3RMEA

Amcase in complex with compound 5
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rmeA01
3L4XA 1UR8A 1SMDA 1TUXA 3N11A 5LA2A 3CMGA 3AXXA 4LXFA 2J4GA 3WELA 4BQ4A 2DT0A 1TCMA 1HJXA 3AZTA 5BRPA 3T2OA 2Y8KA 4P8VA 4UOZA 2NSXA 4RE3A 1C91A 1QNQA 2E9MA 4V27A 1HIZA 4OIFA 4NI3A 3OGRA 4TUFA 1IZKA 1OINA 1W1TA 4H41A 1U30A 3ARZA 3ZT5A 3A47A 3AMKA 5EMYA 3UR8A 2XTKA 5E09A 2CXGA 4ZFMA 4AZ5A 3AHXA 1CGXA 1TR1A 1FFQA 2VZSA 3M46A 4A4AA 2WSPA 1UKSA 3L4YA 3BGAA 1FA2A 1ISVA 1DTUA 1NP0A 2Y2WA 5DEZA 1R85A 1MWOA 5A6BA 2BY0A 2VVNA 4UQDA 1K9TA 3LPGA 2BHUA 2A3BA 4HZ6A 2BVTA 5JIPA 1B31A 3WH9A 1OCQA 4PTXA 2CBIA 2XVPA 5DMYA 4B15A 2ZWYA 1V3IA 2OYMA 1VEPA 4PUDA 1EHAA 3W53A 1DHKA 1CXEA 1SMAA 1E0WA 3TTSA 2XYLA 1G01A 4D6GA 2FHBA 5C70A 1C7TA 2WVUA 1NH6A 1E73M 5KEZA 5D9NA 1ZBKA 1AQHA 3VNZA 3GH4A 2EPNA 1HKMA 2YLAA 2ZUVA 3W6MA 5IFTA 1QI4A 2EEXA 3CZGA 1CGVA 2XGIA 2NW0A 1LWHA 1XD1A 3ZT7A 1GZJA 1WAWA 3ARPA 1H3GA 2GJXB 4J3TA 4GZEA 1GCYA 2F2HA 3AMCA 3KL5A 1US3A 3GXDA 3PHAA 3LMYA 1JIBA 3ARRA 3PTMA 2OLHA 2VR5A 2V3DA 3WF0A 2A3EA 1ZU8A 4FK9A 4MDOA 5D4YA 4PMZA 3VINA 1M7XA 1EXPA 1VB9A 5JIWA 3SUVA 3WEMA 2WANA 3F5KA 1JDCA 4KMQA 2IUZA 1UD4A 5DT7A 2G41A 1ZJAA 1MW0A 4GINA 1FH7A 4A3YA 2EPOA 4BZYA 2HVMA 2VMFA 4JKKA 3ZT6A 1LLOA 3JUGA 1HNYA 2XGBA 4PMRA 5D9PA 4CD8A 1V0KA 2XM1A 2XSAA 3WD3A 2O9PA 4AIOA 5E0CA 3IANA 2VNCA 1H4PA 4PMQA 3VUPA 1TMQA 3AZSA 1JAKA 4NRRA 1VJZA 3GBDA 5KZ6A 1JGIA 1TZ7A 1ISZA 1C3FA 2EO7A 3W81A 1VAHA 2C7FA 4W5ZA 5C71A 4JFWA 7CGTA 3SCWA 3W4RA 3VDCA 4NZCA 2WCAA 5BXPA 5CJ5A 2XWDA 1KB3A 2J7EA 1MW2A 3WF2A 3AJ7A 3LPOA 5CLWA 1MYRA 3GZAA 2Z1KA 1W9VA 2G3JA 3WMBA 2WVVA 2X09A 4A3HA 4MTVA 3QHOA 3AFBA 2DSUA 5I5RA 3RIKA 2DGAA 4QFUA 4XZWA 5A8PA 3GNPA 5GNYA 4R27A 3VD3A 4WKHA 1Y7VA 2GDUA 2FH6A 4AD0A 1LG1A 5A95A 5I0DA 2IXUA 3CH9A 3KE0A 2FGLA 5BCAA 4W8LA 2ESCA 1V3JA 5JBEA 3QHMA 4WKAA 1G1YA 1ESWA 3VIFA 4BQ5A 1JYWA 4HA4A 2YIHA 3OLDA 1W2PA 3PBGA 5M5DA 4Z2IA 1PIFA 3AZRA 4M24A 4ATDA 1LL7A 3APGA 1GOKA 2WBGA 1HT6A 2UY5A 5EBAA 3VGFA 1VFOA 3THCA 1MXDA 2XWEA 2XFYA 4UQEA 1WKYA 1V6UA 1E9LA 4BA0A 1UD8A 2PC8A 5CSUA 4MNJA 3SCOA 5HDRA 1EDQA 3RM8A 4LYQA 1EH9A 1KXTA 3L4TA 1KXQA 4JFSA 1B3WA 1Q6FA 1UZ4A 1FHDA 4W85A 1PX8A 2X2YA 3BCDA 3VGHA 4FLRA 3BMVA 1XSJA 4H7VA 4BS0A 4CD5A 3MS8A 4BQ2A 1M53A 2QMJA 4WK9A 1ISXA 1DWFM 2YJQA 3BAKA 3WDQA 4PYSA 1WNOA 4LYRA 2ZUSA 3N1AA 3A4WA 4B3LA 1TFVA 1UHVA 2CPUA 2JFEX 3MUAA 4DM1A 1QOXA 3GXIA 3NIYA 3AIWA 1AQMA 3U5YA 1RD6A 2A3CA 3DHPA 2YL5A 1G5AA 1E56A 1J0HA 3VGDA 3ARVA 4PCSA 5IFPA 1H09A 1UUQA 4MNMA 4AZ7A 1JZ8A 4BF7A 2FHCA 2CIPA 1ZBWA 1CGWA 4DUXA 1LWJA 1P6WA 2DH3A 1QHOA 3AXHA 1C93A 1OGBA 4EE9A 1K9DA 3PTKA 1KFWA 3WDIA 3AHYA 3VDBA 1VBUA 4IUGA 4X0NA 2VZUA 2VI0A 4HZ8A 3OZPA 2WWDA 2WCGA 2BXZA 1PJ9A 1QNRA 1E6RA 4J28A 1YQ2A 2V3EA 2WVTA 4PRWA 3OBAA 3PZIA 5E9AA 3VKKA 1C92A 4M81A 4MPKA 1VFMA 2X05A 6TAAA 3ZJ8A 3K8LA 4F9DA 2X0HA 5A8OA 1IT0A 1WO2A 3WSUA 2ZX8A 2JF6A 3FAWA 1UYQA 1JFHA 4TVDA 3WDHA 1FHLA 2ZUMA 1LL6A 3MSDA 3VTRA 3CUJA 4MB5A 3J7HA 1OIMA 3T09A 1PAMA 5JUVA 1ITCA 1MQQA 2ZIDA 4ZENA 1ZB5A 3EMCA 2AAAA 1W9DM 1C90A 3B9EA 4DWSC 2WKGA 2VRJA 4HP5A 5IHRA 1I1XA 2GJRA 3ALGA 1B9ZA 3F4VA 1XHGA 2YDQA 5F7UA 4AEFA 1SFSA 4AZBA 1GORA 3FHQA 1E5NA 3NYDA 4C7FA 1H5VA 4UCFA 2W4XA 4MAZA 1GJWA 1CECA 3CHEA 2VC9A 2E8YA 3AICA 4B3KA 4J3WA 9CGTA 1Q4NX 5FD0A 1I1WA 4DWSB 1V02E 4HPHA 2D24A 3CUFA 3WKZA 5HPOA 1VFFA 3N12A 5DO8A 3PZ9A 2VRQA 3SIMA 3SEPA 1E4LA 3SCSA 5LA0A 1J0KA 4NRSA 1D3CA 1HXJA 2J7FA 3VIHA 5EFFA 4AYSA 2YLLA 1JZ7A 2CHOA 3BLPX 3PTQA 1JD9A 2AOSA 1BTCA 1JAEA 4YN5A 3HU7A 1D7FA 3VU2A 1J01A 3OLGA 3VIKA 4L4PA 4W7UA 3VDHA 3EBVA 2VJXA 4PMOA 1VBRA 4FLSA 1VJSA 3GNRA 4TTUA 4D6FA 4J7RA 2YA2A 1OBAA 5DFAA 3BAWA 5BROA 5LYRA 4JKLA 3L4UA 3WEZA 2GK1B 2PWHA 2VX7A 4UFMA 4B16A 1W1PA 4OUEA 2X0YA 3T2QA 1XC6A 2E9BA 1QBBA 1UR0A 2CBVA 3VDAA 2PWFA 1V3LA 2ZUUA 4D6CA 1H0GA 4ACYA 1BYCA 5ECUA 2WWCA 1J12A 2D0FA 2DIJA 2VRKA 3WQWA 1QI0A 3WF4A 1PEZA 4PTWA 3VD9A 5I77A 4WSKA 4D6JA 3RMEA 5HPCA 1CXFA 4XB3A 1DWGM 1RPKA 1EQCA 3KL0A 4M56A 2VURA 4NSBA 3ARWA 3WH8A 2BY3A 4P7LA 4XV0A 3A4XA 4UFLA 3L4VA 2PBGA 3VIPA 4ZXLA 3ARXA 1EA9C 2WMKA 4J27A 4CU8A 3BAXA 3PZNA 3ZQ9A 2CHNA 3WBEA 1EO5A 4URIA 1K9EA 3L4ZA 3BMWA 3PZVA 1FFRA 1GONA 2B31A 1VRXA 4CN6A 2ZXAA 1UWRA 3DYOA 2FDMA 1UWSA 4QLLA 3IJ9A 1GQIA 1HJWA 1MQRA 4U5KA 1HJSA 3CZJA 2BV9A 4HA1A 1WE5A 2EXOA 1HP5A 1H1NA 5HBFA 5A6KA 2D1ZA 1UH3A 5I3DA 1WDQA 1VENA 5CSYA 2WMIB 3WL1A 1NWSA 3CBWA 4CD6A 2QLYA 1UR4A 4Y7EA 5E6YA 3D3AA 3TTOA 5HOSA 1E72M 4E8CA 1Q6GA 1C7SA 4JIEA 3TA9A 3PZQA 2XPKA 1B90A 1L0PA 1NOWA 2UY4A 3AIBA 2WAGA 1E40A 1N82A 2FH8A 4GPNA 3WH5A 4UTFA 1JNDA 2PWEA 3WN6A 3A4AA 3GH5A 3MO4A 1W3JA 3ZIZA 4NF7A 4RE4A 1B1YA 1PZ2A 4ATLA 2ZX5A 1MXGA 2ZX6A 1JYVA 1VEOA 3BCFA 5A2AA 3ZJKA 4W88A 2WHJA 4HMCA 5I23A 3M07A 1AMYA 3F5JA 4QCEA 5I24A 1BHGA 3RCNA 1EO7A 1TE1A 1M04A 4TTGA 2JIWA 3VMNA 4OBRA 2DSVA 3BSHA 1HKJA 3EDFA 2GFTA 1EOKA 4CN4A 4AISA 3GXMA 3FXYA 1TVNA 3MKKA 4PSRA 1J0IA 3WMCA 1JDAA 2Y4SA 1E6ZA 2CYGA 3N9KA 1UKTA 1HL8A 1UKPA 4K68A 3WEOA 1J0ZA 1MW3A 3SCUA 1DWHM 4HZ7A 1CYGA 1UH4A 1A47A 2OYKA 3GBEA 4J3SA 2CBJA 4CKQA 1QI3A 1EDGA 2BHZA 1B3YA 1W2VA 1H0IA 3B8SA 4J3UA 5FKYA 2W92A 2J8FA 2CKSA 4L4OA 1CLXA 2Z1SA 2WLZA 1JFXA 3NSNA 1KXVA 1BVNP 2V3GA 1WCGA 3WD2A 1W1YA 1TA3A 2XVLA 1NOUA 1KWKA 3AS2A 1CGTA 2ZUTA 7A3HA 1FP9A 3KZSA 3QR3A 3VIJA 3TTQA 4H2CA 3BXWA 3AISA 1ZL1A 2BFGA 5CPSA 2RGMA 1CXIA 1UA3A 3U7VA 1BGAA 2CKRA 5FL0A 3GH7A 4GO8A 4H8VA 1H49A 1XH1A 2DSZA 4M80A 3O6AA 1KGWA 4Z2KA 3OZOA 3GNOA 4C7DA 2E8ZA 4CVWA 5CGMA 4D1JA 3MUY1 3WUBA 2W66A 3TOPA 1V3MA 4X0VA 1E6SM 4JL2A 4B9YA 2DQXA 2XVKA 1V6YA 4EK7A 5E6ZA 1RP8A 2XSBA 3B9DA 2V38A 4BQ3A 1QI5A 3U5UA 3PZMA 4MAVA 1H41A 2TAAA 1CEOA 1HVXA 2W91A 4AXNA 2G3IA 4QLKA 3VPLA 3UCQA 1X6LA 1CDGA 4FLQA 3PZUA 3QHNA 1G94A 1GW1A 1W3KA 2Q8XA 4U33A 5AY7A 2G8ZA 3MANA 1BVZA 3U57A 3ZSTA 4ZE4A 3CZEA 3VD5A 5A6AA 1CXKA 1KBKA 1V0MA 1XH0A 3SCVA 1JXJA 1UR9A 2UY2A 2WPGA 4PMYA 3OB8A 2YL6A 4PN2A 5A6BD 5A6MA 3O2LA 1NP2A 3BAJA 2BVDA 3AOFA 4JL1A 1HKIA 3AHTA 2WC7A 4DUWA 1HJVA 1LL4A 1B3VA 3WENA 4TX6A 3CZ8A 3MV01 1VEMA 2D0HA 3AHVA 4AD2A 1LG2A 3VGGA 4TVCA 2YKKA 5JH8A 5FL1A 1OM0A 5D9OA 1CZ1A 2ZXQA 1OWQA 3KL3A 1QHPA 3B9AA 1OB0A 1LQ0A 2JEQA 5IHSA 3WQ6A 4JAWA 1UWTA 3ZR6A 2X8RA 3BLKA 5AYIA 1AQ0A 4UQBA 2WBKA 1BYDA 3ARTA 2WB5A 1WP6A 4MNLA 3WQ5A 3GYCA 2WMGA 4AWEA 1E3XA 1E1EA 2EPLX 2GUYA 3AIEA 2XVNA 1E4NA 3LPPA 5ABFB 3GM8A 3WF3A 3RILA 1E6XM 4W8AA 3NUKA 4WSJA 2MANA 3DYPA 4PMDA 2ZUWA 4PTMA 3IK2A 1EGZA 3CMJA 4D71A 1QHZA 1GVYA 1NQ6A 3EMQA 2E9LA 8CGTA 1SYTA 2JEPA 4MADA 3WF1A 2PI6A 1KR0A 2DIEA 3VGBA 1E6PA 1E5JA 4UNIA 4P7RA 4LX4A 4JCLA 1XSKA 3MSGA 2DH2A 4Z2LA 1XGZA 4GO9A 3CUGA 4D6HA 1HVQA 2C8NA 2ZOXA 1IV8A 2QF8A 3VIIA 5A8NA 4QCFA 1JNEA 4AD3A 2J47A 2ZUNA 4M1RA 1B2YA 1D2KA 3CZLA 4AD1A 4IPLA 4PTVA 3T0BA 1CXHA 2ZXBA 4C7GA 2ZWZA 2J77A 4UQAA 1JF5A 4ZEPA 5A2BA 5JBFA 5BRQA 1K6AA 4D6EA 4JHOA 2G3MA 4F8XA 1NM9A 3ARUA 3CUIA 2D3NA 3RM4A 4PCTA 1UOKA 4H04A 4LPCA 2CERA 2YOCA 3K4DA 1R8LA 3WH6A 3W37A 2WC3A 8A3HA 2XFFA 4U31A 4CUCA 4ACZB 3WH7A 3W28A 1XCWA 1U2YA 4CU6A 3SCNA 4MB3A 3W38A 3W26A 1JZ4A 3ZR5A 1ZJBA 2QPSA 2J78A 3ECQA 4CCEA 5CPTA 5A8QA 3I3BA 4E2OA 1GPFA 3NDZA 2VCAA 4GIAA 4W87A 2WVVB 3AMGA 2OWWA 1XCXA 3I3DA 2UWFA 4QDMA 3T2PA 3AROA 1FP8A 4D6DA 2PWGA 2WW5A 3ARQA 3ZMRA 3UG3A 2WCSA 4P8XA 5GPRA 4LQ1A 2XG9A 4AD5A 2CETA 2WM0A 2DT2A 3BSGA 1TVPA 1UA7A 2YDSA 2VX4A 2J74A 3WQ4A 2XFRA 4PUEA 5ABHA 1HKKA 4U5IA 4UOQA 3RDKA 1ISYA 2D0GA 2J7BA 1RP9A 3AIRA 3WQVA 2WMIA 1XSIA 1WZMA 4GXPA 3W25A 1E0VA 1UWUA 3TONA 1UWIA 3WNMA 3WDJA 3SCRA 4HU0A 1KWGA 4JCMA 1OGGA 4AY1A 4UQCA 4CU7A 1JYXA 4WIWA 1F4HA 3W82A 4KGJA 5BXSA 3SUSA 4EAMA 2V5DA 5BXTA 2VQUA 1GQLA 1W3HA 1DEDA 2XJ7A 1GJUA 5I78A 3AHZA 1XV8A 4M29A 4S3KA 3VIOA 4XX6A 3N18A 3UETA 2XVGA 4UFKA 4F79A 3O9NA 1FH9A 1R86A 1KCKA 1C8QA 5IXEA 1NWRA 5FOOA 5I6SA 1EHNA 2QMKA 1HX0A 2DPEA 2QPUA 1XYZA 3WNPA 3OG2A 2V3FA 1GNXA 2E0PA 2F61A 3MUIA 1UR2A 2VQTA 5E70A 2V5CA 4HU8A 1E0XA 4HMEA 3KWXA 4N42A 1QVBA 1DWJM 1XH2A 4MB4A 5FIPA 5A69A 1UKOA 3IAQA 1A3HA 1QW9A 1Q6CA 2DT3A 1ZS2A 4GKLA 3NSMA 2WXDM 4AW7A 3VVGA 3DECA 4P8WA 2EJ1A 1FOBA 2GJXA 5DF0A 1MFUA 1J11A 4KH2A 1G0CA 1GOWA 1MVYA 4PMNA 4W86A 3AMDA 4X9YA 4HPGA 2XIIA 2RGLA 3CPUA 3VIGA 3N04A 3EYPA 3MV11 1OGSA 1QI2A 1CGYA 2XM2A 2CITA 4KWUA 3SUWA 2FHFA 4JFUA 3SUUA 4J3VA 1HN1A 3N17A 3AIQA 3EMZA 4W93A 1V0LA 3BAIA 1HL9A 1E70M 1TG7A 3UG4A 4FF5A 1CTNA 2J75A 1HP4A 3PZTA 1OD8A 4QP0A 4GZIA 3W24A 2PWDA 1QNSA 1NWUA 2GVYA 4AZIA 1W9BM 1JDDA 3VOCA 1E4IA 3W29A 4F9JA 2QV4A 4PMVA 4AZHA 4ZE5A 5HNNA 3ALFA 3CUHA 3FHAA 3QOMA 4WLCA 4HOXA 3VMPA 2O9RA 3ARSA 1B0IA 3VM7A 4GQQA 5BXRA 4S3JA 4AZGA 2J8GA 1BYBA 3U7BA 1JZ6A 1ZBVA 4HTYA 5M3WA 4QLJA 4P7NA 2X1IA 2UY3A 2VO5A 1WZKA 3EDEA 3VX1A 3GDBA 1OSEA 3VX0A 3WMSA 1MFVA 2DT1A 3WIJA 4DM2A 3MMDA 3DHUA 3SURA 1CENA 4TXEA 5A2CA 1WDPA 3W0KA 4QAWA 3TP4A 4D6IA 2VCCA 4M82A 4AIEA 1XYFA 4JKMA 4P8UA 2J7HA 2WYSA 1CGUA 4IPNB 1PBGA 1ZBCA 2XIBA 4IISA 3K46A 5HXMA 1CPUA 2OSYA 1KBBA 2EPMX 1GUVA 1BGGA 1X1NA 4Q7NA 3G6LA 1KQZA 3IJ8A 2J62A 3NDYA 1KXHA 4OKDA 3VNYA 3CTTA 2E4TA 4OOZA 1BG9A 4MNKA 2C0HA 4OBSA 4R5EA 4AZCB 6A3HA 3UR7A 1V02A 3RPMA 4CN1A 4FMVA 1JZ3A 4UZSA 3VD4A 4U3CA 2PBOA 3K8MA 4GI8A 3CO4A 4LYPA 1UQYA 3NSXA 2W62A 1R87A 3QOKA 1E3ZA 4PSPA 4XUYA 2D22A 2WLYA 5EFDA 2ZX9A 1JF6A 4D1IA 2DSKA 3CHDA 3RJXA 3POHA 5ABFA 4B9ZA 1OIFA 3WQ8A 2BVYA 3ZJ6A 3WNLA 1H11A 1J0YA 3AMLA 1BG4A 3MUZ1 2WZEA 3POCA 2VOTA 5I79A 4AZ6A 2W67A 3SCTA 2WSKA 1UKQA 1JYNA 1O7AA 5A6SA 3F5LA 3G6MA 1BYAA 5JBDA 5A1AA 4YPJA 4AC1X 1ODZA 4TOQA 1HJQA 3ZJ7A 1XD0A 1ISWA 5A94A 4D72A 1PPIA 1W91A 3AXIA 3FN9A 5A6LA 3KEHA 2O9OA 5D9MA 1JL8A 3HMCA 4MJ4A 4HOZA 2O92A 3VGEA 2VL4A 3UG5A 2O9TA 2Y24A 2VZTA 3K4AA 4WF7A 3WNNA 4P7OA 3ZSSA 2XUCA 3NCOA 1QBAA 1OT1A 3WY1A 4CD7A 4AMCA 1W32A 4Z2JA 5IDIA 4GQRA 2CCRA 1G9HA 2XHYA 3RM9A 4JFVA 3OGVA 3WL0A 4U2YA 4JZ5A 1V03A 1NWTA 4E4PA 1GHSA 4GI6A 4W89A 3MMWA 4KRTA 3L4WA 4H8UA 4V2XA 3PZOA 2QHAA 2BS9A 3LPFA 1J9YA 2OWXA 2BY2A 4RE2A 4LGXA 1V6XA 5CQ1A 4ACZA 2J7DA 1V6VA 2DDXA 2PF0A 3AI0A 3MMUA 1JI2A 1UD6A 1O6IA 3OLIA 1ECEA 3VO0A 3GTNA 4YHGA 5CXPA 3BH4A 4F66A 1V3KA 1XRVA 2A3AA 1K9FA 2OSXA 3WD1A 2J25A 1U33A 3WNKA 1CIUA 2VR4A 1JXKA 3HN3A 1JZ2A 3A6OA 4J3XA 4WKFA 4ML4A 3PZGA 1NOFA 3CLWA 1X6NA 1BAGA 1BSIA 4CCDA 2WHKA 4UR9A 3IJ7A 2GJPA 3EDKA 1H2JA 1WZLA 1UZ1A 3NJ3A 1S46A 1V3HA 6CGTA 1M03A 2JIEA 7TAAA 3AS1A 1JG9A 2CEQA 3FAXA 3II1A 1QNPA 3BC9A 3VD7A 3GXFA 4DUVA 3T0DA 3M7SA 2YBTA 2Y8VA 1JZ5A 4MB1A 2WHLA 5I2UA 3FNDA 3UESA 4BCEA 1E6QM 1CXLA 4DWSA 3N15A 4AEEA 4Z2GA 5ABEA 4W7VA 1C8XA 1QW8A 2HISA 1KGXA 2WHMA 3S2CA 5GNZA 1R7AA 3M6DA 1UR1A 3CZKA 1KQYA 3WD4A 1QPKA 1TA3B 3AYRA 1E4MM 2EQDA 2J79A 2W63A 4HMDA 4MJ2A 4E8DA 4UQ9A 5TD4A 4FLOA 4W7WA 3A3HA 2EPKX 2VZOA 1E71M 1UD2A 1UG6A 2ZX7A 1GQJA 3L2LA 4CGTA 1W9XA 4AIUA 2G4FA 4OZOA 1WPCA 3SCPA 2OYLA 3K1DA 3CHCA 3CHFA 4OOUA 1J0JA 5E0FA 2VUYA 3AQUA 1V08A 5A8MA 3UERA 5CGTA 5CZKA 1LF1A 2GK1A 2JE8A 2VX5A 1OT2A 2WMFA 4JFTA 2WMJA 2OWCA 1W3LA 3WUFA 2CESA 3AYSA 4EKJA 1W9UA 2DEPA 3SUTA 1KCLA 3OA5A 2J7GA 5DT5A 1BF2A 3AIVA 2OSWA 4UFIA 3VMOA 1Z32X 4U3AA 4TX8A 2BNJA 1E6NA 2YL8A 4MDPA 2VT0A 5A3HA 3WDRA 4CD4A 1PIGA 1UQZA 2A3HA 1DWAM 3CIVA 1Q6EA 2NT1A 3AIUA 2ZE0A 3WNOA 4AD4A 2BXYA 4UOJA 1KGUA 4H8HA 4UZUA 1W1VA 3HJEA 2WC4A 5LA1A 1GHRA 1JI1A 1MW1A 2GSJA 3OIHA 1GOMA 4IM4A 2BY1A 3FY1A 5M03A 2YBUA 1BFNA 3EDDA 2NT0A 3UEQA 1UD5A 2VX6A 5BYWA 1E1FA 1J10A 3OGSA 2W5FA 3TTYA 1BQCA 4DWSD 5M17A 2AMGA 1LJYA 2JF7A 1PX4A 1B3XA 1CWYA 3CGTA 1AVAA 1GOQA 3WUGA 5CG0A 1OD0A 3PN8A 4RL3A 4U2ZA 3WDPP 4PBGA 3ZO9A 2VCBA 1WDRA 3VM5A 1SR0A 2D20A 2E3ZA 1Q6DA 2YDRA 3ZOAA 1E15A 1V6WA 2WZIA 1R7OA 4GI9A 4Q22A 2GDVA 2Y5EA 1GVIA 3VIMA 4KGLA 1BPLB 3DYMA 1CLVA 3DC0A 3WFLA 4WJXA 4M8UA 4PEEA 2DSWA 2VVSA 2CBUA 2IXVA 4W5UA 3D5HA 1WB0A 4UFHA 2YA0A 3T08A 1EIBA 2D2OA 2YL9A 4EANA 3WUEA 4V28A 2WNWA 2WVSA 5ABGA 2VTFA 1BLIA 1VF8A 4GZJA 1DWIM 5CPQA 5FCZA 2BHYA 3N13A 4AZCA 1J18A 4PMXA 3THDA 4Z2HA 5AC4A 4XZBA 1KR1A 1DP0A 1I75A 1PX3A 5AC5A 2G3NA 1L8NA 2YA1A 1V0NA 2JALA 4ZXOA 3L2MA 5CLTA 1W9PA 3OLEA 1UD3A 1UWQA 1E43A 1M01A 4CCCA 1B3ZA 5C8BB 2ZXDA 1VIWA 4W8BA 1EQPA 3SCQA 3AS0A 5EB8A 2EBNA 3WD0A 2WMHA 3BAYA 3WFZA 1CBGA 3W27A 1VFUA 5GQBA 4ATWA 1WZAA 1CNVA 2D23A 3K8KA 3S6TA 2WK2A 1QNOA 4W84A 4CVUA 1ODUA 1EOMA 3RO8A 1F4AA 1IZJA 1NARA 1MQPA 1GOIA 4OJYA 3ARYA 1HF6A 5D8WA 4TVUA 5AYBA 1HJUA 1RH9A 1GQKA 2W61A 4HOWA 1UH2A 1ITXA 1WDSA 4YHEA 1B30A 2E40A 3W6LA 2PB1A 1GOOA 2ZICA 3E1F1 1C8YA 5D8ZA 2FGZA 3IAPA 3FW6A 4N0RA 1EDTA 3I3EA 3AS3A 2CNCA 1US2A 1E55A 1YHTA 4UFJA 5A6JA 3WBAA 4HA3A 2J7CA 3VILA 2VZVA 3QGVA 2WZHA 3ZM8A 2D3LA 4JHZA 4KRUA 3RJYA 5GNXA 1FH8A 4PMUA 2F8QA 2WKLA 5BWFA 4P7QA 3EDJA 3MU7A 1JD7A 1PZ3A 3T0AA
chains in the Genus database with same CATH superfamily
2F2KA 3BZGA 1UR8A 4FX6M 3WK1A 2BODX 3UXIA 3CMGA 3AXXA 3KRUA 3WELA 1O5KA 1OCJA 1POKA 4NZ1A 4LF1A 2YBVA 2HZGA 5BRPA 4FAPA 4JTFA 3T2OA 4H9VA 2WO5A 1EYMA 4B5XA 4UOZA 3GB6A 2IPFA 4JEQA 5RUBA 1IR1A 4PB3A 1T0OA 1C91A 3MHUA 4HA0A 2EAWA 4IQ2A 4R0XA 4ITZA 3UJFA 1HIZA 3LHVA 5K9CA 2NSOA 1IZKA 1OINA 1U30A 2QS8A 4JYSA 3IJLA 4K1WA 3ZT5A 3A47A 3AMKA 5EMYA 3GTXA 3IJ6A 1TR1A 5AVHA 1FFQA 3EA1A 5HUAA 3RFWA 5ECVA 4IX0A 3RPTA 3BQ5A 5TAOA 1ISVA 1DTUA 1Q6OA 4RK8A 3R11A 2R91A 2BY0A 1SR9A 2FPYA 4LAXA 4GYJA 1L8PA 3PJTA 3W1AA 4PTXA 5BMXA 2CBIA 3IIOA 5AB3A 5DMYA 4M1BA 2ZWYA 1V3IA 2E09A 4K7VA 4FNUA 3NQMA 3OJGA 3LCFA 3E96A 2PCEA 1NF0A 1FWCC 4D6GA 1W17A 3LXBA 5KEZA 1BEUA 3I6TA 5D9NA 1Z3NA 1ZBKA 4HBKA 3GH4A 2BB0A 2JZVA 1VCVA 4YCOA 5IFTA 3CZGA 2NW0A 1LWHA 3OA3A 4MHBA 4JIHA 1DIOA 4YTTA 3PHAA 4GLEA 4X63A 3CEPA 3ARRA 2OLHA 2YW3A 3CAVA 1B3OA 3NNTA 3SUVA 4ZVJA 2IUZA 2UZ9A 1UD4A 1FCQA 4Q8MA 1KM4A 2ZDSA 3RGTA 4CD8A 4FALA 5C2GA 2XM1A 2XSAA 5DBTA 3W7RA 4HU3A 4M5PA 5BOFA 2DZVA 3P82A 5HMEA 4PMQA 1TMQA 1JAKA 4ZO8A 3RUBL 1XG4A 5XINA 2OFNA 3T8LA 4WOQA 3NGFA 5C71A 3N2XA 3KOWA 2I7GA 3OW1A 3VDCA 3AUJA 4NZCA 1SZGA 5BXPA 4WSHA 3DFSA 2J7EA 1EF3A 3WF2A 3GNNA 1YXYA 3SAZA 4HT3A 2OO0A 5KZMA 3IIZA 1W9VA 4R3UA 2VFIA 3CJPA 3C8FA 4B5NA 2WVVA 3SRHA 2DSUA 1F6YA 4HNLA 3RIKA 2DGAA 4JYFA 3W2LA 3GNPA 5GNYA 4R27A 3VD3A 4NY2A 3NI6A 3PANA 1YBQB 4AD0A 4BKNA 4F48A 5A95A 5I0DA 2YSWA 4MGVA 3KE0A 4W8LA 4XSLA 4A8LA 3QHMA 2VWTA 1XX1A 4HA4A 2WOQA 4X2RA 2AL2B 3BWWA 5M5DA 4DO5A 1PIFA 3AZRA 4M24A 4QQUA 1AW2A 3FGCB 1UCWA 2UY5A 4LAWA 5EBAA 1VFOA 3THCA 4KFOA 1MXDA 3OP2A 3LLDA 5LKYA 1TMHA 2GGGA 4YMZA 3DI0A 3WJWA 2V0TA 5HDRA 4H19A 4HCDA 3BV4A 1XQKA 3QGKC 3QPZA 3L4TA 2HDJA 4O19A 2PCQA 1KO0A 4A21A 1FHDA 4FA3A 3VGHA 1RBAA 4RKAA 1YTDA 1KRMA 2P5NA 2QCLA 1LLZA 4BS0A 3VDGA 1ISXA 3RN6A 1DWFM 1AZ1A 4ZPWR 2Z28A 3BLEA 4PYSA 4IMDA 1GYLA 1WNOA 4LYRA 1XYCA 4YS1A 9XIMA 3AALA 3A12A 3A4WA 1HG3A 3IGXA 3RLVA 1QOXA 4RZ5A 3QSTA 3GXIA 1ZLPA 5CC3A 3A4JA 5AFDA 4JIQA 3G1XA 3U5YA 4LY4A 2XZ7A 1E56A 1J0HA 1I6NA 3P60A 1H1YA 4RDZA 1Z48A 5IRPA 3NQGA 2P3EA 1JZ8A 2CIPA 4FOKA 2REQA 3R0KA 3GXTA 4NIRA 4DUXA 2FJKA 3U2CA 4QTGA 3TFCA 2DH3A 3V18A 3GG7A 4DY1A 3C2EA 1QOPA 3M5YA 2ZRVA 3LV6A 4EE9A 1HQTA 2WNNA 1KFWA 2I5QA 3GDLA 3VDBA 1VBUA 4A3QA 4MYXA 4X0NA 2VI0A 1TO3A 3R58A 1NSJA 3EXTA 3TJ4A 1XJBA 1E6RA 1J96A 4GUGA 1WOAA 2WVTA 1R38A 3UZYA 4DRMA 3BJSA 3VNIA 4MZ1A 4GC4A 3H2EA 4LVAA 1TX2A 3VKKA 4M81A 1DE5A 3GIQA 3RLUA 3SY5A 1VFMA 2X05A 6TAAA 1JCYA 3ZJ8A 4GVIA 1IT0A 1T5AA 4JTUA 4PL1A 2X41A 1SZEA 3SGZA 2RUCA 5A5WA 1FHLA 2ALRA 1KTCA 4R88A 4XAPA 1YNQA 2CHRA 4OECA 3SRDA 4US5D 3CUJA 4MB5A 4FHAA 2C13A 1WYIA 4Z1BA 2QKFA 1N1AA 3I7RA 1ITCA 4HCHA 2ZIDA 3QBUA 4ZENA 3EMCA 1DE6A 3S83A 3M6YA 2GOKA 5TNVA 4GK8A 3ALGA 1B9ZA 1WAUA 4QE5A 2YDQA 4G8TA 4L5ZA 4AEFA 3RNDA 1F9CA 4MY9A 3GDKA 3MCOA 2XISA 4S3GA 2W4XA 3FEMA 4MAZA 4NASA 3S5SA 2E8YA 3T78A 2GOUA 4B3KA 3UG8A 4J3WA 4GXMA 1A7XA 5FD0A 3MJYA 4DWSB 4ZQRA 2PV1A 1MRAA 3WKZA 3QLDA 3N12A 1ONWA 1XLEA 3NURA 4NAEA 5C7VA 1YTEA 1D3CA 1HXJA 2J7FA 2QJGA 3I6CA 5EFFA 3BOLA 1TJ2A 1NFGA 3ES8A 3BLPX 2PP1A 3INPA 5FESA 4DJED 1D7FA 4P5UA 3B04A 2QGYA 5D75A 3SY8A 2BP1A 4JY8A 5FJIA 4O12A 4QG6A 3ZYZA 3F7JA 2YXXA 3ABSA 3B06A 4DJFC 3CO8A 4D6FA 2YA2A 1T7LA 1AUSL 5BOEA 3N2MA 5JH1A 3MZ2A 1L1PA 3NWRA 2GK1B 4UFMA 3N4EA 1NY1A 3S9YA 2PWFA 2VEIA 4WEVX 1V3LA 4D6CA 1WBJA 2ACQA 5CPLA 1QI0A 2VFDA 4PTWA 1JCTA 3KOZA 3AU6A 3RYSA 2X7WA 2NQLA 3HOJA 3WLHA 4TW7A 3PVFA 4ODKA 2VURA 3GKFA 3S42A 4P7LA 2YDAA 1R30A 4XBJA 4JQ1A 5D2TA 2H3DA 4MWAB 4JEJA 4J27A 2WJDA 3ZQ9A 2CHNA 1K9EA 1GK8A 1FDZA 4DWDA 3GS6A 3PZVA 1FFRA 4XZIA 2FYMA 4M0XA 3W1MA 1VRXA 4CN6A 2ZXAA 4A8NA 5KINA 4OTKA 5ENLA 1UWSA 3IJ9A 1GQIA 3N2TA 4GWEA 1H1ZA 2ACUA 3H2AA 3ITCA 4Q32A 4U5KA 1HJSA 2CW6A 3WBWA 1HP5A 1H1NA 1TCDA 2FKEA 2QCDA 1E9IA 3KOXA 3WL1A 3CBWA 1AK5A 3U0HA 1XBVA 1Z9AA 4E8CA 1JVNA 4I9TA 3TA9A 4IL2A 3M5XA 4LCSA 2A2IA 2XPKA 2A5HA 1L0PA 3JXVA 1AD4A 1QMLA 3KRZA 4ERIA 1QFEA 5J6EA 1EYWA 1JNDA 4BF8A 4XSMA 2HCVA 2PPGA 1SJBA 1EP1A 1TV2A 3BZJA 4PUJA 1B4KA 2B7PA 1MXGA 4R53A 2AWGA 1VEOA 3PPGA 5A2AA 4O4WA 3UFYA 4HMCA 1EPXA 2X40A 1IQ8A 1AMYA 4PMJA 4H01A 3RCNA 5BW6A 1EO7A 4AF0A 2R1KA 4ORMA 3LB0A 4ERAA 2GFTA 3LCIA 4GCXA 1K03A 3GXMA 4QR6A 1TVNA 1J0IA 2QUTA 2Y4SA 1QPFA 1Q63A 2CYGA 3TCSA 5CBIA 1MW3A 5HKGA 5F2MA 2J13A 4CEXC 4QE4A 4LEQA 3E2RA 1B3YA 4ZR8A 1I2OA 3B0YA 4HHMA 1XRFA 5FJTA 4J3UA 3ITVA 4JTTA 2J8FA 3CL8A 4IFRA 4L4OA 1CLXA 2HXTA 2Z1SA 2WLZA 1JFXA 3NSNA 2OOFA 1H5YA 2V3GA 1KCXA 3S5YA 4A3RA 1WCGA 4QIUA 2EKGA 1FKIA 4Q33A 1W1YA 3P14A 5FEWA 1TA3A 4DLFA 2Z6JA 1P6BA 3PUEA 4JXCA 1SSGA 2ZUTA 1AODA 1J6OA 1H7WA 3KZSA 2CLOA 3QR3A 3VIJA 3PG8A 1CB2A 3AISA 4GVGA 2GZXA 1UMLA 1PHQA 3GAKA 1EEXA 2PDUA 1UA3A 4I9JA 1EX5A 3U7VA 3UVIA 5FL0A 4YIWA 1O1HA 3G0UA 3H9RB 3O5IA 3CAKA 2DZXA 1EJUC 4B2DA 2EG7A 4JY9A 4F0RA 3MI2A 3G2GA 2F23A 3LTPA 3P67A 1KGWA 3UGRA 4C7DA 2E8ZA 1K4GA 1IT8A 3TOPA 3WCZA 1U83A 4JL2A 1V6YA 4EK7A 5K7JA 3B8DA 1T40A 2Q3OA 4BQ3A 2QT3A 1OYCA 1H41A 2Z7GA 4QNEA 1TPFA 1A5CA 1GJPA 3QKZA 1HVXA 1KA9F 1IXPA 1CDGA 3NAVA 1QT1A 4BR1A 1GW1A 2XIOA 5AY7A 3O07A 3L7RA 2YCLA 1KM6A 4GIVA 3ZSTA 4YJ5A 3UBPC 1EWEA 3CZEA 3GK0A 2PDHA 1KBKA 3VE7A 1XH0A 3SN1A 3WLPA 1G69A 2XP4A 3OB8A 2CZ5A 4N2YA 2RJGA 3SSZA 3TEVA 3XISA 3O2LA 1NP2A 3LENA 3AOFA 3PRBA 1RAKA 1Q4WA 4JL1A 3NQCA 1BF6A 4AVFA 4BI7A 1W5PA 2Z24A 1B3VA 1ROTA 4FI4A 5EMKA 1XLDA 4TMBA 1WXYA 3C2FA 1FKKA 3U8GA 4TVCA 3W01A 2YKKA 1XICA 4L3NA 4X61A 5AC6A 4FNRA 4XAYA 1S2VA 5AVNA 1BRLA 2C14A 1LQ0A 5IHSA 1UWTA 1IIHA 2ZR6A 3M47A 4KESA 4UQBA 2WBKA 4WR3A 3ARTA 2PTZA 3WQ5A 4C6QA 1E3XA 1OABA 2EPLX 3PSVA 3PJWA 3QLLA 1OCNA 1J93A 3AIEA 2XVNA 3KAGA 3LRLA 1S3TC 1IT7A 3VKAA 3RR1A 1FUYA 1VZWA 1S5VA 4PULA 1X1OA 3NUKA 3C0LA 3DYPA 2WJZA 2ZUWA 3IK2A 4WGHA 5DY3A 1NQ6A 3NQBA 3EMQA 3UJRA 5M1TA 2E9LA 2JEPA 2A3LA 1NVMA 5F4WA 4WRHA 3K13A 4MGGA 3T8QA 3E02A 2CZVA 1E9YB 1UC5A 3GPKA 4IZGA 3ITGA 3VI2A 4N6EA 2HNHA 4QITA 3B9OA 1XGZA 3SN4A 4LC6A 1FWTA 3WQGA 2C8NA 2ZOXA 3ATYA 2C1GA 2R6OA 4L1GA 3H23A 2J47A 5G5IA 5CCZA 1M41A 1B2YA 2F4EA 3M7WA 3CZLA 3PRDA 2E6DA 3FYPA 3IUDA 3LCXA 2V9DA 4NX0A 4N4QA 1FD9A 4ZEPA 5HW7A 5F4SA 5A2BA 5KTLA 1XPGA 3E5BA 3WYZA 5FJJA 3P74A 4ZA0A 1RK5A 3RRXA 3GTYX 1FVPA 2ICSA 1DJZA 1M3UA 4C1NA 3W88A 2VR2A 4XZ9A 5G4WA 2D3NA 3KUMA 4PCTA 1YKWA 4RXFA 3HB9A 1OF6A 1ZY9A 3CIWA 5FEPA 1R8LA 3WH6A 1K8CA 1KM0A 3L21A 2J9YA 4U31A 3W7OA 3HFYA 2V6AA 3GDMA 2AGKA 1UJPA 4IPJA 4YXGA 5DIUA 3WK3A 3W38A 3W26A 1JZ4A 3URBA 1A5KC 3PG9A 1DKWA 2QPSA 3TLLA 1VIZA 4CCEA 5CPTA 4UUIA 2HEJA 1GPFA 1CT5A 4GY1A 3WFAA 2LJ4A 4GIAA 2OWWA 1XCXA 2P8CA 2UWFA 3T2PA 3QKEA 1FP8A 2PWGA 3ZMRA 1R3RA 1R9HA 4P8XA 1SSDA 2QUVA 2Z0IA 2XG9A 2CETA 4S2BA 4C6KA 1TPDA 1YE6A 2UV8G 2FAPA 3TXVA 4MKNA 1XBZA 2VX4A 4LU0A 4DO4A 4U5IA 1ISYA 3ISIX 3F03K 1U79A 1GGOA 3HM7A 1TTPA 2CLEA 1XSIA 3W25A 1UWUA 3TONA 3KP1A 3WLKX 1YW5A 2KGJA 2O4MA 5LIYX 1A5NC 4WIWA 4GYFA 4HVXA 5BXSA 4EPDC 1IGWA 1ZCCA 2VQUA 1GQLA 4HBEA 1W3HA 3EB2A 2R82A 1RQEA 5I78A 2I56A 3W1PA 4M29A 5DXYA 4Q8WA 5K2ZA 3VIOA 4XX6A 1A0DA 3M0XA 1ZRQA 2QCMA 2ZRYA 1EHNA 4ONVA 3ITXA 1I9CB 3FJ4A 3PNZA 4R7JA 1A5MC 1GNXA 2E0PA 2V5CA 3UWWA 1E0XA 4HMEA 4DO6A 1QVBA 2HJPA 1UZHA 4NXSA 1A3HA 1DJYA 1A5LC 1IEIA 1RA5A 1RPXA 1XFCA 4H1ZA 4NZ5A 3GWQA 1ZS2A 4RE0A 4TR9A 4YL2A 3OOBA 4DZ3A 4GKLA 5CC5A 2ZZ5A 3HV8A 1V6TA 5DF0A 2NVAA 2BASA 3NG3A 2DJXA 5DY2A 4A2SA 4NKCA 4LV4A 4X9YA 2C18A 2RGLA 1ICPA 3VIGA 4LTSA 3AU2A 2ZC1A 3MV11 4ZQCA 3I7QA 1OGSA 4AXKA 3W7MA 3IWPA 4IL0A 1OX6A 3KLLA 2XM2A 5I3IA 1JPHA 3SUWA 3WG6A 3SUUA 1HN1A 2OELA 5U4NA 3B8VA 3AIQA 4W93A 1V0LA 1F76A 3ID7A 1TG7A 3UG4A 4FF5A 2WNQA 1XIIA 3W24A 2PWDA 1Z89A 4EPEC 4RUBA 3IJIA 1OZQA 2RUDA 1EUNA 1OYAA 1JDDA 3W29A 4F9JA 1IEQA 2H90A 1ELSA 3LUTA 4ODQA 1U5JA 4S39A 3LXCA 4WLCA 4DNMA 1FKTA 1W37A 1EFZA 3UYIA 3VMPA 2O9RA 4Y90A 1B4EA 3GTHA 3WQPA 4HPNA 1DJWA 4AZGA 1W3IA 3C2VA 4N9EA 3B8WA 3UWZA 4DYJA 1U22A 1NJJA 2P8BA 1MFVA 3M44A 3MMDA 8XIMA 3SURA 4TXEA 5CJNA 1WDPA 1D7IA 3TIMA 4B5SA 1QO2A 1FBAA 5SWUA 4JKMA 2H8ZA 3GY1A 3LA4A 3TQVA 2XIBA 1CPUA 2PRMA 4J4OA 2OSYA 4MMWA 3F1QA 3BGGA 2J62A 3NDYA 5I3HA 1KXHA 1ZFJA 4OOZA 1BG9A 1JULA 1W8GA 2AL2A 3EX3A 2ZVIA 4FNPA 3FGCA 1AH4A 3G1DA 1JZ3A 4UZSA 5I3JA 2PBOA 1OG6A 2PDNA 1RJQA 3CC1A 3CB8A 3O5EA 1R87A 3DGRA 4XUYA 2D22A 4WDUA 4D1IA 3CHDA 3RJXA 3POHA 4DHGA 4E0CA 5ABFA 3E2QA 3JRKA 1EJTC 1O5RA 1H11A 1J0YA 1FWBC 1JR1A 3TW7A 3SCTA 1UKQA 2FJUB 5A6SA 2CU0A 4AC1X 5KSWA 1HJQA 3TXZA 3ZJ7A 2VEKA 1Q5MA 1ISWA 5A94A 1PPIA 1JDFA 2O9OA 1XBXA 1VLWA 3HMCA 6XIAA 4HOZA 2RKXA 3W83A 1A5BA 2Y24A 2VZTA 1M5WA 4LUTB 2W79A 1XFBA 3NCOA 4UIOA 3L5LA 4D8ZA 4Z2JA 2ATMA 4GQRA 1G9HA 1U1UA 4YVPA 4OGZA 4LEFA 3OGVA 4U2YA 4JBRA 1V03A 1NWTA 1GHSA 1JDEA 4W89A 4KETA 3MMWA 2F6UA 1MEHA 3L4WA 4NZ4A 1VYSX 1A4MA 3LMZA 2QHAA 1UB3A 4O1BA 5HMDA 4WDXA 3JYJA 4YVXA 3V0SA 4KCTA 2B7QA 1LUCB 1H7PA 1LQ2A 1V6VA 2DDXA 1KFCA 3EOUA 2GLKA 1Q2SA 1JI2A 4O1EA 2X1SA 3GTNA 1H7NA 4F66A 5B80A 2XP3A 3MUXA 2BTMA 1K9FA 1F8IA 2OSXA 1CIUA 2P0OA 1JZ2A 4JTQA 5AN7A 3C86A 4G56A 3IGSA 3PZGA 1NOFA 3CLWA 4RZ4A 5E5CA 3B4UA 4X60A 3QPEA 3WBXA 2VDIA 1AQFA 2QJIA 1BSIA 2VDHA 3S0CA 4IQEA 3IJ7A 1JPMA 2C15A 1B5TA 4F4RA 1H2JA 2ZCGA 5BRBA 3BGJA 1WZLA 1GOXA 1UZ1A 2PGEA 3FAXA 3GW3A 5DLCA 3U4FA 1ZALA 3GXFA 4HIBA 3T0DA 1TMLA 4S3DA 1DOSA 3TYZA 3C56A 3LNPA 4Y9MA 3O3RA 1PWLA 3P6LA 3UYCA 1MUCA 1Q7MA 3STPA 4F0MA 1PIIA 4G5DA 1CXLA 4DWSA 5ABEA 4LNCA 3TSMA 3E49A 1DJGA 3WLNA 2VCDA 2HISA 1KGXA 4B2DD 3Q67A 3S2CA 1XM3A 3M6DA 3CZKA 1KRCC 1KQYA 3KDNA 3QR0A 3P84A 2HE5A 5GVJA 4UQ9A 4IPXA 3H54A 4W7WA 1CCWB 4GUJA 1X97A 2X42A 3TDFA 2AQOA 2BXVA 2J66A 4C1KA 2NVCA 2VEMA 3BARA 2HK0A 4BJHA 2ZX7A 1GKRA 4CGTA 1W9XA 3LLXA 4AIUA 4ZL1A 2G4FA 4GXWA 2B7OA 3CHFA 1QJWA 1UJQA 4OOUA 1DPMA 3GVWA 3AQUA 3Q4DA 4UNKA 1RBOB 1AD1A 3ABZA 2GK1A 3EKZA 2WMFA 3A64A 3WUFA 4LW7A 4QDPA 1OX4B 1LRQA 4DAIA 2ZZ2A 3NZPA 1W9UA 4KEVA 1X38A 3R0DA 4V1XA 2PPOA 3M0ZA 3V75A 2PF8A 4RLIA 2OSWA 3VNJA 2ASHA 3UU0A 1Z32X 4U3AA 4DQWA 3W02A 1J8VA 1HL2A 5DIVA 2YL8A 1PB0A 2IKIA 1UQZA 2A3HA 1Q6EA 2NT1A 2R8WA 1ZZMA 5CC7A 3UQIA 1ZGDA 4GRSA 3NPVA 4JTLA 4DZIA 1REQA 5DANA 1LYXA 2J9XA 2I5IA 3QH2A 5BXJA 3R94A 1WQ5A 4HNVA 1T6MA 3SJNA 1MW1A 1IEVA 3OIHA 4IM4A 2YBUA 5LXEA 2D2HA 2ZC8A 4PH6A 1R2TA 1UIOA 1S39A 5AOUA 1SFJA 1BQCA 1LJYA 3CGTA 4OE7A 2LGOA 3PF3A 3UR2A 5FEXA 4PA8A 5EPDA 2QCEA 1GOQA 3LHUA 1SFLA 1OEPA 3M0KA 4U2ZA 3QY8A 4PBGA 4XZHA 3ZO9A 2PDCA 1N2VA 1WDRA 3BV7A 3VM5A 2D20A 3BVJA 2E3ZA 1Q6DA 3KBVA 3T9PA 3ZOAA 2I16A 1E15A 3EWBX 3IUHA 1NF7A 1IHIA 2OKTA 1EBHA 4UMCA 2GDVA 2Y5EA 4L4LA 1FWAC 3VIMA 3RAOA 4KGLA 3M5VA 1OFPA 1B6CA 4LVDA 4ZODA 2IXVA 4W5UA 5G2HA 2V5JA 3NQEA 3UCDA 4MSSA 2D2OA 1UASA 3UXLA 4EANA 2E28A 1Q85A 4GYPC 3VNMA 1DWIM 3QFEA 3CPGA 3KCLA 1V5XA 1LROA 5CPQA 3GNXA 4HB7A 3N13A 1A3WA 4PMXA 4JFMA 3CB3A 2INZA 1OFRA 3RF9A 3KDOA 5I98A 2A4AA 1PX3A 3STFA 2YA1A 3GNDA 4E8GA 3OLEA 2Q8LA 1R3QA 4CCCA 1B3ZA 3S3GA 2OODA 2RSEA 4A6GA 3SO7A 1KRAC 4MY1A 3OO2A 2WMHA 3BAYA 4LAVA 4TNSA 1QW7A 7ODCA 4ATWA 4M6PA 2D23A 3KVJA 3QV9A 1X7IA 1TUFA 4YNGA 1Y0OA 4HNOA 1F4AA 3SFWA 2FQIA 3BLLA 3DG7A 1TV4A 4BI5A 4I8YA 1I2QA 1A5AA 2B5UB 1HJUA 1WDSA 3P3BA 1B30A 3W6LA 1Z8AA 4KEZA 3UZ5A 4KPLA 4IIFA 1C8YA 2FGZA 3TKFA 1VFLA 1SW3A 2RH9A 3NQFA 3HBLA 2CNCA 4UFJA 3ZS4A 3O1NA 3KABA 4IFKA 4HA3A 3WBAA 5LIWX 2VZVA 3GXPA 3QGVA 2WZHA 4O1CA 3W2KA 4LOCA 4WVXA 4NNRA 3E74A 4P7QA 2E25A 1JD7A 4C6OA 4HNNA 3T0AA 1RBLA 2Z2UA 5BNKA 1SMDA 3KBMA 5LA2A 4LS2A 4LUSB 3RPDA 1JQXA 1TCMA 3AZTA 4WY0F 4YCPA 3GHSA 4P8VA 3HZ3A 1BXCA 5MF5A 1FHUA 4REQB 2XFWA 2VYOA 2E9MA 2Z29A 4OIFA 2PN0A 4NI3A 4ROQA 4AU0A 4ZB0A 4H41A 2RHGA 5D05A 3Q2DA 3SGUA 4JIRA 1AG1O 4NYUA 3UCCA 3QFWA 4ZFMA 3GG0A 4ZTYA 2OX4A 1CGXA 3P81A 1EIXA 2VZSA 4A4AA 3BL3A 2OTDA 5HUOA 4YYCA 1V51A 1R85A 4LAZA 4IF2A 3LSCA 1K9TA 3LPGA 1FKJA 2GWGA 2XIJA 3GU2A 1E1CB 4H6QA 2CLIA 2O56A 2XVPA 4WZHA 2OYMA 1S2AA 1SMAA 3SBFA 1G01A 2OT1A 5FF4A 4JR5A 1AQHA 2EPNA 1HKMA 3QQ1A 3BG5A 4Q8NA 2EEXA 3HPSA 1WAWA 3ARPA 3L65A 4J3TA 1GCYA 4LFYA 3AMCA 3KL5A 1YATA 1US3A 2VOMA 3LMYA 4RZBA 4JQAA 3PTMA 3APYA 2A3EA 4FK9A 4Y2WA 1M7XA 1VP5A 1EXPA 5AC7A 5JIWA 2YZRA 4M6VA 4HN4A 3QM3A 1XWYA 5CPNA 1ZP3A 1ZJAA 3M16A 2LPVA 1QPLA 2EPOA 4BZYA 2HVMA 4HNTA 2VMFA 4JKKA 1LLOA 4PMRA 1A53A 3W7EA 2BOGX 4CNNA 3TZFA 4XIMA 2QR6A 3OZMA 3S4TA 5E0CA 2NX1A 3IANA 4G9PA 4G7EA 5LNWA 4NRRA 3GBDA 1JGIA 3UZWA 1C3FA 1UW9A 1SZFA 3FAPA 3W87A 3LCHA 1VAHA 3IKGA 5LHFA 2HS8A 1PWMA 7CGTA 2PDKA 3OG3A 4C6FA 4LUIA 2WCAA 4ODRA 3M1ZA 3T1GA 1ZAHA 1XLBA 2DFAA 4QIBA 2Z1KA 1ECQA 1YE4A 1YEYA 5HMFA 3QZ6A 3KCJA 4A3HA 3W1UA 1OK4A 1TPH1 1XC4A 2D2GA 4FZIA 3A13A 3VNDA 5A8PA 3N9RA 3EX6A 1IGSA 2OZ3A 1ALDA 2HXUA 2GDUA 3RRAA 2UBPC 2IXUA 3IRSA 3CV7A 2QULA 3N4FA 4RW3A 4ZQNA 1JYWA 1ESWA 3RMJA 1EWDA 3RCYA 3PFMA 2YIHA 4Q4OA 4H9UA 1GOKA 4I9MA 1HT6A 4XKYB 1Q13A 2IQDA 3FJNA 3IEBA 4I3GA 2B81A 5HINA 2XFYA 1TJ1A 3GFXA 3JR2A 4HK6A 1WKYA 1E9LA 2QUMA 4US6A 1GTEA 4H00A 3SCOA 2ZYFA 1VBGA 3RM8A 3SFKA 4LYQA 3TN4A 3QPYA 1H63A 3BMXA 1S1RA 3LGDA 3KWSA 3N9SA 2Z1VA 4JFSA 2HRWA 3H2CA 4W85A 3W07A 1PXGA 1PX8A 2X2YA 3HPFA 1VQTA 4M3PA 2HROA 1XIHA 4I5XA 2HMCA 1XSJA 4H7VA 4BQ2A 1DVJA 3EPOA 3LTSA 4Q4SA 2YJQA 2XH0A 1VYPX 3DBPA 3R10A 2ABAA 1TFVA 6REQA 3PULA 1UHVA 4FO4A 1FKHA 2CPUA 4L6DA 1F3EA 3LUOA 3NIYA 3AIWA 1NMWA 3KCOA 2DZUA 1G5AA 2A7RA 5CEWA 3VGDA 3TTEA 1OY0A 4PCSA 5IFPA 4XG1A 3QYQA 4I90A 5I3GA 2FHCA 5T91A 3S8HA 4E38A 1MZRA 1BVWA 1P6WA 5HK4A 1YDOA 3B0UX 3MP5A 4IQDA 2R1MA 4LS0A 1QHOA 4E6MA 3AXHA 1AL8A 1I2NA 1OGBA 4HYRA 3AHYA 1K7XA 1W6TA 5D37A 3RU8X 4NJGA 2VC7A 2VFFA 1YQ2A 3UI6A 4AWTA 3GVQA 4L80A 4H6RA 1TB3A 3QTGA 3UQAA 1VKFA 2F6XA 3LN3A 4F9DA 5HWBA 5A8OA 4ZO6A 2GJLA 1DIEA 2H3BA 4NZ3A 4XAFA 3BO9A 3VKBA 4XO7A 3H7UA 4XTDA 1JFHA 4TVDA 2PP0A 4LALA 4Q8TA 3J7HA 3H55A 3LGGA 3WLIA 2XU2A 1DJIA 1PAMA 2W9MA 3NZRA 4ZQMA 1A49A 1ZB5A 2YZ5A 4C60A 3A24A 3O6YX 2AAAA 3VE9A 2VRJA 5GPGA 4HP5A 5IHRA 3B8TA 1I1XA 4X9SA 1XHGA 5K4XA 2OMAA 1SFSA 4NZFA 4AZBA 2AGTA 3G3MA 5K9XA 1E5NA 3NYDA 1D7JA 3R12A 4MF4A 3LBCA 1M68A 2PDYA 4NL1A 2DP3A 5JQ9A 1CECA 2VC9A 4J4NA 3RX3A 3URNA 4RPPA 2P4VA 9CGTA 4H8NA 3V7PA 1I1WA 5AZ1A 4HPHA 4DRHA 2D24A 3HG4A 4GH1A 5HPOA 1VFFA 5FF0A 1LQAA 4W9OA 3WJSA 3PZ9A 2VRQA 1K3UA 4Z1AA 1XINA 3TH6A 3GHTA 4NRSA 3VIHA 4AYSA 4MOZA 3SJ3A 2E68A 4J35A 1JZ7A 2CHOA 3HURA 4JTKA 1JAEA 3HU7A 1BKHA 2MLZA 4UR7A 5CJMA 5M2FX 3OLGA 4L4PA 4CNSA 2DZSA 1VBRA 5FSDC 3GNRA 3GDRA 4TTUA 1OBAA 2BGNE 4V15A 5HJYA 5DFAA 5BROA 7XIMA 4JKLA 3RCMA 5I09A 5K4ZA 3L4UA 3WEZA 3UR5A 2Q3RA 4B16A 1M7JA 2NXHA 2X0YA 3M0VA 5H2ZA 2E9BA 3H8AA 4OHQA 7REQB 4IWWA 3VDAA 4FIQA 1H0GA 2OXNA 3R8RA 3CM4A 3WQWA 3O5GA 1PEZA 4JTRA 4WSKA 3TC3A 3KHJA 4D6JA 3IIPA 5JXQA 4LCQA 3RMEA 5HPCA 3DFTA 3U4AA 1CXFA 3N4AA 4XB3A 1RPKA 4DIPA 1LZOA 2DZWA 1U1JA 4M56A 1PTDA 2PD5A 3ARWA 3WH8A 2BY3A 1MI3A 3A4XA 3AO0A 2D2JA 2F9RA 1N8WA 2F2DA 1EA9C 3BAXA 3VFCA 3UPBA 3IV3A 2CWNA 1GONA 2B31A 4RW5A 3NPWA 4LAYA 4IIBA 3OTRA 2ZZ4A 2A79A 2A1YA 1WX0A 5AHFA 1HJWA 3CQJA 1SUXA 2Y6ZA 2TYSA 3CZJA 4HA1A 2R1PA 4JTIA 4PUMA 1UP2A 5A6KA 1WDQA 1VENA 4O1DA 5CSYA 2WMIB 1S2WA 2QLYA 4AH7A 3S9IA 1RCQA 4ENLA 5HOSA 1Q6GA 3AWNA 4LS1A 6ENLA 2H6RA 4CLMA 3B0XA 3PZQA 3DAQA 4DX3A 1OFAA 1KKOA 2WAGA 1FDYA 1XF0A 2FH8A 2PWEA 4U86A 3A4AA 3GH5A 4GIRA 3MO4A 3ZIZA 4NF7A 4RE4A 3BG3A 3MQTA 1P0DA 1PZ2A 3HPZA 1EA0A 2DUAA 3ZJKA 3BCFA 2UZ5A 4W88A 3F5JA 1VJIA 4QCEA 1BHGA 5HWNA 2O7SA 3L67A 2JIWA 1TTJA 4OBRA 2DSVA 3O05A 1HKJA 3A5VA 1EOKA 4K6AA 4IPIA 3FXYA 1ADOA 4FEZA 3IUIA 3QV6A 2NQ5A 1E6ZA 4MG4A 2C0AA 3LM3A 2IKHA 3WEOA 5MHBA 4LBUA 1DWHM 2H9AB 3KOYA 3OU8A 3H7RA 2MLYA 1W5NA 4ICNA 2CBJA 4CKQA 1QI3A 3KP0A 3W7QA 2BHZA 4K7YA 5C5YA 2PDBA 1H0IA 4HNUA 5LHEA 3STGA 2Y8UA 3GC2A 3B8IA 3OHMB 3CGNA 3U2EA 1PUDA 3GKAA 1HTIA 4LUJA 2XVLA 4W9TA 1NOUA 1KFJA 2PWUA 3O5DA 3TQ0A 3L9CA 1FP9A 2G50A 1MO0A 4O57A 1KV5A 3ZZ1A 1S5NA 3TTQA 1F8MA 2OZTA 3BXWA 1TWSA 4DF0A 3KTXA 2POZA 5MKGB 2HVNA 3KZ7A 3CMFA 3KVKA 4K37A 2CKRA 3GH7A 4GO8A 2HWGA 1XH1A 3CU2A 3O6AA 3THAA 3MTWA 4UTUA 4Z2KA 3OZOA 3OVGA 5CGMA 3WUBA 1FWEC 2DQXA 3TWAA 1AJ0A 2OLAA 1RP8A 1KBJA 3UJ2A 2V38A 2ONEA 1H62A 2PV2A 1E9ZB 2E6FA 4WGXA 1OX4A 2JKAA 2W91A 4B3ZA 2G3IA 1X6LA 1A80A 2HQAA 2GQ9A 5I7GA 1TJ0A 1G94A 1W3KA 2QV5A 4H83A 2FPTA 1LRTA 4XZNX 1PINA 3SECA 3VD5A 3DFNA 3BLFA 1V0MA 4QSFA 2UY2A 2V63A 4PMYA 2YL6A 1BWLA 1XS2A 5GJNA 3PUDA 4PN2A 1VR6A 2QJMA 3CWHA 3M9YA 4B5UA 3N73A 1HKIA 2WC7A 3GXNA 4MPQA 4TX6A 3CZ8A 5G1MA 3AHVA 3NOEA 3NDOA 2L2SA 2YYUA 4Y9NA 5JH8A 4UTLA 5FL1A 1OM0A 3GO2A 3B9AA 2PE4A 1OB0A 2FZNA 1H50A 3E9AA 4JAWA 3WQ6A 4WJEA 5AYIA 3GTIA 1BWVA 4IJCA 4UTWC 2RDXA 1Q66A 2NQ9A 3GYCA 3NPXA 2QDHA 2KR7A 2JBMA 2OKOA 1KT1A 3EPNA 1GEHA 1O68A 1EBGA 3GM8A 2PDJA 4W8AA 2C6QA 4WSJA 3SRKA 1MSSA 3R4IA 2PLMA 3GG8A 3KTCA 1HZYA 3CMJA 4WY0A 4XD5A 1J79A 1QHZA 2ZKMX 2PZ0A 3LQGA 1SJAA 1RALA 8CGTA 5AHNA 4MADA 1SO6A 2PI6A 1FCBA 1KR0A 2A85A 2DIEA 3PP7A 1BWKA 3VGBA 4XO6A 2VD9A 5HWJA 4UNIA 4P7RA 3KVLA 4JCLA 1VS1A 4LBSA 4GO9A 4IJRA 3LNMA 3MMTA 3VIIA 1XIBA 1FTXA 4C6NA 4ZQPA 4H7CA 3W70A 1LRNA 4AD3A 3O5JA 1R47A 2ZUNA 3WZ0E 1ZK6A 1XIEA 4PTVA 3N25A 1XIDA 3T0BA 1CXHA 1JUKA 4PUKA 3TW6A 1G7VA 2J77A 2PGWA 1VRDA 1K6AA 4XZMX 3FEQA 4JHOA 1Q6LA 4N6FA 4AHOA 4FXSA 5FF7A 3PWIA 3CASA 1XIFA 4HQVA 4LPCA 3RLGA 2CERA 3VFLA 5F2LA 1QASA 3I4KA 2PP3A 2I17A 3W37A 8A3HA 2XFFA 3QZEA 2N87A 1ITUA 4F0KA 1OADA 1Q6UA 5LNSA 2VDGA 3B05A 1U2YA 2R14A 4LAMA 3HG3A 2EKCA 2DW7A 3FK4A 2J78A 3ECQA 3N3MA 4WCJA 2QCGA 3W84A 4E2OA 3S1GA 3H2OA 5H1WA 3I3DA 3NA8A 3AROA 2I5GA 1DTNA 5DBUA 1QPOA 2L5HA 3GVVA 3UG3A 1FHVA 4Q7BA 4L7ZA 4LQ1A 3D6NA 1YMYA 3BK0A 4K38A 4X22A 1WUFA 1TVPA 1XCFA 3FS2A 1UA7A 3R0UA 4IXHA 4C90A 3VOGA 3WQ4A 2XFRA 4OQVA 4PUEA 4JQ4A 5ABHA 1AH3A 2R1LA 2J7BA 3AIRA 1KC7A 3BLIA 2E67A 3LDVA 1G67A 3EIPA 2PAJA 3UZJA 4IP7A 1XGDA 1LDCA 1W56A 2ZTJA 1XISA 3L2IA 2GQ8A 1Q65A 4A3UA 3SCRA 3GYEA 4HU0A 4OBTA 1KWGA 3NZ1A 4JCMA 2Z4GA 4REQA 4INFA 3MZNA 3Q94A 1F4HA 3QQWA 3HTWA 3W82A 3ZXWA 1YXCA 4EAMA 5BXTA 5F1UA 2G5WA 3LS9A 4KR0B 2XJ7A 1IEXA 3FFSA 1PE1A 3AHZA 3EA2A 3S1UA 4FSAA 4DUOA 1P7TA 3N18A 4KKXA 1R86A 1NWRA 4MJMA 2OEMA 5FOOA 5I6SA 4ADUA 4E5TA 5GJMA 2QMKA 1E1CA 1XYZA 4O4VA 4MFEA 2PPNA 1UR2A 3NL2A 4A05A 4LF2A 1DWJM 3VA8A 3E3HA 3IAQA 5B7ZA 1QW9A 1QPRA 2DT3A 3TU9A 4R34A 1ZAIA 4AQLA 4UC5A 1TRDA 2PSNA 2EJ1A 5LXXA 4XTIA 4CNPA 3DG3A 1G0CA 4ZMGA 3IS4A 1H61A 2FIQA 3USBA 3CPUA 3MHGA 1E51A 4IX2A 4IHCA 2JGQA 1R6WA 4HHPA 3GC4A 4B5TA 1ZSXA 2EF9A 4PBEA 5HW6A 3SDOA 3RU6A 2I9UA 1E70M 3G1YA 1QXLA 2J75A 4IXXA 2E7FA 4A29A 5JU6A 4ZO7A 1OD8A 3Q58A 4GZIA 1QNSA 5D33A 4GH3A 2HE8A 5BMWA 1VH7A 3G22A 2OEKA 1HXVA 2FLIA 2BOFX 1W9BM 1YLVA 5EMMA 1E4IA 4CNOA 3WBYA 3B97A 4PMVA 3IRDA 1VFSA 1EF2A 4AZHA 5CC6A 5REQB 3DFPA 2IKGA 3FJLA 4GQQA 3QEZA 1A50A 5A6TC 5BXRA 3DUGA 3KAHA 4UTKA 5EY5A 2YX0A 4YWIA 3BW2A 1L6GA 4ES4A 5M3WA 2BOEX 3H4WA 1OZMA 3M5ZA 3G1FA 5HW8A 4C6CA 1Q8JA 3S2MA 3WMSA 1KT0A 4JTSA 5D2VA 2HBVA 5I02A 1PKLA 4GVHA 2WSQA 3WIJA 4DM2A 4GZ7A 2MNRA 3CV2A 4GE8A 3LV5A 4QE1A 3W7GA 1QWKA 3W0KA 3S1WA 3TP4A 4U10A 1AJ2A 4F2UA 3TZNA 3VOFA 2WYSA 5HXMA 4JYDA 1K6WA 1PKMA 1WA3A 4PCNA 1TPC1 4Q7NA 3IJ8A 3HQOA 3P2VA 4PCPA 1HO1A 3QR1A 3TFXA 4OKDA 2F6KA 3Q45A 3CTTA 2E4TA 4DAFA 4OBSA 4R5EA 4KEMA 4AZCB 5DX7A 4KCWA 3C3UA 2Y78A 2VC5A 3W23A 3S5OA 4GJIA 1THFD 4FMVA 4XKYA 2XIMA 3ITOA 1ZPTA 3W6YA 3AC0A 4U3CA 5L9FA 3W72A 2WQPA 3MJMA 3WJXA 4XVDA 3LERA 3QOKA 1E3ZA 1PCKA 3DI1A 2WLYA 3MW7A 5AECA 5HNRA 2ZX9A 5HTGA 1SU5A 2XIQA 2V81A 3AWOA 4JTAA 1P48A 2BVYA 3ZJ6A 2V69A 2PTXA 3ANYA 3MO7A 3AMLA 5D02A 4N4PA 2WZEA 4LT9A 3HJZA 3P8JA 1FX6A 4AZ6A 2FTYA 4FAMA 5C0QA 4PE8A 3DU0A 3H21A 4NJJA 3S2NA 4PCFA 1O7AA 1XIMA 4S23A 3C52A 1BYAA 4EF8A 5JBDA 1N55A 3V36A 1QK2A 4TOQA 1EX1A 3DH7A 1W91A 3O5QA 3KEHA 1B54A 5AYYA 3DFQA 5D9MA 4FB7A 3PFRA 5AKQA 5EKYA 3B7XA 3NQDA 2IF4A 4WF7A 2ZA2A 1QBAA 1OT1A 3AJXA 3TR9A 4PUWA 4A22A 4AMCA 5IDIA 3ZVHA 1OHLA 2PLJA 4ODNA 2VFEA 3RM9A 2PFHA 2ZRUA 4JFVA 3UZZA 3WL0A 4JZ5A 4E4PA 2CXEA 2Y70A 4H7ZA 4QJ1A 4NHVA 3RITA 3FA5A 4HCLA 3KADA 3PZOA 2W6RA 4Y8FA 1T96A 1WKFA 2BS9A 4IGHA 3F4CA 1J9YA 2BY2A 1JEZA 2VN1A 2PDMA 1RQBA 3MSRA 4Z1DA 4ACZA 2J7DA 4RR4A 3W73A 4YHGA 1G4EA 1W1ZA 5CXPA 3BH4A 4GBDA 3H53A 2HTMA 3BLDA 1A5SA 4KERA 3WD1A 3CT7A 1U33A 3KFTA 3FSUA 3I68A 1JXKA 4J3XA 4WKFA 3EA3A 3QV8A 3TOYA 1EJWC 5FI8A 2ALDA 4Q8OA 1W1A1 1PDZA 2WHKA 4RNHA 4C6BA 2GJPA 3G1SA 3NJ3A 1UWAA 2NZLA 2QEZA 5D38A 1RK6A 1X98A 3II1A 2GVJA 3IK8A 1Q6QA 1QNPA 4Q4KA 3HMJG 1J4RA 4IIHA 4C5ZA 4TV5A 4O11A 2V2DA 1JZ5A 2QGHA 5I2UA 4BCEA 1D6OA 2YYTA 2OVLA 4EOUA 5EGRA 4W7VA 1C8XA 1S38A 3GE7A 1GKQA 1KM3A 1PSCA 1PTAA 2Y5JA 4RV3A 4GBUA 1QPKA 1R9YA 3AYRA 4HMDA 4E8DA 5TD4A 3R8GA 4YTSA 4ORIA 3QTPA 1K02A 5CZSA 3TYCA 3LSBA 1G7UA 1UG6A 1GG0A 3W7PA 3VYLA 4O1AA 2QW5A 4OZOA 4D8AA 1WPCA 3SCPA 5FJRA 4NJHA 2VUYA 3O6CA 1V08A 1X8CA 5A8MA 2ZZ7A 4KEUA 4NVTA 3F4NA 4GMEA 3V4BA 3F2BA 1ICQA 4BK9A 3O6DA 5LIXX 5C2XA 4WOZA 3PR9A 2FZMA 5C9XA 4MM1A 4LUYA 3R13A 4JTGA 1SO3A 2OWCA 3KVMA 4EKJA 5TF0A 2OCZA 2DY3A 2DEPA 1KBLA 3NXLA 1O12A 1KCLA 1P1MA 1ROUA 3EGJA 2XPBA 2FB3A 1C9WA 1BF2A 2QQ6A 3GX9A 4UFIA 5CSSA 4JTCA 2F7FA 1E6NA 2VT0A 3NFUA 2QDGA 3CIVA 1O66A 3VZXA 2ZE0A 4MJZA 4NZJA 4DRNA 4JFKA 2O4QA 4K36A 2B0MA 1RVKA 3OQ8A 4DO7A 4H8HA 2HSAA 4UZUA 5I3FA 3HJEA 3C6CA 5LA1A 3NPUA 3IACA 1GHRA 4PEKA 4F0LA 4R7OA 2GSJA 4JX4A 1BSLA 2BY1A 3EDDA 4QEEA 2Z7KA 3UEQA 1UD5A 4PB4A 1TPWA 3T07A 4GNJA 4KWWA 4DYEA 5HNUA 4DRSA 2PDQA 3M0JA 1QCWA 4BWLA 4RNFA 1XIJA 1AVAA 4KWVA 3E5PA 4IIDA 3WUGA 5CG0A 4HNCA 1ML1A 2CLFA 3PN8A 4RL3A 5LGXA 2ZFAA 1EUAA 2J6XA 2E1WA 2OZ8A 2VCBA 1SR0A 3M41A 3IGUA 2YDRA 4HN8A 3UWQA 3K1GA 4RZ6A 1V6WA 2AQVA 4KF1A 5HQEA 1R7OA 1GVIA 1ZTVA 2IMRA 4DZHA 1OC6A 1YNYA 3E38A 1BPLB 2JQXA 3DYMA 1CLVA 1QU4A 4GX8A 3N2BA 1L6FA 2O0TA 1AH0A 3WFLA 4WJXA 4M8UA 1WB0A 1DXIA 1JPIA 4UFHA 2YL9A 3HG5A 2WNWA 5DELA 3W85A 1BLIA 3MYPA 4ZZ9A 1FWJC 2OQHA 4J3ZA 2PDLA 4ZCWA 1SM9A 3THDA 1H7RA 5D2YA 5FSEC 1K7FA 3STCA 3LBMA 4QDWA 2H9AA 3NOYA 2G3NA 4XBSA 3W7JA 2Q71A 1V0NA 4IIGA 1EJRC 1LBFA 3GR4A 1W9PA 3CIXA 3TCZA 1UD3A 1UWQA 1M01A 5C8BB 4DRIA 4W8BA 1T8QA 3SCQA 5EBUA 3WD0A 1R3WA 3HQNA 4S1FA 3DDMA 1VFUA 1CNVA 1XI3A 5D04C 4HSOA 2WK2A 1QNOA 4B5WA 2A6NA 3T0CA 3F2DA 3HGOA 1ZUAX 3GRIA 3VABA 4Q4PA 1GOIA 2OR2A 5MKGA 2VFHA 4TVUA 2GGJA 1UH2A 4QEHA 3PWGA 3B4YA 3P0XA 1GOOA 2ZICA 4JIIX 2VHLA 1NFPA 4GCAA 4LYKA 1K8YA 1B57A 3P5YA 3FW6A 4N0RA 5HAOA 6PTDA 4DXKA 1EDTA 3AS3A 3ABXA 4KBXA 2E5CA 2WJEA 5A6JA 2PZNA 3OIXA 4PRTA 3ICJA 1GQNA 4W4QA 3H2FA 3DESA 4JHZA 5GNXA 1FH8A 4PMUA 2WKLA 1OX5A 5BWFA 2C1IA 3MU7A 3QMRA 4FXRA 2Y1HA 3L4XA 2B7NA 3TAOA 1TR9A 1TUXA 3QSRA 4AG0A 4BQ4A 4ZSUA 2DT0A 1HJXA 5LIUX 3L12A 1KD0A 2NXGA 3PBVA 4UTHA 4ODLA 4Q4QA 6TIMA 2NSXA 3MI6A 1W5QA 1QNQA 3W1QA 3EKLA 3EXRA 4NJIA 3N14A 4NAEB 3PB0A 4TUFA 4CEUC 2TODA 3UR8A 4L9XA 2CXGA 1F40A 4A8RA 2WSPA 3DERA 1XP3A 1UKSA 5IBXC 3L4YA 3NR0A 1PZ0A 2Y7GA 3BGAA 1UPPA 1K1DA 3CUXA 1NP0A 2GDQA 1SW0A 3UI4A 2Y2WA 3IPWA 1NAL1 1MWOA 4GGQA 5A6BA 2J24A 4HBOA 4DBSA 2QCHA 3QMSA 4PC8A 2A3BA 4HZ6A 5G1TA 2BVTA 4DEFA 5JIPA 1B31A 3WH9A 3VKJA 5KETA 3W00A 4Z42C 3VAWA 1VEPA 3L23A 3O0KA 1DHKA 1CXEA 3TTSA 2XYLA 2A21A 2FHBA 2WVUA 1Q45A 1YYAA 3M43A 2Z26A 1Y5WA 1M6JA 2RURA 3W6MA 5U7SA 1CGVA 1DXEA 2XGIA 2WSRA 3ZT7A 2J9ZA 1GEQA 4NNAA 2GJXB 1OFDA 4GZEA 2F2HA 3W86A 4IMFA 3LRMA 3LHZA 1P6CA 1JIBA 3IJQA 4L6HA 1CB7B 1A4LA 1Y8BA 1EGMA 2VR5A 2V3DA 3JU2A 4IICA 4RDYA 1EXBA 1ZU8A 4Q8UA 3EY6A 5D4YA 2NX3A 4JPGA 4LCRA 1TKKA 4PMZA 3VINA 8TIMA 4E2BA 1EJXC 2J27A 3QQ0A 3WEMA 2WANA 1QZ2A 1JDCA 2ATSA 2BGSA 4L1WA 2G41A 4IT4A 1PYMA 4JTDA 3T4CA 4A3YA 1UP3A 1V77A 1IXQA 3ZT6A 4IUOA 4S38A 1F6PA 1IXNA 1FAPA 4R9XA 3OODA 3CH0A 4ZTXA 3WD3A 2O9PA 4AIOA 3FA3A 4O8AA 2VNCA 1C9DA 3VUPA 4GYKA 4ZO9A 3ZWTA 1PTGA 1TZ7A 3GHRA 4E2VA 2EO7A 4MWAE 1JPKA 3TQKA 3JZUA 4YTUA 4DVOA 1WDWA 4JFWA 4DXXA 1OC7A 3W3OA 5CJ5A 3SQSA 3MSYA 1Q7QA 3AJ7A 3GW0A 5LNVA 1SZNA 1MYRA 3BURA 3GZAA 4L56A 4GISA 4AY8A 3UJSA 3VCCA 5AC8A 2X09A 4MTVA 1BXNA 3QF0A 4M6QA 3QHOA 1AJZA 1O94A 3NQ2A 3NYZA 3QW4B 3UWVA 4IFOA 1I4NA 4JOMA 1IIGA 2Y7FA 1EP3A 1JCLA 3LZ3A 3ELFA 4WKHA 2FH6A 3P61A 1L6YA 1S3HA 3LRKA 1LG1A 3TW9A 5DMNA 5BCAA 5CH9A 2G4JA 1TWIA 4LV9A 1V3JA 5JBEA 4WKAA 3VIFA 3LX9A 4BQ5A 1W2PA 1TWZA 1MDLA 3E2VA 4Z2IA 1LL7A 3V5FA 3O5MA 2ZTKA 2IW0A 1Q7ZA 3VOIA 3I6RA 1LP6A 1SJDA 3O5FA 4Q4MA 4HK5A 2XWEA 2NWSA 3MC5A 1KFKA 1V6UA 3MDWA 4BA0A 2EGZA 1UD8A 2PC8A 5CSUA 2VM8A 2NV9A 2OU4A 4AC7C 4I7WA 1KXTA 4XZLX 1KXQA 1Q6FA 1UZ4A 3AXMA 1IWAA 3TMLA 5KMYA 1J2WA 2A7PA 3O8AA 3V1PA 3BCDA 1W8SA 4GQGA 3T42A 2ITKA 1JRCA 2RQSA 3BMVA 4WD0A 4UMBA 4CD5A 2NQHA 2Y62A 4DZ5A 1P0KA 3BAKA 2DJLA 2OT0A 3GG1A 1PHWA 2Z1BA 2QZRA 2FGBA 1UC4A 2ZUSA 4FOJA 4NI8A 4NNBA 3WK2A 5LNUA 2PEVA 1W3NA 1FKRA 3MUAA 1VHCA 4DM1A 3PY2A 2ON3A 3SW6A 3TC6A 4QHRA 1LOQA 1AQMA 1RSCA 2PTYA 2G0WA 2EG6A 2A3CA 3DHPA 2YL5A 1XRTA 1ZNNA 3H7VA 5AHEA 3UQBA 1UUQA 4MNMA 5BU6A 1R5YA 1ZBWA 1CGWA 1PKNA 1YRRA 4CNUA 1YDVA 2QNEA 4AY7A 2V67A 4S3FA 2XP7A 3CV1A 5CPMA 1DHPA 3PTKA 3WDIA 2NLIA 2YCLB 1OC5A 3KTSA 1I2PA 4HZ8A 3I7SA 2WWDA 1ME8A 4E4FA 4J28A 5AHLA 2V3EA 1U1HA 4J5NA 5I00A 2VKZG 4A35A 2CLLA 4Z1YA 5BOOA 1AMKA 1C92A 2XGZA 4O0KA 4AYGA 1VPYA 3RR4A 4IP4A 2ZX8A 4KQZA 3FLUA 2JF6A 3CQ0A 4R33A 2PGFA 3WDHA 3MSDA 3UY8A 4FF7A 1UMYA 2PMQA 3VTRA 1BRLB 2QF7A 2HK1A 5I03A 4JNZA 4HHHA 2ZQVA 3B9EA 4QJ3B 4JX6A 2NV1A 5LZLA 4QT3A 2XPAA 4V1YA 3F4VA 1KCZA 4M19A 1G6CA 3GLCA 1GORA 1VHNA 3FHQA 3NO5A 3K5XA 3WLQA 1H5VA 3ABRA 1LCOA 2DVUA 4FR6A 4MKVA 2HPMA 3CHEA 3DFOA 3TNBA 1QRQA 3AICA 3VC5A 2GGEA 1SPQA 1Q4NX 1XDJA 3M0HA 1V02E 3LG3A 2GL5A 1EZ2A 3CUFA 2PWVA 5DO8A 3SRFA 1RCXB 1R9XA 3SEPA 1E4LA 1NQKA 1QPQA 1Z42A 1H51A 1XLIA 3SIZA 1UZDA 3CHVA 2YLLA 2VWSA 3PTQA 4XD6A 2ZR5A 2AOSA 2XZ9A 3VNLA 2V5KA 3VU2A 4DJEC 4W7UA 3UF9A 1UP0A 3VDHA 4IJBA 5I3KA 3EBVA 3V35A 4FLSA 1Q1CA 1U5HA 4H9MA 3W7IA 1RD5A 2PWHA 2VX7A 3BPWA 3CS2A 1W1PA 3C4UA 4OUEA 4U84A 5CBJA 3NXFA 3T2QA 1QBBA 3CWOX 4JN6A 1IYXA 3LD5A 5HWMA 2ZUUA 3T7VA 2Y89A 1JCJA 4ACYA 4PTDA 1BYCA 5ECUA 2NX9A 3FJ6A 1J12A 2D0FA 2DIJA 1FKDA 2V82A 3WF4A 5GJPA 3BCJA 1OFEA 2YB1A 1DWGM 1EQCA 4H4IA 4J9JA 4NSBA 5D09A 4QISA 2BVWA 3DGBA 3BQ6A 3C8NA 4IT1A 4UFLA 1VLIA 2PBGA 4GIYA 3VIPA 3N2CA 5CGQA 3ZLFA 3ARXA 1XKYA 3LBOA 2WMKA 3MY9A 2ZQTA 4IH3A 1JRBA 1EO5A 2BG5A 3L4ZA 3BMWA 1E0UA 4O50A 5EMJA 1T99A 2NWRA 8RUCA 4RDWA 3A22A 1LWIA 3EWYA 3DYOA 3R79A 1N8FA 2FDMA 4J40A 2Y88A 3DXIA 1EYEA 5C9UA 1MQRA 2BV9A 4UXDA 1WE5A 3WJZA 5HBFA 4CD6A 1YDNA 4C1LA 4CQAA 5E6YA 3MCMA 3TTOA 1FKLA 3KAFA 2DU2A 2OG9A 4KT2A 3GAYA 2CFFA 4FXJA 1C7SA 4JIEA 4EVZA 1M9HA 1D8CA 3QC0A 1NOWA 1QAPA 2UY4A 3AIBA 3G5EA 4ICMA 9XIAA 4KIRA 1ITQA 1E40A 1N82A 3DZ1A 2HBXA 3S6OA 1S5WA 4GPNA 3WH5A 1I0DA 3WN6A 1W3JA 4UNLA 2ZX5A 3N19B 2ZX6A 1JYVA 2XN0A 4V33A 5I23A 4N19A 2WV8A 1QNVA 4YTQA 3UGVA 4YU1A 2VD8A 1M04A 4TTGA 3VMNA 4CQ8A 1NELA 1GT8A 1YBQA 4PZVA 3U3HA 3HGSA 3W75A 3RXZA 3MKKA 3HGJA 3WMCA 4AVNA 5C9RA 3V16A 2CZFA 5G4HC 2V2HA 5HJLA 4MKSA 1J0ZA 3SCUA 4HZ7A 1XUZA 2RJHA 3EWWA 1A47A 4QRNA 4JFIA 2C3ZA 4TO8A 3G3DA 1EDGA 1F74A 1W2VA 2ZQSA 1RHCA 3A5FA 5FKYA 4JTHA 1O5XA 4B90A 3T6CA 1GTHA 1KXVA 1BVNP 2PRHA 2Q8ZA 3PJUA 4OFCA 1YW1A 1TIMA 2FKPA 4KS0A 4ALDA 4TYOA 4EACA 3QC3A 7A3HA 4FPSA 4H2CA 3AXKA 1X6UA 3D0CA 1ZL1A 2BFGA 5H8PA 5CPSA 4OUIA 3G77A 1L9WA 1CXIA 3SGGA 1SQ7A 2V5BA 3V5CA 3TROA 4B4FA 2MF9A 2XN1A 1OFOA 1H49A 2DSZA 4GG9A 4M80A 2HPIA 1PYFA 1XW8A 2FFIA 5HULA 4D1JA 1YPXA 4X0VA 1UOZA 2XVKA 2F21A 5E6ZA 2XSBA 3B9DA 2QIIA 3SM0A 3G1HA 3V5OA 1GRJA 3PZMA 1CEOA 4MUPA 1TIWA 4AXNA 5BWAA 4QLKA 3VPLA 1M1BA 2VGBA 4FLQA 4U33A 2G8ZA 4HJFA 4H6EA 4S3BA 3UWEA 1RJPA 3U57A 4ZE4A 4DI9A 1TWWA 3VXGA 2CLKA 1QTWA 1U5VA 2XH7A 5HQLA 3PAOA 3SCVA 1JXJA 3H24A 1M7PA 2M1IA 2WPGA 1OVDA 4N9DA 2KFWA 2ODOA 3PJXA 5A6BD 4CQCA 4UWMA 2VEGA 5B8IC