1Q1CA

Crystal structure of n(1-260) of human fkbp52
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
237
structure length
237
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 4
publication title 3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 58
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA02
3UI4A 1Q6HA 1QZ2A 2DG3A 2KE0A 4C02B 4JFIA 1EQ3A 3KCEA 2PV1A 2RURA 3O5PA 3H9RB 1HXVA 1F8AB 2F21A 2RUCA 1FKRA 2XP5A 5HTGA 3B7XA 2ZR5A 3CGNA 2ZQSA 2KFWA 3FAPA 2IF4A 5B8IC 3O5DA 2KO7A 5HWCA 2ZQVA 1T11A 1J4HA 2VN1A 4ODQA 1ROTA 3O5QA 4R0XA 1BL4A 2PBCA 4DRMA 2XP3A 3O5GA 4JFJA 4DRPA 3IK8A 4DZ3A 4DRKA 4DZ2A 4MSPA 1FJDA 4QIBA 4J4NA 3O5MA 3KAFA 2PPNA 5I98A 2MNTA 2OFNA 1Q6IA 1M5YA 2FAPA 4N19A 2LGOA 3NTPA 5D75A 4TX0A 3UQBA 1J6YA 4LAWA 2LJ4A 2M2AA 4JFLA 2PV2A 1QPLA 1U79A 2ZQUA 1N1AA 1Q6UA 1PBKA 3UI6A 3JYMA 4TW6A 1NSGA 3KZ7A 1D7IA 5HW8A 1J4IA 4GGQA 1A7XA 1FKLA 1FKIA 2LPVA 1KT1A 4LAVA 1R9HA 4G2PA 2RUDA 4IQCA 5DIUA 1FKHA 2KR7A 1J4RA 1Y0OA 1C9HA 1EYMA 2LKNA 1ZK6A 2MLZA 4JFKA 4DRQA 1FD9A 4ITZA 4DRHA 3PRDA 3RGCA 3O5LA 4ODRA 4QT3A 2KGJA 4ODMA 2RQSA 3EY6A 3O5RA 2RUQA 4TW7A 2PPPA 4IPXA 5DIVA 2Y78A 3O5OA 3TDBA 4DROA 4DRNA 4ODKA 2L2SA 3TCZA 1FKFA 1FKSA 3JXVA 4LAXA 2DG9A 3JYJA 1D6OA 2XP4A 3LUOA 2D9FA 5HW7A 2ZR6A 4FAPA 1W26A 1YATA 2DG4A 2ITKA 4ODNA 3PRBA 1D7JA 3CGMA 2ZQTA 3MDYB 4TNSA 3O5KA 1YW5A 2PPOA 3UF8A 1B6CA 2RSEA 1FKDA 2XPAA 3UI5A 3I6CA 1NMWA 1PINA 4TW8A 2K8IA 4W9QA 5GPGA 3UQAA 3KAGA 1JVWA 4FN2A 4IQ2A 2MLYA 2MLXA 4ODOA 1Q1CA 1FKJA 2MPHA 1QPFA 5HUAA 1BKFA 2XP6A 4J4OA 4ODPA 1F40A 4DT4A 4G50A 1JNTA 2MF9A 2ZR4A 3KABA 4BF8A 5HWBA 3IKDA 2AWGA 1ROUA 1FAPA 3UQIA 4DH0A 3OOBA 4GIVA 3VAWA 4DIPA 4U84A 3PA7A 1FKTA 1ZCNA 3GPKA 3NI6A 4MGVA 2KI3A 4U85A 5J6EA 4LAYA 3WH0A 1NMVA 3KACA 4U86A 3TC5A 3O5FA 2N87A 2XP8A 1FKBA 2XP7A 2UZ5A 2Q5AA 5HKGA 1L1PA 3O5IA 1KT0A 2M08A 2F4EA 2PV3A 3ODKA 4ODLA 5HT1A 3O5JA 4O2TA 4JYSA 2JZVA 1FKKA 4W9OA 2FKEA 3NRKA 2XPBA 4JFMA 4W9PA 2M1IA 5HW6A 2VCDA 1D7HA 5DITA 2XP9A 3IKGA 4NNRA 4DRJA 3IHZA 4QT2A 3RFWA 5BXJA 3KADA 4DRIA 4TYOA 1JNSA 1P5QA 2F2DA 1TCOC 3KAHA 3O5EA 1FKGA 3KAIA
chains in the Genus database with same CATH superfamily
3RMEA 3WD0A 2RURA 2AOSA 1HKMA 2A3CA 3B7XA 3CGNA 3ARUA 1NH6A 3O5DA 1W1TA 2KO7A 5HWCA 3AS2A 1GOIA 4R0XA 4DRPA 4JFJA 4Z2HA 4MSPA 4P8XA 2PPNA 3B8SA 5DO2A 2FAPA 3UQBA 1LQ0A 1HKJA 2ZQUA 2F23A 2A3EA 1NSGA 3WD2A 5HW8A 4ZPVR 3PRAA 2A3AA 2LPVA 4IQCA 4G2PA 1HJWA 1JNEA 1HKKA 1C9HA 1EYMA 2LKNA 3RGCA 1NWTA 4QT3A 2KGJA 2RQSA 3EY6A 4DRNA 4HARA 4Q22A 3TCZA 1FKSA 4LAXA 3WD3A 3ALGA 3LUOA 1ZBKA 3CHCA 1UR8A 1W26A 1ZBCA 4ODNA 3WD1A 3RM8A 4HBOA 1CTNA 3UF8A 1WNOA 2RSEA 1NMWA 1PINA 3ARQA 4FN2A 1JVWA 4Z2JA 2MLYA 1Q1CA 1FKJA 2XP6A 4J4OA 2ZR4A 2AWGA 2WK2A 3G6MA 5GPRA 1WAWA 2PI6A 2B31A 4U84A 1ZCNA 3NI6A 2KI3A 3KACA 2N87A 1FKBA 3FXYA 2PV3A 3BMBA 3ODKA 1E6RA 4WIWA 1GPFA 4HBEA 4JYSA 1FKKA 2A3BA 2XPBA 4W9PA 5HW6A 2VCDA 1D7HA 2XP9A 1NWRA 4NNRA 3CHEA 5HBFA 4KR0B 1TCOC 3O5EA 1FKGA 5JH8A 1LL7A 2KE0A 5GQBA 3O5PA 4NSBA 1HXVA 3AQUA 2F21A 3FAPA 5B8IC 1W1VA 1OGGA 2DSVA 3ARYA 3CHDA 1WB0A 3QOKA 4Z2IA 3O5QA 1BL4A 2DPEA 3O5GA 1LG2A 1W9VA 2G8ZA 3AS3A 2MNTA 1Q6IA 2DT3A 4P8WA 3NTPA 4DWSC 1J6YA 4LAWA 2M2AA 2PV2A 1QPLA 1W1YA 1U79A 4MNKA 1TFVA 1N1AA 2WLYA 4GGQA 1NWSA 1X6NA 1A7XA 4DRMA 4DRHA 1KT1A 4DWSB 1R9HA 2KR7A 2IUZA 1J4RA 1GRJA 1OGBA 2DT1A 1W9PA 4TW7A 3CZ8A 1FKFA 3WQWA 1FFRA 1HJXA 3G6LA 1ZBWA 1EIBA 4FAPA 1YATA 2DG4A 3ARSA 3CGMA 2ZQTA 1XRVA 3O5KA 3WD4A 1LL6A 4W9QA 4ODOA 4IQ2A 5HUAA 2YBUA 2MPHA 4R5EA 1BKFA 4MNJA 1RD6A 4DT4A 4G50A 4MTVA 4MAVA 3IKDA 4S3KA 1FAPA 3UQIA 3OOBA 3VAWA 1FKTA 3CH9A 4LGXA 3WH0A 4U86A 2XP7A 2UZ5A 3O5IA 3O5JA 2JZVA 4DWSD 2EULA 1E6PA 3NRKA 3ARVA 3BXWA 4JFMA 1LG1A 2O9OA 3W4RA 2M1IA 2WM0A 1K9TA 5BXJA 3KADA 1E15A 4DRIA 1M5YA 4TX0A 3B9AA 1X6LA 3UI4A 1Q6HA 4C02B 4JFIA 3ARXA 3KCEA 2PV1A 3ARTA 1F8AB 2RUCA 1FKRA 2ZR5A 4WKHA 2ZQSA 2KFWA 1KFWA 2ZQVA 4WKFA 1T11A 1J4HA 4KQZA 4ODQA 1ITXA 2PBCA 4DZ3A 4DRKA 1FJDA 4IT6A 4J4NA 3KAFA 1HKIA 1H0IA 3WQVA 1OWQA 1UR9A 4JFLA 1W9UA 1EDQA 1PBKA 2YBTA 3ARPA 3JYMA 4TW6A 3KZ7A 1D7IA 1E6NA 4S3JA 1J4IA 4WJXA 1ZBVA 1FKLA 4LAVA 2RUDA 1FKHA 2MLZA 1D2KA 4P8VA 1FD9A 4ITZA 4MPKA 3PRDA 3WIJA 3WKZA 4ODMA 4W5UA 3O5RA 2FDMA 2Y78A 3O5OA 3TDBA 1SYTA 3JXVA 2DG9A 1D6OA 1LL4A 2D9FA 5HW7A 3RM4A 1SR0A 1H0GA 2ITKA 3WL1A 3ALFA 4TNSA 1YW5A 1JCHB 1B6CA 1FKDA 3I6CA 2ETNA 2K8IA 3KAGA 1F40A 3GTYX 4ODPA 2MF9A 5HWBA 2G41A 4PTMA 2PN0A 3FY1A 4GIVA 4DIPA 3PA7A 4WK9A 3GPKA 2B5UB 4U85A 4Q7NA 4LAYA 2XP8A 1L1PA 1KT0A 5HT1A 1O6IA 2P4VA 4WKAA 2FKEA 2DT2A 1EHNA 3IHZA 3OA5A 3RFWA 2DSZA 4URIA 2F2DA 3KAHA 5DF0A 1GUVA 1LJYA 3RM9A 2DG3A 1QZ2A 4IT4A 1EQ3A 4L72B 4ZS6A 4XAKA 3B9EA 3H9RB 5DEZA 2XP5A 3GU0A 5HTGA 2O92A 1ZB5A 2IF4A 3ARRA 2VN1A 1ROTA 2XP3A 3IK8A 4DZ2A 4QIBA 4DWSA 3O5MA 5I98A 2OFNA 1E44A 4N19A 2LGOA 5D75A 4P8UA 2LJ4A 1Q6UA 3UI6A 3B9DA 1JNDA 2QF8A 1FKIA 4ML4A 5DIUA 4Z2KA 1FFQA 1Y0OA 4NZCA 4QZVB 1ZK6A 4JFKA 4DRQA 4Z2LA 3O5LA 1W1PA 4ODRA 3ARZA 5DIVA 2RUQA 3AROA 2PPPA 4IPXA 4DROA 4L3NA 4ODKA 2L2SA 2DT0A 3AS0A 3JYJA 2XP4A 1IX5A 2ZR6A 2ESCA 3AS1A 3PRBA 1D7JA 3MDYB 2DSWA 2PPOA 3ARWA 1VF8A 1ZL1A 2XPAA 3UI5A 4TW8A 5GPGA 3UQAA 4MNMA 4ZPTR 2MLXA 4AY1A 4Z2GA 1QPFA 3WL0A 3EIPA 2WLZA 4UDMA 1JNTA 4BF8A 3KABA 1ROUA 4DH0A 1NWUA 4MGVA 5J6EA 1NMVA 3TC5A 3O5FA 3PR9A 2Q5AA 1HJVA 5HKGA 2M08A 2F4EA 3CHFA 4ODLA 4O2TA 1E6ZA 4W9OA 1E9LA 2OLHA 1ZU8A 2DSUA 5DITA 3IKGA 4MNLA 4DRJA 4QT2A 1XHGA 4TYOA 1JNSA 1P5QA 3KAIA 4ZPWR
chains in the Genus database with same CATH topology
3RMEA 3WD0A 2RURA 2AOSA 1HKMA 2A3CA 3B7XA 3CGNA 3ARUA 1NH6A 3O5DA 1W1TA 2KO7A 5HWCA 3AS2A 1GOIA 4R0XA 4DRPA 4JFJA 4Z2HA 4MSPA 4P8XA 2PPNA 3B8SA 5DO2A 2FAPA 3UQBA 1LQ0A 1HKJA 2ZQUA 2A3EA 1NSGA 3WD2A 5HW8A 4ZPVR 3PRAA 2A3AA 2LPVA 4IQCA 4G2PA 1HJWA 1JNEA 1HKKA 1C9HA 1EYMA 2LKNA 3RGCA 1NWTA 4QT3A 2KGJA 2RQSA 3EY6A 4DRNA 4HARA 4Q22A 3TCZA 1FKSA 4LAXA 3WD3A 3ALGA 3LUOA 1ZBKA 3CHCA 1UR8A 1W26A 1ZBCA 4ODNA 3WD1A 3RM8A 4HBOA 1CTNA 3UF8A 1WNOA 2RSEA 1NMWA 1PINA 3ARQA 4FN2A 1JVWA 4Z2JA 2MLYA 1Q1CA 1FKJA 2XP6A 4J4OA 2ZR4A 2AWGA 2WK2A 3G6MA 5GPRA 1WAWA 2PI6A 2B31A 4U84A 1ZCNA 3NI6A 2KI3A 3KACA 2N87A 1FKBA 3FXYA 2PV3A 3ODKA 1E6RA 4WIWA 1GPFA 4HBEA 4JYSA 1FKKA 2A3BA 2XPBA 4W9PA 5HW6A 2VCDA 1D7HA 2XP9A 1NWRA 4NNRA 3CHEA 5HBFA 4KR0B 1TCOC 3O5EA 1FKGA 5JH8A 1LL7A 2KE0A 5GQBA 3O5PA 4NSBA 1HXVA 3AQUA 2F21A 3FAPA 5B8IC 1W1VA 1OGGA 2DSVA 3ARYA 3CHDA 1WB0A 3QOKA 4Z2IA 3O5QA 1BL4A 2DPEA 3O5GA 1LG2A 1W9VA 2G8ZA 3AS3A 2MNTA 1Q6IA 2DT3A 4P8WA 3NTPA 4DWSC 1J6YA 4LAWA 2M2AA 2PV2A 1QPLA 1W1YA 1U79A 4MNKA 1TFVA 1N1AA 2WLYA 4GGQA 1NWSA 1X6NA 1A7XA 4DRMA 4DRHA 1KT1A 4DWSB 1R9HA 2KR7A 2IUZA 1J4RA 1OGBA 2DT1A 1W9PA 4TW7A 3CZ8A 1FKFA 3WQWA 1FFRA 1HJXA 3G6LA 1ZBWA 1EIBA 4FAPA 1YATA 2DG4A 3ARSA 3CGMA 2ZQTA 1XRVA 3O5KA 3WD4A 1LL6A 4W9QA 4ODOA 4IQ2A 5HUAA 2YBUA 2MPHA 4R5EA 1BKFA 4MNJA 1RD6A 4DT4A 4G50A 4MTVA 4MAVA 3IKDA 4S3KA 1FAPA 3UQIA 3OOBA 3VAWA 1FKTA 3CH9A 4LGXA 3WH0A 4U86A 2XP7A 2UZ5A 3O5IA 3O5JA 2JZVA 4DWSD 1E6PA 3NRKA 3ARVA 3BXWA 4JFMA 1LG1A 2O9OA 3W4RA 2M1IA 2WM0A 1K9TA 5BXJA 3KADA 1E15A 4DRIA 1M5YA 4TX0A 3B9AA 1X6LA 3UI4A 1Q6HA 4C02B 4JFIA 3ARXA 3KCEA 2PV1A 3ARTA 1F8AB 2RUCA 1FKRA 2ZR5A 4WKHA 2ZQSA 2KFWA 1KFWA 2ZQVA 4WKFA 1T11A 1J4HA 4KQZA 4ODQA 1ITXA 2PBCA 4DZ3A 4DRKA 1FJDA 4IT6A 4J4NA 3KAFA 1HKIA 1H0IA 3WQVA 1OWQA 1UR9A 4JFLA 1W9UA 1EDQA 1PBKA 2YBTA 3ARPA 3JYMA 4TW6A 3KZ7A 1D7IA 1E6NA 4S3JA 1J4IA 4WJXA 1ZBVA 1FKLA 4LAVA 2RUDA 1FKHA 2MLZA 1D2KA 4P8VA 1FD9A 4ITZA 4MPKA 3PRDA 3WIJA 3WKZA 4ODMA 4W5UA 3O5RA 2FDMA 2Y78A 3O5OA 3TDBA 1SYTA 3JXVA 2DG9A 1D6OA 1LL4A 2D9FA 5HW7A 3RM4A 1SR0A 1H0GA 2ITKA 3WL1A 3ALFA 4TNSA 1YW5A 1B6CA 1FKDA 3I6CA 2K8IA 3KAGA 1F40A 4ODPA 2MF9A 5HWBA 2G41A 4PTMA 3FY1A 4GIVA 4DIPA 3PA7A 4WK9A 3GPKA 4U85A 4Q7NA 4LAYA 2XP8A 1L1PA 1KT0A 5HT1A 1O6IA 4WKAA 2FKEA 2DT2A 1EHNA 3IHZA 3OA5A 3RFWA 2DSZA 4URIA 2F2DA 3KAHA 5DF0A 1GUVA 1LJYA 3RM9A 2DG3A 1QZ2A 4IT4A 1EQ3A 4L72B 4ZS6A 4XAKA 3B9EA 3H9RB 5DEZA 2XP5A 5HTGA 2O92A 1ZB5A 2IF4A 3ARRA 2VN1A 1ROTA 2XP3A 3IK8A 4DZ2A 4QIBA 4DWSA 3O5MA 5I98A 2OFNA 4N19A 2LGOA 5D75A 4P8UA 2LJ4A 1Q6UA 3UI6A 3B9DA 1JNDA 2QF8A 1FKIA 4ML4A 5DIUA 4Z2KA 1FFQA 1Y0OA 4NZCA 4QZVB 1ZK6A 4JFKA 4DRQA 4Z2LA 3O5LA 1W1PA 4ODRA 3ARZA 5DIVA 2RUQA 3AROA 2PPPA 4IPXA 4DROA 4L3NA 4ODKA 2L2SA 2DT0A 3AS0A 3JYJA 2XP4A 1IX5A 2ZR6A 2ESCA 3AS1A 3PRBA 1D7JA 3MDYB 2DSWA 2PPOA 3ARWA 1VF8A 1ZL1A 2XPAA 3UI5A 4TW8A 5GPGA 3UQAA 4MNMA 4ZPTR 2MLXA 4AY1A 4Z2GA 1QPFA 3WL0A 2WLZA 1JNTA 4BF8A 3KABA 1ROUA 4DH0A 1NWUA 4MGVA 5J6EA 1NMVA 3TC5A 3O5FA 3PR9A 2Q5AA 1HJVA 5HKGA 2M08A 2F4EA 3CHFA 4ODLA 4O2TA 1E6ZA 4W9OA 1E9LA 2OLHA 1ZU8A 2DSUA 5DITA 3IKGA 4MNLA 4DRJA 4QT2A 1XHGA 4TYOA 1JNSA 1P5QA 3KAIA 4ZPWR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI4 A;  1Q6H A;  1QZ2 A;  2DG3 A;  2KE0 A;  4C02 B;  4JFI A;  1EQ3 A;  3KCE A;  2PV1 A;  2RUR A;  3O5P A;  3H9R B;  1HXV A;  1F8A B;  2F21 A;  2RUC A;  1FKR A;  2XP5 A;  5HTG A;  3B7X A;  2ZR5 A;  3CGN A;  2ZQS A;  2KFW A;  3FAP A;  2IF4 A;  5B8I C;  3O5D A;  2KO7 A;  5HWC A;  2ZQV A;  1T11 A;  1J4H A;  2VN1 A;  4ODQ A;  1ROT A;  3O5Q A;  4R0X A;  1BL4 A;  2PBC A;  4DRM A;  2XP3 A;  3O5G A;  4JFJ A;  4DRP A;  3IK8 A;  4DZ3 A;  4DRK A;  4DZ2 A;  4MSP A;  1FJD A;  4QIB A;  4J4N A;  3O5M A;  3KAF A;  2PPN A;  5I98 A;  2MNT A;  2OFN A;  1Q6I A;  1M5Y A;  2FAP A;  4N19 A;  2LGO A;  3NTP A;  5D75 A;  4TX0 A;  3UQB A;  1J6Y A;  4LAW A;  2LJ4 A;  2M2A A;  4JFL A;  2PV2 A;  1QPL A;  1U79 A;  2ZQU A;  1N1A A;  1Q6U A;  1PBK A;  3UI6 A;  3JYM A;  4TW6 A;  1NSG A;  3KZ7 A;  1D7I A;  5HW8 A;  1J4I A;  4GGQ A;  1A7X A;  1FKL A;  1FKI A;  2LPV A;  1KT1 A;  4LAV A;  1R9H A;  4G2P A;  2RUD A;  4IQC A;  5DIU A;  1FKH A;  2KR7 A;  1J4R A;  1Y0O A;  1C9H A;  1EYM A;  2LKN A;  1ZK6 A;  2MLZ A;  4JFK A;  4DRQ A;  1FD9 A;  4ITZ A;  4DRH A;  3PRD A;  3RGC A;  3O5L A;  4ODR A;  4QT3 A;  2KGJ A;  4ODM A;  2RQS A;  3EY6 A;  3O5R A;  2RUQ A;  4TW7 A;  2PPP A;  4IPX A;  5DIV A;  2Y78 A;  3O5O A;  3TDB A;  4DRO A;  4DRN A;  4ODK A;  2L2S A;  3TCZ A;  1FKF A;  1FKS A;  3JXV A;  4LAX A;  2DG9 A;  3JYJ A;  1D6O A;  2XP4 A;  3LUO A;  2D9F A;  5HW7 A;  2ZR6 A;  4FAP A;  1W26 A;  1YAT A;  2DG4 A;  2ITK A;  4ODN A;  3PRB A;  1D7J A;  3CGM A;  2ZQT A;  3MDY B;  4TNS A;  3O5K A;  1YW5 A;  2PPO A;  3UF8 A;  1B6C A;  2RSE A;  1FKD A;  2XPA A;  3UI5 A;  3I6C A;  1NMW A;  1PIN A;  4TW8 A;  2K8I A;  4W9Q A;  5GPG A;  3UQA A;  3KAG A;  1JVW A;  4FN2 A;  4IQ2 A;  2MLY A;  2MLX A;  4ODO A;  1Q1C A;  1FKJ A;  2MPH A;  1QPF A;  5HUA A;  1BKF A;  2XP6 A;  4J4O A;  4ODP A;  1F40 A;  4DT4 A;  4G50 A;  1JNT A;  2MF9 A;  2ZR4 A;  3KAB A;  4BF8 A;  5HWB A;  3IKD A;  2AWG A;  1ROU A;  1FAP A;  3UQI A;  4DH0 A;  3OOB A;  4GIV A;  3VAW A;  4DIP A;  4U84 A;  3PA7 A;  1FKT A;  1ZCN A;  3GPK A;  3NI6 A;  4MGV A;  2KI3 A;  4U85 A;  5J6E A;  4LAY A;  3WH0 A;  1NMV A;  3KAC A;  4U86 A;  3TC5 A;  3O5F A;  2N87 A;  2XP8 A;  1FKB A;  2XP7 A;  2UZ5 A;  2Q5A A;  5HKG A;  1L1P A;  3O5I A;  1KT0 A;  2M08 A;  2F4E A;  2PV3 A;  3ODK A;  4ODL A;  5HT1 A;  3O5J A;  4O2T A;  4JYS A;  2JZV A;  1FKK A;  4W9O A;  2FKE A;  3NRK A;  2XPB A;  4JFM A;  4W9P A;  2M1I A;  5HW6 A;  2VCD A;  1D7H A;  5DIT A;  2XP9 A;  3IKG A;  4NNR A;  4DRJ A;  3IHZ A;  4QT2 A;  3RFW A;  5BXJ A;  3KAD A;  4DRI A;  4TYO A;  1JNS A;  1P5Q A;  2F2D A;  1TCO C;  3KAH A;  3O5E A;  1FKG A;  3KAI A; 
#chains in the Genus database with same CATH topology
 3RME A;  3WD0 A;  2RUR A;  2AOS A;  1HKM A;  2A3C A;  3B7X A;  3CGN A;  3ARU A;  1NH6 A;  3O5D A;  1W1T A;  2KO7 A;  5HWC A;  3AS2 A;  1GOI A;  4R0X A;  4DRP A;  4JFJ A;  4Z2H A;  4MSP A;  4P8X A;  2PPN A;  3B8S A;  5DO2 A;  2FAP A;  3UQB A;  1LQ0 A;  1HKJ A;  2ZQU A;  2F23 A;  2A3E A;  1NSG A;  3WD2 A;  5HW8 A;  4ZPV R;  3PRA A;  2A3A A;  2LPV A;  4IQC A;  4G2P A;  1HJW A;  1JNE A;  1HKK A;  1C9H A;  1EYM A;  2LKN A;  3RGC A;  1NWT A;  4QT3 A;  2KGJ A;  2RQS A;  3EY6 A;  4DRN A;  4HAR A;  4Q22 A;  3TCZ A;  1FKS A;  4LAX A;  3WD3 A;  3ALG A;  3LUO A;  1ZBK A;  3CHC A;  1UR8 A;  1W26 A;  1ZBC A;  4ODN A;  3WD1 A;  3RM8 A;  4HBO A;  1CTN A;  3UF8 A;  1WNO A;  2RSE A;  1NMW A;  1PIN A;  3ARQ A;  4FN2 A;  1JVW A;  4Z2J A;  2MLY A;  1Q1C A;  1FKJ A;  2XP6 A;  4J4O A;  2ZR4 A;  2AWG A;  2WK2 A;  3G6M A;  5GPR A;  1WAW A;  2PI6 A;  2B31 A;  4U84 A;  1ZCN A;  3NI6 A;  2KI3 A;  3KAC A;  2N87 A;  1FKB A;  3FXY A;  2PV3 A;  3BMB A;  3ODK A;  1E6R A;  4WIW A;  1GPF A;  4HBE A;  4JYS A;  1FKK A;  2A3B A;  2XPB A;  4W9P A;  5HW6 A;  2VCD A;  1D7H A;  2XP9 A;  1NWR A;  4NNR A;  3CHE A;  5HBF A;  4KR0 B;  1TCO C;  3O5E A;  1FKG A;  5JH8 A;  1LL7 A;  2KE0 A;  5GQB A;  3O5P A;  4NSB A;  1HXV A;  3AQU A;  2F21 A;  3FAP A;  5B8I C;  1W1V A;  1OGG A;  2DSV A;  3ARY A;  3CHD A;  1WB0 A;  3QOK A;  4Z2I A;  3O5Q A;  1BL4 A;  2DPE A;  3O5G A;  1LG2 A;  1W9V A;  2G8Z A;  3AS3 A;  2MNT A;  1Q6I A;  2DT3 A;  4P8W A;  3NTP A;  4DWS C;  1J6Y A;  4LAW A;  2M2A A;  2PV2 A;  1QPL A;  1W1Y A;  1U79 A;  4MNK A;  1TFV A;  1N1A A;  2WLY A;  4GGQ A;  1NWS A;  1X6N A;  1A7X A;  4DRM A;  4DRH A;  1KT1 A;  4DWS B;  1R9H A;  2KR7 A;  2IUZ A;  1J4R A;  1GRJ A;  1OGB A;  2DT1 A;  1W9P A;  4TW7 A;  3CZ8 A;  1FKF A;  3WQW A;  1FFR A;  1HJX A;  3G6L A;  1ZBW A;  1EIB A;  4FAP A;  1YAT A;  2DG4 A;  3ARS A;  3CGM A;  2ZQT A;  1XRV A;  3O5K A;  3WD4 A;  1LL6 A;  4W9Q A;  4ODO A;  4IQ2 A;  5HUA A;  2YBU A;  2MPH A;  4R5E A;  1BKF A;  4MNJ A;  1RD6 A;  4DT4 A;  4G50 A;  4MTV A;  4MAV A;  3IKD A;  4S3K A;  1FAP A;  3UQI A;  3OOB A;  3VAW A;  1FKT A;  3CH9 A;  4LGX A;  3WH0 A;  4U86 A;  2XP7 A;  2UZ5 A;  3O5I A;  3O5J A;  2JZV A;  4DWS D;  2EUL A;  1E6P A;  3NRK A;  3ARV A;  3BXW A;  4JFM A;  1LG1 A;  2O9O A;  3W4R A;  2M1I A;  2WM0 A;  1K9T A;  5BXJ A;  3KAD A;  1E15 A;  4DRI A;  1M5Y A;  4TX0 A;  3B9A A;  1X6L A;  3UI4 A;  1Q6H A;  4C02 B;  4JFI A;  3ARX A;  3KCE A;  2PV1 A;  3ART A;  1F8A B;  2RUC A;  1FKR A;  2ZR5 A;  4WKH A;  2ZQS A;  2KFW A;  1KFW A;  2ZQV A;  4WKF A;  1T11 A;  1J4H A;  4KQZ A;  4ODQ A;  1ITX A;  2PBC A;  4DZ3 A;  4DRK A;  1FJD A;  4IT6 A;  4J4N A;  3KAF A;  1HKI A;  1H0I A;  3WQV A;  1OWQ A;  1UR9 A;  4JFL A;  1W9U A;  1EDQ A;  1PBK A;  2YBT A;  3ARP A;  3JYM A;  4TW6 A;  3KZ7 A;  1D7I A;  1E6N A;  4S3J A;  1J4I A;  4WJX A;  1ZBV A;  1FKL A;  4LAV A;  2RUD A;  1FKH A;  2MLZ A;  1D2K A;  4P8V A;  1FD9 A;  4ITZ A;  4MPK A;  3PRD A;  3WIJ A;  3WKZ A;  4ODM A;  4W5U A;  3O5R A;  2FDM A;  2Y78 A;  3O5O A;  3TDB A;  1SYT A;  3JXV A;  2DG9 A;  1D6O A;  1LL4 A;  2D9F A;  5HW7 A;  3RM4 A;  1SR0 A;  1H0G A;  2ITK A;  3WL1 A;  3ALF A;  4TNS A;  1YW5 A;  1JCH B;  1B6C A;  1FKD A;  3I6C A;  2ETN A;  2K8I A;  3KAG A;  1F40 A;  3GTY X;  4ODP A;  2MF9 A;  5HWB A;  2G41 A;  4PTM A;  2PN0 A;  3FY1 A;  4GIV A;  4DIP A;  3PA7 A;  4WK9 A;  3GPK A;  2B5U B;  4U85 A;  4Q7N A;  4LAY A;  2XP8 A;  1L1P A;  1KT0 A;  5HT1 A;  1O6I A;  2P4V A;  4WKA A;  2FKE A;  2DT2 A;  1EHN A;  3IHZ A;  3OA5 A;  3RFW A;  2DSZ A;  4URI A;  2F2D A;  3KAH A;  5DF0 A;  1GUV A;  1LJY A;  3RM9 A;  2DG3 A;  1QZ2 A;  4IT4 A;  1EQ3 A;  4L72 B;  4ZS6 A;  4XAK A;  3B9E A;  3H9R B;  5DEZ A;  2XP5 A;  3GU0 A;  5HTG A;  2O92 A;  1ZB5 A;  2IF4 A;  3ARR A;  2VN1 A;  1ROT A;  2XP3 A;  3IK8 A;  4DZ2 A;  4QIB A;  4DWS A;  3O5M A;  5I98 A;  2OFN A;  1E44 A;  4N19 A;  2LGO A;  5D75 A;  4P8U A;  2LJ4 A;  1Q6U A;  3UI6 A;  3B9D A;  1JND A;  2QF8 A;  1FKI A;  4ML4 A;  5DIU A;  4Z2K A;  1FFQ A;  1Y0O A;  4NZC A;  4QZV B;  1ZK6 A;  4JFK A;  4DRQ A;  4Z2L A;  3O5L A;  1W1P A;  4ODR A;  3ARZ A;  5DIV A;  2RUQ A;  3ARO A;  2PPP A;  4IPX A;  4DRO A;  4L3N A;  4ODK A;  2L2S A;  2DT0 A;  3AS0 A;  3JYJ A;  2XP4 A;  1IX5 A;  2ZR6 A;  2ESC A;  3AS1 A;  3PRB A;  1D7J A;  3MDY B;  2DSW A;  2PPO A;  3ARW A;  1VF8 A;  1ZL1 A;  2XPA A;  3UI5 A;  4TW8 A;  5GPG A;  3UQA A;  4MNM A;  4ZPT R;  2MLX A;  4AY1 A;  4Z2G A;  1QPF A;  3WL0 A;  3EIP A;  2WLZ A;  4UDM A;  1JNT A;  4BF8 A;  3KAB A;  1ROU A;  4DH0 A;  1NWU A;  4MGV A;  5J6E A;  1NMV A;  3TC5 A;  3O5F A;  3PR9 A;  2Q5A A;  1HJV A;  5HKG A;  2M08 A;  2F4E A;  3CHF A;  4ODL A;  4O2T A;  1E6Z A;  4W9O A;  1E9L A;  2OLH A;  1ZU8 A;  2DSU A;  5DIT A;  3IKG A;  4MNL A;  4DRJ A;  4QT2 A;  1XHG A;  4TYO A;  1JNS A;  1P5Q A;  3KAI A;  4ZPW R; 
#chains in the Genus database with same CATH homology
 3RME A;  3WD0 A;  2RUR A;  2AOS A;  1HKM A;  2A3C A;  3B7X A;  3CGN A;  3ARU A;  1NH6 A;  3O5D A;  1W1T A;  2KO7 A;  5HWC A;  3AS2 A;  1GOI A;  4R0X A;  4DRP A;  4JFJ A;  4Z2H A;  4MSP A;  4P8X A;  2PPN A;  3B8S A;  5DO2 A;  2FAP A;  3UQB A;  1LQ0 A;  1HKJ A;  2ZQU A;  2A3E A;  1NSG A;  3WD2 A;  5HW8 A;  4ZPV R;  3PRA A;  2A3A A;  2LPV A;  4IQC A;  4G2P A;  1HJW A;  1JNE A;  1HKK A;  1C9H A;  1EYM A;  2LKN A;  3RGC A;  1NWT A;  4QT3 A;  2KGJ A;  2RQS A;  3EY6 A;  4DRN A;  4HAR A;  4Q22 A;  3TCZ A;  1FKS A;  4LAX A;  3WD3 A;  3ALG A;  3LUO A;  1ZBK A;  3CHC A;  1UR8 A;  1W26 A;  1ZBC A;  4ODN A;  3WD1 A;  3RM8 A;  4HBO A;  1CTN A;  3UF8 A;  1WNO A;  2RSE A;  1NMW A;  1PIN A;  3ARQ A;  4FN2 A;  1JVW A;  4Z2J A;  2MLY A;  1Q1C A;  1FKJ A;  2XP6 A;  4J4O A;  2ZR4 A;  2AWG A;  2WK2 A;  3G6M A;  5GPR A;  1WAW A;  2PI6 A;  2B31 A;  4U84 A;  1ZCN A;  3NI6 A;  2KI3 A;  3KAC A;  2N87 A;  1FKB A;  3FXY A;  2PV3 A;  3ODK A;  1E6R A;  4WIW A;  1GPF A;  4HBE A;  4JYS A;  1FKK A;  2A3B A;  2XPB A;  4W9P A;  5HW6 A;  2VCD A;  1D7H A;  2XP9 A;  1NWR A;  4NNR A;  3CHE A;  5HBF A;  4KR0 B;  1TCO C;  3O5E A;  1FKG A;  5JH8 A;  1LL7 A;  2KE0 A;  5GQB A;  3O5P A;  4NSB A;  1HXV A;  3AQU A;  2F21 A;  3FAP A;  5B8I C;  1W1V A;  1OGG A;  2DSV A;  3ARY A;  3CHD A;  1WB0 A;  3QOK A;  4Z2I A;  3O5Q A;  1BL4 A;  2DPE A;  3O5G A;  1LG2 A;  1W9V A;  2G8Z A;  3AS3 A;  2MNT A;  1Q6I A;  2DT3 A;  4P8W A;  3NTP A;  4DWS C;  1J6Y A;  4LAW A;  2M2A A;  2PV2 A;  1QPL A;  1W1Y A;  1U79 A;  4MNK A;  1TFV A;  1N1A A;  2WLY A;  4GGQ A;  1NWS A;  1X6N A;  1A7X A;  4DRM A;  4DRH A;  1KT1 A;  4DWS B;  1R9H A;  2KR7 A;  2IUZ A;  1J4R A;  1OGB A;  2DT1 A;  1W9P A;  4TW7 A;  3CZ8 A;  1FKF A;  3WQW A;  1FFR A;  1HJX A;  3G6L A;  1ZBW A;  1EIB A;  4FAP A;  1YAT A;  2DG4 A;  3ARS A;  3CGM A;  2ZQT A;  1XRV A;  3O5K A;  3WD4 A;  1LL6 A;  4W9Q A;  4ODO A;  4IQ2 A;  5HUA A;  2YBU A;  2MPH A;  4R5E A;  1BKF A;  4MNJ A;  1RD6 A;  4DT4 A;  4G50 A;  4MTV A;  4MAV A;  3IKD A;  4S3K A;  1FAP A;  3UQI A;  3OOB A;  3VAW A;  1FKT A;  3CH9 A;  4LGX A;  3WH0 A;  4U86 A;  2XP7 A;  2UZ5 A;  3O5I A;  3O5J A;  2JZV A;  4DWS D;  1E6P A;  3NRK A;  3ARV A;  3BXW A;  4JFM A;  1LG1 A;  2O9O A;  3W4R A;  2M1I A;  2WM0 A;  1K9T A;  5BXJ A;  3KAD A;  1E15 A;  4DRI A;  1M5Y A;  4TX0 A;  3B9A A;  1X6L A;  3UI4 A;  1Q6H A;  4C02 B;  4JFI A;  3ARX A;  3KCE A;  2PV1 A;  3ART A;  1F8A B;  2RUC A;  1FKR A;  2ZR5 A;  4WKH A;  2ZQS A;  2KFW A;  1KFW A;  2ZQV A;  4WKF A;  1T11 A;  1J4H A;  4KQZ A;  4ODQ A;  1ITX A;  2PBC A;  4DZ3 A;  4DRK A;  1FJD A;  4IT6 A;  4J4N A;  3KAF A;  1HKI A;  1H0I A;  3WQV A;  1OWQ A;  1UR9 A;  4JFL A;  1W9U A;  1EDQ A;  1PBK A;  2YBT A;  3ARP A;  3JYM A;  4TW6 A;  3KZ7 A;  1D7I A;  1E6N A;  4S3J A;  1J4I A;  4WJX A;  1ZBV A;  1FKL A;  4LAV A;  2RUD A;  1FKH A;  2MLZ A;  1D2K A;  4P8V A;  1FD9 A;  4ITZ A;  4MPK A;  3PRD A;  3WIJ A;  3WKZ A;  4ODM A;  4W5U A;  3O5R A;  2FDM A;  2Y78 A;  3O5O A;  3TDB A;  1SYT A;  3JXV A;  2DG9 A;  1D6O A;  1LL4 A;  2D9F A;  5HW7 A;  3RM4 A;  1SR0 A;  1H0G A;  2ITK A;  3WL1 A;  3ALF A;  4TNS A;  1YW5 A;  1B6C A;  1FKD A;  3I6C A;  2K8I A;  3KAG A;  1F40 A;  4ODP A;  2MF9 A;  5HWB A;  2G41 A;  4PTM A;  3FY1 A;  4GIV A;  4DIP A;  3PA7 A;  4WK9 A;  3GPK A;  4U85 A;  4Q7N A;  4LAY A;  2XP8 A;  1L1P A;  1KT0 A;  5HT1 A;  1O6I A;  4WKA A;  2FKE A;  2DT2 A;  1EHN A;  3IHZ A;  3OA5 A;  3RFW A;  2DSZ A;  4URI A;  2F2D A;  3KAH A;  5DF0 A;  1GUV A;  1LJY A;  3RM9 A;  2DG3 A;  1QZ2 A;  4IT4 A;  1EQ3 A;  4L72 B;  4ZS6 A;  4XAK A;  3B9E A;  3H9R B;  5DEZ A;  2XP5 A;  5HTG A;  2O92 A;  1ZB5 A;  2IF4 A;  3ARR A;  2VN1 A;  1ROT A;  2XP3 A;  3IK8 A;  4DZ2 A;  4QIB A;  4DWS A;  3O5M A;  5I98 A;  2OFN A;  4N19 A;  2LGO A;  5D75 A;  4P8U A;  2LJ4 A;  1Q6U A;  3UI6 A;  3B9D A;  1JND A;  2QF8 A;  1FKI A;  4ML4 A;  5DIU A;  4Z2K A;  1FFQ A;  1Y0O A;  4NZC A;  4QZV B;  1ZK6 A;  4JFK A;  4DRQ A;  4Z2L A;  3O5L A;  1W1P A;  4ODR A;  3ARZ A;  5DIV A;  2RUQ A;  3ARO A;  2PPP A;  4IPX A;  4DRO A;  4L3N A;  4ODK A;  2L2S A;  2DT0 A;  3AS0 A;  3JYJ A;  2XP4 A;  1IX5 A;  2ZR6 A;  2ESC A;  3AS1 A;  3PRB A;  1D7J A;  3MDY B;  2DSW A;  2PPO A;  3ARW A;  1VF8 A;  1ZL1 A;  2XPA A;  3UI5 A;  4TW8 A;  5GPG A;  3UQA A;  4MNM A;  4ZPT R;  2MLX A;  4AY1 A;  4Z2G A;  1QPF A;  3WL0 A;  2WLZ A;  1JNT A;  4BF8 A;  3KAB A;  1ROU A;  4DH0 A;  1NWU A;  4MGV A;  5J6E A;  1NMV A;  3TC5 A;  3O5F A;  3PR9 A;  2Q5A A;  1HJV A;  5HKG A;  2M08 A;  2F4E A;  3CHF A;  4ODL A;  4O2T A;  1E6Z A;  4W9O A;  1E9L A;  2OLH A;  1ZU8 A;  2DSU A;  5DIT A;  3IKG A;  4MNL A;  4DRJ A;  4QT2 A;  1XHG A;  4TYO A;  1JNS A;  1P5Q A;  3KAI A;  4ZPW R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...