4QT2A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with rapamycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
publication title Two crystal structures of the FK506-binding domain of Plasmodium falciparum FKBP35 in complex with rapamycin at high resolution
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 34
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qt2A01
3O5MA 1FKKA 3UI5A 2VN1A 2KI3A 5J6EA 3CGNA 5DIVA 4TW6A 4W9OA 4FN2A 3O5PA 4ODQA 1D7IA 4ODKA 5DITA 5HTGA 4FAPA 3CGMA 1TCOC 3O5EA 4LAWA 1J6YA 1JNTA 2XP3A 5HW8A 5HW6A 1J4HA 5HUAA 4DT4A 1ROTA 2KO7A 4ODNA 3UF8A 2MPHA 3KADA 4NNRA 4U85A 1QPLA 3KABA 3RFWA 1QPFA 2DG4A 1ROUA 1Y0OA 4IPXA 4ODRA 3LUOA 1FKBA 3KCEA 2KFWA 3KACA 4W9PA 3O5IA 3RGCA 5I98A 3MDYB 2JZVA 5HKGA 1NMWA 4LAXA 4O2TA 2RSEA 4DRJA 2XP4A 2XPBA 2F4EA 1J4IA 1D7JA 4DRMA 1R9HA 1FKFA 4R0XA 4DRKA 3KAGA 3NTPA 5DIUA 2KR7A 1ZK6A 1U79A 2MNTA 2M1IA 3KAIA 3O5JA 1L1PA 3JYJA 3IKDA 2K8IA 3OOBA 4DRQA 3PA7A 2OFNA 2MLZA 1J4RA 4J4OA 2LKNA 4G2PA 3ODKA 2XPAA 4LAVA 3O5LA 1PINA 2XP9A 2RUDA 3TDBA 4TW7A 3O5KA 2KGJA 2MLYA 2N87A 3UQIA 3TCZA 1HXVA 1EYMA 5GPGA 1B6CA 5D75A 1FJDA 2ZQTA 2PV2A 3UQBA 4DZ2A 2M08A 4JFLA 2LGOA 4MGVA 4G50A 4U84A 1FKSA 3O5GA 1BKFA 2MLXA 4DRPA 1YATA 1JNSA 3O5QA 1D7HA 4QT2A 2ZQSA 2PPPA 1M5YA 1FKTA 4IQCA 1Q6HA 4J4NA 4GGQA 3IK8A 2FAPA 3WH0A 4C02B 4JYSA 1NSGA 3O5RA 4DH0A 1FKRA 2Y78A 2ZR5A 1FKDA 2DG3A 1F40A 3GPKA 4JFMA 5B8IC 3NI6A 1Q1CA 1KT0A 3PRBA 3UI6A 3JXVA 1Q6IA 3IKGA 4W9QA 1F8AB 2MF9A 3I6CA 3O5DA 5HWCA 3EY6A 2KE0A 1FKIA 3UQAA 2PV1A 2LPVA 2PPNA 3TC5A 1FD9A 1Q6UA 1ZCNA 4TYOA 1EQ3A 2XP7A 2IF4A 1C9HA 1QZ2A 4DRNA 1NMVA 3H9RB 2PPOA 4TX0A 4DIPA 2RURA 2ZQUA 4N19A 1A7XA 1BL4A 2F21A 3KAFA 2PV3A 1FKHA 4TNSA 3B7XA 1FKLA 3PRDA 3IHZA 1W26A 2F2DA 5HT1A 1P5QA 1PBKA 5HW7A 3JYMA 3KZ7A 1N1AA 4ODOA 2LJ4A 2UZ5A 3UI4A 4JFIA 5BXJA 4ODPA 2FKEA 5HWBA 2M2AA 3FAPA 4BF8A 2ZR4A 4QIBA 4TW8A 2AWGA 1YW5A 3VAWA 1KT1A 1JVWA 2XP6A 4JFKA 2RQSA 1D6OA 4DROA 4MSPA 2Q5AA 1T11A 2XP8A 4ITZA 4U86A 4ODLA 2L2SA 2VCDA 4QT3A 4DRIA 2ITKA 1FKGA 2RUCA 2RUQA 2D9FA 2PBCA 4DRHA 2ZR6A 4JFJA 2DG9A 1FKJA 2ZQVA 3O5OA 4GIVA 4IQ2A 4ODMA 3NRKA 4DZ3A 1FAPA 3KAHA 4LAYA 2XP5A 3O5FA
chains in the Genus database with same CATH superfamily
1FKKA 2VN1A 3CGNA 5DITA 4ODKA 4NSBA 3RM9A 3CGMA 3O5EA 2DT0A 2KO7A 3UF8A 4U85A 4NNRA 1IX5A 3ARYA 2DG4A 3GTYX 3CHDA 4ODRA 1FKBA 3WQVA 3O5IA 1H0IA 2YBTA 2B31A 2RSEA 2XPBA 4FAPA 1J4IA 2F4EA 4DRMA 4DRKA 4R0XA 2KR7A 1ZK6A 3ARVA 3KAIA 5HBFA 3OOBA 2MLZA 3B9AA 2LKNA 4WJXA 3O5LA 2EULA 4P8VA 2MLYA 2N87A 3UQIA 5GPGA 5D75A 2ZQTA 3ARUA 3UQBA 1NWTA 4MGVA 3RM8A 1EIBA 1YATA 2ZQSA 1JNDA 4IQCA 4DH0A 3IK8A 4C02B 4JYSA 3O5RA 2Y78A 1X6LA 1F40A 3BMBA 5B8IC 1HKIA 1E6RA 3JXVA 3OA5A 1FKIA 3UQAA 4WKAA 2PV1A 3ARZA 1ZCNA 4S3JA 4TYOA 1EQ3A 1H0GA 1QZ2A 1XHGA 1NMVA 4ZS6A 4W9PA 4TNSA 1FKHA 5HT1A 3ARSA 2YBUA 4JFIA 5BXJA 2DSUA 3ARWA 3WL0A 3ALGA 4MNLA 4MPKA 3WKZA 3VAWA 1LG1A 1KT1A 2XP6A 1ZU8A 1E6PA 2RQSA 4JFKA 4L3NA 4P8UA 1E9LA 4U86A 4MNMA 4ODLA 4QT3A 2A3EA 4DRHA 4DWSB 1OGBA 3AS2A 2WM0A 4IQ2A 3B9EA 3ARPA 3KAHA 1LL4A 4W5UA 3AS0A 3UI5A 1WNOA 5DIVA 4TW6A 4ODQA 1D7IA 4Q7NA 1E6ZA 1JNTA 1ROTA 3B9DA 4WKFA 3KADA 2G8ZA 1QPLA 4ML4A 1W9UA 3RFWA 3FY1A 3WIJA 2A3AA 4IPXA 3LUOA 2DSWA 3KCEA 4S3KA 3G6MA 5I98A 3CHEA 1NMWA 1NWSA 1NWUA 4HBOA 2XP4A 1O6IA 3NTPA 3CZ8A 2M1IA 3O5JA 3JYJA 1LG2A 3ARXA 1J4RA 4J4OA 2XPAA 2XP9A 1OWQA 3TDBA 4WIWA 2KGJA 3ARRA 3TCZA 1B6CA 1FJDA 2PV2A 1W1PA 4DWSD 4U84A 1BKFA 4PTMA 1FFQA 2DSVA 1JNSA 3O5QA 4QT2A 4AY1A 1W1YA 3WD0A 1FKDA 3GPKA 1HJVA 2P4VA 3UI6A 1KT0A 3PRBA 1Q6IA 1GOIA 3I6CA 4ZPWR 3EY6A 2KE0A 3PR9A 1LJYA 1CTNA 4IT4A 3AS3A 1RD6A 2WLYA 1W9VA 4DWSC 4ZPTR 2B5UB 2PPOA 1JNEA 4WKHA 4TX0A 4N19A 1A7XA 1P5QA 2ETNA 3UI4A 2QF8A 4P8XA 1TFVA 4WK9A 3FAPA 1D6OA 4MSPA 1T11A 3AROA 3W4RA 2L2SA 4DRIA 4KR0B 1HKMA 2RUCA 2RUQA 2PBCA 4JFJA 2DG9A 1K9TA 1JCHB 1ZB5A 4UDMA 1D7JA 1D7HA 1SR0A 2XP5A 2A3CA 3O5FA 4HARA 5JH8A 3B8SA 5J6EA 3AQUA 4Q22A 4FN2A 1TCOC 4LAWA 4MTVA 1J6YA 5HW8A 4DT4A 3CHCA 4MNKA 1X6NA 1WB0A 2MPHA 1Y0OA 1SYTA 4LGXA 3MDYB 2JZVA 4O2TA 4DWSA 4DRJA 1FKFA 1R9HA 5DO2A 1E6NA 2MNTA 3AS1A 3RMEA 2K8IA 4IT6A 4TW7A 1ZBKA 3O5KA 1HXVA 1EYMA 1LL6A 2PI6A 4DZ2A 1OGGA 2LGOA 1EDQA 4Z2LA 4G50A 1FFRA 4MAVA 3O5GA 2MLXA 4DRPA 1ITXA 4KQZA 1M5YA 1FKTA 3WH0A 1GUVA 1Q6HA 1FKRA 3BXWA 1GPFA 3NI6A 1Q1CA 3WQWA 3IKGA 5HWCA 4URIA 3O5DA 1HKKA 3ARQA 2PN0A 2LPVA 2PPNA 3PRAA 1FD9A 3TC5A 3WD2A 1C9HA 1W9PA 4HBEA 4NZCA 3H9RB 2OLHA 4DIPA 2PV3A 1WAWA 3PRDA 1W26A 2DT3A 1PBKA 5HW7A 3KZ7A 2WLZA 1N1AA 2UZ5A 4ODPA 2FKEA 2M2AA 2ZR4A 5DF0A 4QIBA 1HKJA 2AWGA 4L72B 1YW5A 1LL7A 3WD3A 1GRJA 1VF8A 2A3BA 4ITZA 2IUZA 2VCDA 2ITKA 1FKGA 4Z2GA 2D9FA 2ZR6A 2ZQVA 4GIVA 1FAPA 1UR9A 1NWRA 3O5MA 2KI3A 4W9OA 3ARTA 3O5PA 2DT1A 5HTGA 3ALFA 2XP3A 5HUAA 5HW6A 1J4HA 4ODNA 2DPEA 5DEZA 3KABA 1QPFA 3QOKA 1D2KA 1ROUA 2KFWA 3KACA 3RGCA 5HKGA 4LAXA 2DSZA 4DROA 3KAGA 5DIUA 1U79A 1NH6A 2O9OA 1L1PA 3WL1A 4Z2KA 3IKDA 4DRQA 3PA7A 2OFNA 4G2PA 5GQBA 3ODKA 2AOSA 4LAVA 1PINA 3CHFA 2RUDA 3RM4A 1W1TA 2M08A 2WK2A 4JFLA 1E44A 1ZBWA 1HJWA 1FKSA 1UR8A 4Z2IA 2PPPA 4J4NA 4GGQA 2FAPA 1NSGA 2ESCA 3CH9A 2ZR5A 1E15A 2DG3A 4ZPVR 4JFMA 4W9QA 1F8AB 1XRVA 1ZBVA 2MF9A 4XAKA 5GPRA 1KFWA 3WD4A 1ZL1A 1Q6UA 4MNJA 2XP7A 2IF4A 2DT2A 3G6LA 1W1VA 2FDMA 4DRNA 2RURA 2ZQUA 1BL4A 2F21A 3KAFA 3EIPA 3FXYA 4Z2JA 3B7XA 1FKLA 2F23A 3IHZA 2F2DA 4R5EA 4P8WA 3JYMA 4ODOA 2LJ4A 2G41A 3WD1A 5HWBA 4BF8A 1EHNA 4Z2HA 1HJXA 4TW8A 1ZBCA 1JVWA 3GU0A 2O92A 2Q5AA 2XP8A 1FKJA 3O5OA 4QZVB 4ODMA 3NRKA 4DZ3A 4LAYA 1LQ0A
chains in the Genus database with same CATH topology
1FKKA 2VN1A 3CGNA 5DITA 4ODKA 4NSBA 3RM9A 3CGMA 3O5EA 2DT0A 2KO7A 3UF8A 4U85A 4NNRA 1IX5A 3ARYA 2DG4A 3CHDA 4ODRA 1FKBA 3WQVA 3O5IA 1H0IA 2YBTA 2B31A 2RSEA 2XPBA 4FAPA 1J4IA 2F4EA 4DRMA 4DRKA 4R0XA 2KR7A 1ZK6A 3ARVA 3KAIA 5HBFA 3OOBA 2MLZA 3B9AA 2LKNA 4WJXA 3O5LA 4P8VA 2MLYA 2N87A 3UQIA 5GPGA 5D75A 2ZQTA 3ARUA 3UQBA 1NWTA 4MGVA 3RM8A 1EIBA 1YATA 2ZQSA 1JNDA 4IQCA 4DH0A 3IK8A 4C02B 4JYSA 3O5RA 2Y78A 1X6LA 1F40A 5B8IC 1HKIA 1E6RA 3JXVA 3OA5A 1FKIA 3UQAA 4WKAA 2PV1A 3ARZA 1ZCNA 4S3JA 4TYOA 1EQ3A 1H0GA 1QZ2A 1XHGA 1NMVA 4ZS6A 4W9PA 4TNSA 1FKHA 5HT1A 3ARSA 2YBUA 4JFIA 5BXJA 2DSUA 3ARWA 3WL0A 3ALGA 4MNLA 4MPKA 3WKZA 3VAWA 1LG1A 1KT1A 2XP6A 1ZU8A 1E6PA 2RQSA 4JFKA 4L3NA 4P8UA 1E9LA 4U86A 4MNMA 4ODLA 4QT3A 2A3EA 4DRHA 4DWSB 1OGBA 3AS2A 2WM0A 4IQ2A 3B9EA 3ARPA 3KAHA 1LL4A 4W5UA 3AS0A 3UI5A 1WNOA 5DIVA 4TW6A 4ODQA 1D7IA 4Q7NA 1E6ZA 1JNTA 1ROTA 3B9DA 4WKFA 3KADA 2G8ZA 1QPLA 4ML4A 1W9UA 3RFWA 3FY1A 3WIJA 2A3AA 4IPXA 3LUOA 2DSWA 3KCEA 4S3KA 3G6MA 5I98A 3CHEA 1NMWA 1NWSA 1NWUA 4HBOA 2XP4A 1O6IA 3NTPA 3CZ8A 2M1IA 3O5JA 3JYJA 1LG2A 3ARXA 1J4RA 4J4OA 2XPAA 2XP9A 1OWQA 3TDBA 4WIWA 2KGJA 3ARRA 3TCZA 1B6CA 1FJDA 2PV2A 1W1PA 4DWSD 4U84A 1BKFA 4PTMA 1FFQA 2DSVA 1JNSA 3O5QA 4QT2A 4AY1A 1W1YA 3WD0A 1FKDA 3GPKA 1HJVA 3UI6A 1KT0A 3PRBA 1Q6IA 1GOIA 3I6CA 4ZPWR 3EY6A 2KE0A 3PR9A 1LJYA 1CTNA 4IT4A 3AS3A 1RD6A 2WLYA 1W9VA 4DWSC 4ZPTR 2PPOA 1JNEA 4WKHA 4TX0A 4N19A 1A7XA 1P5QA 3UI4A 2QF8A 4P8XA 1TFVA 4WK9A 3FAPA 1D6OA 4MSPA 1T11A 3AROA 3W4RA 2L2SA 4DRIA 4KR0B 1HKMA 2RUCA 2RUQA 2PBCA 4JFJA 2DG9A 1K9TA 1ZB5A 1D7JA 1D7HA 1SR0A 2XP5A 2A3CA 3O5FA 4HARA 5JH8A 3B8SA 5J6EA 3AQUA 4Q22A 4FN2A 1TCOC 4LAWA 4MTVA 1J6YA 5HW8A 4DT4A 3CHCA 4MNKA 1X6NA 1WB0A 2MPHA 1Y0OA 1SYTA 4LGXA 3MDYB 2JZVA 4O2TA 4DWSA 4DRJA 1FKFA 1R9HA 5DO2A 1E6NA 2MNTA 3AS1A 3RMEA 2K8IA 4IT6A 4TW7A 1ZBKA 3O5KA 1HXVA 1EYMA 1LL6A 2PI6A 4DZ2A 1OGGA 2LGOA 1EDQA 4Z2LA 4G50A 1FFRA 4MAVA 3O5GA 2MLXA 4DRPA 1ITXA 4KQZA 1M5YA 1FKTA 3WH0A 1GUVA 1Q6HA 1FKRA 3BXWA 1GPFA 3NI6A 1Q1CA 3WQWA 3IKGA 5HWCA 4URIA 3O5DA 1HKKA 3ARQA 2LPVA 2PPNA 3PRAA 1FD9A 3TC5A 3WD2A 1C9HA 1W9PA 4HBEA 4NZCA 3H9RB 2OLHA 4DIPA 2PV3A 1WAWA 3PRDA 1W26A 2DT3A 1PBKA 5HW7A 3KZ7A 2WLZA 1N1AA 2UZ5A 4ODPA 2FKEA 2M2AA 2ZR4A 5DF0A 4QIBA 1HKJA 2AWGA 4L72B 1YW5A 1LL7A 3WD3A 1VF8A 2A3BA 4ITZA 2IUZA 2VCDA 2ITKA 1FKGA 4Z2GA 2D9FA 2ZR6A 2ZQVA 4GIVA 1FAPA 1UR9A 1NWRA 3O5MA 2KI3A 4W9OA 3ARTA 3O5PA 2DT1A 5HTGA 3ALFA 2XP3A 5HUAA 5HW6A 1J4HA 4ODNA 2DPEA 5DEZA 3KABA 1QPFA 3QOKA 1D2KA 1ROUA 2KFWA 3KACA 3RGCA 5HKGA 4LAXA 2DSZA 4DROA 3KAGA 5DIUA 1U79A 1NH6A 2O9OA 1L1PA 3WL1A 4Z2KA 3IKDA 4DRQA 3PA7A 2OFNA 4G2PA 5GQBA 3ODKA 2AOSA 4LAVA 1PINA 3CHFA 2RUDA 3RM4A 1W1TA 2M08A 2WK2A 4JFLA 1ZBWA 1HJWA 1FKSA 1UR8A 4Z2IA 2PPPA 4J4NA 4GGQA 2FAPA 1NSGA 2ESCA 3CH9A 2ZR5A 1E15A 2DG3A 4ZPVR 4JFMA 4W9QA 1F8AB 1XRVA 1ZBVA 2MF9A 4XAKA 5GPRA 1KFWA 3WD4A 1ZL1A 1Q6UA 4MNJA 2XP7A 2IF4A 2DT2A 3G6LA 1W1VA 2FDMA 4DRNA 2RURA 2ZQUA 1BL4A 2F21A 3FXYA 3KAFA 4Z2JA 3B7XA 1FKLA 3IHZA 2F2DA 4R5EA 4P8WA 3JYMA 4ODOA 2LJ4A 2G41A 3WD1A 5HWBA 4BF8A 1EHNA 4Z2HA 1HJXA 4TW8A 1ZBCA 1JVWA 2O92A 2Q5AA 2XP8A 1FKJA 3O5OA 4QZVB 4ODMA 3NRKA 4DZ3A 4LAYA 1LQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5M A;  1FKK A;  3UI5 A;  2VN1 A;  2KI3 A;  5J6E A;  3CGN A;  5DIV A;  4TW6 A;  4W9O A;  4FN2 A;  3O5P A;  4ODQ A;  1D7I A;  4ODK A;  5DIT A;  5HTG A;  4FAP A;  3CGM A;  1TCO C;  3O5E A;  4LAW A;  1J6Y A;  1JNT A;  2XP3 A;  5HW8 A;  5HW6 A;  1J4H A;  5HUA A;  4DT4 A;  1ROT A;  2KO7 A;  4ODN A;  3UF8 A;  2MPH A;  3KAD A;  4NNR A;  4U85 A;  1QPL A;  3KAB A;  3RFW A;  1QPF A;  2DG4 A;  1ROU A;  1Y0O A;  4IPX A;  4ODR A;  3LUO A;  1FKB A;  3KCE A;  2KFW A;  3KAC A;  4W9P A;  3O5I A;  3RGC A;  5I98 A;  3MDY B;  2JZV A;  5HKG A;  1NMW A;  4LAX A;  4O2T A;  2RSE A;  4DRJ A;  2XP4 A;  2XPB A;  2F4E A;  1J4I A;  1D7J A;  4DRM A;  1R9H A;  1FKF A;  4R0X A;  4DRK A;  3KAG A;  3NTP A;  5DIU A;  2KR7 A;  1ZK6 A;  1U79 A;  2MNT A;  2M1I A;  3KAI A;  3O5J A;  1L1P A;  3JYJ A;  3IKD A;  2K8I A;  3OOB A;  4DRQ A;  3PA7 A;  2OFN A;  2MLZ A;  1J4R A;  4J4O A;  2LKN A;  4G2P A;  3ODK A;  2XPA A;  4LAV A;  3O5L A;  1PIN A;  2XP9 A;  2RUD A;  3TDB A;  4TW7 A;  3O5K A;  2KGJ A;  2MLY A;  2N87 A;  3UQI A;  3TCZ A;  1HXV A;  1EYM A;  5GPG A;  1B6C A;  5D75 A;  1FJD A;  2ZQT A;  2PV2 A;  3UQB A;  4DZ2 A;  2M08 A;  4JFL A;  2LGO A;  4MGV A;  4G50 A;  4U84 A;  1FKS A;  3O5G A;  1BKF A;  2MLX A;  4DRP A;  1YAT A;  1JNS A;  3O5Q A;  1D7H A;  4QT2 A;  2ZQS A;  2PPP A;  1M5Y A;  1FKT A;  4IQC A;  1Q6H A;  4J4N A;  4GGQ A;  3IK8 A;  2FAP A;  3WH0 A;  4C02 B;  4JYS A;  1NSG A;  3O5R A;  4DH0 A;  1FKR A;  2Y78 A;  2ZR5 A;  1FKD A;  2DG3 A;  1F40 A;  3GPK A;  4JFM A;  5B8I C;  3NI6 A;  1Q1C A;  1KT0 A;  3PRB A;  3UI6 A;  3JXV A;  1Q6I A;  3IKG A;  4W9Q A;  1F8A B;  2MF9 A;  3I6C A;  3O5D A;  5HWC A;  3EY6 A;  2KE0 A;  1FKI A;  3UQA A;  2PV1 A;  2LPV A;  2PPN A;  3TC5 A;  1FD9 A;  1Q6U A;  1ZCN A;  4TYO A;  1EQ3 A;  2XP7 A;  2IF4 A;  1C9H A;  1QZ2 A;  4DRN A;  1NMV A;  3H9R B;  2PPO A;  4TX0 A;  4DIP A;  2RUR A;  2ZQU A;  4N19 A;  1A7X A;  1BL4 A;  2F21 A;  3KAF A;  2PV3 A;  1FKH A;  4TNS A;  3B7X A;  1FKL A;  3PRD A;  3IHZ A;  1W26 A;  2F2D A;  5HT1 A;  1P5Q A;  1PBK A;  5HW7 A;  3JYM A;  3KZ7 A;  1N1A A;  4ODO A;  2LJ4 A;  2UZ5 A;  3UI4 A;  4JFI A;  5BXJ A;  4ODP A;  2FKE A;  5HWB A;  2M2A A;  3FAP A;  4BF8 A;  2ZR4 A;  4QIB A;  4TW8 A;  2AWG A;  1YW5 A;  3VAW A;  1KT1 A;  1JVW A;  2XP6 A;  4JFK A;  2RQS A;  1D6O A;  4DRO A;  4MSP A;  2Q5A A;  1T11 A;  2XP8 A;  4ITZ A;  4U86 A;  4ODL A;  2L2S A;  2VCD A;  4QT3 A;  4DRI A;  2ITK A;  1FKG A;  2RUC A;  2RUQ A;  2D9F A;  2PBC A;  4DRH A;  2ZR6 A;  4JFJ A;  2DG9 A;  1FKJ A;  2ZQV A;  3O5O A;  4GIV A;  4IQ2 A;  4ODM A;  3NRK A;  4DZ3 A;  1FAP A;  3KAH A;  4LAY A;  2XP5 A;  3O5F A; 
#chains in the Genus database with same CATH topology
 1FKK A;  2VN1 A;  3CGN A;  5DIT A;  4ODK A;  4NSB A;  3RM9 A;  3CGM A;  3O5E A;  2DT0 A;  2KO7 A;  3UF8 A;  4U85 A;  4NNR A;  1IX5 A;  3ARY A;  2DG4 A;  3GTY X;  3CHD A;  4ODR A;  1FKB A;  3WQV A;  3O5I A;  1H0I A;  2YBT A;  2B31 A;  2RSE A;  2XPB A;  4FAP A;  1J4I A;  2F4E A;  4DRM A;  4DRK A;  4R0X A;  2KR7 A;  1ZK6 A;  3ARV A;  3KAI A;  5HBF A;  3OOB A;  2MLZ A;  3B9A A;  2LKN A;  4WJX A;  3O5L A;  2EUL A;  4P8V A;  2MLY A;  2N87 A;  3UQI A;  5GPG A;  5D75 A;  2ZQT A;  3ARU A;  3UQB A;  1NWT A;  4MGV A;  3RM8 A;  1EIB A;  1YAT A;  2ZQS A;  1JND A;  4IQC A;  4DH0 A;  3IK8 A;  4C02 B;  4JYS A;  3O5R A;  2Y78 A;  1X6L A;  1F40 A;  3BMB A;  5B8I C;  1HKI A;  1E6R A;  3JXV A;  3OA5 A;  1FKI A;  3UQA A;  4WKA A;  2PV1 A;  3ARZ A;  1ZCN A;  4S3J A;  4TYO A;  1EQ3 A;  1H0G A;  1QZ2 A;  1XHG A;  1NMV A;  4ZS6 A;  4W9P A;  4TNS A;  1FKH A;  5HT1 A;  3ARS A;  2YBU A;  4JFI A;  5BXJ A;  2DSU A;  3ARW A;  3WL0 A;  3ALG A;  4MNL A;  4MPK A;  3WKZ A;  3VAW A;  1LG1 A;  1KT1 A;  2XP6 A;  1ZU8 A;  1E6P A;  2RQS A;  4JFK A;  4L3N A;  4P8U A;  1E9L A;  4U86 A;  4MNM A;  4ODL A;  4QT3 A;  2A3E A;  4DRH A;  4DWS B;  1OGB A;  3AS2 A;  2WM0 A;  4IQ2 A;  3B9E A;  3ARP A;  3KAH A;  1LL4 A;  4W5U A;  3AS0 A;  3UI5 A;  1WNO A;  5DIV A;  4TW6 A;  4ODQ A;  1D7I A;  4Q7N A;  1E6Z A;  1JNT A;  1ROT A;  3B9D A;  4WKF A;  3KAD A;  2G8Z A;  1QPL A;  4ML4 A;  1W9U A;  3RFW A;  3FY1 A;  3WIJ A;  2A3A A;  4IPX A;  3LUO A;  2DSW A;  3KCE A;  4S3K A;  3G6M A;  5I98 A;  3CHE A;  1NMW A;  1NWS A;  1NWU A;  4HBO A;  2XP4 A;  1O6I A;  3NTP A;  3CZ8 A;  2M1I A;  3O5J A;  3JYJ A;  1LG2 A;  3ARX A;  1J4R A;  4J4O A;  2XPA A;  2XP9 A;  1OWQ A;  3TDB A;  4WIW A;  2KGJ A;  3ARR A;  3TCZ A;  1B6C A;  1FJD A;  2PV2 A;  1W1P A;  4DWS D;  4U84 A;  1BKF A;  4PTM A;  1FFQ A;  2DSV A;  1JNS A;  3O5Q A;  4QT2 A;  4AY1 A;  1W1Y A;  3WD0 A;  1FKD A;  3GPK A;  1HJV A;  2P4V A;  3UI6 A;  1KT0 A;  3PRB A;  1Q6I A;  1GOI A;  3I6C A;  4ZPW R;  3EY6 A;  2KE0 A;  3PR9 A;  1LJY A;  1CTN A;  4IT4 A;  3AS3 A;  1RD6 A;  2WLY A;  1W9V A;  4DWS C;  4ZPT R;  2B5U B;  2PPO A;  1JNE A;  4WKH A;  4TX0 A;  4N19 A;  1A7X A;  1P5Q A;  2ETN A;  3UI4 A;  2QF8 A;  4P8X A;  1TFV A;  4WK9 A;  3FAP A;  1D6O A;  4MSP A;  1T11 A;  3ARO A;  3W4R A;  2L2S A;  4DRI A;  4KR0 B;  1HKM A;  2RUC A;  2RUQ A;  2PBC A;  4JFJ A;  2DG9 A;  1K9T A;  1JCH B;  1ZB5 A;  4UDM A;  1D7J A;  1D7H A;  1SR0 A;  2XP5 A;  2A3C A;  3O5F A;  4HAR A;  5JH8 A;  3B8S A;  5J6E A;  3AQU A;  4Q22 A;  4FN2 A;  1TCO C;  4LAW A;  4MTV A;  1J6Y A;  5HW8 A;  4DT4 A;  3CHC A;  4MNK A;  1X6N A;  1WB0 A;  2MPH A;  1Y0O A;  1SYT A;  4LGX A;  3MDY B;  2JZV A;  4O2T A;  4DWS A;  4DRJ A;  1FKF A;  1R9H A;  5DO2 A;  1E6N A;  2MNT A;  3AS1 A;  3RME A;  2K8I A;  4IT6 A;  4TW7 A;  1ZBK A;  3O5K A;  1HXV A;  1EYM A;  1LL6 A;  2PI6 A;  4DZ2 A;  1OGG A;  2LGO A;  1EDQ A;  4Z2L A;  4G50 A;  1FFR A;  4MAV A;  3O5G A;  2MLX A;  4DRP A;  1ITX A;  4KQZ A;  1M5Y A;  1FKT A;  3WH0 A;  1GUV A;  1Q6H A;  1FKR A;  3BXW A;  1GPF A;  3NI6 A;  1Q1C A;  3WQW A;  3IKG A;  5HWC A;  4URI A;  3O5D A;  1HKK A;  3ARQ A;  2PN0 A;  2LPV A;  2PPN A;  3PRA A;  1FD9 A;  3TC5 A;  3WD2 A;  1C9H A;  1W9P A;  4HBE A;  4NZC A;  3H9R B;  2OLH A;  4DIP A;  2PV3 A;  1WAW A;  3PRD A;  1W26 A;  2DT3 A;  1PBK A;  5HW7 A;  3KZ7 A;  2WLZ A;  1N1A A;  2UZ5 A;  4ODP A;  2FKE A;  2M2A A;  2ZR4 A;  5DF0 A;  4QIB A;  1HKJ A;  2AWG A;  4L72 B;  1YW5 A;  1LL7 A;  3WD3 A;  1GRJ A;  1VF8 A;  2A3B A;  4ITZ A;  2IUZ A;  2VCD A;  2ITK A;  1FKG A;  4Z2G A;  2D9F A;  2ZR6 A;  2ZQV A;  4GIV A;  1FAP A;  1UR9 A;  1NWR A;  3O5M A;  2KI3 A;  4W9O A;  3ART A;  3O5P A;  2DT1 A;  5HTG A;  3ALF A;  2XP3 A;  5HUA A;  5HW6 A;  1J4H A;  4ODN A;  2DPE A;  5DEZ A;  3KAB A;  1QPF A;  3QOK A;  1D2K A;  1ROU A;  2KFW A;  3KAC A;  3RGC A;  5HKG A;  4LAX A;  2DSZ A;  4DRO A;  3KAG A;  5DIU A;  1U79 A;  1NH6 A;  2O9O A;  1L1P A;  3WL1 A;  4Z2K A;  3IKD A;  4DRQ A;  3PA7 A;  2OFN A;  4G2P A;  5GQB A;  3ODK A;  2AOS A;  4LAV A;  1PIN A;  3CHF A;  2RUD A;  3RM4 A;  1W1T A;  2M08 A;  2WK2 A;  4JFL A;  1E44 A;  1ZBW A;  1HJW A;  1FKS A;  1UR8 A;  4Z2I A;  2PPP A;  4J4N A;  4GGQ A;  2FAP A;  1NSG A;  2ESC A;  3CH9 A;  2ZR5 A;  1E15 A;  2DG3 A;  4ZPV R;  4JFM A;  4W9Q A;  1F8A B;  1XRV A;  1ZBV A;  2MF9 A;  4XAK A;  5GPR A;  1KFW A;  3WD4 A;  1ZL1 A;  1Q6U A;  4MNJ A;  2XP7 A;  2IF4 A;  2DT2 A;  3G6L A;  1W1V A;  2FDM A;  4DRN A;  2RUR A;  2ZQU A;  1BL4 A;  2F21 A;  3KAF A;  3EIP A;  3FXY A;  4Z2J A;  3B7X A;  1FKL A;  2F23 A;  3IHZ A;  2F2D A;  4R5E A;  4P8W A;  3JYM A;  4ODO A;  2LJ4 A;  2G41 A;  3WD1 A;  5HWB A;  4BF8 A;  1EHN A;  4Z2H A;  1HJX A;  4TW8 A;  1ZBC A;  1JVW A;  3GU0 A;  2O92 A;  2Q5A A;  2XP8 A;  1FKJ A;  3O5O A;  4QZV B;  4ODM A;  3NRK A;  4DZ3 A;  4LAY A;  1LQ0 A; 
#chains in the Genus database with same CATH homology
 1FKK A;  2VN1 A;  3CGN A;  5DIT A;  4ODK A;  4NSB A;  3RM9 A;  3CGM A;  3O5E A;  2DT0 A;  2KO7 A;  3UF8 A;  4U85 A;  4NNR A;  1IX5 A;  3ARY A;  2DG4 A;  3CHD A;  4ODR A;  1FKB A;  3WQV A;  3O5I A;  1H0I A;  2YBT A;  2B31 A;  2RSE A;  2XPB A;  4FAP A;  1J4I A;  2F4E A;  4DRM A;  4DRK A;  4R0X A;  2KR7 A;  1ZK6 A;  3ARV A;  3KAI A;  5HBF A;  3OOB A;  2MLZ A;  3B9A A;  2LKN A;  4WJX A;  3O5L A;  4P8V A;  2MLY A;  2N87 A;  3UQI A;  5GPG A;  5D75 A;  2ZQT A;  3ARU A;  3UQB A;  1NWT A;  4MGV A;  3RM8 A;  1EIB A;  1YAT A;  2ZQS A;  1JND A;  4IQC A;  4DH0 A;  3IK8 A;  4C02 B;  4JYS A;  3O5R A;  2Y78 A;  1X6L A;  1F40 A;  5B8I C;  1HKI A;  1E6R A;  3JXV A;  3OA5 A;  1FKI A;  3UQA A;  4WKA A;  2PV1 A;  3ARZ A;  1ZCN A;  4S3J A;  4TYO A;  1EQ3 A;  1H0G A;  1QZ2 A;  1XHG A;  1NMV A;  4ZS6 A;  4W9P A;  4TNS A;  1FKH A;  5HT1 A;  3ARS A;  2YBU A;  4JFI A;  5BXJ A;  2DSU A;  3ARW A;  3WL0 A;  3ALG A;  4MNL A;  4MPK A;  3WKZ A;  3VAW A;  1LG1 A;  1KT1 A;  2XP6 A;  1ZU8 A;  1E6P A;  2RQS A;  4JFK A;  4L3N A;  4P8U A;  1E9L A;  4U86 A;  4MNM A;  4ODL A;  4QT3 A;  2A3E A;  4DRH A;  4DWS B;  1OGB A;  3AS2 A;  2WM0 A;  4IQ2 A;  3B9E A;  3ARP A;  3KAH A;  1LL4 A;  4W5U A;  3AS0 A;  3UI5 A;  1WNO A;  5DIV A;  4TW6 A;  4ODQ A;  1D7I A;  4Q7N A;  1E6Z A;  1JNT A;  1ROT A;  3B9D A;  4WKF A;  3KAD A;  2G8Z A;  1QPL A;  4ML4 A;  1W9U A;  3RFW A;  3FY1 A;  3WIJ A;  2A3A A;  4IPX A;  3LUO A;  2DSW A;  3KCE A;  4S3K A;  3G6M A;  5I98 A;  3CHE A;  1NMW A;  1NWS A;  1NWU A;  4HBO A;  2XP4 A;  1O6I A;  3NTP A;  3CZ8 A;  2M1I A;  3O5J A;  3JYJ A;  1LG2 A;  3ARX A;  1J4R A;  4J4O A;  2XPA A;  2XP9 A;  1OWQ A;  3TDB A;  4WIW A;  2KGJ A;  3ARR A;  3TCZ A;  1B6C A;  1FJD A;  2PV2 A;  1W1P A;  4DWS D;  4U84 A;  1BKF A;  4PTM A;  1FFQ A;  2DSV A;  1JNS A;  3O5Q A;  4QT2 A;  4AY1 A;  1W1Y A;  3WD0 A;  1FKD A;  3GPK A;  1HJV A;  3UI6 A;  1KT0 A;  3PRB A;  1Q6I A;  1GOI A;  3I6C A;  4ZPW R;  3EY6 A;  2KE0 A;  3PR9 A;  1LJY A;  1CTN A;  4IT4 A;  3AS3 A;  1RD6 A;  2WLY A;  1W9V A;  4DWS C;  4ZPT R;  2PPO A;  1JNE A;  4WKH A;  4TX0 A;  4N19 A;  1A7X A;  1P5Q A;  3UI4 A;  2QF8 A;  4P8X A;  1TFV A;  4WK9 A;  3FAP A;  1D6O A;  4MSP A;  1T11 A;  3ARO A;  3W4R A;  2L2S A;  4DRI A;  4KR0 B;  1HKM A;  2RUC A;  2RUQ A;  2PBC A;  4JFJ A;  2DG9 A;  1K9T A;  1ZB5 A;  1D7J A;  1D7H A;  1SR0 A;  2XP5 A;  2A3C A;  3O5F A;  4HAR A;  5JH8 A;  3B8S A;  5J6E A;  3AQU A;  4Q22 A;  4FN2 A;  1TCO C;  4LAW A;  4MTV A;  1J6Y A;  5HW8 A;  4DT4 A;  3CHC A;  4MNK A;  1X6N A;  1WB0 A;  2MPH A;  1Y0O A;  1SYT A;  4LGX A;  3MDY B;  2JZV A;  4O2T A;  4DWS A;  4DRJ A;  1FKF A;  1R9H A;  5DO2 A;  1E6N A;  2MNT A;  3AS1 A;  3RME A;  2K8I A;  4IT6 A;  4TW7 A;  1ZBK A;  3O5K A;  1HXV A;  1EYM A;  1LL6 A;  2PI6 A;  4DZ2 A;  1OGG A;  2LGO A;  1EDQ A;  4Z2L A;  4G50 A;  1FFR A;  4MAV A;  3O5G A;  2MLX A;  4DRP A;  1ITX A;  4KQZ A;  1M5Y A;  1FKT A;  3WH0 A;  1GUV A;  1Q6H A;  1FKR A;  3BXW A;  1GPF A;  3NI6 A;  1Q1C A;  3WQW A;  3IKG A;  5HWC A;  4URI A;  3O5D A;  1HKK A;  3ARQ A;  2LPV A;  2PPN A;  3PRA A;  1FD9 A;  3TC5 A;  3WD2 A;  1C9H A;  1W9P A;  4HBE A;  4NZC A;  3H9R B;  2OLH A;  4DIP A;  2PV3 A;  1WAW A;  3PRD A;  1W26 A;  2DT3 A;  1PBK A;  5HW7 A;  3KZ7 A;  2WLZ A;  1N1A A;  2UZ5 A;  4ODP A;  2FKE A;  2M2A A;  2ZR4 A;  5DF0 A;  4QIB A;  1HKJ A;  2AWG A;  4L72 B;  1YW5 A;  1LL7 A;  3WD3 A;  1VF8 A;  2A3B A;  4ITZ A;  2IUZ A;  2VCD A;  2ITK A;  1FKG A;  4Z2G A;  2D9F A;  2ZR6 A;  2ZQV A;  4GIV A;  1FAP A;  1UR9 A;  1NWR A;  3O5M A;  2KI3 A;  4W9O A;  3ART A;  3O5P A;  2DT1 A;  5HTG A;  3ALF A;  2XP3 A;  5HUA A;  5HW6 A;  1J4H A;  4ODN A;  2DPE A;  5DEZ A;  3KAB A;  1QPF A;  3QOK A;  1D2K A;  1ROU A;  2KFW A;  3KAC A;  3RGC A;  5HKG A;  4LAX A;  2DSZ A;  4DRO A;  3KAG A;  5DIU A;  1U79 A;  1NH6 A;  2O9O A;  1L1P A;  3WL1 A;  4Z2K A;  3IKD A;  4DRQ A;  3PA7 A;  2OFN A;  4G2P A;  5GQB A;  3ODK A;  2AOS A;  4LAV A;  1PIN A;  3CHF A;  2RUD A;  3RM4 A;  1W1T A;  2M08 A;  2WK2 A;  4JFL A;  1ZBW A;  1HJW A;  1FKS A;  1UR8 A;  4Z2I A;  2PPP A;  4J4N A;  4GGQ A;  2FAP A;  1NSG A;  2ESC A;  3CH9 A;  2ZR5 A;  1E15 A;  2DG3 A;  4ZPV R;  4JFM A;  4W9Q A;  1F8A B;  1XRV A;  1ZBV A;  2MF9 A;  4XAK A;  5GPR A;  1KFW A;  3WD4 A;  1ZL1 A;  1Q6U A;  4MNJ A;  2XP7 A;  2IF4 A;  2DT2 A;  3G6L A;  1W1V A;  2FDM A;  4DRN A;  2RUR A;  2ZQU A;  1BL4 A;  2F21 A;  3FXY A;  3KAF A;  4Z2J A;  3B7X A;  1FKL A;  3IHZ A;  2F2D A;  4R5E A;  4P8W A;  3JYM A;  4ODO A;  2LJ4 A;  2G41 A;  3WD1 A;  5HWB A;  4BF8 A;  1EHN A;  4Z2H A;  1HJX A;  4TW8 A;  1ZBC A;  1JVW A;  2O92 A;  2Q5A A;  2XP8 A;  1FKJ A;  3O5O A;  4QZV B;  4ODM A;  3NRK A;  4DZ3 A;  4LAY A;  1LQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...