3RMEA

Amcase in complex with compound 5
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
377
structure length
377
Chain Sequence
b'YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rmeA01
3WDHA 3WUFA 2B31A 4J3SA 1W91A 1WZLA 3K8MA 2BXYA 4EE9A 4B16A 3WBAA 1FFRA 3CZGA 1QBAA 2YA1A 3WNKA 5I78A 2VZUA 1UKPA 2BHUA 1UR0A 1XYZA 5A94A 4J27A 1GVIA 1BPLB 2CETA 4H41A 2WM0A 1MQPA 1CXEA 7CGTA 1HKKA 1HF6A 4K68A 4CD7A 2JIWA 4P7QA 2QF8A 2VQTA 4FLQA 2CBIA 2VVNA 2W92A 4AZBA 2AOSA 2Z1KA 1GOWA 3MMWA 3AS1A 4A3HA 1BSIA 1QNPA 3I3EA 1E73M 1V6WA 1CPUA 2FDMA 2J74A 1MWOA 3VPLA 1RP8A 3SCQA 2XWEA 4W88A 4OJYA 2W5FA 2C0HA 3GNPA 3MV01 2ZUTA 4AD1A 1KWGA 1L8NA 3I3DA 1WDQA 1CDGA 1UKQA 4PMNA 3KEHA 1BHGA 2VX5A 1TFVA 1ESWA 4ACZB 3G6LA 1UR1A 4GXPA 1ZBKA 4U2ZA 3EMQA 1GQKA 5A6BA 3L2LA 3K8KA 3A6OA 3BLKA 2XM1A 5A6AA 4AZCB 1NWSA 1HJQA 4GI6A 1FP9A 4HOXA 2GK1A 1ITCA 4LGXA 1HVQA 3WQ5A 4W89A 2O9PA 4JAWA 5EBAA 1R7OA 2YIHA 1EOMA 5A6JA 2X8RA 1G9HA 1MQRA 1P6WA 1WCGA 2OSWA 3PN8A 3QHMA 3VIJA 3DHPA 1IT0A 1E6NA 4URIA 1PAMA 4PCSA 1I75A 5CXPA 4FLOA 1Q6FA 5E6ZA 3LMYA 4GI8A 1YQ2A 1CBGA 1UWQA 1OT1A 3OLGA 3AYRA 8A3HA 3AIBA 3K4DA 5CJ5A 1EQCA 1KR1A 2DGAA 2X2YA 1V6UA 1B0IA 3I3BA 4XZBA 3AIEA 3AZTA 1EHAA 4B3LA 1SR0A 4P8XA 2BV9A 4E4PA 4M56A 3W25A 1NQ6A 1LL4A 3OGSA 1C3FA 2G3NA 1W2VA 4JZ5A 1E6SM 4W93A 6CGTA 2CXGA 2NSXA 3EBVA 3IAPA 2WCAA 4CU6A 1J0YA 2VZSA 1JL8A 2VZVA 1BGAA 1OSEA 2G4FA 1V3HA 4HU8A 1CGWA 1E4MM 5D4YA 2VX7A 3ZO9A 1I1WA 4U33A 1J9YA 3VDCA 4CCDA 3RM4A 1BYCA 2ZUMA 2ZWZA 2RGLA 2VC9A 3CMJA 1QNRA 4M82A 3VDBA 3OZOA 1RD6A 3N1AA 3TTQA 1MXGA 2VOTA 5BRQA 1EA9C 1PX3A 3ZMRA 2WPGA 4ATDA 3TA9A 2BHZA 4FMVA 2XFYA 3VUPA 3MMUA 4HPGA 2OWWA 4AC1X 5EFDA 4D6EA 4TOQA 4LYQA 1Q6DA 4UOQA 2UY5A 2PWDA 5I77A 3MUIA 1LG1A 3OIHA 3DC0A 2GJRA 5CPSA 2DSUA 2EPMX 3AZSA 5I3DA 3AHZA 2G3JA 3HU7A 3CUGA 2GJXB 4W7WA 3NIYA 1GW1A 4PMOA 1LJYA 2VUYA 1KXTA 1E6ZA 3FHQA 3SUWA 2QPSA 1AQMA 5IHSA 3T2OA 2ZUWA 3RM8A 1V0LA 2UWFA 3VVGA 3WH9A 3VGHA 4W87A 5D9MA 4BQ3A 3AIWA 1DWIM 3OGVA 2VCCA 3KWXA 1KB3A 3DHUA 3N12A 3ARZA 1OGSA 1UKOA 2WHLA 1JZ8A 2YL9A 2CCRA 1TR1A 3LPFA 4PMXA 2YA2A 4HA1A 2WVUA 2XFFA 2Y24A 5ABEA 4BF7A 1OCQA 5M17A 1JD9A 3K46A 1ISZA 1J11A 2JF7A 3AMKA 2PBGA 1XHGA 1PPIA 4ML4A 1WNOA 3CGTA 2GUYA 3ZJ6A 2CKRA 3NCOA 3VINA 4U31A 1GJUA 2EPKX 4V27A 5CPQA 2E8YA 2A3CA 5A1AA 2UY2A 1K9TA 5FIPA 1VEPA 1JXJA 3SCWA 1UR2A 1D2KA 4B9ZA 3SUSA 1GNXA 5FCZA 1ISXA 1ZU8A 3BAKA 4W5ZA 1NH6A 4CN4A 1HP5A 2JF6A 3JUGA 1NARA 3E1F1 1UWSA 4DWSA 1OD0A 2CITA 2DQXA 4CD8A 1E6QM 3CZJA 2DH3A 5EMYA 3VMOA 3L4UA 4ZFMA 4JFUA 4AZIA 1CGVA 4CVWA 4AZ7A 3ARYA 5GNYA 3AXHA 1NP2A 1HX0A 2D20A 1CNVA 2BVYA 1A3HA 2XM2A 3W82A 1E5NA 4GPNA 3MSGA 1UKTA 1BAGA 3FY1A 1H49A 3EMCA 2E40A 3HMCA 5A6BD 4TX8A 4GZEA 4P7LA 3ALFA 3BMWA 3WH5A 4MNMA 3PTMA 4CD4A 1VF8A 4H8UA 2YDSA 3PZOA 1AVAA 1OM0A 4JL2A 1R87A 1GZJA 3GXMA 3SEPA 5F7UA 3A3HA 3T0DA 4D1JA 3OZPA 3WMBA 3KL0A 1UQYA 1BYDA 1JDDA 5A69A 1HL9A 3VOCA 1BG9A 3ZT7A 4KRUA 5CSUA 1V3IA 4GQRA 2XIIA 2VR4A 1DHKA 4AZ5A 5I6SA 4C7DA 2UY3A 4MDOA 2WVTA 2XG9A 3W53A 4D6HA 9CGTA 1V0MA 1EHNA 5BCAA 2J79A 1H3GA 4HPHA 3RO8A 1J18A 4J3UA 5ABGA 5A8NA 1JZ3A 1H5VA 3SCUA 2VRQA 4ZENA 4D6FA 5JBEA 3D5HA 2ZX7A 2WMGA 4WF7A 2X09A 4BQ4A 3PZTA 1WDPA 4ACZA 1C8XA 1UD6A 3J7HA 3N18A 1U2YA 4UFMA 3MO4A 2JEPA 3WF1A 4W84A 3AIUA 2Y8KA 3MANA 3CZEA 1BYBA 4QCEA 3W27A 4UFLA 3VIHA 4AZCA 4MNJA 4LPCA 4AZGA 7A3HA 3ZQ9A 3WEOA 3VTRA 1JD7A 5M3WA 1GQIA 1WAWA 2WB5A 4AEFA 3QHNA 1BGGA 4BCEA 4RL3A 2PWFA 3PBGA 3EYPA 3VO0A 1JF5A 4NF7A 4B9YA 4WSKA 1E55A 3VDHA 3ZJ8A 4TVUA 4MNLA 2EEXA 2D2OA 1BVZA 5E6YA 1D7FA 4HZ7A 3GNRA 1PJ9A 3SCOA 5LA0A 5CG0A 3AHYA 1V03A 4CD6A 5KZ6A 1W9DM 1JFHA 1UWTA 1XD0A 5LA2A 1UWRA 2OYLA 4XV0A 4CCEA 1V02E 3QGVA 5HBFA 2WMKA 4AYSA 4OIFA 1B3YA 4W7VA 1HT6A 3GXIA 3WD3A 2ZE0A 2VZOA 2WWCA 1E71M 1W9XA 4UQBA 2Q8XA 2ZXBA 2G8ZA 1FP8A 2XSBA 3SIMA 4HU0A 1CYGA 2X0HA 1AMYA 1JYNA 1J12A 4UQAA 2OWCA 2XTKA 2XSAA 1W3JA 1E4IA 3BAWA 2EPNA 1FH7A 4E2OA 3WNOA 2FHCA 3WFLA 4PEEA 3VIOA 3CH9A 4GINA 2OYKA 5AC4A 4N0RA 3WNPA 4UCFA 4AWEA 4HTYA 1E15A 1QPKA 5ABFB 4C7GA 1CLVA 1UD8A 3NSXA 4JL1A 4TTGA 3IJ7A 4BQ5A 3KL5A 1UH4A 2O9OA 3ARVA 1ZBVA 2FHFA 3WQ6A 3GXDA 1W2PA 1C90A 4AIUA 2ZUNA 1MW1A 1UH3A 3ALGA 5I0DA 1W1VA 5AY7A 1I1XA 3SCNA 5A6SA 4UQDA 3LPGA 4QLLA 1B2YA 2CBUA 4AEEA 2VQUA 1KGXA 1TE1A 4AD4A 1ZBWA 2CBJA 3AROA 4PMYA 1J0IA 2GSJA 2J7HA 4JFSA 1DWJM 3W6LA 1VFOA 5ECUA 1HXJA 5BWFA 3PZNA 4UFIA 4A4AA 3WD1A 4AIOA 4M80A 4KRTA 4UNIA 1K9EA 2GJXA 5GQBA 1K9FA 1HJVA 1J0HA 2YDRA 4WK9A 3TP4A 1E4NA 4DWSD 1ECEA 3ARQA 3BXWA 4WKFA 3WMCA 1JZ4A 5GNXA 4R27A 3WEZA 5I5RA 3OLEA 2CKSA 2D23A 2IXVA 2MANA 1W1YA 4L4OA 2BVTA 3MSDA 1US2A 1FHDA 5A6KA 4AW7A 2YL5A 2VT0A 3CUFA 1ISWA 3ARXA 1E6PA 3DECA 4ZE4A 4Z2IA 1W1PA 3B9DA 1OBAA 1C92A 5E09A 5BROA 5EFFA 4KWUA 1C8YA 2DIJA 2ZUUA 5A2AA 1B90A 4HOWA 4P7OA 3AMGA 3EDKA 3PTQA 4PYSA 1ZB5A 4U5KA 5E70A 2ZUVA 1XV8A 3AQUA 1C7TA 1PBGA 1WZKA 1HP4A 2GDUA 3GH7A 5A95A 2XYLA 1G01A 3N17A 4PTXA 2ZUSA 1M04A 5EB8A 1WKYA 1V6VA 1VBUA 1D3CA 2V3EA 4YPJA 1BG4A 5A6MA 3ZIZA 1GUVA 1JXKA 2YL8A 3LPPA 3EDJA 3W26A 1EDTA 4OOZA 1GVYA 2E9MA 4HOZA 1W3HA 2ZX6A 2WSPA 1DTUA 1JNDA 2W4XA 1UHVA 2WK2A 2WBGA 2J75A 2ZXQA 2EO7A 2VI0A 5TD4A 2Y8VA 4OZOA 1BQCA 4W7UA 3W37A 4W86A 6A3HA 3AXXA 4NRSA 3VD7A 3T2PA 2C8NA 4LYRA 5ABHA 2J78A 1B30A 1BLIA 4WIWA 5KEZA 4EANA 5A8OA 3PZVA 5A3HA 2CPUA 3A4XA 3VMPA 4UFKA 1UA7A 2BY3A 4Z2LA 3W4RA 3MV11 4PTVA 1E6RA 5BXPA 1US3A 1UQZA 4MAVA 1JI2A 3K8LA 4HP5A 4NSBA 2QPUA 1XH0A 4RE2A 1XH1A 2WZHA 3L4VA 5A2BA 1ISVA 1UUQA 2CERA 1QNSA 3TTSA 1NOUA 3RJXA 3VMNA 1OGGA 1VIWA 4L4PA 4D6CA 1YHTA 3CZLA 4PMVA 4PMRA 4TUFA 3VX0A 3ZM8A 1SYTA 3BCDA 2BFGA 1W9VA 1CENA 2D3NA 4GIAA 2WVSA 4JFTA 1JZ7A 5GPRA 1JAEA 4CVUA 3PZGA 3AICA 4D6IA 3NDZA 4ACYA 1JYVA 3WD2A 5GNZA 4PSRA 3VM7A 2WMJA 3IJ9A 1GQJA 2HVMA 4MNKA 3VGEA 4UOJA 1XSKA 4U2YA 1CGYA 2XVPA 2BHYA 2G3MA 2VCAA 1GORA 4HZ6A 4J3TA 3UR7A 2BXZA 4QCFA 5CLWA 1R7AA 1HKMA 1H0GA 4GQQA 4PMDA 5IFTA 2D0FA 2J7EA 2WMFA 2WLYA 1OT2A 5I2UA 3VDAA 2XIBA 3CPUA 4IPNB 1HVXA 3A4AA 5DT5A 5E0FA 1E1EA 2JEQA 1E9LA 4GO9A 1MXDA 1DWAM 2JALA 1E0VA 1ODZA 3BH4A 3ECQA 4YN5A 4JHZA 5I23A 2UY4A 1U33A 1ZBCA 3L4WA 2JE8A 4FLSA 2PWGA 1HJXA 3WD0A 5JUVA 2IXUA 3MUZ1 1CXKA 1EOKA 4MJ2A 1EGZA 1B3ZA 1V6XA 3WMSA 1JI1A 3APGA 3RDKA 1XSJA 3GH5A 1CGUA 3B9AA 3FAWA 1GHRA 3VIKA 3IK2A 3MMDA 4H8VA 2ZX8A 2CYGA 1CXIA 3QOKA 4D6DA 1QI3A 3UETA 1KGWA 1TZ7A 2J7DA 1M53A 1DEDA 2DH2A 1B1YA 3CHEA 1K6AA 5C8BB 2CBVA 2D24A 3A47A 1JDAA 3WUGA 2XVKA 1OD8A 4EAMA 2J7FA 2WMIB 4AZ6A 5DEZA 3AMCA 1GQLA 1CZ1A 3BCFA 3F5LA 3GZAA 4HA4A 2GJPA 4IPLA 1QI2A 4DUWA 1JGIA 2W62A 2NT0A 2D0HA 3O2LA 4AZHA 3AZRA 3NUKA 2XVLA 1DWGM 4A3YA 1GCYA 1UYQA 4FK9A 1GONA 7TAAA 2WBKA 3SCPA 4CUCA 4U3CA 2YOCA 1LF1A 1UR9A 3IANA 4LQ1A 3WDPP 5ABFA 3SCVA 1Q6CA 1UR4A 4YHGA 2DEPA 1WZAA 4GO8A 4PCTA 1J0ZA 4IISA 5JBFA 5D9PA 4AISA 1LWJA 4P7RA 3CLWA 2G3IA 2JFEX 3B8SA 2XWDA 2ZXDA 1WB0A 2ZOXA 1UOKA 5D9OA 1OIMA 5AYIA 4CN1A 2V3DA 4AMCA 1EXPA 3T08A 3PZQA 2E9BA 5FL1A 1WDSA 2WVVB 2VRJA 1C91A 1E43A 1X6LA 1G5AA 4LYPA 1JF6A 1CECA 4BA0A 4B15A 5DF0A 1XD1A 1ODUA 2J4GA 3VNYA 3SCTA 1TCMA 2VL4A 2WC7A 2D22A 5HXMA 2WXDM 3F4VA 1RPKA 2V5DA 4F8XA 1HJUA 3M7SA 4UQCA 2JIEA 1H11A 5CLTA 1O7AA 1UA3A 2XJ7A 3WEMA 1GOMA 5HOSA 3BGAA 1E6XM 1MQQA 3ZOAA 4UOZA 4GI9A 3DYPA 1E3ZA 3BSGA 1ZL1A 3AHVA 1BVNP 1JZ6A 4WSJA 1QNOA 4X9YA 4JHOA 1W3KA 4J3VA 1KFWA 4TX6A 1WE5A 2O9RA 4J3XA 1V0NA 4GZJA 4IM4A 3AMDA 2PC8A 3VGDA 3BAIA 2FGLA 1HJSA 4NI3A 2W63A 4EKJA 3WF4A 3T09A 1G1YA 4D1IA 3AHTA 3FHAA 5E0CA 3WDRA 1W3LA 2WHMA 3U5UA 4WJXA 2O9TA 2WZEA 2CEQA 3UR8A 2ZIDA 4QP0A 1CGXA 4UZSA 3VD9A 2WYSA 1EQPA 2F2HA 2PWEA 4P8VA 1KGUA 4IUGA 4JIEA 1JNEA 3VIMA 2WKGA 4JFWA 2WW5A 2NW0A 1NOWA 2OSXA 1EH9A 6TAAA 1KCKA 2G41A 3PZMA 1W9UA 2ZWYA 5A2CA 3VGGA 1CIUA 3AMLA 1JDCA 1TA3B 3N15A 4AD5A 1XRVA 4P8WA 5JH8A 2J7CA 2J47A 3WD4A 2VZTA 4RE3A 1E70M 5E9AA 1TMQA 4ATWA 4M8UA 2WANA 2WC4A 2E4TA 2QHAA 3HN3A 5DMYA 2YJQA 3WQWA 3GXFA 1MFUA 1MW0A 3B9EA 2ZX9A 3MUY1 1M01A 5HPCA 4UQEA 3RJYA 3VIFA 2X1IA 4CU8A 1E5JA 1KBKA 4Z2KA 3VX1A 4PUDA 5A8QA 1BYAA 4UFHA 1J0JA 3UERA 4C7FA 1NWRA 1L0PA 4H04A 5DFAA 4HMCA 4PTWA 1H1NA 1DWHM 1E0WA 1Q6EA 4Z2GA 2AAAA 3ARUA 2NT1A 4GKLA 2PB1A 2FGZA 1VJSA 4YHEA 3KZSA 3CZ8A 1M03A 1QHOA 3OLIA 3WF2A 1JZ5A 1QNQA 3WN6A 2GFTA 1E40A 4B3KA 4JKMA 4QLJA 3CBWA 4H2CA 5FKYA 3WIJA 4J3WA 3U7BA 2BVDA 3ZT5A 1CTNA 3A4WA 1W32A 4KMQA 2J62A 5IXEA 1SMDA 2XGBA 1JFXA 1QBBA 4FLRA 1PZ2A 5CZKA 2EJ1A 3BC9A 1PEZA 2W61A 2WMHA 4ZE5A 1G94A 1KBBA 3WL1A 1EO5A 1V3JA 1E1FA 2Y2WA 1VFMA 5JBDA 3ZSSA 1QHPA 4J28A 3II1A 4D6GA 3AIVA 4U5IA 1VRXA 1E4LA 3IAQA 1PX4A 4JFVA 4PTMA 4JCMA 3VGBA 3VD3A 4DUVA 1LWHA 1PZ3A 4PN2A 3AFBA 4AIEA 2WCSA 3PHAA 3AXIA 1XC6A 2EQDA 2OSYA 3SUVA 1TVNA 1CXFA 2J77A 1GJWA 2VURA 3ZT6A 1B3XA 2QMJA 3VGFA 3QOMA 2WNWA 3OBAA 4DWSC 3T2QA 2VRKA 3AS0A 3WKZA 2WAGA 1UD4A 2CNCA 4HMDA 3WH6A 3TTOA 4NRRA 2YL6A 5C70A 1HJWA 1LLOA 3AOFA 3WUBA 5BXTA 5CGMA 1X1NA 3M46A 5BYWA 3G6MA 4ZXLA 1XCWA 1HKJA 3WUEA 1LL7A 1LQ0A 3WF3A 3FXYA 1UWUA 2FH6A 1Y7VA 1OINA 2PF0A 2W67A 4QDMA 3POCA 5FL0A 1UH2A 1UZ1A 4DUXA 3W24A 1KXQA 3EDDA 1VB9A 2A3AA 1WDRA 3L2MA 4AD2A 3VIPA 4D6JA 3UESA 3ARSA 3AI0A 1SFSA 3BAXA 3U5YA 1WO2A 2WMIA 1E0XA 2D0GA 3M07A 3OA5A 4OBRA 3WENA 2F61A 3W38A 1UD3A 2BNJA 3UG5A 3ZR6A 2WC3A 3T0BA 3O6AA 4V2XA 1CXLA 5AC5A 3THDA 3U57A 1MYRA 3MU7A 1KCLA 2DPEA 2Z1SA 1FH9A 2BY0A 3WNLA 2OYMA 2QMKA 2XUCA 1HIZA 4M81A 1CXHA 1B31A 4W8AA 1W1TA 5AYBA 3WDJA 3ZR5A 1GOOA 4JKLA 1EIBA 1UWIA 1XCXA 3D3AA 4XUYA 1F4HA 5CSYA 3CUJA 3DYOA 4UFJA 4HZ8A 1B3VA 4UR9A 2V3GA 2YA0A 2OLHA 2YKKA 1NOFA 2WCGA 1J10A 3N13A 1GHSA 4LX4A 4D72A 1WP6A 1QVBA 4WKAA 1R8LA 2Y5EA 4UQ9A 3GH4A 3WQVA 1JYWA 2VTFA 2WZIA 2DSVA 5M5DA 1NP0A 2WHKA 1XGZA 2WVVA 4LXFA 2V3FA 5LA1A 1O6IA 4CKQA 3HJEA 3IJ8A 4KH2A 2D3LA 3AS2A 3VILA 3MKKA 2J25A 2XGIA 1E56A 1PIFA 1XH2A 3WH7A 5HDRA 1B9ZA 2E0PA 3BSHA 2CHNA 1VJZA 1UD5A 2A3EA 1GPFA 3W28A 1E3XA 1ITXA 1UKSA 3OLDA 5DO8A 4BQ2A 4HMEA 1MVYA 2DT1A 1FH8A 1IV8A 4MB4A 3AHXA 4Y7EA 3BMVA 2DIEA 3EDFA 3PZUA 3WFZA 2EBNA 4W8LA 4HA3A 4BS0A 2J8FA 1UZ4A 2VJXA 1OGBA 3VIIA 3BLPX 4JCLA 4S3KA 4AY1A 1CGTA 1Q4NX 4XZWA 4PSPA 1UG6A 2EPOA 2XHYA 1KQZA 2WHJA 2VMFA 1ZJBA 1QOXA 3L4TA 3L4YA 3FAXA 3L4ZA 1QI5A 4W5UA 1TG7A 3WNMA 4F79A 4TXEA 3ZJ7A 1Z32X 3U7VA 3WSUA 2DT3A 3OGRA 3WL0A 1BFNA 1HKIA 4DM1A 3WDIA 3GNOA 1KXHA 5IFPA 3NDYA 1LG2A 5HNNA 1FFQA 2VNCA 3CUIA 3F5KA 4MAZA 1DP0A 5BRPA 2DT0A 3TTYA 3GBDA 4CU7A 1FA2A 3CHFA 3GTNA 3CTTA 3KE0A 2EPLX 4CCCA 3TONA 2VR5A 2J7BA 2PWHA 1AQHA 3F5JA 3UCQA 3CUHA 4W8BA 3N11A 4PUEA 3EDEA 1TA3A 1RP9A 1OB0A 5BXRA 2VVSA 2GDVA 3ARWA 4PMQA 4QLKA 1LL6A 4NZCA 3CHDA 5A8MA 2E9LA 1JIBA 5I79A 3SURA 4X0NA 3AISA 4M24A 8CGTA 1KQYA 1VENA 1NM9A 3SCSA 3LPOA 4S3JA 1OWQA 3S2CA 3WY1A 3RILA 4KGJA 3RIKA 2CESA 2DT2A 1CEOA 1R86A 4CGTA 1V3MA 1XYFA 1AQ0A 4XX6A 2W91A 1BTCA 3AJ7A 4RE4A 3GDBA 3RCNA 4PMZA 4OOUA 1JYXA 3AYSA 1NWTA 3AS3A 3EMZA 4F9JA 4J7RA 5LYRA 1CWYA 3N04A 1QI4A 3KL3A 4M1RA 5FD0A 2BS9A 3POHA 3VNZA 4XB3A 5HPOA 4QFUA 2GK1B 5A6LA 1GOQA 2A3BA 1DWFM 1F4AA 3W6MA 2PI6A 2FH8A 1Q6GA 3CO4A 2VX6A 3PTKA 3PZIA 1MW3A 1PIGA 1EO7A 1N82A 1SMAA 2XPKA 3VU2A 1IZJA 4AXNA 1C7SA 1KXVA 3WELA 3RPMA 1KWKA 3VKKA 2DSZA 4AD3A 3FW6A 1H41A 3ZJKA 2XVNA 3WF0A 1HL8A 1FOBA 2J8GA 2OWXA 2V38A 4H8HA 5CPTA 1H09A 4MADA 1CLXA 1E72M 1ZJAA 4MJ4A 3BAJA 4UTFA 4Z2HA 3CMGA 2ZX5A 1XSIA 4U3AA 5IDIA 4EK7A 3WQ8A 4E8CA 1VEMA 5BXSA 2PBOA 2YBTA 4Q7NA 2QV4A 1S46A 3FN9A 3ARPA 1TUXA 1X6NA 4ATLA 2VCBA 2GVYA 3AIQA 3W29A 3QR3A 1QI0A 3GYCA 3M6DA 2AMGA 3MS8A 1J01A 4X0VA 3DYMA 1RH9A 3K4AA 4PMUA 3NYDA 4E8DA 3WQ4A 3GBEA 2YLAA 1HNYA 1V02A 4MB3A 2CHOA 2O92A 3VD5A 2J7GA 3W0KA 3TOPA 1QW8A 4TVDA 1ISYA 2HISA 4CD5A 4Q22A 1VEOA 2VO5A 4R5EA 1FHLA 1U30A 3NSMA 1R85A 3CIVA 5I24A 4OUEA 3VM5A 1V08A 5D8WA 4JKKA 1MFVA 3L4XA 2WSKA 4Z2JA 1WZMA 3WBEA 4OBSA 4OKDA 1M7XA 3BAYA 2BY1A 1K9DA 1H4PA 1V0KA 3THCA 5JIWA 2X0YA 1A47A 3SUTA 1EDGA 1EDQA 3S6TA 2E8ZA 3UEQA 3RM9A 1J0KA 2Y4SA 4N42A 5IHRA 4P8UA 4GZIA 1W9BM 4BZYA 4H7VA 4V28A 5D8ZA 2YBUA 1C8QA 5JIPA 2IUZA 4F66A 3WH8A 1PX8A 2EXOA 4FF5A 5M03A 2ZICA 3PZ9A 2V5CA 2WWDA 2ESCA 3CHCA 4MB1A 3OG2A 2C7FA 1VFUA 4KGLA 2DSWA 3CZKA 5FOOA 2WLZA 2E3ZA 2XVGA 1MW2A 3FNDA 4D71A 4ZXOA 1H0IA 1UR8A 3VIGA 1WPCA 2FHBA 5DT7A 2VX4A 1B3WA 2TAAA 4MPKA 2YLLA 1JAKA 1IZKA 4TVCA 4MTVA 2BY2A 4M29A 4TTUA 2A3HA 4W85A 1QW9A 4MDPA 1ZS2A 3WDQA 3VD4A 5C71A 1JZ2A 3UG4A 4DM2A 1GOIA 3MUAA 4P7NA 4ZEPA 3AIRA 3T0AA 1QHZA 5CGTA 3RMEA 1VBRA 1W9PA 5A8PA 3SCRA 2DDXA 3SUUA 1V3KA 1V6YA 3W81A 4QAWA 2WKLA 2XFRA 3ARRA 4F9DA 3NJ3A 2YDQA 1TVPA 2RGMA 3OB8A 5D9NA 3QHOA 1OIFA 3NSNA 2F8QA 3ZSTA 3O9NA 4MB5A 1VAHA 4DWSB 3GM8A 2CIPA 5CQ1A 3N9KA 3K1DA 1KR0A 2ZXAA 1JG9A 2DSKA 4UZUA 1C93A 1HN1A 1V3LA 4WLCA 1H2JA 4CN6A 1GOKA 3ARTA 1UD2A 3UG3A 1BF2A 2W66A 1NWUA 4AD0A 1G0CA 4PRWA 4WKHA 2D1ZA 2X05A 4PBGA 3WNNA 2QLYA 1VFFA
chains in the Genus database with same CATH superfamily
1UW9A 4S38A 4MG4A 3WDHA 4B16A 4JDBA 2VP8A 4I7VA 3U2OA 1FFRA 2OKTA 3GQYA 3KDNA 3G8RA 3NL6A 2GOKA 1A0CA 3CL8A 1PCWA 5I78A 2P10A 1UR0A 2BOFX 1XYZA 1M7JA 3BOXA 1YNPA 4H41A 4ZCWA 4AHQA 1I4NA 1VZWA 2FPVA 2DZAA 4CD7A 4EWND 1XLJA 2FPTA 2CBIA 1OCNA 2Y5JA 3A4JA 3AS1A 1BSIA 3APYA 3W02A 2VC7A 4FF7A 2BBFA 2C13A 2EJAA 1ROUA 4JFJA 4IIBA 2ACQA 3LHUA 1Z9AA 3UG8A 2P76A 1EZ2A 4IIFA 2FPYA 3WLHA 4AD1A 1KWGA 1L8NA 1JPHA 1PHQA 1XG4A 1BHGA 1TFVA 5T9CE 3STEA 1UR1A 3A5FA 3PANA 4LAMA 4ZGYA 1GQKA 4GKTA 5A6BA 4IOTA 4FALA 4NUWA 4RX0A 3VZXA 2Y7GA 4FPSA 1I0BA 4HBKA 3S5SA 2J6VA 1B54A 5A6AA 1Q63A 3TUUA 1R0MA 3WYZA 3QMSA 3BCJA 3BICA 3R43A 3C4UA 3MHUA 1K7EA 4DJEA 1R7OA 3VXGA 4KW2A 1FWWA 4L9YA 5A6JA 2X8RA 2OVLA 3PN8A 2XP3A 3VIJA 3DHPA 2Z6JA 1Q6FA 4FLOA 1RALA 2C14A 1FDJA 4JS3A 3S42A 2RUDA 3UD6A 1EC8A 1CBGA 2ZTJA 2VC6A 3OLGA 2QAPA 8A3HA 3K4DA 1EQCA 3S8HA 2DGAA 1V6UA 1XYBA 1B0IA 1Z69A 4YYFA 3AIEA 4N4PA 1LRTA 2BGNE 1IEQA 1C3FA 1PDYA 3BJFA 2VCDA 2ZC8A 4JZ5A 1E6SM 4W93A 4FOJA 4E8GA 4HD5A 1GGOA 3E0FA 1JL8A 2VZVA 3MP4A 1CGWA 1E4MM 1EJVC 1V51A 5D4YA 3LQLA 4JOMA 4U33A 2AL1A 3UP8A 1RQHA 4ICMA 2A2IA 5EMLA 3NI6A 2W3ZA 2DW7A 2ZWZA 2RGLA 1DE6A 1VP5A 3UR5A 3CMJA 3QF0A 3N1AA 1E51A 3THAA 2VOTA 2W27A 5BRQA 2W6RA 3UF9A 1XIMA 3WQCA 4ATDA 4N7QA 2BHZA 4FMVA 4HPGA 1E9YB 5TQLA 3DGRA 1XYAA 4QR6A 3TN3A 2CLLA 4RZ4A 2RKXA 3W70A 5I77A 1J93A 3KBJA 3B3DA 5DRCA 2L5HA 2PDWA 4LUSB 4DF0A 4PRRA 3M0MA 3SADA 1X1OA 2RAGA 3LQGA 5G1TA 3HQNA 1ZALA 2GJXB 1NQKA 3NIYA 1GW1A 4PMOA 1JEZA 3W6YA 4KKXA 1AQMA 1YPXA 5IHSA 3D3FA 3RM8A 2UWFA 3VVGA 3WH9A 4AF0B 3DG7A 6XIAA 3KBNA 3R8RA 3OGVA 4FSAA 5CZJA 2VCCA 3KWXA 1H7PA 4UB9A 3DHUA 1R2SA 4LAOA 1KRCC 1JZ8A 3O63A 4ILSA 2V2HA 2QCCA 2DORA 4PMXA 2XFFA 4ZQCA 4BF7A 4DO5A 1F8MA 3UWZA 4HNTA 2PBGA 5HJYA 4FHAA 1XHGA 3Q45A 1TQJA 1WNOA 3B0VC 3ZJ6A 3HPFA 4MVAA 4FXSA 4ODOA 2XH7A 4R3UA 4RNHA 3MCOA 4V27A 4PODA 1IEIA 2E8YA 5CPQA 2A3CA 1QUMA 4GYKA 3KOFA 2ZZ2A 4OU1A 1UOZA 3V16A 3SUSA 1ISXA 1ZU8A 3BAKA 5KTLA 2YYUA 2JF6A 2HNEA 4DWSA 3QGAC 1SO3A 2DQXA 3EOSA 1FHUA 2DH3A 4MY8A 5EMYA 3BW2A 1F76A 3IWPA 3L4UA 3M6YA 4ZFMA 2PGWA 2PU1A 1HL2A 4GYPA 2IKIA 2A21A 5GNYA 1SR9A 4EIVA 1O5XA 1A3HA 1UC4A 2VGIA 4QZVB 1C9HA 3LCGA 1XISA 1UKTA 1BAGA 3FY1A 1OX6A 1ZAJA 1H49A 5A6BD 4K1GA 3R0UA 1NJJA 3ALFA 2MNRA 3WH5A 1YDNA 4JYSA 3L0KA 2WKJA 3PTMA 4UMBA 5EA9A 3EOEA 1I45A 3EB3A 2YDSA 3UCDA 4XD6A 3LUOA 3BGJA 4DJED 2NSOA 3GXMA 3UWEA 2V67A 5K9CA 3A3HA 4LFYA 1FCQA 4RPPA 4B5SA 1JDDA 2V81A 5A69A 1BG9A 4MYXA 1VKFA 3JRKA 1QO2A 5CSUA 1DXEA 4GQRA 3REQA 2VR4A 1DHKA 2PPNA 5I6SA 3GXTA 1RLDA 3GXNA 9CGTA 2J79A 2WQDA 3FA5A 2HSAA 2F84A 4O52A 1O60A 1H5VA 3FLUA 4JFKA 1RK6A 2C3ZA 2X09A 3NA8A 5GJPA 4CQDA 5A6TC 2QS8A 1UD6A 3J7HA 1K70A 4W84A 4M0XA 4FEZA 1BYBA 3VKJA 1JCJA 4ENLA 4AZCA 3CQHA 3MY9A 7A3HA 4OBTA 3SRKA 1S5MA 3TC7A 1P7TB 1NDVA 4BCEA 2PBCA 4RL3A 2PWFA 1F8AB 3EYPA 2GVJA 3U2CA 4HPNA 4MNLA 2EEXA 2ISSA 3WLSA 3L7RA 2D2OA 1D7FA 2R1PA 3SCOA 3M0ZA 2FB3A 1LUCA 5KZ6A 3LV6A 4OVXA 1UWTA 1ME8A 5LA2A 4G7EA 1ZAIA 2OYLA 4JTDA 1ECQA 2OEKA 3P82A 3QGVA 4AYSA 1B3YA 5EL1A 3GAKA 1HT6A 3GXIA 4C91A 1JRCA 1ZP4A 1ZLPA 5LKYA 1SZEA 4QISA 1FWBC 3HO8A 5TBOA 3LZ3A 1R3SA 1IQ8A 4HU0A 1CYGA 2X0HA 1J12A 1OF8A 1TO3A 2OWCA 2F7FA 2EPNA 1W8SA 4EXBA 2FHCA 3WFLA 4PR4A 3CH9A 4IGNA 1AW2A 1KRBC 1QT1A 1SZNA 4AWEA 3WH0A 1TVLA 3B7XA 1IEXA 4FIQA 3ELFA 5EGRA 1QPLA 3NSXA 4JL1A 2X1RA 3QV6A 1PWMA 1EBGA 2O9OA 3CV2A 1ZBVA 1SZRA 3AYVA 3NOYA 2DUZA 3HQ1A 3WQ6A 4J3ZA 5AC7A 4LY8A 3SI9A 3L23A 1F07A 3AALA 1UH3A 3ALGA 5I0DA 1W1VA 3THQA 2ZKMX 3QGKC 1ME9A 3G22A 1QPOA 5AHMA 1I1XA 3GW3A 4QT3A 4QLLA 5HNRA 2CBUA 2E1WA 3UXIA 1QCWA 3N2XA 1DVJA 1VQTA 2QVHA 4AD4A 3E38A 4N19A 4K39A 5I02A 3QTPA 1J0IA 4O4VA 3LB0A 1FKFA 1DWJM 4HKPA 3SN0A 2VELA 1JPIA 4L7ZA 3RLHA 5BWFA 1G4EA 3HG4A 3TSMA 4DJDC 4PB4A 1GK8A 4AIOA 3WJYA 4UNIA 3KS5A 1K9FA 4DWSD 4QE4A 4QITA 3BXWA 5BOEA 4BI6A 3UZ5A 4YCPA 1KM3A 4H4IA 2Z1VA 2IXVA 3IIZA 3SIZA 1UPMB 4IX2A 5A6KA 4AW7A 3F4WA 1N7KA 5HA7A 3MKVA 1XIEA 4JPGA 3W76A 1W1PA 3W9ZA 5E09A 1TJ1A 2O7QA 5EFFA 2YCJA 2RH9A 3N6HA 1P5BA 2DIJA 4NZJA 3UWWA 2EF9A 5E70A 3IGHX 5HW7A 1IXQA 3WLMA 1MUCA 1OQFA 2QCGA 1NFGA 2GWGA 2B4GA 1O5QA 3GH7A 3KP0A 5A95A 3DI0A 5KSWA 1J5SA 3TMLA 3LENA 2ZQTA 2VEKA 4PL2A 2ZUSA 2Z0IA 4B5WA 5HINA 1WKYA 1K4GA 1V6VA 1LBMA 1PDZA 5BMWA 3W26A 4ICNA 2PDQA 1MEWA 1Q3NA 4R7JA 4NNAA 3JVAA 2WSPA 3BSMA 3T42A 2ZADA 3CB3A 1BTMA 3WMLA 1CB7B 4NVTA 4ZO6A 3W1TA 2WBGA 2J75A 1TZ9A 3M5XA 1LLZA 2EO7A 2VI0A 1GKQA 4Q8VA 1XLBA 1V6TA 3T0CA 4CQBA 2Y88A 4S3DA 4C6DA 4W7UA 4ZR8A 4NIRA 1O1ZA 4W86A 3XISA 1B4KA 3VD7A 1XW8A 2C8NA 1OZQA 2IKJA 4KEVA 1AW5A 1THFD 1BLIA 5KEZA 4EANA 3PZVA 2CPUA 4PB3A 3CT2A 4Z2LA 3W4RA 2NLYA 1J6YA 2ZVIA 1UUMA 3OG3A 4PTVA 1V8EA 1E6RA 3VDGA 1K8YA 4MAVA 3KCJA 4GFSA 1DKWA 4UTKA 4HP5A 1EYWA 3N9RA 5KZMA 4W4QA 4TX0A 2WZHA 1BXNA 3TVAA 2VN1A 2FVMA 1MXSA 4XZNX 3RRAA 3O0KA 1NOUA 2I9EA 3WK3A 5F4SA 4D6CA 2A7RA 4WVXA 4GABA 1VCGA 3GVGA 3ZM8A 4LBRA 3BCDA 4C6JA 2BFGA 1W9VA 1CENA 2D3NA 3FOKA 2CLKA 3EWCA 2E6DA 3NDZA 1QWGA 3WD2A 4PSRA 2DZUA 2WMJA 4GE8A 4HN8A 1GQJA 5FJJA 3TYDA 4MNKA 3VGEA 3EOUA 1X97A 1DJNA 4U2YA 1CGYA 4PRTA 4XKMA 3BLFA 1GORA 4J3TA 3M16A 4M19A 2D0FA 4Z1BA 3W1PA 4DF2A 4JYEA 1SSGA 1WUFA 4PGLA 1OT2A 3SGGA 3G1VA 4JNMA 3NQEA 2CU0A 3H70A 1JDEA 3KAOA 1YXYA 2JALA 4IXXA 2DVUA 1L6YA 3BH4A 3ABSA 1SFTA 4XUGA 4YN5A 5CPLA 1K77A 1U33A 4ZOCA 3L4WA 4DRKA 4FLSA 4JFMA 3M44A 4FNSA 1HJXA 5FAGA 1EJTC 2IXUA 2D9FA 3MUZ1 1EOKA 4GVGA 2EKGA 3LCWA 3PBVA 1JPMA 4M6QA 3D0CA 2H90A 1CGUA 3FAWA 3VNLA 4QRNA 3QH2A 2CYGA 1QI3A 2VGBA 1DL3A 3SQLA 4O53A 1M53A 4X3ZA 2KFWA 3W07A 3ZWSA 1RCXB 1R9XA 3B04A 1K6AA 2CBVA 3A47A 3TFCA 3NZQA 5DEZA 1JR1A 4F2TA 4O1BA 3N3TA 3EB4A 1CZ1A 3BCFA 3F5LA 3UPMA 2ZQVA 3K13A 2J27A 4H2HA 1FTXA 2ISFA 1IXPA 2CC0A 3LX9A 2QF7A 1Q1CA 4AZHA 3W7EA 3QQWA 5A5WA 2OLAA 1GCYA 3ZWTA 1UYQA 4FK9A 3SCPA 4CUCA 4BWLA 2ZRXA 3JW7A 3W7QA 1LF1A 2IPJA 4O54A 3U2ZA 3W7CA 2PTYA 3SCVA 1KBLA 1ZSXA 1X98A 4PCTA 1XC4A 3QY6A 4JTHA 1NMVA 1LWJA 4P7RA 4DRNA 3NO5A 2ZXDA 1WB0A 5LIXX 2ZOXA 4XD4A 1S1PA 5B80A 5AYIA 3V5FA 1QAPA 5AHNA 4CN1A 3T08A 2RDWA 3HGRA 4XG1A 5FL1A 3HM7A 3ZVIA 3QMRA 4ZODA 3KACA 4RV3A 4LYKA 4B92A 5EBUA 3T7VA 4B15A 1KBJA 3LLXA 4V33A 1SO6A 3RLUA 1NIUA 2OQHA 3BG5A 3BW3A 1NU5A 2WC7A 4QHRA 3QR1A 3UWUA 4R33A 4F8XA 2RJHA 3IUDA 5H91A 2JIEA 1H11A 1GVRA 3TEVA 3W7LA 3BGAA 4Z08A 1MQQA 4GI9A 3DYPA 4NI8A 4K2SA 4PFHA 4NAEB 3O6YX 1E3ZA 1ZL1A 1ML1A 3BOFA 1QNOA 4X9YA 4J3VA 1IIHA 4P5UA 2O9RA 4J3XA 1J4IA 3AMDA 1G69A 2V82A 2QCFA 2V2CA 4MSPA 2W63A 4EKJA 1G1YA 5E0CA 4L1XA 1W3LA 2WHMA 4MKVA 2WZEA 2CEQA 4DXKA 3S1WA 4HNVA 2C79A 2Q71A 4QP0A 1CGXA 4K3ZA 2PZ0A 1F9CA 2F2HA 2M08A 4IPJA 1VD6A 4H9TA 1NDZA 3NQAA 1JNEA 2D2HA 1I6NA 3GR8A 3G2GA 3QY8A 1JNTA 2NW0A 1KCKA 2G41A 3PZMA 4I8DA 1CIUA 4NT0A 1M68A 3FXGA 4FI4A 1XUZA 1JDCA 4AD5A 3HMJG 4BJHA 5JH8A 1YTKA 1KFJA 5DIVA 1EUNA 3WD4A 3V35A 4U28A 9RUBA 4EACA 3GU0A 3N4AA 3W1RA 4ATWA 1ENUA 2PLMA 3EOLA 5JH1A 4M8UA 2WANA 2E4TA 4W9PA 3H53A 1XFCA 3GXFA 4I90A 2X2GA 1L9WA 1JCNA 3B9EA 2ZX9A 1HQTA 3VIFA 2X1IA 4DRJA 4QGCA 2Y0FA 4UBPC 3ZYZA 4S3CA 3VX1A 1L6FA 4PUDA 3E2SA 3V75A 2GPTA 4HMCA 2DUXA 1H1NA 3ARUA 3SY8A 3FSTA 3DHDA 3M5YA 4O14A 3IPWA 3O07A 4S1FA 3L9CA 4JKMA 4KEZA 4WDTA 4H2CA 3TYZA 1EUAA 5FKYA 2RUQA 3IV8A 1OEPA 3WIJA 4Q33A 1W0MA 3E9AA 1W32A 1F40A 4KMQA 5T91A 4YCOA 4JGDA 5IXEA 4MJMA 3GU9A 1VRDA 4K37A 4ODLA 4RR4A 4IPIA 1PZ2A 5CZKA 2EJ1A 1ICQA 3BC9A 4I7UA 1TPC1 4GWEA 2E7FA 5DN1A 1RA5A 1E1FA 1VFMA 4AY8A 1H7RA 1N8WA 3T55A 4JBRA 1QHPA 3CWHA 4J28A 3LK6A 3H6OA 3WQFA 4U86A 3GDMA 1PUDA 2Z7GA 4JCMA 4DUVA 3USBA 4KR0B 1EZWA 2XIMA 3AFBA 5EY5A 3IRDA 4HTBA 3IVSA 1Y5VA 3AXIA 1XC6A 1I60A 4RXGA 1GJWA 2VURA 5J04A 1US0A 2Z29A 3K30A 3KLKA 3UWYA 4QIUA 2CNCA 3OVGA 3FGCB 1ZCCA 4UTTC 4HMDA 1JQVA 1WV2A 4CQ8A 2BWGA 1KCZA 3P0XA 1NDYA 3W71A 1Z89A 1YXDA 2RURA 5AOUA 4MZ1A 1VGAA 3WUBA 5CGMA 4LTSA 3G6MA 4BF5A 4FNTA 1J4HA 3WUEA 4QBXA 1LQ0A 2B7QA 3FXYA 1TTIA 4NYYA 3TN6A 4F3HA 4QDMA 3POCA 3VFCA 1UZ1A 2IS7A 2PDCA 4ERGA 4O8AA 1WDRA 3PR2A 4PL1A 4D6JA 1FWJC 3KTSA 3AI0A 3CWOX 3BAXA 4DHGA 1HO1A 1TQXA 5LIUX 3SQSA 3QR0A 3OA5A 3WENA 2IPWA 1HG3A 2NV1A 3ZR6A 4ADTA 5C7HA 5HQEA 2FZ8A 1CXLA 5HMFA 4M7SA 2F21A 4GLEA 3MU7A 1Q6HA 1KCLA 2DPEA 2FMOA 1SW7A 2XUCA 1K7FA 1B31A 4O8RA 3BANA 5AYBA 3M41A 3WDJA 4Q8OA 3D3AA 4HZ8A 4MYAA 3CQ0A 1PTAA 2V6AA 5I3FA 3FEMA 5I09A 4TV6A 3TXVA 3N13A 2CZ5A 4IP5A 1UR3M 2ANUA 3B8IA 4LX4A 3TN5A 4D72A 3C8FA 4UQ9A 2PP0A 4LAKA 1W1A1 2XIOA 2WZIA 2RHGA 3DZ1A 2AGKA 1XGZA 3NVDA 5LA1A 5C2XA 2GGEA 3IJ8A 1OYAA 2D3LA 2J25A 3BJSA 1XH2A 2ITKA 2XZ9A 3WH7A 2E0PA 3VC5A 2NWRA 3BSHA 4DIAA 5CAKA 3R5EA 1GPFA 3TH6A 3PFRA 5HMEA 1BWVA 1P0NA 4JQ2A 2I5QA 3VAVA 3PG9A 4IJRA 4BQ2A 1NAL1 1MVYA 2DT1A 5HULA 2DIEA 5DCEA 2MUCA 5HUOA 3WFZA 1B4EA 2DIKA 4HA3A 3PBYA 3BLPX 1AD1A 3HB9A 1CGTA 3PULA 1ZJBA 3L4TA 4BHYA 1IZCA 1MUMA 3GTXA 3ITXA 2FLIA 2KAUC 1GQNA 4W5UA 4DRSA 4TXEA 3OVRA 5GVJA 1QRQA 3WL0A 3RNDA 5LXEA 3L0GA 4FO4A 2OMAA 3H2MA 5IFPA 3NDYA 3UJEA 3UQIA 3F5KA 4CEUC 1R3YA 4WGXA 3VZYA 1XBZA 5K9XA 1FA2A 3CHFA 2ODOA 4QDWA 3FAPA 2I1OA 3KE0A 2Q6ZA 2VR5A 2J7BA 2PWHA 4J5NA 2FB2A 3UCQA 3RHGA 3NEHA 2VENA 4PUEA 3TYUA 3EDEA 2G3FA 1TA3A 2ABAA 2QAFA 1XDJA 3LD5A 3W1XA 3SM0A 4PMQA 4A2SA 4J4KA 1D9EA 1JIBA 4JY8A 2KGJA 1TPEA 1KKOA 4GYFA 3SURA 4DZ3A 3AISA 4M24A 4LY4A 1NMWA 2EG8A 1KQYA 1GZ1A 4JX5A 1JGMA 1TSIA 3LPOA 4S3JA 3LGDA 2CESA 4Y2WA 1V3MA 3MJMA 1AQ0A 2ZZ7A 3MVTA 3TN4A 3L12A 1CWYA 5M2FX 1W5NA 2IKHA 5FD0A 2OT1A 1EF3A 3E5PA 1BWKA 5HPOA 4DJDA 4QFUA 2A3BA 2WJDA 7REQA 1Y65A 3CO4A 2ATSA 2VX6A 5C9XA 3JXVA 1MW3A 1XR2A 3DBPA 1IZJA 3TR9A 3VKKA 2DSZA 1XRFA 1O1HA 4MM1A 3PJWA 2XVNA 3N2BA 1LQAA 2YW4A 1EYMA 4H8HA 1RQEA 3E2VA 4KESA 3UCCA 4I9AA 3CMFA 9XIAA 1BSLA 1XSIA 4LB4A 2VYOA 3GUWA 4U3AA 1SJDA 2PBOA 3U2EA 2YBTA 4HSNA 4Q7NA 3NQDA 4IL0A 1X1ZA 1X6NA 1EXBA 4C6MA 4FXRA 1B5TA 3C52A 5HJXA 1QI0A 3UW6A 1J01A 1NF0A 4X0VA 2DG3A 3DYMA 4B3ZA 1G7UA 4GUHA 5TAOA 4F2BA 3NYDA 2YLAA 1HNYA 4YTUA 3VD5A 3W0KA 2J9ZA 3ABXA 2NWSA 5B7ZA 2HISA 4UIOA 4R5EA 1XYLA 3NSMA 4JIRA 5I24A 3VM5A 3DXIA 1XLAA 5FEPA 1V08A 3MBDA 4NZ4A 3S9IA 3APTA 2WOQA 4JKKA 1MFVA 2PSNA 4AEOA 3PJXA 4GK8A 4OBSA 4OKDA 3HOJA 4M6UA 3LSCA 1EEXA 3LXCA 1M7XA 1ZAHA 3SRHA 1TRIA 4JR5A 4A22A 2XP6A 3A24A 2REQA 2OODA 3WX7A 4B90A 3S6TA 4MWAC 3UEQA 1GRJA 1FWCC 3O05A 3RM9A 4O1DA 1W9BM 1YX1A 4BR1A 4H7VA 4LVBA 2YBUA 5JIPA 1Q45A 3WH8A 1PX8A 3CAQA 3PZ9A 1RZMA 2V5CA 2ESCA 3F2CA 1IHIA 2H6RA 3OG2A 2QCHA 2GQ9A 4KGLA 3E0IA 5FOOA 4JQ1A 2QYGA 4Z17A 1F6PA 2FHBA 4C6KA 1UROA 1XJBA 1UZDA 3R6IA 3A3WA 3BLEA 2BY2A 2F6KA 1QOPA 3EKGA 1L6GA 1U1UA 2OT0A 3NQMA 2ATMA 4MDPA 4NNCA 1X8CA 2KI3A 2FKEA 3WDQA 1SU5A 5C71A 3B0PA 4TW7A 4ZVJA 5L6UA 2YDAA 4GBUA 5C54A 3MUAA 1KT0A 3THUA 3RFAA 1YPFA 3CT7A 4LAVA 5CGTA 2CFFA 2Y7FA 2Z25A 2A4AA 2XIQA 4L6OA 3W81A 4QAWA 4ORIA 4Q8WA 3ARRA 2YDQA 4HK6A 3UXDA 3LTPA 3OB8A 4FXFA 5D9NA 5FJOA 3LG3A 2F8QA 3RXZA 3DKJA 3O9NA 4NX5A 3O1NA 2RJGA 4DWSB 3K1DA 4ZFCA 4UZUA 1QPFA 5AN7A 5KITA 4WLCA 5HNTA 4CN6A 5AHIA 5FJUA 3DFYA 2ZR4A 4GY7A 4IWWA 1DE5A 3V1HA 4HA0A 1XI3A 3T4CA 1G0CA 2GZXA 2D1ZA 1FKTA 3MTWA 1W91A 1WZLA 2AQWA 2BXYA 3OTRA 5DBUA 2H3DA 1QATA 4H7CA 3XINA 1TELA 3WNKA 2VZUA 1UKPA 4DJDD 2BHUA 2FIQA 2NVCA 1H62A 3G8EA 2Z4GA 3OODA 2CETA 4AQLA 3LRMA 1CXEA 3UVAA 3P8IA 4K68A 4P7QA 5GJNA 3AWNA 2VQTA 4M5PA 2VVNA 3NXLA 2W92A 4AZBA 1GOWA 3MMWA 3I3EA 1NFPA 4C6OA 4I8YA 5BRBA 1ONRA 1CPUA 4DVOA 3REQB 3GC4A 3AC0A 4XBKA 1MEHA 3VPLA 1WOBA 5F2IA 2Y7DA 4HZMA 4OJYA 2C0HA 2ZUTA 2Z2AA 5HR7A 3QVQA 4NX0A 3KEHA 2VX5A 3GS6A 1JUBA 1ZBKA 1RY0A 4LVFA 1MZHA 4ES4A 3L2LA 4HT3A 1OFDA 2C15A 3WK1A 3BLKA 1IF2A 4EWJA 1KD0A 3G1SA 1W6TA 1GG1A 1WYIA 4AZCB 4J35A 2DJLA 1HJQA 2UZ9A 3M0JA 1A0EA 3C2VA 5LGZA 1FP9A 1UBSA 1KBIA 2GK1A 1F6KA 2Z6IA 3O6DA 2W79A 4GQBA 4AMAA 4G50A 2CLPA 2O9PA 4IICA 3W88A 2YIHA 1EOMA 1Q6OA 3O5FA 2XISA 3G5EA 1WCGA 2OSWA 3QHMA 1FKKA 3Q94A 1LUCB 5MF5A 3RGCA 1YQ2A 1S2VA 4OWGA 4KWWA 2R94A 2VFIA 4G7EB 3B4YA 3OP2A 2B7OA 2BZNA 3SDOA 1F3WA 3BLLA 4DRIA 1H7WA 4XZBA 3N25A 3AZTA 1YKWA 3O5LA 2YZ5A 4E4PA 5ECVA 3W25A 1NQ6A 3DG6A 4IIHA 2WJEA 3W2KA 1X6UA 1LL4A 4AU0A 5IM51 2F9RA 4GI4A 3QZ6A 1A3WA 2CXGA 2Z27A 2NSXA 4EAYA 1YXCA 3NFUA 1J0YA 3NPVA 1C8VA 3B4UA 3B8WA 1V3HA 1VYPX 4HU8A 4DJFC 3CIXA 4PCNA 1DBTA 3P14A 5JMUA 1D3GA 4DO4A 3VDCA 2C18A 4C6NA 3ZZ1A 3CV6A 3B8UA 3W01A 3RM4A 1BYCA 4FX6M 3GIPA 4IJBA 2F38A 3BQ6A 4HNCA 1QNRA 2Y8UA 4M82A 3A13A 4B5XA 4E3VA 2FZDA 4Q4OA 1X7IA 1EA9C 3BE7A 5AHEA 3LBMA 3GDKA 2WNZA 2Q01A 2PMQA 1FWEC 1S2AA 2XFYA 3KTXA 3VUPA 1UWAA 5EFDA 4M6VA 3RYSA 4LYQA 4AC7C 1Q6DA 2UY5A 2PWDA 1LG1A 3OIHA 4EF9A 2V68A 3FJ4A 2OEMA 4DZAA 2GJRA 5CPSA 2DSUA 1FAPA 4ZTYA 5HUPA 3AHZA 2PRHA 2G3JA 2ZRWA 3KLLA 3M43A 1A0DA 3WLLA 3IV3A 1JCLA 3ZVHA 2VUYA 1KXTA 1E6ZA 2QPSA 3T2OA 3TW9A 2FZNA 3VGHA 3P93A 5D9MA 2EULA 3AIWA 1DJYA 3E6EA 2E5DA 5FI8A 3KWSA 3GIQA 1RK5A 3N2TA 4H00A 5AKQA 3N12A 2J13A 3ARZA 5G2WA 3TAOA 3WLNA 4B2DA 2PP3A 2YA2A 4O1CA 2QJJA 3DENA 3ZXWA 1MI3A 1Y0OA 2HDJA 3H54A 1OCQA 2R6OA 3K46A 3LY0A 1ISZA 3OIXA 2OJPA 4DUOA 3EKZA 5DY2A 3IHZA 2D73A 1R3QA 2RDUA 2EKCA 3CGTA 2XU2A 2RFGA 5AZ0A 1PZ0A 1P6BA 4E4FA 5A1AA 3FYPA 2UY2A 3IUHA 3ZR4A 4WSHA 3SCWA 1XWYA 3NVTA 1EA0A 4UTLA 1EYEA 1GNXA 2DY3A 5JH2A 4A05A 1NH6A 3JUGA 3E1F1 4JNYA 3VNIA 2CITA 3N4FA 1Z7AA 4EXQA 3SY1A 4CD8A 1E6QM 3OHMB 3GRIA 1W31A 4UTTA 1EP2A 1YE6A 3FSUA 5KMYA 2V5KA 4O10A 4AZ7A 1EIXA 1TWIA 3ES7A 4Z1AA 1FY6A 2P5NA 1BKFA 1RXOB 2HVOA 1U5HA 2P3EA 3EMCA 5HWNA 3HMCA 4TX8A 1S5WA 3HQOA 4O17A 5F2LA 1OFEA 2NV2A 5XINA 3MMTA 3KVMA 5LNUA 5HT1A 3QFWA 4JL2A 1XICA 2MLZA 1LOLA 1E9IA 3SEPA 1KW1A 3PNUA 1XPYA 4TNSA 3CWNA 5JVLA 1YADA 4ZB2A 4MOZA 3ZT7A 4IG2A 1JRBA 6REQA 2XIIA 1ZQ5A 4FR6A 5KZEA 1LRNA 3V7PA 3LGGA 2WVTA 2XG9A 3KRUA 3W53A 3F4NA 1V0MA 3LYEA 1S3TC 5ABGA 1JZ3A 3MVIA 3KAIA 4D6FA 2ZX7A 3RN6A 4ACZA 1GZGA 2POTA 3N18A 2CLFA 4GIVA 2NLIA 3ATYA 4EPEC 1IEVA 3MO4A 1HGYA 2JEPA 2QVNA 1RJRA 4O0KA 3AIUA 2Y8KA 3MANA 2GYIA 3CZEA 4OQVA 1W5OA 4QCEA 3W27A 3GTIA 4C6FA 1FCBA 4H9XA 4DO7A 2Q02A 3ZQ9A 2E6AA 1WAWA 2WB5A 5FF3A 3QHNA 1D7JA 1BGGA 1ZY9A 2CWXA 3RAOA 1EL3A 1JF5A 3VE7A 4NF7A 4WOQA 4WSKA 1E55A 1XPGA 4RDVA 4GGHA 2FMNA 3V3WA 1BVZA 5E6YA 3BMXA 5LA0A 1Q6IA 2GGGA 5CG0A 1W1IE 1AMKA 2F6XA 3IRSA 3AHYA 3TWBA 4CD6A 5K2ZA 4LVDA 1UUOA 1XD0A 1YDVA 4XQ6A 3I7SA 4P2VA 5EYWA 1R47A 4XV0A 4CCEA 1V02E 4IP7A 2WMKA 4L1GA 3CAVA 3WD3A 2ZE0A 4XZHA 2VZOA 4IXHA 3Q37A 1PTGA 2ZA1A 2Q8XA 1EPXA 1HFBA 4JDYA 5E0KA 1F2JA 1JYNA 4UQAA 3NPXA 4B4FA 3JYMA 4Y8FA 3LDVA 1XKYA 5SWUA 4PEEA 2OXNA 3R4IA 5FESA 3RR1A 1P0BA 4N0RA 3SFKA 1M7PA 1VJIA 4GD0A 4C7GA 4A8LA 2I9UA 2TPSA 3WZ0E 3IJ7A 4BQ5A 4ECLA 5BNKA 1UH4A 4XBJA 1D3HA 1ZFJA 2FHFA 2XP9A 4KRZA 4JTGA 4JD4A 3CXOA 2G4JA 5FEZA 1AUSL 4HCDA 4A6GA 1SSDA 4B2DD 2HE5A 2HMCA 2QUUA 3SCNA 3VNDA 5A6SA 3LPGA 3PUEA 1B2YA 4ODQA 4PA8A 3NL3A 1KGXA 3QFEA 1FKRA 3WCZA 4XAKA 3G3MA 3UVIA 9XIMA 4UTWC 4UTMA 1ICSA 2J7HA 2PEVA 1EP3A 2PCEA 1VBGA 3FX4A 4DPPA 5HW6A 3W6LA 4FIRA 5DANA 4DRPA 4PCFA 4DI9A 1IIGA 4A3QA 3PZNA 3WD1A 3K2GA 5HATA 3P74A 1X38A 4KRTA 5GQBA 4MPQA 3TROA 3UZWA 1J0HA 2YDRA 3TP4A 2VFHA 3IARA 4Q8MA 2IQTA 3ARQA 3B8VA 4WKFA 5REQB 2B0MA 4GUGA 3E0LA 5GNXA 4IT4A 1XIBA 3M0YA 3OLEA 2MANA 1OFQA 3GLCA 4L4OA 3TLLA 4XZMX 3HPZA 1FHDA 3VKBA 2PLKA 5CC5A 2YL5A 1XG3A 4RJEA 1XGEA 4HBEA 3KVKA 3B9DA 1OBAA 5LIYX 4KWUA 4Q6JA 1DIOA 3PB0A 1ZJIA 5CZTA 2ZUUA 1U83A 2FTPA 1RQBA 3PTQA 4PYSA 4U5KA 2ZUVA 1C7TA 1GEQA 1PBGA 2VD8A 3S2MA 1G01A 4PTXA 1VFHA 2BB0A 2Z2UA 4GUJA 5EB8A 1VBUA 1LP6A 1D3CA 1U1JA 2V3EA 4JTTA 3CNYA 2WZTA 1BG4A 3QV9A 3W23A 3ZIZA 1JXKA 3E12A 2CHRA 4HK7A 1EDTA 4IQJA 3EWUA 3TC5A 3BO9A 5AHLA 4TR9A 2A85A 1DTUA 2W4XA 3EPNA 1M5YA 3NM3A 3QC3A 5TD4A 5LIKX 3WFAA 5LNSA 1BQCA 5D05A 1VLIA 1RD5A 1EB3A 3T2PA 2HROA 4LYRA 1XIGA 5ABHA 3G24A 4U10A 1TIWA 4QE1A 5A8OA 2E67A 5A3HA 3VMPA 2NUWA 2BY3A 1KV5A 2PLCA 4MWAA 1US3A 5BXPA 1UQZA 5FAJA 1XX1A 3H2EA 3K8LA 3R1ZA 1XP3A 1DXFA 1XH0A 3W75A 3NZGA 4LT9A 3L4VA 5DITA 1UUQA 3QN3A 2UZ5A 2PD9A 3VMNA 3URQA 1LQ2A 4S2CA 5KZDA 4L4PA 4JNZA 4MFDA 4PMRA 4PMVA 5LGXA 1JZ7A 2V8ZA 4KFOA 4NG3A 4MMWA 2VUNA 1DJIA 3R13A 2BGQA 2ZZ6A 3EXTA 4ZOBA 3VM7A 4GXWA 2OZ8A 1XBYA 1A80A 4DXXA 1OABA 3CUZA 1MO0A 4R88A 2UV8G 1I2PA 3MZ2A 1PKYA 4LBUA 2G3MA 4QCFA 1R7AA 1HKMA 1H0GA 4GQQA 4PMDA 4Q4PA 5IFTA 4LF2A 1J4EA 2YXGA 2OB3A 3NQGA 1HVXA 3A4AA 3LI1A 2A3LA 5CKSA 1DWAM 3AXMA 1FRBA 2QDGA 3ERPA 1ZNNA 2UY4A 3UZZA 3P5YA 1K8ZA 1XLKA 4KEUA 3W7MA 3WD0A 5JUVA 3S5YA 2P0IA 2Y63A 2DG4A 2FAPA 2J24A 3APGA 3RDKA 1XSJA 3P81A 4GNJA 4XAGA 3QTGA 2X7VA 3VIKA 3EX6A 4ZO9A 4H8VA 3EWXA 4UCGA 2QW5A 3QOKA 4D6DA 3UETA 2J9YA 3LCHA 3H9RB 1A4MA 5D32A 1DEDA 3ABOA 1FWTA 4JFIA 1H50A 2YBVA 1ZHAA 2DQWA 2VFEA 1K8XA 1T0OA 2GOUA 4EAMA 3GR4A 1QO5A 3ZLHA 3E3HA 4Q7BA 4HA4A 1GKPA 3IGUA 2GJPA 3U6WA 4IPLA 4C02B 4DUWA 1W37A 1JGIA 3C2RA 1SO5A 2X7WA 4R34A 3KRBA 1D7HA 1GONA 1J5TA 4QG8A 3WQDA 2YOCA 4LQ1A 3WDPP 2X16A 2M2AA 3IKDA 4UTUA 4XAZA 2IQDA 3V5CA 3CAWA 1W17A 1RHCA 2WNQA 4YHGA 2DEPA 1A53A 4GGBA 1K02A 2G97A 4GO8A 3UQAA 3UFYA 5EMUA 3LBOA 1J0ZA 5JBFA 1S5VA 3BLIA 4L5ZA 3CLWA 4HGXA 4IQDA 4QJ4B 4WY0F 4MIMA 3I4KA 3SR7A 1UOKA 1E1CA 2V3DA 2ZYFA 5CPOA 1EXPA 4AMCA 4QSFA 4O11A 1E43A 4DZHA 1JF6A 1CECA 4BA0A 4C6QA 3IACA 3KAGA 2ZZ3A 2Z2BA 3S2NA 1XD1A 1L8PA 3LHTA 1O4UA 2VL4A 4OUIA 5HXMA 3ICJA 4R85A 1TV3A 1AZ2A 1VFLA 3MUXA 3SJNA 3PRAA 3TNOA 4LS0A 3W00A 3CLMA 3G1FA 3WEMA 1H7XA 3GG8A 3STFA 5G1MA 2MLYA 4ZPVR 4XIAA 3AHVA 4IT6A 3CL6A 1TWSA 4WSJA 3SRFA 2NXHA 3DHFA 4G1KA 2WSYA 3U48A 3O8AA 1LORA 3CQIA 4JICA 2H8XA 3KFTA 2BASA 2PC8A 3VGDA 2OKOA 4HSOA 4NI3A 3T09A 1GVQA 3RF9A 4QQ3A 3U5UA 4WJXA 3VUSA 1JVNA 3H24A 1EJUC 1W56A 1UPPA 2FFCA 4YWIA 4NZ3A 3Q58A 4MWAD 1EQPA 2PWEA 5AYYA 4POCA 2YYTA 2JKAA 2WKGA 3WQGA 2OSXA 6TAAA 1AA1B 3H4WA 4JTFA 3C61A 2OR2A 2ZWYA 3IUIA 4UNKA 2NQZA 4MHBA 3AMLA 4WR3A 1EGMA 1TA3B 4FA3A 1XRVA 3M7WA 2BOGX 4IQCA 4DJFA 2J47A 4ZOAA 1E70M 3GTHA 1TMQA 3S83A 3EX3A 2A6NA 4YXGA 2ON3A 2QHAA 1MEIA 1MFUA 1MW0A 3W22A 3UBPC 4YYCA 5HPCA 4UQEA 4HHMA 3RJYA 4XSMA 4IMEA 2W0UA 1E5JA 1MNSA 3FYYA 2R8WA 5A8QA 1NFBA 1TMHA 1BWLA 1BYAA 2PZNA 1J0JA 4UFHA 1L0PA 4H04A 3TQKA 1WBHA 3A22A 1A5KC 2BXVA 2F23A 1DWHM 1Q6EA 2PB1A 4GC4A 4YNGA 1VJSA 4YHEA 2POZA 3KZSA 3CZ8A 1M03A 1JZ5A 3JS3A 3WN6A 5CGQA 5H2ZA 2VC5A 3CBWA 4TMCA 2VKZG 5HUAA 7REQB 4DRHA 3RPTA 1H63A 3U8GA 2OGYA 2J9XA 3E96A 5L9FA 3ITOA 1FKIA 1QBBA 3OZYA 3TCEA 3LCFA 4MY9A 3R58A 2VEMA 3GFYA 1FD9A 1WKDA 2ZFAA 4IMCA 2DVTA 1PEZA 3GAYA 4DNHA 2WMHA 3LLFA 5EMKA 4Y9OA 1SFJA 1XDLA 1KBBA 1XLCA 1V3JA 2Y2WA 3URNA 4W9TA 3QW4B 3H2NA 4ICCX 4C1KA 3GG7A 4REQA 3II1A 4U5IA 1VRXA 3UY8A 4UMAA 3B8DA 4ROQA 4L1WA 3VD3A 1LWHA 4QTGA 5D2XA 3UJRA 3NGFA 4C5YA 4ODPA 4XVEA 2EQDA 4KCWA 2OSYA 4PUJA 1TVNA 3PB2A 4DX3A 2GDQA 1B3XA 2QMJA 5D09A 4JTEA 3VGFA 2BG5A 3QOMA 1SUXA 2X41A 1POJA 5C9RA 2WNWA 1R9HA 4I5XA 1FHVA 3AS0A 2OZ0A 4K1WA 2A5HA 4BWLC 2F4EA 4IIEA 4B91A 3WH6A 4RDYA 3TTOA 4NRRA 1DJXA 4HYVA 3QW3A 4MUPA 2Q5AA 3UI6A 1TJ2A 5D2TA 3AOFA 4L72B 2P8BA 4ZXLA 4R7OA 2N87A 3WF3A 1UWUA 2FH6A 3TLQA 5JXQA 1Y7VA 3IJDA 1NVMA 2W67A 3RMJA 4QROA 1IWPA 4DUXA 1Q66A 1KXQA 3EDDA 4C60A 1VB9A 2A3AA 4DNMA 4F0RA 3F1QA 2REQB 4H6QA 2ICSA 1SFSA 1A5MC 1SO4A 1JQXA 1VHNA 2BTMA 1J2BA 2QUVA 4OFCA 2HS6A 1H1YA 2LJ4A 4DLMA 3PUOA 3FJLA 1M9HA 1R6WA 4MKNA 3UG5A 1OYBA 3STGA 5AC5A 3C2OA 3THDA 3U57A 2Z1SA 3O5KA 2BY0A 2OYMA 2QMKA 1RJQA 1CXHA 3GX9A 3OYXA 5RUBA 3EA3A 1GOOA 1Q2RA 4JKLA 3V5OA 1EIBA 1MZRA 4D8LA 4ZSTA 1W5MA 3EZ4A 1F4HA 5CSYA 1B3VA 3B03A 2R82A 1TPVA 3P5ZA 5I3JA 3B0UX 2AQVA 1PV8A 4EF8A 1RV8A 3TXZA 3W72A 4DAIA 3P6LA 1NOFA 2WCGA 4XD3A 3UQNA 4I9JA 1GHSA 3W7JA 1H7OA 2YW3A 4H9UA 1PINA 5M5DA 3WLIA 2V3FA 1AL8A 4H1ZA 3TYAA 3HJEA 3IK4A 2XP4A 4KH2A 3HGOA 2OOGA 3AS2A 3VILA 4MZ8A 3GHSA 3ISIX 1TV5A 3GR7A 4JTCA 1VJZA 1UD5A 4JEQA 4YIWA 1AODA 3W28A 1ITXA 4A8IA 3ITTA 3NGJA 3W74A 1IGWA 3NOEA 5FSDC 5C9ZA 1FH8A 3MA8A 3AHXA 2O4MA 2W9MA 3T6CA 4D8AA 2Z7KA 4DJFD 4ZA0A 4YLWA 3GXPA 4M3PA 2XH2A 4UR7A 2J8FA 1OGBA 1GVOA 3MZNA 4PEKA 4AY1A 3PBMA 4DH0A 4XZWA 1FWGC 2QJNA 3P2VA 2IKGA 2WHJA 2QT3A 3L4YA 2MF9A 1PO9A 3FAXA 2BVWA 3RGTA 2FJUB 3WG6A 4WHBA 3UZYA 4M7TA 3GK0A 3ZJ7A 1Z32X 1JCYA 1PIIA 1OJXA 1WDWA 3W3OA 2DT3A 3OGRA 1HKIA 3R0DA 3A23A 1QW7A 2OO6A 4NAFA 4L9ZA 1KXHA 5FEWA 3I6EA 3A9IA 1Q6LA 2P50A 2VNCA 1DP0A 5BRPA 3MI2A 3TTYA 4I5UA 3GBDA 1PB0A 1X8FA 3O5PA 2EPLX 2E77A 3TONA 3F5JA 1OCJA 4A21A 4IP4A 3CUHA 1XLFA 1M5WA 4DEFA 2VEPA 2VVSA 3DFQA 2G96A 3W2UA 4QLKA 1RCOB 2C1GA 4AVFA 5LIWX 4NZCA 1JCMP 3CHDA 1YRRA 3IEBA 3FA3A 2CLEA 2PPPA 1W3TA 4C6CA 1Q8JA 4X0NA 1XIHA 4E4UA 1QPNA 1VENA 1NTHA 1NM9A 4DT4A 2G50A 4LC8A 3M47A 1OWQA 3H8AA 3VOGA 3WY1A 3RILA 3UA3A 5LSMA 1XIJA 4KGJA 3RIKA 3H7RA 2WSQA 4FOKA 5I3HA 3CU2A 4DROA 4O1FA 1Z8AA 1Y5XA 4AVOA 5EU9A 2D2GA 4RE4A 5CG7A 4X22A 3TIMA 4UTWA 3LU2A 1TTJA 1JYXA 3AS3A 1QI4A 2C1HA 3HZ3A 3POHA 3GVQA 2GK1B 4HHPA 4JN7A 2YCKX 3HPSA 4XAYA 1A5OC 2FVKA 2FH8A 4PTDA 1R46A 3R8GA 3ORWA 2ZC1A 4QQUA 4WX2A 1P0DA 3R89A 2QCNA 2XPKA 5DY3A 3VU2A 4H9ZA 1C7SA 1KXVA 8TIMA 3SSJA 4AD3A 3TV8A 3FW6A 3ES8A 3WF0A 4ZPTR 1FOBA 2J8GA 2OWXA 2V38A 4LF1A 5CPTA 3L0NA 1Q7ZA 2I16A 4XKYA 4MADA 4R9XA 1CLXA 1E72M 3MW7A 1MRAA 2ZX5A 4C6IA 4EK7A 3WQ8A 2XP8A 2XP7A 4AH7A 3OHIA 2NQJA 3ARPA 1TUXA 5DO2A 5C9UA 3S5NA 4ATLA 1QASA 3AIQA 1LOQA 3W29A 3UPWA 5HQMA 2R1MA 3GYCA 5C5YA 1RH9A 3LMZA 3MSYA 3R79A 4H7ZA 4E8DA 2PC4A 3GY1A 5XIMA 5EPDA 3N2CA 4LJ3A 3NPWA 4KCTA 5MKGB 3TA6A 4CD5A 2Q3RA 2VO5A 1FHLA 1U30A 5BZAA 3GU1A 1DJQA 3IJ6A 3CIVA 3AU2A 5D8WA 2HJPA 4MGVA 1HUVA 3L4XA 2Y70A 2FTWA 4Z2JA 3TTEA 2ZZ1A 1PL9A 2J8TA 4FB7A 2I57A 3QZAA 1IEWA 3BV4A 3PWGA 4GMEA 4Y8EA 2GQ8A 1EJRC 3ENLA 3O16A 2BY1A 4PUUA 3WLTA 4DRMA 3EWYA 1EDGA 4LVGA 2PD5A 2KZHA 4N42A 5IHRA 4P8UA 1VC4A 1ICPA 4N6EA 3GG0A 1VS1A 3VC6A 1IT8A 1A5NC 1N8IA 3MYPA 3PSVA 2QCDA 1O5KA 3ZVHB 4ZO7A 5HW8A 4V15A 2INZA 3H55A 4LEQA 3CZKA 5AZ1A 4OECA 2XVGA 4BK9A 4ZXOA 5C6MA 1H0IA 4L4LA 4F0LA 3QEZA 4QXIA 1B3WA 4MPKA 2YLLA 4I7WA 1KNWA 1TJ0A 3HURA 3KOYA 3DFHA 4FP1A 4RW5A 3W1UA 2A3HA 4W85A 5LZLA 2OU4A 4GVHA 3KADA 3NO3A 1F6YA 3VD4A 1MDRA 4RDZA 2HBXA 6ENLA 1WXZA 3S0CA 3LTSA 4DM2A 1GWJA 3OQEA 2IPGA 3OVPA 4YTQA 3LUTA 3RU8X 1GOIA 3H23A 5CJNA 3T0AA 3E2RA 4RW3A 4US5A 4B5VA 1VBRA 1W9PA 3G18A 4FAPA 2DDXA 3SUUA 1V3KA 5C7VA 5DRIA 5T26A 2P0OA 1EGVA 3R8HA 1IR2A 4NJIA 3NJ3A 4F9DA 1TVPA 1N8FA 3UA4A 4AB4A 3GKAA 5FF2A 3QHOA 4N2YA 1VAHA 2NZLA 2GVLA 3GM8A 2CIPA 5CQ1A 3N9KA 3EA2A 1J6OA 4UXDA 3OYZA 4Q7IA 1C93A 3GUGA 2GJNA 5TF0A 1FBAA 3UJFA 1UD2A 5FEXA 3TNBA 2JKEA 1FKSA 1T6MA 2W66A 4UTHA 4AD0A 4FOUA 1HZYA 4PRWA 2FJKA 5XIAA 2X05A 4JAWA 5CBBA 2B31A 3K8MA 1PKLA 3C5QA 1HO4A 1EWEA 5CEWA 3WBAA 2OGJA 3CZGA 2YA1A 2VGGA 3KX6A 4J27A 2OFNA 4XAPA 3UXLA 2VDGA 1EFZA 1MQPA 7CGTA 1HKKA 1Q2SA 4NXKA 1EWDA 2JIWA 2HPIA 4YMZA 2QF8A 1AH0A 1D7KA 1FDYA 4GX8A 3URAA 1QNPA 1R3TA 2R91A 3V0TA 1V6WA 4OE7A 6REQB 2FDMA 2C6QA 5DXYA 4HSHA 4IH3A 4NJGA 1MWOA 4X9SA 4GY0A 4I6KA 3BURA 1TMLA 2KO7A 4Q8PA 3I7RA 1QXLA 4HN4A 1QWKA 4W88A 1ZENA 4LUYA 3W86A 4M6PA 4DBUA 1RVGA 3MI3A 1T99A 1ZCOA 5HNUA 1CDGA 3S9YA 4U84A 4LVAA 5ENLA 4ACZB 2PGEA 1OFOA 4U2ZA 3EMQA 2EGZA 2PDPA 2YB1A 3A6OA 2XM1A 4KT2A 3RX2A 4GHRA 2QCMA 1NWSA 3MHGA 4GI6A 4U4MA 4LGXA 3WQ5A 4W89A 4NZ5A 3MJYA 1CT5A 1G9HA 1EPVA 4ZZ9A 3QC0A 4ADSA 1KTCA 1IT0A 1E6NA 4URIA 2JQXA 1I75A 5CXPA 3DFNA 5E6ZA 1AH4A 2D2JA 3RCYA 3FYOA 3H2FA 4RNFA 3QLDA 3UYIA 1FWAC 4KS0A 4KEMA 1OK4A 2H9AA 1OT1A 1YW1A 2Q09A 3T40A 3FK4A 3I3BA 5CJMA 2AGTA 4IZGA 2PDNA 4WUIA 3AXKA 1JULA 1JDFA 2XIJA 4B3LA 4P8XA 3DERA 2BV9A 4M56A 4EVZA 3OGSA 3BARA 2PPGA 2ZCGA 6CGTA 3E2QA 3IAPA 2WCAA 1AH3A 2VZSA 4HQVA 4N9CA 3O5JA 1BGAA 1OSEA 2JK2A 3B97A 3NL2A 1SJCA 3CQKA 2GWNA 5KINA 3ZO9A 1AZ1A 1I1WA 2DV0A 3NTYA 4CCDA 3CAKA 3MKCA 2PFHA 4PUNA 3GTYX 2AL2B 3ITGA 3VDBA 1RD6A 1MXGA 4N02A 2FDSA 3ZMRA 2WPGA 1BQGA 1ZK6A 3I6CA 3ONCA 3MMUA 2E6FA 4AC1X 4NNBA 3W7PA 4TOQA 2GQAA 4US5D 4UOQA 4YTSA 4I6VA 3MUIA 4RNJA 5F2GA 1D8CA 2EPMX 3W7HA 1PS9A 4LNCA 3G1HA 1Q65A 3CUGA 3AJXA 3C56A 3BV7A 1V77A 3HBLA 3GO2A 2ONEA 4TIMA 3FHQA 3SUWA 3OA3A 4H6RA 1RA0A 4LAWA 1CLKA 3RX3A 4O0ZA 4W87A 1YIXA 4BQ3A 3LCIA 3PUDA 4HK5A 1KB3A 1EC7A 3KHDA 1UKOA 1W54A 2CCRA 1TR1A 3BLOA 5D2WA 1NDWA 5IBXC 4C6BA 4HA1A 2WVUA 2HCVA 4WCJA 3GC5A 3IJLA 5ABEA 4IT1A 4CNUA 1JD9A 3TOYA 1J11A 2JF7A 2JGYA 1HKVA 4JQAA 1F3EA 2RUSA 4ML4A 1QFEA 1REQA 2P1FA 1LLWA 1GJUA 2EPKX 3MDUA 5U4NA 1R9ZA 1SW0A 1JXJA 3C86A 3EWDA 1SQ7A 2Y78A 2D69A 2OQLA 1WQ5A 3SY5A 4X2PA 4H01A 1EJWC 4W5ZA 1HP5A 3AYTA 3N2MA 4E38A 5H8MA 3OBEA 1OD0A 2ZR5A 1AJ0A 3DIPA 3O5OA 3BGGA 2XH0A 3CZJA 1NSJA 3M9YA 3TCZA 3P67A 2V0TA 2YFNA 3F7JA 4JFUA 1PKMA 1H60A 2XDFA 3CGMA 1D7IA 3G0XA 4DN1A 3TYEA 1KM5A 2NVDA 3EA1A 4XTDA 4DXVA 1LT8A 4HARA 3ARYA 1LCOA 1NP2A 4MF4A 1XIDA 2D20A 1PYMA 3P7YA 2YSWA 2PV1A 3MSGA 2E40A 4LAXA 3LCLA 4GZEA 1XLGA 3V0SA 1QMLA 4P7LA 1Q4WA 1DQUA 3LTYA 3BMWA 3UI4A 4MWAB 1VPXA 4MNMA 4CD4A 1VF8A 4H8UA 1XYCA 2O7SA 3DI1A 1A49A 3NPUA 3PZOA 1AVAA 1OM0A 4B4HA 1GZJA 4GIYA 5F7UA 4HU4A 3T0DA 2QPXA 3W7RA 3OZPA 1G4PA 1OX4A 1HL9A 3QMTA 5HANA 1P1XA 1LT7A 4KRUA 3PVFA 1G4TA 5HWBA 2KX9A 4C7DA 2UY3A 1AJ2A 3N6QA 4BY3A 4D6HA 1H3GA 3RO8A 5PTDA 1C9DA 4J3UA 4WJ8A 5A8NA 3SCUA 3CYJA 3D5HA 4WF7A 4BQ4A 2I14A 3PZTA 1BRLA 1C8XA 3SGZA 2PGRA 3ZLFA 3EIPA 1A5SA 5DMNA 2NXIA 2R24A 1KTNA 3N34A 4LUTA 3VIHA 3HF3A 3SRDA 4LPCA 4PBFA 1EP1A 4FX7A 2G37A 3KBSA 1SPQA 1XCFA 3WEOA 5M3WA 4EPDC 4L80A 2EAWA 3PBGA 2G95A 3C0LA 3VO0A 4B9YA 1S2CA 3C2EA 3VDHA 2DZPA 2DZBA 4TVUA 3USZA 4FN2A 1KM2A 2Z26A 1EJXC 3GNRA 2NX1A 2QCLA 1V03A 1M1BA 1I8JA 3H4XA 3TSBA 1JFHA 3H26A 3KOWA 4F40A 2PDYA 1UWRA 3NZRA 5HBFA 1XIFA 4W7VA 5G4WA 3ZS4A 1KLYA 2WWCA 1W9XA 3PM6A 4UQBA 4ERIA 4TX9A 4RUBA 1R5YA 4GQGA 3S46A 1RBAA 3KAFA 1AMYA 4GJIA 3GB6A 3EOOA 1ADSA 1W3JA 4YU1A 1E4IA 3S2LA 4E2OA 3WNOA 3VIOA 1FWFC 1FKGA 4JFLA 3F4CA 3P8JA 4NJHA 1TV2A 5HK4A 4DY1A 3WNPA 1YYAA 1E15A 4HTYA 1LWIA 2CZVA 4J9JA 4G9PA 3O5MA 3KRZA 1UD8A 1E0TA 4CNPA 4TTGA 5TNVA 4WEVX 3W73A 1WA3A 1ONWA 3GXDA 5DIUA 4HYRA 3NR0A 4PC8A 3NZPA 2JKPA 1P6CA 1E1CB 4ZMGA 4JTKA 4UQDA 3C0SA 3NO1A 4AEEA 2VQUA 4GVIA 2PDMA 1Z44A 3CL7A 3TKFA 3MYOA 4A8RA 1TRDA 4E3TA 3PJTA 5ECUA 5CBJA 4HJFA 1HXJA 4DRQA 1WAUA 1TKKA 3M5ZA 3CJPA 2ZRZA 4UFIA 3T8QA 4ALDA 1HJVA 4NP7A 1KLZA 2Z1BA 2RDTA 4P61A 3H2OA 3VZZA 1CW2A 3R11A 4IGSA 2CKSA 2D23A 5IRPA 1ONEA 3MSDA 1BEUA 3WLPA 4A3UA 2VT0A 3CUFA 2MPHA 3AU6A 2ZVRA 3ARXA 1T40A 2GQ3A 2QIWA 3FV9A 4NXSA 4E0CA 4J4NA 2QGYA 4ZE4A 5D75A 3JYJA 1EJSC 3UR2A 1C92A 5BROA 1LYXA 4J1OA 4EP8C 2LKNA 1KV8A 4O57A 3E5BA 5A2AA 3NG3A 4Q8NA 1B90A 2RUCA 3AMGA 3EDKA 3PG8A 1ZB5A 1PYFA 1DHPA 3AUOA 3AQUA 4KETA 3QLLA 2P8CA 2XN2A 4A35A 3CB8A 1OFAA 3N17A 5CC3A 3T07A 1GYMA 1VHCA 4EX4A 4DBDA 1RVKA 1E0UA 3S3GA 3FDKA 4Z42C 1FDZA 1GUVA 1XBXA 2YL8A 4Y9MA 3O7UA 3EDJA 3TCSA 4IMFA 3KXQA 1HKWA 1GVYA 2E9MA 3S1VA 4HOZA 2F6UA 2ZX6A 1Q8AA 8XIMA 1OX5A 5I03A 2Y8VA 7ENLA 4OZOA 1OY0A 2Y62A 2VDHA 2LGOA 4Y9AA 1RSCA 3ANUA 1B30A 4YTRA 4WIWA 3A4XA 1UA7A 1ZTVA 3LM3A 1A5AA 4JTJA 3MV11 1S1RA 3OBKA 2QPUA 4RE2A 4Q4MA 5LNRA 1XUUA 4INFA 2CXEA 3FFSA 4Q4SA 4KERA 5A2BA 4O50A 4MSSA 3RJXA 1OGGA 1FCUA 4LSBA 3ID7A 1YHTA 5CBIA 3VX0A 1SYTA 4JTUA 4GIAA 2WVSA 4JFTA 5GPRA 1JAEA 4CVUA 3FJNA 1XRTA 3PZGA 4ZTXA 4N4QA 1J4RA 4D6IA 1EJ7L 3I4EA 1JYVA 5GNZA 3EWZA 3NQ8A 3TW7A 1R38A 3IJ9A 2B81A 3INPA 1XSKA 1A5BA 4AUBA 2XVPA 4REQB 1WOAA 2BHYA 3SSZA 2ETNA 2Z00A 2VCAA 3ITLA 3BPWA 3GYEA 2BXZA 1WKFA 3KS6A 5CLWA 4GVFA 4UDMA 3HFYA 4QNWA 2WLYA 2R14A 1DIDA 3N9SA 5I2UA 3VDAA 4LRTA 2XIBA 2ZQUA 1YNQA 3CPUA 4IPNB 1SJBA 1SVDA 2CWNA 5DT5A 3QQ0A 4HPJA 1LBLA 3AAMA 3R7MA 4XAFA 1E0VA 4AXKA 4KWSA 3DCPA 1ONXA 3M0HA 3DFOA 4PBEA 3IS4A 1K1DA 2JE8A 3W1MA 2PWGA 2Y1HA 4NILA 5C9WA 2AAMA 5H1WA 1CXKA 4N9DA 1EGZA 1B3ZA 2BMBA 3KOXA 4D2JA 2QUNA 2O56A 3KVLA 1GHRA 3EWBX 1UIOA 4J4OA 2ZX8A 1DORA 3MB9A