1Q1CA

Crystal structure of n(1-260) of human fkbp52
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
237
structure length
237
Chain Sequence
b'EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 4
publication title 3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 58
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA02
1PBKA 1F8AB 4W9OA 2PV1A 2RUCA 2JZVA 4DRJA 4ITZA 4W9QA 2MLZA 1NSGA 4J4NA 4U85A 1ZK6A 3JXVA 2XP3A 1Q6IA 2N87A 3O5GA 4G2PA 4JFMA 3PRBA 1Y0OA 4GIVA 3KABA 2OFNA 5HW6A 2M2AA 3UQBA 3O5DA 3RFWA 4MGVA 1FKLA 3JYMA 4O2TA 1TCOC 2K8IA 3O5RA 4JFKA 1R9HA 1D7HA 2M08A 2RSEA 4U84A 1FJDA 3O5OA 2VN1A 5BXJA 4QT2A 3KAHA 5HUAA 2KE0A 2XPAA 5J6EA 5B8IC 2ZR6A 2KFWA 5HW7A 3KAGA 4ODRA 2FAPA 3TDBA 3UI6A 4DRMA 4DRIA 2XPBA 1FKSA 4JFJA 3UQAA 4DZ3A 3KACA 1BL4A 2ZR5A 1FKFA 1J4RA 1ROUA 4BF8A 3I6CA 1FD9A 1W26A 2UZ5A 2ZR4A 3ODKA 2RURA 2ZQTA 3TCZA 5HWBA 5DIVA 1JNSA 1JNTA 2L2SA 3IHZA 4JFIA 3UQIA 1FKTA 4N19A 1KT1A 3NI6A 1EQ3A 4DT4A 4IQ2A 3UF8A 2LGOA 1Q1CA 2LJ4A 2MF9A 2PPNA 4DROA 3PRDA 2LKNA 4TYOA 3NTPA 2XP8A 1FKKA 4FN2A 4DZ2A 2MLXA 3O5KA 4ODNA 1EYMA 4DRQA 3KAFA 3EY6A 1PINA 2MLYA 2PPPA 4J4OA 2XP6A 1HXVA 1B6CA 4JFLA 3IK8A 4LAVA 1N1AA 1U79A 3B7XA 2XP7A 3O5QA 2VCDA 4DRNA 3JYJA 3IKGA 1NMVA 2DG9A 2LPVA 4ODOA 5HW8A 4TW7A 1L1PA 3MDYB 4GGQA 2M1IA 3H9RB 1YW5A 4LAYA 1QPLA 3UI4A 1KT0A 1C9HA 4TNSA 1D6OA 4TW8A 1ZCNA 2AWGA 2RQSA 3LUOA 3O5PA 3O5MA 2KI3A 3KCEA 3TC5A 4R0XA 2MPHA 2DG3A 3O5EA 1F40A 2ZQUA 2KR7A 1FAPA 1FKDA 3OOBA 4QIBA 1T11A 1M5YA 2MNTA 3CGNA 3KAIA 2KGJA 3PA7A 1J6YA 3GPKA 3O5IA 2F21A 5HKGA 3CGMA 4FAPA 1Q6HA 1FKIA 1D7IA 4W9PA 1FKGA 2ZQSA 3NRKA 3WH0A 4TX0A 3O5FA 2ITKA 4TW6A 2XP9A 2XP5A 1J4HA 1FKBA 4JYSA 2IF4A 1D7JA 1YATA 2DG4A 1BKFA 2ZQVA 4ODKA 5DIUA 5HWCA 2RUQA 4U86A 1J4IA 4QT3A 4ODPA 4DRKA 3FAPA 4ODMA 1FKRA 1JVWA 4IPXA 2F2DA 3VAWA 4DIPA 2Q5AA 4G50A 4DRHA 3UI5A 1A7XA 4LAXA 4LAWA 4ODQA 1FKJA 5HTGA 3RGCA 3O5LA 1FKHA 2PPOA 3KADA 5I98A 2D9FA 3O5JA 5DITA 4NNRA 4DRPA 1Q6UA 2Y78A 3KZ7A 4IQCA 1NMWA 1P5QA 2PV3A 2XP4A 4MSPA 4C02B 4ODLA 1ROTA 5HT1A 2F4EA 4DH0A 1QZ2A 2KO7A 5D75A 5GPGA 2PV2A 3IKDA 2FKEA 1QPFA 2PBCA 2RUDA
chains in the Genus database with same CATH superfamily
4Z2IA 2JZVA 4DRJA 3EIPA 1CTNA 2MLZA 3ARRA 2O9OA 2A3AA 1Q6IA 2DSWA 3AQUA 1UR8A 1FKLA 4Q22A 1E9LA 1R9HA 1FJDA 5GQBA 5BXJA 4QT2A 2YBUA 2KE0A 2DT2A 1NWSA 3UQAA 1FKFA 1X6LA 1J4RA 4BF8A 3TCZA 3WKZA 3ODKA 2ZQTA 3G6MA 4N19A 1KT1A 3NI6A 1HJXA 1VF8A 3CZ8A 2LGOA 1JCHB 1Q1CA 3WIJA 2PPNA 3PRDA 1W1YA 4L3NA 5DEZA 1LJYA 4Z2GA 1GUVA 1HKJA 2XP6A 1HXVA 4JFLA 3IK8A 1U79A 3O5QA 2DG9A 2LPVA 4PTMA 1L1PA 4GGQA 2M1IA 3ARVA 1WNOA 4LAYA 1UR9A 1QPLA 1KT0A 1D6OA 3O5MA 1W9PA 4R0XA 2MPHA 1F40A 2KR7A 3OOBA 5GPRA 1IX5A 2KGJA 3PA7A 3W4RA 2ETNA 3CHDA 1Q6HA 1FKIA 4MTVA 4DWSC 4WKAA 2ZQSA 3NRKA 2DPEA 4TW6A 2XP5A 1FKBA 1E44A 2IF4A 1D7JA 1NH6A 2DG4A 2RUQA 1JNEA 4ODPA 3AROA 2IUZA 1HJWA 4G50A 3UI5A 3RGCA 3O5LA 4C02B 1P5QA 2F4EA 1QZ2A 2KO7A 5D75A 5GPGA 1WAWA 3B9AA 1HJVA 4KQZA 1F8AB 2RUCA 1TFVA 2AOSA 1H0IA 4W9QA 4URIA 2N87A 3ARWA 3O5GA 4JFMA 1Y0OA 3RM8A 3KABA 2OFNA 1HKIA 3RFWA 4MGVA 3ARPA 1TCOC 2K8IA 4JFKA 1D2KA 2RSEA 2DSUA 2VN1A 3ARXA 4DWSA 3BMBA 2WLYA 2P4VA 3KAHA 2F23A 5B8IC 1HKKA 1XRVA 4ODRA 1GRJA 1E6PA 2XPBA 1FKSA 4P8WA 3ARZA 2OLHA 3I6CA 1FD9A 1W26A 2RURA 5DIVA 2O92A 1EQ3A 4DT4A 3UF8A 2MF9A 2LKNA 4DZ2A 3O5KA 1OGBA 2PPPA 3PR9A 4J4OA 1H0GA 1WB0A 1ITXA 4LAVA 5JH8A 1W9UA 4ODOA 2WK2A 3CHEA 4TW8A 1ZCNA 2RQSA 3KCEA 4S3JA 2WLZA 1GPFA 1ZL1A 2ZQUA 4QIBA 4KR0B 4P8XA 3ALGA 4Z2KA 3CGNA 3KAIA 1J6YA 4HBEA 2F21A 3CGMA 4NSBA 4W9PA 4TX0A 3ARQA 4NZCA 1J4HA 3ALFA 1BKFA 1HKMA 1FFRA 5DIUA 4ML4A 1J4IA 4QT3A 4Z2HA 1E6NA 4DWSD 3FAPA 4ODMA 1FKRA 3VAWA 2F2DA 2Q5AA 4IT4A 1LL7A 1NWRA 4LAWA 5HTGA 2DSVA 3KADA 5I98A 1OGGA 5DITA 4DRPA 4WK9A 4IQCA 1NMWA 2PV3A 2XP4A 2PBCA 4IT6A 4P8UA 4WIWA 4W9OA 2PV1A 3WD3A 4ITZA 3B9DA 3B9EA 4DWSB 4ZPTR 4U85A 1ZK6A 3JXVA 2XP3A 4G2PA 1E15A 1K9TA 1EIBA 3PRBA 2B5UB 2A3EA 4L72B 5HBFA 3UQBA 3O5DA 3B8SA 3WD4A 1ZBWA 3PRAA 1W1PA 2B31A 3O5OA 4MNLA 3AS0A 4ZPVR 2PI6A 2XPAA 3QOKA 5J6EA 2ZR6A 5HW7A 4QZVB 5DF0A 4DRMA 3KACA 1BL4A 2ZR5A 4WKHA 5HWBA 2UZ5A 2ZR4A 1JNSA 1ZBKA 1ZB5A 1W1VA 3FY1A 4IQ2A 1LG2A 3RM4A 1E6RA 4MNJA 2XP8A 1FKKA 3GTYX 4FN2A 3FXYA 1EYMA 4ODNA 4DRQA 1PINA 2MLYA 1RD6A 3RM9A 3WL0A 1N1AA 4DRNA 2VCDA 3IKGA 1NMVA 5HW8A 4P8VA 3MDYB 3UI4A 1O6IA 2AWGA 3O5PA 4Z2JA 3WQVA 3ARSA 3O5EA 1FAPA 1ZBVA 2MNTA 3BXWA 2WM0A 2DT1A 3GPKA 4FAPA 3WD2A 4R5EA 2G8ZA 1FKGA 2FDMA 4WKFA 4AY1A 1X6NA 2XP9A 1LQ0A 4JYSA 1YATA 2ZQVA 4ODKA 5DO2A 4DRKA 2EULA 1JVWA 4LGXA 4DIPA 2YBTA 4DRHA 1KFWA 4LAXA 4ODQA 1FKJA 4MAVA 1FKHA 3CHFA 2PPOA 3WD1A 3O5JA 3AS2A 4ODLA 1ROTA 3WQWA 1ZBCA 5HT1A 2DSZA 1QPFA 3GU0A 1PBKA 3ARUA 1NSGA 1LL6A 2ESCA 4J4NA 4HBOA 1NWTA 4MNKA 3OA5A 1GOIA 3AS1A 2DT0A 4GIVA 3CH9A 5HW6A 2M2AA 4WJXA 3RMEA 3JYMA 4XAKA 4O2TA 3O5RA 1D7HA 2M08A 4U84A 1E6ZA 5HUAA 1W1TA 3ARTA 2KFWA 3KAGA 1FFQA 2FAPA 3TDBA 3UI6A 4DRIA 4JFJA 1W9VA 4DZ3A 2QF8A 1NWUA 1EHNA 1ROUA 4Q7NA 1JNTA 2L2SA 1SYTA 3IHZA 4JFIA 1FKTA 4HARA 3UQIA 2LJ4A 3CHCA 4DROA 1ZU8A 1OWQA 4TYOA 1EDQA 1LL4A 4MNMA 3NTPA 4MPKA 2MLXA 3KAFA 3EY6A 4Z2LA 1B6CA 2G41A 3ARYA 3B7XA 1XHGA 2XP7A 3JYJA 4TW7A 3H9RB 1YW5A 1C9HA 4TNSA 3WL1A 3LUOA 3TC5A 2KI3A 2DG3A 2DT3A 1FKDA 1T11A 1M5YA 2A3CA 4ZPWR 4UDMA 1SR0A 3O5IA 5HKGA 1JNDA 1D7IA 3WH0A 3O5FA 2ITKA 2A3BA 4ZS6A 5HWCA 4U86A 3G6LA 4S3KA 2PN0A 3AS3A 4IPXA 1A7XA 2D9FA 3WD0A 4NNRA 1Q6UA 2Y78A 3KZ7A 4MSPA 1LG1A 4DH0A 4W5UA 2PV2A 3IKDA 2FKEA 2RUDA
chains in the Genus database with same CATH topology
4Z2IA 2JZVA 4DRJA 1CTNA 2MLZA 3ARRA 2O9OA 2A3AA 1Q6IA 2DSWA 3AQUA 1UR8A 1FKLA 4Q22A 1E9LA 1R9HA 1FJDA 5GQBA 5BXJA 4QT2A 2YBUA 2KE0A 2DT2A 1NWSA 3UQAA 1FKFA 1X6LA 1J4RA 4BF8A 3TCZA 3WKZA 3ODKA 2ZQTA 3G6MA 4N19A 1KT1A 3NI6A 1HJXA 1VF8A 3CZ8A 2LGOA 1Q1CA 3WIJA 2PPNA 3PRDA 1W1YA 4L3NA 5DEZA 1LJYA 4Z2GA 1GUVA 1HKJA 2XP6A 1HXVA 4JFLA 3IK8A 1U79A 3O5QA 2DG9A 2LPVA 4PTMA 1L1PA 4GGQA 2M1IA 3ARVA 1WNOA 4LAYA 1UR9A 1QPLA 1KT0A 1D6OA 3O5MA 1W9PA 4R0XA 2MPHA 1F40A 2KR7A 3OOBA 5GPRA 1IX5A 2KGJA 3PA7A 3W4RA 3CHDA 1Q6HA 1FKIA 4MTVA 4DWSC 4WKAA 2ZQSA 3NRKA 2DPEA 4TW6A 2XP5A 1FKBA 2IF4A 1D7JA 1NH6A 2DG4A 2RUQA 1JNEA 4ODPA 3AROA 2IUZA 1HJWA 4G50A 3UI5A 3RGCA 3O5LA 4C02B 1P5QA 2F4EA 1QZ2A 2KO7A 5D75A 5GPGA 1WAWA 3B9AA 1HJVA 4KQZA 1F8AB 2RUCA 1TFVA 2AOSA 1H0IA 4W9QA 4URIA 2N87A 3ARWA 3O5GA 4JFMA 1Y0OA 3RM8A 3KABA 2OFNA 1HKIA 3RFWA 4MGVA 3ARPA 1TCOC 2K8IA 4JFKA 1D2KA 2RSEA 2DSUA 2VN1A 3ARXA 4DWSA 2WLYA 3KAHA 5B8IC 1HKKA 1XRVA 4ODRA 1E6PA 2XPBA 1FKSA 4P8WA 3ARZA 2OLHA 3I6CA 1FD9A 1W26A 2RURA 5DIVA 2O92A 1EQ3A 4DT4A 3UF8A 2MF9A 2LKNA 4DZ2A 3O5KA 1OGBA 2PPPA 3PR9A 4J4OA 1H0GA 1WB0A 1ITXA 4LAVA 5JH8A 1W9UA 4ODOA 2WK2A 3CHEA 4TW8A 1ZCNA 2RQSA 3KCEA 4S3JA 2WLZA 1GPFA 1ZL1A 2ZQUA 4QIBA 4KR0B 4P8XA 3ALGA 4Z2KA 3CGNA 3KAIA 1J6YA 4HBEA 2F21A 3CGMA 4NSBA 4W9PA 4TX0A 3ARQA 4NZCA 1J4HA 3ALFA 1BKFA 1HKMA 1FFRA 5DIUA 4ML4A 1J4IA 4QT3A 4Z2HA 1E6NA 4DWSD 3FAPA 4ODMA 1FKRA 3VAWA 2F2DA 2Q5AA 4IT4A 1LL7A 1NWRA 4LAWA 5HTGA 2DSVA 3KADA 5I98A 1OGGA 5DITA 4DRPA 4WK9A 4IQCA 1NMWA 2PV3A 2XP4A 2PBCA 4IT6A 4P8UA 4WIWA 4W9OA 2PV1A 3WD3A 4ITZA 3B9DA 3B9EA 4DWSB 4ZPTR 4U85A 1ZK6A 3JXVA 2XP3A 4G2PA 1E15A 1K9TA 1EIBA 3PRBA 2A3EA 4L72B 5HBFA 3UQBA 3O5DA 3B8SA 3WD4A 1ZBWA 3PRAA 1W1PA 2B31A 3O5OA 4MNLA 3AS0A 4ZPVR 2PI6A 2XPAA 3QOKA 5J6EA 2ZR6A 5HW7A 4QZVB 5DF0A 4DRMA 3KACA 1BL4A 2ZR5A 4WKHA 5HWBA 2UZ5A 2ZR4A 1JNSA 1ZBKA 1ZB5A 1W1VA 3FY1A 4IQ2A 1LG2A 3RM4A 1E6RA 4MNJA 2XP8A 1FKKA 4FN2A 3FXYA 1EYMA 4ODNA 4DRQA 1PINA 2MLYA 1RD6A 3RM9A 3WL0A 1N1AA 4DRNA 2VCDA 3IKGA 1NMVA 5HW8A 4P8VA 3MDYB 3UI4A 1O6IA 2AWGA 3O5PA 4Z2JA 3WQVA 3ARSA 3O5EA 1FAPA 1ZBVA 2MNTA 3BXWA 2WM0A 2DT1A 3GPKA 4FAPA 3WD2A 4R5EA 2G8ZA 1FKGA 2FDMA 4WKFA 4AY1A 1X6NA 2XP9A 1LQ0A 4JYSA 1YATA 2ZQVA 4ODKA 5DO2A 4DRKA 1JVWA 4LGXA 4DIPA 2YBTA 4DRHA 1KFWA 4LAXA 4ODQA 1FKJA 4MAVA 1FKHA 3CHFA 2PPOA 3WD1A 3O5JA 3AS2A 4ODLA 1ROTA 3WQWA 1ZBCA 5HT1A 2DSZA 1QPFA 1PBKA 3ARUA 1NSGA 1LL6A 2ESCA 4J4NA 4HBOA 1NWTA 4MNKA 3OA5A 1GOIA 3AS1A 2DT0A 4GIVA 3CH9A 5HW6A 2M2AA 4WJXA 3RMEA 3JYMA 4XAKA 4O2TA 3O5RA 1D7HA 2M08A 4U84A 1E6ZA 5HUAA 1W1TA 3ARTA 2KFWA 3KAGA 1FFQA 2FAPA 3TDBA 3UI6A 4DRIA 4JFJA 1W9VA 4DZ3A 2QF8A 1NWUA 1EHNA 1ROUA 4Q7NA 1JNTA 2L2SA 1SYTA 3IHZA 4JFIA 1FKTA 4HARA 3UQIA 2LJ4A 3CHCA 4DROA 1ZU8A 1OWQA 4TYOA 1EDQA 1LL4A 4MNMA 3NTPA 4MPKA 2MLXA 3KAFA 3EY6A 4Z2LA 1B6CA 2G41A 3ARYA 3B7XA 1XHGA 2XP7A 3JYJA 4TW7A 3H9RB 1YW5A 1C9HA 4TNSA 3WL1A 3LUOA 3TC5A 2KI3A 2DG3A 2DT3A 1FKDA 1T11A 1M5YA 2A3CA 4ZPWR 1SR0A 3O5IA 5HKGA 1JNDA 1D7IA 3WH0A 3O5FA 2ITKA 2A3BA 4ZS6A 5HWCA 4U86A 3G6LA 4S3KA 3AS3A 4IPXA 1A7XA 2D9FA 3WD0A 4NNRA 1Q6UA 2Y78A 3KZ7A 4MSPA 1LG1A 4DH0A 4W5UA 2PV2A 3IKDA 2FKEA 2RUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBK A;  1F8A B;  4W9O A;  2PV1 A;  2RUC A;  2JZV A;  4DRJ A;  4ITZ A;  4W9Q A;  2MLZ A;  1NSG A;  4J4N A;  4U85 A;  1ZK6 A;  3JXV A;  2XP3 A;  1Q6I A;  2N87 A;  3O5G A;  4G2P A;  4JFM A;  3PRB A;  1Y0O A;  4GIV A;  3KAB A;  2OFN A;  5HW6 A;  2M2A A;  3UQB A;  3O5D A;  3RFW A;  4MGV A;  1FKL A;  3JYM A;  4O2T A;  1TCO C;  2K8I A;  3O5R A;  4JFK A;  1R9H A;  1D7H A;  2M08 A;  2RSE A;  4U84 A;  1FJD A;  3O5O A;  2VN1 A;  5BXJ A;  4QT2 A;  3KAH A;  5HUA A;  2KE0 A;  2XPA A;  5J6E A;  5B8I C;  2ZR6 A;  2KFW A;  5HW7 A;  3KAG A;  4ODR A;  2FAP A;  3TDB A;  3UI6 A;  4DRM A;  4DRI A;  2XPB A;  1FKS A;  4JFJ A;  3UQA A;  4DZ3 A;  3KAC A;  1BL4 A;  2ZR5 A;  1FKF A;  1J4R A;  1ROU A;  4BF8 A;  3I6C A;  1FD9 A;  1W26 A;  2UZ5 A;  2ZR4 A;  3ODK A;  2RUR A;  2ZQT A;  3TCZ A;  5HWB A;  5DIV A;  1JNS A;  1JNT A;  2L2S A;  3IHZ A;  4JFI A;  3UQI A;  1FKT A;  4N19 A;  1KT1 A;  3NI6 A;  1EQ3 A;  4DT4 A;  4IQ2 A;  3UF8 A;  2LGO A;  1Q1C A;  2LJ4 A;  2MF9 A;  2PPN A;  4DRO A;  3PRD A;  2LKN A;  4TYO A;  3NTP A;  2XP8 A;  1FKK A;  4FN2 A;  4DZ2 A;  2MLX A;  3O5K A;  4ODN A;  1EYM A;  4DRQ A;  3KAF A;  3EY6 A;  1PIN A;  2MLY A;  2PPP A;  4J4O A;  2XP6 A;  1HXV A;  1B6C A;  4JFL A;  3IK8 A;  4LAV A;  1N1A A;  1U79 A;  3B7X A;  2XP7 A;  3O5Q A;  2VCD A;  4DRN A;  3JYJ A;  3IKG A;  1NMV A;  2DG9 A;  2LPV A;  4ODO A;  5HW8 A;  4TW7 A;  1L1P A;  3MDY B;  4GGQ A;  2M1I A;  3H9R B;  1YW5 A;  4LAY A;  1QPL A;  3UI4 A;  1KT0 A;  1C9H A;  4TNS A;  1D6O A;  4TW8 A;  1ZCN A;  2AWG A;  2RQS A;  3LUO A;  3O5P A;  3O5M A;  2KI3 A;  3KCE A;  3TC5 A;  4R0X A;  2MPH A;  2DG3 A;  3O5E A;  1F40 A;  2ZQU A;  2KR7 A;  1FAP A;  1FKD A;  3OOB A;  4QIB A;  1T11 A;  1M5Y A;  2MNT A;  3CGN A;  3KAI A;  2KGJ A;  3PA7 A;  1J6Y A;  3GPK A;  3O5I A;  2F21 A;  5HKG A;  3CGM A;  4FAP A;  1Q6H A;  1FKI A;  1D7I A;  4W9P A;  1FKG A;  2ZQS A;  3NRK A;  3WH0 A;  4TX0 A;  3O5F A;  2ITK A;  4TW6 A;  2XP9 A;  2XP5 A;  1J4H A;  1FKB A;  4JYS A;  2IF4 A;  1D7J A;  1YAT A;  2DG4 A;  1BKF A;  2ZQV A;  4ODK A;  5DIU A;  5HWC A;  2RUQ A;  4U86 A;  1J4I A;  4QT3 A;  4ODP A;  4DRK A;  3FAP A;  4ODM A;  1FKR A;  1JVW A;  4IPX A;  2F2D A;  3VAW A;  4DIP A;  2Q5A A;  4G50 A;  4DRH A;  3UI5 A;  1A7X A;  4LAX A;  4LAW A;  4ODQ A;  1FKJ A;  5HTG A;  3RGC A;  3O5L A;  1FKH A;  2PPO A;  3KAD A;  5I98 A;  2D9F A;  3O5J A;  5DIT A;  4NNR A;  4DRP A;  1Q6U A;  2Y78 A;  3KZ7 A;  4IQC A;  1NMW A;  1P5Q A;  2PV3 A;  2XP4 A;  4MSP A;  4C02 B;  4ODL A;  1ROT A;  5HT1 A;  2F4E A;  4DH0 A;  1QZ2 A;  2KO7 A;  5D75 A;  5GPG A;  2PV2 A;  3IKD A;  2FKE A;  1QPF A;  2PBC A;  2RUD A; 
#chains in the Genus database with same CATH topology
 4Z2I A;  2JZV A;  4DRJ A;  3EIP A;  1CTN A;  2MLZ A;  3ARR A;  2O9O A;  2A3A A;  1Q6I A;  2DSW A;  3AQU A;  1UR8 A;  1FKL A;  4Q22 A;  1E9L A;  1R9H A;  1FJD A;  5GQB A;  5BXJ A;  4QT2 A;  2YBU A;  2KE0 A;  2DT2 A;  1NWS A;  3UQA A;  1FKF A;  1X6L A;  1J4R A;  4BF8 A;  3TCZ A;  3WKZ A;  3ODK A;  2ZQT A;  3G6M A;  4N19 A;  1KT1 A;  3NI6 A;  1HJX A;  1VF8 A;  3CZ8 A;  2LGO A;  1JCH B;  1Q1C A;  3WIJ A;  2PPN A;  3PRD A;  1W1Y A;  4L3N A;  5DEZ A;  1LJY A;  4Z2G A;  1GUV A;  1HKJ A;  2XP6 A;  1HXV A;  4JFL A;  3IK8 A;  1U79 A;  3O5Q A;  2DG9 A;  2LPV A;  4PTM A;  1L1P A;  4GGQ A;  2M1I A;  3ARV A;  1WNO A;  4LAY A;  1UR9 A;  1QPL A;  1KT0 A;  1D6O A;  3O5M A;  1W9P A;  4R0X A;  2MPH A;  1F40 A;  2KR7 A;  3OOB A;  5GPR A;  1IX5 A;  2KGJ A;  3PA7 A;  3W4R A;  2ETN A;  3CHD A;  1Q6H A;  1FKI A;  4MTV A;  4DWS C;  4WKA A;  2ZQS A;  3NRK A;  2DPE A;  4TW6 A;  2XP5 A;  1FKB A;  1E44 A;  2IF4 A;  1D7J A;  1NH6 A;  2DG4 A;  2RUQ A;  1JNE A;  4ODP A;  3ARO A;  2IUZ A;  1HJW A;  4G50 A;  3UI5 A;  3RGC A;  3O5L A;  4C02 B;  1P5Q A;  2F4E A;  1QZ2 A;  2KO7 A;  5D75 A;  5GPG A;  1WAW A;  3B9A A;  1HJV A;  4KQZ A;  1F8A B;  2RUC A;  1TFV A;  2AOS A;  1H0I A;  4W9Q A;  4URI A;  2N87 A;  3ARW A;  3O5G A;  4JFM A;  1Y0O A;  3RM8 A;  3KAB A;  2OFN A;  1HKI A;  3RFW A;  4MGV A;  3ARP A;  1TCO C;  2K8I A;  4JFK A;  1D2K A;  2RSE A;  2DSU A;  2VN1 A;  3ARX A;  4DWS A;  3BMB A;  2WLY A;  2P4V A;  3KAH A;  2F23 A;  5B8I C;  1HKK A;  1XRV A;  4ODR A;  1GRJ A;  1E6P A;  2XPB A;  1FKS A;  4P8W A;  3ARZ A;  2OLH A;  3I6C A;  1FD9 A;  1W26 A;  2RUR A;  5DIV A;  2O92 A;  1EQ3 A;  4DT4 A;  3UF8 A;  2MF9 A;  2LKN A;  4DZ2 A;  3O5K A;  1OGB A;  2PPP A;  3PR9 A;  4J4O A;  1H0G A;  1WB0 A;  1ITX A;  4LAV A;  5JH8 A;  1W9U A;  4ODO A;  2WK2 A;  3CHE A;  4TW8 A;  1ZCN A;  2RQS A;  3KCE A;  4S3J A;  2WLZ A;  1GPF A;  1ZL1 A;  2ZQU A;  4QIB A;  4KR0 B;  4P8X A;  3ALG A;  4Z2K A;  3CGN A;  3KAI A;  1J6Y A;  4HBE A;  2F21 A;  3CGM A;  4NSB A;  4W9P A;  4TX0 A;  3ARQ A;  4NZC A;  1J4H A;  3ALF A;  1BKF A;  1HKM A;  1FFR A;  5DIU A;  4ML4 A;  1J4I A;  4QT3 A;  4Z2H A;  1E6N A;  4DWS D;  3FAP A;  4ODM A;  1FKR A;  3VAW A;  2F2D A;  2Q5A A;  4IT4 A;  1LL7 A;  1NWR A;  4LAW A;  5HTG A;  2DSV A;  3KAD A;  5I98 A;  1OGG A;  5DIT A;  4DRP A;  4WK9 A;  4IQC A;  1NMW A;  2PV3 A;  2XP4 A;  2PBC A;  4IT6 A;  4P8U A;  4WIW A;  4W9O A;  2PV1 A;  3WD3 A;  4ITZ A;  3B9D A;  3B9E A;  4DWS B;  4ZPT R;  4U85 A;  1ZK6 A;  3JXV A;  2XP3 A;  4G2P A;  1E15 A;  1K9T A;  1EIB A;  3PRB A;  2B5U B;  2A3E A;  4L72 B;  5HBF A;  3UQB A;  3O5D A;  3B8S A;  3WD4 A;  1ZBW A;  3PRA A;  1W1P A;  2B31 A;  3O5O A;  4MNL A;  3AS0 A;  4ZPV R;  2PI6 A;  2XPA A;  3QOK A;  5J6E A;  2ZR6 A;  5HW7 A;  4QZV B;  5DF0 A;  4DRM A;  3KAC A;  1BL4 A;  2ZR5 A;  4WKH A;  5HWB A;  2UZ5 A;  2ZR4 A;  1JNS A;  1ZBK A;  1ZB5 A;  1W1V A;  3FY1 A;  4IQ2 A;  1LG2 A;  3RM4 A;  1E6R A;  4MNJ A;  2XP8 A;  1FKK A;  3GTY X;  4FN2 A;  3FXY A;  1EYM A;  4ODN A;  4DRQ A;  1PIN A;  2MLY A;  1RD6 A;  3RM9 A;  3WL0 A;  1N1A A;  4DRN A;  2VCD A;  3IKG A;  1NMV A;  5HW8 A;  4P8V A;  3MDY B;  3UI4 A;  1O6I A;  2AWG A;  3O5P A;  4Z2J A;  3WQV A;  3ARS A;  3O5E A;  1FAP A;  1ZBV A;  2MNT A;  3BXW A;  2WM0 A;  2DT1 A;  3GPK A;  4FAP A;  3WD2 A;  4R5E A;  2G8Z A;  1FKG A;  2FDM A;  4WKF A;  4AY1 A;  1X6N A;  2XP9 A;  1LQ0 A;  4JYS A;  1YAT A;  2ZQV A;  4ODK A;  5DO2 A;  4DRK A;  2EUL A;  1JVW A;  4LGX A;  4DIP A;  2YBT A;  4DRH A;  1KFW A;  4LAX A;  4ODQ A;  1FKJ A;  4MAV A;  1FKH A;  3CHF A;  2PPO A;  3WD1 A;  3O5J A;  3AS2 A;  4ODL A;  1ROT A;  3WQW A;  1ZBC A;  5HT1 A;  2DSZ A;  1QPF A;  3GU0 A;  1PBK A;  3ARU A;  1NSG A;  1LL6 A;  2ESC A;  4J4N A;  4HBO A;  1NWT A;  4MNK A;  3OA5 A;  1GOI A;  3AS1 A;  2DT0 A;  4GIV A;  3CH9 A;  5HW6 A;  2M2A A;  4WJX A;  3RME A;  3JYM A;  4XAK A;  4O2T A;  3O5R A;  1D7H A;  2M08 A;  4U84 A;  1E6Z A;  5HUA A;  1W1T A;  3ART A;  2KFW A;  3KAG A;  1FFQ A;  2FAP A;  3TDB A;  3UI6 A;  4DRI A;  4JFJ A;  1W9V A;  4DZ3 A;  2QF8 A;  1NWU A;  1EHN A;  1ROU A;  4Q7N A;  1JNT A;  2L2S A;  1SYT A;  3IHZ A;  4JFI A;  1FKT A;  4HAR A;  3UQI A;  2LJ4 A;  3CHC A;  4DRO A;  1ZU8 A;  1OWQ A;  4TYO A;  1EDQ A;  1LL4 A;  4MNM A;  3NTP A;  4MPK A;  2MLX A;  3KAF A;  3EY6 A;  4Z2L A;  1B6C A;  2G41 A;  3ARY A;  3B7X A;  1XHG A;  2XP7 A;  3JYJ A;  4TW7 A;  3H9R B;  1YW5 A;  1C9H A;  4TNS A;  3WL1 A;  3LUO A;  3TC5 A;  2KI3 A;  2DG3 A;  2DT3 A;  1FKD A;  1T11 A;  1M5Y A;  2A3C A;  4ZPW R;  4UDM A;  1SR0 A;  3O5I A;  5HKG A;  1JND A;  1D7I A;  3WH0 A;  3O5F A;  2ITK A;  2A3B A;  4ZS6 A;  5HWC A;  4U86 A;  3G6L A;  4S3K A;  2PN0 A;  3AS3 A;  4IPX A;  1A7X A;  2D9F A;  3WD0 A;  4NNR A;  1Q6U A;  2Y78 A;  3KZ7 A;  4MSP A;  1LG1 A;  4DH0 A;  4W5U A;  2PV2 A;  3IKD A;  2FKE A;  2RUD A; 
#chains in the Genus database with same CATH homology
 4Z2I A;  2JZV A;  4DRJ A;  1CTN A;  2MLZ A;  3ARR A;  2O9O A;  2A3A A;  1Q6I A;  2DSW A;  3AQU A;  1UR8 A;  1FKL A;  4Q22 A;  1E9L A;  1R9H A;  1FJD A;  5GQB A;  5BXJ A;  4QT2 A;  2YBU A;  2KE0 A;  2DT2 A;  1NWS A;  3UQA A;  1FKF A;  1X6L A;  1J4R A;  4BF8 A;  3TCZ A;  3WKZ A;  3ODK A;  2ZQT A;  3G6M A;  4N19 A;  1KT1 A;  3NI6 A;  1HJX A;  1VF8 A;  3CZ8 A;  2LGO A;  1Q1C A;  3WIJ A;  2PPN A;  3PRD A;  1W1Y A;  4L3N A;  5DEZ A;  1LJY A;  4Z2G A;  1GUV A;  1HKJ A;  2XP6 A;  1HXV A;  4JFL A;  3IK8 A;  1U79 A;  3O5Q A;  2DG9 A;  2LPV A;  4PTM A;  1L1P A;  4GGQ A;  2M1I A;  3ARV A;  1WNO A;  4LAY A;  1UR9 A;  1QPL A;  1KT0 A;  1D6O A;  3O5M A;  1W9P A;  4R0X A;  2MPH A;  1F40 A;  2KR7 A;  3OOB A;  5GPR A;  1IX5 A;  2KGJ A;  3PA7 A;  3W4R A;  3CHD A;  1Q6H A;  1FKI A;  4MTV A;  4DWS C;  4WKA A;  2ZQS A;  3NRK A;  2DPE A;  4TW6 A;  2XP5 A;  1FKB A;  2IF4 A;  1D7J A;  1NH6 A;  2DG4 A;  2RUQ A;  1JNE A;  4ODP A;  3ARO A;  2IUZ A;  1HJW A;  4G50 A;  3UI5 A;  3RGC A;  3O5L A;  4C02 B;  1P5Q A;  2F4E A;  1QZ2 A;  2KO7 A;  5D75 A;  5GPG A;  1WAW A;  3B9A A;  1HJV A;  4KQZ A;  1F8A B;  2RUC A;  1TFV A;  2AOS A;  1H0I A;  4W9Q A;  4URI A;  2N87 A;  3ARW A;  3O5G A;  4JFM A;  1Y0O A;  3RM8 A;  3KAB A;  2OFN A;  1HKI A;  3RFW A;  4MGV A;  3ARP A;  1TCO C;  2K8I A;  4JFK A;  1D2K A;  2RSE A;  2DSU A;  2VN1 A;  3ARX A;  4DWS A;  2WLY A;  3KAH A;  5B8I C;  1HKK A;  1XRV A;  4ODR A;  1E6P A;  2XPB A;  1FKS A;  4P8W A;  3ARZ A;  2OLH A;  3I6C A;  1FD9 A;  1W26 A;  2RUR A;  5DIV A;  2O92 A;  1EQ3 A;  4DT4 A;  3UF8 A;  2MF9 A;  2LKN A;  4DZ2 A;  3O5K A;  1OGB A;  2PPP A;  3PR9 A;  4J4O A;  1H0G A;  1WB0 A;  1ITX A;  4LAV A;  5JH8 A;  1W9U A;  4ODO A;  2WK2 A;  3CHE A;  4TW8 A;  1ZCN A;  2RQS A;  3KCE A;  4S3J A;  2WLZ A;  1GPF A;  1ZL1 A;  2ZQU A;  4QIB A;  4KR0 B;  4P8X A;  3ALG A;  4Z2K A;  3CGN A;  3KAI A;  1J6Y A;  4HBE A;  2F21 A;  3CGM A;  4NSB A;  4W9P A;  4TX0 A;  3ARQ A;  4NZC A;  1J4H A;  3ALF A;  1BKF A;  1HKM A;  1FFR A;  5DIU A;  4ML4 A;  1J4I A;  4QT3 A;  4Z2H A;  1E6N A;  4DWS D;  3FAP A;  4ODM A;  1FKR A;  3VAW A;  2F2D A;  2Q5A A;  4IT4 A;  1LL7 A;  1NWR A;  4LAW A;  5HTG A;  2DSV A;  3KAD A;  5I98 A;  1OGG A;  5DIT A;  4DRP A;  4WK9 A;  4IQC A;  1NMW A;  2PV3 A;  2XP4 A;  2PBC A;  4IT6 A;  4P8U A;  4WIW A;  4W9O A;  2PV1 A;  3WD3 A;  4ITZ A;  3B9D A;  3B9E A;  4DWS B;  4ZPT R;  4U85 A;  1ZK6 A;  3JXV A;  2XP3 A;  4G2P A;  1E15 A;  1K9T A;  1EIB A;  3PRB A;  2A3E A;  4L72 B;  5HBF A;  3UQB A;  3O5D A;  3B8S A;  3WD4 A;  1ZBW A;  3PRA A;  1W1P A;  2B31 A;  3O5O A;  4MNL A;  3AS0 A;  4ZPV R;  2PI6 A;  2XPA A;  3QOK A;  5J6E A;  2ZR6 A;  5HW7 A;  4QZV B;  5DF0 A;  4DRM A;  3KAC A;  1BL4 A;  2ZR5 A;  4WKH A;  5HWB A;  2UZ5 A;  2ZR4 A;  1JNS A;  1ZBK A;  1ZB5 A;  1W1V A;  3FY1 A;  4IQ2 A;  1LG2 A;  3RM4 A;  1E6R A;  4MNJ A;  2XP8 A;  1FKK A;  4FN2 A;  3FXY A;  1EYM A;  4ODN A;  4DRQ A;  1PIN A;  2MLY A;  1RD6 A;  3RM9 A;  3WL0 A;  1N1A A;  4DRN A;  2VCD A;  3IKG A;  1NMV A;  5HW8 A;  4P8V A;  3MDY B;  3UI4 A;  1O6I A;  2AWG A;  3O5P A;  4Z2J A;  3WQV A;  3ARS A;  3O5E A;  1FAP A;  1ZBV A;  2MNT A;  3BXW A;  2WM0 A;  2DT1 A;  3GPK A;  4FAP A;  3WD2 A;  4R5E A;  2G8Z A;  1FKG A;  2FDM A;  4WKF A;  4AY1 A;  1X6N A;  2XP9 A;  1LQ0 A;  4JYS A;  1YAT A;  2ZQV A;  4ODK A;  5DO2 A;  4DRK A;  1JVW A;  4LGX A;  4DIP A;  2YBT A;  4DRH A;  1KFW A;  4LAX A;  4ODQ A;  1FKJ A;  4MAV A;  1FKH A;  3CHF A;  2PPO A;  3WD1 A;  3O5J A;  3AS2 A;  4ODL A;  1ROT A;  3WQW A;  1ZBC A;  5HT1 A;  2DSZ A;  1QPF A;  1PBK A;  3ARU A;  1NSG A;  1LL6 A;  2ESC A;  4J4N A;  4HBO A;  1NWT A;  4MNK A;  3OA5 A;  1GOI A;  3AS1 A;  2DT0 A;  4GIV A;  3CH9 A;  5HW6 A;  2M2A A;  4WJX A;  3RME A;  3JYM A;  4XAK A;  4O2T A;  3O5R A;  1D7H A;  2M08 A;  4U84 A;  1E6Z A;  5HUA A;  1W1T A;  3ART A;  2KFW A;  3KAG A;  1FFQ A;  2FAP A;  3TDB A;  3UI6 A;  4DRI A;  4JFJ A;  1W9V A;  4DZ3 A;  2QF8 A;  1NWU A;  1EHN A;  1ROU A;  4Q7N A;  1JNT A;  2L2S A;  1SYT A;  3IHZ A;  4JFI A;  1FKT A;  4HAR A;  3UQI A;  2LJ4 A;  3CHC A;  4DRO A;  1ZU8 A;  1OWQ A;  4TYO A;  1EDQ A;  1LL4 A;  4MNM A;  3NTP A;  4MPK A;  2MLX A;  3KAF A;  3EY6 A;  4Z2L A;  1B6C A;  2G41 A;  3ARY A;  3B7X A;  1XHG A;  2XP7 A;  3JYJ A;  4TW7 A;  3H9R B;  1YW5 A;  1C9H A;  4TNS A;  3WL1 A;  3LUO A;  3TC5 A;  2KI3 A;  2DG3 A;  2DT3 A;  1FKD A;  1T11 A;  1M5Y A;  2A3C A;  4ZPW R;  1SR0 A;  3O5I A;  5HKG A;  1JND A;  1D7I A;  3WH0 A;  3O5F A;  2ITK A;  2A3B A;  4ZS6 A;  5HWC A;  4U86 A;  3G6L A;  4S3K A;  3AS3 A;  4IPX A;  1A7X A;  2D9F A;  3WD0 A;  4NNR A;  1Q6U A;  2Y78 A;  3KZ7 A;  4MSP A;  1LG1 A;  4DH0 A;  4W5U A;  2PV2 A;  3IKD A;  2FKE A;  2RUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...