1J6YA

Solution structure of pin1at from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
HMASRDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords peptidyl-prolyl cis-trans isomerase
publication title Solution Structure of the Single-domain Prolyl Cis/Trans Isomerase PIN1At from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 17
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j6yA00
1FD9A 3TCZA 3KADA 3MDYB 1EQ3A 1BKFA 2ZR5A 1D7IA 2PV1A 1ZK6A 2F21A 2M2AA 5HKGA 1NMWA 1J4IA 2RUDA 3ODKA 4DH0A 4DROA 3O5JA 1Q1CA 2ZR6A 3UI4A 1F8AB 2DG4A 2N87A 4GGQA 1KT0A 1FKJA 2LPVA 2XP7A 1ZCNA 4DZ3A 5HW6A 4DRPA 3JYMA 5HW8A 2K8IA 1PINA 4ODMA 1QPLA 1QZ2A 4ODPA 2LKNA 4DIPA 3UQIA 3KZ7A 1FAPA 2ITKA 3IKGA 2D9FA 4QT3A 1J4RA 1JNSA 2IF4A 2PV3A 1YW5A 2KE0A 2XP4A 4JFJA 4ODRA 1J6YA 4JFIA 3UQBA 3UI6A 2RURA 2PBCA 3PRDA 1D6OA 3IK8A 4DRIA 5HWCA 2MPHA 4IQCA 3KAHA 4DRMA 3PRBA 2MLXA 3JXVA 4W9PA 1NMVA 4DRKA 1Q6HA 2ZQSA 2PPOA 1Q6IA 3KABA 2MF9A 4TW6A 4W9OA 1FKFA 2XP6A 4TYOA 1YATA 5DITA 4ODLA 4QIBA 1Y0OA 2L2SA 2RUCA 3NRKA 5HTGA 2FAPA 1PBKA 2ZR4A 4MSPA 4DT4A 5B8IC 3CGNA 4U84A 4MGVA 4J4NA 5DIUA 1F40A 2KFWA 1TCOC 2AWGA 2PPPA 2LGOA 2PV2A 4IQ2A 2KO7A 1FKGA 2LJ4A 2M08A 2Y78A 2MNTA 3OOBA 1M5YA 4O2TA 5GPGA 5HT1A 4DRHA 1D7JA 2F4EA 3I6CA 3O5DA 1P5QA 1U79A 1FKKA 2VN1A 3IKDA 4JFKA 4TW7A 1J4HA 1Q6UA 2RSEA 2RQSA 3KAIA 2MLYA 4U86A 3UQAA 2OFNA 1L1PA 4JFMA 4LAXA 1FKBA 3O5OA 1EYMA 1A7XA 3RFWA 4ODKA 1BL4A 1T11A 5BXJA 2MLZA 2UZ5A 2XPAA 4TNSA 4U85A 3O5GA 3CGMA 4ODOA 4DRQA 3NI6A 5HUAA 1FKIA 1N1AA 4N19A 4R0XA 3UI5A 3TC5A 4LAVA 4LAYA 3RGCA 4ODNA 3O5IA 3LUOA 5DIVA 1FKRA 3WH0A 4LAWA 4DRNA 1FKTA 4DRJA 2RUQA 3O5RA 1D7HA 4DZ2A 2ZQTA 3IHZA 3B7XA 4TW8A 2JZVA 3KACA 3O5KA 5D75A 3O5PA 3GPKA 2KGJA 3NTPA 1FKHA 1JNTA 5HW7A 4J4OA 2FKEA 3O5EA 3O5MA 4FAPA 1ROTA 2XP9A 3O5LA 1W26A 1ROUA 1JVWA 5I98A 2F2DA 2KR7A 5J6EA 2Q5AA 3O5QA 1NSGA 4C02B 1R9HA 4FN2A 4NNRA 4G2PA 1FKLA 2KI3A 2XP8A 3H9RB 4IPXA 4QT2A 3KAGA 3VAWA 1FKDA 2ZQUA 2M1IA 3PA7A 1FKSA 2XP5A 3KAFA 4JFLA 1C9HA 4GIVA 3KCEA 1B6CA 1QPFA 3JYJA 4W9QA 3FAPA 3UF8A 2ZQVA 4G50A 3EY6A 1HXVA 4JYSA 4BF8A 5HWBA 4ITZA 1FJDA 4ODQA 1KT1A 2XPBA 3TDBA 2PPNA 2XP3A 3O5FA 2DG9A 4TX0A 2VCDA 2DG3A
chains in the Genus database with same CATH superfamily
3MDYB 3WD3A 1BKFA 2ZR5A 1D7IA 1NH6A 2F21A 2RUDA 1D2KA 3CHDA 4DH0A 3ARTA 2G41A 2ZR6A 3GTYX 1KT0A 1W1VA 1ZCNA 4DZ3A 1OWQA 3FY1A 1WNOA 4ODPA 2D9FA 1J4RA 2PV3A 4JFJA 1J6YA 3UQBA 3UI6A 3B9DA 1D6OA 3IK8A 2DPEA 4Z2LA 4W5UA 1CTNA 3ARVA 4TYOA 1E6RA 1Y0OA 2L2SA 2RUCA 1GPFA 1HKJA 3CGNA 5DIUA 4ODNA 2LGOA 4O2TA 2MNTA 5HT1A 1D7JA 2F4EA 3I6CA 1HJVA 1Q6UA 3CHFA 3UQAA 1L1PA 4JFMA 1HJWA 2DSZA 3RFWA 4Q7NA 5BXJA 1JNEA 3CGMA 4ODOA 3NI6A 4UDMA 1E6PA 1JCHB 3TC5A 3WD4A 4LAYA 4Z2IA 3RGCA 3CZ8A 1UR8A 4ZS6A 1JNDA 4LAWA 4DRNA 4DRJA 2QF8A 4DZ2A 2ZQTA 4P8WA 3B7XA 3O5PA 2YBTA 3AS0A 3O5LA 1W26A 5I98A 4HBOA 2KR7A 1HKKA 1OGGA 1NSGA 4HARA 4DWSD 4FN2A 2KI3A 4ML4A 3KAGA 1FKDA 2M1IA 1NWUA 3WQVA 4GIVA 1B6CA 3QOKA 3WL0A 2ZQVA 3RM4A 4BF8A 4ODQA 1GRJA 3ALGA 4XAKA 3ARRA 3O5KA 2DG3A 1ZL1A 1EQ3A 3ARPA 4Z2KA 2M2AA 5HKGA 2B5UB 4L3NA 4DROA 3O5JA 2N87A 3RM8A 1WAWA 2LPVA 2XP7A 5HW8A 2K8IA 1QPLA 3G6LA 1QZ2A 4DIPA 2LKNA 3KZ7A 2IF4A 1LQ0A 4MNLA 1VF8A 4DRIA 5HWCA 1H0IA 4MNJA 2MLXA 1SYTA 1Q6HA 4W9OA 1Q6IA 3KABA 1W1TA 4AY1A 1E44A 1X6NA 2DSWA 5HTGA 4P8XA 2FAPA 1PBKA 2DSUA 4IT6A 4MSPA 2WM0A 4Q22A 4J4NA 3WIJA 2KO7A 4Z2GA 4WKFA 5GPGA 1ZBCA 4HBEA 3IKDA 4JFKA 4LAXA 4KR0B 1HJXA 3O5OA 2DT0A 1TFVA 2IUZA 2MLZA 4MTVA 4TNSA 4U85A 3O5GA 4DRQA 4P8UA 4DWSB 5HUAA 1EHNA 4R0XA 1N1AA 4IT4A 3LUOA 4S3JA 4WKAA 3WH0A 2RUQA 4KQZA 5D75A 3B9EA 1XRVA 1K9TA 2KGJA 1FKHA 5HW7A 3AROA 3ARQA 4J4OA 2FKEA 1HKIA 4NZCA 2B31A 2G8ZA 3PR9A 4URIA 1GOIA 3G6MA 4P8VA 3WD2A 4G2PA 1FKLA 2XP8A 4QT2A 1HKMA 2ZQUA 4QZVB 1FFRA 3FAPA 3UF8A 2A3CA 1NWRA 4S3KA 3ARSA 3ARUA 1LG1A 4ZPVR 3O5FA 1FD9A 1LL4A 5DO2A 3TCZA 1ZK6A 4MAVA 4WK9A 1J4IA 3ODKA 4DWSA 1Q1CA 1LL6A 3UI4A 2PN0A 2DG4A 1FKJA 3ARZA 3OA5A 1E15A 4Z2JA 1PINA 1FFQA 4ODMA 1NWTA 3CH9A 3UQIA 1FAPA 1W1YA 2O9OA 2DT1A 4QT3A 3ARWA 3WD1A 4ODRA 2RURA 2PBCA 4MPKA 3KAHA 4DRMA 1KFWA 5DF0A 3JXVA 4W9PA 4LGXA 4DRKA 2ZQSA 2PPOA 2MF9A 2EULA 3RMEA 1WB0A 1GUVA 2OLHA 2A3EA 1ZBKA 3WD0A 1TCOC 1LG2A 2AWGA 2PPPA 2PV2A 3AQUA 4IPXA 4NSBA 2LJ4A 2M08A 3OOBA 4DRHA 1M5YA 4Z2HA 1P5QA 1U79A 3PRAA 3BMBA 1J4HA 2RSEA 3KAIA 2MLYA 4L72B 4U86A 1EYMA 2ESCA 1BL4A 1NWSA 3WL1A 2UZ5A 2XPAA 1ZBWA 1RD6A 1FKIA 4N19A 3UI5A 4LAVA 3O5IA 3WQWA 1FKTA 1D7HA 3IHZA 2WK2A 3GPKA 3NTPA 4WKHA 3ALFA 3O5EA 3O5MA 4FAPA 2XP9A 4PTMA 1ROUA 1JVWA 2Q5AA 3O5QA 2WLZA 4C02B 1W1PA 3FXYA 4NNRA 1E6ZA 1FJDA 3PA7A 1C9HA 3KCEA 1QPFA 1EDQA 1W9VA 5HWBA 4ITZA 2FDMA 2XPBA 2XP3A 2O92A 2A3AA 2P4VA 4TX0A 3KADA 2YBUA 2PV1A 1NMWA 1ZB5A 1IX5A 1F8AB 1O6IA 4GGQA 5GQBA 3B9AA 5HW6A 1ZU8A 3EIPA 3JYMA 2DT3A 2ITKA 3IKGA 1X6LA 3CHCA 1JNSA 1YW5A 2KE0A 2XP4A 4JFIA 3PRDA 2VCDA 4WJXA 2MPHA 4IQCA 3AS1A 3PRBA 1NMVA 3ARXA 4TW6A 1FKFA 4DWSC 2XP6A 1YATA 3BXWA 4ODLA 4QIBA 5DITA 3NRKA 5DEZA 2ZR4A 4DT4A 5B8IC 4U84A 1W9PA 4MGVA 4MNKA 1F40A 2KFWA 4IQ2A 2Y78A 1FKGA 3AS3A 4DRPA 1LJYA 1OGBA 1UR9A 1FKKA 2VN1A 3O5DA 2F23A 4TW7A 2ETNA 2DSVA 2RQSA 4ZPTR 2OFNA 1FKBA 1XHGA 1H0GA 3W4RA 1A7XA 1E6NA 4ODKA 1T11A 3GU0A 5JH8A 2DT2A 1W9UA 1LL7A 1ITXA 4WIWA 4MNMA 5DIVA 1FKRA 1ZBVA 3O5RA 5HBFA 2AOSA 4TW8A 2JZVA 3ARYA 3KACA 3WKZA 4ZPWR 1JNTA 1ROTA 3RM9A 5GPRA 2F2DA 5J6EA 2PI6A 1R9HA 3VAWA 3H9RB 3AS2A 2A3BA 1FKSA 2XP5A 3KAFA 4JFLA 1SR0A 3JYJA 3CHEA 4W9QA 4G50A 3EY6A 1HXVA 4JYSA 1E9LA 1EIBA 1KT1A 3TDBA 2WLYA 2PPNA 2DG9A 4R5EA 3B8SA
chains in the Genus database with same CATH topology
3MDYB 3WD3A 1BKFA 2ZR5A 1D7IA 1NH6A 2F21A 2RUDA 1D2KA 3CHDA 4DH0A 3ARTA 2G41A 2ZR6A 1KT0A 1W1VA 1ZCNA 4DZ3A 1OWQA 3FY1A 1WNOA 4ODPA 2D9FA 1J4RA 2PV3A 4JFJA 1J6YA 3UQBA 3UI6A 3B9DA 1D6OA 3IK8A 2DPEA 4Z2LA 4W5UA 1CTNA 3ARVA 4TYOA 1E6RA 1Y0OA 2L2SA 2RUCA 1GPFA 1HKJA 3CGNA 5DIUA 4ODNA 2LGOA 4O2TA 2MNTA 5HT1A 1D7JA 2F4EA 3I6CA 1HJVA 1Q6UA 3CHFA 3UQAA 1L1PA 4JFMA 1HJWA 2DSZA 3RFWA 4Q7NA 5BXJA 1JNEA 3CGMA 4ODOA 3NI6A 1E6PA 3TC5A 3WD4A 4LAYA 4Z2IA 3RGCA 3CZ8A 1UR8A 4ZS6A 1JNDA 4LAWA 4DRNA 4DRJA 2QF8A 4DZ2A 2ZQTA 4P8WA 3B7XA 3O5PA 2YBTA 3AS0A 3O5LA 1W26A 5I98A 4HBOA 2KR7A 1HKKA 1OGGA 1NSGA 4HARA 4DWSD 4FN2A 2KI3A 4ML4A 3KAGA 1FKDA 2M1IA 1NWUA 3WQVA 4GIVA 1B6CA 3QOKA 3WL0A 2ZQVA 3RM4A 4BF8A 4ODQA 3ALGA 4XAKA 3ARRA 3O5KA 2DG3A 1ZL1A 1EQ3A 3ARPA 4Z2KA 2M2AA 5HKGA 4L3NA 4DROA 3O5JA 2N87A 3RM8A 1WAWA 2LPVA 2XP7A 5HW8A 2K8IA 1QPLA 3G6LA 1QZ2A 4DIPA 2LKNA 3KZ7A 2IF4A 1LQ0A 4MNLA 1VF8A 4DRIA 5HWCA 1H0IA 4MNJA 2MLXA 1SYTA 1Q6HA 4W9OA 1Q6IA 3KABA 1W1TA 4AY1A 1X6NA 2DSWA 5HTGA 4P8XA 2FAPA 1PBKA 2DSUA 4IT6A 4MSPA 2WM0A 4Q22A 4J4NA 3WIJA 2KO7A 4Z2GA 4WKFA 5GPGA 1ZBCA 4HBEA 3IKDA 4JFKA 4LAXA 4KR0B 1HJXA 3O5OA 2DT0A 1TFVA 2IUZA 2MLZA 4MTVA 4TNSA 4U85A 3O5GA 4DRQA 4P8UA 4DWSB 5HUAA 1EHNA 4R0XA 1N1AA 4IT4A 3LUOA 4S3JA 4WKAA 3WH0A 2RUQA 4KQZA 5D75A 3B9EA 1XRVA 1K9TA 2KGJA 1FKHA 5HW7A 3AROA 3ARQA 4J4OA 2FKEA 1HKIA 4NZCA 2B31A 2G8ZA 3PR9A 4URIA 1GOIA 3G6MA 4P8VA 3WD2A 4G2PA 1FKLA 2XP8A 4QT2A 1HKMA 2ZQUA 4QZVB 1FFRA 3FAPA 3UF8A 2A3CA 1NWRA 4S3KA 3ARSA 3ARUA 1LG1A 4ZPVR 3O5FA 1FD9A 1LL4A 5DO2A 3TCZA 1ZK6A 4MAVA 4WK9A 1J4IA 3ODKA 4DWSA 1Q1CA 1LL6A 3UI4A 2DG4A 1FKJA 3ARZA 3OA5A 1E15A 4Z2JA 1PINA 1FFQA 4ODMA 1NWTA 3CH9A 3UQIA 1FAPA 1W1YA 2O9OA 2DT1A 4QT3A 3ARWA 3WD1A 4ODRA 2RURA 2PBCA 4MPKA 3KAHA 4DRMA 1KFWA 5DF0A 3JXVA 4W9PA 4LGXA 4DRKA 2ZQSA 2PPOA 2MF9A 3RMEA 1WB0A 1GUVA 2OLHA 2A3EA 1ZBKA 3WD0A 1TCOC 1LG2A 2AWGA 2PPPA 2PV2A 3AQUA 4IPXA 4NSBA 2LJ4A 2M08A 3OOBA 4DRHA 1M5YA 4Z2HA 1P5QA 1U79A 3PRAA 1J4HA 2RSEA 3KAIA 2MLYA 4L72B 4U86A 1EYMA 2ESCA 1BL4A 1NWSA 3WL1A 2UZ5A 2XPAA 1ZBWA 1RD6A 1FKIA 4N19A 3UI5A 4LAVA 3O5IA 3WQWA 1FKTA 1D7HA 3IHZA 2WK2A 3GPKA 3NTPA 4WKHA 3ALFA 3O5EA 3O5MA 4FAPA 2XP9A 4PTMA 1ROUA 1JVWA 2Q5AA 3O5QA 2WLZA 4C02B 1W1PA 3FXYA 4NNRA 1E6ZA 1FJDA 3PA7A 1C9HA 3KCEA 1QPFA 1EDQA 1W9VA 5HWBA 4ITZA 2FDMA 2XPBA 2XP3A 2O92A 2A3AA 4TX0A 3KADA 2YBUA 2PV1A 1NMWA 1ZB5A 1IX5A 1F8AB 1O6IA 4GGQA 5GQBA 3B9AA 5HW6A 1ZU8A 3JYMA 2DT3A 2ITKA 3IKGA 1X6LA 3CHCA 1JNSA 1YW5A 2KE0A 2XP4A 4JFIA 3PRDA 2VCDA 4WJXA 2MPHA 4IQCA 3AS1A 3PRBA 1NMVA 3ARXA 4TW6A 1FKFA 4DWSC 2XP6A 1YATA 3BXWA 4ODLA 4QIBA 5DITA 3NRKA 5DEZA 2ZR4A 4DT4A 5B8IC 4U84A 1W9PA 4MGVA 4MNKA 1F40A 2KFWA 4IQ2A 2Y78A 1FKGA 3AS3A 4DRPA 3O5DA 1LJYA 1OGBA 1FKKA 1UR9A 2VN1A 4TW7A 2DSVA 2RQSA 4ZPTR 2OFNA 1FKBA 1XHGA 1H0GA 3W4RA 1A7XA 1E6NA 4ODKA 1T11A 5JH8A 2DT2A 1W9UA 1LL7A 1ITXA 4WIWA 4MNMA 5DIVA 1FKRA 1ZBVA 3O5RA 5HBFA 2AOSA 4TW8A 2JZVA 3ARYA 3KACA 3WKZA 4ZPWR 1JNTA 1ROTA 3RM9A 5GPRA 2F2DA 5J6EA 2PI6A 1R9HA 3VAWA 3H9RB 3AS2A 2A3BA 1FKSA 2XP5A 3KAFA 4JFLA 1SR0A 3JYJA 3CHEA 4W9QA 4G50A 3EY6A 1HXVA 4JYSA 1E9LA 1EIBA 1KT1A 3TDBA 2WLYA 2PPNA 2DG9A 4R5EA 3B8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD9 A;  3TCZ A;  3KAD A;  3MDY B;  1EQ3 A;  1BKF A;  2ZR5 A;  1D7I A;  2PV1 A;  1ZK6 A;  2F21 A;  2M2A A;  5HKG A;  1NMW A;  1J4I A;  2RUD A;  3ODK A;  4DH0 A;  4DRO A;  3O5J A;  1Q1C A;  2ZR6 A;  3UI4 A;  1F8A B;  2DG4 A;  2N87 A;  4GGQ A;  1KT0 A;  1FKJ A;  2LPV A;  2XP7 A;  1ZCN A;  4DZ3 A;  5HW6 A;  4DRP A;  3JYM A;  5HW8 A;  2K8I A;  1PIN A;  4ODM A;  1QPL A;  1QZ2 A;  4ODP A;  2LKN A;  4DIP A;  3UQI A;  3KZ7 A;  1FAP A;  2ITK A;  3IKG A;  2D9F A;  4QT3 A;  1J4R A;  1JNS A;  2IF4 A;  2PV3 A;  1YW5 A;  2KE0 A;  2XP4 A;  4JFJ A;  4ODR A;  1J6Y A;  4JFI A;  3UQB A;  3UI6 A;  2RUR A;  2PBC A;  3PRD A;  1D6O A;  3IK8 A;  4DRI A;  5HWC A;  2MPH A;  4IQC A;  3KAH A;  4DRM A;  3PRB A;  2MLX A;  3JXV A;  4W9P A;  1NMV A;  4DRK A;  1Q6H A;  2ZQS A;  2PPO A;  1Q6I A;  3KAB A;  2MF9 A;  4TW6 A;  4W9O A;  1FKF A;  2XP6 A;  4TYO A;  1YAT A;  5DIT A;  4ODL A;  4QIB A;  1Y0O A;  2L2S A;  2RUC A;  3NRK A;  5HTG A;  2FAP A;  1PBK A;  2ZR4 A;  4MSP A;  4DT4 A;  5B8I C;  3CGN A;  4U84 A;  4MGV A;  4J4N A;  5DIU A;  1F40 A;  2KFW A;  1TCO C;  2AWG A;  2PPP A;  2LGO A;  2PV2 A;  4IQ2 A;  2KO7 A;  1FKG A;  2LJ4 A;  2M08 A;  2Y78 A;  2MNT A;  3OOB A;  1M5Y A;  4O2T A;  5GPG A;  5HT1 A;  4DRH A;  1D7J A;  2F4E A;  3I6C A;  3O5D A;  1P5Q A;  1U79 A;  1FKK A;  2VN1 A;  3IKD A;  4JFK A;  4TW7 A;  1J4H A;  1Q6U A;  2RSE A;  2RQS A;  3KAI A;  2MLY A;  4U86 A;  3UQA A;  2OFN A;  1L1P A;  4JFM A;  4LAX A;  1FKB A;  3O5O A;  1EYM A;  1A7X A;  3RFW A;  4ODK A;  1BL4 A;  1T11 A;  5BXJ A;  2MLZ A;  2UZ5 A;  2XPA A;  4TNS A;  4U85 A;  3O5G A;  3CGM A;  4ODO A;  4DRQ A;  3NI6 A;  5HUA A;  1FKI A;  1N1A A;  4N19 A;  4R0X A;  3UI5 A;  3TC5 A;  4LAV A;  4LAY A;  3RGC A;  4ODN A;  3O5I A;  3LUO A;  5DIV A;  1FKR A;  3WH0 A;  4LAW A;  4DRN A;  1FKT A;  4DRJ A;  2RUQ A;  3O5R A;  1D7H A;  4DZ2 A;  2ZQT A;  3IHZ A;  3B7X A;  4TW8 A;  2JZV A;  3KAC A;  3O5K A;  5D75 A;  3O5P A;  3GPK A;  2KGJ A;  3NTP A;  1FKH A;  1JNT A;  5HW7 A;  4J4O A;  2FKE A;  3O5E A;  3O5M A;  4FAP A;  1ROT A;  2XP9 A;  3O5L A;  1W26 A;  1ROU A;  1JVW A;  5I98 A;  2F2D A;  2KR7 A;  5J6E A;  2Q5A A;  3O5Q A;  1NSG A;  4C02 B;  1R9H A;  4FN2 A;  4NNR A;  4G2P A;  1FKL A;  2KI3 A;  2XP8 A;  3H9R B;  4IPX A;  4QT2 A;  3KAG A;  3VAW A;  1FKD A;  2ZQU A;  2M1I A;  3PA7 A;  1FKS A;  2XP5 A;  3KAF A;  4JFL A;  1C9H A;  4GIV A;  3KCE A;  1B6C A;  1QPF A;  3JYJ A;  4W9Q A;  3FAP A;  3UF8 A;  2ZQV A;  4G50 A;  3EY6 A;  1HXV A;  4JYS A;  4BF8 A;  5HWB A;  4ITZ A;  1FJD A;  4ODQ A;  1KT1 A;  2XPB A;  3TDB A;  2PPN A;  2XP3 A;  3O5F A;  2DG9 A;  4TX0 A;  2VCD A;  2DG3 A; 
#chains in the Genus database with same CATH topology
 3MDY B;  3WD3 A;  1BKF A;  2ZR5 A;  1D7I A;  1NH6 A;  2F21 A;  2RUD A;  1D2K A;  3CHD A;  4DH0 A;  3ART A;  2G41 A;  2ZR6 A;  3GTY X;  1KT0 A;  1W1V A;  1ZCN A;  4DZ3 A;  1OWQ A;  3FY1 A;  1WNO A;  4ODP A;  2D9F A;  1J4R A;  2PV3 A;  4JFJ A;  1J6Y A;  3UQB A;  3UI6 A;  3B9D A;  1D6O A;  3IK8 A;  2DPE A;  4Z2L A;  4W5U A;  1CTN A;  3ARV A;  4TYO A;  1E6R A;  1Y0O A;  2L2S A;  2RUC A;  1GPF A;  1HKJ A;  3CGN A;  5DIU A;  4ODN A;  2LGO A;  4O2T A;  2MNT A;  5HT1 A;  1D7J A;  2F4E A;  3I6C A;  1HJV A;  1Q6U A;  3CHF A;  3UQA A;  1L1P A;  4JFM A;  1HJW A;  2DSZ A;  3RFW A;  4Q7N A;  5BXJ A;  1JNE A;  3CGM A;  4ODO A;  3NI6 A;  4UDM A;  1E6P A;  1JCH B;  3TC5 A;  3WD4 A;  4LAY A;  4Z2I A;  3RGC A;  3CZ8 A;  1UR8 A;  4ZS6 A;  1JND A;  4LAW A;  4DRN A;  4DRJ A;  2QF8 A;  4DZ2 A;  2ZQT A;  4P8W A;  3B7X A;  3O5P A;  2YBT A;  3AS0 A;  3O5L A;  1W26 A;  5I98 A;  4HBO A;  2KR7 A;  1HKK A;  1OGG A;  1NSG A;  4HAR A;  4DWS D;  4FN2 A;  2KI3 A;  4ML4 A;  3KAG A;  1FKD A;  2M1I A;  1NWU A;  3WQV A;  4GIV A;  1B6C A;  3QOK A;  3WL0 A;  2ZQV A;  3RM4 A;  4BF8 A;  4ODQ A;  1GRJ A;  3ALG A;  4XAK A;  3ARR A;  3O5K A;  2DG3 A;  1ZL1 A;  1EQ3 A;  3ARP A;  4Z2K A;  2M2A A;  5HKG A;  2B5U B;  4L3N A;  4DRO A;  3O5J A;  2N87 A;  3RM8 A;  1WAW A;  2LPV A;  2XP7 A;  5HW8 A;  2K8I A;  1QPL A;  3G6L A;  1QZ2 A;  4DIP A;  2LKN A;  3KZ7 A;  2IF4 A;  1LQ0 A;  4MNL A;  1VF8 A;  4DRI A;  5HWC A;  1H0I A;  4MNJ A;  2MLX A;  1SYT A;  1Q6H A;  4W9O A;  1Q6I A;  3KAB A;  1W1T A;  4AY1 A;  1E44 A;  1X6N A;  2DSW A;  5HTG A;  4P8X A;  2FAP A;  1PBK A;  2DSU A;  4IT6 A;  4MSP A;  2WM0 A;  4Q22 A;  4J4N A;  3WIJ A;  2KO7 A;  4Z2G A;  4WKF A;  5GPG A;  1ZBC A;  4HBE A;  3IKD A;  4JFK A;  4LAX A;  4KR0 B;  1HJX A;  3O5O A;  2DT0 A;  1TFV A;  2IUZ A;  2MLZ A;  4MTV A;  4TNS A;  4U85 A;  3O5G A;  4DRQ A;  4P8U A;  4DWS B;  5HUA A;  1EHN A;  4R0X A;  1N1A A;  4IT4 A;  3LUO A;  4S3J A;  4WKA A;  3WH0 A;  2RUQ A;  4KQZ A;  5D75 A;  3B9E A;  1XRV A;  1K9T A;  2KGJ A;  1FKH A;  5HW7 A;  3ARO A;  3ARQ A;  4J4O A;  2FKE A;  1HKI A;  4NZC A;  2B31 A;  2G8Z A;  3PR9 A;  4URI A;  1GOI A;  3G6M A;  4P8V A;  3WD2 A;  4G2P A;  1FKL A;  2XP8 A;  4QT2 A;  1HKM A;  2ZQU A;  4QZV B;  1FFR A;  3FAP A;  3UF8 A;  2A3C A;  1NWR A;  4S3K A;  3ARS A;  3ARU A;  1LG1 A;  4ZPV R;  3O5F A;  1FD9 A;  1LL4 A;  5DO2 A;  3TCZ A;  1ZK6 A;  4MAV A;  4WK9 A;  1J4I A;  3ODK A;  4DWS A;  1Q1C A;  1LL6 A;  3UI4 A;  2PN0 A;  2DG4 A;  1FKJ A;  3ARZ A;  3OA5 A;  1E15 A;  4Z2J A;  1PIN A;  1FFQ A;  4ODM A;  1NWT A;  3CH9 A;  3UQI A;  1FAP A;  1W1Y A;  2O9O A;  2DT1 A;  4QT3 A;  3ARW A;  3WD1 A;  4ODR A;  2RUR A;  2PBC A;  4MPK A;  3KAH A;  4DRM A;  1KFW A;  5DF0 A;  3JXV A;  4W9P A;  4LGX A;  4DRK A;  2ZQS A;  2PPO A;  2MF9 A;  2EUL A;  3RME A;  1WB0 A;  1GUV A;  2OLH A;  2A3E A;  1ZBK A;  3WD0 A;  1TCO C;  1LG2 A;  2AWG A;  2PPP A;  2PV2 A;  3AQU A;  4IPX A;  4NSB A;  2LJ4 A;  2M08 A;  3OOB A;  4DRH A;  1M5Y A;  4Z2H A;  1P5Q A;  1U79 A;  3PRA A;  3BMB A;  1J4H A;  2RSE A;  3KAI A;  2MLY A;  4L72 B;  4U86 A;  1EYM A;  2ESC A;  1BL4 A;  1NWS A;  3WL1 A;  2UZ5 A;  2XPA A;  1ZBW A;  1RD6 A;  1FKI A;  4N19 A;  3UI5 A;  4LAV A;  3O5I A;  3WQW A;  1FKT A;  1D7H A;  3IHZ A;  2WK2 A;  3GPK A;  3NTP A;  4WKH A;  3ALF A;  3O5E A;  3O5M A;  4FAP A;  2XP9 A;  4PTM A;  1ROU A;  1JVW A;  2Q5A A;  3O5Q A;  2WLZ A;  4C02 B;  1W1P A;  3FXY A;  4NNR A;  1E6Z A;  1FJD A;  3PA7 A;  1C9H A;  3KCE A;  1QPF A;  1EDQ A;  1W9V A;  5HWB A;  4ITZ A;  2FDM A;  2XPB A;  2XP3 A;  2O92 A;  2A3A A;  2P4V A;  4TX0 A;  3KAD A;  2YBU A;  2PV1 A;  1NMW A;  1ZB5 A;  1IX5 A;  1F8A B;  1O6I A;  4GGQ A;  5GQB A;  3B9A A;  5HW6 A;  1ZU8 A;  3EIP A;  3JYM A;  2DT3 A;  2ITK A;  3IKG A;  1X6L A;  3CHC A;  1JNS A;  1YW5 A;  2KE0 A;  2XP4 A;  4JFI A;  3PRD A;  2VCD A;  4WJX A;  2MPH A;  4IQC A;  3AS1 A;  3PRB A;  1NMV A;  3ARX A;  4TW6 A;  1FKF A;  4DWS C;  2XP6 A;  1YAT A;  3BXW A;  4ODL A;  4QIB A;  5DIT A;  3NRK A;  5DEZ A;  2ZR4 A;  4DT4 A;  5B8I C;  4U84 A;  1W9P A;  4MGV A;  4MNK A;  1F40 A;  2KFW A;  4IQ2 A;  2Y78 A;  1FKG A;  3AS3 A;  4DRP A;  1LJY A;  1OGB A;  1UR9 A;  1FKK A;  2VN1 A;  3O5D A;  2F23 A;  4TW7 A;  2ETN A;  2DSV A;  2RQS A;  4ZPT R;  2OFN A;  1FKB A;  1XHG A;  1H0G A;  3W4R A;  1A7X A;  1E6N A;  4ODK A;  1T11 A;  3GU0 A;  5JH8 A;  2DT2 A;  1W9U A;  1LL7 A;  1ITX A;  4WIW A;  4MNM A;  5DIV A;  1FKR A;  1ZBV A;  3O5R A;  5HBF A;  2AOS A;  4TW8 A;  2JZV A;  3ARY A;  3KAC A;  3WKZ A;  4ZPW R;  1JNT A;  1ROT A;  3RM9 A;  5GPR A;  2F2D A;  5J6E A;  2PI6 A;  1R9H A;  3VAW A;  3H9R B;  3AS2 A;  2A3B A;  1FKS A;  2XP5 A;  3KAF A;  4JFL A;  1SR0 A;  3JYJ A;  3CHE A;  4W9Q A;  4G50 A;  3EY6 A;  1HXV A;  4JYS A;  1E9L A;  1EIB A;  1KT1 A;  3TDB A;  2WLY A;  2PPN A;  2DG9 A;  4R5E A;  3B8S A; 
#chains in the Genus database with same CATH homology
 3MDY B;  3WD3 A;  1BKF A;  2ZR5 A;  1D7I A;  1NH6 A;  2F21 A;  2RUD A;  1D2K A;  3CHD A;  4DH0 A;  3ART A;  2G41 A;  2ZR6 A;  1KT0 A;  1W1V A;  1ZCN A;  4DZ3 A;  1OWQ A;  3FY1 A;  1WNO A;  4ODP A;  2D9F A;  1J4R A;  2PV3 A;  4JFJ A;  1J6Y A;  3UQB A;  3UI6 A;  3B9D A;  1D6O A;  3IK8 A;  2DPE A;  4Z2L A;  4W5U A;  1CTN A;  3ARV A;  4TYO A;  1E6R A;  1Y0O A;  2L2S A;  2RUC A;  1GPF A;  1HKJ A;  3CGN A;  5DIU A;  4ODN A;  2LGO A;  4O2T A;  2MNT A;  5HT1 A;  1D7J A;  2F4E A;  3I6C A;  1HJV A;  1Q6U A;  3CHF A;  3UQA A;  1L1P A;  4JFM A;  1HJW A;  2DSZ A;  3RFW A;  4Q7N A;  5BXJ A;  1JNE A;  3CGM A;  4ODO A;  3NI6 A;  1E6P A;  3TC5 A;  3WD4 A;  4LAY A;  4Z2I A;  3RGC A;  3CZ8 A;  1UR8 A;  4ZS6 A;  1JND A;  4LAW A;  4DRN A;  4DRJ A;  2QF8 A;  4DZ2 A;  2ZQT A;  4P8W A;  3B7X A;  3O5P A;  2YBT A;  3AS0 A;  3O5L A;  1W26 A;  5I98 A;  4HBO A;  2KR7 A;  1HKK A;  1OGG A;  1NSG A;  4HAR A;  4DWS D;  4FN2 A;  2KI3 A;  4ML4 A;  3KAG A;  1FKD A;  2M1I A;  1NWU A;  3WQV A;  4GIV A;  1B6C A;  3QOK A;  3WL0 A;  2ZQV A;  3RM4 A;  4BF8 A;  4ODQ A;  3ALG A;  4XAK A;  3ARR A;  3O5K A;  2DG3 A;  1ZL1 A;  1EQ3 A;  3ARP A;  4Z2K A;  2M2A A;  5HKG A;  4L3N A;  4DRO A;  3O5J A;  2N87 A;  3RM8 A;  1WAW A;  2LPV A;  2XP7 A;  5HW8 A;  2K8I A;  1QPL A;  3G6L A;  1QZ2 A;  4DIP A;  2LKN A;  3KZ7 A;  2IF4 A;  1LQ0 A;  4MNL A;  1VF8 A;  4DRI A;  5HWC A;  1H0I A;  4MNJ A;  2MLX A;  1SYT A;  1Q6H A;  4W9O A;  1Q6I A;  3KAB A;  1W1T A;  4AY1 A;  1X6N A;  2DSW A;  5HTG A;  4P8X A;  2FAP A;  1PBK A;  2DSU A;  4IT6 A;  4MSP A;  2WM0 A;  4Q22 A;  4J4N A;  3WIJ A;  2KO7 A;  4Z2G A;  4WKF A;  5GPG A;  1ZBC A;  4HBE A;  3IKD A;  4JFK A;  4LAX A;  4KR0 B;  1HJX A;  3O5O A;  2DT0 A;  1TFV A;  2IUZ A;  2MLZ A;  4MTV A;  4TNS A;  4U85 A;  3O5G A;  4DRQ A;  4P8U A;  4DWS B;  5HUA A;  1EHN A;  4R0X A;  1N1A A;  4IT4 A;  3LUO A;  4S3J A;  4WKA A;  3WH0 A;  2RUQ A;  4KQZ A;  5D75 A;  3B9E A;  1XRV A;  1K9T A;  2KGJ A;  1FKH A;  5HW7 A;  3ARO A;  3ARQ A;  4J4O A;  2FKE A;  1HKI A;  4NZC A;  2B31 A;  2G8Z A;  3PR9 A;  4URI A;  1GOI A;  3G6M A;  4P8V A;  3WD2 A;  4G2P A;  1FKL A;  2XP8 A;  4QT2 A;  1HKM A;  2ZQU A;  4QZV B;  1FFR A;  3FAP A;  3UF8 A;  2A3C A;  1NWR A;  4S3K A;  3ARS A;  3ARU A;  1LG1 A;  4ZPV R;  3O5F A;  1FD9 A;  1LL4 A;  5DO2 A;  3TCZ A;  1ZK6 A;  4MAV A;  4WK9 A;  1J4I A;  3ODK A;  4DWS A;  1Q1C A;  1LL6 A;  3UI4 A;  2DG4 A;  1FKJ A;  3ARZ A;  3OA5 A;  1E15 A;  4Z2J A;  1PIN A;  1FFQ A;  4ODM A;  1NWT A;  3CH9 A;  3UQI A;  1FAP A;  1W1Y A;  2O9O A;  2DT1 A;  4QT3 A;  3ARW A;  3WD1 A;  4ODR A;  2RUR A;  2PBC A;  4MPK A;  3KAH A;  4DRM A;  1KFW A;  5DF0 A;  3JXV A;  4W9P A;  4LGX A;  4DRK A;  2ZQS A;  2PPO A;  2MF9 A;  3RME A;  1WB0 A;  1GUV A;  2OLH A;  2A3E A;  1ZBK A;  3WD0 A;  1TCO C;  1LG2 A;  2AWG A;  2PPP A;  2PV2 A;  3AQU A;  4IPX A;  4NSB A;  2LJ4 A;  2M08 A;  3OOB A;  4DRH A;  1M5Y A;  4Z2H A;  1P5Q A;  1U79 A;  3PRA A;  1J4H A;  2RSE A;  3KAI A;  2MLY A;  4L72 B;  4U86 A;  1EYM A;  2ESC A;  1BL4 A;  1NWS A;  3WL1 A;  2UZ5 A;  2XPA A;  1ZBW A;  1RD6 A;  1FKI A;  4N19 A;  3UI5 A;  4LAV A;  3O5I A;  3WQW A;  1FKT A;  1D7H A;  3IHZ A;  2WK2 A;  3GPK A;  3NTP A;  4WKH A;  3ALF A;  3O5E A;  3O5M A;  4FAP A;  2XP9 A;  4PTM A;  1ROU A;  1JVW A;  2Q5A A;  3O5Q A;  2WLZ A;  4C02 B;  1W1P A;  3FXY A;  4NNR A;  1E6Z A;  1FJD A;  3PA7 A;  1C9H A;  3KCE A;  1QPF A;  1EDQ A;  1W9V A;  5HWB A;  4ITZ A;  2FDM A;  2XPB A;  2XP3 A;  2O92 A;  2A3A A;  4TX0 A;  3KAD A;  2YBU A;  2PV1 A;  1NMW A;  1ZB5 A;  1IX5 A;  1F8A B;  1O6I A;  4GGQ A;  5GQB A;  3B9A A;  5HW6 A;  1ZU8 A;  3JYM A;  2DT3 A;  2ITK A;  3IKG A;  1X6L A;  3CHC A;  1JNS A;  1YW5 A;  2KE0 A;  2XP4 A;  4JFI A;  3PRD A;  2VCD A;  4WJX A;  2MPH A;  4IQC A;  3AS1 A;  3PRB A;  1NMV A;  3ARX A;  4TW6 A;  1FKF A;  4DWS C;  2XP6 A;  1YAT A;  3BXW A;  4ODL A;  4QIB A;  5DIT A;  3NRK A;  5DEZ A;  2ZR4 A;  4DT4 A;  5B8I C;  4U84 A;  1W9P A;  4MGV A;  4MNK A;  1F40 A;  2KFW A;  4IQ2 A;  2Y78 A;  1FKG A;  3AS3 A;  4DRP A;  3O5D A;  1LJY A;  1OGB A;  1FKK A;  1UR9 A;  2VN1 A;  4TW7 A;  2DSV A;  2RQS A;  4ZPT R;  2OFN A;  1FKB A;  1XHG A;  1H0G A;  3W4R A;  1A7X A;  1E6N A;  4ODK A;  1T11 A;  5JH8 A;  2DT2 A;  1W9U A;  1LL7 A;  1ITX A;  4WIW A;  4MNM A;  5DIV A;  1FKR A;  1ZBV A;  3O5R A;  5HBF A;  2AOS A;  4TW8 A;  2JZV A;  3ARY A;  3KAC A;  3WKZ A;  4ZPW R;  1JNT A;  1ROT A;  3RM9 A;  5GPR A;  2F2D A;  5J6E A;  2PI6 A;  1R9H A;  3VAW A;  3H9R B;  3AS2 A;  2A3B A;  1FKS A;  2XP5 A;  3KAF A;  4JFL A;  1SR0 A;  3JYJ A;  3CHE A;  4W9Q A;  4G50 A;  3EY6 A;  1HXV A;  4JYS A;  1E9L A;  1EIB A;  1KT1 A;  3TDB A;  2WLY A;  2PPN A;  2DG9 A;  4R5E A;  3B8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...