3RMEA

Amcase in complex with compound 5
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
total genus 131
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rmeA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rmeA01
3CZLA 3AZSA 2WWCA 1QNQA 4UQEA 4CCCA 4D1JA 1VEOA 4XB3A 1CDGA 2YDQA 4MPKA 1H49A 2BHYA 4PUEA 1PAMA 4KGLA 5CQ1A 1BSIA 1B3XA 2QF8A 5A8PA 4URIA 4HZ8A 3WNOA 1VBRA 1O7AA 2DH3A 4JL2A 4EANA 4P7NA 2DSWA 1QNRA 4J3UA 1VB9A 5CPQA 5GNYA 2WWDA 3THCA 3BMVA 2ZX7A 4MB5A 1D3CA 4X0VA 2VL4A 1E4MM 2D0GA 4W85A 3DHPA 2EPOA 3NSXA 1VENA 2JEQA 1YQ2A 3ARRA 4CD7A 3W27A 1I1WA 3WUGA 1W3LA 2XVGA 3L4YA 5ABFA 4W7UA 3AFBA 5I0DA 4M8UA 1V0KA 1QHPA 3ARYA 1UH4A 1HL8A 5I6SA 1TUXA 5EB8A 3WSUA 4IPLA 3PTKA 2BXZA 4AD3A 3CUJA 3D3AA 3GBDA 2O9PA 4S3JA 1B9ZA 2G4FA 1UWQA 1UZ1A 2F2HA 4CD4A 1LJYA 4H8VA 1UWTA 3VX0A 2CBVA 4WSJA 1PIGA 4LYQA 4D71A 5DFAA 1JG9A 1RP9A 1KCKA 4FK9A 1MW3A 1UD4A 3VGEA 1CZ1A 1UQZA 4H04A 1E72M 1OBAA 3WKZA 4WF7A 3AIUA 3CIVA 1V3IA 5CJ5A 3SCNA 4KGJA 1DEDA 3GZAA 4FLQA 3QGVA 4QAWA 2GJPA 4J3TA 3RMEA 1GOWA 3WQWA 3NYDA 3WFZA 2GK1A 4JFWA 2J8GA 4P8WA 3WD2A 1QOXA 1XD1A 5EMYA 2CHNA 2PWHA 3AZTA 5AC4A 3WH5A 5HNNA 2O92A 3WQ8A 2AOSA 3SCOA 1VFOA 3DYMA 1DHKA 1E0WA 4MTVA 4GI9A 3K4AA 2J62A 3O6AA 1CEOA 3D5HA 1UOKA 2XUCA 4CN4A 1GHSA 3A47A 4AW7A 1XH0A 2WBKA 2BY3A 2YA0A 4ATDA 1JAEA 1H1NA 2CYGA 2WCSA 1MYRA 1W1VA 1E1EA 2V3EA 3VDBA 3W82A 3RCNA 3ALFA 4CCEA 4PMDA 3IJ8A 2D23A 4MB1A 1EOKA 2D0FA 2O9OA 3NDYA 2D1ZA 4GPNA 1QW8A 3LPFA 3VD3A 3CZKA 1EGZA 2DT2A 1OT1A 4ML4A 4HZ7A 1E15A 1JFXA 5A69A 5I5RA 5BRQA 3G6LA 2V38A 2WC7A 3WDIA 1XSJA 2W67A 4TVUA 1WB0A 2JE8A 3DC0A 2EBNA 3MKKA 3W29A 2WVUA 1MFUA 4OBRA 4JZ5A 3PN8A 4QDMA 4AZ6A 4AD2A 3F4VA 2CKSA 3ZJKA 1G01A 4W8LA 3AIWA 1UKPA 1EXPA 2V5CA 1V3HA 3SCQA 3WENA 1R86A 4MDOA 2ZX5A 2NT0A 2J77A 1WPCA 1BVZA 1J0KA 5E70A 2YBUA 2DDXA 3PZVA 3GXDA 1RPKA 5EFDA 3B9DA 1JNDA 1G94A 4AD4A 1GORA 1MW0A 1V6XA 1EIBA 3WQ5A 1FHLA 4QLKA 1TE1A 1B3ZA 1ODUA 4PTVA 2NT1A 4WIWA 4QLJA 4ZXOA 2WYSA 5DF0A 3VIJA 2ZUUA 3AXIA 1WDQA 1SR0A 1TVPA 3HN3A 3VPLA 3VGGA 1XYZA 1IV8A 2GK1B 1NWTA 4KRTA 3EDEA 3UETA 1HJUA 2Q8XA 5D8WA 2FHFA 4U31A 2JF6A 2EJ1A 1UR1A 1ZBCA 2DSUA 2D22A 4ZENA 1GZJA 2ZUWA 3UG4A 3VO0A 2X0YA 1XYFA 1KGUA 2WMJA 2DGAA 2E0PA 1AMYA 5KEZA 4OIFA 1ITCA 3SCPA 1NWRA 4PN2A 1KXHA 2WZEA 4J3XA 4DM2A 2ZXQA 1G0CA 4Z2KA 1ZBVA 1QBAA 3KE0A 2WMIA 3N15A 4GQRA 2DSVA 3A4XA 2XM1A 2E8YA 1FH7A 3BGAA 2XVKA 3M7SA 4W87A 1J0HA 4D6IA 2WHLA 4HA4A 1H3GA 3N04A 2D24A 3VGDA 1E1FA 4WKHA 1B0IA 1ZU8A 4Q22A 4RE4A 3ARXA 3CUHA 3VVGA 1JZ7A 4P8XA 3S6TA 1QI3A 1V3LA 2WHKA 4A4AA 3VDAA 1VAHA 3U5UA 1W1TA 1B3VA 4AD0A 2XVNA 5A6MA 4HMCA 1BHGA 2VOTA 2BVTA 4GQQA 3FN9A 4L4OA 2WMIB 3AS0A 2FH6A 2CHOA 1UA7A 1V3MA 3UERA 3PHAA 5GNZA 3WUFA 4LYRA 3ZT6A 1KGXA 3N11A 2YL5A 4W84A 1KWGA 1V0LA 4ACZB 1BPLB 3AIEA 3BAXA 3OGRA 1CXEA 3AIBA 1UR4A 4GXPA 1GJWA 3F5KA 3VIOA 5JBEA 1EQPA 1WO2A 3AHZA 1EO5A 2QMKA 1H41A 7A3HA 5JIWA 1EH9A 4AEEA 4F79A 2RGLA 4R5EA 5M17A 1NP0A 2DSKA 3TTSA 3QOKA 3VNYA 4D6FA 4BA0A 3CBWA 4BQ2A 2PC8A 1UR9A 4PMNA 3VINA 1GOMA 1OCQA 1SMDA 2OWXA 4AYSA 4U2ZA 2XWDA 4AZGA 3VX1A 4TTGA 3WD1A 1CBGA 1F4AA 1V3JA 3BAIA 3CUGA 1HKIA 2YLLA 5IFTA 3CZGA 5AYIA 4UNIA 1ZJAA 5IFPA 4R27A 5D9OA 2UY3A 5CLWA 2A3CA 3OZOA 1CPUA 4K68A 4JKLA 3WMCA 1W91A 1W32A 5AY7A 4HU8A 4W7VA 1UZ4A 2E40A 3AHXA 2J7BA 1MFVA 3W28A 2F8QA 1PX3A 4MAZA 1YHTA 5A6KA 3VDCA 4B3LA 2OWWA 2X05A 1HN1A 1U33A 1Z32X 2QV4A 1GNXA 1TVNA 3HU7A 4M56A 3KZSA 1GQIA 3EMZA 1Q6GA 1C8YA 2Y24A 3OGSA 5I2UA 2UY2A 4UFJA 4H2CA 3L2LA 9CGTA 4U3AA 1C93A 4AZIA 1HVXA 5AYBA 3BLPX 3B8SA 3VUPA 3AJ7A 2FDMA 4ACYA 1KB3A 1E0VA 4BQ5A 1NOUA 3K8MA 3VMOA 2YDRA 1CIUA 2CXGA 3DHUA 3O2LA 1JYVA 4HPHA 2FGZA 5CGTA 2J7HA 3FAXA 3ARZA 2J7DA 2JIEA 2J7EA 2JIWA 3WH6A 3SCRA 5JUVA 2E4TA 5CG0A 1D2KA 3AOFA 4GINA 1PZ3A 1VJZA 4J7RA 3CUFA 1UYQA 1J0IA 4ZEPA 2ZXDA 4ZXLA 1E3ZA 1MW2A 1LLOA 1KWKA 1OM0A 1GHRA 2X09A 1HJWA 3MUZ1 1MWOA 2GFTA 3SCWA 3WNPA 4PBGA 2YL6A 5A8MA 3VU2A 1E56A 1LG1A 2WMHA 3RM8A 5LYRA 3L4WA 4GIAA 1K9DA 3AMCA 5CZKA 3FY1A 3WD4A 2OSXA 3BC9A 1BLIA 3WEMA 2WK2A 1SYTA 1E55A 3PZ9A 5A94A 4HA3A 1HKJA 2ZX6A 3GNOA 1QNOA 2WSKA 3GH7A 2NW0A 2FHBA 3PZTA 1RH9A 4AZBA 3VM7A 4JHOA 4UOJA 3ARVA 4DWSC 3WNMA 1R7AA 1W1PA 3CHDA 1JZ4A 3WY1A 3SUVA 3WMBA 4PMOA 3A4AA 1K9TA 1GPFA 1L8NA 4EAMA 4AISA 4D6JA 2WMFA 3GBEA 2VC9A 4J3WA 1CXFA 4DUWA 5BCAA 4M81A 1MQPA 3I3DA 3AIVA 2GJXA 3W53A 1MVYA 5JH8A 1IZKA 2IXUA 4PSPA 1CGUA 3SUSA 4C7GA 1VFMA 2ZE0A 3WD0A 5ABEA 3NCOA 1FFRA 4GI8A 1WP6A 3WBEA 1W1YA 2Y8VA 3APGA 2J78A 3SUTA 1OGBA 1KR0A 2EQDA 2OLHA 1X1NA 4JFUA 5GQBA 1E0XA 1V0MA 5CSYA 4JKKA 2XFYA 4AZ7A 1JFHA 3BAYA 1B2YA 1JNEA 4DWSA 1GQJA 2DT0A 3VD5A 4X0NA 1HJQA 2UY4A 1Q4NX 2VZSA 3WQ4A 1JYWA 3AS1A 3KWXA 2PI6A 3AHTA 3KL5A 1UH2A 5FKYA 1EA9C 5BXRA 4NI3A 4FF5A 3QOMA 2W62A 2VR4A 3SCUA 4HU0A 3AROA 2J7GA 2E3ZA 1QW9A 1XHGA 2WC4A 1BF2A 2WAGA 1BVNP 2XFRA 1ISZA 4UOZA 2XSAA 3KEHA 4CVWA 2QLYA 3BAKA 2VCBA 3ARTA 2G41A 4HZ6A 3UG3A 4PMUA 1TR1A 2A3HA 5C71A 1UD5A 3CLWA 3WN6A 3GNRA 5A3HA 3EBVA 1X6LA 3PZNA 3AI0A 1LG2A 1TCMA 3POHA 4GKLA 4HMEA 3OLIA 4CN1A 2BVYA 4BCEA 2Z1KA 1JL8A 1V6YA 2E9LA 3WUEA 4AZCB 3WQVA 3AISA 4XUYA 3UR8A 4AIEA 4D6CA 5EFFA 4Z2GA 1BYDA 2WKGA 3N18A 1FH8A 1V0NA 4E4PA 4BQ4A 4XV0A 3WDQA 1HXJA 2XTKA 5A6BD 3U7VA 5BRPA 1GONA 2YJQA 5KZ6A 1ZL1A 1CGVA 2D3NA 2XSBA 4MB4A 3RDKA 4UFLA 5A6AA 1RD6A 2QMJA 2VNCA 3WF2A 2DH2A 3FXYA 1UUQA 2EPKX 2FHCA 4W5UA 2DIEA 2BY2A 4CU7A 1DWHM 4ZFMA 4M29A 1KQZA 4W5ZA 3K8LA 1HL9A 3VD9A 1DWFM 2C8NA 2J75A 1NQ6A 1B3WA 2WCAA 1QI0A 3WF4A 5DEZA 4Z2HA 4JAWA 1ISWA 3BXWA 1J11A 1LQ0A 4MNLA 3VGBA 2XYLA 1EDQA 1JXKA 1W3KA 2BY1A 2O9TA 1JYNA 1IZJA 2V3GA 3VGHA 2WM0A 4JFSA 1JZ3A 2G3IA 3EDFA 4LQ1A 4M82A 2WHJA 2CPUA 2XG9A 4UZSA 3KL0A 1MQRA 2W91A 3WL0A 3WF3A 2YA2A 2VRQA 1JD7A 4J27A 3ZMRA 1UA3A 1UHVA 1D7FA 1K9EA 4UFHA 4YHGA 1H2JA 1E71M 5D9MA 3VOCA 3WNLA 1WCGA 2D2OA 3GYCA 1E4IA 2QHAA 1VBUA 4YPJA 1LWHA 4NRSA 1PX8A 1NOFA 1CYGA 1OGSA 3OLDA 3MV01 1KR1A 1KBKA 1BQCA 1M53A 3FHAA 2WMKA 4CCDA 2GUYA 2QPSA 1HKMA 2E9MA 1PIFA 1JIBA 3TA9A 1OIMA 3WELA 4NSBA 1EQCA 2YLAA 2WVVB 4KMQA 2WCGA 4A3YA 2YL9A 1UKOA 3AQUA 4UQDA 2WXDM 2VMFA 4PMVA 2XIBA 4QLLA 3AHVA 1CGXA 2Z1SA 4UTFA 3AXHA 1NM9A 3MMWA 1HVQA 1UD6A 1WZLA 4EK7A 1U30A 3ZR6A 1J12A 3VM5A 4XZWA 4MDPA 4FLOA 1GCYA 2WW5A 3MU7A 3T0AA 4E2OA 4U5IA 2WZHA 1XSIA 1F4HA 3CO4A 3W24A 2VZTA 3WDHA 3A4WA 1V02E 4UCFA 1E6SM 1HKKA 3L4ZA 1E6QM 3F5JA 3W25A 1CXLA 3B9AA 3RM4A 3AZRA 1B3YA 1KFWA 3T2PA 3ECQA 1J0ZA 4BQ3A 3G6MA 1OSEA 4UFMA 5BXTA 5I23A 4H8HA 4FLRA 1UKQA 1DWGM 4LX4A 4OKDA 4JCMA 3LPPA 5A2AA 4D72A 3CTTA 2VX5A 1MXDA 5DT7A 3K46A 3SEPA 4CUCA 6TAAA 3FAWA 1GOQA 1CXKA 4TXEA 1FHDA 2EPMX 4WLCA 3ARWA 2Y4SA 1JI2A 1JZ2A 1J9YA 3CHCA 4PMQA 3RM9A 4OUEA 3WD3A 4IM4A 4DUVA 4OZOA 4P7LA 8A3HA 4S3KA 3ZSTA 1DWJM 3W6LA 1QI4A 1G9HA 3MSGA 3M46A 2CITA 4J3VA 5GPRA 3O9NA 4E8CA 3W81A 1UR0A 4MJ4A 1JGIA 4OOUA 3OLEA 1QI2A 3NUKA 3IAPA 3K8KA 1OIFA 1EDTA 2XWEA 4UQAA 4MNJA 2VURA 3ALGA 4OOZA 1B30A 1EHNA 2YOCA 3AICA 1OGGA 3K1DA 2WLYA 2DPEA 1E43A 3VIGA 2X0HA 1JDCA 8CGTA 3PZGA 3WMSA 4EE9A 2VQTA 3HJEA 1PEZA 4TVDA 5A8QA 1H0GA 2BVDA 3AYRA 3N9KA 1FP9A 3BAWA 4JCLA 4JFTA 4M1RA 4F66A 1CWYA 1FA2A 3AIQA 3DECA 2V5DA 3TTOA 4IISA 1ESWA 4F9DA 4U3CA 2X1IA 1ISVA 5A8OA 4AY1A 4U5KA 1HX0A 2BS9A 2WANA 3GXIA 2TAAA 3ZSSA 1NARA 1GQKA 1A3HA 3UR7A 2V3DA 3IK2A 1J0JA 2ZUNA 4AXNA 2WMGA 4Q7NA 2OSWA 2GJRA 2IXVA 4QCFA 3FHQA 4F9JA 1I1XA 2GDUA 3LMYA 1E6RA 4DWSB 4Y7EA 2WLZA 2J7FA 1E6NA 3VIPA 4GZIA 1BYBA 2W4XA 2VVSA 4KRUA 2AMGA 4UFIA 1ZJBA 3FW6A 2CBIA 4HOXA 2BHUA 4GZJA 3WDRA 2CEQA 1JI1A 1SFSA 5E0FA 1W3HA 1W9DM 4D6EA 3T0BA 4J3SA 5FCZA 5E9AA 3BAJA 3AXXA 1E70M 2OYKA 4HOWA 1KQYA 1UG6A 1VFFA 4WK9A 1H5VA 3A6OA 1QPKA 1DWAM 1DWIM 3WF1A 5CPTA 3ZM8A 1JDDA 2B31A 4AZ5A 3UCQA 3FNDA 5TD4A 4B15A 2ZWYA 3OGVA 3CUIA 1Q6DA 4TX8A 1G1YA 1JDAA 1VFUA 2ZUMA 1E4LA 4A3HA 4UQ9A 2WPGA 1ZBWA 1PPIA 1QHOA 2PB1A 3M07A 4CVUA 3U5YA 2AAAA 4W8AA 5ABFB 1ZS2A 2J74A 3N12A 3RIKA 2XVPA 1ZB5A 1GVYA 1KXQA 2J47A 3RILA 2WKLA 2CCRA 1VIWA 2J4GA 4Z2LA 5I24A 1HIZA 3TONA 1CGTA 1TMQA 2OYMA 2DT3A 2XFFA 1G5AA 4MNKA 2G3MA 5DT5A 1NH6A 3EDJA 3GDBA 5AC5A 2GDVA 4UOQA 1GOKA 5LA1A 3CPUA 4PTWA 4AWEA 3QHOA 5E09A 5A6LA 1E3XA 2JALA 4P7RA 4PCTA 3A3HA 2VI0A 1R8LA 5BXPA 3N13A 2DIJA 2HVMA 5GNXA 2C0HA 2XGBA 4RL3A 4HA1A 4ZE4A 3MUY1 4PEEA 1K6AA 3TTQA 3VILA 3WH9A 1OWQA 3VIKA 4AC1X 2WNWA 1EOMA 5A2BA 3IAQA 6A3HA 2BNJA 5FD0A 1UD2A 1AQMA 3UEQA 3EDDA 1QI5A 3WEOA 3CMJA 3GTNA 4MJ2A 4AEFA 4AZCA 5A95A 3MUAA 3OBAA 2YIHA 1BAGA 1H4PA 3QR3A 3WQ6A 2VX6A 1E6XM 2BV9A 3GH4A 5JBFA 4AD1A 4PSRA 5FL1A 1WDPA 3MANA 5FL0A 5IHSA 5A2CA 3QHNA 1CXIA 4FMVA 2ZX9A 3N1AA 1NWSA 3LPGA 2WHMA 2Y5EA 4HP5A 3CZJA 4PMXA 5BXSA 2G8ZA 2J25A 2ZX8A 1J10A 2VZVA 1X6NA 3AS3A 4YN5A 2ZUTA 3PZOA 1FH9A 4AMCA 4AZHA 1Q6CA 4N0RA 2W63A 2CESA 5I79A 2DSZA 1L0PA 4JL1A 2XJ7A 3PTQA 1VEMA 2WZIA 2A3AA 5D8ZA 5M03A 3VIHA 4UFKA 1JZ8A 3L4VA 3VDHA 4BS0A 4OBSA 4L4PA 4LGXA 4PTMA 4HPGA 4UQCA 1US2A 4H41A 4JFVA 2CKRA 1E6ZA 4AIUA 1ZBKA 3EDKA 3VD7A 3WF0A 1KGWA 1UKSA 4DM1A 4W7WA 1C92A 1H11A 1XH1A 2E8ZA 2XPKA 2CERA 1WNOA 1J01A 2ZOXA 1W9UA 4B9YA 2RGMA 1MQQA 4Z2JA 2ZXAA 3L2MA 1OD8A 3I3BA 1S46A 4KWUA 1CLVA 1JF6A 1HJSA 3J7HA 1BGGA 1GOIA 1LF1A 3F5LA 2BFGA 4NF7A 1VF8A 1UR2A 3L4UA 1TZ7A 4W93A 1B1YA 3AYSA 2DQXA 2ZUSA 3MMUA 1VEPA 1KXTA 1W9VA 4MNMA 1XV8A 1GVIA 2J79A 2WC3A 3ZOAA 1UQYA 1BFNA 3PZIA 2W5FA 3AS2A 2PBOA 4CU8A 1WZKA 2CETA 1US3A 1XSKA 2WSPA 1DTUA 3VD4A 3POCA 1W9BM 4HMDA 2EPNA 5A6JA 2D3LA 1CXHA 4PUDA 4BZYA 1OB0A 3CH9A 3PZUA 3SCSA 1XGZA 1UWRA 1XD0A 4GZEA 4H7VA 4B3KA 1R87A 3WDPP 2VRKA 1PJ9A 3BCFA 1TFVA 1PZ2A 3WH7A 7CGTA 3ARSA 1DP0A 1JXJA 5HOSA 2VTFA 1PBGA 2ZUVA 6CGTA 1E5NA 2XGIA 1WE5A 1R85A 3MV11 5IXEA 2EXOA 3W37A 1BYAA 1ISYA 1WZMA 5E6YA 1E6PA 2BXYA 1UKTA 2ZIDA 1VRXA 1ISXA 1M01A 2Y8KA 4DUXA 3MUIA 4PCSA 4CD6A 3ZR5A 2HISA 1HNYA 4FLSA 3BLKA 5C70A 4PMRA 3NSNA 3E1F1 1CNVA 3GXFA 1UD3A 1C7SA 2VX7A 4X9YA 2CIPA 5I78A 5D9NA 2YA1A 2G3NA 3WH8A 4ACZA 1WAWA 4LPCA 5EBAA 1QNSA 4HTYA 2F61A 4GO9A 4WJXA 1GQLA 5A1AA 2XVLA 4U2YA 2FH8A 2WVSA 3PTMA 4TVCA 2IUZA 2DT1A 2OSYA 1JF5A 3UG5A 3NDZA 1UWSA 3WEZA 3PZQA 3VMPA 3U57A 4P7QA 1UH3A 2VR5A 2VCAA 1U2YA 3BH4A 5JBDA 2QPUA 3KL3A 1BTCA 2XM2A 3THDA 5LA2A 1AQHA 4CN6A 1V08A 4ATLA 5F7UA 2C7FA 3MMDA 4M24A 1V6WA 3HMCA 4P7OA 2X8RA 3ZO9A 2ZWZA 1GJUA 4M80A 1FOBA 3ZJ7A 2VZOA 4PRWA 2YDSA 3L4XA 5HBFA 3AMGA 4RE3A 2VJXA 1WZAA 1KXVA 4C7DA 1JYXA 2V3FA 4QCEA 3WNKA 2PBGA 2EPLX 4W88A 5DO8A 5CXPA 2VT0A 1QHZA 2FGLA 3WDJA 2MANA 4J28A 3LPOA 5BWFA 1CLXA 5ECUA 3GH5A 4MADA 3CZEA 4N42A 1C3FA 3EMCA 4U33A 5M3WA 3MSDA 1WDSA 3AMKA 4AIOA 4XX6A 4JKMA 3NJ3A 4CD8A 1V03A 4P8UA 3MS8A 2EEXA 5CSUA 5CPSA 3OB8A 4QP0A 3WFLA 2PWGA 5LA0A 4GI6A 2W66A 1AVAA 1BYCA 3GXMA 4OJYA 5BROA 4UQBA 4PMZA 4MAVA 3ZJ6A 1OINA 4ZE5A 2ZICA 1HP5A 4W8BA 2JEPA 4AD5A 3ARPA 3IJ7A 1UWIA 2ESCA 3W26A 3CHFA 5HPOA 2XHYA 2UY5A 1PX4A 4GO8A 4NRRA 1OD0A 2O9RA 4QFUA 1H09A 4CGTA 5CGMA 4W89A 4TUFA 1Y7VA 3TOPA 1R7OA 4CU6A 2UWFA 1LL7A 5HPCA 2D0HA 1UR8A 4DWSD 1ODZA 1QVBA 1CECA 2PWFA 3N17A 4WKFA 3AMLA 5A8NA 2YKKA 2A3EA 4Z2IA 1O6IA 3T2OA 5FIPA 3SCVA 5M5DA 1C8XA 1JAKA 3VMNA 1M04A 1UD8A 3RJYA 4D1IA 1W9PA 3VIMA 4TX6A 3BMWA 2NSXA 1QBBA 1UWUA 4CKQA 3I3EA 2BHZA 4V2XA 2WVTA 1C91A 1XCWA 1ITXA 2W61A 3WNNA 5DMYA 5E0CA 3WUBA 1LWJA 5CLTA 4LYPA 5I77A 3T0DA 2WVVA 2OYLA 2BY0A 4WSKA 1J0YA 4E8DA 1AQ0A 2W92A 1HF6A 1B31A 4D6GA 3T2QA 4WKAA 5FOOA 2CNCA 3ZJ8A 4D6DA 4UZUA 1P6WA 5HDRA 7TAAA 3TTYA 1W9XA 1FFQA 3ARUA 3VIIA 1OT2A 3RPMA 1KBBA 1V6UA 3CZ8A 2J7CA 2JF7A 2PF0A 1GW1A 1Q6EA 1SMAA 3EMQA 4JHZA 3M6DA 2CBJA 1LL6A 1CENA 1FP8A 4B16A 3U7BA 2GSJA 2VUYA 3T08A 3OZPA 2VVNA 1E40A 1MXGA 1BG9A 4IPNB 1WKYA 4V28A 3PZMA 4KH2A 4V27A 5A6SA 3NIYA 3BSGA 1MW1A 3S2CA 1Q6FA 1EDGA 1J18A 3PBGA 3WBAA 1JD9A 2Y2WA 2OWCA 1QNPA 4PYSA 1I75A 5ABGA 3W4RA 4F8XA 3QHMA 3JUGA 2DEPA 3OG2A 4HOZA 3IJ9A 3VIFA 5C8BB 1HT6A 3II1A 1B90A 1GOOA 3RJXA 1XH2A 1HP4A 3ZT7A 3B9EA 3K4DA 4CD5A 1TG7A 2VZUA 1GUVA 4NZCA 2XIIA 3SUUA 1BGAA 3VGFA 2PWEA 1NOWA 4TOQA 4PTXA 3WL1A 3UESA 1VJSA 2YL8A 3TP4A 3W0KA 3RO8A 3ARQA 1XRVA 1N82A 3SUWA 3CGTA 1W2VA 3SCTA 4B9ZA 1W2PA 1KCLA 2VX4A 1IT0A 1CGYA 5HXMA 1TA3B 3NSMA 3BCDA 4BF7A 3VTRA 3SURA 1A47A 1C7TA 1HJXA 4JIEA 3GM8A 5D9PA 1M03A 1EO7A 2G3JA 1XC6A 1BG4A 1E9LA 3AIRA 4XZBA 4LXFA 4RE2A 3VKKA 5JIPA 3EYPA 1E5JA 3VNZA 3W38A 2PWDA 1RP8A 1JZ5A 5A6BA 2VQUA 3SIMA 3DYOA 2CBUA 3AMDA 3GNPA 4PMYA 4P8VA 1V02A 5D4YA 5E6ZA 4TTUA 1TA3A 1ECEA 1CGWA 1V3KA 1WDRA 5BYWA 3OLGA 2EO7A 1LL4A 1H0IA 3ZQ9A 1C90A 4W86A 2X2YA 3AHYA 4H8UA 2VCCA 3BSHA 3ZT5A 2WBGA 2YBTA 2E9BA 2VO5A 1EHAA 3IANA 1C8QA 1K9FA 1CTNA 3OIHA 3DYPA 3W6MA 2A3BA 5ABHA 1V6VA 1W3JA 3OA5A 2D20A 1XCXA 1E4NA 2ZXBA 4YHEA 2VRJA 4IUGA 1NP2A 2J8FA 2JFEX 3L4TA 5IDIA 1JZ6A 2GVYA 1NWUA 4D6HA 4EKJA 2WB5A 4UR9A 3CMGA 3MO4A 5IHRA 3ZIZA 4ATWA 3WIJA 1E73M 4C7FA 1HJVA 5I3DA 4MB3A 1M7XA 2GJXB 3T09A 3CHEA
chains in the Genus database with same CATH superfamily
3AZSA 2R1LA 4J4OA 1TZZA 1MDRA 2YDQA 1F8MA 1OF8A 2BHYA 5C9UA 3UD6A 1DIEA 4GVFA 4JIRA 1S2WA 1XJBA 1B3XA 1LRTA 1VYPX 4DQWA 5A8PA 3WK0A 2DH3A 2GVGA 4JL2A 1Q85A 2R91A 2YPIA 4J3UA 3W02A 3W3OA 1GKPA 1TTQA 5CPQA 1IGSA 3G18A 2WWDA 3BMVA 4A3QA 4MB5A 1JRBA 5G1YA 5HJYA 4PGLA 2IMRA 1AG1O 4W85A 3DHPA 1ML1A 2EJAA 2PV3A 4ZZ9A 2EPOA 1VENA 2JEQA 3W87A 3ARRA 4CD7A 2VEFA 1QWGA 5I0DA 1PKLA 2OOFA 3LTYA 3V5FA 4FA3A 3IS4A 1QHPA 4H9TA 5I6SA 4MFDA 5FJIA 2J88A 1QZ2A 2BXZA 3O5QA 3GNNA 4AD3A 3UGVA 1ONXA 4LCSA 3W1RA 4IP7A 3TXVA 3OVRA 4Z0JA 2G4FA 3HV9A 1UWQA 5F4SA 4H8VA 4AFYA 3VX0A 2CBVA 4LYQA 1DJWA 3KBJA 4FK9A 1UD4A 3KRUA 4H04A 4H9MA 4R9OA 3TNOA 4WF7A 3S9YA 4QX4A 1YNYA 4IXHA 4ROPA 1KKRA 3STGA 1DEDA 4QAWA 1P48A 4J3TA 3RMEA 3WQWA 3IK8A 1I0DA 2GK1A 4AWSA 2J8GA 4P8WA 1QOXA 2JGQA 4H7CA 4MLJA 1MNZA 1TREA 4Z42C 5AC4A 4PUKA 3R12A 1K3UA 3SCOA 3S5YA 1E0WA 4GI9A 3GR7A 2QUNA 2GQAA 2J62A 4GMEA 5H6HA 4K2SA 3HGOA 1CEOA 1V4YA 4DAFA 2Q02A 3A47A 4KEZA 3IGSA 4ATDA 1NFBA 3TQPA 4M7TA 1KT1A 1PKMA 3W86A 4PMDA 8TIMA 1PUDA 2D23A 1NU5A 1BKFA 4IGSA 2O9OA 3GW3A 3OEXA 5FEWA 4GPNA 5AYYA 4BEUA 4O0ZA 2NV1A 3CZKA 4K1GA 2DT2A 4ML4A 3UQBA 3GTYX 2O56A 1E15A 1JFXA 3TN3A 1RAKA 2AQWA 2WC7A 2W67A 4QE4A 2JE8A 4CNPA 2VR2A 1TRIA 3W29A 1Q7QA 2WVUA 3U8GA 4A3UA 2VWTA 4AZ6A 4Q4RA 4JICA 4DBEA 5H8PA 2V5CA 1V3HA 3SCQA 3BVJA 2KFWA 3CQ0A 4DJDA 1R86A 4MDOA 3RMJA 2KAUC 2ZX5A 1QOQA 2J77A 4H00A 5DQPA 1YTDA 1O5RA 1ME9A 3GKAA 4GY1A 2F84A 4LC8A 1G94A 1EIBA 3WQ5A 4QLKA 4TO8A 3O5OA 4TW7A 4WIWA 1ICPA 2NT1A 5CH9A 5XINA 3ITTA 2PC4A 1SR0A 1TCOC 1B57A 3D46A 5FJUA 1GG0A 5B7YA 3EDEA 3DHFA 2Q8XA 1EA0A 3VKBA 4LF2A 4NJIA 4DI8A 2JF6A 2YCLA 2EJ1A 1ZBCA 2D22A 4FI4A 2XH2A 1RR2A 1AW5A 2ASHA 4MY9A 3RR4A 3BQ6A 1QTWA 2CLMA 3N14A 2A3LA 2DGAA 1X8CA 1XYCA 2M1IA 4J3XA 4RZ6A 3GNXA 2ZQUA 3W7QA 4IH3A 2QVHA 3HGRA 3KE0A 1Q6QA 2WMIA 3WLPA 1ITUA 5DX7A 1FH7A 3AUOA 4PC8A 1JPMA 3REQB 4HA4A 1JUBA 3EY6A 4YTRA 4HNCA 3GDRA 2H6RA 3M0LA 1ZU8A 2BVWA 4RE4A 3EWZA 4XD5A 1FHUA 4PUNA 2OB3A 1JZ7A 1W3IA 3MB9A 5KITA 1V3LA 4A4AA 1THFD 3L7RA 3W75A 3TA6A 5MHBA 1W1TA 4AD0A 2XVNA 5A6MA 1K7EA 1ZHAA 2BVTA 4PZVA 2WMIB 3UERA 1J8VA 2GGJA 1QR7A 5F2GA 1T11A 2CLIA 5FA5A 2CU0A 4ERAA 3NO5A 1OC5A 1YATA 1V0LA 2ZRZA 1QO5A 4JTQA 1EP3A 2D73A 1NVMA 4GD0A 3AIBA 1UR4A 4JTEA 1UCWA 4IGNA 1TIMA 5C7HA 3VIOA 2MNTA 3NNTA 3E0VA 3SECA 2YB1A 5GVJA 2OPJA 3AHZA 4UMCA 4C6MA 1H41A 4CNSA 3B04A 3WLNA 1EH9A 4XVEA 2RGLA 4NXKA 1K03A 4JFJA 3KOZA 3O5FA 5AC6A 4MWAE 3S1VA 2B7PA 3VNYA 1R2RA 2OQLA 4S3GA 4BA0A 3M0MA 2PC8A 3FVMA 1QASA 1X1ZA 3BJTA 2OWXA 2XWDA 2VXNA 1UP3A 4AZGA 3VX1A 2R8WA 1EPXA 4C6PA 2F2KA 2GVLA 2ZKMX 4IG2A 3B8WA 2YLLA 1TPWA 4Q3MA 5DXXA 4EF9A 1O1ZA 1ZJAA 3QR0A 5IFPA 4R27A 5D9OA 2W79A 2A3CA 1GYMA 1CPUA 4Q7BA 4K68A 4LRSA 3C3UA 3PY2A 3NQ8A 4A35A 4PE8A 2OODA 1XDLA 2J7BA 2NWRA 4HBEA 1FXQA 5C55A 3THAA 1MFVA 2VEMA 3W28A 2F8QA 3MSYA 4MAZA 3M43A 1YHTA 4ZODA 3VDCA 2OWWA 5BXJA 4GFIA 1U33A 1GNXA 4PCPA 1TVNA 2P0OA 2G96A 1XRSA 2XPAA 1GQIA 2GGHA 3CXOA 2Y24A 3OGSA 1EL3A 2Y7GA 5I2UA 2PGWA 3P5ZA 3V16A 4UFJA 4LOCA 3L2LA 4ZO9A 4LW7A 1XLGA 9CGTA 1J4RA 1C93A 1LUCB 4AZIA 1TJ0A 3B8SA 1R46A 3LCIA 1CT5A 4JTLA 2XP7A 3AJ7A 5FF0A 1SSGA 2ATMA 2GVJA 1KM6A 2DUZA 4BQ5A 1OCNA 3K8MA 3U9IA 1XLIA 1CIUA 3DHUA 5HJXA 5CGTA 4ERIA 1MUCA 2OEMA 1G4SA 4UNKA 3ARZA 3C61A 3TJIA 2JIEA 3WH6A 4EWND 2E4TA 4EXBA 4ILSA 2QDHA 1VHCA 4C6LA 3AOFA 4GINA 3RCMA 4Z1DA 1VJZA 2PLMA 1UJPA 1UYQA 3PBYA 2HMCA 3VZZA 4G50A 4XSLA 3ANUA 1W37A 3N6HA 3RAOA 2GLKA 3DFYA 1H7RA 5HUAA 3DESA 1MW2A 4ODQA 4KPLA 1OM0A 1XUZA 1KBLA 1MWOA 2GFTA 2YL6A 3VU2A 2WMHA 4NNCA 5LYRA 2C1HA 3W1UA 4E2VA 3MSRA 2PSNA 5DY3A 3TZFA 3KS5A 2XP4A 4FXRA 2B7QA 1VCVA 4DJEA 2ZX6A 1B4EA 3PZTA 1RH9A 3BJSA 4JHOA 4UOJA 1R7AA 1W1PA 4Y2WA 1Z3NA 3WY1A 3WMBA 3HQNA 4A8LA 3GVGA 3U2ZA 2FPYA 4EAMA 3ICJA 1MEHA 4DUWA 3E96A 4M81A 3IJIA 3R8RA 4LV9A 5HWMA 2GJXA 2C18A 2A6LA 2FYMA 2IXUA 1PHQA 4MFEA 4PSPA 3SUSA 1W8GA 5DANA 5ABEA 2FJUB 5DO2A 4JTJA 4GI8A 1WP6A 4QXIA 1L6GA 2V8ZA 2D2HA 3IARA 2P1FA 2ZR4A 3E74A 2EQDA 3BV7A 1V0MA 5CSYA 2XFYA 1U5JA 1A3WA 4DWSA 2CZFA 2OELA 3GAYA 2UY4A 4AUBA 4IT4A 3WQ4A 1F73A 3UJ2A 4YU1A 2Y61A 4LUTB 1EA9C 1ZSXA 4RZBA 3KCJA 5KZDA 5C7VA 1WUFA 3AROA 3G8RA 4JTAA 3NO3A 2Z7GA 1XHGA 5GJNA 2QUMA 2UZ9A 1ISZA 2XSAA 3EZ4A 4QS6A 3UT0A 3IIZA 3TYCA 2XIQA 2C0AA 2G41A 3S2JA 3KVLA 3BZJA 1GOXA 3WN6A 3GNRA 4G5DA 5DCBA 5FSDC 3OLIA 3PJUA 4C5ZA 3GU0A 3LGGA 2EG7A 1JL8A 1V6YA 3SRKA 3WUEA 4AZCB 4C65A 1XWYA 5BU6A 5C5YA 2FZ8A 3UWWA 1ADSA 3UR8A 3PR9A 4Z2GA 1V0NA 1GONA 5HWNA 5KZ6A 2ABBA 2WKJA 3UU0A 2XSBA 3GU2A 4MB4A 4XAFA 2NXHA 4UFLA 2PPNA 5EBUA 6PTDA 3ZFHA 1JPHA 1WX0A 2BXVA 3WF2A 3EX3A 4OUIA 4K8EA 5HW6A 1JGMA 1US0A 2FHCA 1DWHM 1YXDA 4ZFMA 2G50A 2DY3A 1HL9A 2QXWA 3GS6A 2C8NA 2J75A 3RRXA 1SU5A 4Z2HA 5H1WA 1LQ0A 1L6SA 3T8QA 5BOOA 3W7RA 4O1BA 2QCGA 1JXKA 4HK6A 2YCEA 4ODKA 4YYCA 2DZWA 4CNTA 1YE4A 4ZO7A 4NIRA 3VGHA 2Z24A 2WM0A 4P5UA 4ZQNA 2WHJA 3DENA 3KS6A 3QV8A 2GOKA 2PPGA 4UZSA 1MQRA 3WL0A 2WSYA 1SPQA 2PDQA 5MKGA 3UQIA 1RQBA 5JXQA 1JD7A 5AHEA 1EJWC 5EMMA 1D7FA 2VC7A 4YHGA 3HJZA 1JJKA 4GCAA 1WCGA 1JUKA 3GYCA 3WLTA 3H4WA 3FIGA 1LWHA 4NRSA 3EPMA 4QE1A 4BR1A 1KR1A 2FVLA 4JFIA 2WMKA 3G1FA 1C29A 4PL2A 4GK8A 1XLMA 3DFQA 1QJWA 4A3YA 1B54A 3OA3A 2YBVA 5DBTA 1W5MA 2HE5A 3NGJA 4UQDA 1ZRQA 4UIOA 2XIBA 1TV7A 4I6VA 4H9ZA 4QLLA 3AHVA 1IWPA 3VOGA 1WKEA 2BLEA 3QSTA 3AXHA 1NM9A 2ABAA 2V82A 1EEXA 4QTGA 5A5WA 3T55A 3JS3A 4QQ3A 1J12A 4KQZA 2C71A 4XZWA 3VM5A 1T0OA 4MDPA 4MWAA 3S4TA 4FLOA 3DKJA 1GCYA 3MU7A 3P8JA 5K7JA 4XBKA 2LJ4A 3H7RA 3IIOA 4QJ3B 1F4HA 3CO4A 1AODA 3BV4A 3IRDA 4KFPA 4AVOA 1R3WA 3F5JA 2FZMA 5B7ZA 3D6NA 2PDFA 4J2PA 5K9CA 3RM4A 3GVRA 3A64A 3G1SA 4GIRA 2E1WA 4YL2A 3OQ8A 2YCJA 3U6WA 3HPSA 5FJOA 1KBIA 4BQ3A 3EOEA 1N8WA 4H8HA 1ZCNA 1A5MC 2PDUA 4OKDA 2V5BA 4JCMA 1ZY9A 2EG6A 1E44A 4HN4A 5F4XA 1JNSA 4IGHA 3V5CA 5MF5A 1OABA 3K30A 3TU9A 1PO9A 5I3HA 4RZ5A 4UDMA 2EPMX 1P0NA 3ARWA 2PLJA 1M3UA 4N4QA 1ZCCA 3LRKA 1J9YA 5DRCA 4H1ZA 1AZ1A 4MG4A 4PMQA 3R0DA 2QCHA 1IX5A 1BKHA 8A3HA 4KETA 4S3KA 2C19A 1DWJM 1G9HA 1FKTA 2Y70A 4C1NB 2EGZA 2HEJA 3BLDA 3TWAA 2OX4A 1E0TA 5GPRA 3O9NA 5F4WA 4REQB 2QJNA 3H21A 4MJ4A 3NUKA 4ZQMA 3QN3A 3I7RA 2IPFA 4O50A 1B30A 2A6NA 2YOCA 3AICA 1OGGA 3JYMA 2F6XA 3UYCA 3EGJA 1Q1CA 1T8QA 3CV1A 4O4VA 2F21A 2X0HA 4QJ1A 2H3DA 1NFPA 3RFWA 4OU1A 3S2LA 4QQUA 4IF2A 1SZRA 2FZNA 2BTMA 3APTA 3W7JA 4YLWA 4DYJA 3H55A 7ODCA 1A53A 3T81A 3TYZA 2XP8A 3EXSA 4LAMA 2G5WA 3QVQA 1ESWA 1OX5A 1TPFA 2X1IA 1A5OC 4GVGA 3GXIA 4JN8A 3MP5A 4L9XA 1NARA 4GACA 4HKPA 1NQKA 3G3DA 2FAPA 2V3DA 2ZUNA 3N3MA 3E5BA 4TX9A 1QK0A 3LA4A 2Y85A 3PWAA 3FHQA 2DG4A 1I1XA 4W9QA 1E6RA 3GPKA 2DW7A 4GHRA 1BYBA 2VVSA 2D2GA 3CLMA 4UFIA 3CEUA 4GZJA 1VLIA 1Q7ZA 3AO0A 3WG6A 4F48A 2W3ZA 1FBAA 3BAJA 1CI1A 2AGKA 2ACSA 1REQB 1UG6A 1VFFA 4WK9A 2LLEA 4M1BA 3ABQA 5J6EA 3USZA 1EYMA 4DRMA 4DXKA 4ZB0A 3MZ2A 4YTSA 3KP1A 3IJDA 3UQNA 1G1YA 1JDAA 1EJTC 4QDWA 1E4LA 2Z1XA 4A3HA 3P14A 2I5IA 1PPIA 3PVFA 3BZGA 4B5UA 1EX1A 1WXJA 2PUZA 3RIKA 3DI1A 5LGXA 3V7PA 1R3TA 3LV5A 1AMKA 4IJBA 1EEPA 2TYSA 5D33A 3HPXA 3BK0A 1CW2A 3AUJA 3BO9A 3BG5A 1TMQA 3QQWA 2OYMA 3OTRA 1E9IA 4NAEA 3MHUA 4TV5A 1HKVA 3TH6A 5AC5A 1W56A 3VXGA 5LA1A 4NYUA 1J6OA 3CPUA 4PTWA 2AKZA 5A6LA 3LHVA 3P81A 4PCTA 2VI0A 3MP4A 2E5CA 3EB3A 2WJDA 3H70A 3DERA 3NXLA 3FA3A 4HA1A 3DFTA 4ZE4A 1SFLA 4YNGA 2HWGA 2G97A 2B4GA 1H63A 4G7EA 3WH9A 3I4KA 4UMAA 1OWQA 1YE6A 5A8GA 3VIKA 2VDIA 4XZNX 4H6KA 3IJQA 4UUIA 6A3HA 1PZ1A 2BNJA 4M0XA 1UD2A 2VGGA 3GG0A 1AQMA 4JY8A 3QTPA 3GTNA 1XDJA 1NJJA 3QMTA 3T44A 4PEKA 2VGIA 1BAGA 3W2MA 3TW9A 3DEQA 1E6XM 2VELA 2BV9A 4NX5A 4FAMA 4QS5A 4PSRA 1IEXA 3HV8A 1VYSX 1KFCA 1UBSA 5A2CA 3QHNA 1N8IA 5TIMA 1CXIA 4JIHA 3IV3A 1KO0A 2FFCA 3CZJA 4YTUA 3RPTA 4LNCA 2EF9A 5H2ZA 5B8IC 5BXSA 2G8ZA 1J10A 3AS3A 1XIHA 4YN5A 2ZUTA 2OR2A 1FH9A 4GIYA 2FQIA 5I79A 2DSZA 2FB3A 1A4MA 1WDWA 2WZIA 4DZIA 3UVAA 3VIHA 4UFKA 2F6UA 1JZ8A 1QOPA 2QAPA 4BS0A 4HPGA 4L5ZA 2C16A 1US2A 1UR3M 4Q33A 5JH2A 4H41A 3LHWA 3SRHA 4R53A 1E6ZA 4J4KA 4NJJA 3EDKA 2L2SA 3WF0A 1KGWA 3Q94A 1UKSA 2A1YA 1K6WA 1H11A 2CERA 3LCXA 3YPIA 1J01A 1TQJA 1MQQA 3HPAA 1F61A 3NVTA 4Z2JA 3JW7A 4MY1A 1OD8A 1HJSA 3KWSA 3L23A 3R25A 3FA5A 1PSCA 3MBDA 1FWJC 4Q4QA 3TN5A 1UR2A 2XN0A 3L4UA 2FVMA 4HNNA 4U85A 3CHVA 3DI0A 1KXTA 1OFEA 2FTWA 4QBXA 3RRAA 1U1UA 2PBOA 3PZIA 2Z1BA 1UIPA 2WSPA 1NIUA 1DOSA 1FKFA 3VD4A 2AKMA 4Q8UA 3CTLA 2D69A 1V93A 3EXTA 4R3UA 5A6JA 4YJ5A 3LRLA 2D3LA 4PUDA 3BCJA 4C6BA 1VFLA 4GVHA 3CH9A 1ZQ5A 3KZ7A 1SZEA 1XD0A 2P4VA 3URNA 4KFOA 3B8VA 3TAKA 3WDPP 1PJ9A 5CCZA 3MPGA 1BVWA 2CLHA 3ARSA 1TVLA 1JXJA 1TWSA 4O15A 2XGIA 3PK7A 2EXOA 5D30A 2XGZA 5E6YA 2PEVA 4JYEA 2ZIDA 1ISXA 3O8AA 4KT2A 1O5XA 5JH1A 4LEQA 4IQCA 3MUIA 4XO6A 5E1QA 2ZQTA 2DJLA 3IK4A 2HS8A 2QJHA 4L72B 2V5LA 3TNBA 4CNOA 3GTXA 3V36A 3DUGA 3SGGA 3GW0A 1W3NA 1C7SA 2VX7A 2VYOA 2P10A 4X9YA 4D9PA 5I78A 2YA1A 3A4JA 4MUPA 3TK7A 1GKQA 3IUDA 1GQLA 3KBSA 1YNPA 1KCXA 5DN1A 4LS2A 4ORIA 2RDUA 4D8ZA 2QIIA 4HN8A 2IUZA 3UG5A 1JF5A 3LCLA 4YVVA 4DJFC 1M68A 4KQNA 3W2LA 3WK1A 2VCAA 3EB4A 4RW3A 3RNDA 3LXAA 5D05A 5E5CA 4XQ6A 3VAWA 1BTCA 1FKWA 3PB0A 1AQHA 4CN6A 1OF6A 1XISA 3VOHA 3UWZA 1V08A 2GJLA 4M24A 2C7FA 3CJPA 1IXQA 3HMCA 3ONBA 2X8RA 3NPUA 2OGYA 4ZCWA 1HQTA 2FZBA 2V0TA 4NZ1A 4M80A 2XZ7A 2VZOA 1WAUA 3FJ6A 5HBFA 2VJXA 1WZAA 1KXVA 3WLQA 3DG6A 4AWTA 3C2YA 2EPLX 4W88A 1JPKA 1RK5A 1GZGA 1PBKA 3NQEA 3URQA 2OU4A 3NFUA 3WDJA 4J28A 1CLXA 4EPKA 3A22A 3NQAA 4MADA 2VDGA 4LWWA 1C3FA 5M3WA 1OYCA 5D2TA 2OLAA 3NJ3A 4P8UA 1D3HA 2EEXA 5CPSA 5LIKX 5FF2A 4GI6A 2MLZA 1AVAA 1BYCA 4XIMA 3ZJ6A 4DUOA 2ZICA 4W8BA 3ARPA 3HO8A 1EJSC 1RQHA 1HO4A 3CHFA 5HPOA 4DI9A 2XHYA 1D7IA 2UY5A 1PX4A 3SFKA 4UXDA 3LCFA 4GO8A 4NRRA 1K7FA 2DIKA 2O9RA 3WYZA 1IT8A 1F7BA 4CGTA 5CGMA 1Y7VA 5T8GA 4JEJA 3W1QA 2Z2UA 1R7OA 5IM51 1LL7A 3FK4A 3THQA 1M7JA 1UR8A 4DWSD 1TV8A 4WKFA 1S2VA 2I14A 5A8NA 2YKKA 3HM7A 1O6IA 3P5YA 5M5DA 4TMBA 4LVDA 3VC6A 3EEGA 1UD8A 4JTSA 4GY7A 4GKTA 4PODA 4D1IA 2NQJA 3OYXA 2PZ0A 1W9PA 4Y9PA 4O14A 3SBFA 3BMWA 2NSXA 3IVSA 1QBBA 3TC3A 4FR1A 4CKQA 3L2IA 1K4HA 2PFHA 1ZAHA 2NV2A 3N6QA 3LHZA 4V2XA 2WVTA 4QG9A 1XCWA 1Y0EA 1W5PA 1F6KA 4OQVA 3WNNA 4LY8A 5E0CA 2J9ZA 3WUBA 1HW6A 5I77A 3CMFA 2WVVA 3BUVA 4U86A 4AC7C 4E8DA 1AQ0A 3O0KA 2W92A 9RUBA 4JFKA 1B31A 4MUZA 5G4EA 3WMLA 1EZ2A 3MCMA 3C2EA 2ZA2A 2GUUA 3T2QA 3KVMA 3NQ6A 1DKWA 1XBXA 3GVQA 4KCUA 3TTYA 2F9RA 1S3HA 3VIIA 4NAEB 3KAFA 4XAKA 3NL5A 2PDJA 2JF7A 3BGJA 1GW1A 3CS2A 2FLIA 1NELA 1DIKA 4ICNA 3M0XA 4JHZA 4EIVA 2ALRA 2ZE3A 1E40A 4IPNB 4OWGA 1WKYA 3VE9A 3EWCA 1ZAIA 2HBXA 4EPEC 4GFSA 4DZHA 3NIYA 3BSGA 1MW1A 4ROQA 3M0IA 1EDGA 1LM1A 1J18A 1JD9A 2OWCA 1ICSA 4QJ4B 4MSPA 1WDDA 3VOFA 4S2CA 1F07A 3S5NA 2RHGA 4PYSA 4IFOA 1ONWA 5ABGA 2I1OA 3QHMA 3JUGA 1W5QA 1Q65A 1GEHA 3OG2A 4IX0A 4WY0A 3VIFA 4GNKB 3BLLA 1QNVA 2Q6ZA 3B9EA 4FNQA 3VCCA 1TG7A 1PTGA 1SO6A 3T4WA 2XIIA 1NAL1 3LI1A 1BGAA 2PWEA 3PF3A 5JQ9A 4TOQA 1PTAA 1FTXA 3WL1A 3SZ8A 3TP4A 3W0KA 3BG3A 3RO8A 2E6FA 4KEVA 3ARQA 1XRVA 2VFHA 1GTHA 2VFIA 1AH0A 3SUWA 4MWAC 3GE7A 5SWUA 1W2PA 3QKEA 3L0NA 1IT0A 1XLKA 3PFMA 4I9AA 1PINA 5L6UA 5T26A 1X97A 1A47A 1C7TA 4JIEA 4RJEA 4M51A 4O8RA 1JQXA 2I7GA 1M03A 4GX8A 1TR9A 2HBVA 3QQ0A 1K1DA 1SW3A 1E9LA 1ZUAX 4B91A 1Q8JA 5HUOA 3RHGA 2ZR6A 4XUGA 3HGJA 1BEUA 4GIVA 1NSJA 2A2IA 3D47A 3VNZA 3W38A 1Z44A 3COTA 3IPWA 1RLCL 1L6YA 4KF1A 5A6BA 1AJ0A 5TBOA 3WLOA 3IVUA 1W1A1 3DYOA 4PMYA 2NXGA 1UP2A 3I68A 4TTUA 3SY5A 3B0XA 3DFPA 3AU2A 1P0BA 3E49A 3TVAA 1H0IA 3ZQ9A 1C90A 3OOQA 1ELSA 1XW8A 4MKVA 1YRRA 1VFTA 2WBGA 2E9BA 2E28A 2RH9A 2V9DA 4O16A 3QRHA 1EPVA 3IANA 1EQ3A 1UIOA 3DYPA 2V81A 1V6VA 4BJHA 4HA0A 2X41A 2ZXBA 4YHEA 2VRJA 3DDMA 1NP2A 1F3WA 4IX2A 2VEKA 1XIDA 5IDIA 4WY0B 5KMYA 1JZ6A 1NWUA 4ZQPA 3HBLA 3CMGA 2R14A 3MO4A 4ATWA 1YDNA 1E73M 2OO6A 3DCPA 4QT3A 2DVTA 3WQDA 5BOFA 4GUIA 3T09A 1EBHA 2Y78A 2WWCA 2RDWA 3EOSA 4CCCA 3O6CA 1VEOA 4QHRA 3F7JA 3F2CA 2Q3RA 1D8CA 4WDUA 4KGLA 3TCZA 1R3VA 1VBRA 1O7AA 4OGZA 4CQCA 4LTSA 4ZOEA 4AEOA 4EANA 5CZSA 4C60A 3LCHA 4P7NA 5M1TA 1KM2A 4MKSA 5GNYA 3THCA 2HDJA 4A05A 4X0VA 3DGRA 3N2CA 3NSXA 1PIIA 1L2QA 3W71A 4UTHA 4S3DA 5G2IA 1HTIA 1V0KA 3ARYA 1MNSA 3ZR4A 1HL8A 4HZMA 5EB8A 4E5TA 2R82A 4GYFA 3K4WA 4UTLA 3ZWTA 4NZFA 1B9ZA 3LBCA 1K77A 4CD4A 1DJIA 4LT9A 2QIWA 4OV9A 4WSJA 1P7TA 3MJYA 3HPZA 1CZ1A 3EA3A 1C9DA 1E72M 3CL8A 4BI7A 1H61A 4GGBA 3LN3A 2ZZ7A 2YXOA 2PP0A 3GZAA 3FSUA 5LHEA 3QGVA 5FESA 3UWVA 4JQ3A 1R30A 3DU0A 1Q66A 1KLZA 1Z41A 1GOWA 4O19A 1S5WA 3XIMA 1FKRA 1DXFA 3WH5A 1BWKA 1HGYA 5HNNA 3TSMA 2HS6A 2XSXA 2PA6A 5AHIA 2AOSA 1VFOA 2NV9A 3O3RA 4HPNA 3O6AA 1PS9A 2OT0A 2DORA 2XUCA 1GHSA 2XU2A 3G77A 4NP7A 2WBKA 4Y6GA 1JAEA 1H1NA 2CYGA 4P2VA 2FGBA 3S3GA 3T78A 4GQGA 4PCNA 2V3EA 1IZCA 3W82A 4CCEA 4A29A 1X7FA 1S2CA 1OFOA 4G56A 3WX7A 4UR7A 1EOKA 2D0FA 4FXSA 5C9XA 3NDYA 3UR2A 2D1ZA 3BLOA 2A5HA 3VKDA 3H4XA 5FACA 4YTTA 1Q8AA 1S38A 3D0CA 1OT1A 5DMLA 3KDOA 3S2MA 3G6LA 3S0CA 2V38A 2NUWA 1WB0A 2EBNA 2OQHA 4Z1YA 4ITZA 4OBRA 3O7UA 1T41A 3B9OA 4QDMA 4IIBA 1KA9F 3C56A 2CKSA 4W8LA 1VH7A 3AIWA 2YSWA 3WQFA 1JVWA 2NT0A 1S5NA 1WPCA 1J0KA 1PE1A 3PZVA 3MA8A 2EKGA 4A6GA 4O12A 3U48A 1JNDA 1MW0A 1V6XA 3QXBA 2XDFA 3DBPA 3S9IA 4LUSB 3AYTA 5BWAA 3UXDA 5TAOA 3AXIA 1WDQA 3TYBA 1NWTA 4KRTA 3UETA 4X61A 4U31A 4E6MA 4XAYA 6REQA 3VZYA 4OTKA 4LAKA 3VO0A 3UZXA 2X0YA 2UZ5A 1R9ZA 4WDWA 2ANUA 1QW7A 5KTLA 3B0YA 4OIFA 4C6QA 4HIBA 3SCPA 1NWRA 4PN2A 2CLFA 1KXHA 2ZXQA 1G0CA 5JVLA 1TSIA 2QJIA 3FVDA 1PZ0A 1PWMA 2BB0A 1QBAA 1KM3A 3O5LA 3N15A 2HNHA 4GQRA 3OHIA 3MKCA 5L9FA 5DELA 2XM1A 4HD5A 4IFRA 4W87A 3VE7A 4D6IA 1FCVA 3DBNA 2J27A 2VD9A 2VC5A 1E1FA 4WKHA 2YYTA 4Q22A 5C9WA 5I98A 3VVGA 4P8XA 4XKYB 3V4BA 1QI3A 1QPQA 4Z17A 1Y8BA 3RN6A 3VDAA 3O6DA 1VAHA 2ZZ5A 4DY1A 3QC0A 1B3VA 2XN2A 2H8ZA 4H2HA 3ATZA 4L4OA 3AS0A 5FEXA 3EPOA 1V3MA 5GNZA 5FJPA 3N11A 5IBXC 5DIUA 3FJ4A 1KWGA 2MUCA 3P0XA 3BAXA 3VUSA 3OGRA 3SQLA 4F2BA 1CXEA 5LKYA 1DVJA 4NAFB 2ZQSA 3BW3A 4AG0A 2PDNA 3LENA 1VQTA 3F03K 3V75A 5JBEA 1EQPA 2XINA 4O1CA 5KETA 4FR6A 2IPWA 3PBMA 1EO5A 2QMKA 7A3HA 1MMFA 4LVFA 1RY0A 4LB3A 4IJCA 3B7XA 3KLKA 4F79A 2VWSA 2E1DA 5HINA 3JRKA 3PNUA 4HGXA 4NL1A 5U4NA 3QOKA 3CBWA 4ZVJA 2BASA 3A9IA 4H6RA 1RCQA 1GOMA 4AAJA 4AYSA 4WJEA 3OYZA 4HARA 1I2QA 2Y62A 4DRKA 4WX2A 1F4AA 3RITA 5LXXA 3CUGA 5AHFA 3GG8A 1HKIA 3CZGA 5AYIA 1KM1A 4X22A 3OZOA 5D32A 3L9CA 4FHAA 1I8JA 1T6MA 2Q71A 2WJZA 4B3LA 1LBFA 1WKDA 4L6HA 3NQ2A 4B5WA 3BJFA 2VGFA 2C91A 2VHLA 1EUAA 1IR2A 2XH4A 4AXKA 3NQ7A 3TZNA 4AX7A 2VFEA 1HVXA 4HNLA 4K7YA 4GUHA 3V0UA 3KOWA 4JNMA 3SY1A 2FDMA 5ABTA 1UWAA 4BY3A 3M5VA 3KM8A 2JIWA 4H8NA 1HFBA 5JUVA 3UNTA 4DBWA 3IIPA 1EYEA 3W73A 4FNSA 3ENLA 3VKAA 1EF2A 1H60A 3E6EA 5HWBA 4MY8A 4CQBA 2YB4A 1W5OA 3G1XA 4ZEPA 3M47A 4F3HA 4ZXLA 1E3ZA 3WCZA 4ZOCA 1LLOA 1KWKA 1PDZA 3Q45A 1DJNA 1GHRA 3MUZ1 3SCWA 4AIBA 1X8FA 3QPZA 1E56A 1JR1A 3ZZ1A 1J4HA 3WD4A 3C3NA 5DRIA 3BC9A 4R85A 1FKJA 5D2YA 1E55A 5A6TC 4PTDA 5GPGA 3CU2A 4IIGA 3BANA 2I56A 1HKJA 4ZMGA 2WSKA 2NW0A 2FHBA 3A23A 4ZPWR 4DWSC 1S1RA 3WNMA 4H6EA 2Y7DA 4FF7A 4JEQA 3CHDA 3EEZA 3QY7A 3A4AA 1B4KA 1K9TA 3O5JA 1XP3A 5HK4A 1J96A 1L8NA 4XG1A 4AISA 3GBEA 2VC9A 4J3WA 1CXFA 4O53A 3GXNA 4QZVB 3T0TA 3IUHA 4E38A 4C6EA 3NL3A 3NZGA 1MVYA 5JH8A 1ZENA 2VCDA 4C7GA 4OBTA 1P7TB 4C02B 4L7ZA 3NCOA 1FFRA 3G3MA 3V0SA 3UFYA 1W1YA 3TUUA 4F0RA 3I6CA 3SUTA 3W7OA 5AC7A 1OGBA 4QIBA 4JX4A 5GQBA 2X30A 3LK6A 4DZAA 3S9ZA 3DFHA 4JKKA 1TKKA 4XAZA 1B2YA 1JNEA 3MI2A 2DT0A 3QLLA 3RCYA 1OZQA 4X0NA 1QT1A 2R24A 4ZR8A 2PI6A 3FKRA 1GZ1A 3NVDA 2QF7A 3UXIA 5BXRA 2W62A 2Q8LA 2E3ZA 4BEQA 1JCMP 2WC4A 3H26A 5BRBA 4Q4KA 1BF2A 1BVNP 4Z0SA 4MOZA 3RFAA 1FWFC 2M2AA 5DMMA 2QLYA 3BAKA 4F0LA 5EY5A 4DO5A 3UG3A 2ACQA 2I9UA 4PMUA 5DXYA 3CLWA 1VGAA 1DHPA 2WOQA 3EBVA 4HMEA 1RA5A 1WXZA 4GKLA 4IQJA 4BCEA 2Z1KA 3EOOA 3A5VA 3QBUA 2GQ3A 3AISA 3EKGA 1YDYA 5H91A 2WKGA 3N18A 3M9YA 1FH8A 4YTQA 3WDQA 2XTKA 5A6BD 4C1LA 1ONRA 4XD4A 1LTDA 1OX4A 2D3NA 3RDKA 2GL5A 4RNIA 3B40A 1RD6A 3EWBX 4DX3A 5I3FA 2QMJA 2VNCA 3FXYA 1Q6IA 4XZ9A 5GJPA 4DJEC 4ZQRA 2P0IA 1LOSA 2EPKX 1UMLA 4CU7A 1OFRA 1W17A 3QGAC 2YCKX 2GWNA 1KQZA 2HNEA 4W5ZA 5HAOA 3TJLA 1DWFM 3LY0A 4I90A 2D9FA 5DEZA 1QRQA 1L6FA 3BXWA 1FKIA 1TZ9A 8XIMA 1KRBC 4Q4SA 3LXCA 4H19A 2BY1A 3DFSA 4NX0A 1IZJA 2ZVIA 2AQOA 1OX6A 4Y9OA 3N19B 4JFSA 3NZRA 3MKVA 2G3IA 3EDFA 3W74A 1RVGA 3VDGA 2CPUA 4NHVA 3CWHA 3NQMA 5J04A 1XIBA 2PDIA 1GKRA 4PFMA 2W91A 3A3WA 3TYAA 4NAFA 3IGUA 1PVNA 3MUCA 4GQBA 4DWDA 3ZMRA 2PTXA 1UJQA 4ODMA 5C9RA 2WNZA 2O7SA 2ATSA 4WVXA 4PR4A 2BG5A 2REQA 1K9EA 3W70A 2VEIA 5D9MA 3VOCA 2D2OA 1E4IA 2QHAA 4HYWA 1VRDA 2Q09A 3DN5A 1FKHA 2Y7FA 3L21A 2ZQVA 1M53A 4WDXA 3FHAA 4JQAA 4CCDA 2QPSA 4S39A 3DIPA 3QV9A 1JIBA 1PIFA 2IQTA 1L1PA 1OIMA 3C2FA 3QH2A 3TA9A 4K8GA 1EQCA 2WVVB 4KMQA 2YL9A 1H62A 1NY1A 2Z27A 1R38A 1FWBC 1WKFA 2WXDM 3EX4A 2VMFA 4IFKB 4GH3A 2CFFA 2NWSA 4GCXA 1OHLA 1OC7A 1KW1A 1O94A 4DRHA 1MZHA 2Z4GA 3ZR6A 1FWCC 4L61A 3H4GA 5B80A 2A21A 2WW5A 4FOUA 4QR6A 4OHQA 3QZAA 1NDZA 4E2OA 1XSIA 2WZHA 3VKJA 1FX6A 2VZTA 3A4WA 1V02E 4N9DA 3SAZA 5D09A 3W25A 1G6CA 3N73A 1UZDA 3AXKA 2DFAA 3B9AA 3AZRA 1JCLA 1WQ5A 3LZ5A 2X42A 3FV9A 4BWLC 1NFGA 1LROA 3ECQA 4GOAA 5BXTA 5I23A 4RX0A 4B2DA 2INFA 2NQZA 4LX4A 5I06A 5TQLA 3C0LA 3BW4A 3W1AA 4IT6A 3LMZA 4PB3A 3SEPA 2J9XA 4E3VA 4TXEA 5PTDA 2YZRA 3PUOA 1WV2A 5FEPA 2Y4SA 1JZ2A 4DRSA 3KRZA 3QEZA 3CQJA 4IMCA 4OUEA 4OZOA 1FKDA 5EA9A 1YTKA 5DLCA 4NXSA 1QI4A 3FDKA 3MSGA 1IR1A 3WQPA 2R1KA 4TX0A 4UTMA 2QVNA 5BNKA 1HXVA 2CITA 4E8CA 3W81A 1UR0A 5K9XA 1A50A 3IAPA 4Z1BA 3MI6A 1EDTA 2XWEA 4UQAA 4MNJA 4OOZA 3LI0A 1Q7MA 3VAVA 1GGOA 3BMXA 2WPBA 2ETNA 1R3SA 3WBWA 5C2CA 2QCDA 4DXXA 4WCJA 3LLDA 1FWAC 1SO3A 2VOMA 3W7IA 4EE9A 5D75A 4TVDA 2WSQA 4C1NA 1LBMA 4KBXA 1N8FA 3AXMA 1FWTA 3TROA 3BAWA 4JCLA 1ALDA 2J24A 4JFTA 1MEIA 3EOLA 1F40A 4F66A 3AIQA 4US5D 3DECA 2V5DA 3TSDA 3WBXA 5D2XA 4JYSA 4F9DA 3QYQA 4B2DD 1J5TA 1ISVA 1J5SA 3H8AA 1HX0A 4UTJA 4TW6A 2WANA 3N6JA 3W7DA 2YZ5A 2TAAA 3ZSSA 1UP0A 3GWQA 4IMAA 1GQKA 1N1AA 3H2AA 3TIMA 1A3HA 3UR7A 1XLLA 3IK2A 4R7JA 4AXNA 3MT1A 4O1FA 2QW5A 1FCQA 2R1MA 3QZEA 1RSCA 2IS7A 4F9JA 1XIJA 2GDUA 4DWSB 1D3GA 4Y7EA 3MWAA 1ENUA 1E6NA 3VIPA 1QMLA 2W4XA 1JVNA 5LIWX 2AMGA 1V5XA 1ZJBA 3MWCA 3PG9A 4E0CA 4ZB5A 3WDRA 5I7GA 3V5OA 5HMEA 1W3HA 2DUAA 4XTDA 3MVTA 2F2DA 1IF2A 3AXXA 3KP0A 1E70M 4HOWA 2V69A 2QR6A 1H5VA 3A6OA 1DWAM 1DWIM 1YW1A 3GLCA 5CPTA 3ZM8A 4LF1A 4A8IA 3UZJA 3AC0A 3UCQA 3F2DA 3N9SA 2G4JA 3T4CA 1IT7A 1VFUA 2QAFA 4ZA0A 3UA4A 2PB1A 3R89A 4CVUA 4XZLX 2PRLA 3U5YA 4W8AA 1O95A 2J74A 3N12A 2XVPA 3BOFA 1U1JA 1GVYA 4P61A 3RILA 1F6PA 1M5YA 2WKLA 2CCRA 4TW8A 2J4GA 4K37A 1WOAA 2WNNA 1Z7AA 3NOYA 3QFWA 5IBXA 3WJWA 2ZVRA 3GQYA 2DT3A 5DY2A 4TYOA 1H7XA 4FOJA 2A4AA 5DT5A 2I17A 4MWAD 3GDBA 2F23A 3RLGA 4UOQA 1PKYA 3OVPA 1YX1A 5E09A 4IQDA 2JALA 4P7RA 3A3HA 1P0KA 4KW2A 1I2OA 3LQGA 3N13A 2DIJA 1J6PA 4S23A 2J6XA 2C0HA 2XGBA 4ZQCA 3MUY1 4LBRA 4PEEA 4PUMA 2BGQA 3QTGA 3TTQA 4DLFA 3WBYA 4AC1X 1F9CA 1EOMA 3E38A 4IPPA 4UTTA 2GGIA 2PU0A 4C6DA 4ZL1A 3UEQA 2CLLA 3EDDA 4AWUA 3RX3A 1E1CA 5A95A 4W9TA 3MUAA 3OBAA 3ANYA 1DORA 1A0EA 3WQ6A 5CPLA 1BL4A 2RUQA 2AL2B 2FKEA 4FIQA 3F4WA 1X38A 2RDXA 5FL1A 1WDPA 3MANA 2Z2AA 4QITA 4G1KA 2IW0A 3VNJA 1AK5A 2ZX9A 3N1AA 4RV8A 3LPGA 3R94A 1AD1A 2W27A 2Y5EA 4YIWA 3H2EA 3PJWA 4A3RA 1K02A 2ZX8A 2VZVA 1X6NA 1TJPA 3PZOA 1Z42A 4TNSA 4AZHA 4N0RA 4HCLA 1U5HA 4JL1A 4FB7A 5I00A 5CZ0A 2E6AA 5AHLA 3UPMA 3DGBA 3CAVA 2ZFAA 4O11A 3PA7A 1VIZA 3H7UA 3L4VA 3KFTA 2E77A 4K38A 4OBSA 4L4PA 3GDLA 4FOKA 1EWEA 4AIUA 2PDMA 5H8MA 1SFTA 5I3KA 3VD7A 3W1NA 4O17A 4W7WA 5K2ZA 4J3ZA 1C92A 1A3XA 2E8ZA 1V6TA 2XPKA 1WNOA 3WH0A 3PWGA 2PDHA 1VPYA 1W9UA 4B9YA 3O63A 1KM5A 1CLVA 3J7HA 1BGGA 2UV8G 2QEZA 4JFMA 4GXWA 2HPIA 2VKZG 5EGRA 2BFGA 1D7KA 3UI6A 4ODNA 2CZDA 2GWGA 1TZ7A 1LCOA 4W93A 1B1YA 3MJMA 2PDPA 3QQ1A 3OW1A 3O5DA 1IWAA 2PRMA 1GVIA 4LUJA 2J79A 2CLEA 4H9XA 1BFNA 1WZKA 2CETA 5AOUA 3BLFA 3QV6A 1U5VA 3HG2A 4EF8A 2IPGA 1QWKA 1Q3NA 2VP8A 3WK2A 2XPBA 2EPNA 4WXZA 4M6VA 4LAUA 4NVTA 3CGNA 4D8AA 4JIPA 5K9DA 3UJEA 2VFFA 1R47A 3SCSA 1R9XA 3DZ1A 4GZEA 4ONVA 5HULA 1OADA 3GSMA 1E9YB 1SUXA 4LJ3A 1Z9AA 2VRKA 3KBVA 4YCPA 3BCFA 3S46A 4O1EA 2ZUVA 3TN6A 2IKGA 3EWDA 3W37A 2ZA1A 1TX2A 3SN0A 4ZGYA 4N6FA 3ES8A 3A13A 2Y8KA 1SO5A 4KS0A 4PCSA 4F0HA 1HNYA 3BLKA 1K8CA 5C70A 4BI6A 1KTNA 1QXLA 2C79A 3E1F1 4D8LA 3FYOA 2CW6A 2IKHA 4RUBA 1UD3A 3SB0A 1H1YA 3WLJA 1T8XA 3VOJA 3WH8A 2O55A 3MDYB 3FFSA 4MKNA 4LPCA 2F61A 4GO9A 4PBFA 1M7OA 3E12A 3ITOA 1FJDA 3BURA 3PTMA 3W00A 4KR0B 1EP2A 1Q4WA 2OSYA 3NDZA 4C6FA 4KIEA 1UH3A 3EB2A 1A0CA 3GDMA 5JBDA 5F1VA 2JKPA 4JTKA 4HPXA 2XM2A 3T40A 3L5AA 1K8YA 1EFZA 1V77A 4ATLA 5G1TA 3MMDA 3BPWA 4MMWA 2Z29A 2ZWZA 2OXNA 5C54A 1A5NC 1FOBA 4PRWA 4HK7A 3CWNA 3KHJA 3VFLA 5LZLA 2JKAA 3CPGA 4C7DA 3CYVA 4KCWA 2V68A 2V3FA 1UC5A 3LLFA 2XFWA 1FWRA 1Q5MA 1D9EA 2FGLA 2VEGA 2CWNA 1ZALA 4WUIA 2HE8A 3TYDA 4RK8A 1OX4B 4N42A 2KR7A 3UA3A 1WDSA 3W1TA 4MYAA 2QDDA 2CLOA 3HFTA 1AA1B 3AMKA 4AIOA 4CD8A 5CSUA 9XIMA 3OB8A 4QP0A 3PSWA 2PWGA 1A80A 5LA0A 4C6KA 3V3WA 2W66A 3BICA 3P8IA 4ADTA 4MAVA 1UC4A 1XLFA 2B81A 4HVXA 1GVOA 1GT8A 3W7HA 4L65A 4AD5A 5AZ1A 2E25A 4A8NA 4ZOAA 3IVTA 1TB3A 3ITLA 2PAJA 1ZP4A 4JOMA 3EWWA 4AYGA 1SJCA 1H7NA 4F0KA 3CUXA 1OD0A 3REQA 3OP2A 4PBEA 1UB3A 3HOJA 3NR0A 2VFGA 4TUFA 4IIEA 3OJGA 1CECA 2YR1A 3Q2DA 3N17A 2VC6A 1HO1A 1GG1A 4RDVA 3SQSA 5I3IA 1X96A 3SCVA 1C8XA 1REQA 1POJA 3NZ1A 4DVOA 3T6CA 4NYYA 3VIMA 3NWRA 5AHNA 1CLKA 3E2RA 3I3EA 2BHZA 1C91A 3CAKA 1ITXA 2OX1A 5DMYA 2HK1A 3E0LA 1XFCA 3T0DA 1KCZA 1E1CB 3NRKA 4WSKA 5LIXX 2RQSA 1HF6A 2W6RA 4XAPA 4IMEA 3FEQA 1XYAA 2CC0A 3VFCA 3RU8X 4Q4OA 3IKGA 4WKAA 4D6DA 4W4QA 1P6WA 5HDRA 1W8SA 1XIIA 5HQMA 1W9XA 3RPMA 4KIRA 2XIMA 2FMOA 1Q6EA 4LVBA 2AQVA 3ITXA 3I10A 1SMAA 3EMQA 4B16A 5CC5A 4UR8A 2GSJA 1ADDA 1EGMA 4FP1A 1MXGA 2YCIX 3CAWA 4Y90A 4KH2A 4HSNA 3M0ZA 3PBGA 5AFDA 2Y2WA 3W1XA 1QNPA 1I75A 5D2VA 3SM0A 2DEPA 3IJ9A 1NTHA 3PAJA 1YTEA 3ABXA 1XH2A 1HP4A 3W72A 4CD5A 1RQEA 3URBA 3M0VA 2ZR5A 2FJKA 3SUUA 3VGFA 1NOWA 1VJSA 3JVAA 1LLZA 1TIWA 2DVUA 4S3AA 1TPUA 2FDSA 1N82A 1D8WA 3TDBA 2FZ9A 3CGTA 1GYNA 4GIEA 4B9ZA 5HXMA 1C9WA 3BCDA 4IMGA 2NLYA 4BF7A 2EKCA 4S1FA 3GM8A 1M5WA 5D9PA 3M16A 1EO7A 4IPXA 1TTIA 1BG4A 1XCFA 4GLEA 4RE2A 3M7WA 3BOXA 1E5JA 3BLIA 3RPDA 5FF7A 5EMLA 3GC5A 2B5UB 2VGBA 3SIMA 4O1DA 3UI4A 3AMDA 1V02A 4DLMA 4RXFA 2FTPA 3B8UA 3OLGA 4FNTA 3S6OA 1LL4A 1HZYA 2WZMA 6ALDA 2DG9A 1IYXA 4HNTA 4HJFA 2X2YA 4M5PA 3WLSA 2QCMA 4YWIA 2VCCA 3BSHA 5F2IA 2Y5JA 3LTSA 4KKXA 2VO5A 2BZNA 1IWBA 2P3ZA 1C8QA 4LC6A 3W1LA 1EP1A 4AY8A 4PULA 2ZQ0A 4REQA 5BW6A 4WR3A 4B4FA 1RHCA 3CK5A 4J4NA 2PDGA 3BWWA 1H7OA 2HJPA 1J79A 1XFBA 2BOFX 5MKGB 1I2RA 4L80A 3FJNA 1HJVA 1TO3A 3ME3A 4MB3A 3R43A 2GJXB 3LDVA 2QCDB 3CHEA 1QNQA 4UQEA 4WSHA 4RCXA 3R13A 4XB3A 1CDGA 3NPWA 4MPKA 1TPH1 1I0BA 5AYXA 1A5BA 3A3XA 1OG0A 5U7SA 1ZP3A 1BSIA 4GYJA 5CQ1A 4GGQA 1NDVA 4O52A 4FO4A 1VB9A 1XBYA 2ZX7A 1POKA 4GYPC 3BARA 2VL4A 3PS7A 1XL9A 4QT2A 4L1XA 3CV2A 5EYWA 1FWDC 1O60A 3TW7A 2Z0IA 2CZVA 3ORWA 4XIAA 1AL8A 3CT7A 1FD9A 1I1WA 2DP3A 2QT3A 1FCUA 4V1YA 3WUGA 5CGQA 2XVGA 3L4YA 4YVXA 4S3CA 3AFBA 5EKYA 3WFAA 4QISA 4QE5A 4M8UA 3W22A 5EPDA 1UH4A 3MHFA 1TUXA 3CUJA 3D3AA 3GBDA 2BX7A 4DJFD 2BGSA 2F2HA 3QC3A 4GC4A 3R11A 1LJYA 2E68A 1UWTA 4GQ0A 1PIGA 4D71A 1S2AA 3LM3A 1TWDA 5DFAA 4RE0A 3L68A 5LGZA 1RP9A 4X3ZA 1KCKA 3VGEA 2PN0A 1UASA 3LTPA 1OBAA 1J4EA 3DOPA 3ZLFA 1ZK6A 1U1HA 3O5KA 3SCNA 3UWQA 2QJJA 2HQAA 2POTA 4XD6A 3PRBA 3QF0A 4EVZA 2OKOA 3QM3A 1DPMA 3NYDA 1XYBA 5M2FX 2QDEA 3WD2A 5HATA 1XD1A 1L6WA 3MI3A 4AU0A 5EMYA 2CHNA 2PWHA 3GRIA 3PANA 4OFCA 1XI3A 2O92A 4QSHA 3UPBA 1XX1A 2Z2BA 1DHKA 2E6YA 2ZBTA 3O06A 3K4AA 3LRMA 3HG5A 4OECA 4GWEA 4Y8FA 3EA2A 3AAMA 1UOKA 4B5XA 3RK8A 1OQFA 3NPVA 3KAIA 5D37A 4AW7A 3V35A 2Y1HA 3K13A 2WCSA 1W1VA 3ALFA 3IJ8A 4MB1A 4XTIA 1Y5WA 1XGDA 2C3ZA 3MW7A 1QW8A 3CL6A 3NOEA 1GW9A 1EGZA 3P80A 4LAWA 3FCPA 2ISSA 1VCFA 3LNMA 3NL2A 5I5RA 1XLEA 5CPNA 3OO2A 1FWEC 5IRPA 2P88A 3WDIA 4TVUA 3GX9A 3LSCA 3DC0A 4B92A 3NQFA 3KZPA 5REQA 1MFUA 5HMDA 3PN8A 2YYUA 3LLXA 3SR7A 2A7PA 1PDYA 3F4VA 4L1WA 2BWGA 3IJ6A 5RUBA 3ZJKA 1ROTA 1G01A 1GVRA 1EXPA 3TX9A 1XXXA 1UZHA 1BVZA 4FNPA 3KAGA 2YBUA 2DDXA 2G3FA 1DYSA 2C14A 1TPB1 3NI6A 4QG8A 4QGCA 4N19A 2YFNA 3B9DA 5EFDA 4KWWA 1FWSA 5CJMA 2ZTJA 3AJXA 4GISA 4ZO8A 4AD4A 1GORA 4G7FA 1FHLA 3P60A 2SFPA 3R0KA 1B3ZA 1ODUA 3PWIA 1VKFA 4PTVA 4QLJA 4ZXOA 2WYSA 1X1OA 1TVPA 3HN3A 4Q8NA 4R9XA 3ZYZA 3R2GA 4S3BA 4JX5A 4F0MA 1HJUA 5D8WA 1F76A 3VA8A 1DJZA 3I65A 3NAVA 3UI5A 2R1PA 1LOQA 1IEWA 1GZJA 1Z6KA 3PB2A 1XYFA 4AVFA 1KGUA 2J66A 2E0PA 5CZTA 5KEZA 2RKXA 1TRDA 4EPBC 1ITCA 4BWLA 2X2GA 4IG2B 4I9JA 1W54A 3ABOA 4DM2A 2KX9A 4HHPA 3LHUA 3L5MA 1KRMA 1ZJIA 4L56A 4HSHA 2LPVA 3LZ3A 7PTDA 4Z2KA 4LNYA 1LORA 4UTKA 1DIDA 3QJAA 3GU1A 4N4PA 1BRLB 2E8YA 3BGAA 4IQLA 1VZWA 2PPOA 1H3GA 4J9JA 3TDFA 3L0GA 2ZADA 4MGVA 3RO6A 7XIMA 3FYYA 2RURA 1TV4A 3GIYA 4FAPA 4AF0A 5REQB 5E93A 3SIZA 3W9ZA 3CQIA 3U5UA 4I7VA 1BHGA 5XIAA 1TE6A 2VOTA 3MBFA 4NG3A 4Z08A 4C91A 5BZAA 5FEZA 3C2VA 4BF8A 3IJLA 3W7MA 1GVSA 1W31A 4HU4A 4LYRA 4OV4A 1XRFA 3ES7A 4W84A 3G1RA 2BOGX 3N25A 4ACZB 3UW6A 2FVKA 3PM6A 2OZ3A 3AYVA 4WZHA 2GPTA 1RBOB 1AD4A 1QPRA 1TTPA 1GJWA 2OO0A 4Q8OA 4CQ9A 1WO2A 4DPQA 1XKYA 4EACA 4RW5A 5JU6A 4AEEA 2PWVA 1SJAA 2W9MA 2C15A 2X1UA 2MF9A 4R5EA 3O05A 2P50A 2V6AA 3TTSA 3W7PA 2ONEA 4BQ2A 4IJRA 1UR9A 1HGWA 1TCDA 4GG9A 4JTIA 5KINA 3VINA 4UWMA 3S1XA 1OCQA 1ONEA 1SMDA 4DRQA 4AHPA 3K5XA 1PTDA 3IHZA 3U2OA 1SR9A 4D2JA 4TTGA 2OGJA 2RUDA 1B9BA 2PCQA 3UGRA 4PMJA 4AVNA 4LAOA 3I7SA 1P43A 3W7GA 4EXAA 3QMRA 4JKLA 1VYRA 4DROA 1W26A 1W91A 1W32A 4EPDC 2O0TA 1W1B1 4W7VA 1UZ4A 2XP6A 5CZJA 2Y89A 3AHXA 5AVHA 1YEYA 4Y9MA 2X05A 4MWAB 5AC8A 1SJDA 3HU7A 4M56A 1XLAA 3GC4A 3UXAA 3KZSA 4NUWA 1C8YA 1AJ2A 4H2CA 2OEJA 1Q13A 2OZ8A 4HCDA 4R7WA 5AYBA 2C6QA 3BLPX 5HMSA 4DF2A 2P8CA 3T07A 3T05A 1A49A 4ACYA 1E0VA 4ZTXA 1OG6A 4XWUA 2IKJA 4YCOA 1NOUA 4RKAA 3VMOA 2YDRA 3OBKA 2CXGA 4HPHA 1FDJA 4L4MA 3TJ4A 2J7HA 3FAXA 3LX9A 1MI3A 2J7DA 2X7VA 2J7EA 3EWYA 3NEHA 4WY0F 4L4LA 1U79A 1BSLA 3IIVA 5E0KA 3QMSA 1EUNA 1PZ3A 4W9OA 1SQ7A 3TSBA 1SW0A 4L6OA 1J0IA 3QLDA 1BWVA 1TV2A 3GFZA 1BTMA 3OQEA 1FQ0A 4FEZA 3A21A 3PFRA 2X09A 1EJXC 3WNPA 3DHDA 1LG1A 3RM8A 3H24A 3L4WA 4B5SA 2EAWA 1K9DA 3AMCA 1VPXA 5CZKA 4XAGA 1J93A 3S1UA 4TV6A 1BLIA 3WEMA 4IMFA 1O12A 1SYTA 3PZ9A 5A94A 2VD8A 3JZEA 1OK4A 3KRBA 4I8DA 3GNOA 1QNOA 4JNYA 2A7RA 2OJPA 1AZ2A 1KFJA 1FKBA 3VM7A 3ARVA 4XISA 4Q8TA 3TAOA 1JZ4A 4LUSA 4RV3A 3SUVA 4ZSUA 2QQ6A 3GG7A 1GPFA 4D6JA 4JIIX 4JGDA 3TE9A 2QCCA 1H7PA 5T9BG 4ICCX 1X39A 3R0UA 1FWHC 3U3HA 1KRCC 1MQPA 4US6A 3I3DA 3AIVA 1V51A 2QUVA 3W53A 2E6DA 3H7VA 4O13A 3LBMA 3UZ5A 2NQ5A 3P62A 1F3TA 1SVDA 3OIXA 3APGA 1JRCA 2HVOA 2J78A 1TJ2A 3XINA 3UNDA 4FS9A 4HNVA 1T40A 3GIPA 4AZ7A 3BAYA 4LUYA 1KRAC 3R58A 3HURA 1Q63A 2GGGA 2V63A 3OVGA 3VD5A 3OU8A 2VZSA 3KWXA 3AHTA 1TX0A 5FKYA 3N2TA 1Q45A 3QOMA 3LM7A 1DBTA 2YXGA 3CO8A 3QV7A 3SCUA 3KBNA 3BL3A 4HU0A 4RPPA 2J7GA 2RUSA 1KBJA 3K1GA 1DXEA 3CM4A 1QW9A 1IQ8A 3LGEA 2WAGA 2XFRA 7ENLA 3KEHA 1R2SA 2XP3A 4QNWA 2O7QA 3KTCA 1VC4A 2FTYA 4FX7A 2RJHA 3AI0A 3POHA 4CN1A 2FZDA 4F2TA 2BVYA 4ZTYA 4DZ3A 2WO5A 3WQVA 3FX4A 1M41A 4E4FA 4IOTA 2PDLA 4AIEA 1BYDA 2PTYA 3GG1A 4BQ4A 4XV0A 3PULA 1HXJA 3U7VA 5BRPA 1QK2A 2YJQA 1V8EA 3T8LA 3VC5A 3B0PA 3CWOX 2ZDRA 2DH2A 4JYDA 3M0HA 1XLHA 4UCGA 1TPC1 3QFEA 2BY2A 4LU0A 2Z7KA 4M29A 1PXGA 1V79A 4JTTA 1P0DA 2I16A 2OTDA 1B3WA 2WCAA 1QI0A 3WF4A 4JAWA 5DIVA 1F8IA 3KABA 4IQ2A 2QYGA 2NUXA 1SFJA 1W3KA 2Q5AA 2O9TA 1JYNA 3UF9A 2JK2A 1P4CA 3S1WA 4PB4A 4UTIA 3TC7A 2QGHA 5T91A 3VNDA 1W5NA 2LKNA 3WF3A 5J5DA 3AWNA 2VRQA 3FOKA 3GK0A 4GGHA 1FUYA 5HWJA 3BLEA 4O10A 3TYEA 2JZVA 2WJEA 4ODOA 3B8IA 1N55A 3GTFA 1S5VA 4XBSA<