4QT2A

Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with rapamycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two crystal structures of the FK506-binding domain of Plasmodium falciparum FKBP35 in complex with rapamycin at high resolution
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Isomerase
molecule keywords FK506-binding protein (FKBP)-type peptidyl-propyl isomerase
total genus 34
structure length 122
sequence length 122
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qt2A01
1ROTA 1Q6UA 3JYMA 4ODMA 4ODOA 4ODNA 1U79A 2M08A 1FKSA 1L1PA 1N1AA 4QIBA 4DZ3A 3UQBA 1NSGA 1D7JA 3OOBA 4LAVA 4DRHA 2JZVA 3O5OA 5HUAA 1P5QA 1TCOC 2PPPA 4U86A 2XP6A 2XP8A 5DITA 2ZQUA 2LGOA 2RUCA 1J4IA 2L2SA 3O5GA 3RGCA 3IKGA 4DRIA 2IF4A 3UQAA 2XP9A 1FKLA 3KABA 4GGQA 1Q6IA 3KACA 3O5JA 5BXJA 4W9OA 3O5PA 3WH0A 3TDBA 1FKJA 1ZK6A 4BF8A 2F21A 1PINA 2D9FA 4TNSA 3KAHA 1JNTA 3JYJA 4FN2A 4MSPA 4N19A 2KFWA 3RFWA 3UQIA 3NTPA 3PRBA 2AWGA 3CGMA 3O5LA 3TC5A 4J4OA 3O5QA 4LAWA 3IKDA 3GPKA 1T11A 2KE0A 2ZQTA 1W26A 4NNRA 2M1IA 4FAPA 5HW7A 4TYOA 1D6OA 2XP4A 2PV3A 5HTGA 3KAFA 4TW6A 1QPLA 2F2DA 4DH0A 2FKEA 2ITKA 4ITZA 3UI6A 4DZ2A 2LPVA 2PPOA 1FKDA 3O5MA 5HKGA 1NMVA 1FKBA 2RQSA 4MGVA 1ZCNA 3KADA 2VN1A 3LUOA 3O5RA 2M2AA 4ODQA 4TW8A 4DRPA 2FAPA 1FKIA 1FKKA 3KAGA 5DIUA 4O2TA 1QPFA 4DIPA 2N87A 4QT2A 1Q1CA 2Y78A 2KI3A 1EQ3A 3NRKA 4DRNA 1YW5A 1FAPA 4ODPA 5DIVA 4DRQA 2UZ5A 1KT1A 5HT1A 2MLYA 4ODLA 3B7XA 1FKTA 3KZ7A 1Q6HA 1FKRA 4JFLA 4U85A 5D75A 4DRJA 1NMWA 2RSEA 4C02B 3VAWA 4G2PA 2LKNA 4ODRA 4GIVA 4TX0A 1JNSA 2RURA 2LJ4A 1YATA 1BL4A 1EYMA 1F8AB 2MLXA 4JFKA 4R0XA 1JVWA 3KAIA 2XP3A 4IQCA 2MNTA 4U84A 1FKGA 2VCDA 1QZ2A 4QT3A 3FAPA 3H9RB 4JFMA 2ZR4A 1J4RA 1Y0OA 4JFJA 4W9QA 2ZR6A 1ROUA 2XPBA 1D7IA 1HXVA 5B8IC 2RUDA 1F40A 4DT4A 1B6CA 4J4NA 2Q5AA 2ZR5A 5HWCA 5J6EA 4LAYA 3NI6A 5GPGA 3UI4A 1M5YA 2MPHA 1R9HA 2PV1A 2KO7A 2ZQSA 3UF8A 4DRMA 2XP7A 3PA7A 4JFIA 1FKFA 2KR7A 2PPNA 2XP5A 3IK8A 2PBCA 3O5IA 2MF9A 2ZQVA 5HW8A 4DROA 5HWBA 1J6YA 3KCEA 3MDYB 1FJDA 3IHZA 1BKFA 3O5DA 3UI5A 4DRKA 2RUQA 3I6CA 4IQ2A 4IPXA 2XPAA 4G50A 4ODKA 5HW6A 2DG3A 2PV2A 2DG9A 3O5FA 3TCZA 1J4HA 4W9PA 3ODKA 3EY6A 3JXVA 4JYSA 1PBKA 1FKHA 1C9HA 1D7HA 1A7XA 4TW7A 3O5EA 2KGJA 2F4EA 1KT0A 2K8IA 3O5KA 3PRDA 2MLZA 4LAXA 5I98A 3CGNA 2DG4A 1FD9A 2OFNA
chains in the Genus database with same CATH superfamily
1Q6UA 4ODMA 3WKZA 1L1PA 1H0GA 3WD3A 3CHFA 3ARPA 3UQBA 1D7JA 2IUZA 1P5QA 3CH9A 2XP6A 4MPKA 3QOKA 1E6NA 1J4IA 4DRIA 2IF4A 2WM0A 2XP9A 3UQAA 4Z2JA 3TDBA 3JYJA 4S3KA 4IT6A 1W1VA 3NTPA 3O5QA 4Z2IA 1ZBWA 3GPKA 4L3NA 4TYOA 4XAKA 5HKGA 2ITKA 4ITZA 4DZ2A 2PPOA 1JCHB 1FKBA 4W5UA 1SYTA 1W9UA 2M2AA 4TW8A 4DRPA 2FAPA 4O2TA 1QPFA 4DIPA 2N87A 4WKHA 2Y78A 3WIJA 3ARYA 4DRNA 4ODPA 1Q6HA 1FFRA 2DT2A 2B5UB 1WAWA 4C02B 2LKNA 1JNSA 4GIVA 1NH6A 2MLXA 1ITXA 3G6LA 1ZL1A 1JVWA 4IQCA 5GPRA 1FKGA 4JFMA 3PRAA 4W9QA 2XPBA 2WLYA 1SR0A 3G6MA 3ARRA 1WB0A 2ZR5A 5J6EA 3B9AA 5GPGA 1M5YA 2MPHA 4DWSB 4WKFA 3PA7A 2KR7A 3KCEA 1FJDA 4DWSD 2RUQA 3WD1A 4IQ2A 2XPAA 4ODKA 2PV2A 2WK2A 3O5FA 3FXYA 3ODKA 1PBKA 4WJXA 1D7HA 1HKKA 1A7XA 1LL4A 3O5EA 1RD6A 3CHEA 2MLZA 3CGNA 3NI6A 2DG4A 1FD9A 4JFJA 5DF0A 4ODOA 1U79A 2M08A 1FKSA 1NSGA 5HUAA 3W4RA 1HJVA 2B31A 4ML4A 4QZVB 2L2SA 3WD0A 1Q6IA 3O5JA 4W9OA 3AS1A 4Z2GA 4WK9A 1NWUA 1GRJA 3RFWA 2KFWA 3UQIA 2AWGA 3O5LA 3TC5A 1JNEA 4ZPWR 2DSZA 4FAPA 4MNJA 5HW7A 4UDMA 1D6OA 5HTGA 3WL0A 1QPLA 2FKEA 2LPVA 3RM9A 3O5MA 1HJXA 4MGVA 3KADA 1NWRA 3LUOA 2DSUA 4ODQA 3ARQA 3KAGA 4KQZA 4MTVA 4QT2A 1Q1CA 2DPEA 2KI3A 2WLZA 3ARSA 5JH8A 5DIVA 4DRQA 4MAVA 1KT1A 4ODLA 3RM4A 2G8ZA 3KZ7A 1FKRA 4JFLA 4U85A 3ARXA 2DSWA 1NMWA 2DT0A 2RSEA 3PR9A 4AY1A 4TX0A 2PI6A 2RURA 1ZB5A 1BL4A 1F8AB 4JFKA 3KAIA 3WL1A 1ZU8A 4U84A 1GPFA 3FAPA 2DT1A 1Y0OA 1ROUA 4DWSA 4Z2HA 5B8IC 4DT4A 2O9OA 3ARWA 2Q5AA 3BMBA 2YBUA 4LAYA 4ZPTR 3UF8A 4P8UA 1FKFA 2PBCA 3O5IA 5HWBA 3MDYB 2EULA 1BKFA 5HW6A 1XRVA 3TCZA 3AS3A 4WKAA 1E6RA 1TFVA 4MNLA 1FFQA 1OWQA 2A3BA 1IX5A 1N1AA 4QIBA 4DZ3A 4DRHA 2JZVA 3O5OA 1TCOC 2PPPA 4MNMA 2O92A 3O5GA 4URIA 3RGCA 3BXWA 4Q22A 3KABA 1FKLA 4GGQA 1LL7A 3WH0A 3O5PA 5HBFA 1GOIA 4BF8A 1EIBA 2F21A 1PINA 2D9FA 4TNSA 1ZBCA 4FN2A 4N19A 1OGBA 3RMEA 4J4OA 2A3AA 1T11A 2KE0A 2ZQTA 1W26A 3WD2A 2ETNA 2PV3A 3KAFA 4TW6A 1E6PA 2F2DA 1FKDA 2G41A 2RQSA 4ZS6A 1W1PA 2VN1A 3O5RA 1FKIA 3GTYX 1EHNA 1FAPA 2F23A 5HT1A 1GUVA 1FKTA 5D75A 4DRJA 3EIPA 3B9DA 1LL6A 3VAWA 4G2PA 1WNOA 2LJ4A 1YATA 1LQ0A 1XHGA 2MNTA 4QT3A 1QZ2A 2DT3A 3H9RB 2ZR4A 2ZR6A 1D7IA 4IT4A 1O6IA 4HBOA 2RUDA 1HJWA 4Z2KA 1F40A 1B6CA 2FDMA 4PTMA 1K9TA 2PV1A 1R9HA 2ZQSA 3AS2A 1X6LA 2XP7A 4JFIA 1W1TA 2PPNA 3IK8A 5HW8A 3O5DA 3UI5A 4DRKA 3I6CA 3RM8A 4G50A 4WIWA 4R5EA 1EDQA 3B9EA 3ALGA 2DG9A 1HKMA 2A3CA 1J4HA 3JXVA 3WD4A 1FKHA 1C9HA 3GU0A 1H0IA 2F4EA 1KT0A 2KGJA 3O5KA 4Q7NA 4HARA 1ROTA 3JYMA 1LJYA 4ODNA 1LG2A 4KR0B 3ARZA 1E15A 1W1YA 3OOBA 4LAVA 4U86A 2ESCA 2XP8A 5DITA 4P8XA 2ZQUA 2LGOA 2RUCA 1E9LA 4NSBA 3IKGA 4P8WA 5BXJA 3KACA 1FKJA 1ZK6A 4S3JA 1ZBKA 3KAHA 1JNTA 4MSPA 2YBTA 3CHCA 1JNDA 3PRBA 3CGMA 4L72B 1OGGA 3OA5A 1X6NA 4LAWA 3IKDA 1ZBVA 4NZCA 4NNRA 2M1IA 2XP4A 1UR8A 1E44A 4DH0A 3UI6A 2QF8A 1LG1A 1NMVA 5DO2A 2P4VA 1ZCNA 4Z2LA 1HKJA 2OLHA 5DIUA 1FKKA 4MNKA 1NWTA 4P8VA 2A3EA 4DWSC 1EQ3A 3NRKA 1YW5A 2UZ5A 2MLYA 3B7XA 4LGXA 3CZ8A 1E6ZA 2DSVA 2AOSA 4ODRA 3AROA 4R0XA 1EYMA 2XP3A 2VCDA 3ARUA 5GQBA 1J4RA 1HXVA 1HKIA 3ARVA 4HBEA 3ARTA 4J4NA 1NWSA 3B8SA 3CHDA 5HWCA 3UI4A 2KO7A 4DRMA 1W9PA 2XP5A 2MF9A 2ZQVA 1J6YA 4DROA 1CTNA 3FY1A 3IHZA 4IPXA 2DG3A 2PN0A 3ALFA 3WQVA 1VF8A 1W9VA 3AQUA 1UR9A 4W9PA 3EY6A 4JYSA 5DEZA 4ZPVR 3AS0A 4TW7A 2K8IA 1D2KA 1KFWA 3PRDA 3WQWA 4LAXA 5I98A 2OFNA
chains in the Genus database with same CATH topology
1Q6UA 4ODMA 3WKZA 1L1PA 1H0GA 3WD3A 3CHFA 3ARPA 3UQBA 1D7JA 2IUZA 1P5QA 3CH9A 2XP6A 4MPKA 3QOKA 1E6NA 1J4IA 4DRIA 2IF4A 2WM0A 2XP9A 3UQAA 4Z2JA 3TDBA 3JYJA 4S3KA 4IT6A 1W1VA 3NTPA 3O5QA 4Z2IA 1ZBWA 3GPKA 4L3NA 4TYOA 4XAKA 5HKGA 2ITKA 4ITZA 4DZ2A 2PPOA 1FKBA 4W5UA 1SYTA 1W9UA 2M2AA 4TW8A 4DRPA 2FAPA 4O2TA 1QPFA 4DIPA 2N87A 4WKHA 2Y78A 3WIJA 3ARYA 4DRNA 4ODPA 1Q6HA 1FFRA 2DT2A 1WAWA 4C02B 2LKNA 1JNSA 4GIVA 1NH6A 2MLXA 1ITXA 3G6LA 1ZL1A 1JVWA 4IQCA 5GPRA 1FKGA 4JFMA 3PRAA 4W9QA 2XPBA 2WLYA 1SR0A 3G6MA 3ARRA 1WB0A 2ZR5A 5J6EA 3B9AA 5GPGA 1M5YA 2MPHA 4DWSB 4WKFA 3PA7A 2KR7A 3KCEA 1FJDA 4DWSD 2RUQA 3WD1A 4IQ2A 2XPAA 4ODKA 2PV2A 2WK2A 3O5FA 3FXYA 3ODKA 1PBKA 4WJXA 1D7HA 1HKKA 1A7XA 1LL4A 3O5EA 1RD6A 3CHEA 2MLZA 3CGNA 3NI6A 2DG4A 1FD9A 4JFJA 5DF0A 4ODOA 1U79A 2M08A 1FKSA 1NSGA 5HUAA 3W4RA 1HJVA 2B31A 4ML4A 4QZVB 2L2SA 3WD0A 1Q6IA 3O5JA 4W9OA 3AS1A 4Z2GA 4WK9A 1NWUA 3RFWA 2KFWA 3UQIA 2AWGA 3O5LA 3TC5A 1JNEA 4ZPWR 2DSZA 4FAPA 4MNJA 5HW7A 1D6OA 5HTGA 3WL0A 1QPLA 2FKEA 2LPVA 3RM9A 3O5MA 1HJXA 4MGVA 3KADA 1NWRA 3LUOA 2DSUA 4ODQA 3ARQA 3KAGA 4KQZA 4MTVA 4QT2A 1Q1CA 2DPEA 2KI3A 2WLZA 3ARSA 5JH8A 5DIVA 4DRQA 4MAVA 1KT1A 4ODLA 3RM4A 2G8ZA 3KZ7A 1FKRA 4JFLA 4U85A 3ARXA 2DSWA 1NMWA 2DT0A 2RSEA 3PR9A 4AY1A 4TX0A 2PI6A 2RURA 1ZB5A 1BL4A 1F8AB 4JFKA 3KAIA 3WL1A 1ZU8A 4U84A 1GPFA 3FAPA 2DT1A 1Y0OA 1ROUA 4DWSA 4Z2HA 5B8IC 4DT4A 2O9OA 3ARWA 2Q5AA 2YBUA 4LAYA 4ZPTR 3UF8A 4P8UA 1FKFA 2PBCA 3O5IA 5HWBA 3MDYB 1BKFA 5HW6A 1XRVA 3TCZA 3AS3A 4WKAA 1E6RA 1TFVA 4MNLA 1FFQA 1OWQA 2A3BA 1IX5A 1N1AA 4QIBA 4DZ3A 4DRHA 2JZVA 3O5OA 1TCOC 2PPPA 4MNMA 2O92A 3O5GA 4URIA 3RGCA 3BXWA 4Q22A 3KABA 1FKLA 4GGQA 1LL7A 3WH0A 3O5PA 5HBFA 1GOIA 4BF8A 1EIBA 2F21A 1PINA 2D9FA 4TNSA 1ZBCA 4FN2A 4N19A 1OGBA 3RMEA 4J4OA 2A3AA 1T11A 2KE0A 2ZQTA 1W26A 3WD2A 2PV3A 3KAFA 4TW6A 1E6PA 2F2DA 1FKDA 2G41A 2RQSA 4ZS6A 1W1PA 2VN1A 3O5RA 1FKIA 1EHNA 1FAPA 5HT1A 1GUVA 1FKTA 5D75A 4DRJA 3B9DA 1LL6A 3VAWA 4G2PA 1WNOA 2LJ4A 1YATA 1LQ0A 1XHGA 2MNTA 4QT3A 1QZ2A 2DT3A 3H9RB 2ZR4A 2ZR6A 1D7IA 4IT4A 1O6IA 4HBOA 2RUDA 1HJWA 4Z2KA 1F40A 1B6CA 2FDMA 4PTMA 1K9TA 2PV1A 1R9HA 2ZQSA 3AS2A 1X6LA 2XP7A 4JFIA 1W1TA 2PPNA 3IK8A 5HW8A 3O5DA 3UI5A 4DRKA 3I6CA 3RM8A 4G50A 4WIWA 4R5EA 1EDQA 3B9EA 3ALGA 2DG9A 1HKMA 2A3CA 1J4HA 3JXVA 3WD4A 1FKHA 1C9HA 1H0IA 2F4EA 1KT0A 2KGJA 3O5KA 4Q7NA 4HARA 1ROTA 3JYMA 1LJYA 4ODNA 1LG2A 4KR0B 3ARZA 1E15A 1W1YA 3OOBA 4LAVA 4U86A 2ESCA 2XP8A 5DITA 4P8XA 2ZQUA 2LGOA 2RUCA 1E9LA 4NSBA 3IKGA 4P8WA 5BXJA 3KACA 1FKJA 1ZK6A 4S3JA 1ZBKA 3KAHA 1JNTA 4MSPA 2YBTA 3CHCA 1JNDA 3PRBA 3CGMA 4L72B 1OGGA 3OA5A 1X6NA 4LAWA 3IKDA 1ZBVA 4NZCA 4NNRA 2M1IA 2XP4A 1UR8A 4DH0A 3UI6A 2QF8A 1LG1A 1NMVA 5DO2A 1ZCNA 4Z2LA 1HKJA 2OLHA 5DIUA 1FKKA 4MNKA 1NWTA 4P8VA 2A3EA 4DWSC 1EQ3A 3NRKA 1YW5A 2UZ5A 2MLYA 3B7XA 4LGXA 3CZ8A 1E6ZA 2DSVA 2AOSA 4ODRA 3AROA 4R0XA 1EYMA 2XP3A 2VCDA 3ARUA 5GQBA 1J4RA 1HXVA 1HKIA 3ARVA 4HBEA 3ARTA 4J4NA 1NWSA 3B8SA 3CHDA 5HWCA 3UI4A 2KO7A 4DRMA 1W9PA 2XP5A 2MF9A 2ZQVA 1J6YA 4DROA 1CTNA 3FY1A 3IHZA 4IPXA 2DG3A 3ALFA 3WQVA 1VF8A 1W9VA 3AQUA 1UR9A 4W9PA 3EY6A 4JYSA 5DEZA 4ZPVR 3AS0A 4TW7A 2K8IA 1D2KA 1KFWA 3PRDA 3WQWA 4LAXA 5I98A 2OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROT A;  1Q6U A;  3JYM A;  4ODM A;  4ODO A;  4ODN A;  1U79 A;  2M08 A;  1FKS A;  1L1P A;  1N1A A;  4QIB A;  4DZ3 A;  3UQB A;  1NSG A;  1D7J A;  3OOB A;  4LAV A;  4DRH A;  2JZV A;  3O5O A;  5HUA A;  1P5Q A;  1TCO C;  2PPP A;  4U86 A;  2XP6 A;  2XP8 A;  5DIT A;  2ZQU A;  2LGO A;  2RUC A;  1J4I A;  2L2S A;  3O5G A;  3RGC A;  3IKG A;  4DRI A;  2IF4 A;  3UQA A;  2XP9 A;  1FKL A;  3KAB A;  4GGQ A;  1Q6I A;  3KAC A;  3O5J A;  5BXJ A;  4W9O A;  3O5P A;  3WH0 A;  3TDB A;  1FKJ A;  1ZK6 A;  4BF8 A;  2F21 A;  1PIN A;  2D9F A;  4TNS A;  3KAH A;  1JNT A;  3JYJ A;  4FN2 A;  4MSP A;  4N19 A;  2KFW A;  3RFW A;  3UQI A;  3NTP A;  3PRB A;  2AWG A;  3CGM A;  3O5L A;  3TC5 A;  4J4O A;  3O5Q A;  4LAW A;  3IKD A;  3GPK A;  1T11 A;  2KE0 A;  2ZQT A;  1W26 A;  4NNR A;  2M1I A;  4FAP A;  5HW7 A;  4TYO A;  1D6O A;  2XP4 A;  2PV3 A;  5HTG A;  3KAF A;  4TW6 A;  1QPL A;  2F2D A;  4DH0 A;  2FKE A;  2ITK A;  4ITZ A;  3UI6 A;  4DZ2 A;  2LPV A;  2PPO A;  1FKD A;  3O5M A;  5HKG A;  1NMV A;  1FKB A;  2RQS A;  4MGV A;  1ZCN A;  3KAD A;  2VN1 A;  3LUO A;  3O5R A;  2M2A A;  4ODQ A;  4TW8 A;  4DRP A;  2FAP A;  1FKI A;  1FKK A;  3KAG A;  5DIU A;  4O2T A;  1QPF A;  4DIP A;  2N87 A;  4QT2 A;  1Q1C A;  2Y78 A;  2KI3 A;  1EQ3 A;  3NRK A;  4DRN A;  1YW5 A;  1FAP A;  4ODP A;  5DIV A;  4DRQ A;  2UZ5 A;  1KT1 A;  5HT1 A;  2MLY A;  4ODL A;  3B7X A;  1FKT A;  3KZ7 A;  1Q6H A;  1FKR A;  4JFL A;  4U85 A;  5D75 A;  4DRJ A;  1NMW A;  2RSE A;  4C02 B;  3VAW A;  4G2P A;  2LKN A;  4ODR A;  4GIV A;  4TX0 A;  1JNS A;  2RUR A;  2LJ4 A;  1YAT A;  1BL4 A;  1EYM A;  1F8A B;  2MLX A;  4JFK A;  4R0X A;  1JVW A;  3KAI A;  2XP3 A;  4IQC A;  2MNT A;  4U84 A;  1FKG A;  2VCD A;  1QZ2 A;  4QT3 A;  3FAP A;  3H9R B;  4JFM A;  2ZR4 A;  1J4R A;  1Y0O A;  4JFJ A;  4W9Q A;  2ZR6 A;  1ROU A;  2XPB A;  1D7I A;  1HXV A;  5B8I C;  2RUD A;  1F40 A;  4DT4 A;  1B6C A;  4J4N A;  2Q5A A;  2ZR5 A;  5HWC A;  5J6E A;  4LAY A;  3NI6 A;  5GPG A;  3UI4 A;  1M5Y A;  2MPH A;  1R9H A;  2PV1 A;  2KO7 A;  2ZQS A;  3UF8 A;  4DRM A;  2XP7 A;  3PA7 A;  4JFI A;  1FKF A;  2KR7 A;  2PPN A;  2XP5 A;  3IK8 A;  2PBC A;  3O5I A;  2MF9 A;  2ZQV A;  5HW8 A;  4DRO A;  5HWB A;  1J6Y A;  3KCE A;  3MDY B;  1FJD A;  3IHZ A;  1BKF A;  3O5D A;  3UI5 A;  4DRK A;  2RUQ A;  3I6C A;  4IQ2 A;  4IPX A;  2XPA A;  4G50 A;  4ODK A;  5HW6 A;  2DG3 A;  2PV2 A;  2DG9 A;  3O5F A;  3TCZ A;  1J4H A;  4W9P A;  3ODK A;  3EY6 A;  3JXV A;  4JYS A;  1PBK A;  1FKH A;  1C9H A;  1D7H A;  1A7X A;  4TW7 A;  3O5E A;  2KGJ A;  2F4E A;  1KT0 A;  2K8I A;  3O5K A;  3PRD A;  2MLZ A;  4LAX A;  5I98 A;  3CGN A;  2DG4 A;  1FD9 A;  2OFN A; 
#chains in the Genus database with same CATH topology
 1Q6U A;  4ODM A;  3WKZ A;  1L1P A;  1H0G A;  3WD3 A;  3CHF A;  3ARP A;  3UQB A;  1D7J A;  2IUZ A;  1P5Q A;  3CH9 A;  2XP6 A;  4MPK A;  3QOK A;  1E6N A;  1J4I A;  4DRI A;  2IF4 A;  2WM0 A;  2XP9 A;  3UQA A;  4Z2J A;  3TDB A;  3JYJ A;  4S3K A;  4IT6 A;  1W1V A;  3NTP A;  3O5Q A;  4Z2I A;  1ZBW A;  3GPK A;  4L3N A;  4TYO A;  4XAK A;  5HKG A;  2ITK A;  4ITZ A;  4DZ2 A;  2PPO A;  1JCH B;  1FKB A;  4W5U A;  1SYT A;  1W9U A;  2M2A A;  4TW8 A;  4DRP A;  2FAP A;  4O2T A;  1QPF A;  4DIP A;  2N87 A;  4WKH A;  2Y78 A;  3WIJ A;  3ARY A;  4DRN A;  4ODP A;  1Q6H A;  1FFR A;  2DT2 A;  2B5U B;  1WAW A;  4C02 B;  2LKN A;  1JNS A;  4GIV A;  1NH6 A;  2MLX A;  1ITX A;  3G6L A;  1ZL1 A;  1JVW A;  4IQC A;  5GPR A;  1FKG A;  4JFM A;  3PRA A;  4W9Q A;  2XPB A;  2WLY A;  1SR0 A;  3G6M A;  3ARR A;  1WB0 A;  2ZR5 A;  5J6E A;  3B9A A;  5GPG A;  1M5Y A;  2MPH A;  4DWS B;  4WKF A;  3PA7 A;  2KR7 A;  3KCE A;  1FJD A;  4DWS D;  2RUQ A;  3WD1 A;  4IQ2 A;  2XPA A;  4ODK A;  2PV2 A;  2WK2 A;  3O5F A;  3FXY A;  3ODK A;  1PBK A;  4WJX A;  1D7H A;  1HKK A;  1A7X A;  1LL4 A;  3O5E A;  1RD6 A;  3CHE A;  2MLZ A;  3CGN A;  3NI6 A;  2DG4 A;  1FD9 A;  4JFJ A;  5DF0 A;  4ODO A;  1U79 A;  2M08 A;  1FKS A;  1NSG A;  5HUA A;  3W4R A;  1HJV A;  2B31 A;  4ML4 A;  4QZV B;  2L2S A;  3WD0 A;  1Q6I A;  3O5J A;  4W9O A;  3AS1 A;  4Z2G A;  4WK9 A;  1NWU A;  1GRJ A;  3RFW A;  2KFW A;  3UQI A;  2AWG A;  3O5L A;  3TC5 A;  1JNE A;  4ZPW R;  2DSZ A;  4FAP A;  4MNJ A;  5HW7 A;  4UDM A;  1D6O A;  5HTG A;  3WL0 A;  1QPL A;  2FKE A;  2LPV A;  3RM9 A;  3O5M A;  1HJX A;  4MGV A;  3KAD A;  1NWR A;  3LUO A;  2DSU A;  4ODQ A;  3ARQ A;  3KAG A;  4KQZ A;  4MTV A;  4QT2 A;  1Q1C A;  2DPE A;  2KI3 A;  2WLZ A;  3ARS A;  5JH8 A;  5DIV A;  4DRQ A;  4MAV A;  1KT1 A;  4ODL A;  3RM4 A;  2G8Z A;  3KZ7 A;  1FKR A;  4JFL A;  4U85 A;  3ARX A;  2DSW A;  1NMW A;  2DT0 A;  2RSE A;  3PR9 A;  4AY1 A;  4TX0 A;  2PI6 A;  2RUR A;  1ZB5 A;  1BL4 A;  1F8A B;  4JFK A;  3KAI A;  3WL1 A;  1ZU8 A;  4U84 A;  1GPF A;  3FAP A;  2DT1 A;  1Y0O A;  1ROU A;  4DWS A;  4Z2H A;  5B8I C;  4DT4 A;  2O9O A;  3ARW A;  2Q5A A;  3BMB A;  2YBU A;  4LAY A;  4ZPT R;  3UF8 A;  4P8U A;  1FKF A;  2PBC A;  3O5I A;  5HWB A;  3MDY B;  2EUL A;  1BKF A;  5HW6 A;  1XRV A;  3TCZ A;  3AS3 A;  4WKA A;  1E6R A;  1TFV A;  4MNL A;  1FFQ A;  1OWQ A;  2A3B A;  1IX5 A;  1N1A A;  4QIB A;  4DZ3 A;  4DRH A;  2JZV A;  3O5O A;  1TCO C;  2PPP A;  4MNM A;  2O92 A;  3O5G A;  4URI A;  3RGC A;  3BXW A;  4Q22 A;  3KAB A;  1FKL A;  4GGQ A;  1LL7 A;  3WH0 A;  3O5P A;  5HBF A;  1GOI A;  4BF8 A;  1EIB A;  2F21 A;  1PIN A;  2D9F A;  4TNS A;  1ZBC A;  4FN2 A;  4N19 A;  1OGB A;  3RME A;  4J4O A;  2A3A A;  1T11 A;  2KE0 A;  2ZQT A;  1W26 A;  3WD2 A;  2ETN A;  2PV3 A;  3KAF A;  4TW6 A;  1E6P A;  2F2D A;  1FKD A;  2G41 A;  2RQS A;  4ZS6 A;  1W1P A;  2VN1 A;  3O5R A;  1FKI A;  3GTY X;  1EHN A;  1FAP A;  2F23 A;  5HT1 A;  1GUV A;  1FKT A;  5D75 A;  4DRJ A;  3EIP A;  3B9D A;  1LL6 A;  3VAW A;  4G2P A;  1WNO A;  2LJ4 A;  1YAT A;  1LQ0 A;  1XHG A;  2MNT A;  4QT3 A;  1QZ2 A;  2DT3 A;  3H9R B;  2ZR4 A;  2ZR6 A;  1D7I A;  4IT4 A;  1O6I A;  4HBO A;  2RUD A;  1HJW A;  4Z2K A;  1F40 A;  1B6C A;  2FDM A;  4PTM A;  1K9T A;  2PV1 A;  1R9H A;  2ZQS A;  3AS2 A;  1X6L A;  2XP7 A;  4JFI A;  1W1T A;  2PPN A;  3IK8 A;  5HW8 A;  3O5D A;  3UI5 A;  4DRK A;  3I6C A;  3RM8 A;  4G50 A;  4WIW A;  4R5E A;  1EDQ A;  3B9E A;  3ALG A;  2DG9 A;  1HKM A;  2A3C A;  1J4H A;  3JXV A;  3WD4 A;  1FKH A;  1C9H A;  3GU0 A;  1H0I A;  2F4E A;  1KT0 A;  2KGJ A;  3O5K A;  4Q7N A;  4HAR A;  1ROT A;  3JYM A;  1LJY A;  4ODN A;  1LG2 A;  4KR0 B;  3ARZ A;  1E15 A;  1W1Y A;  3OOB A;  4LAV A;  4U86 A;  2ESC A;  2XP8 A;  5DIT A;  4P8X A;  2ZQU A;  2LGO A;  2RUC A;  1E9L A;  4NSB A;  3IKG A;  4P8W A;  5BXJ A;  3KAC A;  1FKJ A;  1ZK6 A;  4S3J A;  1ZBK A;  3KAH A;  1JNT A;  4MSP A;  2YBT A;  3CHC A;  1JND A;  3PRB A;  3CGM A;  4L72 B;  1OGG A;  3OA5 A;  1X6N A;  4LAW A;  3IKD A;  1ZBV A;  4NZC A;  4NNR A;  2M1I A;  2XP4 A;  1UR8 A;  1E44 A;  4DH0 A;  3UI6 A;  2QF8 A;  1LG1 A;  1NMV A;  5DO2 A;  2P4V A;  1ZCN A;  4Z2L A;  1HKJ A;  2OLH A;  5DIU A;  1FKK A;  4MNK A;  1NWT A;  4P8V A;  2A3E A;  4DWS C;  1EQ3 A;  3NRK A;  1YW5 A;  2UZ5 A;  2MLY A;  3B7X A;  4LGX A;  3CZ8 A;  1E6Z A;  2DSV A;  2AOS A;  4ODR A;  3ARO A;  4R0X A;  1EYM A;  2XP3 A;  2VCD A;  3ARU A;  5GQB A;  1J4R A;  1HXV A;  1HKI A;  3ARV A;  4HBE A;  3ART A;  4J4N A;  1NWS A;  3B8S A;  3CHD A;  5HWC A;  3UI4 A;  2KO7 A;  4DRM A;  1W9P A;  2XP5 A;  2MF9 A;  2ZQV A;  1J6Y A;  4DRO A;  1CTN A;  3FY1 A;  3IHZ A;  4IPX A;  2DG3 A;  2PN0 A;  3ALF A;  3WQV A;  1VF8 A;  1W9V A;  3AQU A;  1UR9 A;  4W9P A;  3EY6 A;  4JYS A;  5DEZ A;  4ZPV R;  3AS0 A;  4TW7 A;  2K8I A;  1D2K A;  1KFW A;  3PRD A;  3WQW A;  4LAX A;  5I98 A;  2OFN A; 
#chains in the Genus database with same CATH homology
 1Q6U A;  4ODM A;  3WKZ A;  1L1P A;  1H0G A;  3WD3 A;  3CHF A;  3ARP A;  3UQB A;  1D7J A;  2IUZ A;  1P5Q A;  3CH9 A;  2XP6 A;  4MPK A;  3QOK A;  1E6N A;  1J4I A;  4DRI A;  2IF4 A;  2WM0 A;  2XP9 A;  3UQA A;  4Z2J A;  3TDB A;  3JYJ A;  4S3K A;  4IT6 A;  1W1V A;  3NTP A;  3O5Q A;  4Z2I A;  1ZBW A;  3GPK A;  4L3N A;  4TYO A;  4XAK A;  5HKG A;  2ITK A;  4ITZ A;  4DZ2 A;  2PPO A;  1FKB A;  4W5U A;  1SYT A;  1W9U A;  2M2A A;  4TW8 A;  4DRP A;  2FAP A;  4O2T A;  1QPF A;  4DIP A;  2N87 A;  4WKH A;  2Y78 A;  3WIJ A;  3ARY A;  4DRN A;  4ODP A;  1Q6H A;  1FFR A;  2DT2 A;  1WAW A;  4C02 B;  2LKN A;  1JNS A;  4GIV A;  1NH6 A;  2MLX A;  1ITX A;  3G6L A;  1ZL1 A;  1JVW A;  4IQC A;  5GPR A;  1FKG A;  4JFM A;  3PRA A;  4W9Q A;  2XPB A;  2WLY A;  1SR0 A;  3G6M A;  3ARR A;  1WB0 A;  2ZR5 A;  5J6E A;  3B9A A;  5GPG A;  1M5Y A;  2MPH A;  4DWS B;  4WKF A;  3PA7 A;  2KR7 A;  3KCE A;  1FJD A;  4DWS D;  2RUQ A;  3WD1 A;  4IQ2 A;  2XPA A;  4ODK A;  2PV2 A;  2WK2 A;  3O5F A;  3FXY A;  3ODK A;  1PBK A;  4WJX A;  1D7H A;  1HKK A;  1A7X A;  1LL4 A;  3O5E A;  1RD6 A;  3CHE A;  2MLZ A;  3CGN A;  3NI6 A;  2DG4 A;  1FD9 A;  4JFJ A;  5DF0 A;  4ODO A;  1U79 A;  2M08 A;  1FKS A;  1NSG A;  5HUA A;  3W4R A;  1HJV A;  2B31 A;  4ML4 A;  4QZV B;  2L2S A;  3WD0 A;  1Q6I A;  3O5J A;  4W9O A;  3AS1 A;  4Z2G A;  4WK9 A;  1NWU A;  3RFW A;  2KFW A;  3UQI A;  2AWG A;  3O5L A;  3TC5 A;  1JNE A;  4ZPW R;  2DSZ A;  4FAP A;  4MNJ A;  5HW7 A;  1D6O A;  5HTG A;  3WL0 A;  1QPL A;  2FKE A;  2LPV A;  3RM9 A;  3O5M A;  1HJX A;  4MGV A;  3KAD A;  1NWR A;  3LUO A;  2DSU A;  4ODQ A;  3ARQ A;  3KAG A;  4KQZ A;  4MTV A;  4QT2 A;  1Q1C A;  2DPE A;  2KI3 A;  2WLZ A;  3ARS A;  5JH8 A;  5DIV A;  4DRQ A;  4MAV A;  1KT1 A;  4ODL A;  3RM4 A;  2G8Z A;  3KZ7 A;  1FKR A;  4JFL A;  4U85 A;  3ARX A;  2DSW A;  1NMW A;  2DT0 A;  2RSE A;  3PR9 A;  4AY1 A;  4TX0 A;  2PI6 A;  2RUR A;  1ZB5 A;  1BL4 A;  1F8A B;  4JFK A;  3KAI A;  3WL1 A;  1ZU8 A;  4U84 A;  1GPF A;  3FAP A;  2DT1 A;  1Y0O A;  1ROU A;  4DWS A;  4Z2H A;  5B8I C;  4DT4 A;  2O9O A;  3ARW A;  2Q5A A;  2YBU A;  4LAY A;  4ZPT R;  3UF8 A;  4P8U A;  1FKF A;  2PBC A;  3O5I A;  5HWB A;  3MDY B;  1BKF A;  5HW6 A;  1XRV A;  3TCZ A;  3AS3 A;  4WKA A;  1E6R A;  1TFV A;  4MNL A;  1FFQ A;  1OWQ A;  2A3B A;  1IX5 A;  1N1A A;  4QIB A;  4DZ3 A;  4DRH A;  2JZV A;  3O5O A;  1TCO C;  2PPP A;  4MNM A;  2O92 A;  3O5G A;  4URI A;  3RGC A;  3BXW A;  4Q22 A;  3KAB A;  1FKL A;  4GGQ A;  1LL7 A;  3WH0 A;  3O5P A;  5HBF A;  1GOI A;  4BF8 A;  1EIB A;  2F21 A;  1PIN A;  2D9F A;  4TNS A;  1ZBC A;  4FN2 A;  4N19 A;  1OGB A;  3RME A;  4J4O A;  2A3A A;  1T11 A;  2KE0 A;  2ZQT A;  1W26 A;  3WD2 A;  2PV3 A;  3KAF A;  4TW6 A;  1E6P A;  2F2D A;  1FKD A;  2G41 A;  2RQS A;  4ZS6 A;  1W1P A;  2VN1 A;  3O5R A;  1FKI A;  1EHN A;  1FAP A;  5HT1 A;  1GUV A;  1FKT A;  5D75 A;  4DRJ A;  3B9D A;  1LL6 A;  3VAW A;  4G2P A;  1WNO A;  2LJ4 A;  1YAT A;  1LQ0 A;  1XHG A;  2MNT A;  4QT3 A;  1QZ2 A;  2DT3 A;  3H9R B;  2ZR4 A;  2ZR6 A;  1D7I A;  4IT4 A;  1O6I A;  4HBO A;  2RUD A;  1HJW A;  4Z2K A;  1F40 A;  1B6C A;  2FDM A;  4PTM A;  1K9T A;  2PV1 A;  1R9H A;  2ZQS A;  3AS2 A;  1X6L A;  2XP7 A;  4JFI A;  1W1T A;  2PPN A;  3IK8 A;  5HW8 A;  3O5D A;  3UI5 A;  4DRK A;  3I6C A;  3RM8 A;  4G50 A;  4WIW A;  4R5E A;  1EDQ A;  3B9E A;  3ALG A;  2DG9 A;  1HKM A;  2A3C A;  1J4H A;  3JXV A;  3WD4 A;  1FKH A;  1C9H A;  1H0I A;  2F4E A;  1KT0 A;  2KGJ A;  3O5K A;  4Q7N A;  4HAR A;  1ROT A;  3JYM A;  1LJY A;  4ODN A;  1LG2 A;  4KR0 B;  3ARZ A;  1E15 A;  1W1Y A;  3OOB A;  4LAV A;  4U86 A;  2ESC A;  2XP8 A;  5DIT A;  4P8X A;  2ZQU A;  2LGO A;  2RUC A;  1E9L A;  4NSB A;  3IKG A;  4P8W A;  5BXJ A;  3KAC A;  1FKJ A;  1ZK6 A;  4S3J A;  1ZBK A;  3KAH A;  1JNT A;  4MSP A;  2YBT A;  3CHC A;  1JND A;  3PRB A;  3CGM A;  4L72 B;  1OGG A;  3OA5 A;  1X6N A;  4LAW A;  3IKD A;  1ZBV A;  4NZC A;  4NNR A;  2M1I A;  2XP4 A;  1UR8 A;  4DH0 A;  3UI6 A;  2QF8 A;  1LG1 A;  1NMV A;  5DO2 A;  1ZCN A;  4Z2L A;  1HKJ A;  2OLH A;  5DIU A;  1FKK A;  4MNK A;  1NWT A;  4P8V A;  2A3E A;  4DWS C;  1EQ3 A;  3NRK A;  1YW5 A;  2UZ5 A;  2MLY A;  3B7X A;  4LGX A;  3CZ8 A;  1E6Z A;  2DSV A;  2AOS A;  4ODR A;  3ARO A;  4R0X A;  1EYM A;  2XP3 A;  2VCD A;  3ARU A;  5GQB A;  1J4R A;  1HXV A;  1HKI A;  3ARV A;  4HBE A;  3ART A;  4J4N A;  1NWS A;  3B8S A;  3CHD A;  5HWC A;  3UI4 A;  2KO7 A;  4DRM A;  1W9P A;  2XP5 A;  2MF9 A;  2ZQV A;  1J6Y A;  4DRO A;  1CTN A;  3FY1 A;  3IHZ A;  4IPX A;  2DG3 A;  3ALF A;  3WQV A;  1VF8 A;  1W9V A;  3AQU A;  1UR9 A;  4W9P A;  3EY6 A;  4JYS A;  5DEZ A;  4ZPV R;  3AS0 A;  4TW7 A;  2K8I A;  1D2K A;  1KFW A;  3PRD A;  3WQW A;  4LAX A;  5I98 A;  2OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...