBMA 3AWNA 3E38A 3IV8A 2VHLA 1F3XA 4FNTA 4LBUA 1CGTA 4HCDA 3RPTA 5HNNA 5BXSA 3QZEA 2ZX8A 4Q6JA 3RR1A 4UTMA 2QMKA 3HF3A 4TOQA 1UQZA 5I06A 4Q3MA 4MSPA 5HPOA 4D8ZA 3L0GA 4FSAA 4OU1A 4MFDA 3BGJA 1DIEA 3HQ1A 1N7KA 3U2OA 2BV9A 3HTWA 2YB1A 1TTIA 3COTA 4DJFA 3TW7A 2BVYA 1JD9A 3TN3A 3LPOA 3NWRA 3KOYA 4AWUA 3T2OA 3GYEA 4FX7A 1KXHA 3WF2A 1BRLA 4LWWA 1TJRA 3S1GA 4EIVA 4ICMA 1UZ4A 2H9AB 4HHLA 2DUZA 1W9VA 1Q8JA 3CV7A 3R4IA 4RE3A 1ZAIA 3MHGA 4O0ZA 3RX3A 5PTDA 1XRSA 4AD1A 1UP2A 4HHPA 4O1CA 2QJHA 4G8TA 4XZNX 1AH4A 2ZCGA 4QIUA 3U4FA 3O5KA 4U28A 4FPSA 4AZIA 4JX4A 2G8ZA 1SMAA 1MW1A 3RGCA 1XUZA 1TKKA 5BXTA 2Y78A 3FSTA 1G9HA 2E1WA 3TC6A 4QS6A 3AO0A 4C1LA 4BWLC 2CLFA 1S2TA 5LGXA 3LYEA 4G7EB 3AJXA 4Y9AA 1HKMA 3GU0A 3NQ8A 3LI0A 1PIGA 5LIUX 4C6FA 1DVJA 2PDXA 1NELA 4ONVA 4BFAA 3S5YA 4HBOA 2DV0A 1DORA 5ABTA 1TYGA 3O5GA 3GKAA 1DPMA 1J5TA 4OE7A 3NJ3A 2Q8ZA 2AGTA 4PBFA 3L21A 5C2GA 5CBBA 1YNQA 1RAKA 3SCQA 3VKJA 1CXFA 4P8XA 2CBJA 2INZA 3FYYA 1T96A 4KERA 5FF3A 3SM0A 5A6MA 3WSUA 1IZCA 5H8PA 1IV8A 1YEYA 5AZ1A 2D1ZA 2JZVA 2YBUA 3K5XA 3ZT5A 3A4XA 2VCCA 4HU0A 4JN6A 1Y0EA 3BAYA 3BCDA 4J3UA 4NZ3A 4GYFA 3IAQA 1VHNA 2YDQA 4DJED 4NKCA 2OSYA 1IGWA 3U7BA 4GACA 3QHNA 1Y5XA 3GFZA 5FA5A 3P8IA 4YVVA 3WLRA 1L9WA 5K9XA 5HMDA 1OC5A 2UY2A 3K30A 5AYXA 2O7QA 4LNCA 4FXRA 1SPQA 1ADSA 2VGIA 2VJXA 4HMEA 4JTTA 1EJVC 4UZSA 3UPBA 3QC3A 2VC6A 1HJUA 3QV6A 3S2NA 5FAGA 3W85A 3DC8A 1KTNA 4H04A 2G3JA 1E6NA 3HQNA 4MZYA 4GD0A 4JDYA 3KZSA 3G1DA 4IFKB 5KSWA 1K6WA 2OT0A 1LOSA 5A2CA 3ALFA 4NSBA 4QLLA 5AC5A 1G67A 3PUGA 1GG0A 4P7LA 4HK7A 3CQ0A 4IJBA 1SYTA 3ZS4A 3UG5A 2CZVA 3DHUA 1YYAA 3WUGA 1O6IA 2D22A 4QCFA 3G18A 3V5OA 2P8CA 3T8LA 2W0UA 4P8WA 3VFLA 4GQQA 3RN6A 2BNJA 4EPDC 4M6QA 4BS0A 3KVJA 2F8QA 4RNJA 1RZMA 1GTHA 1LQ0A 4LBRA 3QV8A 3VMOA 2EGZA 5EMKA 5F2IA 4ODMA 4JCMA 1O94A 4AISA 1XYAA 2FVKA 1HZYA 3O0KA 2YCIX 1S5MA 4TXEA 4ZTYA 3NZRA 2MUCA 4H41A 4QGCA 1J18A 2Q01A 3KCJA 3CL6A 4GA8A 3ZR4A 2PD9A 1IGSA 4UR7A 3K1GA 5J8LA 4ERAA 4LAKA 1FUYA 1K8YA 1XCWA 1W6TA 3VYLA 4QLJA 4W87A 1GVYA 1NDYA 3FNDA 2ZX6A 2BY1A 3GZAA 3EWYA 4DJDD 3T4WA 3BG3A 3N2XA 4K6AA 1PX4A 3HGOA 5CPTA 3H23A 3T0TA 2ISDA 4LAVA 4W86A 2GK1A 3EWDA 3LQGA 1QASA 4CEUC 4HU4A 3BZGA 3GG8A 1XRTA 1JUKA 4FNQA 4JTLA 1OK6A 1TUXA 4FX8A 2GSEA 2ISWA 3R0KA 1V0NA 2V5KA 1O5XA 4IFOA 5XINA 1LCOA 3TSBA 1FKHA 3MY9A 2XIMA 3E6EA 1S5VA 2C1GA 1O68A 1SR9A 4NU7A 3ZJ8A 4C6BA 1W32A 3VUSA 2DIEA 1G0CA 1Z48A 4O57A 9RUBA 4IWWA 2YCEA 3OZMA 1FWRA 1GOOA 1XF0A 3IJLA 1HO1A 3QV7A 1XLJA 3NTPA 3M0ZA 1SFSA 2BB0A 1HG3A 2Q5AA 3EX3A 4GHRA 1XW8A 1VFTA 3FJNA 5HDRA 1UD6A 3O0FA 1J0ZA 4IQLA 3AFBA 1H41A 3U4AA 2PEVA 3OHMB 4LEQA 3G1AA 1JFXA 3WDIA 5FF0A 1A4MA 1W8SA 1QNPA 5LYRA 2RAGA 3R2GA 3IJ9A 1LG1A 3V0UA 5DELA 1DJWA 6ALDA 4HD5A 2DT1A 3ITLA 1Q4NX 3KUMA 5JH2A 3C0JA 2QEZA 3PJTA 1TTQA 4U84A 4KEMA 1U30A 2OZTA 3F5LA 5LNUA 1MEWA 4J3VA 4XZMX 4JTSA 2QV5A 2C3ZA 3EX6A 3LSCA 3OGSA 4H00A 4S3KA 1Q6OA 4QR6A 3UR8A 3UXIA 2LLEA 3K8LA 5H2ZA 2WKLA 1BYDA 2HVOA 3W7IA 5D9OA 3WD0A 4UTWA 3TTYA 2O9OA 3AS1A 2JALA 2PRMA 4JIQA 1VJZA 1Q7MA 3W84A 1ZBVA 1P48A 1XM3A 1J4EA 4OFCA 4F4RA 2PDCA 1KM3A 3TYUA 4TX9A 3NZ1A 1AW2A 4OZOA 1ZCNA 4E2OA 3RJXA 4S3GA 1W3HA 4A3HA 3S0CA 1XRFA 4K8HA 3PG9A 1NWRA 3MWAA 1FXPA 2FB3A 1MW2A 3VGGA 3DG6A 1CT5A 1R6WA 3KTXA 5AC4A 4JTFA 4HMCA 4H19A 4JFLA 1MRQA 3JZUA 1QK2A 4GBDA 1EQPA 4XIMA 3G5EA 1X7IA 2VC5A 5K2ZA 3HPAA 3LB0A 2CLKA 3NQDA 4GZJA 1W1PA 4QLKA 4IIEA 3EPOA 3I3EA 4XBKA 3OJGA 1WX0A 1W9XA 3UD6A 3B4UA 3W53A 3UZZA 1NQKA 5AY7A 6CGTA 3F5JA 4M29A 3VK5A 1B31A 2D2JA 3DUGA 1ISXA 3G0UA 2VURA 3V16A 5C9XA 1TVLA 5GNZA 4TMBA 4XD4A 1JAEA 4M81A 4X63A 1XDLA 3SCTA 5D2WA 5HJYA 3O5IA 4L4OA 5E0KA 1DL3A 1WKFA 1XHGA 1A50A 5HUOA 4D6GA 2YIHA 1TPC1 3CGNA 4O8AA 2HVMA 5GQBA 1K9TA 2ZR4A 1HVQA 1OYCA 4DJDA 3DAQA 1G4PA 4Z1DA 2I5IA 2UWFA 4AIEA 1I9CB 3EPMA 3OLDA 4RUBA 2R1LA 1AQHA 4FN2A 1FBAA 2OLSA 6REQB 1FWCC 4HN4A 4C65A 1V02A 2QCGA 4I8YA 1AH3A 4IG2A 2PLJA 3WIJA 4MJZA 4O16A 4R33A 4Y7EA 4AC1X 4Z2HA 2BFGA 4GGQA 3W1UA 1EC9A 3L2IA 4QX4A 3GY1A 4FNUA 2A3AA 1J93A 3P93A 5A6JA 1AJ0A 2WNQA 2BG5A 3WL0A 2V69A 2PPOA 3HPSA 3TXZA 2GJLA 1F05A 4TV5A 2BOEX 1ML1A 2PODA 3ITYA 2OZ3A 3AU6A 4ES4A 4JAWA 2EJAA 2LPVA 3IK8A 2F23A 4NAFA 4M82A 1MUCA 4BJHA 3WLHA 4XAZA 3GDBA 5FEXA 4W84A 3D3AA 3CM4A 3EBVA 4BKNA 4O4WA 4UFHA 3NQBA 3UYIA 1O12A 1NVMA 4ZVJA 5A6SA 3QLDA 1GYLA 3SCWA 3AICA 3KWSA 1MXDA 4XKYB 1EYWA 2QV4A 3T0AA 1GZGA 3S9IA 3ZR5A 1EXPA 2OSXA 1C8XA 3VIGA 4JICA 2WXDM 3TJXA 1Q6DA 2EO7A 2RKXA 3MDUA 4ZTXA 2WZEA 3MUCA 3FS2A 1NWTA 2ZQTA 1AJZA 2QHAA 2XWDA 3KS6A 4C5YA 1Q8AA 3WH5A 3UWUA 4FNSA 1WOAA 5ENLA 2X7VA 1YNYA 3UWEA 2GL5A 4B16A 3QGAC 3ES7A 1IT7A 4Q8MA 4R0XA 2CC0A 4W7VA 2OFJA 5E9XA 2CESA 4AF0A 3UXDA 2D69A 4AB4A 3ZSSA 2J7CA 4PMDA 3PAJA 5TQLA 3RM4A 3A22A 3GS6A 1XIFA 4GVIA 1TZ9A 3C6CA 1YMYA 3EZ4A 4L9XA 1R30A 4C6JA 3PAOA 3P62A 7ODCA 2WQDA 4JFIA 1T5AA 4JX5A 4Q8QA 4E4PA 1OGBA 1AODA 4P7QA 2VRKA 3E2QA 3WFAA 3UJ2A 1SU5A 1W3JA 3QLLA 1YBQB 4BR1A 1V5XA 4UQEA 3REQB 3K8MA 2XYLA 4S3DA 3M6DA 1GVOA 5KINA 3R43A 1HKKA 4RPPA 1EDQA 2ZADA 3P82A 1BGGA 4LQ1A 4LB4A 1O7AA 3CH0A 5G2IA 4WKAA 2C15A 1XC6A 3WJWA 1HP5A 4MJMA 2OODA 4L3NA 3E1F1 3RMEA 2ZUSA 3E0VA 1A53A 5HR6A 3SN0A 3VXGA 4NIRA 1VYSX 4RNHA 3M0LA 1FX6A 4HARA 4JTEA 3T4CA 1RBOB 4KESA 1ITQA 2EPLX 2C13A 1JIBA 1TIWA 4JFKA 2HCVA 1IR2A 4O54A 3ZVIA 2ISVA 4MB1A 3W7EA 1ONEA 1U1UA 1MWOA 4EWND 4P7NA 1F8AB 3C2FA 3QW3A 4ICCX 4DF1A 3BAKA 1EYMA 3LN3A 1OHLA 2ONEA 1QO5A 3GNPA 4B5TA 1FWJC 2QXWA 4IPLA 3NM1A 3TJ4A 4B4HA 4DRPA 6XIAA 3V35A 3ZO9A 2IXUA 1HJWA 1I2NA 1JCTA 3NQFA 3UZ5A 2WMHA 2WCSA 3DDMA 3AUOA 2IQDA 5EA9A 1ADDA 4OKDA 4GINA 1PE1A 1Z69A 1JNDA 3MDYB 1S1PA 1SZRA 4GWEA 3U57A 3GR8A 4GPNA 4BF5A 4Y2WA 2YCLA 4IH3A 4AHPA 5EBAA 3CZGA 2VM8A 3SY1A 4N9DA 5C9WA 3ZJ7A 5G2HA 2J7EA 1IR1A 1V03A 3MMWA 4M56A 4H6EA 1RJQA 4ASTA 1I6NA 5EYWA 1B9ZA 3HG3A 1HL8A 1QPQA 3QGVA 2J7GA 4U3CA 5DCBA 2DDXA 1YIXA 4K3ZA 2FPYA 1IWPA 1L8NA 3QOMA 1V0LA 5G1TA 3VKBA 1J2BA 5E6ZA 4KQNA 1Q6IA 4QIBA 5DX7A 1TWWA 5GVJA 3TX9A 5JQ9A 1SJDA 1DXFA 3B9EA 1PUDA 2XU2A 2OXNA 4FR6A 4XX6A 2Z1VA 4RZ5A 3PNZA 4CN6A 2Y8KA 4PUDA 4ATLA 3CHDA 1UWIA 3AIUA 3T8QA 3W25A 4IMEA 3P14A 1EXBA 4E4UA 1T11A 4HNTA 1Q66A 3A13A 3HURA 2I16A 2AKZA 2VCDA 5LIKX 1P5BA 1BXNA 1NH6A 1VBRA 3MMDA 1WDDA 4DZ3A 3DECA 5I79A 3VIHA 1THFD 3L4UA 3MDWA 1VB9A 3GWQA 3NL6A 1NQ6A 1PINA 1G5AA 1QPKA 1XC4A 3Q37A 1GVIA 1O5KA 1TR1A 2ANUA 1SUXA 1XYFA 4Q6XA 1PZ3A 3WLQA 3HN3A 3N4AA 1F4AA 3KXQA 2PU0A 4B91A 1F76A 3VC5A 3VIMA 1MXGA 3CQIA 3ORWA 4JY9A 2A3LA 3ZQ9A 5ABFB 3PSVA 1NMWA 2FHFA 2V3FA 4B2DD 1VYPX 5D05A 1S2CA 2WC4A 4C6LA 3IUIA 1MDRA 1QFEA 1E73M 1KR0A 3PNUA 2PGFA 4FXFA 2Y5EA 4I5RA 1PKMA 4GIEA 4ML9A 4DYJA 3MO7A 1K9EA 3SJ3A 3OVRA 4CD7A 2YXXA 2OMAA 4D1JA 4URIA 1LOQA 3WF1A 1HUVA 1QRQA 5CBJA 2GYIA 3QR3A 4U5IA 4QG6A 1X1NA 1G69A 9CGTA 4I8DA 2VCAA 3GDMA 1GRJA 1F07A 4DUXA 2CKRA 4AX6A 3QSTA 3CAVA 1AG1O 3WLJA 3NQGA 2W27A 3WKZA 3P84A 3NO1A 1LJYA 4H2CA 2QUMA 3AS3A 4IM4A 1US0A 2XIBA 1GQJA 3T2PA 5BCAA 8A3HA 3W2MA 3BANA 3KTSA 4LAOA 4LEFA 1GVSA 1YKWA 3ITOA 3NXLA 2Y70A 1BTMA 2OLAA 3XINA 1AA1B 2FGLA 4ILSA 4R27A 2A7NA 4IF2A 4WKHA 3LK6A 3SJNA 3EEZA 4YCPA 1PIIA 1JR1A 4JQ3A 4KFPA 3TYDA 1UH4A 5I3FA 2OTDA 2ZWYA 1GOMA 4P7RA 4TYOA 3W01A 1JCLA 2E5CA 4WCJA 3WLIA 3QFWA 2Y6ZA 1EUAA 3GHSA 1TRIA 4CVUA 4HVXA 1E4LA 1R7AA 1TWDA 4HA3A 5EMJA 2VZTA 4XAGA 4XD5A 4U5KA 2PDQA 3NEHA 5GJMA 1FKTA 3CGMA 1KRCC 5CG0A 3RLUA 3L12A 4AXNA 4QQ3A 5CPMA 1LUCB 1XLIA 4FLQA 3WD4A 4JHOA 4XZBA 3TAOA 3L4VA 5IXEA 2P4VA 5A8MA 1A5UA 3UGRA 5I00A 5K9DA 2F7FA 1XIHA 1N1AA 2XIOA 2WNWA 3T0DA 3HGSA 1DWIM 4S3JA 1JGMA 3WNOA 1S2VA 2QJGA 2PRHA 1M1BA 4OIFA 4MKVA 4CVWA 3WDRA 4C7GA 1MW3A 5FL0A 2HNEA 3LXBA 3FVDA 1XJBA 5F4WA 3JS3A 1RLDA 1RQHA 3CQKA 3N2BA 4IGHA 4YWIA 3PA7A 1OX6A 3QW4B 2ZDSA 4Q7IA 3CQHA 1RK6A 3QJAA 2DVTA 3NOYA 2PWFA 3G1VA 3VABA 2ZE0A 5FSEC 1KM5A 1R5YA 4PCPA 2Y7DA 4OUIA 2YSWA 4DZ5A 3GC5A 2VX5A 3DC0A 4FLRA 2WV8A 3R0UA 3F2CA 1B3ZA 3MHFA 4IPXA 1OCNA 1MXSA 1E0WA 5F2MA 4AVOA 1IZJA 2D20A 5FJJA 4EPKA 3I4EA 3KAFA 1U79A 1LLWA 3C2OA 3AUJA 2PTXA 2OYMA 3W7LA 3BLEA 3RRAA 1WKDA 4EXAA 4IT6A 1YATA 4CNSA 1JL8A 4LS0A 2O9PA 1JUBA 1DHKA 3PS7A 3BOXA 4S2BA 3AHXA 4UFKA 1GPWA 4LAZA 3KVLA 3JXVA 5C7VA 3CEPA 3FXGA 2PCQA 2XGBA 1JYNA 4B5SA 1QNQA 1YQ2A 5D03A 2IMRA 3SO7A 1O1ZA 1XLGA 1VCVA 4HA0A 3WK2A 2B0MA 1DJZA 2YGYA 1F8IA 4ZENA 2G97A 1BPLB 5AHMA 2PBGA 3H2CA 3MKCA 3TWBA 4E3VA 2YL8A 5MHBA 1EWDA 2OJPA 1ISYA 1JF6A 1KCLA 4AEEA 3WJXA 3UZWA 3EA2A 1BVWA 2VEGA 4MZ1A 1IE7C 3N73A 4MJ4A 3ZLFA 4CNUA 1NSJA 2WVUA 5BXJA 3LERA 3VAVA 4R85A 4WF7A 2NXIA 1VCFA 2FJKA 4FO4A 4UNKA 3C52A 4I6KA 1ODUA 1KWKA 2WC7A 4EACA 3E2SA 3DHDA 4J2PA 3CPUA 4HSHA 3A47A 3FGCB 3QPEA 5I03A 3OBAA 3B04A 4B4FA 2PF0A 3RCYA 3EB2A 5F7UA 1K70A 1HXJA 2UY4A 4PUEA 5LXXA 3WBWA 1NP0A 3W87A 2CEQA 3JUGA 2VELA 3VZXA 3W1QA 2A3CA 4X2PA 5IBXC 3UQNA 4WRHA 2GWGA 3WFLA 1OFRA 3WYZA 4BQ4A 1KXVA 4HNVA 5I2UA 3PZGA 2ZZ1A 1TO3A 1QI2A 3N14A 4JTQA 1L8PA 3I6RA 1KLYA 1XX1A 4NI3A 1PX3A 4R34A 3WH8A 4F9DA 3PB0A 1JPIA 1FKGA 1JFHA 3FAWA 1J0IA 5HW7A 3IVUA 2VWSA 4C6PA 2YL6A 3KAOA 4LV4A 2YYTA 1U22A 2PLKA 3N6JA 3ABQA 4RV3A 3LHVA 1J79A 3IAPA 3IRDA 3LRMA 1KFWA 1V8EA 4RPQA 3LGDA 4ACZA 4NASA 4PTNA 5CJNA 2CZ5A 1Q2SA 1XR2A 1JPMA 3FAPA 2YLAA 4A22A 2OWCA 3R25A 1J0JA 1J11A 3UESA 3NPUA 1H5VA 4Q8WA 2VEKA 4BI7A 1PKYA 4CCEA 3TYAA 5FJUA 2Y5SA 4DWSD 4DO6A 1UA3A 2ZIDA 5IRPA 5BWAA 3MUIA 3NQAA 4R53A 2PBCA 4B5VA 3LSBA 2I57A 3VKAA 1AQFA 3LY0A 3AIVA 3U2EA 3T42A 4GOAA 1ITXA 3NPXA 5C9ZA 5LHFA 3U2ZA 1UR9A 2KX9A 4M1RA 4WSHA 4AFYA 2CETA 4NUWA 1DJQA 3WQ5A 2HJPA 2J4GA 1W31A 1UR3M 2DZPA 1D8WA 1EQ3A 1HVXA 5B80A 4GVFA 4UQCA 4UQBA 2G0WA 1PKLA 1ELSA 4QEEA 1QAPA 2ZBTA 4DY1A 2X1TA 3KVMA 3SN4A 3T44A 4H9UA 3E2VA 3LOTA 3MZNA 3ME3A 4FOKA 4JYFA 5KETA 3VIIA 2X7WA 3D46A 3FHAA 2N87A 1H09A 2W4XA 3P6LA 1E70M 4B90A 2Y7GA 4UCGA 4BQ2A 3NQMA 2PURA 4IIBA 3CZLA 3O7UA 3O6AA 2VDHA 5HUAA 1WE5A 4YIWA 4MADA 3GAKA 3IJDA 2GGJA 1FKJA 1SSDA 2MLZA 1LDCA 2ZE3A 4M6UA 1VEOA 4NJKA 3VNKA 3G24A 4ODNA 4IP7A 1MZHA 1XKYA 3IK2A 4H3DA 1FP8A 3MS8A 5H91A 1VRXA 3M5VA 1L6GA 3NTYA 1I2PA 1PYMA 3GIYA 2JQXA 1SM9A 4I9TA 4P8VA 4ZOCA 3NL3A 4LUTB 5C8BB 1GCYA 3SQSA 2WJFA 1W5PA 2XP8A 1UUQA 4GYPA 2QPUA 4KCWA 4PSRA 3PULA 1VQTA 2FHBA 1Z3NA 1ZFJA 4PH6A 1LOLA 2P8BA 4ZXLA 4EAYA 4QT2A 5AKQA 3LCGA 1F61A 1VBGA 3P7YA 1LT7A 3RPDA 2WNZA 3LXAA 2VWTA 4FI4A 2FGBA 2GVJA 3N2CA 3CTLA 1JZ4A 1FKWA 4S3AA 1MEIA 3MYPA 2WAGA 4QITA 2NSOA 1TPUA 3O05A 4RDZA 3F2DA 1X1ZA 1LORA 3W9ZA 4DUOA 4GI4A 3I7RA 1EJXC 2F84A 1EC7A 4X2RA 4H01A 4W9QA 1WBJA 1WPCA 4O11A 1T99A 3GUGA 2VR2A 1T7LA 1R9YA 3GC2A 5HUPA 3MUXA 1K9FA 5A6KA 2F4EA 2KE0A 2A79A 4ZQNA 1LRQA 4G6CA 3WDHA 1YDNA 2QJMA 3LBCA 2M1IA 4G9PA 1P0EA 4B9ZA 4F0MA 3P0XA 1N55A 4A8IA 1C92A 2FZ8A 1FXQA 2ZC1A 1QWGA 4ORMA 2WOQA 1QWKA 3PZTA 3NA8A 2E40A 4AHOA 4W88A 3V3WA 1ZCCA 3BCFA 4DJFC 3HGJA 3PTDA 1V02E 4DN1A 2OLHA 2ALRA 5LA0A 3OZOA 2GZXA 3H2NA 5ABHA 4FNRA 3AIEA 5I3GA 3O5QA 1I2RA 2RHGA 5CPNA 2BXVA 4J3WA 5LIYX 3DH7A 3JYJA 4JTAA 3MYOA 4W89A 4DO5A 5I6SA 4D6DA 2V5DA 1M7OA 4PGLA 4IXHA 1PAMA 4DWSA 3OYXA 1VLWA 1DQXA 4FK9A 2QUUA 2B81A 2R9RA 4B5XA 4IPJA 1KRAC 3SURA 4POCA 2DG4A 4DAIA 3BSHA 1FTXA 4D6FA 2HS6A 3VOGA 1VFFA 1P1MA 4F79A 3VIOA 4IUGA 5G1YA 1QNSA 1UR4A 4E2DA 5I78A 3BDKA 4G1KA 4R5EA 3PC0A 5LNRA 2E09A 3PZ9A 5A3HA 5GPRA 1DE5A 3A64A 4D8LA 1EA0A 1JAKA 5TBOA 2VD9A 1NF7A 1RD6A 1DTUA 2TPSA 4U86A 3NYDA 5FKYA 4QM1A 2F2DA 3VU2A 1F3TA 1CCWB 4HNLA 4UTKA 2NZLA 3PR2A 1E5JA 1KFLA 4A05A 4D6JA 3FX4A 4WDXA 4QRNA 4F40A 3NSMA 3H8AA 3GVWA 5CSRA 3EKLA 1FFRA 3G1XA 1DEDA 3NXFA 1A7XA 4DUVA 4JNYA 1FA2A 1FH7A 4PUNA 1D3CA 3W83A 1TQJA 4KT2A 4GIYA 2GQ3A 4B92A 1DP0A 3TYCA 1XG4A 2NV1A 2J7HA 1LROA 3SZ8A 6TAAA 9XIAA 3OGRA 4KS0A 3L4TA 1KV8A 2PFHA 4KWOA 2VVNA 1L6YA 4M7TA 2PDPA 5LHEA 2OQYA 4LB3A 2IKHA 2PZNA 1IEQA 1CTNA 4KRUA 3WX7A 3HQOA 1Q5MA 5E9AA 5I98A 1F40A 1W1YA 7REQA 2G5WA 2VZVA 4AIOA 3WLNA 1BG9A 1IEVA 1XYCA 2G3IA 2QPXA 1W5NA 4H9TA 2X1RA 4RZ4A 5DF0A 1OT1A 3BPWA 1KGWA 3TA6A 3UZYA 4E38A 1HN1A 1CLVA 2Y24A 2XDFA 3D0CA 3P2VA 4ZOAA 2NUXA 1Z32X 1FCUA 4DUWA 4O1EA 3QHOA 3UBPC 5DO8A 1LRTA 5HKGA 4DB7A 3VOFA 1CBGA 5BW6A 3P74A 1J96A 1UD8A 5D38A 3TFXA 2FTWA 3CIVA 1FWAC 2Z24A 3C0SA 5AECA 4HZ6A 2VR4A 4LH8A 3VIPA 1CXIA 5CLWA 3PTQA 1FWHC 4P7OA 5KZEA 4C6EA 1UQYA 2FZMA 2ISSA 4C7DA 3PTMA 3KBWA 1G4SA 3O07A 1XLFA 3EMCA 4B9YA 1B3WA 1GK8A 2PPPA 2PU1A 2VQUA 3WDJA 2QKFA 3APYA 1QT1A 3V7PA 1OG0A 1XLEA 2HDJA 1NDZA 2PWUA 2QJIA 3GDTA 4Q4QA 3R8HA 1EWEA 3TV8A 1W5OA 3STEA 4BEUA 4CD5A 3M0HA 4MLRA 2OEKA 3AS0A 3A24A 3VM5A 4IISA 2DT0A 3PZUA 2QCFA 4ROPA 3KOZA 4GGBA 1ALDA 4PA8A 3S47A 1JYVA 2ZICA 4IOTA 1MQRA 4TW8A 3LHUA 4C1NB 5FJPA 2PCEA 1QW8A 1TQXA 2I1OA 4C90A 1AUSL 2R24A 1H7RA 5J5DA 1NU5A 1OYBA 1OIMA 3SUUA 3WQDA 4ZPWR 1M5WA 1TZ7A 1QNRA 2HBXA 2GLKA 3UWVA 3NR0A 1ESWA 3QTGA 3Q45A 2VEFA 3BMVA 2VYOA 4AAJA 3KAHA 1VRDA 3EXSA 5DY2A 3HIJA 1DWHM 3OW1A 5FD0A 4GXPA 1F3EA 4HBEA 4PTWA 3RMJA 4W8LA 1RQBA 5I0DA 2QGHA 3BAXA 3NIYA 1XD1A 3EIPA 1V3KA 2PF8A 2FVMA 4S23A 5EFDA 4HU3A 2VUYA 3WF4A 3TC7A 5D2TA 1YPFA 5F2LA 4KQZA 3LEPA 4MNJA 3M41A 4G2DA 2FYMA 3QY7A 3DGBA 3W2NA 1FWGC 4PZVA 2MLXA 4IG2B 1JEZA 4W8BA 4L1XA 2A3BA 3CMJA 3NEVA 3UQAA 1EJWC 3OQEA 2MANA 4ODQA 1UWSA 4JBRA 1R3SA 5C5YA 3B06A 4E2BA 1JZ2A 3QYSA 4QAWA 2CU0A 2DZSA 3TKFA 4MNMA 3HPXA 1DWJM 4MF4A 3O5FA 1JI1A 3MUY1 2HPIA 4UNIA 1R86A 4CEXC 2CXGA 3CAKA 3HPZA 4C6MA 1N82A 2WCGA 5GJNA 3R89A 1XIBA 4XD6A 2ZA3A 1CB7B 1NFGA 3ZJ6A 4D6EA 2BDQA 3PZVA 2PDHA 4QE1A 4M3PA 3PANA 3KRUA 1ZSXA 2V0TA 4LJ3A 4AD4A 1Z42A 2DSZA 1O5RA 3RXZA 5H6HA 4ZFMA 2GPTA 3KX6A 3UU0A 3W7OA 1LWIA 4ENLA 3OBKA 4KWVA 2ODOA 4DRMA 1BYCA 2XP9A 3EXTA 3LUTA 4GG9A 3IKGA 1YE4A 4DWDA 3MBFA 2GJXA 3OEXA 3W3OA 1CNVA 4DJEC 2EKGA 4CNNA 1K77A 4LCRA 3FLUA 4QEHA 2Y8UA 2RSEA 3AOFA 4S3CA 5FEZA 4C6KA 4W5ZA 2EPHA 5G2WA 1E6PA 3IGSA 4JQ2A 1TELA 1Z44A 5CZSA 5DMMA 2DH2A 4KMQA 1CPUA 4UTWC 2XSXA 3UF8A 2CHNA 3PR9A 3DFQA 4AF0B 4ODPA 1XWYA 1EJRC 2Z2AA 2Y5JA 3CTTA 3SSJA 1OD8A 3NO5A 1K7EA 3TW9A 3VINA 4H9MA 5HR7A 1TV3A 4Z0JA 4BY3A 1S46A 1V0KA 3I68A 3TU9A 1PVNA 3BG9A 4UTIA 4FMVA 3POHA 1QK0A 4KH2A 3KDOA 2YX0A 3TN5A 4OBTA 3UWQA 3BJSA 3OG3A 3LD5A 3GXIA 4KEZA 2B31A 3EA1A 3LTPA 4HCLA 2QQ6A 4DRJA 4W9PA 3GRIA 1JZ8A 4TX0A 1EH9A 3H2MA 3Q65A 4Z1BA 3ZFHA 3CU2A 1R8LA 3U6WA 4DZHA 4DZIA 1E40A 4O53A 3QY6A 4ECLA 3RGTA 4PMXA 2XSBA 4US6A 3KBJA 5A5WA 3O06A 4GYKA 1TUFA 4L6OA 4PUKA 4Z2JA 2QF8A 1UP3A 5M1TA 4WHBA 3NYZA 4TV6A 1ENUA 2P0OA 3EX4A 2D73A 2K8IA 3LGGA 1F7BA 4QSFA 1PHQA 4MM1A 4TIMA 3UWWA 4DI9A 3BJFA 3ID7A 4ATWA 3UQBA 1HKJA 5G5IA 2WSKA 4IX2A 1KD0A 5FCZA 3ARSA 1A5NC 2CKSA 3VOIA 2ZRYA 2GFTA 3LPPA 1AZ2A 1WYIA 3SAZA 3SI9A 4DJDC 2P53A 3HB9A 2E6FA 2V82A 3WQVA 1E1CA 1ADOA 4KW2A 1I0DA 3SRHA 1B6CA 3GDRA 2D2GA 2A4AA 2Q3OA 4W9OA 4JZ5A 2GVYA 3R7MA 1GKQA 3DEQA 2W79A 2ZA1A 3E02A 3OB8A 2KFWA 2GSJA 4X22A 3BAWA 4KEVA 1VHCA 3RHGA 3D6NA 3O6DA 4GRSA 2Y0FA 3ZM8A 1LQAA 1Q4WA 3DFTA 2ADAA 3W1MA 3BLIA 3AC0A 4WY0B 1A3XA 3G1SA 3EXRA 4HOXA 3VILA 4H83A 3M44A 4LT9A 1C9WA 3VDGA 1RXOB 4DF0A 3USZA 3CB3A 1ZALA 4TTGA 2XTKA 4PMNA 1Y65A 4QISA 2R1PA 2J9ZA 3L0KA 4R7WA 2VL4A 3CK5A 3GB6A 7TIMA 3DFNA 3IGUA 4NVTA 4ACYA 5D75A 3K13A 4REQA 2W9MA 2XH7A 1KM0A 2YL5A 2W91A 3TTSA 3TQPA 2QCCA 4GIAA 4GO8A 3GR4A 4RKAA 3VCNA 5LNSA 1WKEA 1AD4A 1F8MA 4FZIA 1L6SA 1NAL1 2ABAA 3TMLA 3GU2A 3SCUA 3W2JA 1QOQA 3MSRA 3SUVA 4FOJA 1N8FA 3URNA 2XVKA 3CJPA 4CQAA 2UY5A 4W5UA 3LU2A 2EPMX 1BYAA 2W63A 1XQLA 4DRIA 4HNCA 3GX9A 2WHMA 3W71A 1YX1A 1YW5A 1QPLA 4AY1A 4O28A 2QW5A 3DX5A 1EBGA 4MB5A 3S6DA 1OBAA 1FKSA 4Y9NA 3GNDA 4NNAA 3UG3A 3ARXA 3BSGA 2J8TA 5ECUA 2WZIA 4GUGA 2OU4A 3E12A 4DYKA 1KM4A 4JEQA 2CZEA 4L80A 2J79A 1E0UA 1EP1A 1DBTA 3OA3A 1T6MA 2WYSA 1KGXA 3WJZA 4LYQA 1PBKA 2YOCA 7PTDA 3I7SA 3KL3A 1EPVA 4GQRA 1R3YA 2ZX5A 3PBYA 3ZVHA 2PE4A 4ITZA 1FOBA 1US2A 4WSJA 2C71A 3ZT7A 1KRBC 1ME8A 5B8IC 5FOOA 3IGHX 5DCEA 1RVGA 1VR6A 2Y63A 3OHIA 5HQLA 4BF8A 3KL5A 2BSLA 4BCEA 3HFTA 4UIOA 4J4KA 1FHLA 3LZ3A 1NDWA 2OO6A 3WNPA 3SUWA 3SIMA 1BKSA 1A3WA 3MO4A 4GVGA 3URAA 4UZUA 3WD3A 5BROA 4I5UA 2YXOA 1OINA 4KEUA 3B8IA 3ICJA 3KBSA 1UWTA 5CZTA 2BY0A 1EJUC 2WMKA 4R88A 1REQA 2GJNA 5AC6A 5SWUA 4F2BA 3R11A 3N34A 1V08A 1HT6A 4HYRA 3WLMA 3LM7A 4PCTA 2HROA 1EPXA 1JPHA 2VO5A 3UQIA 2VXNA 3CT2A 4H8HA 4AMAA 2CCRA 4G5DA 4Q32A 4YTSA 1B4EA 1Y5VA 3AXIA 4QJ4B 3VIJA 2JK2A 1NP2A 3RR4A 3UNTA 3UR5A 1YTDA 4G50A 1LL6A 1B5TA 2FJUB 2C91A 4ZOEA 3NVDA 2XFYA 3RCNA 3ISIX 1CXKA 3O8AA 3B9DA 2VD8A 3VC6A 4PMUA 1R3RA 1POKA 1KBIA 3MP4A 3WO8A 4Q8UA 2BGQA 1R9ZA 3LDVA 3A9IA 1H61A 3TNBA 4AZ5A 5D4YA 4GJ1A 4LS1A 3CGTA 1XIJA 1F73A 1E72M 5D37A 2I14A 5KZMA 4LUIA 3CWNA 1RUSA 3IJ6A 1VFSA 4QNWA 3V0SA 4BZYA 2PC4A 3U48A 3L5LA 3FYPA 4ZL1A 3TQKA 3LBOA 2X8RA 1RP8A 1UMLA 3WG6A 2OFNA 4W4QA 3UA4A 2FH8A 4EOUA 2Z25A 1V6YA 5AN7A 5AHIA 3UYCA 4UC5A 5JBDA 1UIOA 3H2AA 1J0KA 2F9RA 1JI2A 2YFNA 1EO5A 4HPGA 3VNDA 2FFCA 4QG9A 1IIGA 4RJEA 3RU8X 1B57A 1MVYA 1LYXA 4L61A 4YHGA 4GUHA 1CWYA 2XH0A 3G1RA 2E9BA 4LALA 2WZTA 3GW0A 4H7VA 4N9CA 3SR7A 4UQ9A 1CIUA 4KGLA 3RRXA 2XZ9A 5M5DA 1QR7A 2FMNA 3O3RA 5IBXA 4RLIA 1XYMA 4U2ZA 1XDJA 4GFIA 4M0XA 4UTLA 1BXBA 1AW5A 1DE6A 1R0MA 1X97A 3GXDA 1JPKA 1HKIA 5AFDA 3CB8A 3HA1A 3AZSA 2WANA 3VM7A 2Y88A 4YTRA 3I10A 4GO9A 3FIGA 2OKOA 3W74A 2X0YA 2H8ZA 3BCJA 4NJHA 5XIAA 1IX5A 4UR8A 3RJYA 3UT0A 3UXKA 3VOHA 3KRBA 4HA4A 5KTLA 4A3RA 4GABA 1U5JA 3M0MA 4DVOA 5TNVA 1OYAA 2ZZ5A 3LGEA 2Q8LA 4NI8A 2WBGA 3T40A 4XO6A 4PMRA 3O5RA 2P3EA 4A8NA 1ZNNA 3UZXA 3LI1A 3QQ1A 3SBFA 1XLKA 2JIWA 3KRZA 3R12A 4LPCA 4YNGA 5DANA 3KAGA 1TZZA 3M5YA 4WUIA 4JIIX 1AZ1A 4UXDA 1TV7A 5REQB 1QDSA 4JHZA 3M46A 1HNYA 4I7UA 1BWKA 4DHGA 3DXIA 1A5BA 3UF9A 4X0VA 2Z29A 1XIEA 3DBPA 3U3HA 2Q02A 3ITXA 2CNCA 3VIKA 2E3ZA 1FWDC 3CPGA 2PDNA 1L6WA 1VS1A 1OVDA 4ZQPA 1FCQA 1E1EA 4IHCA 4UWMA 3W6YA 3H7VA 3C2RA 3XIMA 3DG3A 3H7UA 1QUMA 1AMYA 3YPIA 4CGTA 4LVAA 1AL8A 1IEWA 4L56A 3VUPA 1V51A 4J3XA 4NRSA 3O5OA 4GY0A 4HSNA 1TJPA 3UR7A 1F74A 4CCCA 2VX6A 3RX4A 3T78A 1TX0A 2Y1HA 3V5CA 1ZJBA 2Z1XA 2ZX7A 1FKBA 1F5ZA 3S1WA 1FKIA 1A5LC 2CLLA 4RE0A 8RUCA 3LX9A 2XIJA 4AZGA 4AZ6A 1QXLA 4PB3A 1UCWA 2B7QA 3RX2A 3W26A 4N0RA 2VC7A 3AWOA 2V38A 3W1PA 5BOEA 4ZZ9A 3CV6A 1PTGA 4LW7A 2PGWA 2R94A 4JTCA 4MOZA 4L72B 1W1ZA 3VNIA 1RJRA 1UD5A 2ZTKA 4JTIA 5CQ1A 4KCVA 3RFAA 2PTYA 3B97A 1PIFA 5BU9A 3MUAA 4ZGYA 3W38A 5A6LA 1LM1A 1XIMA 1XH2A 4V1YA 3EDJA 5E6YA 2EEXA 5I77A 4C60A 1ZB5A 1XYBA 1GPFA 2EF9A 1AFSA 1JULA 2F2KA 3BVJA 3WMSA 3ARTA 1WAWA 1DV7A 3KCLA 2GJRA 1PSCA 3SECA 1KTCA 1AVAA 1G7VA 4G56A 1WNOA 1JDFA 1LF1A 3TH6A 1HIZA 4NNCA 1YPXA 3SADA 1AQMA 3S46A 1E4NA 4ZB5A 3T08A 4BHYA 5AVHA 5M03A 3IARA 3F4VA 4J3ZA 1KKOA 4FALA 2A85A 1PKNA 5CPSA 1XPYA 4GJIA 3E5PA 4CD8A 2R82A 3GR7A 3OP2A 1Q6RA 3LTSA 1G7UA 1GG1A 2OG9A 3BK0A 1FRBA 2DFAA 1KCZA 1IWBA 6TIMA 2UZ9A 2V5JA 2E68A 4AG0A 5JXQA 2V8ZA 4IL2A 3S1XA 1PPIA 1A4LA 4GY1A 3N25A 3VGFA 3WNKA 4MUZA 4GI8A 4UTUA 4NY2A 1R46A 2F38A 3F2BA 1RY0A 4A6GA 5K9CA 1IF2A 2A3HA 3PWGA 2WWDA 1FWSA 1F4HA 1DQWA 4IGSA 3DKLA 3B8UA 4JOMA 2R6OA 2CHOA 3BLKA 2O0TA 5IM51 5A95A 4O1AA 4KBXA 2LGOA 1Z8AA 1OCQA 1S2AA 1ZENA 1JZ7A 1E71M 5JVLA 3DKJA 2WSRA 3PBUA 1W26A 2G50A 2PA6A 2OX4A 3FSUA 3GTIA 5I07A 3U5YA 4H6KA 1XYZA 3UWZA 3TLQA 5CPLA 1B90A 2XFFA 4XTDA 5AC8A 4HYVA 1EO7A 1N8IA 5KEZA 2J7BA 3ANYA 1MZRA 1DTNA 1DOSA 1E56A 3O63A 4QROA 3EKGA 1TREA 5BOOA 5HWBA 3VGDA 2WSYA 4ZS6A 3B9AA 1KB3A 3WLLA 4DLFA 1QU4A 2NQHA 1DKWA 2ACQA 4H9YA 4C02B 5H8UA 1BGAA 1W37A 1EDTA 3GG1A 1BHGA 3THCA 4ZQOA 1KBLA 3M0JA 1B4KA 5AB3A 3M0XA 4Q33A 4JKKA 3M5XA 4XKMA 2VENA 4QP0A 4UR9A 4D6IA 3BZJA 3JU2A 5U4NA 4PTVA 1OM0A 4I9JA 3K4DA 1J9YA 3KFTA 2O92A 1VYRA 4QT3A 2ZWZA 3WLTA 3EWBX 1WKYA 2PDJA 2A7PA 2CLPA 5FIPA 4N2YA 1GOQA 1ZP4A 1OF6A 3GE7A 1RCXB 3UA3A 2X05A 1WXZA 5A2BA 1UWQA 3A23A 1ITUA 3NNTA 4M51A 3UJFA 4G2PA 1OC7A 5C2CA 1A49A 4Q4PA 4PR4A 4E5TA 2Q09A 3TQ0A 1GYNA 1SSGA 3CEUA 4W93A 1S1RA 4P8UA 3AIWA 2FZBA 2EXOA 4HPXA 3TMQA 3KVKA 1XFBA 3NGJA 2V2CA 4LSBA 4J35A 4MY8A 2O4QA 3T55A 4O50A 3K4WA 1Z89A 3R10A 3W27A 5HWJA 5A2AA 4ZPVR 3PSWA 4QSHA 4AQLA 3NGFA 4OHQA 2RFGA 1LL4A 3WJYA 2X1SA 4LVGA 3IV3A 4DWSB 4J5NA 3GC4A 3VKCA 3CUIA 4JTUA 2VGBA 1WDQA 3DIPA 2Q3RA 2WSPA 3UJRA 4BQ5A 4CU6A 4K68A 4IQ2A 1WDPA 2PLMA 1YTKA 5M2FX 3W72A 3TDBA 4K38A 1E9ZB 2JKEA 4F3HA 5DN1A 1AJ2A 3OVGA 3W00A 2OQLA 2P88A 1X39A 2PDLA 2KGJA 2NVCA 1WZAA 4O0KA 3W7GA 2VCBA 5CC3A 2L5HA 1SGJA 4QHRA 1UH2A 1XCFA 1UH3A 4JXCA 1MYRA 1OT2A 3B9NA 3QFEA 4RW5A 1ONRA 2W67A 3IVSA 3WDQA 3W88A 4UFMA 4NZ1A 1EJTC 4GCXA 4V27A 5CPQA 3WQEA 3N9SA 3B8WA 3NSXA 5FF7A 4ZOBA 1FWWA 4LU0A 4JIHA 3M1ZA 2TYSA 5D9PA 1Q7ZA 3G77A 3MJMA 1ZBWA 1HXVA 4HU8A 2E0PA 2TMDA 4LANA 1E55A 3S6OA 3KOFA 1TB3A 1S5NA 3AHYA 2PV1A 2QT3A 1J6PA 2E7FA 5K7JA 4RNFA 1J6OA 4HSOA 5BNKA 2PAJA 4YPJA 3MZ2A 3N6QA 2DZWA 3W2LA 4HNOA 3VNLA 4AZCA 1JZ5A 4TVUA 1GVFA 3LLXA 2QVNA 5DIUA 2PV2A 1QI4A 1SO3A 2B7NA 4CU8A 3SRDA 1KWGA 1VP5A 4JFVA 5D30A 2C0AA 3MI2A 2DZTA 3DI0A 4GYPC 3ALGA 3T81A 3KE0A 4XZIA 3M43A 4XZWA 4Y9OA