4QT2A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with rapamycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
b'FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFREL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
publication title Two crystal structures of the FK506-binding domain of Plasmodium falciparum FKBP35 in complex with rapamycin at high resolution
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Isomerase
total genus 34
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qt2A01
2ZQUA 2LKNA 1F40A 4U85A 3TC5A 2PPPA 1D6OA 4ODNA 2Y78A 4JFIA 5DIUA 2RUQA 2ZR5A 4GGQA 2UZ5A 3VAWA 2KR7A 4LAWA 1D7JA 1M5YA 2ITKA 2M08A 4JFLA 2KE0A 4DH0A 4DRKA 4IPXA 4DZ3A 5HW8A 3PA7A 2LGOA 4TW8A 1YW5A 2PV3A 1NMWA 1J4RA 1FKTA 2PPOA 1FKKA 1T11A 3KZ7A 2IF4A 2MPHA 1NMVA 3IK8A 4IQCA 4J4NA 1Y0OA 2M1IA 3ODKA 3UI6A 5HW6A 2XP3A 1D7IA 1JVWA 2RUCA 2DG3A 1ROUA 2ZQSA 3RFWA 2ZR6A 4GIVA 4R0XA 2VCDA 5HWCA 1ZK6A 4DRQA 1P5QA 2MLZA 5GPGA 1FKBA 4U86A 4U84A 2XP7A 4DT4A 3GPKA 4BF8A 2MF9A 4ODRA 3KACA 5DIVA 3WH0A 1Q1CA 1ROTA 1FKLA 2K8IA 2FAPA 2FKEA 2RQSA 2RURA 1D7HA 1QPFA 3O5OA 2LJ4A 4J4OA 4JFJA 4DRMA 5I98A 2VN1A 5DITA 3H9RB 4TW6A 2LPVA 1ZCNA 1BKFA 2AWGA 3O5JA 2ZQTA 1EQ3A 4O2TA 5B8IC 4MGVA 1Q6IA 4FN2A 3CGMA 3JXVA 4FAPA 1KT0A 1PBKA 4QIBA 1FKDA 4JYSA 5D75A 3JYJA 2XP5A 4MSPA 5HWBA 2RSEA 4IQ2A 1FJDA 3O5RA 2RUDA 4DZ2A 1EYMA 2XP4A 4G2PA 2DG9A 2N87A 3UI5A 3B7XA 1JNTA 4ODPA 3TDBA 3KAFA 1A7XA 3O5GA 3RGCA 4QT2A 2KGJA 4TX0A 1J6YA 4ODQA 3EY6A 4ODMA 4LAVA 4LAYA 3IKDA 3KADA 2XP8A 4ODOA 5BXJA 3UI4A 5J6EA 2F4EA 3PRDA 1PINA 2XP6A 3KAGA 4JFMA 2F2DA 4TNSA 3O5LA 4DRPA 4ODKA 4DRHA 1W26A 2ZQVA 1Q6HA 1QZ2A 3JYMA 2JZVA 1QPLA 3NTPA 2OFNA 4TW7A 4DROA 5HW7A 3FAPA 3TCZA 3NI6A 5HUAA 2MNTA 1FKHA 4ITZA 4W9OA 4N19A 1FKFA 1N1AA 2XPAA 3MDYB 4TYOA 2XPBA 4W9QA 5HT1A 1FKRA 1J4HA 3CGNA 3KAHA 2MLXA 4NNRA 4W9PA 3PRBA 1FKJA 3UF8A 3UQAA 3IKGA 3O5KA 3O5FA 1YATA 2DG4A 1FAPA 3KABA 1R9HA 1F8AB 1KT1A 3IHZA 4QT3A 5HKGA 1C9HA 1HXVA 2F21A 3O5IA 3UQBA 3I6CA 1FD9A 1FKSA 2PBCA 1JNSA 2Q5AA 3UQIA 2KO7A 3O5EA 2M2AA 3LUOA 1BL4A 4G50A 1U79A 2L2SA 3O5PA 2KFWA 3KCEA 1Q6UA 3NRKA 3O5QA 3OOBA 1L1PA 4C02B 5HTGA 2ZR4A 4ODLA 2XP9A 1B6CA 3O5MA 3KAIA 4JFKA 2D9FA 1FKIA 2PV2A 4DIPA 2PPNA 3O5DA 4DRJA 4DRIA 1TCOC 4DRNA 2MLYA 4LAXA 1FKGA 1J4IA 2KI3A 2PV1A 1NSGA
chains in the Genus database with same CATH superfamily
4ML4A 2LKNA 3CZ8A 2O92A 4ODNA 2WK2A 5DIUA 3CHFA 2UZ5A 4LAWA 1M5YA 2KE0A 4DRKA 4DZ3A 5HW8A 3ALGA 4TW8A 2PV3A 4DWSB 2ESCA 1J4RA 2PPOA 3GTYX 1FKKA 4IQCA 1H0IA 2MPHA 3KZ7A 1NMVA 4ODQA 4QT3A 5DITA 2XP3A 3B9DA 1W1PA 2RUCA 1ROUA 1ZU8A 2WM0A 4GIVA 4R0XA 1LJYA 1ZK6A 1XHGA 4MNKA 4WKAA 1HKKA 3GPKA 2MF9A 2RQSA 2FAPA 2FKEA 2RURA 3BXWA 4JFJA 3H9RB 3QOKA 2AWGA 5B8IC 1Q6IA 1NH6A 3AS0A 3ARSA 2DG9A 3B7XA 1JNTA 3TDBA 3WQVA 3RGCA 3KADA 4JFMA 1PINA 4Z2JA 3O5LA 4DRPA 3JYMA 5HBFA 1UR9A 4L72B 4S3JA 5HW7A 3OA5A 5GPRA 1KFWA 1FKFA 1N1AA 5HT1A 1W1TA 1VF8A 4W9QA 4Z2GA 1NWTA 1D2KA 4MNLA 3WQWA 4MPKA 4W9PA 2AOSA 1FKJA 1YATA 1JNDA 2DG4A 1FAPA 3KABA 1HJWA 1W9PA 1ZL1A 3ARXA 2F21A 3I6CA 2PBCA 3UQIA 2IUZA 4MNJA 4G50A 4IT4A 1NWUA 1L1PA 1E9LA 3O5QA 5HTGA 2D9FA 1W9VA 4DRJA 3W4RA 4DRNA 1LG2A 1ZBCA 2RUQA 1OGGA 2ZR5A 3AQUA 2G8ZA 1GPFA 1LL4A 2EULA 1FKTA 3ARQA 4QZVB 2IF4A 3IK8A 1Y0OA 2M1IA 1E6NA 2WLZA 1HKJA 2ZQSA 4PTMA 2VCDA 4DRQA 1FKBA 4DWSC 4U84A 3PR9A 4DT4A 4W5UA 5DF0A 1H0GA 1ROTA 2K8IA 1IX5A 1QPFA 2DT0A 3ARRA 1E6PA 3WD0A 1ZCNA 3O5JA 4MGVA 4FN2A 3AS2A 1PBKA 5D75A 2XP5A 4IQ2A 2RUDA 1EYMA 1HJVA 2XP4A 1LL6A 4ODPA 1A7XA 3EIPA 3O5GA 1GOIA 4P8UA 2B5UB 1OGBA 4QT2A 2KGJA 3CHCA 1HKMA 4ODOA 4ODMA 3WD1A 2XP8A 1HJXA 4HARA 3WKZA 4TNSA 2A3BA 1W26A 1Q6HA 1WAWA 2A3EA 3NTPA 1QPLA 1FFRA 3AS3A 3WD4A 2OFNA 4TW7A 1EDQA 4ITZA 4N19A 4P8VA 3MDYB 1FKRA 2F23A 3ARPA 3ARYA 2OLHA 2DPEA 2G41A 3CH9A 3IKGA 4P8WA 2YBTA 3IHZA 1C9HA 2DT2A 1FD9A 1FKSA 3O5EA 2M2AA 1U79A 3B9AA 4WJXA 3KCEA 1Q6UA 5GQBA 4WKFA 1EIBA 4IT6A 3KAIA 4JFKA 4DIPA 3B8SA 4LAXA 2PV1A 2ZQUA 4U85A 3WL0A 1K9TA 1NWRA 3B9EA 4JFIA 2DSVA 4JFLA 4DH0A 3PA7A 3WIJA 4HBOA 4O2TA 3ALFA 1W1VA 2DSZA 1D7IA 3RMEA 3RFWA 5HWCA 1WB0A 1P5QA 4MAVA 2A3AA 1W1YA 4U86A 2XP7A 4BF8A 2P4VA 4ODRA 4URIA 3WH0A 1Q1CA 1FKLA 4MTVA 4Q7NA 3O5OA 4DRMA 1LQ0A 1RD6A 1EQ3A 3CGMA 3JXVA 1UR8A 1SYTA 4FAPA 1KT0A 4QIBA 1FKDA 2DSWA 4JYSA 4Z2LA 1FJDA 3ARVA 1XRVA 4DZ2A 4G2PA 2N87A 4DWSD 3KAFA 2O9OA 3G6MA 1JCHB 3EY6A 4LAVA 3IKDA 5J6EA 3UI4A 1WNOA 2F4EA 2YBUA 3PRDA 2XP6A 4Z2HA 3CHDA 4ODKA 1E15A 4DRHA 3CHEA 3WL1A 3FAPA 5HUAA 2MNTA 1FKHA 2XPAA 4TYOA 2PN0A 1J4HA 4ZPTR 3KAHA 2MLXA 4NNRA 1X6LA 3PRBA 3UF8A 3UQAA 3O5FA 1R9HA 4KQZA 1F8AB 1KT1A 4Z2IA 5HKGA 3G6LA 1LG1A 2PI6A 4WK9A 2DSUA 1JNSA 2KO7A 1W9UA 1BL4A 4WIWA 3O5PA 4ZPVR 2KFWA 2B31A 3NRKA 3OOBA 4C02B 4XAKA 1ITXA 1OWQA 1B6CA 2QF8A 2PPNA 1FKGA 1J4IA 1NSGA 3O5IA 1F40A 3TC5A 2PPPA 1D6OA 2Y78A 3AS1A 4GGQA 3VAWA 2KR7A 1D7JA 2ITKA 2M08A 1NWSA 4KR0B 4IPXA 3WD3A 4ZPWR 2LGOA 1E44A 1YW5A 1NMWA 4AY1A 4J4NA 1T11A 4UDMA 5HWBA 3ODKA 3UI6A 4S3KA 5HW6A 1JVWA 1HKIA 2DG3A 4DWSA 3WD2A 2ZR6A 3ARTA 4WKHA 2MLZA 5GPGA 4L3NA 4LGXA 3KACA 5DIVA 4J4OA 3ARZA 1D7HA 2LJ4A 5I98A 4Q22A 2VN1A 4TW6A 2LPVA 1BKFA 4R5EA 2ZQTA 4Z2KA 1ZBWA 1O6IA 3JYJA 1ZB5A 4MSPA 2WLYA 2RSEA 1E6ZA 3RM9A 1X6NA 3O5RA 1ZBKA 3FY1A 4ZS6A 2DT3A 3UI5A 1LL7A 3ARUA 5DEZA 4HBEA 1GRJA 4TX0A 1J6YA 4LAYA 5BXJA 4P8XA 3KAGA 3PRAA 2F2DA 2ZQVA 1QZ2A 2JZVA 1CTNA 1SR0A 4DROA 3FXYA 3TCZA 3NI6A 1FFQA 4W9OA 2A3CA 1EHNA 2FDMA 2XPBA 4NSBA 3CGNA 3BMBA 3ARWA 3O5KA 4MNMA 1ZBVA 2ETNA 1TFVA 1E6RA 3GU0A 5JH8A 3UQBA 2Q5AA 3LUOA 2DT1A 3RM4A 2L2SA 1JNEA 3RM8A 2ZR4A 4ODLA 2XP9A 4NZCA 3O5MA 1FKIA 2PV2A 4DRIA 3O5DA 1GUVA 1TCOC 3AROA 2MLYA 5DO2A 1HXVA 2KI3A
chains in the Genus database with same CATH topology
4ML4A 2LKNA 3CZ8A 2O92A 4ODNA 2WK2A 5DIUA 3CHFA 2UZ5A 4LAWA 1M5YA 2KE0A 4DRKA 4DZ3A 5HW8A 3ALGA 4TW8A 2PV3A 4DWSB 2ESCA 1J4RA 2PPOA 4IQCA 1FKKA 4ODQA 1H0IA 2MPHA 3KZ7A 1NMVA 4QT3A 5DITA 2XP3A 3B9DA 1W1PA 2RUCA 1ROUA 1ZU8A 2WM0A 4GIVA 4R0XA 1LJYA 1ZK6A 1XHGA 4MNKA 4WKAA 1HKKA 3GPKA 2MF9A 2RQSA 2FAPA 2FKEA 2RURA 3BXWA 4JFJA 3H9RB 3QOKA 2AWGA 5B8IC 1Q6IA 1NH6A 3AS0A 3ARSA 2DG9A 3B7XA 1JNTA 3TDBA 3WQVA 3RGCA 3KADA 4JFMA 1PINA 4Z2JA 3O5LA 4DRPA 3JYMA 5HBFA 1UR9A 4L72B 4S3JA 5HW7A 3OA5A 5GPRA 1KFWA 1FKFA 1N1AA 5HT1A 1W1TA 1VF8A 4W9QA 4Z2GA 1NWTA 1D2KA 4MNLA 3WQWA 4MPKA 4W9PA 2AOSA 1FKJA 1YATA 1JNDA 2DG4A 1FAPA 3KABA 1HJWA 1W9PA 1ZL1A 3ARXA 2F21A 3I6CA 2PBCA 3UQIA 2IUZA 4MNJA 4G50A 4IT4A 1NWUA 1L1PA 1E9LA 3O5QA 5HTGA 2D9FA 1W9VA 4DRJA 3W4RA 4DRNA 1LG2A 1ZBCA 2RUQA 1OGGA 2ZR5A 3AQUA 2G8ZA 1GPFA 1LL4A 1FKTA 3ARQA 4QZVB 2IF4A 3IK8A 1Y0OA 2M1IA 1E6NA 2WLZA 1HKJA 2ZQSA 4PTMA 2VCDA 4DRQA 1FKBA 4DWSC 4U84A 3PR9A 4DT4A 4W5UA 5DF0A 1H0GA 1ROTA 2K8IA 1IX5A 1QPFA 2DT0A 3ARRA 1E6PA 3WD0A 1ZCNA 3O5JA 4MGVA 4FN2A 3AS2A 1PBKA 5D75A 2XP5A 4IQ2A 2RUDA 1EYMA 1HJVA 2XP4A 1LL6A 4ODPA 1A7XA 3O5GA 1GOIA 4P8UA 1OGBA 4QT2A 2KGJA 3CHCA 1HKMA 4ODOA 4ODMA 3WD1A 2XP8A 1HJXA 4HARA 3WKZA 4TNSA 2A3BA 1W26A 1Q6HA 1WAWA 2A3EA 3NTPA 1QPLA 1FFRA 3AS3A 3WD4A 2OFNA 4TW7A 1EDQA 4ITZA 4N19A 4P8VA 3MDYB 1FKRA 3ARPA 3ARYA 2OLHA 2DPEA 2G41A 3CH9A 3IKGA 4P8WA 2YBTA 3IHZA 1C9HA 2DT2A 1FD9A 1FKSA 3O5EA 2M2AA 1U79A 3B9AA 4WJXA 3KCEA 1Q6UA 5GQBA 4WKFA 1EIBA 4IT6A 3KAIA 4JFKA 4DIPA 3B8SA 4LAXA 2PV1A 2ZQUA 4U85A 3WL0A 1K9TA 1NWRA 3B9EA 4JFIA 2DSVA 4JFLA 4DH0A 3PA7A 3WIJA 4HBOA 4O2TA 3ALFA 1W1VA 2DSZA 1D7IA 3RMEA 3RFWA 5HWCA 1WB0A 1P5QA 4MAVA 2A3AA 1W1YA 4U86A 2XP7A 4BF8A 4ODRA 4URIA 3WH0A 1Q1CA 1FKLA 4MTVA 4Q7NA 3O5OA 4DRMA 1LQ0A 1RD6A 1EQ3A 3CGMA 3JXVA 1UR8A 1SYTA 4FAPA 1KT0A 4QIBA 1FKDA 2DSWA 4JYSA 4Z2LA 1FJDA 3ARVA 1XRVA 4DZ2A 4G2PA 2N87A 4DWSD 3KAFA 2O9OA 3G6MA 3EY6A 4LAVA 3IKDA 5J6EA 3UI4A 1WNOA 2F4EA 2YBUA 3PRDA 2XP6A 4Z2HA 3CHDA 4ODKA 1E15A 4DRHA 3CHEA 3WL1A 3FAPA 5HUAA 2MNTA 1FKHA 2XPAA 4TYOA 1J4HA 4ZPTR 3KAHA 2MLXA 4NNRA 1X6LA 3PRBA 3UF8A 3UQAA 3O5FA 1R9HA 4KQZA 1F8AB 1KT1A 4Z2IA 5HKGA 3G6LA 1LG1A 2PI6A 4WK9A 2DSUA 1JNSA 2KO7A 1W9UA 1BL4A 4WIWA 3O5PA 4ZPVR 2KFWA 2B31A 3NRKA 3OOBA 4C02B 4XAKA 1ITXA 1OWQA 1B6CA 2QF8A 2PPNA 1FKGA 1J4IA 1NSGA 3O5IA 1F40A 3TC5A 2PPPA 1D6OA 2Y78A 3AS1A 4GGQA 3VAWA 2KR7A 1D7JA 2ITKA 2M08A 1NWSA 4KR0B 4IPXA 3WD3A 4ZPWR 2LGOA 1YW5A 1NMWA 4AY1A 4J4NA 1T11A 5HWBA 3ODKA 3UI6A 4S3KA 5HW6A 1JVWA 1HKIA 2DG3A 4DWSA 3WD2A 2ZR6A 3ARTA 4WKHA 2MLZA 5GPGA 4L3NA 4LGXA 3KACA 5DIVA 4J4OA 3ARZA 1D7HA 2LJ4A 5I98A 4Q22A 2VN1A 4TW6A 2LPVA 1BKFA 4R5EA 2ZQTA 4Z2KA 1ZBWA 1O6IA 3JYJA 1ZB5A 4MSPA 2WLYA 2RSEA 1E6ZA 3RM9A 1X6NA 3O5RA 1ZBKA 3FY1A 4ZS6A 2DT3A 3UI5A 1LL7A 3ARUA 5DEZA 4HBEA 4TX0A 1J6YA 4LAYA 5BXJA 4P8XA 3KAGA 3PRAA 2F2DA 2ZQVA 1QZ2A 2JZVA 1CTNA 1SR0A 4DROA 3FXYA 3TCZA 3NI6A 1FFQA 4W9OA 2A3CA 1EHNA 2FDMA 2XPBA 4NSBA 3CGNA 3ARWA 3O5KA 4MNMA 1ZBVA 1TFVA 1E6RA 5JH8A 3UQBA 2Q5AA 3LUOA 2DT1A 3RM4A 2L2SA 1JNEA 3RM8A 2ZR4A 4ODLA 2XP9A 4NZCA 3O5MA 1FKIA 2PV2A 4DRIA 3O5DA 1GUVA 1TCOC 3AROA 2MLYA 5DO2A 1HXVA 2KI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQU A;  2LKN A;  1F40 A;  4U85 A;  3TC5 A;  2PPP A;  1D6O A;  4ODN A;  2Y78 A;  4JFI A;  5DIU A;  2RUQ A;  2ZR5 A;  4GGQ A;  2UZ5 A;  3VAW A;  2KR7 A;  4LAW A;  1D7J A;  1M5Y A;  2ITK A;  2M08 A;  4JFL A;  2KE0 A;  4DH0 A;  4DRK A;  4IPX A;  4DZ3 A;  5HW8 A;  3PA7 A;  2LGO A;  4TW8 A;  1YW5 A;  2PV3 A;  1NMW A;  1J4R A;  1FKT A;  2PPO A;  1FKK A;  1T11 A;  3KZ7 A;  2IF4 A;  2MPH A;  1NMV A;  3IK8 A;  4IQC A;  4J4N A;  1Y0O A;  2M1I A;  3ODK A;  3UI6 A;  5HW6 A;  2XP3 A;  1D7I A;  1JVW A;  2RUC A;  2DG3 A;  1ROU A;  2ZQS A;  3RFW A;  2ZR6 A;  4GIV A;  4R0X A;  2VCD A;  5HWC A;  1ZK6 A;  4DRQ A;  1P5Q A;  2MLZ A;  5GPG A;  1FKB A;  4U86 A;  4U84 A;  2XP7 A;  4DT4 A;  3GPK A;  4BF8 A;  2MF9 A;  4ODR A;  3KAC A;  5DIV A;  3WH0 A;  1Q1C A;  1ROT A;  1FKL A;  2K8I A;  2FAP A;  2FKE A;  2RQS A;  2RUR A;  1D7H A;  1QPF A;  3O5O A;  2LJ4 A;  4J4O A;  4JFJ A;  4DRM A;  5I98 A;  2VN1 A;  5DIT A;  3H9R B;  4TW6 A;  2LPV A;  1ZCN A;  1BKF A;  2AWG A;  3O5J A;  2ZQT A;  1EQ3 A;  4O2T A;  5B8I C;  4MGV A;  1Q6I A;  4FN2 A;  3CGM A;  3JXV A;  4FAP A;  1KT0 A;  1PBK A;  4QIB A;  1FKD A;  4JYS A;  5D75 A;  3JYJ A;  2XP5 A;  4MSP A;  5HWB A;  2RSE A;  4IQ2 A;  1FJD A;  3O5R A;  2RUD A;  4DZ2 A;  1EYM A;  2XP4 A;  4G2P A;  2DG9 A;  2N87 A;  3UI5 A;  3B7X A;  1JNT A;  4ODP A;  3TDB A;  3KAF A;  1A7X A;  3O5G A;  3RGC A;  4QT2 A;  2KGJ A;  4TX0 A;  1J6Y A;  4ODQ A;  3EY6 A;  4ODM A;  4LAV A;  4LAY A;  3IKD A;  3KAD A;  2XP8 A;  4ODO A;  5BXJ A;  3UI4 A;  5J6E A;  2F4E A;  3PRD A;  1PIN A;  2XP6 A;  3KAG A;  4JFM A;  2F2D A;  4TNS A;  3O5L A;  4DRP A;  4ODK A;  4DRH A;  1W26 A;  2ZQV A;  1Q6H A;  1QZ2 A;  3JYM A;  2JZV A;  1QPL A;  3NTP A;  2OFN A;  4TW7 A;  4DRO A;  5HW7 A;  3FAP A;  3TCZ A;  3NI6 A;  5HUA A;  2MNT A;  1FKH A;  4ITZ A;  4W9O A;  4N19 A;  1FKF A;  1N1A A;  2XPA A;  3MDY B;  4TYO A;  2XPB A;  4W9Q A;  5HT1 A;  1FKR A;  1J4H A;  3CGN A;  3KAH A;  2MLX A;  4NNR A;  4W9P A;  3PRB A;  1FKJ A;  3UF8 A;  3UQA A;  3IKG A;  3O5K A;  3O5F A;  1YAT A;  2DG4 A;  1FAP A;  3KAB A;  1R9H A;  1F8A B;  1KT1 A;  3IHZ A;  4QT3 A;  5HKG A;  1C9H A;  1HXV A;  2F21 A;  3O5I A;  3UQB A;  3I6C A;  1FD9 A;  1FKS A;  2PBC A;  1JNS A;  2Q5A A;  3UQI A;  2KO7 A;  3O5E A;  2M2A A;  3LUO A;  1BL4 A;  4G50 A;  1U79 A;  2L2S A;  3O5P A;  2KFW A;  3KCE A;  1Q6U A;  3NRK A;  3O5Q A;  3OOB A;  1L1P A;  4C02 B;  5HTG A;  2ZR4 A;  4ODL A;  2XP9 A;  1B6C A;  3O5M A;  3KAI A;  4JFK A;  2D9F A;  1FKI A;  2PV2 A;  4DIP A;  2PPN A;  3O5D A;  4DRJ A;  4DRI A;  1TCO C;  4DRN A;  2MLY A;  4LAX A;  1FKG A;  1J4I A;  2KI3 A;  2PV1 A;  1NSG A; 
#chains in the Genus database with same CATH topology
 4ML4 A;  2LKN A;  3CZ8 A;  2O92 A;  4ODN A;  2WK2 A;  5DIU A;  3CHF A;  2UZ5 A;  4LAW A;  1M5Y A;  2KE0 A;  4DRK A;  4DZ3 A;  5HW8 A;  3ALG A;  4TW8 A;  2PV3 A;  4DWS B;  2ESC A;  1J4R A;  2PPO A;  3GTY X;  1FKK A;  4IQC A;  1H0I A;  2MPH A;  3KZ7 A;  1NMV A;  4ODQ A;  4QT3 A;  5DIT A;  2XP3 A;  3B9D A;  1W1P A;  2RUC A;  1ROU A;  1ZU8 A;  2WM0 A;  4GIV A;  4R0X A;  1LJY A;  1ZK6 A;  1XHG A;  4MNK A;  4WKA A;  1HKK A;  3GPK A;  2MF9 A;  2RQS A;  2FAP A;  2FKE A;  2RUR A;  3BXW A;  4JFJ A;  3H9R B;  3QOK A;  2AWG A;  5B8I C;  1Q6I A;  1NH6 A;  3AS0 A;  3ARS A;  2DG9 A;  3B7X A;  1JNT A;  3TDB A;  3WQV A;  3RGC A;  3KAD A;  4JFM A;  1PIN A;  4Z2J A;  3O5L A;  4DRP A;  3JYM A;  5HBF A;  1UR9 A;  4L72 B;  4S3J A;  5HW7 A;  3OA5 A;  5GPR A;  1KFW A;  1FKF A;  1N1A A;  5HT1 A;  1W1T A;  1VF8 A;  4W9Q A;  4Z2G A;  1NWT A;  1D2K A;  4MNL A;  3WQW A;  4MPK A;  4W9P A;  2AOS A;  1FKJ A;  1YAT A;  1JND A;  2DG4 A;  1FAP A;  3KAB A;  1HJW A;  1W9P A;  1ZL1 A;  3ARX A;  2F21 A;  3I6C A;  2PBC A;  3UQI A;  2IUZ A;  4MNJ A;  4G50 A;  4IT4 A;  1NWU A;  1L1P A;  1E9L A;  3O5Q A;  5HTG A;  2D9F A;  1W9V A;  4DRJ A;  3W4R A;  4DRN A;  1LG2 A;  1ZBC A;  2RUQ A;  1OGG A;  2ZR5 A;  3AQU A;  2G8Z A;  1GPF A;  1LL4 A;  2EUL A;  1FKT A;  3ARQ A;  4QZV B;  2IF4 A;  3IK8 A;  1Y0O A;  2M1I A;  1E6N A;  2WLZ A;  1HKJ A;  2ZQS A;  4PTM A;  2VCD A;  4DRQ A;  1FKB A;  4DWS C;  4U84 A;  3PR9 A;  4DT4 A;  4W5U A;  5DF0 A;  1H0G A;  1ROT A;  2K8I A;  1IX5 A;  1QPF A;  2DT0 A;  3ARR A;  1E6P A;  3WD0 A;  1ZCN A;  3O5J A;  4MGV A;  4FN2 A;  3AS2 A;  1PBK A;  5D75 A;  2XP5 A;  4IQ2 A;  2RUD A;  1EYM A;  1HJV A;  2XP4 A;  1LL6 A;  4ODP A;  1A7X A;  3EIP A;  3O5G A;  1GOI A;  4P8U A;  2B5U B;  1OGB A;  4QT2 A;  2KGJ A;  3CHC A;  1HKM A;  4ODO A;  4ODM A;  3WD1 A;  2XP8 A;  1HJX A;  4HAR A;  3WKZ A;  4TNS A;  2A3B A;  1W26 A;  1Q6H A;  1WAW A;  2A3E A;  3NTP A;  1QPL A;  1FFR A;  3AS3 A;  3WD4 A;  2OFN A;  4TW7 A;  1EDQ A;  4ITZ A;  4N19 A;  4P8V A;  3MDY B;  1FKR A;  2F23 A;  3ARP A;  3ARY A;  2OLH A;  2DPE A;  2G41 A;  3CH9 A;  3IKG A;  4P8W A;  2YBT A;  3IHZ A;  1C9H A;  2DT2 A;  1FD9 A;  1FKS A;  3O5E A;  2M2A A;  1U79 A;  3B9A A;  4WJX A;  3KCE A;  1Q6U A;  5GQB A;  4WKF A;  1EIB A;  4IT6 A;  3KAI A;  4JFK A;  4DIP A;  3B8S A;  4LAX A;  2PV1 A;  2ZQU A;  4U85 A;  3WL0 A;  1K9T A;  1NWR A;  3B9E A;  4JFI A;  2DSV A;  4JFL A;  4DH0 A;  3PA7 A;  3WIJ A;  4HBO A;  4O2T A;  3ALF A;  1W1V A;  2DSZ A;  1D7I A;  3RME A;  3RFW A;  5HWC A;  1WB0 A;  1P5Q A;  4MAV A;  2A3A A;  1W1Y A;  4U86 A;  2XP7 A;  4BF8 A;  2P4V A;  4ODR A;  4URI A;  3WH0 A;  1Q1C A;  1FKL A;  4MTV A;  4Q7N A;  3O5O A;  4DRM A;  1LQ0 A;  1RD6 A;  1EQ3 A;  3CGM A;  3JXV A;  1UR8 A;  1SYT A;  4FAP A;  1KT0 A;  4QIB A;  1FKD A;  2DSW A;  4JYS A;  4Z2L A;  1FJD A;  3ARV A;  1XRV A;  4DZ2 A;  4G2P A;  2N87 A;  4DWS D;  3KAF A;  2O9O A;  3G6M A;  1JCH B;  3EY6 A;  4LAV A;  3IKD A;  5J6E A;  3UI4 A;  1WNO A;  2F4E A;  2YBU A;  3PRD A;  2XP6 A;  4Z2H A;  3CHD A;  4ODK A;  1E15 A;  4DRH A;  3CHE A;  3WL1 A;  3FAP A;  5HUA A;  2MNT A;  1FKH A;  2XPA A;  4TYO A;  2PN0 A;  1J4H A;  4ZPT R;  3KAH A;  2MLX A;  4NNR A;  1X6L A;  3PRB A;  3UF8 A;  3UQA A;  3O5F A;  1R9H A;  4KQZ A;  1F8A B;  1KT1 A;  4Z2I A;  5HKG A;  3G6L A;  1LG1 A;  2PI6 A;  4WK9 A;  2DSU A;  1JNS A;  2KO7 A;  1W9U A;  1BL4 A;  4WIW A;  3O5P A;  4ZPV R;  2KFW A;  2B31 A;  3NRK A;  3OOB A;  4C02 B;  4XAK A;  1ITX A;  1OWQ A;  1B6C A;  2QF8 A;  2PPN A;  1FKG A;  1J4I A;  1NSG A;  3O5I A;  1F40 A;  3TC5 A;  2PPP A;  1D6O A;  2Y78 A;  3AS1 A;  4GGQ A;  3VAW A;  2KR7 A;  1D7J A;  2ITK A;  2M08 A;  1NWS A;  4KR0 B;  4IPX A;  3WD3 A;  4ZPW R;  2LGO A;  1E44 A;  1YW5 A;  1NMW A;  4AY1 A;  4J4N A;  1T11 A;  4UDM A;  5HWB A;  3ODK A;  3UI6 A;  4S3K A;  5HW6 A;  1JVW A;  1HKI A;  2DG3 A;  4DWS A;  3WD2 A;  2ZR6 A;  3ART A;  4WKH A;  2MLZ A;  5GPG A;  4L3N A;  4LGX A;  3KAC A;  5DIV A;  4J4O A;  3ARZ A;  1D7H A;  2LJ4 A;  5I98 A;  4Q22 A;  2VN1 A;  4TW6 A;  2LPV A;  1BKF A;  4R5E A;  2ZQT A;  4Z2K A;  1ZBW A;  1O6I A;  3JYJ A;  1ZB5 A;  4MSP A;  2WLY A;  2RSE A;  1E6Z A;  3RM9 A;  1X6N A;  3O5R A;  1ZBK A;  3FY1 A;  4ZS6 A;  2DT3 A;  3UI5 A;  1LL7 A;  3ARU A;  5DEZ A;  4HBE A;  1GRJ A;  4TX0 A;  1J6Y A;  4LAY A;  5BXJ A;  4P8X A;  3KAG A;  3PRA A;  2F2D A;  2ZQV A;  1QZ2 A;  2JZV A;  1CTN A;  1SR0 A;  4DRO A;  3FXY A;  3TCZ A;  3NI6 A;  1FFQ A;  4W9O A;  2A3C A;  1EHN A;  2FDM A;  2XPB A;  4NSB A;  3CGN A;  3BMB A;  3ARW A;  3O5K A;  4MNM A;  1ZBV A;  2ETN A;  1TFV A;  1E6R A;  3GU0 A;  5JH8 A;  3UQB A;  2Q5A A;  3LUO A;  2DT1 A;  3RM4 A;  2L2S A;  1JNE A;  3RM8 A;  2ZR4 A;  4ODL A;  2XP9 A;  4NZC A;  3O5M A;  1FKI A;  2PV2 A;  4DRI A;  3O5D A;  1GUV A;  1TCO C;  3ARO A;  2MLY A;  5DO2 A;  1HXV A;  2KI3 A; 
#chains in the Genus database with same CATH homology
 4ML4 A;  2LKN A;  3CZ8 A;  2O92 A;  4ODN A;  2WK2 A;  5DIU A;  3CHF A;  2UZ5 A;  4LAW A;  1M5Y A;  2KE0 A;  4DRK A;  4DZ3 A;  5HW8 A;  3ALG A;  4TW8 A;  2PV3 A;  4DWS B;  2ESC A;  1J4R A;  2PPO A;  4IQC A;  1FKK A;  4ODQ A;  1H0I A;  2MPH A;  3KZ7 A;  1NMV A;  4QT3 A;  5DIT A;  2XP3 A;  3B9D A;  1W1P A;  2RUC A;  1ROU A;  1ZU8 A;  2WM0 A;  4GIV A;  4R0X A;  1LJY A;  1ZK6 A;  1XHG A;  4MNK A;  4WKA A;  1HKK A;  3GPK A;  2MF9 A;  2RQS A;  2FAP A;  2FKE A;  2RUR A;  3BXW A;  4JFJ A;  3H9R B;  3QOK A;  2AWG A;  5B8I C;  1Q6I A;  1NH6 A;  3AS0 A;  3ARS A;  2DG9 A;  3B7X A;  1JNT A;  3TDB A;  3WQV A;  3RGC A;  3KAD A;  4JFM A;  1PIN A;  4Z2J A;  3O5L A;  4DRP A;  3JYM A;  5HBF A;  1UR9 A;  4L72 B;  4S3J A;  5HW7 A;  3OA5 A;  5GPR A;  1KFW A;  1FKF A;  1N1A A;  5HT1 A;  1W1T A;  1VF8 A;  4W9Q A;  4Z2G A;  1NWT A;  1D2K A;  4MNL A;  3WQW A;  4MPK A;  4W9P A;  2AOS A;  1FKJ A;  1YAT A;  1JND A;  2DG4 A;  1FAP A;  3KAB A;  1HJW A;  1W9P A;  1ZL1 A;  3ARX A;  2F21 A;  3I6C A;  2PBC A;  3UQI A;  2IUZ A;  4MNJ A;  4G50 A;  4IT4 A;  1NWU A;  1L1P A;  1E9L A;  3O5Q A;  5HTG A;  2D9F A;  1W9V A;  4DRJ A;  3W4R A;  4DRN A;  1LG2 A;  1ZBC A;  2RUQ A;  1OGG A;  2ZR5 A;  3AQU A;  2G8Z A;  1GPF A;  1LL4 A;  1FKT A;  3ARQ A;  4QZV B;  2IF4 A;  3IK8 A;  1Y0O A;  2M1I A;  1E6N A;  2WLZ A;  1HKJ A;  2ZQS A;  4PTM A;  2VCD A;  4DRQ A;  1FKB A;  4DWS C;  4U84 A;  3PR9 A;  4DT4 A;  4W5U A;  5DF0 A;  1H0G A;  1ROT A;  2K8I A;  1IX5 A;  1QPF A;  2DT0 A;  3ARR A;  1E6P A;  3WD0 A;  1ZCN A;  3O5J A;  4MGV A;  4FN2 A;  3AS2 A;  1PBK A;  5D75 A;  2XP5 A;  4IQ2 A;  2RUD A;  1EYM A;  1HJV A;  2XP4 A;  1LL6 A;  4ODP A;  1A7X A;  3O5G A;  1GOI A;  4P8U A;  1OGB A;  4QT2 A;  2KGJ A;  3CHC A;  1HKM A;  4ODO A;  4ODM A;  3WD1 A;  2XP8 A;  1HJX A;  4HAR A;  3WKZ A;  4TNS A;  2A3B A;  1W26 A;  1Q6H A;  1WAW A;  2A3E A;  3NTP A;  1QPL A;  1FFR A;  3AS3 A;  3WD4 A;  2OFN A;  4TW7 A;  1EDQ A;  4ITZ A;  4N19 A;  4P8V A;  3MDY B;  1FKR A;  3ARP A;  3ARY A;  2OLH A;  2DPE A;  2G41 A;  3CH9 A;  3IKG A;  4P8W A;  2YBT A;  3IHZ A;  1C9H A;  2DT2 A;  1FD9 A;  1FKS A;  3O5E A;  2M2A A;  1U79 A;  3B9A A;  4WJX A;  3KCE A;  1Q6U A;  5GQB A;  4WKF A;  1EIB A;  4IT6 A;  3KAI A;  4JFK A;  4DIP A;  3B8S A;  4LAX A;  2PV1 A;  2ZQU A;  4U85 A;  3WL0 A;  1K9T A;  1NWR A;  3B9E A;  4JFI A;  2DSV A;  4JFL A;  4DH0 A;  3PA7 A;  3WIJ A;  4HBO A;  4O2T A;  3ALF A;  1W1V A;  2DSZ A;  1D7I A;  3RME A;  3RFW A;  5HWC A;  1WB0 A;  1P5Q A;  4MAV A;  2A3A A;  1W1Y A;  4U86 A;  2XP7 A;  4BF8 A;  4ODR A;  4URI A;  3WH0 A;  1Q1C A;  1FKL A;  4MTV A;  4Q7N A;  3O5O A;  4DRM A;  1LQ0 A;  1RD6 A;  1EQ3 A;  3CGM A;  3JXV A;  1UR8 A;  1SYT A;  4FAP A;  1KT0 A;  4QIB A;  1FKD A;  2DSW A;  4JYS A;  4Z2L A;  1FJD A;  3ARV A;  1XRV A;  4DZ2 A;  4G2P A;  2N87 A;  4DWS D;  3KAF A;  2O9O A;  3G6M A;  3EY6 A;  4LAV A;  3IKD A;  5J6E A;  3UI4 A;  1WNO A;  2F4E A;  2YBU A;  3PRD A;  2XP6 A;  4Z2H A;  3CHD A;  4ODK A;  1E15 A;  4DRH A;  3CHE A;  3WL1 A;  3FAP A;  5HUA A;  2MNT A;  1FKH A;  2XPA A;  4TYO A;  1J4H A;  4ZPT R;  3KAH A;  2MLX A;  4NNR A;  1X6L A;  3PRB A;  3UF8 A;  3UQA A;  3O5F A;  1R9H A;  4KQZ A;  1F8A B;  1KT1 A;  4Z2I A;  5HKG A;  3G6L A;  1LG1 A;  2PI6 A;  4WK9 A;  2DSU A;  1JNS A;  2KO7 A;  1W9U A;  1BL4 A;  4WIW A;  3O5P A;  4ZPV R;  2KFW A;  2B31 A;  3NRK A;  3OOB A;  4C02 B;  4XAK A;  1ITX A;  1OWQ A;  1B6C A;  2QF8 A;  2PPN A;  1FKG A;  1J4I A;  1NSG A;  3O5I A;  1F40 A;  3TC5 A;  2PPP A;  1D6O A;  2Y78 A;  3AS1 A;  4GGQ A;  3VAW A;  2KR7 A;  1D7J A;  2ITK A;  2M08 A;  1NWS A;  4KR0 B;  4IPX A;  3WD3 A;  4ZPW R;  2LGO A;  1YW5 A;  1NMW A;  4AY1 A;  4J4N A;  1T11 A;  5HWB A;  3ODK A;  3UI6 A;  4S3K A;  5HW6 A;  1JVW A;  1HKI A;  2DG3 A;  4DWS A;  3WD2 A;  2ZR6 A;  3ART A;  4WKH A;  2MLZ A;  5GPG A;  4L3N A;  4LGX A;  3KAC A;  5DIV A;  4J4O A;  3ARZ A;  1D7H A;  2LJ4 A;  5I98 A;  4Q22 A;  2VN1 A;  4TW6 A;  2LPV A;  1BKF A;  4R5E A;  2ZQT A;  4Z2K A;  1ZBW A;  1O6I A;  3JYJ A;  1ZB5 A;  4MSP A;  2WLY A;  2RSE A;  1E6Z A;  3RM9 A;  1X6N A;  3O5R A;  1ZBK A;  3FY1 A;  4ZS6 A;  2DT3 A;  3UI5 A;  1LL7 A;  3ARU A;  5DEZ A;  4HBE A;  4TX0 A;  1J6Y A;  4LAY A;  5BXJ A;  4P8X A;  3KAG A;  3PRA A;  2F2D A;  2ZQV A;  1QZ2 A;  2JZV A;  1CTN A;  1SR0 A;  4DRO A;  3FXY A;  3TCZ A;  3NI6 A;  1FFQ A;  4W9O A;  2A3C A;  1EHN A;  2FDM A;  2XPB A;  4NSB A;  3CGN A;  3ARW A;  3O5K A;  4MNM A;  1ZBV A;  1TFV A;  1E6R A;  5JH8 A;  3UQB A;  2Q5A A;  3LUO A;  2DT1 A;  3RM4 A;  2L2S A;  1JNE A;  3RM8 A;  2ZR4 A;  4ODL A;  2XP9 A;  4NZC A;  3O5M A;  1FKI A;  2PV2 A;  4DRI A;  3O5D A;  1GUV A;  1TCO C;  3ARO A;  2MLY A;  5DO2 A;  1HXV A;  2KI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...