1J6YA

Solution structure of pin1at from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
120
structure length
120
Chain Sequence
HMASRDQVKASHILIKHQGSRRKASWKDPEGKIILTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Single-domain Prolyl Cis/Trans Isomerase PIN1At from Arabidopsis thaliana
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Isomerase
molecule keywords peptidyl-prolyl cis-trans isomerase
total genus 17
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1j6yA00
5J6EA 1YATA 4JFJA 3UI4A 2LGOA 1JNTA 1EYMA 3UI6A 3O5IA 1FAPA 4TX0A 3UI5A 2MPHA 4ODQA 2PBCA 2MF9A 1BKFA 3UQAA 4LAXA 1FJDA 4R0XA 3CGNA 3UQIA 4IQ2A 2DG3A 1R9HA 2XPBA 4G50A 5HTGA 1J6YA 2RURA 3O5MA 2KFWA 4GIVA 3VAWA 3B7XA 1ZCNA 1PBKA 1L1PA 2DG9A 2ZQTA 3MDYB 4JFIA 1Q6HA 2PV1A 1ROTA 4DROA 2RSEA 3O5JA 2LJ4A 4TW8A 3WH0A 4QT2A 2ZR4A 1B6CA 1D6OA 3O5GA 4IPXA 1FKTA 1T11A 3KAIA 4QT3A 1Q6UA 4DRQA 3NTPA 3KAHA 5HUAA 3CGMA 3EY6A 3KAGA 4J4OA 2PPNA 2JZVA 2RQSA 1FKIA 2D9FA 1J4IA 1W26A 3NRKA 4DRPA 2Y78A 1FD9A 1NMWA 3OOBA 3JYJA 4W9OA 1QPLA 3KCEA 1D7IA 4JFLA 5HKGA 1FKBA 1PINA 3O5DA 2XP6A 4U84A 5DITA 4ODOA 2KO7A 4TNSA 5DIVA 4IQCA 2RUCA 2XP4A 4DRNA 4BF8A 1QPFA 5I98A 2RUQA 1P5QA 4ODMA 1HXVA 5HWBA 3JXVA 2OFNA 3O5PA 1N1AA 4DRKA 4DRIA 1Q6IA 1NMVA 3GPKA 2VCDA 3FAPA 3NI6A 4C02B 3KZ7A 4DT4A 3O5RA 4J4NA 4LAWA 4ODRA 1BL4A 3O5EA 3O5FA 2MLYA 3IKDA 4DIPA 2Q5AA 2KI3A 2PV3A 1J4RA 3PRDA 2MLZA 1ZK6A 2PPPA 1C9HA 2N87A 2PV2A 2MLXA 3O5OA 4O2TA 4ODKA 2DG4A 2L2SA 4DRHA 3UQBA 3IHZA 3PA7A 2F21A 4W9QA 4U86A 1EQ3A 4MSPA 4DRJA 2ZQVA 1J4HA 5DIUA 3UF8A 2UZ5A 1FKDA 1TCOC 2ZR5A 4FN2A 4QIBA 1FKSA 4N19A 2VN1A 1KT0A 3RFWA 2MNTA 3LUOA 4ODPA 5HWCA 1Y0OA 2ZR6A 3I6CA 1ROUA 2LPVA 3TCZA 3KACA 2M2AA 2ZQSA 1FKHA 1U79A 3KABA 3ODKA 1FKKA 1KT1A 4DZ2A 2AWGA 5D75A 4DZ3A 1FKJA 3TDBA 2FAPA 1Q1CA 4ODLA 1M5YA 2KE0A 4ODNA 1JVWA 4DRMA 2IF4A 1NSGA 3H9RB 2KGJA 3PRBA 2XP5A 3IK8A 4W9PA 5B8IC 5HW6A 1FKRA 1YW5A 2XP9A 4ITZA 3IKGA 4TW7A 1QZ2A 4TW6A 2LKNA 2XPAA 2KR7A 2XP8A 2XP3A 2ZQUA 3O5QA 4U85A 4DH0A 2RUDA 1D7JA 3RGCA 5HW8A 4G2PA 1JNSA 2ITKA 3KADA 5HT1A 3KAFA 5GPGA 2F4EA 2PPOA 1D7HA 2M1IA 1A7XA 1FKGA 4JFMA 2K8IA 3TC5A 1FKLA 2XP7A 3JYMA 4GGQA 5BXJA 1F40A 3O5LA 4TYOA 4JFKA 4NNRA 1FKFA 2M08A 2FKEA 3O5KA 4JYSA 4LAVA 1F8AB 4MGVA 5HW7A 4LAYA 4FAPA 2F2DA
chains in the Genus database with same CATH superfamily
1YATA 2F23A 3UI4A 4IT4A 1E6ZA 3WIJA 1E15A 1BKFA 1JNDA 3CGNA 3UQIA 4LGXA 1W1VA 4L3NA 4Z2LA 4Q22A 2DT0A 2LJ4A 3AQUA 1B6CA 1D6OA 3O5GA 4WIWA 1T11A 2B31A 3KAIA 4QT3A 4KR0B 3CGMA 3KAGA 1SYTA 2WLZA 2WM0A 3WD1A 2DT1A 2Y78A 1TFVA 4W9OA 3KCEA 4U84A 5DITA 4ODOA 2RUCA 4NZCA 5I98A 1JCHB 2RUQA 4ODMA 3ARSA 2OFNA 3O5PA 4DRIA 1NMVA 3GPKA 1W9PA 4QZVB 4ODRA 2OLHA 3O5EA 2MLYA 4P8UA 1ZK6A 4UDMA 3O5OA 4DRHA 2EULA 1XRVA 4U86A 3BMBA 4DRJA 3CHEA 1H0IA 2ZQVA 2DPEA 1J4HA 5DIUA 3ARQA 1NWSA 2DT3A 3I6CA 2LPVA 3KACA 4DWSB 1FKHA 1U79A 2AWGA 1CTNA 1GPFA 1ZL1A 1WAWA 5DF0A 1LJYA 3WL0A 4DRMA 4MAVA 2KGJA 2P4VA 4IT6A 4W9PA 1SR0A 5B8IC 2O92A 1YW5A 1W9UA 1QZ2A 1UR9A 3WD2A 2LKNA 2XP3A 4U85A 3RGCA 3CHFA 2ITKA 1OWQA 4Z2JA 3KAFA 5DO2A 2PPOA 1W1TA 1FKGA 4JFMA 5DEZA 1HKIA 4TYOA 2A3CA 4ZS6A 4LAVA 1RD6A 3AS0A 2DSUA 3OA5A 3RM9A 4MNKA 4TX0A 3WQWA 2PBCA 3ARYA 4IQ2A 4Z2HA 4DWSD 1ZCNA 1PBKA 3WD4A 1L1PA 3MDYB 4JFIA 1ROTA 3O5JA 1VF8A 3WH0A 3GU0A 2ZR4A 3CHDA 4IPXA 1FKTA 4DRQA 1EDQA 2D9FA 1W26A 1FD9A 4ZPWR 3JYJA 3FXYA 1FKBA 3O5DA 1QPFA 1HJWA 1N1AA 1E44A 1Q6IA 4W5UA 4P8WA 1LQ0A 4WK9A 4S3KA 3FAPA 4C02B 3KZ7A 4J4NA 1BL4A 4DIPA 1C9HA 3WKZA 3RM8A 2MLXA 4ODKA 1H0GA 1O6IA 1WB0A 3PA7A 2DSWA 1E6PA 4WKHA 1NWRA 1LL6A 1ZBWA 1FKDA 2ZR5A 4QIBA 4N19A 3AROA 3RFWA 1EHNA 2MNTA 1HKKA 4WJXA 2M2AA 3KABA 5D75A 3TDBA 2PI6A 2KE0A 1HKJA 2AOSA 3RM4A 3IK8A 5HW6A 1FFQA 1GUVA 3WQVA 2XP9A 4TW7A 1NWTA 4TW6A 2XPAA 2KR7A 2ZQUA 4DH0A 3ARVA 2RUDA 1D7JA 5GPGA 1A7XA 2K8IA 1K9TA 2XP7A 2A3BA 4GGQA 1F40A 4Q7NA 2FKEA 1F8AB 4MNLA 4LAYA 1WNOA 2MPHA 2F2DA 2LGOA 1EYMA 3UI6A 4P8VA 1FAPA 3UQAA 4LAXA 1FJDA 1E9LA 2XPBA 4G50A 4ZPTR 2RURA 3O5MA 1D2KA 2KFWA 1XHGA 3B7XA 1Q6HA 2QF8A 4QT2A 4ML4A 1JNSA 5HUAA 3KAHA 4L72B 2PPNA 4MNJA 2RQSA 1FKIA 1LL7A 4XAKA 3W4RA 3WD3A 4DRPA 1NMWA 3OOBA 1QPLA 4JFLA 3G6LA 5HKGA 1PINA 4PTMA 1FFRA 3ARXA 2XP6A 3B9DA 4MTVA 1LG1A 4IQCA 1W1PA 4Z2IA 3CHCA 1HJXA 1P5QA 1HXVA 1E6RA 5HWBA 3B9AA 1W1YA 3NI6A 2VCDA 3PR9A 4KQZA 4DT4A 3O5RA 3EIPA 4LAWA 4Z2GA 3IKDA 1E6NA 1UR8A 3AS2A 2KI3A 2PV3A 1J4RA 3PRDA 2MLZA 2PV2A 2N87A 4R5EA 2IUZA 2DG4A 2L2SA 3PRAA 4WKAA 3UQBA 3IHZA 2F21A 4W9QA 4MPKA 1KFWA 3UF8A 2UZ5A 1TCOC 5HWCA 1Y0OA 1ROUA 2ZQSA 3G6MA 3ODKA 4DZ2A 4DZ3A 1FKJA 2FAPA 1HKMA 4ODLA 1M5YA 4DWSC 4MNMA 4ODNA 1JVWA 3ARTA 2G41A 1NSGA 3H9RB 3PRBA 5JH8A 4ITZA 3IKGA 2YBUA 1OGGA 2DT2A 3GTYX 1NH6A 3CZ8A 2DSVA 5HW8A 2FDMA 3B9EA 3KADA 5HT1A 3B8SA 2F4EA 1ZBKA 2M1IA 4NSBA 1FKLA 4JFKA 4NNRA 1FKFA 2M08A 4JYSA 5HW7A 4MGVA 4FAPA 5J6EA 1LG2A 4JFJA 5HBFA 2ETNA 1JNTA 3O5IA 3UI5A 1EIBA 4ODQA 2MF9A 4R0XA 2DG3A 1X6LA 1R9HA 3ARWA 4Z2KA 5HTGA 3ARRA 1J6YA 2PN0A 3RMEA 3VAWA 4GIVA 2DG9A 2ZQTA 4DROA 2PV1A 2RSEA 4TW8A 2B5UB 1ZBCA 2G8ZA 1Q6UA 3NTPA 3EY6A 4J4OA 1ZB5A 2JZVA 1J4IA 3NRKA 4HBOA 4AY1A 3ALGA 4HBEA 3QOKA 3ARPA 1D7IA 2O9OA 4TNSA 2KO7A 5DIVA 2XP4A 4DRNA 4P8XA 2WK2A 4URIA 4BF8A 2DSZA 3ALFA 3JXVA 3WL1A 4DRKA 1LL4A 1ZU8A 2WLYA 3O5FA 2Q5AA 2PPPA 2YBTA 4O2TA 4ZPVR 3AS1A 1OGBA 1EQ3A 4MSPA 3ARZA 5GQBA 4FN2A 1X6NA 1FKSA 2VN1A 1KT0A 3LUOA 4ODPA 2ZR6A 3TCZA 4DWSA 1NWUA 1GRJA 4HARA 1FKKA 1KT1A 3CH9A 3WD0A 2ESCA 1Q1CA 4S3JA 3ARUA 1W9VA 2IF4A 2XP5A 1FKRA 1GOIA 5GPRA 3FY1A 2XP8A 3BXWA 3O5QA 3AS3A 4G2PA 1HJVA 1D7HA 1IX5A 2A3AA 3TC5A 3JYMA 5BXJA 3O5LA 1ITXA 1ZBVA 3O5KA 4WKFA 1JNEA 2A3EA
chains in the Genus database with same CATH topology
1YATA 3UI4A 4IT4A 1E6ZA 3WIJA 1E15A 1BKFA 1JNDA 3CGNA 3UQIA 4LGXA 1W1VA 4L3NA 4Z2LA 4Q22A 2DT0A 2LJ4A 3AQUA 1B6CA 1D6OA 3O5GA 4WIWA 1T11A 2B31A 3KAIA 4QT3A 4KR0B 3CGMA 3KAGA 1SYTA 2WLZA 2WM0A 3WD1A 2DT1A 2Y78A 1TFVA 4W9OA 3KCEA 4U84A 5DITA 4ODOA 2RUCA 4NZCA 5I98A 2RUQA 4ODMA 3ARSA 2OFNA 3O5PA 4DRIA 1NMVA 3GPKA 1W9PA 4QZVB 4ODRA 2OLHA 3O5EA 2MLYA 4P8UA 1ZK6A 3O5OA 4DRHA 1XRVA 4U86A 4DRJA 3CHEA 1H0IA 2ZQVA 2DPEA 1J4HA 5DIUA 3ARQA 1NWSA 2DT3A 3I6CA 2LPVA 3KACA 4DWSB 1FKHA 1U79A 2AWGA 1CTNA 1GPFA 1ZL1A 1WAWA 5DF0A 1LJYA 3WL0A 4DRMA 4MAVA 2KGJA 4IT6A 4W9PA 1SR0A 5B8IC 2O92A 1YW5A 1W9UA 1QZ2A 1UR9A 3WD2A 2LKNA 2XP3A 4U85A 3RGCA 3CHFA 2ITKA 1OWQA 4Z2JA 3KAFA 5DO2A 2PPOA 1W1TA 1FKGA 4JFMA 5DEZA 1HKIA 4TYOA 2A3CA 4ZS6A 4LAVA 1RD6A 3AS0A 2DSUA 3OA5A 3RM9A 4MNKA 4TX0A 3WQWA 2PBCA 3ARYA 4IQ2A 4Z2HA 4DWSD 1ZCNA 1PBKA 3WD4A 1L1PA 3MDYB 4JFIA 1ROTA 3O5JA 1VF8A 3WH0A 2ZR4A 3CHDA 4IPXA 1FKTA 4DRQA 1EDQA 2D9FA 1W26A 1FD9A 4ZPWR 3JYJA 3FXYA 1FKBA 3O5DA 1QPFA 1HJWA 1N1AA 1Q6IA 4W5UA 4P8WA 1LQ0A 4WK9A 4S3KA 3FAPA 4C02B 3KZ7A 4J4NA 1BL4A 4DIPA 1C9HA 3WKZA 3RM8A 2MLXA 4ODKA 1H0GA 1O6IA 1WB0A 3PA7A 2DSWA 1E6PA 4WKHA 1NWRA 1LL6A 1ZBWA 1FKDA 2ZR5A 4QIBA 4N19A 3AROA 3RFWA 1EHNA 2MNTA 1HKKA 4WJXA 2M2AA 3KABA 5D75A 3TDBA 2PI6A 2KE0A 1HKJA 2AOSA 3RM4A 3IK8A 5HW6A 1FFQA 1GUVA 3WQVA 2XP9A 4TW7A 1NWTA 4TW6A 2XPAA 2KR7A 2ZQUA 4DH0A 3ARVA 2RUDA 1D7JA 5GPGA 1A7XA 2K8IA 1K9TA 2XP7A 2A3BA 4GGQA 1F40A 4Q7NA 2FKEA 1F8AB 4MNLA 4LAYA 1WNOA 2MPHA 2F2DA 2LGOA 1EYMA 3UI6A 4P8VA 1FAPA 3UQAA 4LAXA 1FJDA 1E9LA 2XPBA 4G50A 4ZPTR 2RURA 3O5MA 1D2KA 2KFWA 1XHGA 3B7XA 1Q6HA 2QF8A 4QT2A 4ML4A 1JNSA 5HUAA 3KAHA 4L72B 2PPNA 4MNJA 2RQSA 1FKIA 1LL7A 4XAKA 3W4RA 3WD3A 4DRPA 1NMWA 3OOBA 1QPLA 4JFLA 3G6LA 5HKGA 1PINA 4PTMA 1FFRA 3ARXA 2XP6A 3B9DA 4MTVA 1LG1A 4IQCA 1W1PA 4Z2IA 3CHCA 1HJXA 1P5QA 1HXVA 1E6RA 5HWBA 3B9AA 1W1YA 3NI6A 2VCDA 3PR9A 4KQZA 4DT4A 3O5RA 4LAWA 4Z2GA 3IKDA 1E6NA 1UR8A 3AS2A 2KI3A 2PV3A 1J4RA 3PRDA 2MLZA 2PV2A 2N87A 4R5EA 2IUZA 2DG4A 2L2SA 3PRAA 4WKAA 3UQBA 3IHZA 2F21A 4W9QA 4MPKA 1KFWA 3UF8A 2UZ5A 1TCOC 5HWCA 1Y0OA 1ROUA 2ZQSA 3G6MA 3ODKA 4DZ2A 4DZ3A 1FKJA 2FAPA 1HKMA 4ODLA 1M5YA 4DWSC 4MNMA 4ODNA 1JVWA 3ARTA 2G41A 1NSGA 3H9RB 3PRBA 5JH8A 4ITZA 3IKGA 2YBUA 1OGGA 2DT2A 1NH6A 3CZ8A 2DSVA 5HW8A 2FDMA 3B9EA 3KADA 5HT1A 3B8SA 2F4EA 1ZBKA 2M1IA 4NSBA 1FKLA 4JFKA 4NNRA 1FKFA 2M08A 4JYSA 5HW7A 4MGVA 4FAPA 5J6EA 1LG2A 4JFJA 5HBFA 1JNTA 3O5IA 3UI5A 1EIBA 4ODQA 2MF9A 4R0XA 2DG3A 1X6LA 1R9HA 3ARWA 4Z2KA 5HTGA 3ARRA 1J6YA 3RMEA 3VAWA 4GIVA 2DG9A 2ZQTA 4DROA 2PV1A 2RSEA 4TW8A 1ZBCA 2G8ZA 1Q6UA 3NTPA 3EY6A 4J4OA 1ZB5A 2JZVA 1J4IA 3NRKA 4HBOA 4AY1A 3ALGA 4HBEA 3QOKA 3ARPA 1D7IA 2O9OA 4TNSA 2KO7A 5DIVA 2XP4A 4DRNA 4P8XA 2WK2A 4URIA 4BF8A 2DSZA 3ALFA 3JXVA 3WL1A 4DRKA 1LL4A 1ZU8A 2WLYA 3O5FA 2Q5AA 2PPPA 2YBTA 4O2TA 4ZPVR 3AS1A 1OGBA 1EQ3A 4MSPA 3ARZA 5GQBA 4FN2A 1X6NA 1FKSA 2VN1A 1KT0A 3LUOA 4ODPA 2ZR6A 3TCZA 4DWSA 1NWUA 4HARA 1FKKA 1KT1A 3CH9A 3WD0A 2ESCA 1Q1CA 4S3JA 3ARUA 1W9VA 2IF4A 2XP5A 1FKRA 1GOIA 5GPRA 3FY1A 2XP8A 3BXWA 3O5QA 3AS3A 4G2PA 1HJVA 1D7HA 1IX5A 2A3AA 3TC5A 3JYMA 5BXJA 3O5LA 1ITXA 1ZBVA 3O5KA 4WKFA 1JNEA 2A3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J6E A;  1YAT A;  4JFJ A;  3UI4 A;  2LGO A;  1JNT A;  1EYM A;  3UI6 A;  3O5I A;  1FAP A;  4TX0 A;  3UI5 A;  2MPH A;  4ODQ A;  2PBC A;  2MF9 A;  1BKF A;  3UQA A;  4LAX A;  1FJD A;  4R0X A;  3CGN A;  3UQI A;  4IQ2 A;  2DG3 A;  1R9H A;  2XPB A;  4G50 A;  5HTG A;  1J6Y A;  2RUR A;  3O5M A;  2KFW A;  4GIV A;  3VAW A;  3B7X A;  1ZCN A;  1PBK A;  1L1P A;  2DG9 A;  2ZQT A;  3MDY B;  4JFI A;  1Q6H A;  2PV1 A;  1ROT A;  4DRO A;  2RSE A;  3O5J A;  2LJ4 A;  4TW8 A;  3WH0 A;  4QT2 A;  2ZR4 A;  1B6C A;  1D6O A;  3O5G A;  4IPX A;  1FKT A;  1T11 A;  3KAI A;  4QT3 A;  1Q6U A;  4DRQ A;  3NTP A;  3KAH A;  5HUA A;  3CGM A;  3EY6 A;  3KAG A;  4J4O A;  2PPN A;  2JZV A;  2RQS A;  1FKI A;  2D9F A;  1J4I A;  1W26 A;  3NRK A;  4DRP A;  2Y78 A;  1FD9 A;  1NMW A;  3OOB A;  3JYJ A;  4W9O A;  1QPL A;  3KCE A;  1D7I A;  4JFL A;  5HKG A;  1FKB A;  1PIN A;  3O5D A;  2XP6 A;  4U84 A;  5DIT A;  4ODO A;  2KO7 A;  4TNS A;  5DIV A;  4IQC A;  2RUC A;  2XP4 A;  4DRN A;  4BF8 A;  1QPF A;  5I98 A;  2RUQ A;  1P5Q A;  4ODM A;  1HXV A;  5HWB A;  3JXV A;  2OFN A;  3O5P A;  1N1A A;  4DRK A;  4DRI A;  1Q6I A;  1NMV A;  3GPK A;  2VCD A;  3FAP A;  3NI6 A;  4C02 B;  3KZ7 A;  4DT4 A;  3O5R A;  4J4N A;  4LAW A;  4ODR A;  1BL4 A;  3O5E A;  3O5F A;  2MLY A;  3IKD A;  4DIP A;  2Q5A A;  2KI3 A;  2PV3 A;  1J4R A;  3PRD A;  2MLZ A;  1ZK6 A;  2PPP A;  1C9H A;  2N87 A;  2PV2 A;  2MLX A;  3O5O A;  4O2T A;  4ODK A;  2DG4 A;  2L2S A;  4DRH A;  3UQB A;  3IHZ A;  3PA7 A;  2F21 A;  4W9Q A;  4U86 A;  1EQ3 A;  4MSP A;  4DRJ A;  2ZQV A;  1J4H A;  5DIU A;  3UF8 A;  2UZ5 A;  1FKD A;  1TCO C;  2ZR5 A;  4FN2 A;  4QIB A;  1FKS A;  4N19 A;  2VN1 A;  1KT0 A;  3RFW A;  2MNT A;  3LUO A;  4ODP A;  5HWC A;  1Y0O A;  2ZR6 A;  3I6C A;  1ROU A;  2LPV A;  3TCZ A;  3KAC A;  2M2A A;  2ZQS A;  1FKH A;  1U79 A;  3KAB A;  3ODK A;  1FKK A;  1KT1 A;  4DZ2 A;  2AWG A;  5D75 A;  4DZ3 A;  1FKJ A;  3TDB A;  2FAP A;  1Q1C A;  4ODL A;  1M5Y A;  2KE0 A;  4ODN A;  1JVW A;  4DRM A;  2IF4 A;  1NSG A;  3H9R B;  2KGJ A;  3PRB A;  2XP5 A;  3IK8 A;  4W9P A;  5B8I C;  5HW6 A;  1FKR A;  1YW5 A;  2XP9 A;  4ITZ A;  3IKG A;  4TW7 A;  1QZ2 A;  4TW6 A;  2LKN A;  2XPA A;  2KR7 A;  2XP8 A;  2XP3 A;  2ZQU A;  3O5Q A;  4U85 A;  4DH0 A;  2RUD A;  1D7J A;  3RGC A;  5HW8 A;  4G2P A;  1JNS A;  2ITK A;  3KAD A;  5HT1 A;  3KAF A;  5GPG A;  2F4E A;  2PPO A;  1D7H A;  2M1I A;  1A7X A;  1FKG A;  4JFM A;  2K8I A;  3TC5 A;  1FKL A;  2XP7 A;  3JYM A;  4GGQ A;  5BXJ A;  1F40 A;  3O5L A;  4TYO A;  4JFK A;  4NNR A;  1FKF A;  2M08 A;  2FKE A;  3O5K A;  4JYS A;  4LAV A;  1F8A B;  4MGV A;  5HW7 A;  4LAY A;  4FAP A;  2F2D A; 
#chains in the Genus database with same CATH topology
 1YAT A;  2F23 A;  3UI4 A;  4IT4 A;  1E6Z A;  3WIJ A;  1E15 A;  1BKF A;  1JND A;  3CGN A;  3UQI A;  4LGX A;  1W1V A;  4L3N A;  4Z2L A;  4Q22 A;  2DT0 A;  2LJ4 A;  3AQU A;  1B6C A;  1D6O A;  3O5G A;  4WIW A;  1T11 A;  2B31 A;  3KAI A;  4QT3 A;  4KR0 B;  3CGM A;  3KAG A;  1SYT A;  2WLZ A;  2WM0 A;  3WD1 A;  2DT1 A;  2Y78 A;  1TFV A;  4W9O A;  3KCE A;  4U84 A;  5DIT A;  4ODO A;  2RUC A;  4NZC A;  5I98 A;  1JCH B;  2RUQ A;  4ODM A;  3ARS A;  2OFN A;  3O5P A;  4DRI A;  1NMV A;  3GPK A;  1W9P A;  4QZV B;  4ODR A;  2OLH A;  3O5E A;  2MLY A;  4P8U A;  1ZK6 A;  4UDM A;  3O5O A;  4DRH A;  2EUL A;  1XRV A;  4U86 A;  3BMB A;  4DRJ A;  3CHE A;  1H0I A;  2ZQV A;  2DPE A;  1J4H A;  5DIU A;  3ARQ A;  1NWS A;  2DT3 A;  3I6C A;  2LPV A;  3KAC A;  4DWS B;  1FKH A;  1U79 A;  2AWG A;  1CTN A;  1GPF A;  1ZL1 A;  1WAW A;  5DF0 A;  1LJY A;  3WL0 A;  4DRM A;  4MAV A;  2KGJ A;  2P4V A;  4IT6 A;  4W9P A;  1SR0 A;  5B8I C;  2O92 A;  1YW5 A;  1W9U A;  1QZ2 A;  1UR9 A;  3WD2 A;  2LKN A;  2XP3 A;  4U85 A;  3RGC A;  3CHF A;  2ITK A;  1OWQ A;  4Z2J A;  3KAF A;  5DO2 A;  2PPO A;  1W1T A;  1FKG A;  4JFM A;  5DEZ A;  1HKI A;  4TYO A;  2A3C A;  4ZS6 A;  4LAV A;  1RD6 A;  3AS0 A;  2DSU A;  3OA5 A;  3RM9 A;  4MNK A;  4TX0 A;  3WQW A;  2PBC A;  3ARY A;  4IQ2 A;  4Z2H A;  4DWS D;  1ZCN A;  1PBK A;  3WD4 A;  1L1P A;  3MDY B;  4JFI A;  1ROT A;  3O5J A;  1VF8 A;  3WH0 A;  3GU0 A;  2ZR4 A;  3CHD A;  4IPX A;  1FKT A;  4DRQ A;  1EDQ A;  2D9F A;  1W26 A;  1FD9 A;  4ZPW R;  3JYJ A;  3FXY A;  1FKB A;  3O5D A;  1QPF A;  1HJW A;  1N1A A;  1E44 A;  1Q6I A;  4W5U A;  4P8W A;  1LQ0 A;  4WK9 A;  4S3K A;  3FAP A;  4C02 B;  3KZ7 A;  4J4N A;  1BL4 A;  4DIP A;  1C9H A;  3WKZ A;  3RM8 A;  2MLX A;  4ODK A;  1H0G A;  1O6I A;  1WB0 A;  3PA7 A;  2DSW A;  1E6P A;  4WKH A;  1NWR A;  1LL6 A;  1ZBW A;  1FKD A;  2ZR5 A;  4QIB A;  4N19 A;  3ARO A;  3RFW A;  1EHN A;  2MNT A;  1HKK A;  4WJX A;  2M2A A;  3KAB A;  5D75 A;  3TDB A;  2PI6 A;  2KE0 A;  1HKJ A;  2AOS A;  3RM4 A;  3IK8 A;  5HW6 A;  1FFQ A;  1GUV A;  3WQV A;  2XP9 A;  4TW7 A;  1NWT A;  4TW6 A;  2XPA A;  2KR7 A;  2ZQU A;  4DH0 A;  3ARV A;  2RUD A;  1D7J A;  5GPG A;  1A7X A;  2K8I A;  1K9T A;  2XP7 A;  2A3B A;  4GGQ A;  1F40 A;  4Q7N A;  2FKE A;  1F8A B;  4MNL A;  4LAY A;  1WNO A;  2MPH A;  2F2D A;  2LGO A;  1EYM A;  3UI6 A;  4P8V A;  1FAP A;  3UQA A;  4LAX A;  1FJD A;  1E9L A;  2XPB A;  4G50 A;  4ZPT R;  2RUR A;  3O5M A;  1D2K A;  2KFW A;  1XHG A;  3B7X A;  1Q6H A;  2QF8 A;  4QT2 A;  4ML4 A;  1JNS A;  5HUA A;  3KAH A;  4L72 B;  2PPN A;  4MNJ A;  2RQS A;  1FKI A;  1LL7 A;  4XAK A;  3W4R A;  3WD3 A;  4DRP A;  1NMW A;  3OOB A;  1QPL A;  4JFL A;  3G6L A;  5HKG A;  1PIN A;  4PTM A;  1FFR A;  3ARX A;  2XP6 A;  3B9D A;  4MTV A;  1LG1 A;  4IQC A;  1W1P A;  4Z2I A;  3CHC A;  1HJX A;  1P5Q A;  1HXV A;  1E6R A;  5HWB A;  3B9A A;  1W1Y A;  3NI6 A;  2VCD A;  3PR9 A;  4KQZ A;  4DT4 A;  3O5R A;  3EIP A;  4LAW A;  4Z2G A;  3IKD A;  1E6N A;  1UR8 A;  3AS2 A;  2KI3 A;  2PV3 A;  1J4R A;  3PRD A;  2MLZ A;  2PV2 A;  2N87 A;  4R5E A;  2IUZ A;  2DG4 A;  2L2S A;  3PRA A;  4WKA A;  3UQB A;  3IHZ A;  2F21 A;  4W9Q A;  4MPK A;  1KFW A;  3UF8 A;  2UZ5 A;  1TCO C;  5HWC A;  1Y0O A;  1ROU A;  2ZQS A;  3G6M A;  3ODK A;  4DZ2 A;  4DZ3 A;  1FKJ A;  2FAP A;  1HKM A;  4ODL A;  1M5Y A;  4DWS C;  4MNM A;  4ODN A;  1JVW A;  3ART A;  2G41 A;  1NSG A;  3H9R B;  3PRB A;  5JH8 A;  4ITZ A;  3IKG A;  2YBU A;  1OGG A;  2DT2 A;  3GTY X;  1NH6 A;  3CZ8 A;  2DSV A;  5HW8 A;  2FDM A;  3B9E A;  3KAD A;  5HT1 A;  3B8S A;  2F4E A;  1ZBK A;  2M1I A;  4NSB A;  1FKL A;  4JFK A;  4NNR A;  1FKF A;  2M08 A;  4JYS A;  5HW7 A;  4MGV A;  4FAP A;  5J6E A;  1LG2 A;  4JFJ A;  5HBF A;  2ETN A;  1JNT A;  3O5I A;  3UI5 A;  1EIB A;  4ODQ A;  2MF9 A;  4R0X A;  2DG3 A;  1X6L A;  1R9H A;  3ARW A;  4Z2K A;  5HTG A;  3ARR A;  1J6Y A;  2PN0 A;  3RME A;  3VAW A;  4GIV A;  2DG9 A;  2ZQT A;  4DRO A;  2PV1 A;  2RSE A;  4TW8 A;  2B5U B;  1ZBC A;  2G8Z A;  1Q6U A;  3NTP A;  3EY6 A;  4J4O A;  1ZB5 A;  2JZV A;  1J4I A;  3NRK A;  4HBO A;  4AY1 A;  3ALG A;  4HBE A;  3QOK A;  3ARP A;  1D7I A;  2O9O A;  4TNS A;  2KO7 A;  5DIV A;  2XP4 A;  4DRN A;  4P8X A;  2WK2 A;  4URI A;  4BF8 A;  2DSZ A;  3ALF A;  3JXV A;  3WL1 A;  4DRK A;  1LL4 A;  1ZU8 A;  2WLY A;  3O5F A;  2Q5A A;  2PPP A;  2YBT A;  4O2T A;  4ZPV R;  3AS1 A;  1OGB A;  1EQ3 A;  4MSP A;  3ARZ A;  5GQB A;  4FN2 A;  1X6N A;  1FKS A;  2VN1 A;  1KT0 A;  3LUO A;  4ODP A;  2ZR6 A;  3TCZ A;  4DWS A;  1NWU A;  1GRJ A;  4HAR A;  1FKK A;  1KT1 A;  3CH9 A;  3WD0 A;  2ESC A;  1Q1C A;  4S3J A;  3ARU A;  1W9V A;  2IF4 A;  2XP5 A;  1FKR A;  1GOI A;  5GPR A;  3FY1 A;  2XP8 A;  3BXW A;  3O5Q A;  3AS3 A;  4G2P A;  1HJV A;  1D7H A;  1IX5 A;  2A3A A;  3TC5 A;  3JYM A;  5BXJ A;  3O5L A;  1ITX A;  1ZBV A;  3O5K A;  4WKF A;  1JNE A;  2A3E A; 
#chains in the Genus database with same CATH homology
 1YAT A;  3UI4 A;  4IT4 A;  1E6Z A;  3WIJ A;  1E15 A;  1BKF A;  1JND A;  3CGN A;  3UQI A;  4LGX A;  1W1V A;  4L3N A;  4Z2L A;  4Q22 A;  2DT0 A;  2LJ4 A;  3AQU A;  1B6C A;  1D6O A;  3O5G A;  4WIW A;  1T11 A;  2B31 A;  3KAI A;  4QT3 A;  4KR0 B;  3CGM A;  3KAG A;  1SYT A;  2WLZ A;  2WM0 A;  3WD1 A;  2DT1 A;  2Y78 A;  1TFV A;  4W9O A;  3KCE A;  4U84 A;  5DIT A;  4ODO A;  2RUC A;  4NZC A;  5I98 A;  2RUQ A;  4ODM A;  3ARS A;  2OFN A;  3O5P A;  4DRI A;  1NMV A;  3GPK A;  1W9P A;  4QZV B;  4ODR A;  2OLH A;  3O5E A;  2MLY A;  4P8U A;  1ZK6 A;  3O5O A;  4DRH A;  1XRV A;  4U86 A;  4DRJ A;  3CHE A;  1H0I A;  2ZQV A;  2DPE A;  1J4H A;  5DIU A;  3ARQ A;  1NWS A;  2DT3 A;  3I6C A;  2LPV A;  3KAC A;  4DWS B;  1FKH A;  1U79 A;  2AWG A;  1CTN A;  1GPF A;  1ZL1 A;  1WAW A;  5DF0 A;  1LJY A;  3WL0 A;  4DRM A;  4MAV A;  2KGJ A;  4IT6 A;  4W9P A;  1SR0 A;  5B8I C;  2O92 A;  1YW5 A;  1W9U A;  1QZ2 A;  1UR9 A;  3WD2 A;  2LKN A;  2XP3 A;  4U85 A;  3RGC A;  3CHF A;  2ITK A;  1OWQ A;  4Z2J A;  3KAF A;  5DO2 A;  2PPO A;  1W1T A;  1FKG A;  4JFM A;  5DEZ A;  1HKI A;  4TYO A;  2A3C A;  4ZS6 A;  4LAV A;  1RD6 A;  3AS0 A;  2DSU A;  3OA5 A;  3RM9 A;  4MNK A;  4TX0 A;  3WQW A;  2PBC A;  3ARY A;  4IQ2 A;  4Z2H A;  4DWS D;  1ZCN A;  1PBK A;  3WD4 A;  1L1P A;  3MDY B;  4JFI A;  1ROT A;  3O5J A;  1VF8 A;  3WH0 A;  2ZR4 A;  3CHD A;  4IPX A;  1FKT A;  4DRQ A;  1EDQ A;  2D9F A;  1W26 A;  1FD9 A;  4ZPW R;  3JYJ A;  3FXY A;  1FKB A;  3O5D A;  1QPF A;  1HJW A;  1N1A A;  1Q6I A;  4W5U A;  4P8W A;  1LQ0 A;  4WK9 A;  4S3K A;  3FAP A;  4C02 B;  3KZ7 A;  4J4N A;  1BL4 A;  4DIP A;  1C9H A;  3WKZ A;  3RM8 A;  2MLX A;  4ODK A;  1H0G A;  1O6I A;  1WB0 A;  3PA7 A;  2DSW A;  1E6P A;  4WKH A;  1NWR A;  1LL6 A;  1ZBW A;  1FKD A;  2ZR5 A;  4QIB A;  4N19 A;  3ARO A;  3RFW A;  1EHN A;  2MNT A;  1HKK A;  4WJX A;  2M2A A;  3KAB A;  5D75 A;  3TDB A;  2PI6 A;  2KE0 A;  1HKJ A;  2AOS A;  3RM4 A;  3IK8 A;  5HW6 A;  1FFQ A;  1GUV A;  3WQV A;  2XP9 A;  4TW7 A;  1NWT A;  4TW6 A;  2XPA A;  2KR7 A;  2ZQU A;  4DH0 A;  3ARV A;  2RUD A;  1D7J A;  5GPG A;  1A7X A;  2K8I A;  1K9T A;  2XP7 A;  2A3B A;  4GGQ A;  1F40 A;  4Q7N A;  2FKE A;  1F8A B;  4MNL A;  4LAY A;  1WNO A;  2MPH A;  2F2D A;  2LGO A;  1EYM A;  3UI6 A;  4P8V A;  1FAP A;  3UQA A;  4LAX A;  1FJD A;  1E9L A;  2XPB A;  4G50 A;  4ZPT R;  2RUR A;  3O5M A;  1D2K A;  2KFW A;  1XHG A;  3B7X A;  1Q6H A;  2QF8 A;  4QT2 A;  4ML4 A;  1JNS A;  5HUA A;  3KAH A;  4L72 B;  2PPN A;  4MNJ A;  2RQS A;  1FKI A;  1LL7 A;  4XAK A;  3W4R A;  3WD3 A;  4DRP A;  1NMW A;  3OOB A;  1QPL A;  4JFL A;  3G6L A;  5HKG A;  1PIN A;  4PTM A;  1FFR A;  3ARX A;  2XP6 A;  3B9D A;  4MTV A;  1LG1 A;  4IQC A;  1W1P A;  4Z2I A;  3CHC A;  1HJX A;  1P5Q A;  1HXV A;  1E6R A;  5HWB A;  3B9A A;  1W1Y A;  3NI6 A;  2VCD A;  3PR9 A;  4KQZ A;  4DT4 A;  3O5R A;  4LAW A;  4Z2G A;  3IKD A;  1E6N A;  1UR8 A;  3AS2 A;  2KI3 A;  2PV3 A;  1J4R A;  3PRD A;  2MLZ A;  2PV2 A;  2N87 A;  4R5E A;  2IUZ A;  2DG4 A;  2L2S A;  3PRA A;  4WKA A;  3UQB A;  3IHZ A;  2F21 A;  4W9Q A;  4MPK A;  1KFW A;  3UF8 A;  2UZ5 A;  1TCO C;  5HWC A;  1Y0O A;  1ROU A;  2ZQS A;  3G6M A;  3ODK A;  4DZ2 A;  4DZ3 A;  1FKJ A;  2FAP A;  1HKM A;  4ODL A;  1M5Y A;  4DWS C;  4MNM A;  4ODN A;  1JVW A;  3ART A;  2G41 A;  1NSG A;  3H9R B;  3PRB A;  5JH8 A;  4ITZ A;  3IKG A;  2YBU A;  1OGG A;  2DT2 A;  1NH6 A;  3CZ8 A;  2DSV A;  5HW8 A;  2FDM A;  3B9E A;  3KAD A;  5HT1 A;  3B8S A;  2F4E A;  1ZBK A;  2M1I A;  4NSB A;  1FKL A;  4JFK A;  4NNR A;  1FKF A;  2M08 A;  4JYS A;  5HW7 A;  4MGV A;  4FAP A;  5J6E A;  1LG2 A;  4JFJ A;  5HBF A;  1JNT A;  3O5I A;  3UI5 A;  1EIB A;  4ODQ A;  2MF9 A;  4R0X A;  2DG3 A;  1X6L A;  1R9H A;  3ARW A;  4Z2K A;  5HTG A;  3ARR A;  1J6Y A;  3RME A;  3VAW A;  4GIV A;  2DG9 A;  2ZQT A;  4DRO A;  2PV1 A;  2RSE A;  4TW8 A;  1ZBC A;  2G8Z A;  1Q6U A;  3NTP A;  3EY6 A;  4J4O A;  1ZB5 A;  2JZV A;  1J4I A;  3NRK A;  4HBO A;  4AY1 A;  3ALG A;  4HBE A;  3QOK A;  3ARP A;  1D7I A;  2O9O A;  4TNS A;  2KO7 A;  5DIV A;  2XP4 A;  4DRN A;  4P8X A;  2WK2 A;  4URI A;  4BF8 A;  2DSZ A;  3ALF A;  3JXV A;  3WL1 A;  4DRK A;  1LL4 A;  1ZU8 A;  2WLY A;  3O5F A;  2Q5A A;  2PPP A;  2YBT A;  4O2T A;  4ZPV R;  3AS1 A;  1OGB A;  1EQ3 A;  4MSP A;  3ARZ A;  5GQB A;  4FN2 A;  1X6N A;  1FKS A;  2VN1 A;  1KT0 A;  3LUO A;  4ODP A;  2ZR6 A;  3TCZ A;  4DWS A;  1NWU A;  4HAR A;  1FKK A;  1KT1 A;  3CH9 A;  3WD0 A;  2ESC A;  1Q1C A;  4S3J A;  3ARU A;  1W9V A;  2IF4 A;  2XP5 A;  1FKR A;  1GOI A;  5GPR A;  3FY1 A;  2XP8 A;  3BXW A;  3O5Q A;  3AS3 A;  4G2P A;  1HJV A;  1D7H A;  1IX5 A;  2A3A A;  3TC5 A;  3JYM A;  5BXJ A;  3O5L A;  1ITX A;  1ZBV A;  3O5K A;  4WKF A;  1JNE A;  2A3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...