1Q1CA

Crystal structure of n(1-260) of human fkbp52
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
237
structure length
237
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 4
publication title 3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA02
2MLXA 1D7JA 1FKTA 2XP8A 3LUOA 3UI4A 2KR7A 1NSGA 1R9HA 2ITKA 4G2PA 4TW7A 2IF4A 3UQAA 1ROTA 1J6YA 3O5FA 1C9HA 2F4EA 3TDBA 5I98A 3O5QA 5HWBA 4DRJA 4DIPA 3JYJA 4QIBA 3KAHA 4IQCA 1FKRA 2VCDA 3PRDA 4JFJA 4J4OA 4DRNA 1W26A 1QPLA 3H9RB 3O5KA 4J4NA 1U79A 4O2TA 4DT4A 4GIVA 1F40A 2ZQSA 1PBKA 3TC5A 2RURA 3I6CA 3UQIA 1FKKA 4FAPA 5GPGA 4JFMA 4GGQA 1HXVA 4JYSA 1KT1A 4DRMA 2PBCA 2PPOA 2D9FA 4G50A 2KFWA 4QT2A 1Q6HA 1FKLA 3NTPA 3IKGA 2XP6A 2F21A 1A7XA 5HUAA 2M08A 2L2SA 1YATA 2KO7A 3O5LA 1J4HA 2JZVA 1ZK6A 2KGJA 4LAWA 4DRPA 2PV2A 2PPPA 4DRHA 4BF8A 4LAYA 2ZR5A 2AWGA 4DROA 4MGVA 3UF8A 2RUCA 3KACA 3IKDA 1B6CA 1Q6UA 2ZQTA 1FKHA 1ROUA 4DRQA 1FKDA 3KAGA 1JNTA 1M5YA 4IQ2A 5HW6A 1QZ2A 2MF9A 2PV3A 2UZ5A 5B8IC 3UQBA 1QPFA 3O5MA 4ODMA 4DRIA 4NNRA 3O5RA 3IK8A 3KAFA 2FAPA 3O5OA 2MNTA 2XP9A 2MLYA 2M2AA 2XPBA 5BXJA 2FKEA 2M1IA 3KAIA 3KZ7A 5DITA 4MSPA 4JFKA 4DRKA 1FKSA 2DG3A 1FKFA 1J4RA 1JNSA 5HW8A 4TW6A 4R0XA 3GPKA 1Y0OA 1EQ3A 1FJDA 3KADA 2DG4A 1N1AA 2MPHA 5D75A 4ODLA 1PINA 4W9PA 4U85A 1Q6IA 2LPVA 2K8IA 2N87A 2XP7A 2Y78A 2VN1A 2RUQA 2LGOA 4LAVA 1FKBA 2XPAA 4U86A 4W9QA 2KI3A 4ODPA 3RGCA 3MDYB 1JVWA 3VAWA 5HKGA 2OFNA 4TNSA 4TW8A 4C02B 1F8AB 3O5JA 3ODKA 3O5DA 3O5EA 4DZ2A 1FKIA 1J4IA 3WH0A 1EYMA 2MLZA 1Q1CA 4JFLA 2PPNA 2ZQUA 1T11A 2RUDA 3NI6A 3O5GA 2F2DA 1NMWA 1NMVA 3CGNA 3PA7A 4QT3A 2RSEA 1BL4A 4DH0A 2PV1A 3JXVA 3KCEA 2DG9A 4FN2A 3UI6A 2ZR4A 1KT0A 3O5PA 5HT1A 3KABA 2XP3A 4JFIA 4ODRA 2XP4A 2KE0A 3OOBA 5J6EA 2ZR6A 4ODKA 4ODOA 3B7XA 1BKFA 4LAXA 4TX0A 4DZ3A 2LKNA 4IPXA 4U84A 3PRBA 3EY6A 3UI5A 1FKJA 2ZQVA 3CGMA 4ODNA 5DIUA 3RFWA 3JYMA 1D7HA 1TCOC 1D7IA 2LJ4A 4TYOA 5HWCA 2RQSA 1YW5A 3NRKA 2XP5A 1FD9A 4W9OA 5DIVA 3FAPA 4N19A 3TCZA 3O5IA 2Q5AA 4ODQA 1FKGA 1FAPA 4ITZA 1ZCNA 5HTGA 5HW7A 1L1PA 3IHZA 1P5QA 1D6OA
chains in the Genus database with same CATH superfamily
1CTNA 1LJYA 2G8ZA 2MLXA 3ARZA 4TW7A 4DWSC 3AS2A 2WLYA 1FKRA 2VCDA 1WAWA 1QPLA 4O2TA 4DT4A 2PI6A 3AROA 4DRMA 2PBCA 2PPOA 4HBEA 1JNEA 2YBUA 1Q6HA 3FXYA 1A7XA 1YATA 2KO7A 3O5LA 1J4HA 2KGJA 1ZU8A 4DRHA 3ARYA 4BF8A 4LAYA 1HKJA 3UF8A 1Q6UA 1FKHA 5HW6A 1FKDA 1M5YA 2MF9A 4PTMA 5B8IC 3UQBA 1QPFA 2P4VA 3O5RA 4S3JA 3O5OA 4IT4A 5BXJA 4Z2KA 5DITA 4MSPA 4JFKA 4WK9A 4DRKA 1FKSA 1FKFA 4WIWA 4R0XA 3GPKA 3KADA 4ODLA 2LPVA 2YBTA 5HKGA 1EDQA 4ODPA 4Q7NA 4TW8A 3ODKA 3O5EA 4P8VA 3WH0A 3AQUA 3CHDA 1W1TA 1T11A 4Z2GA 1NMVA 4HARA 4Z2LA 4DH0A 2DG9A 3B9EA 3UI6A 2ZR4A 3O5PA 1LG1A 2KE0A 2DSUA 1FFQA 1E44A 4IPXA 2DSZA 3PRBA 3EY6A 1ZBVA 1XHGA 3B8SA 5HWCA 1ZCNA 1D6OA 2OLHA 2PN0A 2EULA 1XRVA 2KR7A 1HKKA 1UR8A 2ITKA 1HJXA 2IF4A 1GUVA 1C9HA 3ARWA 1NWRA 3TDBA 2ESCA 1GRJA 1O6IA 4DIPA 3JYJA 3KAHA 3ARTA 4DRNA 1W26A 3H9RB 2ZQSA 1E9LA 1PBKA 2DSVA 3BMBA 4ML4A 1KFWA 5DF0A 3TC5A 3I6CA 5GPGA 1K9TA 4G50A 2KFWA 1W9UA 2WM0A 3NTPA 3IKGA 3WL1A 3WD2A 1ZK6A 4DRPA 2PPPA 1X6NA 4DROA 4MGVA 3ARQA 2DT0A 1E6ZA 2ZQTA 4UDMA 4DRQA 1HJVA 4IQ2A 1W9PA 1H0GA 5DO2A 4ODMA 2FAPA 2MNTA 4MTVA 2G41A 2XPBA 4KR0B 2FKEA 3CHCA 2DG3A 3WD3A 4TW6A 1Y0OA 1FJDA 2ETNA 4MNKA 1LG2A 2AOSA 4U85A 1Q6IA 4WKFA 1W1YA 2Y78A 1ZBKA 2K8IA 2VN1A 2RUQA 4LAVA 2XPAA 4U86A 2KI3A 1NWSA 1F40A 1JVWA 4TNSA 4WJXA 3O5JA 4DZ2A 1JNDA 3O5DA 1OWQA 2B5UB 4Z2IA 3NI6A 2F2DA 1NMWA 2WK2A 4FN2A 3CHEA 4JFIA 2XP4A 3CH9A 1LL6A 4IT6A 4ODKA 4TX0A 3B7XA 4DZ3A 4XAKA 1RD6A 4L72B 1EHNA 3UI5A 1FKJA 2ZQVA 1ZBCA 1IX5A 5DIUA 3JYMA 1D7HA 1TCOC 2LJ4A 4TYOA 1SR0A 1D2KA 3AS1A 4L3NA 4N19A 4ODQA 1JCHB 1GPFA 4ITZA 5HW7A 2QF8A 1E6NA 1WNOA 1D7JA 1FKTA 2A3BA 3LUOA 3WD4A 1E15A 3ARUA 1NSGA 3WQVA 1R9HA 4ZPVR 4G2PA 1J6YA 1HKIA 4IQCA 3PRDA 4JFJA 4J4OA 3O5KA 3WD0A 3AS3A 1ZBWA 3RMEA 4DWSA 3UQIA 4FAPA 1FKKA 1NWTA 4JFMA 1ITXA 3ARXA 1KT1A 4S3KA 2XP6A 3G6LA 1GOIA 2F21A 2DPEA 3WKZA 1NH6A 1W9VA 4Z2JA 3WQWA 1E6PA 5JH8A 3CZ8A 3QOKA 2UZ5A 4MNJA 4QZVB 3O5MA 1E6RA 1ZL1A 1LL4A 4DRIA 4ZPWR 3IK8A 3KAFA 3OA5A 3RM9A 2M2AA 3GTYX 1X6LA 3KAIA 2A3CA 4KQZA 4AY1A 4P8UA 3PR9A 2DG4A 1N1AA 2MPHA 2A3EA 1PINA 2N87A 4ZPTR 2LGOA 3FY1A 1JNSA 4NZCA 4C02B 1F8AB 3ARSA 1J4IA 1EYMA 2MLZA 1Q1CA 3G6MA 2PPNA 5HBFA 2RUDA 3O5GA 1LL7A 4QT3A 2RSEA 1BL4A 2PV1A 3JXVA 3WIJA 1KT0A 5HT1A 3KABA 2DT1A 2XP3A 3OOBA 2ZR6A 1W1VA 4ODOA 1BKFA 4LAXA 4Q22A 1NWUA 3CGMA 4ODNA 2DT2A 1W1PA 1D7IA 3EIPA 4LGXA 2WLZA 3FAPA 3TCZA 3O5IA 4W5UA 1FAPA 3IHZA 1OGBA 1FFRA 1LQ0A 2XP8A 3UI4A 4MNMA 3GU0A 3UQAA 1HKMA 1ROTA 3O5FA 2F4EA 2FDMA 5I98A 3O5QA 5HWBA 4DRJA 5GPRA 4QIBA 3WL0A 4J4NA 1U79A 4GIVA 2RURA 4NSBA 3ARVA 4GGQA 4DWSB 4DWSD 4JYSA 1HXVA 4MNLA 2D9FA 4MAVA 4QT2A 2A3AA 4ZS6A 1FKLA 3ALFA 5GQBA 5DEZA 5HUAA 2M08A 2L2SA 2JZVA 4LAWA 2PV2A 3WD1A 2ZR5A 4P8WA 4HBOA 2AWGA 2O92A 1SYTA 1EIBA 2RUCA 3W4RA 2O9OA 3KACA 3IKDA 1B6CA 4P8XA 1ROUA 3KAGA 1JNTA 1QZ2A 2PV3A 4Z2HA 3AS0A 4NNRA 2XP9A 1UR9A 2MLYA 4URIA 3ARRA 2M1IA 3KZ7A 1HJWA 1J4RA 5HW8A 1EQ3A 3B9DA 5D75A 4W9PA 2XP7A 2DT3A 4W9QA 1FKBA 3RGCA 3PRAA 3MDYB 3VAWA 2OFNA 3B9AA 4R5EA 1FKIA 4MPKA 1WB0A 4JFLA 2ZQUA 3RM4A 1ZB5A 4WKHA 3CGNA 2IUZA 3ALGA 3PA7A 3KCEA 1OGGA 3CHFA 4WKAA 1TFVA 4ODRA 5J6EA 1H0IA 1VF8A 2LKNA 4U84A 2F23A 3RFWA 2B31A 3ARPA 2RQSA 1YW5A 2DSWA 2XP5A 1FD9A 3NRKA 3BXWA 4W9OA 5DIVA 3RM8A 2Q5AA 1FKGA 1L1PA 5HTGA 1P5QA
chains in the Genus database with same CATH topology
1CTNA 1LJYA 2G8ZA 2MLXA 3ARZA 4TW7A 4DWSC 3AS2A 2WLYA 1FKRA 2VCDA 1WAWA 1QPLA 4O2TA 4DT4A 2PI6A 3AROA 4DRMA 2PBCA 2PPOA 4HBEA 1JNEA 2YBUA 1Q6HA 3FXYA 1A7XA 1YATA 2KO7A 3O5LA 1J4HA 2KGJA 1ZU8A 4DRHA 3ARYA 4BF8A 4LAYA 1HKJA 3UF8A 1Q6UA 1FKHA 5HW6A 1FKDA 1M5YA 2MF9A 4PTMA 5B8IC 3UQBA 1QPFA 3O5RA 4S3JA 3O5OA 4IT4A 5BXJA 4Z2KA 5DITA 4MSPA 4JFKA 4WK9A 4DRKA 1FKSA 1FKFA 4WIWA 4R0XA 3GPKA 3KADA 4ODLA 2LPVA 2YBTA 5HKGA 1EDQA 4ODPA 4Q7NA 4TW8A 3ODKA 3O5EA 4P8VA 3WH0A 3AQUA 3CHDA 1W1TA 1T11A 4Z2GA 1NMVA 4HARA 4Z2LA 4DH0A 2DG9A 3B9EA 3UI6A 2ZR4A 3O5PA 1LG1A 2KE0A 2DSUA 1FFQA 4IPXA 2DSZA 3PRBA 3EY6A 1ZBVA 1XHGA 3B8SA 5HWCA 1ZCNA 1D6OA 2OLHA 1XRVA 2KR7A 1HKKA 1UR8A 2ITKA 1HJXA 2IF4A 1GUVA 1C9HA 3ARWA 1NWRA 3TDBA 2ESCA 1O6IA 4DIPA 3JYJA 3KAHA 3ARTA 4DRNA 1W26A 3H9RB 2ZQSA 1E9LA 1PBKA 2DSVA 4ML4A 5DF0A 1KFWA 3TC5A 3I6CA 5GPGA 1K9TA 4G50A 2KFWA 1W9UA 2WM0A 3NTPA 3IKGA 3WL1A 3WD2A 1ZK6A 4DRPA 2PPPA 1X6NA 4DROA 4MGVA 3ARQA 2DT0A 1E6ZA 2ZQTA 4DRQA 1HJVA 4IQ2A 1W9PA 1H0GA 5DO2A 4ODMA 2FAPA 2MNTA 4MTVA 2G41A 2XPBA 4KR0B 2FKEA 3CHCA 2DG3A 3WD3A 4TW6A 1Y0OA 1FJDA 4MNKA 1LG2A 2AOSA 4U85A 1Q6IA 4WKFA 1W1YA 2Y78A 1ZBKA 2K8IA 2VN1A 2RUQA 4LAVA 2XPAA 4U86A 2KI3A 1NWSA 1F40A 1JVWA 4TNSA 4WJXA 3O5JA 4DZ2A 1JNDA 3O5DA 1OWQA 4Z2IA 3NI6A 2F2DA 1NMWA 2WK2A 4FN2A 3CHEA 4JFIA 2XP4A 3CH9A 1LL6A 4IT6A 4ODKA 4TX0A 3B7XA 4DZ3A 4XAKA 1RD6A 4L72B 1EHNA 3UI5A 1FKJA 2ZQVA 1ZBCA 1IX5A 5DIUA 3JYMA 1D7HA 1TCOC 2LJ4A 4TYOA 1SR0A 1D2KA 3AS1A 4L3NA 4N19A 4ODQA 1GPFA 4ITZA 5HW7A 2QF8A 1E6NA 1WNOA 1D7JA 1FKTA 2A3BA 3LUOA 3WD4A 1E15A 3ARUA 1NSGA 3WQVA 1R9HA 4ZPVR 4G2PA 1J6YA 1HKIA 4IQCA 3PRDA 4JFJA 4J4OA 3O5KA 3WD0A 3AS3A 1ZBWA 3RMEA 4DWSA 3UQIA 4FAPA 1FKKA 1NWTA 4JFMA 1ITXA 3ARXA 1KT1A 4S3KA 2XP6A 3G6LA 1GOIA 2F21A 2DPEA 3WKZA 1NH6A 1W9VA 4Z2JA 3WQWA 1E6PA 5JH8A 3CZ8A 3QOKA 2UZ5A 4MNJA 4QZVB 3O5MA 1E6RA 1ZL1A 1LL4A 4DRIA 4ZPWR 3IK8A 3KAFA 3OA5A 3RM9A 2M2AA 1X6LA 3KAIA 2A3CA 4KQZA 4AY1A 4P8UA 3PR9A 2DG4A 1N1AA 2MPHA 2A3EA 1PINA 2N87A 4ZPTR 2LGOA 3FY1A 1JNSA 4NZCA 4C02B 1F8AB 3ARSA 1J4IA 1EYMA 2MLZA 1Q1CA 3G6MA 2PPNA 5HBFA 2RUDA 3O5GA 1LL7A 4QT3A 2RSEA 1BL4A 2PV1A 3JXVA 3WIJA 1KT0A 5HT1A 3KABA 2DT1A 2XP3A 3OOBA 2ZR6A 1W1VA 4ODOA 1BKFA 4LAXA 4Q22A 1NWUA 3CGMA 4ODNA 2DT2A 1W1PA 1D7IA 4LGXA 2WLZA 3FAPA 3TCZA 3O5IA 4W5UA 1FAPA 3IHZA 1OGBA 1FFRA 1LQ0A 2XP8A 3UI4A 4MNMA 3UQAA 1HKMA 1ROTA 3O5FA 2F4EA 2FDMA 5I98A 3O5QA 5HWBA 4DRJA 5GPRA 4QIBA 3WL0A 4J4NA 1U79A 4GIVA 2RURA 4NSBA 3ARVA 4GGQA 4DWSB 4DWSD 4JYSA 1HXVA 4MNLA 2D9FA 4MAVA 4QT2A 2A3AA 4ZS6A 1FKLA 3ALFA 5GQBA 5DEZA 5HUAA 2M08A 2L2SA 2JZVA 4LAWA 2PV2A 3WD1A 2ZR5A 4P8WA 4HBOA 2AWGA 2O92A 1SYTA 1EIBA 2RUCA 3W4RA 2O9OA 3KACA 3IKDA 1B6CA 4P8XA 1ROUA 3KAGA 1JNTA 1QZ2A 2PV3A 4Z2HA 3AS0A 4NNRA 2XP9A 1UR9A 2MLYA 4URIA 3ARRA 2M1IA 3KZ7A 1HJWA 1J4RA 5HW8A 1EQ3A 3B9DA 5D75A 4W9PA 2XP7A 2DT3A 4W9QA 1FKBA 3RGCA 3PRAA 3MDYB 3VAWA 2OFNA 3B9AA 4R5EA 1FKIA 4MPKA 1WB0A 4JFLA 2ZQUA 3RM4A 1ZB5A 4WKHA 3CGNA 2IUZA 3ALGA 3PA7A 3KCEA 1OGGA 3CHFA 4WKAA 1TFVA 4ODRA 5J6EA 1H0IA 1VF8A 2LKNA 4U84A 3RFWA 2B31A 3ARPA 3NRKA 2RQSA 1YW5A 2DSWA 1FD9A 2XP5A 3BXWA 4W9OA 5DIVA 3RM8A 2Q5AA 1FKGA 1L1PA 5HTGA 1P5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLX A;  1D7J A;  1FKT A;  2XP8 A;  3LUO A;  3UI4 A;  2KR7 A;  1NSG A;  1R9H A;  2ITK A;  4G2P A;  4TW7 A;  2IF4 A;  3UQA A;  1ROT A;  1J6Y A;  3O5F A;  1C9H A;  2F4E A;  3TDB A;  5I98 A;  3O5Q A;  5HWB A;  4DRJ A;  4DIP A;  3JYJ A;  4QIB A;  3KAH A;  4IQC A;  1FKR A;  2VCD A;  3PRD A;  4JFJ A;  4J4O A;  4DRN A;  1W26 A;  1QPL A;  3H9R B;  3O5K A;  4J4N A;  1U79 A;  4O2T A;  4DT4 A;  4GIV A;  1F40 A;  2ZQS A;  1PBK A;  3TC5 A;  2RUR A;  3I6C A;  3UQI A;  1FKK A;  4FAP A;  5GPG A;  4JFM A;  4GGQ A;  1HXV A;  4JYS A;  1KT1 A;  4DRM A;  2PBC A;  2PPO A;  2D9F A;  4G50 A;  2KFW A;  4QT2 A;  1Q6H A;  1FKL A;  3NTP A;  3IKG A;  2XP6 A;  2F21 A;  1A7X A;  5HUA A;  2M08 A;  2L2S A;  1YAT A;  2KO7 A;  3O5L A;  1J4H A;  2JZV A;  1ZK6 A;  2KGJ A;  4LAW A;  4DRP A;  2PV2 A;  2PPP A;  4DRH A;  4BF8 A;  4LAY A;  2ZR5 A;  2AWG A;  4DRO A;  4MGV A;  3UF8 A;  2RUC A;  3KAC A;  3IKD A;  1B6C A;  1Q6U A;  2ZQT A;  1FKH A;  1ROU A;  4DRQ A;  1FKD A;  3KAG A;  1JNT A;  1M5Y A;  4IQ2 A;  5HW6 A;  1QZ2 A;  2MF9 A;  2PV3 A;  2UZ5 A;  5B8I C;  3UQB A;  1QPF A;  3O5M A;  4ODM A;  4DRI A;  4NNR A;  3O5R A;  3IK8 A;  3KAF A;  2FAP A;  3O5O A;  2MNT A;  2XP9 A;  2MLY A;  2M2A A;  2XPB A;  5BXJ A;  2FKE A;  2M1I A;  3KAI A;  3KZ7 A;  5DIT A;  4MSP A;  4JFK A;  4DRK A;  1FKS A;  2DG3 A;  1FKF A;  1J4R A;  1JNS A;  5HW8 A;  4TW6 A;  4R0X A;  3GPK A;  1Y0O A;  1EQ3 A;  1FJD A;  3KAD A;  2DG4 A;  1N1A A;  2MPH A;  5D75 A;  4ODL A;  1PIN A;  4W9P A;  4U85 A;  1Q6I A;  2LPV A;  2K8I A;  2N87 A;  2XP7 A;  2Y78 A;  2VN1 A;  2RUQ A;  2LGO A;  4LAV A;  1FKB A;  2XPA A;  4U86 A;  4W9Q A;  2KI3 A;  4ODP A;  3RGC A;  3MDY B;  1JVW A;  3VAW A;  5HKG A;  2OFN A;  4TNS A;  4TW8 A;  4C02 B;  1F8A B;  3O5J A;  3ODK A;  3O5D A;  3O5E A;  4DZ2 A;  1FKI A;  1J4I A;  3WH0 A;  1EYM A;  2MLZ A;  1Q1C A;  4JFL A;  2PPN A;  2ZQU A;  1T11 A;  2RUD A;  3NI6 A;  3O5G A;  2F2D A;  1NMW A;  1NMV A;  3CGN A;  3PA7 A;  4QT3 A;  2RSE A;  1BL4 A;  4DH0 A;  2PV1 A;  3JXV A;  3KCE A;  2DG9 A;  4FN2 A;  3UI6 A;  2ZR4 A;  1KT0 A;  3O5P A;  5HT1 A;  3KAB A;  2XP3 A;  4JFI A;  4ODR A;  2XP4 A;  2KE0 A;  3OOB A;  5J6E A;  2ZR6 A;  4ODK A;  4ODO A;  3B7X A;  1BKF A;  4LAX A;  4TX0 A;  4DZ3 A;  2LKN A;  4IPX A;  4U84 A;  3PRB A;  3EY6 A;  3UI5 A;  1FKJ A;  2ZQV A;  3CGM A;  4ODN A;  5DIU A;  3RFW A;  3JYM A;  1D7H A;  1TCO C;  1D7I A;  2LJ4 A;  4TYO A;  5HWC A;  2RQS A;  1YW5 A;  3NRK A;  2XP5 A;  1FD9 A;  4W9O A;  5DIV A;  3FAP A;  4N19 A;  3TCZ A;  3O5I A;  2Q5A A;  4ODQ A;  1FKG A;  1FAP A;  4ITZ A;  1ZCN A;  5HTG A;  5HW7 A;  1L1P A;  3IHZ A;  1P5Q A;  1D6O A; 
#chains in the Genus database with same CATH topology
 1CTN A;  1LJY A;  2G8Z A;  2MLX A;  3ARZ A;  4TW7 A;  4DWS C;  3AS2 A;  2WLY A;  1FKR A;  2VCD A;  1WAW A;  1QPL A;  4O2T A;  4DT4 A;  2PI6 A;  3ARO A;  4DRM A;  2PBC A;  2PPO A;  4HBE A;  1JNE A;  2YBU A;  1Q6H A;  3FXY A;  1A7X A;  1YAT A;  2KO7 A;  3O5L A;  1J4H A;  2KGJ A;  1ZU8 A;  4DRH A;  3ARY A;  4BF8 A;  4LAY A;  1HKJ A;  3UF8 A;  1Q6U A;  1FKH A;  5HW6 A;  1FKD A;  1M5Y A;  2MF9 A;  4PTM A;  5B8I C;  3UQB A;  1QPF A;  2P4V A;  3O5R A;  4S3J A;  3O5O A;  4IT4 A;  5BXJ A;  4Z2K A;  5DIT A;  4MSP A;  4JFK A;  4WK9 A;  4DRK A;  1FKS A;  1FKF A;  4WIW A;  4R0X A;  3GPK A;  3KAD A;  4ODL A;  2LPV A;  2YBT A;  5HKG A;  1EDQ A;  4ODP A;  4Q7N A;  4TW8 A;  3ODK A;  3O5E A;  4P8V A;  3WH0 A;  3AQU A;  3CHD A;  1W1T A;  1T11 A;  4Z2G A;  1NMV A;  4HAR A;  4Z2L A;  4DH0 A;  2DG9 A;  3B9E A;  3UI6 A;  2ZR4 A;  3O5P A;  1LG1 A;  2KE0 A;  2DSU A;  1FFQ A;  1E44 A;  4IPX A;  2DSZ A;  3PRB A;  3EY6 A;  1ZBV A;  1XHG A;  3B8S A;  5HWC A;  1ZCN A;  1D6O A;  2OLH A;  2PN0 A;  2EUL A;  1XRV A;  2KR7 A;  1HKK A;  1UR8 A;  2ITK A;  1HJX A;  2IF4 A;  1GUV A;  1C9H A;  3ARW A;  1NWR A;  3TDB A;  2ESC A;  1GRJ A;  1O6I A;  4DIP A;  3JYJ A;  3KAH A;  3ART A;  4DRN A;  1W26 A;  3H9R B;  2ZQS A;  1E9L A;  1PBK A;  2DSV A;  3BMB A;  4ML4 A;  1KFW A;  5DF0 A;  3TC5 A;  3I6C A;  5GPG A;  1K9T A;  4G50 A;  2KFW A;  1W9U A;  2WM0 A;  3NTP A;  3IKG A;  3WL1 A;  3WD2 A;  1ZK6 A;  4DRP A;  2PPP A;  1X6N A;  4DRO A;  4MGV A;  3ARQ A;  2DT0 A;  1E6Z A;  2ZQT A;  4UDM A;  4DRQ A;  1HJV A;  4IQ2 A;  1W9P A;  1H0G A;  5DO2 A;  4ODM A;  2FAP A;  2MNT A;  4MTV A;  2G41 A;  2XPB A;  4KR0 B;  2FKE A;  3CHC A;  2DG3 A;  3WD3 A;  4TW6 A;  1Y0O A;  1FJD A;  2ETN A;  4MNK A;  1LG2 A;  2AOS A;  4U85 A;  1Q6I A;  4WKF A;  1W1Y A;  2Y78 A;  1ZBK A;  2K8I A;  2VN1 A;  2RUQ A;  4LAV A;  2XPA A;  4U86 A;  2KI3 A;  1NWS A;  1F40 A;  1JVW A;  4TNS A;  4WJX A;  3O5J A;  4DZ2 A;  1JND A;  3O5D A;  1OWQ A;  2B5U B;  4Z2I A;  3NI6 A;  2F2D A;  1NMW A;  2WK2 A;  4FN2 A;  3CHE A;  4JFI A;  2XP4 A;  3CH9 A;  1LL6 A;  4IT6 A;  4ODK A;  4TX0 A;  3B7X A;  4DZ3 A;  4XAK A;  1RD6 A;  4L72 B;  1EHN A;  3UI5 A;  1FKJ A;  2ZQV A;  1ZBC A;  1IX5 A;  5DIU A;  3JYM A;  1D7H A;  1TCO C;  2LJ4 A;  4TYO A;  1SR0 A;  1D2K A;  3AS1 A;  4L3N A;  4N19 A;  4ODQ A;  1JCH B;  1GPF A;  4ITZ A;  5HW7 A;  2QF8 A;  1E6N A;  1WNO A;  1D7J A;  1FKT A;  2A3B A;  3LUO A;  3WD4 A;  1E15 A;  3ARU A;  1NSG A;  3WQV A;  1R9H A;  4ZPV R;  4G2P A;  1J6Y A;  1HKI A;  4IQC A;  3PRD A;  4JFJ A;  4J4O A;  3O5K A;  3WD0 A;  3AS3 A;  1ZBW A;  3RME A;  4DWS A;  3UQI A;  4FAP A;  1FKK A;  1NWT A;  4JFM A;  1ITX A;  3ARX A;  1KT1 A;  4S3K A;  2XP6 A;  3G6L A;  1GOI A;  2F21 A;  2DPE A;  3WKZ A;  1NH6 A;  1W9V A;  4Z2J A;  3WQW A;  1E6P A;  5JH8 A;  3CZ8 A;  3QOK A;  2UZ5 A;  4MNJ A;  4QZV B;  3O5M A;  1E6R A;  1ZL1 A;  1LL4 A;  4DRI A;  4ZPW R;  3IK8 A;  3KAF A;  3OA5 A;  3RM9 A;  2M2A A;  3GTY X;  1X6L A;  3KAI A;  2A3C A;  4KQZ A;  4AY1 A;  4P8U A;  3PR9 A;  2DG4 A;  1N1A A;  2MPH A;  2A3E A;  1PIN A;  2N87 A;  4ZPT R;  2LGO A;  3FY1 A;  1JNS A;  4NZC A;  4C02 B;  1F8A B;  3ARS A;  1J4I A;  1EYM A;  2MLZ A;  1Q1C A;  3G6M A;  2PPN A;  5HBF A;  2RUD A;  3O5G A;  1LL7 A;  4QT3 A;  2RSE A;  1BL4 A;  2PV1 A;  3JXV A;  3WIJ A;  1KT0 A;  5HT1 A;  3KAB A;  2DT1 A;  2XP3 A;  3OOB A;  2ZR6 A;  1W1V A;  4ODO A;  1BKF A;  4LAX A;  4Q22 A;  1NWU A;  3CGM A;  4ODN A;  2DT2 A;  1W1P A;  1D7I A;  3EIP A;  4LGX A;  2WLZ A;  3FAP A;  3TCZ A;  3O5I A;  4W5U A;  1FAP A;  3IHZ A;  1OGB A;  1FFR A;  1LQ0 A;  2XP8 A;  3UI4 A;  4MNM A;  3GU0 A;  3UQA A;  1HKM A;  1ROT A;  3O5F A;  2F4E A;  2FDM A;  5I98 A;  3O5Q A;  5HWB A;  4DRJ A;  5GPR A;  4QIB A;  3WL0 A;  4J4N A;  1U79 A;  4GIV A;  2RUR A;  4NSB A;  3ARV A;  4GGQ A;  4DWS B;  4DWS D;  4JYS A;  1HXV A;  4MNL A;  2D9F A;  4MAV A;  4QT2 A;  2A3A A;  4ZS6 A;  1FKL A;  3ALF A;  5GQB A;  5DEZ A;  5HUA A;  2M08 A;  2L2S A;  2JZV A;  4LAW A;  2PV2 A;  3WD1 A;  2ZR5 A;  4P8W A;  4HBO A;  2AWG A;  2O92 A;  1SYT A;  1EIB A;  2RUC A;  3W4R A;  2O9O A;  3KAC A;  3IKD A;  1B6C A;  4P8X A;  1ROU A;  3KAG A;  1JNT A;  1QZ2 A;  2PV3 A;  4Z2H A;  3AS0 A;  4NNR A;  2XP9 A;  1UR9 A;  2MLY A;  4URI A;  3ARR A;  2M1I A;  3KZ7 A;  1HJW A;  1J4R A;  5HW8 A;  1EQ3 A;  3B9D A;  5D75 A;  4W9P A;  2XP7 A;  2DT3 A;  4W9Q A;  1FKB A;  3RGC A;  3PRA A;  3MDY B;  3VAW A;  2OFN A;  3B9A A;  4R5E A;  1FKI A;  4MPK A;  1WB0 A;  4JFL A;  2ZQU A;  3RM4 A;  1ZB5 A;  4WKH A;  3CGN A;  2IUZ A;  3ALG A;  3PA7 A;  3KCE A;  1OGG A;  3CHF A;  4WKA A;  1TFV A;  4ODR A;  5J6E A;  1H0I A;  1VF8 A;  2LKN A;  4U84 A;  2F23 A;  3RFW A;  2B31 A;  3ARP A;  2RQS A;  1YW5 A;  2DSW A;  2XP5 A;  1FD9 A;  3NRK A;  3BXW A;  4W9O A;  5DIV A;  3RM8 A;  2Q5A A;  1FKG A;  1L1P A;  5HTG A;  1P5Q A; 
#chains in the Genus database with same CATH homology
 1CTN A;  1LJY A;  2G8Z A;  2MLX A;  3ARZ A;  4TW7 A;  4DWS C;  3AS2 A;  2WLY A;  1FKR A;  2VCD A;  1WAW A;  1QPL A;  4O2T A;  4DT4 A;  2PI6 A;  3ARO A;  4DRM A;  2PBC A;  2PPO A;  4HBE A;  1JNE A;  2YBU A;  1Q6H A;  3FXY A;  1A7X A;  1YAT A;  2KO7 A;  3O5L A;  1J4H A;  2KGJ A;  1ZU8 A;  4DRH A;  3ARY A;  4BF8 A;  4LAY A;  1HKJ A;  3UF8 A;  1Q6U A;  1FKH A;  5HW6 A;  1FKD A;  1M5Y A;  2MF9 A;  4PTM A;  5B8I C;  3UQB A;  1QPF A;  3O5R A;  4S3J A;  3O5O A;  4IT4 A;  5BXJ A;  4Z2K A;  5DIT A;  4MSP A;  4JFK A;  4WK9 A;  4DRK A;  1FKS A;  1FKF A;  4WIW A;  4R0X A;  3GPK A;  3KAD A;  4ODL A;  2LPV A;  2YBT A;  5HKG A;  1EDQ A;  4ODP A;  4Q7N A;  4TW8 A;  3ODK A;  3O5E A;  4P8V A;  3WH0 A;  3AQU A;  3CHD A;  1W1T A;  1T11 A;  4Z2G A;  1NMV A;  4HAR A;  4Z2L A;  4DH0 A;  2DG9 A;  3B9E A;  3UI6 A;  2ZR4 A;  3O5P A;  1LG1 A;  2KE0 A;  2DSU A;  1FFQ A;  4IPX A;  2DSZ A;  3PRB A;  3EY6 A;  1ZBV A;  1XHG A;  3B8S A;  5HWC A;  1ZCN A;  1D6O A;  2OLH A;  1XRV A;  2KR7 A;  1HKK A;  1UR8 A;  2ITK A;  1HJX A;  2IF4 A;  1GUV A;  1C9H A;  3ARW A;  1NWR A;  3TDB A;  2ESC A;  1O6I A;  4DIP A;  3JYJ A;  3KAH A;  3ART A;  4DRN A;  1W26 A;  3H9R B;  2ZQS A;  1E9L A;  1PBK A;  2DSV A;  4ML4 A;  5DF0 A;  1KFW A;  3TC5 A;  3I6C A;  5GPG A;  1K9T A;  4G50 A;  2KFW A;  1W9U A;  2WM0 A;  3NTP A;  3IKG A;  3WL1 A;  3WD2 A;  1ZK6 A;  4DRP A;  2PPP A;  1X6N A;  4DRO A;  4MGV A;  3ARQ A;  2DT0 A;  1E6Z A;  2ZQT A;  4DRQ A;  1HJV A;  4IQ2 A;  1W9P A;  1H0G A;  5DO2 A;  4ODM A;  2FAP A;  2MNT A;  4MTV A;  2G41 A;  2XPB A;  4KR0 B;  2FKE A;  3CHC A;  2DG3 A;  3WD3 A;  4TW6 A;  1Y0O A;  1FJD A;  4MNK A;  1LG2 A;  2AOS A;  4U85 A;  1Q6I A;  4WKF A;  1W1Y A;  2Y78 A;  1ZBK A;  2K8I A;  2VN1 A;  2RUQ A;  4LAV A;  2XPA A;  4U86 A;  2KI3 A;  1NWS A;  1F40 A;  1JVW A;  4TNS A;  4WJX A;  3O5J A;  4DZ2 A;  1JND A;  3O5D A;  1OWQ A;  4Z2I A;  3NI6 A;  2F2D A;  1NMW A;  2WK2 A;  4FN2 A;  3CHE A;  4JFI A;  2XP4 A;  3CH9 A;  1LL6 A;  4IT6 A;  4ODK A;  4TX0 A;  3B7X A;  4DZ3 A;  4XAK A;  1RD6 A;  4L72 B;  1EHN A;  3UI5 A;  1FKJ A;  2ZQV A;  1ZBC A;  1IX5 A;  5DIU A;  3JYM A;  1D7H A;  1TCO C;  2LJ4 A;  4TYO A;  1SR0 A;  1D2K A;  3AS1 A;  4L3N A;  4N19 A;  4ODQ A;  1GPF A;  4ITZ A;  5HW7 A;  2QF8 A;  1E6N A;  1WNO A;  1D7J A;  1FKT A;  2A3B A;  3LUO A;  3WD4 A;  1E15 A;  3ARU A;  1NSG A;  3WQV A;  1R9H A;  4ZPV R;  4G2P A;  1J6Y A;  1HKI A;  4IQC A;  3PRD A;  4JFJ A;  4J4O A;  3O5K A;  3WD0 A;  3AS3 A;  1ZBW A;  3RME A;  4DWS A;  3UQI A;  4FAP A;  1FKK A;  1NWT A;  4JFM A;  1ITX A;  3ARX A;  1KT1 A;  4S3K A;  2XP6 A;  3G6L A;  1GOI A;  2F21 A;  2DPE A;  3WKZ A;  1NH6 A;  1W9V A;  4Z2J A;  3WQW A;  1E6P A;  5JH8 A;  3CZ8 A;  3QOK A;  2UZ5 A;  4MNJ A;  4QZV B;  3O5M A;  1E6R A;  1ZL1 A;  1LL4 A;  4DRI A;  4ZPW R;  3IK8 A;  3KAF A;  3OA5 A;  3RM9 A;  2M2A A;  1X6L A;  3KAI A;  2A3C A;  4KQZ A;  4AY1 A;  4P8U A;  3PR9 A;  2DG4 A;  1N1A A;  2MPH A;  2A3E A;  1PIN A;  2N87 A;  4ZPT R;  2LGO A;  3FY1 A;  1JNS A;  4NZC A;  4C02 B;  1F8A B;  3ARS A;  1J4I A;  1EYM A;  2MLZ A;  1Q1C A;  3G6M A;  2PPN A;  5HBF A;  2RUD A;  3O5G A;  1LL7 A;  4QT3 A;  2RSE A;  1BL4 A;  2PV1 A;  3JXV A;  3WIJ A;  1KT0 A;  5HT1 A;  3KAB A;  2DT1 A;  2XP3 A;  3OOB A;  2ZR6 A;  1W1V A;  4ODO A;  1BKF A;  4LAX A;  4Q22 A;  1NWU A;  3CGM A;  4ODN A;  2DT2 A;  1W1P A;  1D7I A;  4LGX A;  2WLZ A;  3FAP A;  3TCZ A;  3O5I A;  4W5U A;  1FAP A;  3IHZ A;  1OGB A;  1FFR A;  1LQ0 A;  2XP8 A;  3UI4 A;  4MNM A;  3UQA A;  1HKM A;  1ROT A;  3O5F A;  2F4E A;  2FDM A;  5I98 A;  3O5Q A;  5HWB A;  4DRJ A;  5GPR A;  4QIB A;  3WL0 A;  4J4N A;  1U79 A;  4GIV A;  2RUR A;  4NSB A;  3ARV A;  4GGQ A;  4DWS B;  4DWS D;  4JYS A;  1HXV A;  4MNL A;  2D9F A;  4MAV A;  4QT2 A;  2A3A A;  4ZS6 A;  1FKL A;  3ALF A;  5GQB A;  5DEZ A;  5HUA A;  2M08 A;  2L2S A;  2JZV A;  4LAW A;  2PV2 A;  3WD1 A;  2ZR5 A;  4P8W A;  4HBO A;  2AWG A;  2O92 A;  1SYT A;  1EIB A;  2RUC A;  3W4R A;  2O9O A;  3KAC A;  3IKD A;  1B6C A;  4P8X A;  1ROU A;  3KAG A;  1JNT A;  1QZ2 A;  2PV3 A;  4Z2H A;  3AS0 A;  4NNR A;  2XP9 A;  1UR9 A;  2MLY A;  4URI A;  3ARR A;  2M1I A;  3KZ7 A;  1HJW A;  1J4R A;  5HW8 A;  1EQ3 A;  3B9D A;  5D75 A;  4W9P A;  2XP7 A;  2DT3 A;  4W9Q A;  1FKB A;  3RGC A;  3PRA A;  3MDY B;  3VAW A;  2OFN A;  3B9A A;  4R5E A;  1FKI A;  4MPK A;  1WB0 A;  4JFL A;  2ZQU A;  3RM4 A;  1ZB5 A;  4WKH A;  3CGN A;  2IUZ A;  3ALG A;  3PA7 A;  3KCE A;  1OGG A;  3CHF A;  4WKA A;  1TFV A;  4ODR A;  5J6E A;  1H0I A;  1VF8 A;  2LKN A;  4U84 A;  3RFW A;  2B31 A;  3ARP A;  3NRK A;  2RQS A;  1YW5 A;  2DSW A;  1FD9 A;  2XP5 A;  3BXW A;  4W9O A;  5DIV A;  3RM8 A;  2Q5A A;  1FKG A;  1L1P A;  5HTG A;  1P5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...