4QT2A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with rapamycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
publication title Two crystal structures of the FK506-binding domain of Plasmodium falciparum FKBP35 in complex with rapamycin at high resolution
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Isomerase
total genus 34
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qt2A01
1A7XA 4IPXA 2DG3A 2KGJA 1EYMA 3CGMA 3O5KA 1Q6IA 4QT3A 3UI4A 5BXJA 2XP9A 3KABA 5HT1A 5J6EA 2XP7A 3IKGA 3O5OA 1D7IA 1NSGA 3NI6A 4R0XA 3O5FA 4DRNA 1FAPA 1KT0A 2ZR6A 2M1IA 4IQCA 1FKDA 5HW6A 3KACA 1PBKA 1ROUA 3O5GA 3RGCA 3O5PA 2KE0A 3O5IA 5I98A 4DRQA 2ZQUA 3PRBA 3ODKA 1FKKA 4U86A 5HWBA 2PV1A 3VAWA 4MSPA 4JFMA 1ZCNA 1T11A 3TDBA 2ZQSA 3EY6A 4DRHA 1ROTA 1W26A 4NNRA 4ODQA 1C9HA 3KAHA 2K8IA 2KO7A 3UQAA 1J6YA 4JFJA 4ODRA 1P5QA 1Q6HA 4ODKA 2M2AA 3B7XA 2L2SA 3I6CA 3OOBA 3KCEA 2D9FA 2MLYA 4FN2A 5HW8A 1FKJA 2F2DA 1QPFA 2ZR5A 3KAFA 3UQIA 3KADA 2IF4A 1FKRA 4DIPA 1L1PA 1JNTA 1J4RA 1BKFA 3IK8A 1M5YA 4U85A 1F8AB 3JXVA 4DRKA 2MPHA 1FKFA 2Y78A 2PPOA 2RQSA 3FAPA 4FAPA 1R9HA 4G50A 1FD9A 4J4NA 4TW6A 2PV2A 4QIBA 1FKHA 4DRPA 4DZ2A 2VN1A 3O5MA 4ITZA 4DH0A 2LJ4A 3CGNA 4GIVA 2RURA 3PRDA 1U79A 4DRIA 4ODMA 1B6CA 2ITKA 4BF8A 4DRJA 1D7HA 2JZVA 2DG4A 2MNTA 4LAWA 1NMVA 4O2TA 1TCOC 2OFNA 4MGVA 3NTPA 2LPVA 3IHZA 4LAXA 3O5LA 3TC5A 1J4HA 1NMWA 2XPBA 2PBCA 1Q6UA 2LGOA 3O5JA 4J4OA 5DIUA 2ZQTA 1F40A 4ODOA 1YW5A 2Q5AA 1J4IA 4TW8A 1EQ3A 2MF9A 2XP6A 3UI6A 5HUAA 4IQ2A 2ZQVA 2F4EA 1BL4A 2KR7A 2AWGA 2PV3A 3KZ7A 3O5DA 1KT1A 2LKNA 3NRKA 2F21A 4ODLA 4DRMA 5GPGA 1FKSA 2XP3A 3TCZA 4TYOA 1FKGA 2RUDA 2UZ5A 4DT4A 2VCDA 1ZK6A 2RSEA 3GPKA 1D7JA 2MLXA 4LAVA 4W9PA 1JVWA 1N1AA 2FAPA 3LUOA 4LAYA 4W9OA 4DROA 1FJDA 4JFLA 3KAGA 2DG9A 5DITA 3UF8A 4TW7A 1Y0OA 1FKLA 3O5RA 4DZ3A 3UI5A 3UQBA 2PPPA 1FKIA 4GGQA 3O5QA 4G2PA 2N87A 3O5EA 2KI3A 3H9RB 5DIVA 1YATA 3PA7A 2PPNA 3JYMA 4TNSA 5HWCA 2RUQA 4ODNA 4C02B 5HW7A 2XP8A 5D75A 2XP4A 4QT2A 2KFWA 4TX0A 1HXVA 3WH0A 4JFIA 5HKGA 1JNSA 2FKEA 2M08A 4JFKA 3KAIA 1D6OA 2XP5A 3RFWA 3MDYB 1Q1CA 2RUCA 3JYJA 4JYSA 4N19A 5HTGA 1FKBA 2MLZA 1PINA 1QZ2A 4W9QA 4U84A 5B8IC 3IKDA 2ZR4A 4ODPA 1QPLA 2XPAA 1FKTA
chains in the Genus database with same CATH superfamily
1A7XA 3CHFA 4IPXA 3O5KA 1EYMA 5BXJA 1E6NA 2B31A 3AS1A 2DSZA 3PRAA 4ML4A 4DWSA 1HKMA 1KT0A 1UR8A 2M1IA 4ZPWR 3B9EA 2A3AA 2KE0A 2YBUA 1LL7A 1FKKA 2PV1A 4MSPA 4W5UA 3TDBA 4DRHA 1ROTA 1W26A 3ARTA 4Z2HA 2IUZA 1J6YA 4ODRA 3ARSA 4ODKA 1ZBKA 3ARRA 3B7XA 3OOBA 2G41A 5HW8A 3ARXA 2DT2A 2FDMA 4PTMA 1L1PA 1WB0A 1E6ZA 1JNTA 1H0GA 1BKFA 3ARZA 2MPHA 3AS2A 3OA5A 3AS3A 3WD2A 1FKFA 4LGXA 4G50A 1W1YA 1OWQA 2PV2A 1FKHA 4DRPA 1NWRA 4DRIA 3CGNA 1U79A 4ODMA 2ITKA 1FFRA 1NMVA 4MGVA 3IHZA 1J4HA 1HJVA 1FFQA 3CH9A 3FXYA 3AQUA 2ZQTA 1F40A 4ODOA 1TFVA 1J4IA 2DSWA 3B9DA 1ZBWA 1BL4A 3UI6A 2AWGA 3WL0A 4DRMA 1K9TA 1KT1A 2F21A 2XP3A 3TCZA 4TYOA 1LQ0A 4MAVA 2VCDA 1W9VA 2RSEA 3GPKA 2MLXA 4LAVA 3WQVA 1FJDA 3ARQA 2DSUA 2DG9A 4L72B 4P8XA 1Y0OA 3UI5A 1NH6A 3ALGA 3ARUA 1X6NA 2PPNA 3B9AA 4TNSA 5HWCA 4DWSC 4Z2LA 3RM8A 4C02B 5D75A 4QT2A 1LL6A 4S3KA 2M08A 5DEZA 4KQZA 5HTGA 1LL4A 2MLZA 5B8IC 4U84A 3W4RA 3IKDA 1W1TA 1FAPA 3FY1A 1FKTA 1O6IA 2KGJA 3GU0A 4HBEA 3KABA 2YBTA 4WKHA 5HT1A 2XP7A 4R0XA 3O5OA 3O5FA 4DRNA 1FKDA 5HW6A 2PI6A 1SR0A 2A3EA 3KACA 3RGCA 3AS0A 4L3NA 3CHDA 4KR0B 4DRQA 2ZQUA 3ODKA 1ZU8A 4U86A 5GPRA 4JFMA 4WKAA 1ZCNA 3EIPA 2ZQSA 4MNKA 4NNRA 1ZBVA 4ODQA 1LG1A 4ZPVR 4FN2A 1QPFA 2P4VA 2OLHA 4DIPA 1ZL1A 1J4RA 1M5YA 4U85A 1F8AB 3JXVA 2PPOA 2RQSA 3FAPA 1XHGA 1W1VA 2ETNA 3CHEA 4J4NA 4TW6A 4QIBA 2EULA 4DWSB 2A3BA 1W1PA 3O5MA 4ITZA 4WJXA 3PRDA 1B6CA 4NZCA 1D7HA 2JZVA 1TCOC 2OFNA 3NTPA 1ITXA 4LAXA 3RMEA 3O5LA 4MPKA 4IT6A 1NMWA 2XPBA 4S3JA 2LGOA 3G6LA 4Z2KA 3CHCA 2Q5AA 1HJXA 4TW8A 1EQ3A 2MF9A 4IQ2A 3ARVA 2F4EA 2PV3A 4HARA 4ODLA 3BMBA 1HKKA 4QZVB 1ZK6A 1JVWA 2FAPA 4W9OA 1E6PA 1ZB5A 4JFLA 5DITA 4TW7A 1FKLA 3O5RA 2PPPA 3WD0A 2N87A 4MNJA 1D2KA 3WD1A 3PR9A 2XP8A 4MNMA 4DWSD 2WLZA 1JCHB 2KFWA 2O9OA 4JFIA 5HKGA 2FKEA 2AOSA 2O92A 1Q1CA 4JYSA 4UDMA 4WKFA 4W9QA 1NWSA 4ODPA 1QPLA 1GRJA 2ESCA 3UI4A 1Q6IA 3ALFA 2XP9A 1LJYA 5J6EA 3IKGA 1D7IA 1NSGA 4IQCA 3CZ8A 1H0IA 4Z2IA 1ROUA 2DPEA 3O5GA 3O5PA 5HWBA 3RM4A 1T11A 4Z2JA 1C9HA 3KAHA 3UQAA 2KO7A 1W9PA 4Q22A 4JFJA 1Q6HA 2M2AA 2L2SA 2WLYA 2DSVA 2D9FA 2MLYA 1FKJA 2F2DA 1SYTA 3G6MA 3KAFA 3UQIA 3KADA 1IX5A 1FKRA 1WNOA 1JNDA 3IK8A 1WAWA 3AROA 4FAPA 4HBOA 4IT4A 2LJ4A 4GIVA 1NWTA 4DRJA 1XRVA 2MNTA 2DG4A 4O2TA 4ZS6A 3WQWA 3WD4A 1OGBA 1RD6A 2LPVA 1Q6UA 5DIUA 1YW5A 2XP6A 5HUAA 2ZQVA 3WD3A 2KR7A 1E44A 1KFWA 1HKIA 4AY1A 4DT4A 2DT3A 3RM9A 1NWUA 3ARWA 3LUOA 4W9PA 4DROA 4URIA 3KAGA 4P8WA 3UF8A 4DZ3A 1FKIA 4GGQA 3O5QA 2KI3A 3H9RB 1YATA 4WIWA 3PA7A 3JYMA 4ODNA 5HW7A 1UR9A 2XP4A 1HXVA 3WH0A 3B8SA 4JFKA 3KAIA 2XP5A 3RFWA 2DT1A 2B5UB 3BXWA 5JH8A 4N19A 1FKBA 5GQBA 1QZ2A 2XPAA 2DG3A 3CGMA 4QT3A 2DT0A 2G8ZA 1HKJA 4R5EA 3NI6A 2A3CA 1HJWA 2ZR6A 1GOIA 2QF8A 1PBKA 3O5IA 5I98A 4NSBA 3PRBA 4Z2GA 1E15A 4XAKA 3VAWA 4MTVA 1ZBCA 3EY6A 3WKZA 2WM0A 2K8IA 1OGGA 3ARPA 1P5QA 3I6CA 3KCEA 2PN0A 3ARYA 2ZR5A 4Q7NA 2IF4A 2WK2A 4DRKA 2Y78A 3GTYX 1R9HA 4ZPTR 1FD9A 4DZ2A 2VN1A 4DH0A 2RURA 1GPFA 1CTNA 4P8UA 4BF8A 5DO2A 1GUVA 1JNEA 4P8VA 4LAWA 1E6RA 1LG2A 3TC5A 2PBCA 2F23A 3O5JA 4J4OA 1EDQA 4MNLA 1EHNA 3KZ7A 3O5DA 1X6LA 2LKNA 3NRKA 1EIBA 5GPGA 1FKSA 1FKGA 2RUDA 2UZ5A 1D7JA 3WIJA 1N1AA 4LAYA 3UQBA 1VF8A 4G2PA 3O5EA 4WK9A 5DIVA 5HBFA 2RUQA 3WL1A 4TX0A 1JNSA 1D6OA 5DF0A 3MDYB 2RUCA 3JYJA 1W9UA 1PINA 1E9LA 2ZR4A 3QOKA
chains in the Genus database with same CATH topology
1A7XA 3CHFA 4IPXA 3O5KA 1EYMA 5BXJA 1E6NA 2B31A 3AS1A 2DSZA 3PRAA 4ML4A 4DWSA 1HKMA 1KT0A 1UR8A 2M1IA 4ZPWR 3B9EA 2A3AA 2KE0A 2YBUA 1LL7A 1FKKA 2PV1A 4MSPA 4W5UA 3TDBA 4DRHA 1ROTA 1W26A 3ARTA 4Z2HA 2IUZA 1J6YA 4ODRA 3ARSA 4ODKA 1ZBKA 3ARRA 3B7XA 3OOBA 2G41A 5HW8A 3ARXA 2DT2A 2FDMA 4PTMA 1L1PA 1WB0A 1E6ZA 1JNTA 1H0GA 1BKFA 3ARZA 2MPHA 3AS2A 3OA5A 3AS3A 3WD2A 1FKFA 4LGXA 4G50A 1W1YA 1OWQA 2PV2A 1FKHA 4DRPA 1NWRA 4DRIA 3CGNA 1U79A 4ODMA 2ITKA 1FFRA 1NMVA 4MGVA 3IHZA 1J4HA 1HJVA 1FFQA 3CH9A 3FXYA 3AQUA 2ZQTA 1F40A 4ODOA 1TFVA 1J4IA 2DSWA 3B9DA 1ZBWA 1BL4A 3UI6A 2AWGA 3WL0A 4DRMA 1K9TA 1KT1A 2F21A 2XP3A 3TCZA 4TYOA 1LQ0A 4MAVA 2VCDA 1W9VA 2RSEA 3GPKA 2MLXA 4LAVA 3WQVA 1FJDA 3ARQA 2DSUA 2DG9A 4L72B 4P8XA 1Y0OA 3UI5A 1NH6A 3ALGA 3ARUA 1X6NA 2PPNA 3B9AA 4TNSA 5HWCA 4DWSC 4Z2LA 3RM8A 4C02B 5D75A 4QT2A 1LL6A 4S3KA 2M08A 5DEZA 4KQZA 5HTGA 1LL4A 2MLZA 5B8IC 4U84A 3W4RA 3IKDA 1W1TA 1FAPA 3FY1A 1FKTA 1O6IA 2KGJA 4HBEA 3KABA 2YBTA 4WKHA 5HT1A 2XP7A 4R0XA 3O5OA 3O5FA 4DRNA 1FKDA 5HW6A 2PI6A 1SR0A 2A3EA 3KACA 3RGCA 3AS0A 4L3NA 3CHDA 4KR0B 4DRQA 2ZQUA 3ODKA 1ZU8A 4U86A 5GPRA 4JFMA 4WKAA 1ZCNA 2ZQSA 4MNKA 4NNRA 1ZBVA 4ODQA 1LG1A 4ZPVR 4FN2A 1QPFA 2OLHA 4DIPA 1ZL1A 1J4RA 1M5YA 4U85A 1F8AB 3JXVA 2PPOA 2RQSA 3FAPA 1XHGA 1W1VA 3CHEA 4J4NA 4TW6A 4QIBA 4DWSB 2A3BA 1W1PA 3O5MA 4ITZA 4WJXA 3PRDA 1B6CA 4NZCA 1D7HA 2JZVA 1TCOC 2OFNA 3NTPA 1ITXA 4LAXA 3RMEA 3O5LA 4MPKA 4IT6A 1NMWA 2XPBA 4S3JA 2LGOA 3G6LA 4Z2KA 3CHCA 2Q5AA 1HJXA 4TW8A 1EQ3A 2MF9A 4IQ2A 3ARVA 2F4EA 2PV3A 4HARA 4ODLA 1HKKA 4QZVB 1ZK6A 1JVWA 2FAPA 4W9OA 1E6PA 1ZB5A 4JFLA 5DITA 4TW7A 1FKLA 3O5RA 2PPPA 3WD0A 2N87A 4MNJA 1D2KA 3WD1A 3PR9A 2XP8A 4MNMA 4DWSD 2WLZA 2KFWA 2O9OA 4JFIA 5HKGA 2FKEA 2AOSA 2O92A 1Q1CA 4JYSA 4WKFA 4W9QA 1NWSA 4ODPA 1QPLA 2ESCA 3UI4A 1Q6IA 3ALFA 2XP9A 1LJYA 5J6EA 3IKGA 1D7IA 1NSGA 4IQCA 3CZ8A 1H0IA 4Z2IA 1ROUA 2DPEA 3O5GA 3O5PA 5HWBA 3RM4A 1T11A 4Z2JA 1C9HA 3KAHA 3UQAA 2KO7A 1W9PA 4Q22A 4JFJA 1Q6HA 2M2AA 2L2SA 2WLYA 2DSVA 2D9FA 2MLYA 1FKJA 2F2DA 1SYTA 3G6MA 3KAFA 3UQIA 3KADA 1IX5A 1FKRA 1WNOA 1JNDA 3IK8A 1WAWA 3AROA 4FAPA 4HBOA 4IT4A 2LJ4A 4GIVA 1NWTA 4DRJA 1XRVA 2MNTA 2DG4A 4O2TA 4ZS6A 3WQWA 3WD4A 1OGBA 1RD6A 2LPVA 1Q6UA 5DIUA 1YW5A 2XP6A 5HUAA 2ZQVA 3WD3A 2KR7A 1KFWA 1HKIA 4AY1A 4DT4A 2DT3A 3RM9A 1NWUA 3ARWA 3LUOA 4W9PA 4DROA 4URIA 3KAGA 4P8WA 3UF8A 4DZ3A 1FKIA 4GGQA 3O5QA 2KI3A 3H9RB 1YATA 4WIWA 3PA7A 3JYMA 4ODNA 5HW7A 1UR9A 2XP4A 1HXVA 3WH0A 3B8SA 4JFKA 3KAIA 2XP5A 3RFWA 2DT1A 3BXWA 5JH8A 4N19A 1FKBA 5GQBA 1QZ2A 2XPAA 2DG3A 3CGMA 4QT3A 2DT0A 2G8ZA 1HKJA 4R5EA 3NI6A 2A3CA 1HJWA 2ZR6A 1GOIA 2QF8A 1PBKA 3O5IA 5I98A 4NSBA 3PRBA 4Z2GA 1E15A 4XAKA 3VAWA 4MTVA 1ZBCA 3EY6A 3WKZA 2WM0A 2K8IA 1OGGA 3ARPA 1P5QA 3I6CA 3KCEA 3ARYA 2ZR5A 4Q7NA 2IF4A 2WK2A 4DRKA 2Y78A 1R9HA 4ZPTR 1FD9A 4DZ2A 2VN1A 4DH0A 2RURA 1GPFA 1CTNA 4P8UA 4BF8A 5DO2A 1GUVA 1JNEA 4P8VA 4LAWA 1E6RA 1LG2A 3TC5A 2PBCA 3O5JA 4J4OA 1EDQA 4MNLA 1EHNA 3KZ7A 3O5DA 1X6LA 2LKNA 3NRKA 1EIBA 5GPGA 1FKSA 1FKGA 2RUDA 2UZ5A 1D7JA 3WIJA 1N1AA 4LAYA 3UQBA 1VF8A 4G2PA 3O5EA 4WK9A 5DIVA 5HBFA 2RUQA 3WL1A 4TX0A 1JNSA 1D6OA 5DF0A 3MDYB 2RUCA 3JYJA 1W9UA 1PINA 1E9LA 2ZR4A 3QOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7X A;  4IPX A;  2DG3 A;  2KGJ A;  1EYM A;  3CGM A;  3O5K A;  1Q6I A;  4QT3 A;  3UI4 A;  5BXJ A;  2XP9 A;  3KAB A;  5HT1 A;  5J6E A;  2XP7 A;  3IKG A;  3O5O A;  1D7I A;  1NSG A;  3NI6 A;  4R0X A;  3O5F A;  4DRN A;  1FAP A;  1KT0 A;  2ZR6 A;  2M1I A;  4IQC A;  1FKD A;  5HW6 A;  3KAC A;  1PBK A;  1ROU A;  3O5G A;  3RGC A;  3O5P A;  2KE0 A;  3O5I A;  5I98 A;  4DRQ A;  2ZQU A;  3PRB A;  3ODK A;  1FKK A;  4U86 A;  5HWB A;  2PV1 A;  3VAW A;  4MSP A;  4JFM A;  1ZCN A;  1T11 A;  3TDB A;  2ZQS A;  3EY6 A;  4DRH A;  1ROT A;  1W26 A;  4NNR A;  4ODQ A;  1C9H A;  3KAH A;  2K8I A;  2KO7 A;  3UQA A;  1J6Y A;  4JFJ A;  4ODR A;  1P5Q A;  1Q6H A;  4ODK A;  2M2A A;  3B7X A;  2L2S A;  3I6C A;  3OOB A;  3KCE A;  2D9F A;  2MLY A;  4FN2 A;  5HW8 A;  1FKJ A;  2F2D A;  1QPF A;  2ZR5 A;  3KAF A;  3UQI A;  3KAD A;  2IF4 A;  1FKR A;  4DIP A;  1L1P A;  1JNT A;  1J4R A;  1BKF A;  3IK8 A;  1M5Y A;  4U85 A;  1F8A B;  3JXV A;  4DRK A;  2MPH A;  1FKF A;  2Y78 A;  2PPO A;  2RQS A;  3FAP A;  4FAP A;  1R9H A;  4G50 A;  1FD9 A;  4J4N A;  4TW6 A;  2PV2 A;  4QIB A;  1FKH A;  4DRP A;  4DZ2 A;  2VN1 A;  3O5M A;  4ITZ A;  4DH0 A;  2LJ4 A;  3CGN A;  4GIV A;  2RUR A;  3PRD A;  1U79 A;  4DRI A;  4ODM A;  1B6C A;  2ITK A;  4BF8 A;  4DRJ A;  1D7H A;  2JZV A;  2DG4 A;  2MNT A;  4LAW A;  1NMV A;  4O2T A;  1TCO C;  2OFN A;  4MGV A;  3NTP A;  2LPV A;  3IHZ A;  4LAX A;  3O5L A;  3TC5 A;  1J4H A;  1NMW A;  2XPB A;  2PBC A;  1Q6U A;  2LGO A;  3O5J A;  4J4O A;  5DIU A;  2ZQT A;  1F40 A;  4ODO A;  1YW5 A;  2Q5A A;  1J4I A;  4TW8 A;  1EQ3 A;  2MF9 A;  2XP6 A;  3UI6 A;  5HUA A;  4IQ2 A;  2ZQV A;  2F4E A;  1BL4 A;  2KR7 A;  2AWG A;  2PV3 A;  3KZ7 A;  3O5D A;  1KT1 A;  2LKN A;  3NRK A;  2F21 A;  4ODL A;  4DRM A;  5GPG A;  1FKS A;  2XP3 A;  3TCZ A;  4TYO A;  1FKG A;  2RUD A;  2UZ5 A;  4DT4 A;  2VCD A;  1ZK6 A;  2RSE A;  3GPK A;  1D7J A;  2MLX A;  4LAV A;  4W9P A;  1JVW A;  1N1A A;  2FAP A;  3LUO A;  4LAY A;  4W9O A;  4DRO A;  1FJD A;  4JFL A;  3KAG A;  2DG9 A;  5DIT A;  3UF8 A;  4TW7 A;  1Y0O A;  1FKL A;  3O5R A;  4DZ3 A;  3UI5 A;  3UQB A;  2PPP A;  1FKI A;  4GGQ A;  3O5Q A;  4G2P A;  2N87 A;  3O5E A;  2KI3 A;  3H9R B;  5DIV A;  1YAT A;  3PA7 A;  2PPN A;  3JYM A;  4TNS A;  5HWC A;  2RUQ A;  4ODN A;  4C02 B;  5HW7 A;  2XP8 A;  5D75 A;  2XP4 A;  4QT2 A;  2KFW A;  4TX0 A;  1HXV A;  3WH0 A;  4JFI A;  5HKG A;  1JNS A;  2FKE A;  2M08 A;  4JFK A;  3KAI A;  1D6O A;  2XP5 A;  3RFW A;  3MDY B;  1Q1C A;  2RUC A;  3JYJ A;  4JYS A;  4N19 A;  5HTG A;  1FKB A;  2MLZ A;  1PIN A;  1QZ2 A;  4W9Q A;  4U84 A;  5B8I C;  3IKD A;  2ZR4 A;  4ODP A;  1QPL A;  2XPA A;  1FKT A; 
#chains in the Genus database with same CATH topology
 1A7X A;  3CHF A;  4IPX A;  3O5K A;  1EYM A;  5BXJ A;  1E6N A;  2B31 A;  3AS1 A;  2DSZ A;  3PRA A;  4ML4 A;  4DWS A;  1HKM A;  1KT0 A;  1UR8 A;  2M1I A;  4ZPW R;  3B9E A;  2A3A A;  2KE0 A;  2YBU A;  1LL7 A;  1FKK A;  2PV1 A;  4MSP A;  4W5U A;  3TDB A;  4DRH A;  1ROT A;  1W26 A;  3ART A;  4Z2H A;  2IUZ A;  1J6Y A;  4ODR A;  3ARS A;  4ODK A;  1ZBK A;  3ARR A;  3B7X A;  3OOB A;  2G41 A;  5HW8 A;  3ARX A;  2DT2 A;  2FDM A;  4PTM A;  1L1P A;  1WB0 A;  1E6Z A;  1JNT A;  1H0G A;  1BKF A;  3ARZ A;  2MPH A;  3AS2 A;  3OA5 A;  3AS3 A;  3WD2 A;  1FKF A;  4LGX A;  4G50 A;  1W1Y A;  1OWQ A;  2PV2 A;  1FKH A;  4DRP A;  1NWR A;  4DRI A;  3CGN A;  1U79 A;  4ODM A;  2ITK A;  1FFR A;  1NMV A;  4MGV A;  3IHZ A;  1J4H A;  1HJV A;  1FFQ A;  3CH9 A;  3FXY A;  3AQU A;  2ZQT A;  1F40 A;  4ODO A;  1TFV A;  1J4I A;  2DSW A;  3B9D A;  1ZBW A;  1BL4 A;  3UI6 A;  2AWG A;  3WL0 A;  4DRM A;  1K9T A;  1KT1 A;  2F21 A;  2XP3 A;  3TCZ A;  4TYO A;  1LQ0 A;  4MAV A;  2VCD A;  1W9V A;  2RSE A;  3GPK A;  2MLX A;  4LAV A;  3WQV A;  1FJD A;  3ARQ A;  2DSU A;  2DG9 A;  4L72 B;  4P8X A;  1Y0O A;  3UI5 A;  1NH6 A;  3ALG A;  3ARU A;  1X6N A;  2PPN A;  3B9A A;  4TNS A;  5HWC A;  4DWS C;  4Z2L A;  3RM8 A;  4C02 B;  5D75 A;  4QT2 A;  1LL6 A;  4S3K A;  2M08 A;  5DEZ A;  4KQZ A;  5HTG A;  1LL4 A;  2MLZ A;  5B8I C;  4U84 A;  3W4R A;  3IKD A;  1W1T A;  1FAP A;  3FY1 A;  1FKT A;  1O6I A;  2KGJ A;  3GU0 A;  4HBE A;  3KAB A;  2YBT A;  4WKH A;  5HT1 A;  2XP7 A;  4R0X A;  3O5O A;  3O5F A;  4DRN A;  1FKD A;  5HW6 A;  2PI6 A;  1SR0 A;  2A3E A;  3KAC A;  3RGC A;  3AS0 A;  4L3N A;  3CHD A;  4KR0 B;  4DRQ A;  2ZQU A;  3ODK A;  1ZU8 A;  4U86 A;  5GPR A;  4JFM A;  4WKA A;  1ZCN A;  3EIP A;  2ZQS A;  4MNK A;  4NNR A;  1ZBV A;  4ODQ A;  1LG1 A;  4ZPV R;  4FN2 A;  1QPF A;  2P4V A;  2OLH A;  4DIP A;  1ZL1 A;  1J4R A;  1M5Y A;  4U85 A;  1F8A B;  3JXV A;  2PPO A;  2RQS A;  3FAP A;  1XHG A;  1W1V A;  2ETN A;  3CHE A;  4J4N A;  4TW6 A;  4QIB A;  2EUL A;  4DWS B;  2A3B A;  1W1P A;  3O5M A;  4ITZ A;  4WJX A;  3PRD A;  1B6C A;  4NZC A;  1D7H A;  2JZV A;  1TCO C;  2OFN A;  3NTP A;  1ITX A;  4LAX A;  3RME A;  3O5L A;  4MPK A;  4IT6 A;  1NMW A;  2XPB A;  4S3J A;  2LGO A;  3G6L A;  4Z2K A;  3CHC A;  2Q5A A;  1HJX A;  4TW8 A;  1EQ3 A;  2MF9 A;  4IQ2 A;  3ARV A;  2F4E A;  2PV3 A;  4HAR A;  4ODL A;  3BMB A;  1HKK A;  4QZV B;  1ZK6 A;  1JVW A;  2FAP A;  4W9O A;  1E6P A;  1ZB5 A;  4JFL A;  5DIT A;  4TW7 A;  1FKL A;  3O5R A;  2PPP A;  3WD0 A;  2N87 A;  4MNJ A;  1D2K A;  3WD1 A;  3PR9 A;  2XP8 A;  4MNM A;  4DWS D;  2WLZ A;  1JCH B;  2KFW A;  2O9O A;  4JFI A;  5HKG A;  2FKE A;  2AOS A;  2O92 A;  1Q1C A;  4JYS A;  4UDM A;  4WKF A;  4W9Q A;  1NWS A;  4ODP A;  1QPL A;  1GRJ A;  2ESC A;  3UI4 A;  1Q6I A;  3ALF A;  2XP9 A;  1LJY A;  5J6E A;  3IKG A;  1D7I A;  1NSG A;  4IQC A;  3CZ8 A;  1H0I A;  4Z2I A;  1ROU A;  2DPE A;  3O5G A;  3O5P A;  5HWB A;  3RM4 A;  1T11 A;  4Z2J A;  1C9H A;  3KAH A;  3UQA A;  2KO7 A;  1W9P A;  4Q22 A;  4JFJ A;  1Q6H A;  2M2A A;  2L2S A;  2WLY A;  2DSV A;  2D9F A;  2MLY A;  1FKJ A;  2F2D A;  1SYT A;  3G6M A;  3KAF A;  3UQI A;  3KAD A;  1IX5 A;  1FKR A;  1WNO A;  1JND A;  3IK8 A;  1WAW A;  3ARO A;  4FAP A;  4HBO A;  4IT4 A;  2LJ4 A;  4GIV A;  1NWT A;  4DRJ A;  1XRV A;  2MNT A;  2DG4 A;  4O2T A;  4ZS6 A;  3WQW A;  3WD4 A;  1OGB A;  1RD6 A;  2LPV A;  1Q6U A;  5DIU A;  1YW5 A;  2XP6 A;  5HUA A;  2ZQV A;  3WD3 A;  2KR7 A;  1E44 A;  1KFW A;  1HKI A;  4AY1 A;  4DT4 A;  2DT3 A;  3RM9 A;  1NWU A;  3ARW A;  3LUO A;  4W9P A;  4DRO A;  4URI A;  3KAG A;  4P8W A;  3UF8 A;  4DZ3 A;  1FKI A;  4GGQ A;  3O5Q A;  2KI3 A;  3H9R B;  1YAT A;  4WIW A;  3PA7 A;  3JYM A;  4ODN A;  5HW7 A;  1UR9 A;  2XP4 A;  1HXV A;  3WH0 A;  3B8S A;  4JFK A;  3KAI A;  2XP5 A;  3RFW A;  2DT1 A;  2B5U B;  3BXW A;  5JH8 A;  4N19 A;  1FKB A;  5GQB A;  1QZ2 A;  2XPA A;  2DG3 A;  3CGM A;  4QT3 A;  2DT0 A;  2G8Z A;  1HKJ A;  4R5E A;  3NI6 A;  2A3C A;  1HJW A;  2ZR6 A;  1GOI A;  2QF8 A;  1PBK A;  3O5I A;  5I98 A;  4NSB A;  3PRB A;  4Z2G A;  1E15 A;  4XAK A;  3VAW A;  4MTV A;  1ZBC A;  3EY6 A;  3WKZ A;  2WM0 A;  2K8I A;  1OGG A;  3ARP A;  1P5Q A;  3I6C A;  3KCE A;  2PN0 A;  3ARY A;  2ZR5 A;  4Q7N A;  2IF4 A;  2WK2 A;  4DRK A;  2Y78 A;  3GTY X;  1R9H A;  4ZPT R;  1FD9 A;  4DZ2 A;  2VN1 A;  4DH0 A;  2RUR A;  1GPF A;  1CTN A;  4P8U A;  4BF8 A;  5DO2 A;  1GUV A;  1JNE A;  4P8V A;  4LAW A;  1E6R A;  1LG2 A;  3TC5 A;  2PBC A;  2F23 A;  3O5J A;  4J4O A;  1EDQ A;  4MNL A;  1EHN A;  3KZ7 A;  3O5D A;  1X6L A;  2LKN A;  3NRK A;  1EIB A;  5GPG A;  1FKS A;  1FKG A;  2RUD A;  2UZ5 A;  1D7J A;  3WIJ A;  1N1A A;  4LAY A;  3UQB A;  1VF8 A;  4G2P A;  3O5E A;  4WK9 A;  5DIV A;  5HBF A;  2RUQ A;  3WL1 A;  4TX0 A;  1JNS A;  1D6O A;  5DF0 A;  3MDY B;  2RUC A;  3JYJ A;  1W9U A;  1PIN A;  1E9L A;  2ZR4 A;  3QOK A; 
#chains in the Genus database with same CATH homology
 1A7X A;  3CHF A;  4IPX A;  3O5K A;  1EYM A;  5BXJ A;  1E6N A;  2B31 A;  3AS1 A;  2DSZ A;  3PRA A;  4ML4 A;  4DWS A;  1HKM A;  1KT0 A;  1UR8 A;  2M1I A;  4ZPW R;  3B9E A;  2A3A A;  2KE0 A;  2YBU A;  1LL7 A;  1FKK A;  2PV1 A;  4MSP A;  4W5U A;  3TDB A;  4DRH A;  1ROT A;  1W26 A;  3ART A;  4Z2H A;  2IUZ A;  1J6Y A;  4ODR A;  3ARS A;  4ODK A;  1ZBK A;  3ARR A;  3B7X A;  3OOB A;  2G41 A;  5HW8 A;  3ARX A;  2DT2 A;  2FDM A;  4PTM A;  1L1P A;  1WB0 A;  1E6Z A;  1JNT A;  1H0G A;  1BKF A;  3ARZ A;  2MPH A;  3AS2 A;  3OA5 A;  3AS3 A;  3WD2 A;  1FKF A;  4LGX A;  4G50 A;  1W1Y A;  1OWQ A;  2PV2 A;  1FKH A;  4DRP A;  1NWR A;  4DRI A;  3CGN A;  1U79 A;  4ODM A;  2ITK A;  1FFR A;  1NMV A;  4MGV A;  3IHZ A;  1J4H A;  1HJV A;  1FFQ A;  3CH9 A;  3FXY A;  3AQU A;  2ZQT A;  1F40 A;  4ODO A;  1TFV A;  1J4I A;  2DSW A;  3B9D A;  1ZBW A;  1BL4 A;  3UI6 A;  2AWG A;  3WL0 A;  4DRM A;  1K9T A;  1KT1 A;  2F21 A;  2XP3 A;  3TCZ A;  4TYO A;  1LQ0 A;  4MAV A;  2VCD A;  1W9V A;  2RSE A;  3GPK A;  2MLX A;  4LAV A;  3WQV A;  1FJD A;  3ARQ A;  2DSU A;  2DG9 A;  4L72 B;  4P8X A;  1Y0O A;  3UI5 A;  1NH6 A;  3ALG A;  3ARU A;  1X6N A;  2PPN A;  3B9A A;  4TNS A;  5HWC A;  4DWS C;  4Z2L A;  3RM8 A;  4C02 B;  5D75 A;  4QT2 A;  1LL6 A;  4S3K A;  2M08 A;  5DEZ A;  4KQZ A;  5HTG A;  1LL4 A;  2MLZ A;  5B8I C;  4U84 A;  3W4R A;  3IKD A;  1W1T A;  1FAP A;  3FY1 A;  1FKT A;  1O6I A;  2KGJ A;  4HBE A;  3KAB A;  2YBT A;  4WKH A;  5HT1 A;  2XP7 A;  4R0X A;  3O5O A;  3O5F A;  4DRN A;  1FKD A;  5HW6 A;  2PI6 A;  1SR0 A;  2A3E A;  3KAC A;  3RGC A;  3AS0 A;  4L3N A;  3CHD A;  4KR0 B;  4DRQ A;  2ZQU A;  3ODK A;  1ZU8 A;  4U86 A;  5GPR A;  4JFM A;  4WKA A;  1ZCN A;  2ZQS A;  4MNK A;  4NNR A;  1ZBV A;  4ODQ A;  1LG1 A;  4ZPV R;  4FN2 A;  1QPF A;  2OLH A;  4DIP A;  1ZL1 A;  1J4R A;  1M5Y A;  4U85 A;  1F8A B;  3JXV A;  2PPO A;  2RQS A;  3FAP A;  1XHG A;  1W1V A;  3CHE A;  4J4N A;  4TW6 A;  4QIB A;  4DWS B;  2A3B A;  1W1P A;  3O5M A;  4ITZ A;  4WJX A;  3PRD A;  1B6C A;  4NZC A;  1D7H A;  2JZV A;  1TCO C;  2OFN A;  3NTP A;  1ITX A;  4LAX A;  3RME A;  3O5L A;  4MPK A;  4IT6 A;  1NMW A;  2XPB A;  4S3J A;  2LGO A;  3G6L A;  4Z2K A;  3CHC A;  2Q5A A;  1HJX A;  4TW8 A;  1EQ3 A;  2MF9 A;  4IQ2 A;  3ARV A;  2F4E A;  2PV3 A;  4HAR A;  4ODL A;  1HKK A;  4QZV B;  1ZK6 A;  1JVW A;  2FAP A;  4W9O A;  1E6P A;  1ZB5 A;  4JFL A;  5DIT A;  4TW7 A;  1FKL A;  3O5R A;  2PPP A;  3WD0 A;  2N87 A;  4MNJ A;  1D2K A;  3WD1 A;  3PR9 A;  2XP8 A;  4MNM A;  4DWS D;  2WLZ A;  2KFW A;  2O9O A;  4JFI A;  5HKG A;  2FKE A;  2AOS A;  2O92 A;  1Q1C A;  4JYS A;  4WKF A;  4W9Q A;  1NWS A;  4ODP A;  1QPL A;  2ESC A;  3UI4 A;  1Q6I A;  3ALF A;  2XP9 A;  1LJY A;  5J6E A;  3IKG A;  1D7I A;  1NSG A;  4IQC A;  3CZ8 A;  1H0I A;  4Z2I A;  1ROU A;  2DPE A;  3O5G A;  3O5P A;  5HWB A;  3RM4 A;  1T11 A;  4Z2J A;  1C9H A;  3KAH A;  3UQA A;  2KO7 A;  1W9P A;  4Q22 A;  4JFJ A;  1Q6H A;  2M2A A;  2L2S A;  2WLY A;  2DSV A;  2D9F A;  2MLY A;  1FKJ A;  2F2D A;  1SYT A;  3G6M A;  3KAF A;  3UQI A;  3KAD A;  1IX5 A;  1FKR A;  1WNO A;  1JND A;  3IK8 A;  1WAW A;  3ARO A;  4FAP A;  4HBO A;  4IT4 A;  2LJ4 A;  4GIV A;  1NWT A;  4DRJ A;  1XRV A;  2MNT A;  2DG4 A;  4O2T A;  4ZS6 A;  3WQW A;  3WD4 A;  1OGB A;  1RD6 A;  2LPV A;  1Q6U A;  5DIU A;  1YW5 A;  2XP6 A;  5HUA A;  2ZQV A;  3WD3 A;  2KR7 A;  1KFW A;  1HKI A;  4AY1 A;  4DT4 A;  2DT3 A;  3RM9 A;  1NWU A;  3ARW A;  3LUO A;  4W9P A;  4DRO A;  4URI A;  3KAG A;  4P8W A;  3UF8 A;  4DZ3 A;  1FKI A;  4GGQ A;  3O5Q A;  2KI3 A;  3H9R B;  1YAT A;  4WIW A;  3PA7 A;  3JYM A;  4ODN A;  5HW7 A;  1UR9 A;  2XP4 A;  1HXV A;  3WH0 A;  3B8S A;  4JFK A;  3KAI A;  2XP5 A;  3RFW A;  2DT1 A;  3BXW A;  5JH8 A;  4N19 A;  1FKB A;  5GQB A;  1QZ2 A;  2XPA A;  2DG3 A;  3CGM A;  4QT3 A;  2DT0 A;  2G8Z A;  1HKJ A;  4R5E A;  3NI6 A;  2A3C A;  1HJW A;  2ZR6 A;  1GOI A;  2QF8 A;  1PBK A;  3O5I A;  5I98 A;  4NSB A;  3PRB A;  4Z2G A;  1E15 A;  4XAK A;  3VAW A;  4MTV A;  1ZBC A;  3EY6 A;  3WKZ A;  2WM0 A;  2K8I A;  1OGG A;  3ARP A;  1P5Q A;  3I6C A;  3KCE A;  3ARY A;  2ZR5 A;  4Q7N A;  2IF4 A;  2WK2 A;  4DRK A;  2Y78 A;  1R9H A;  4ZPT R;  1FD9 A;  4DZ2 A;  2VN1 A;  4DH0 A;  2RUR A;  1GPF A;  1CTN A;  4P8U A;  4BF8 A;  5DO2 A;  1GUV A;  1JNE A;  4P8V A;  4LAW A;  1E6R A;  1LG2 A;  3TC5 A;  2PBC A;  3O5J A;  4J4O A;  1EDQ A;  4MNL A;  1EHN A;  3KZ7 A;  3O5D A;  1X6L A;  2LKN A;  3NRK A;  1EIB A;  5GPG A;  1FKS A;  1FKG A;  2RUD A;  2UZ5 A;  1D7J A;  3WIJ A;  1N1A A;  4LAY A;  3UQB A;  1VF8 A;  4G2P A;  3O5E A;  4WK9 A;  5DIV A;  5HBF A;  2RUQ A;  3WL1 A;  4TX0 A;  1JNS A;  1D6O A;  5DF0 A;  3MDY B;  2RUC A;  3JYJ A;  1W9U A;  1PIN A;  1E9L A;  2ZR4 A;  3QOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...