1J6YA

Solution structure of pin1at from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
b'HMASRDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptidyl-prolyl cis-trans isomerase
publication title Solution Structure of the Single-domain Prolyl Cis/Trans Isomerase PIN1At from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
total genus 17
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j6yA00
1FAPA 2KE0A 3RFWA 3KAGA 1FKBA 5DITA 5J6EA 5HWCA 1P5QA 2ITKA 3MDYB 4U86A 4FN2A 5B8IC 5DIUA 3JYJA 1J4RA 1Y0OA 1FKDA 5DIVA 2M1IA 2MLYA 2DG9A 2MF9A 4ODMA 1NMWA 1FKRA 1JNTA 1D7HA 2Y78A 2KO7A 4JYSA 1BKFA 4DRNA 3LUOA 2PPNA 1C9HA 2PBCA 3OOBA 4LAYA 4ODPA 4U84A 1JNSA 4JFJA 3O5OA 4G2PA 5I98A 3O5FA 4U85A 2IF4A 4W9OA 1YATA 1J4IA 3UI4A 1TCOC 3JXVA 2KFWA 4IQCA 1A7XA 2F4EA 3B7XA 1Q6IA 4TNSA 4GIVA 3UQIA 4DZ2A 2ZQSA 3NI6A 1FKTA 3KZ7A 4QT3A 1U79A 2XP4A 4QT2A 2MPHA 3ODKA 1KT1A 3KADA 2ZQUA 4JFMA 2FKEA 1FKGA 1PINA 2VCDA 3CGMA 2XP6A 1N1AA 4JFLA 5HKGA 3O5MA 3O5EA 2FAPA 4TW6A 1FKIA 2N87A 4NNRA 3O5DA 3O5LA 5D75A 3KAFA 3IKDA 3UQAA 1ROTA 2PV3A 1F8AB 2F21A 3IHZA 3WH0A 3FAPA 4FAPA 2L2SA 1ZK6A 2M2AA 3UF8A 2RURA 4BF8A 5HUAA 2XPAA 3CGNA 3O5KA 4DZ3A 2LGOA 4DT4A 1D6OA 3PA7A 2PPOA 1FKKA 3VAWA 2XP3A 4JFIA 4DROA 2PV2A 2PV1A 1QPLA 2XP5A 1ROUA 1Q6UA 2ZQVA 4N19A 1PBKA 4W9PA 5BXJA 5HWBA 3JYMA 4ITZA 1HXVA 2K8IA 2RQSA 2Q5AA 4R0XA 2KI3A 3O5GA 4LAXA 1EYMA 3UI5A 3NTPA 3TCZA 3UI6A 3O5RA 3O5PA 3TDBA 5HTGA 4LAVA 1EQ3A 4DRPA 4J4NA 4ODKA 4ODLA 4TW7A 2LPVA 4ODOA 4QIBA 4GGQA 2MNTA 3H9RB 3O5JA 2RUDA 2KGJA 4ODNA 1FKFA 1M5YA 2ZR4A 3KACA 4DRMA 1YW5A 4DRIA 5HW7A 1J4HA 5HW6A 3KABA 3TC5A 2ZR6A 4MGVA 1FKLA 1Q6HA 4DRQA 4IQ2A 4TW8A 2KR7A 1T11A 1W26A 2D9FA 1NMVA 4IPXA 4O2TA 4DIPA 3RGCA 2RUQA 1JVWA 3IKGA 1Q1CA 1NSGA 2LJ4A 4DH0A 1FJDA 3KAHA 3GPKA 2UZ5A 4ODQA 2XP9A 1BL4A 3NRKA 1B6CA 4ODRA 3KAIA 2DG3A 4JFKA 5GPGA 2M08A 1FKSA 2JZVA 3O5QA 1QZ2A 1FKHA 3EY6A 2PPPA 3PRBA 5HT1A 2VN1A 2AWGA 2XPBA 1FD9A 2DG4A 4DRHA 2F2DA 1QPFA 4TYOA 1D7IA 2ZQTA 2RUCA 3I6CA 3UQBA 1L1PA 4LAWA 4DRJA 2LKNA 2XP8A 5HW8A 2ZR5A 2MLXA 4TX0A 4W9QA 2MLZA 1F40A 1R9HA 2OFNA 3O5IA 4DRKA 4C02B 2XP7A 1FKJA 2RSEA 1D7JA 3IK8A 1KT0A 3KCEA 3PRDA 4G50A 1ZCNA 1J6YA 4MSPA 4J4OA
chains in the Genus database with same CATH superfamily
1FAPA 1HKJA 5DITA 5DIUA 3JYJA 2DPEA 1FKDA 2M1IA 4MNLA 3WQVA 1FKRA 4JYSA 2KO7A 1UR8A 3G6LA 1JNSA 1HJVA 5I98A 2F23A 3ARUA 4U85A 2OLHA 3UI4A 1OGGA 3JXVA 2KFWA 2F4EA 3B7XA 4GIVA 4DZ2A 2FDMA 3NI6A 1FKTA 3AS0A 3ARTA 4DWSC 2AOSA 1KT1A 1D2KA 4IT4A 1XRVA 3AS3A 4WK9A 1N1AA 3EIPA 1E6RA 4NNRA 3BMBA 3O5LA 5D75A 3WH0A 2EULA 1LG2A 3UF8A 3WQWA 3WKZA 5HUAA 3O5KA 3CGNA 4DT4A 3ARSA 3VAWA 4JFIA 2PV1A 4N19A 1Q6UA 5BXJA 3PR9A 1HXVA 2RQSA 1LG1A 1GPFA 4LAXA 3ARXA 3UI5A 3WD0A 4L3NA 1VF8A 4DWSD 4NSBA 1IX5A 1HJWA 4ODNA 4ZPWR 4DWSB 5HW6A 3TC5A 1FKLA 1Q6HA 4DRQA 4NZCA 1NSGA 2LJ4A 2UZ5A 2A3CA 2DG3A 4JFKA 1FKSA 4Q7NA 2VN1A 2AWGA 1E44A 2DG4A 1QPFA 1NWSA 1D7IA 2ZQTA 3UQBA 1FFQA 4LAWA 4LGXA 2B31A 4TX0A 4W9QA 2XP7A 1W9VA 3KCEA 4G50A 3PRDA 1W1PA 4MSPA 1EIBA 1ITXA 4R5EA 1H0GA 4WKAA 2QF8A 3ARWA 1FKBA 4UDMA 5HWCA 2ITKA 4U86A 5B8IC 1J4RA 4MNKA 1NMWA 1GOIA 4WKFA 1BKFA 4DRNA 2PPNA 1C9HA 2PBCA 2B5UB 2DSVA 3O5FA 2IF4A 4W9OA 4IQCA 1E6PA 1RD6A 3AS1A 1W1VA 2WK2A 1E9LA 4QT3A 1U79A 1E6ZA 3KADA 3ARPA 2ZQUA 5HKGA 2XP6A 4JFLA 2FAPA 1LQ0A 3O5DA 3KAFA 3IKDA 4KR0B 2L2SA 5DF0A 1EHNA 3ALFA 4BF8A 4DZ3A 4ZPVR 1D6OA 4WIWA 5HBFA 2XP3A 1K9TA 2XP5A 4W9PA 4ML4A 1WNOA 4ITZA 2Q5AA 1H0IA 1NWUA 3O5PA 3TDBA 3G6MA 4LAVA 1EQ3A 4J4NA 4ODKA 4W5UA 4TW7A 2LPVA 4ODOA 4GGQA 3O5JA 2DSUA 1M5YA 4DRMA 4DRIA 3WL0A 2DT1A 1FFRA 4MGVA 1T11A 1CTNA 4IPXA 4DIPA 3CZ8A 1JVWA 5GQBA 4DH0A 1FJDA 3GPKA 3NRKA 4S3KA 1NH6A 2JZVA 3AS2A 1QZ2A 3PRBA 1ZL1A 4IT6A 2XPBA 1FD9A 4DRHA 2F2DA 3I6CA 1L1PA 4DRJA 3CHDA 2LKNA 5HW8A 4L72B 1O6IA 3O5IA 4DRKA 4PTMA 2RSEA 1D7JA 2PN0A 4QZVB 3B9DA 1J6YA 1ZBWA 3W4RA 3OA5A 3WD2A 4Z2KA 2DT2A 3KAGA 5DO2A 1LL7A 4P8VA 2G8ZA 3MDYB 4FN2A 3WIJA 5DIVA 2DG9A 1D7HA 2Y78A 1W9UA 3B8SA 1GUVA 4Z2LA 4MTVA 3OOBA 4ODPA 4JFJA 4G2PA 4DWSA 4Z2JA 3FXYA 1YATA 1TCOC 3ARRA 4TNSA 3UQIA 2ZQSA 3KZ7A 2XP4A 1KFWA 2MPHA 2IUZA 1HKKA 1W1TA 4JFMA 1FKGA 1PINA 2YBTA 3O5MA 3O5EA 3RM4A 4TW6A 2N87A 3UQAA 1ZBKA 4P8WA 1ROTA 4WKHA 2PV3A 1F8AB 3IHZA 3FAPA 4FAPA 2DSZA 1SYTA 2RURA 4Z2IA 1EDQA 4MNMA 2PPOA 4MPKA 1FKKA 3GTYX 4DROA 2PV2A 1TFVA 2WLZA 1ROUA 3WD4A 4ZPTR 3QOKA 5HWBA 3JYMA 4R0XA 5JH8A 3O5GA 4MAVA 3TCZA 3UI6A 3O5RA 2WM0A 5HTGA 4URIA 4DRPA 4ODLA 4QIBA 3RM9A 2MNTA 2KGJA 3WD1A 1OWQA 5HW7A 2KR7A 1W26A 1NMVA 4O2TA 3AQUA 1Q1CA 3KAHA 4ODQA 3WL1A 1JCHB 2XP9A 2ESCA 1B6CA 2M08A 4WJXA 3RMEA 1FKHA 3EY6A 1JNEA 2ETNA 2G41A 1GRJA 1HJXA 2RUCA 2A3BA 2ZR5A 1LJYA 2A3EA 2MLZA 3B9AA 1R9HA 2OFNA 3B9EA 3CHFA 4ZS6A 1KT0A 3ARYA 4Q22A 2KE0A 3RFWA 4AY1A 3BXWA 1WAWA 1NWRA 2DT3A 2O92A 5J6EA 1P5QA 2DSWA 3PRAA 1Y0OA 2MLYA 2MF9A 3RM8A 4ODMA 1LL4A 4KQZA 1JNTA 2WLYA 4XAKA 3ALGA 3LUOA 2DT0A 1XHGA 4LAYA 4U84A 3ARVA 3O5OA 2A3AA 1ZB5A 1E15A 4HARA 1J4IA 1W1YA 5GPRA 1A7XA 1Q6IA 4QT2A 3ODKA 1UR9A 3ARZA 1HKIA 4TW8A 2FKEA 2VCDA 3CGMA 1FKIA 4P8XA 4HBEA 2F21A 1ZK6A 2M2AA 3CH9A 2XPAA 2LGOA 4HBOA 3PA7A 3GU0A 3CHEA 1W9PA 1QPLA 1LL6A 2ZQVA 1PBKA 2P4VA 2K8IA 1ZBVA 5DEZA 2KI3A 1EYMA 3NTPA 2PI6A 1ZU8A 5HT1A 3H9RB 2RUDA 3AROA 1FKFA 2ZR4A 3KACA 1YW5A 1X6NA 1J4HA 3KABA 2ZR6A 1OGBA 4IQ2A 4S3JA 1X6LA 2D9FA 3RGCA 2YBUA 1ZBCA 2RUQA 4Z2HA 3IKGA 3ARQA 1NWTA 1BL4A 4Z2GA 2O9OA 4ODRA 3KAIA 5GPGA 1SR0A 3O5QA 2PPPA 3WD3A 4MNJA 1JNDA 1HKMA 4TYOA 2XP8A 3FY1A 2MLXA 1F40A 3CHCA 4C02B 1FKJA 1E6NA 3IK8A 4P8UA 1ZCNA 4J4OA 1WB0A
chains in the Genus database with same CATH topology
1FAPA 1HKJA 5DITA 5DIUA 3JYJA 2DPEA 1FKDA 2M1IA 4MNLA 3WQVA 1FKRA 4JYSA 2KO7A 1UR8A 3G6LA 1JNSA 1HJVA 5I98A 4U85A 3ARUA 2OLHA 3UI4A 1OGGA 3JXVA 2KFWA 2F4EA 3B7XA 4GIVA 4DZ2A 2FDMA 3NI6A 1FKTA 3AS0A 3ARTA 4DWSC 2AOSA 1KT1A 1D2KA 4IT4A 1XRVA 3AS3A 4WK9A 1N1AA 1E6RA 4NNRA 3O5LA 5D75A 3WH0A 1LG2A 3UF8A 3WQWA 3WKZA 5HUAA 3O5KA 3CGNA 4DT4A 3ARSA 3VAWA 4JFIA 2PV1A 4N19A 1Q6UA 5BXJA 3PR9A 1HXVA 2RQSA 1LG1A 1GPFA 4LAXA 3ARXA 3UI5A 3WD0A 4L3NA 1VF8A 4DWSD 4NSBA 1IX5A 1HJWA 4ODNA 4ZPWR 4DWSB 5HW6A 3TC5A 1FKLA 1Q6HA 4DRQA 4NZCA 1NSGA 2LJ4A 2UZ5A 2A3CA 2DG3A 4JFKA 1FKSA 4Q7NA 2VN1A 2AWGA 2DG4A 1QPFA 1NWSA 1D7IA 2ZQTA 3UQBA 1FFQA 4LAWA 4LGXA 2B31A 4TX0A 4W9QA 2XP7A 1W9VA 3KCEA 4G50A 3PRDA 1W1PA 4MSPA 1EIBA 1ITXA 4R5EA 1H0GA 4WKAA 2QF8A 3ARWA 1FKBA 5HWCA 2ITKA 4U86A 5B8IC 1J4RA 4MNKA 1NMWA 1GOIA 4WKFA 1BKFA 4DRNA 2PPNA 1C9HA 2PBCA 2DSVA 3O5FA 2IF4A 4W9OA 4IQCA 1E6PA 1RD6A 3AS1A 1W1VA 2WK2A 1E9LA 4QT3A 1U79A 1E6ZA 3KADA 3ARPA 2ZQUA 5HKGA 2XP6A 4JFLA 2FAPA 1LQ0A 3O5DA 3KAFA 3IKDA 4KR0B 2L2SA 5DF0A 1EHNA 3ALFA 4BF8A 4DZ3A 4ZPVR 1D6OA 4WIWA 5HBFA 2XP3A 1K9TA 2XP5A 4W9PA 4ML4A 1WNOA 4ITZA 2Q5AA 1H0IA 1NWUA 3O5PA 3TDBA 3G6MA 4LAVA 1EQ3A 4J4NA 4ODKA 4W5UA 4TW7A 2LPVA 4ODOA 4GGQA 3O5JA 2DSUA 1M5YA 4DRMA 4DRIA 3WL0A 2DT1A 1FFRA 4MGVA 1T11A 1CTNA 4IPXA 4DIPA 3CZ8A 1JVWA 5GQBA 4DH0A 1FJDA 3GPKA 3NRKA 4S3KA 1NH6A 2JZVA 3AS2A 1QZ2A 3PRBA 1ZL1A 4IT6A 2XPBA 1FD9A 4DRHA 2F2DA 3I6CA 1L1PA 4DRJA 3CHDA 2LKNA 5HW8A 4L72B 1O6IA 3O5IA 4DRKA 4PTMA 2RSEA 1D7JA 4QZVB 3B9DA 1J6YA 1ZBWA 3W4RA 3OA5A 3WD2A 4Z2KA 2DT2A 3KAGA 5DO2A 1LL7A 4P8VA 2G8ZA 3MDYB 4FN2A 3WIJA 5DIVA 2DG9A 1D7HA 2Y78A 1W9UA 3B8SA 1GUVA 4Z2LA 4MTVA 3OOBA 4ODPA 4JFJA 4G2PA 4DWSA 4Z2JA 3FXYA 1YATA 1TCOC 3ARRA 4TNSA 3UQIA 2ZQSA 3KZ7A 2XP4A 1KFWA 2MPHA 2IUZA 1HKKA 1W1TA 4JFMA 1FKGA 1PINA 2YBTA 3O5MA 3O5EA 3RM4A 4TW6A 2N87A 3UQAA 1ZBKA 4P8WA 1ROTA 4WKHA 2PV3A 1F8AB 3IHZA 3FAPA 4FAPA 2DSZA 1SYTA 2RURA 4Z2IA 1EDQA 4MNMA 2PPOA 4MPKA 1FKKA 4DROA 2PV2A 1TFVA 2WLZA 1ROUA 3WD4A 4ZPTR 3QOKA 5HWBA 3JYMA 4R0XA 5JH8A 3O5GA 4MAVA 3TCZA 3UI6A 3O5RA 2WM0A 5HTGA 4URIA 4DRPA 4ODLA 4QIBA 3RM9A 2MNTA 2KGJA 3WD1A 1OWQA 5HW7A 2KR7A 1W26A 1NMVA 4O2TA 3AQUA 1Q1CA 3KAHA 4ODQA 3WL1A 2XP9A 2ESCA 1B6CA 2M08A 4WJXA 3RMEA 1FKHA 3EY6A 1JNEA 2G41A 1HJXA 2RUCA 2A3BA 2ZR5A 1LJYA 2A3EA 2MLZA 3B9AA 1R9HA 2OFNA 3B9EA 3CHFA 4ZS6A 1KT0A 3ARYA 4Q22A 2KE0A 3RFWA 4AY1A 3BXWA 1WAWA 1NWRA 2DT3A 2O92A 5J6EA 1P5QA 2DSWA 3PRAA 1Y0OA 2MLYA 2MF9A 3RM8A 4ODMA 1LL4A 4KQZA 1JNTA 2WLYA 4XAKA 3ALGA 3LUOA 2DT0A 1XHGA 4LAYA 4U84A 3ARVA 3O5OA 2A3AA 1ZB5A 1E15A 4HARA 1J4IA 1W1YA 5GPRA 1A7XA 1Q6IA 4QT2A 3ODKA 1UR9A 3ARZA 1HKIA 4TW8A 2FKEA 2VCDA 3CGMA 1FKIA 4P8XA 4HBEA 2F21A 1ZK6A 2M2AA 3CH9A 2XPAA 2LGOA 4HBOA 3PA7A 3CHEA 1W9PA 1QPLA 1LL6A 2ZQVA 1PBKA 2K8IA 1ZBVA 5DEZA 2KI3A 1EYMA 3NTPA 2PI6A 1ZU8A 5HT1A 3H9RB 2RUDA 3AROA 1FKFA 2ZR4A 3KACA 1YW5A 1X6NA 1J4HA 3KABA 2ZR6A 1OGBA 4IQ2A 4S3JA 1X6LA 2D9FA 3RGCA 2YBUA 1ZBCA 2RUQA 4Z2HA 3IKGA 3ARQA 1NWTA 1BL4A 4Z2GA 2O9OA 4ODRA 3KAIA 5GPGA 1SR0A 3O5QA 2PPPA 3WD3A 4MNJA 1JNDA 1HKMA 4TYOA 2XP8A 3FY1A 2MLXA 1F40A 3CHCA 4C02B 1FKJA 1E6NA 3IK8A 4P8UA 1ZCNA 4J4OA 1WB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAP A;  2KE0 A;  3RFW A;  3KAG A;  1FKB A;  5DIT A;  5J6E A;  5HWC A;  1P5Q A;  2ITK A;  3MDY B;  4U86 A;  4FN2 A;  5B8I C;  5DIU A;  3JYJ A;  1J4R A;  1Y0O A;  1FKD A;  5DIV A;  2M1I A;  2MLY A;  2DG9 A;  2MF9 A;  4ODM A;  1NMW A;  1FKR A;  1JNT A;  1D7H A;  2Y78 A;  2KO7 A;  4JYS A;  1BKF A;  4DRN A;  3LUO A;  2PPN A;  1C9H A;  2PBC A;  3OOB A;  4LAY A;  4ODP A;  4U84 A;  1JNS A;  4JFJ A;  3O5O A;  4G2P A;  5I98 A;  3O5F A;  4U85 A;  2IF4 A;  4W9O A;  1YAT A;  1J4I A;  3UI4 A;  1TCO C;  3JXV A;  2KFW A;  4IQC A;  1A7X A;  2F4E A;  3B7X A;  1Q6I A;  4TNS A;  4GIV A;  3UQI A;  4DZ2 A;  2ZQS A;  3NI6 A;  1FKT A;  3KZ7 A;  4QT3 A;  1U79 A;  2XP4 A;  4QT2 A;  2MPH A;  3ODK A;  1KT1 A;  3KAD A;  2ZQU A;  4JFM A;  2FKE A;  1FKG A;  1PIN A;  2VCD A;  3CGM A;  2XP6 A;  1N1A A;  4JFL A;  5HKG A;  3O5M A;  3O5E A;  2FAP A;  4TW6 A;  1FKI A;  2N87 A;  4NNR A;  3O5D A;  3O5L A;  5D75 A;  3KAF A;  3IKD A;  3UQA A;  1ROT A;  2PV3 A;  1F8A B;  2F21 A;  3IHZ A;  3WH0 A;  3FAP A;  4FAP A;  2L2S A;  1ZK6 A;  2M2A A;  3UF8 A;  2RUR A;  4BF8 A;  5HUA A;  2XPA A;  3CGN A;  3O5K A;  4DZ3 A;  2LGO A;  4DT4 A;  1D6O A;  3PA7 A;  2PPO A;  1FKK A;  3VAW A;  2XP3 A;  4JFI A;  4DRO A;  2PV2 A;  2PV1 A;  1QPL A;  2XP5 A;  1ROU A;  1Q6U A;  2ZQV A;  4N19 A;  1PBK A;  4W9P A;  5BXJ A;  5HWB A;  3JYM A;  4ITZ A;  1HXV A;  2K8I A;  2RQS A;  2Q5A A;  4R0X A;  2KI3 A;  3O5G A;  4LAX A;  1EYM A;  3UI5 A;  3NTP A;  3TCZ A;  3UI6 A;  3O5R A;  3O5P A;  3TDB A;  5HTG A;  4LAV A;  1EQ3 A;  4DRP A;  4J4N A;  4ODK A;  4ODL A;  4TW7 A;  2LPV A;  4ODO A;  4QIB A;  4GGQ A;  2MNT A;  3H9R B;  3O5J A;  2RUD A;  2KGJ A;  4ODN A;  1FKF A;  1M5Y A;  2ZR4 A;  3KAC A;  4DRM A;  1YW5 A;  4DRI A;  5HW7 A;  1J4H A;  5HW6 A;  3KAB A;  3TC5 A;  2ZR6 A;  4MGV A;  1FKL A;  1Q6H A;  4DRQ A;  4IQ2 A;  4TW8 A;  2KR7 A;  1T11 A;  1W26 A;  2D9F A;  1NMV A;  4IPX A;  4O2T A;  4DIP A;  3RGC A;  2RUQ A;  1JVW A;  3IKG A;  1Q1C A;  1NSG A;  2LJ4 A;  4DH0 A;  1FJD A;  3KAH A;  3GPK A;  2UZ5 A;  4ODQ A;  2XP9 A;  1BL4 A;  3NRK A;  1B6C A;  4ODR A;  3KAI A;  2DG3 A;  4JFK A;  5GPG A;  2M08 A;  1FKS A;  2JZV A;  3O5Q A;  1QZ2 A;  1FKH A;  3EY6 A;  2PPP A;  3PRB A;  5HT1 A;  2VN1 A;  2AWG A;  2XPB A;  1FD9 A;  2DG4 A;  4DRH A;  2F2D A;  1QPF A;  4TYO A;  1D7I A;  2ZQT A;  2RUC A;  3I6C A;  3UQB A;  1L1P A;  4LAW A;  4DRJ A;  2LKN A;  2XP8 A;  5HW8 A;  2ZR5 A;  2MLX A;  4TX0 A;  4W9Q A;  2MLZ A;  1F40 A;  1R9H A;  2OFN A;  3O5I A;  4DRK A;  4C02 B;  2XP7 A;  1FKJ A;  2RSE A;  1D7J A;  3IK8 A;  1KT0 A;  3KCE A;  3PRD A;  4G50 A;  1ZCN A;  1J6Y A;  4MSP A;  4J4O A; 
#chains in the Genus database with same CATH topology
 1FAP A;  1HKJ A;  5DIT A;  5DIU A;  3JYJ A;  2DPE A;  1FKD A;  2M1I A;  4MNL A;  3WQV A;  1FKR A;  4JYS A;  2KO7 A;  1UR8 A;  3G6L A;  1JNS A;  1HJV A;  5I98 A;  2F23 A;  3ARU A;  4U85 A;  2OLH A;  3UI4 A;  1OGG A;  3JXV A;  2KFW A;  2F4E A;  3B7X A;  4GIV A;  4DZ2 A;  2FDM A;  3NI6 A;  1FKT A;  3AS0 A;  3ART A;  4DWS C;  2AOS A;  1KT1 A;  1D2K A;  4IT4 A;  1XRV A;  3AS3 A;  4WK9 A;  1N1A A;  3EIP A;  1E6R A;  4NNR A;  3BMB A;  3O5L A;  5D75 A;  3WH0 A;  2EUL A;  1LG2 A;  3UF8 A;  3WQW A;  3WKZ A;  5HUA A;  3O5K A;  3CGN A;  4DT4 A;  3ARS A;  3VAW A;  4JFI A;  2PV1 A;  4N19 A;  1Q6U A;  5BXJ A;  3PR9 A;  1HXV A;  2RQS A;  1LG1 A;  1GPF A;  4LAX A;  3ARX A;  3UI5 A;  3WD0 A;  4L3N A;  1VF8 A;  4DWS D;  4NSB A;  1IX5 A;  1HJW A;  4ODN A;  4ZPW R;  4DWS B;  5HW6 A;  3TC5 A;  1FKL A;  1Q6H A;  4DRQ A;  4NZC A;  1NSG A;  2LJ4 A;  2UZ5 A;  2A3C A;  2DG3 A;  4JFK A;  1FKS A;  4Q7N A;  2VN1 A;  2AWG A;  1E44 A;  2DG4 A;  1QPF A;  1NWS A;  1D7I A;  2ZQT A;  3UQB A;  1FFQ A;  4LAW A;  4LGX A;  2B31 A;  4TX0 A;  4W9Q A;  2XP7 A;  1W9V A;  3KCE A;  4G50 A;  3PRD A;  1W1P A;  4MSP A;  1EIB A;  1ITX A;  4R5E A;  1H0G A;  4WKA A;  2QF8 A;  3ARW A;  1FKB A;  4UDM A;  5HWC A;  2ITK A;  4U86 A;  5B8I C;  1J4R A;  4MNK A;  1NMW A;  1GOI A;  4WKF A;  1BKF A;  4DRN A;  2PPN A;  1C9H A;  2PBC A;  2B5U B;  2DSV A;  3O5F A;  2IF4 A;  4W9O A;  4IQC A;  1E6P A;  1RD6 A;  3AS1 A;  1W1V A;  2WK2 A;  1E9L A;  4QT3 A;  1U79 A;  1E6Z A;  3KAD A;  3ARP A;  2ZQU A;  5HKG A;  2XP6 A;  4JFL A;  2FAP A;  1LQ0 A;  3O5D A;  3KAF A;  3IKD A;  4KR0 B;  2L2S A;  5DF0 A;  1EHN A;  3ALF A;  4BF8 A;  4DZ3 A;  4ZPV R;  1D6O A;  4WIW A;  5HBF A;  2XP3 A;  1K9T A;  2XP5 A;  4W9P A;  4ML4 A;  1WNO A;  4ITZ A;  2Q5A A;  1H0I A;  1NWU A;  3O5P A;  3TDB A;  3G6M A;  4LAV A;  1EQ3 A;  4J4N A;  4ODK A;  4W5U A;  4TW7 A;  2LPV A;  4ODO A;  4GGQ A;  3O5J A;  2DSU A;  1M5Y A;  4DRM A;  4DRI A;  3WL0 A;  2DT1 A;  1FFR A;  4MGV A;  1T11 A;  1CTN A;  4IPX A;  4DIP A;  3CZ8 A;  1JVW A;  5GQB A;  4DH0 A;  1FJD A;  3GPK A;  3NRK A;  4S3K A;  1NH6 A;  2JZV A;  3AS2 A;  1QZ2 A;  3PRB A;  1ZL1 A;  4IT6 A;  2XPB A;  1FD9 A;  4DRH A;  2F2D A;  3I6C A;  1L1P A;  4DRJ A;  3CHD A;  2LKN A;  5HW8 A;  4L72 B;  1O6I A;  3O5I A;  4DRK A;  4PTM A;  2RSE A;  1D7J A;  2PN0 A;  4QZV B;  3B9D A;  1J6Y A;  1ZBW A;  3W4R A;  3OA5 A;  3WD2 A;  4Z2K A;  2DT2 A;  3KAG A;  5DO2 A;  1LL7 A;  4P8V A;  2G8Z A;  3MDY B;  4FN2 A;  3WIJ A;  5DIV A;  2DG9 A;  1D7H A;  2Y78 A;  1W9U A;  3B8S A;  1GUV A;  4Z2L A;  4MTV A;  3OOB A;  4ODP A;  4JFJ A;  4G2P A;  4DWS A;  4Z2J A;  3FXY A;  1YAT A;  1TCO C;  3ARR A;  4TNS A;  3UQI A;  2ZQS A;  3KZ7 A;  2XP4 A;  1KFW A;  2MPH A;  2IUZ A;  1HKK A;  1W1T A;  4JFM A;  1FKG A;  1PIN A;  2YBT A;  3O5M A;  3O5E A;  3RM4 A;  4TW6 A;  2N87 A;  3UQA A;  1ZBK A;  4P8W A;  1ROT A;  4WKH A;  2PV3 A;  1F8A B;  3IHZ A;  3FAP A;  4FAP A;  2DSZ A;  1SYT A;  2RUR A;  4Z2I A;  1EDQ A;  4MNM A;  2PPO A;  4MPK A;  1FKK A;  3GTY X;  4DRO A;  2PV2 A;  1TFV A;  2WLZ A;  1ROU A;  3WD4 A;  4ZPT R;  3QOK A;  5HWB A;  3JYM A;  4R0X A;  5JH8 A;  3O5G A;  4MAV A;  3TCZ A;  3UI6 A;  3O5R A;  2WM0 A;  5HTG A;  4URI A;  4DRP A;  4ODL A;  4QIB A;  3RM9 A;  2MNT A;  2KGJ A;  3WD1 A;  1OWQ A;  5HW7 A;  2KR7 A;  1W26 A;  1NMV A;  4O2T A;  3AQU A;  1Q1C A;  3KAH A;  4ODQ A;  3WL1 A;  1JCH B;  2XP9 A;  2ESC A;  1B6C A;  2M08 A;  4WJX A;  3RME A;  1FKH A;  3EY6 A;  1JNE A;  2ETN A;  2G41 A;  1GRJ A;  1HJX A;  2RUC A;  2A3B A;  2ZR5 A;  1LJY A;  2A3E A;  2MLZ A;  3B9A A;  1R9H A;  2OFN A;  3B9E A;  3CHF A;  4ZS6 A;  1KT0 A;  3ARY A;  4Q22 A;  2KE0 A;  3RFW A;  4AY1 A;  3BXW A;  1WAW A;  1NWR A;  2DT3 A;  2O92 A;  5J6E A;  1P5Q A;  2DSW A;  3PRA A;  1Y0O A;  2MLY A;  2MF9 A;  3RM8 A;  4ODM A;  1LL4 A;  4KQZ A;  1JNT A;  2WLY A;  4XAK A;  3ALG A;  3LUO A;  2DT0 A;  1XHG A;  4LAY A;  4U84 A;  3ARV A;  3O5O A;  2A3A A;  1ZB5 A;  1E15 A;  4HAR A;  1J4I A;  1W1Y A;  5GPR A;  1A7X A;  1Q6I A;  4QT2 A;  3ODK A;  1UR9 A;  3ARZ A;  1HKI A;  4TW8 A;  2FKE A;  2VCD A;  3CGM A;  1FKI A;  4P8X A;  4HBE A;  2F21 A;  1ZK6 A;  2M2A A;  3CH9 A;  2XPA A;  2LGO A;  4HBO A;  3PA7 A;  3GU0 A;  3CHE A;  1W9P A;  1QPL A;  1LL6 A;  2ZQV A;  1PBK A;  2P4V A;  2K8I A;  1ZBV A;  5DEZ A;  2KI3 A;  1EYM A;  3NTP A;  2PI6 A;  1ZU8 A;  5HT1 A;  3H9R B;  2RUD A;  3ARO A;  1FKF A;  2ZR4 A;  3KAC A;  1YW5 A;  1X6N A;  1J4H A;  3KAB A;  2ZR6 A;  1OGB A;  4IQ2 A;  4S3J A;  1X6L A;  2D9F A;  3RGC A;  2YBU A;  1ZBC A;  2RUQ A;  4Z2H A;  3IKG A;  3ARQ A;  1NWT A;  1BL4 A;  4Z2G A;  2O9O A;  4ODR A;  3KAI A;  5GPG A;  1SR0 A;  3O5Q A;  2PPP A;  3WD3 A;  4MNJ A;  1JND A;  1HKM A;  4TYO A;  2XP8 A;  3FY1 A;  2MLX A;  1F40 A;  3CHC A;  4C02 B;  1FKJ A;  1E6N A;  3IK8 A;  4P8U A;  1ZCN A;  4J4O A;  1WB0 A; 
#chains in the Genus database with same CATH homology
 1FAP A;  1HKJ A;  5DIT A;  5DIU A;  3JYJ A;  2DPE A;  1FKD A;  2M1I A;  4MNL A;  3WQV A;  1FKR A;  4JYS A;  2KO7 A;  1UR8 A;  3G6L A;  1JNS A;  1HJV A;  5I98 A;  4U85 A;  3ARU A;  2OLH A;  3UI4 A;  1OGG A;  3JXV A;  2KFW A;  2F4E A;  3B7X A;  4GIV A;  4DZ2 A;  2FDM A;  3NI6 A;  1FKT A;  3AS0 A;  3ART A;  4DWS C;  2AOS A;  1KT1 A;  1D2K A;  4IT4 A;  1XRV A;  3AS3 A;  4WK9 A;  1N1A A;  1E6R A;  4NNR A;  3O5L A;  5D75 A;  3WH0 A;  1LG2 A;  3UF8 A;  3WQW A;  3WKZ A;  5HUA A;  3O5K A;  3CGN A;  4DT4 A;  3ARS A;  3VAW A;  4JFI A;  2PV1 A;  4N19 A;  1Q6U A;  5BXJ A;  3PR9 A;  1HXV A;  2RQS A;  1LG1 A;  1GPF A;  4LAX A;  3ARX A;  3UI5 A;  3WD0 A;  4L3N A;  1VF8 A;  4DWS D;  4NSB A;  1IX5 A;  1HJW A;  4ODN A;  4ZPW R;  4DWS B;  5HW6 A;  3TC5 A;  1FKL A;  1Q6H A;  4DRQ A;  4NZC A;  1NSG A;  2LJ4 A;  2UZ5 A;  2A3C A;  2DG3 A;  4JFK A;  1FKS A;  4Q7N A;  2VN1 A;  2AWG A;  2DG4 A;  1QPF A;  1NWS A;  1D7I A;  2ZQT A;  3UQB A;  1FFQ A;  4LAW A;  4LGX A;  2B31 A;  4TX0 A;  4W9Q A;  2XP7 A;  1W9V A;  3KCE A;  4G50 A;  3PRD A;  1W1P A;  4MSP A;  1EIB A;  1ITX A;  4R5E A;  1H0G A;  4WKA A;  2QF8 A;  3ARW A;  1FKB A;  5HWC A;  2ITK A;  4U86 A;  5B8I C;  1J4R A;  4MNK A;  1NMW A;  1GOI A;  4WKF A;  1BKF A;  4DRN A;  2PPN A;  1C9H A;  2PBC A;  2DSV A;  3O5F A;  2IF4 A;  4W9O A;  4IQC A;  1E6P A;  1RD6 A;  3AS1 A;  1W1V A;  2WK2 A;  1E9L A;  4QT3 A;  1U79 A;  1E6Z A;  3KAD A;  3ARP A;  2ZQU A;  5HKG A;  2XP6 A;  4JFL A;  2FAP A;  1LQ0 A;  3O5D A;  3KAF A;  3IKD A;  4KR0 B;  2L2S A;  5DF0 A;  1EHN A;  3ALF A;  4BF8 A;  4DZ3 A;  4ZPV R;  1D6O A;  4WIW A;  5HBF A;  2XP3 A;  1K9T A;  2XP5 A;  4W9P A;  4ML4 A;  1WNO A;  4ITZ A;  2Q5A A;  1H0I A;  1NWU A;  3O5P A;  3TDB A;  3G6M A;  4LAV A;  1EQ3 A;  4J4N A;  4ODK A;  4W5U A;  4TW7 A;  2LPV A;  4ODO A;  4GGQ A;  3O5J A;  2DSU A;  1M5Y A;  4DRM A;  4DRI A;  3WL0 A;  2DT1 A;  1FFR A;  4MGV A;  1T11 A;  1CTN A;  4IPX A;  4DIP A;  3CZ8 A;  1JVW A;  5GQB A;  4DH0 A;  1FJD A;  3GPK A;  3NRK A;  4S3K A;  1NH6 A;  2JZV A;  3AS2 A;  1QZ2 A;  3PRB A;  1ZL1 A;  4IT6 A;  2XPB A;  1FD9 A;  4DRH A;  2F2D A;  3I6C A;  1L1P A;  4DRJ A;  3CHD A;  2LKN A;  5HW8 A;  4L72 B;  1O6I A;  3O5I A;  4DRK A;  4PTM A;  2RSE A;  1D7J A;  4QZV B;  3B9D A;  1J6Y A;  1ZBW A;  3W4R A;  3OA5 A;  3WD2 A;  4Z2K A;  2DT2 A;  3KAG A;  5DO2 A;  1LL7 A;  4P8V A;  2G8Z A;  3MDY B;  4FN2 A;  3WIJ A;  5DIV A;  2DG9 A;  1D7H A;  2Y78 A;  1W9U A;  3B8S A;  1GUV A;  4Z2L A;  4MTV A;  3OOB A;  4ODP A;  4JFJ A;  4G2P A;  4DWS A;  4Z2J A;  3FXY A;  1YAT A;  1TCO C;  3ARR A;  4TNS A;  3UQI A;  2ZQS A;  3KZ7 A;  2XP4 A;  1KFW A;  2MPH A;  2IUZ A;  1HKK A;  1W1T A;  4JFM A;  1FKG A;  1PIN A;  2YBT A;  3O5M A;  3O5E A;  3RM4 A;  4TW6 A;  2N87 A;  3UQA A;  1ZBK A;  4P8W A;  1ROT A;  4WKH A;  2PV3 A;  1F8A B;  3IHZ A;  3FAP A;  4FAP A;  2DSZ A;  1SYT A;  2RUR A;  4Z2I A;  1EDQ A;  4MNM A;  2PPO A;  4MPK A;  1FKK A;  4DRO A;  2PV2 A;  1TFV A;  2WLZ A;  1ROU A;  3WD4 A;  4ZPT R;  3QOK A;  5HWB A;  3JYM A;  4R0X A;  5JH8 A;  3O5G A;  4MAV A;  3TCZ A;  3UI6 A;  3O5R A;  2WM0 A;  5HTG A;  4URI A;  4DRP A;  4ODL A;  4QIB A;  3RM9 A;  2MNT A;  2KGJ A;  3WD1 A;  1OWQ A;  5HW7 A;  2KR7 A;  1W26 A;  1NMV A;  4O2T A;  3AQU A;  1Q1C A;  3KAH A;  4ODQ A;  3WL1 A;  2XP9 A;  2ESC A;  1B6C A;  2M08 A;  4WJX A;  3RME A;  1FKH A;  3EY6 A;  1JNE A;  2G41 A;  1HJX A;  2RUC A;  2A3B A;  2ZR5 A;  1LJY A;  2A3E A;  2MLZ A;  3B9A A;  1R9H A;  2OFN A;  3B9E A;  3CHF A;  4ZS6 A;  1KT0 A;  3ARY A;  4Q22 A;  2KE0 A;  3RFW A;  4AY1 A;  3BXW A;  1WAW A;  1NWR A;  2DT3 A;  2O92 A;  5J6E A;  1P5Q A;  2DSW A;  3PRA A;  1Y0O A;  2MLY A;  2MF9 A;  3RM8 A;  4ODM A;  1LL4 A;  4KQZ A;  1JNT A;  2WLY A;  4XAK A;  3ALG A;  3LUO A;  2DT0 A;  1XHG A;  4LAY A;  4U84 A;  3ARV A;  3O5O A;  2A3A A;  1ZB5 A;  1E15 A;  4HAR A;  1J4I A;  1W1Y A;  5GPR A;  1A7X A;  1Q6I A;  4QT2 A;  3ODK A;  1UR9 A;  3ARZ A;  1HKI A;  4TW8 A;  2FKE A;  2VCD A;  3CGM A;  1FKI A;  4P8X A;  4HBE A;  2F21 A;  1ZK6 A;  2M2A A;  3CH9 A;  2XPA A;  2LGO A;  4HBO A;  3PA7 A;  3CHE A;  1W9P A;  1QPL A;  1LL6 A;  2ZQV A;  1PBK A;  2K8I A;  1ZBV A;  5DEZ A;  2KI3 A;  1EYM A;  3NTP A;  2PI6 A;  1ZU8 A;  5HT1 A;  3H9R B;  2RUD A;  3ARO A;  1FKF A;  2ZR4 A;  3KAC A;  1YW5 A;  1X6N A;  1J4H A;  3KAB A;  2ZR6 A;  1OGB A;  4IQ2 A;  4S3J A;  1X6L A;  2D9F A;  3RGC A;  2YBU A;  1ZBC A;  2RUQ A;  4Z2H A;  3IKG A;  3ARQ A;  1NWT A;  1BL4 A;  4Z2G A;  2O9O A;  4ODR A;  3KAI A;  5GPG A;  1SR0 A;  3O5Q A;  2PPP A;  3WD3 A;  4MNJ A;  1JND A;  1HKM A;  4TYO A;  2XP8 A;  3FY1 A;  2MLX A;  1F40 A;  3CHC A;  4C02 B;  1FKJ A;  1E6N A;  3IK8 A;  4P8U A;  1ZCN A;  4J4O A;  1WB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...