1Q1CA

Crystal structure of n(1-260) of human fkbp52
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
237
structure length
237
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 4
total genus 58
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA02
1D7JA 1NSGA 1HXVA 1FKHA 4QIBA 3TC5A 4ODNA 4ODQA 2LKNA 2RSEA 2RQSA 3KAIA 4IPXA 1EQ3A 2DG9A 4J4NA 4J4OA 1ZK6A 3KAGA 1ZCNA 2PPOA 5HUAA 4LAXA 2LGOA 1ROUA 4IQCA 1W26A 1EYMA 4DIPA 2Q5AA 4G2PA 1BL4A 2F4EA 1Q1CA 1FKDA 1FKLA 1F8AB 1QZ2A 3O5LA 4ODKA 3IHZA 3TDBA 4DZ3A 1PBKA 1JNSA 3LUOA 1FKJA 2MF9A 1D6OA 2KE0A 3EY6A 1D7IA 2ZR5A 3IK8A 1R9HA 1KT1A 3JXVA 3NRKA 1FJDA 1JVWA 1FKIA 4ODOA 5HKGA 1YATA 1C9HA 2IF4A 4NNRA 4MSPA 2ZQVA 4W9QA 4U86A 3PRBA 4O2TA 5HT1A 1D7HA 1F40A 3MDYB 4JFKA 4W9OA 4FAPA 1A7XA 4GIVA 1TCOC 3O5IA 2XP3A 3UQAA 3VAWA 3KABA 3O5OA 2PV3A 4DRNA 1KT0A 2K8IA 4JFIA 4DRHA 2L2SA 2ZQUA 4ODLA 2MNTA 4ODPA 2ZR6A 1T11A 3JYJA 4DRPA 4TW8A 4ITZA 3JYMA 5DIUA 2MLYA 3GPKA 2FAPA 1M5YA 2DG4A 2PPNA 2RURA 3H9RB 2RUQA 3UI5A 4LAVA 2XP5A 1B6CA 2MLZA 3OOBA 3CGNA 2Y78A 1QPLA 1N1AA 2KGJA 4W9PA 5HWBA 3O5FA 5BXJA 4BF8A 4FN2A 1L1PA 2D9FA 5HWCA 2XP9A 1Y0OA 3O5PA 3O5QA 1J4RA 4C02B 5D75A 2KI3A 4ODMA 5HW6A 1J4IA 1Q6HA 3KZ7A 3ODKA 4DH0A 1FKSA 3I6CA 1Q6IA 3IKDA 1P5QA 3FAPA 1JNTA 1FAPA 1FD9A 1NMWA 3O5GA 4DRJA 4DRIA 2XP6A 4LAWA 1FKBA 4GGQA 4TX0A 2OFNA 4QT2A 3O5RA 2XP4A 4DROA 3NTPA 4QT3A 3UQIA 4JFLA 2RUDA 3CGMA 2ZR4A 4G50A 4JYSA 1YW5A 1FKRA 2KFWA 2F2DA 4TYOA 3O5DA 4U85A 2XP7A 4JFJA 3UI6A 4DRKA 4ODRA 2PV2A 2RUCA 4TW7A 1PINA 2MPHA 5J6EA 1FKGA 3UI4A 5DITA 4DZ2A 4MGVA 2AWGA 2PBCA 2PV1A 3PRDA 2M08A 3KAHA 4DT4A 1NMVA 3KADA 5B8IC 2XPAA 5HTGA 1BKFA 3RGCA 1J4HA 3O5JA 2KO7A 2XP8A 2LPVA 1FKFA 5DIVA 4TW6A 2MLXA 1FKTA 3O5EA 2XPBA 3KAFA 2ZQTA 1J6YA 3RFWA 2F21A 4R0XA 3O5KA 4U84A 5HW8A 5HW7A 4LAYA 2LJ4A 3PA7A 4DRMA 2JZVA 4IQ2A 2M2AA 2VCDA 4N19A 5I98A 2ZQSA 3WH0A 1QPFA 1ROTA 2ITKA 2VN1A 3UF8A 4DRQA 2KR7A 3TCZA 4JFMA 3O5MA 4TNSA 1FKKA 3UQBA 2M1IA 3B7XA 2PPPA 3KACA 2FKEA 3KCEA 2DG3A 2N87A 5GPGA 1Q6UA 3IKGA 3NI6A 1U79A 2UZ5A
chains in the Genus database with same CATH superfamily
1D7JA 4ODNA 1E6ZA 2RQSA 4J4NA 1K9TA 1ZK6A 2PPOA 4IQCA 4Z2HA 1LL7A 4DIPA 1Q1CA 1FKDA 3WIJA 3TDBA 3O5LA 4HBEA 3ARTA 4DZ3A 2MF9A 1D6OA 2KE0A 2YBTA 3IK8A 5HKGA 3CHFA 2FDMA 4MSPA 2ZQVA 4MNLA 1F40A 4UDMA 2G8ZA 3WD2A 1TCOC 3VAWA 1HJWA 2ZR6A 1T11A 4L3NA 4TW8A 2DT0A 5HBFA 2MLYA 1SYTA 3H9RB 2MLZA 1QPLA 1N1AA 4W9PA 5BXJA 2IUZA 4BF8A 5HWCA 3AS1A 4C02B 3AQUA 4ZPTR 1ITXA 1FD9A 2XP6A 3BMBA 2PN0A 2XP4A 1SR0A 5DO2A 1CTNA 3GTYX 2RUCA 3ALFA 2MPHA 1LL6A 5J6EA 5DITA 1W1YA 2PV1A 1W9VA 3PRDA 1E15A 1LG2A 1FFQA 3KADA 5B8IC 2XPAA 1W1TA 3RGCA 1J4HA 3O5JA 2DSUA 2WLZA 2LPVA 3AS2A 4S3JA 5DIVA 3AS0A 4TW6A 2MLXA 3O5EA 2XPBA 1X6LA 3RFWA 4R0XA 2A3CA 5HW8A 4LAYA 1HKKA 2JZVA 5I98A 1JNEA 2A3EA 1ROTA 2ITKA 2VN1A 4DRQA 3GU0A 3O5MA 1FKKA 3UQBA 3KACA 2DG3A 1J4RA 2UZ5A 3G6MA 3TC5A 4Z2GA 3ARPA 4ODQA 2RSEA 3KAIA 4IPXA 2WM0A 1ZCNA 3CHCA 2LGOA 1ROUA 3OA5A 1W26A 4Z2KA 3B9EA 1BL4A 2F4EA 3B8SA 1FKLA 4ODKA 3IHZA 3EY6A 1D7IA 1R9HA 2EULA 3NRKA 1FJDA 5DF0A 1OWQA 2IF4A 3WQVA 5JH8A 4W9QA 3PRBA 5HT1A 1D7HA 1GOIA 3CHEA 3MDYB 4JFKA 4GIVA 1W1VA 1E6NA 1XRVA 3UQAA 2PV3A 1KT0A 1W9UA 4Z2IA 4DRHA 2ZQUA 4ODLA 4ODPA 3JYJA 4DWSD 4ITZA 2G41A 5GQBA 2DSZA 5DIUA 3UI5A 2PPNA 1HKMA 2DG4A 2RUQA 1B6CA 3WL1A 3W4RA 5HWBA 3O5FA 4FN2A 2D9FA 2DT3A 3WD4A 1Y0OA 3O5QA 5D75A 5HW6A 4DH0A 1HKIA 3B9DA 4P8VA 3O5GA 3FAPA 4W5UA 1FAPA 1NMWA 4DRIA 4LAWA 1FKBA 2DSWA 2O92A 4DROA 4MNJA 2DPEA 3UQIA 3CGMA 1E6RA 1LJYA 2ZR4A 4Q22A 1YW5A 1FKRA 1WB0A 1PINA 4DZ2A 2ETNA 3KAHA 3ARQA 3BXWA 1ZBVA 3ARUA 1EIBA 1HJXA 4MNKA 1NWUA 3WD1A 1OGBA 3ALGA 1J6YA 1HKJA 2LJ4A 4DRMA 2ZQSA 1ZBKA 3UF8A 2YBUA 3WKZA 1NH6A 4JFMA 4TNSA 2M1IA 3B7XA 4P8UA 3KCEA 5GPGA 1WAWA 3WL0A 3IKGA 1HJVA 1U79A 3I6CA 3RM8A 2A3BA 1ZBWA 1FKHA 1JNDA 3AROA 3ARWA 2OLHA 1D2KA 4KR0B 4Q7NA 4DWSC 5DEZA 4LAXA 1EYMA 4G2PA 4ML4A 1F8AB 4Z2LA 4P8XA 1JNSA 3LUOA 1FKJA 1IX5A 2ZR5A 1KT1A 1JVWA 3WD0A 1FKIA 1YATA 1GRJA 1C9HA 4R5EA 4IT6A 4DWSB 4Z2JA 4WKHA 3O5IA 1LQ0A 3KABA 3B9AA 2L2SA 2MNTA 3ARYA 4XAKA 3JYMA 4WK9A 2FAPA 2RURA 4LAVA 3OOBA 3CGNA 2Y78A 1ZBCA 1L1PA 2B5UB 4ZPWR 1J4IA 1Q6HA 1FFRA 3CH9A 1FKSA 2ESCA 1Q6IA 3IKDA 1P5QA 2P4VA 3RM9A 4GGQA 1ZU8A 4TX0A 4QT2A 1GUVA 3O5RA 3ARZA 2PI6A 1W1PA 4QT3A 2B31A 1H0GA 1W9PA 3ARVA 4L72B 3ARRA 1LG1A 4JYSA 2KFWA 3UI6A 4U85A 4DRKA 4ODRA 2PV2A 3ARSA 1FKGA 3RMEA 3UI4A 1RD6A 4ZPVR 4MGVA 2AWGA 2PBCA 3AS3A 4DT4A 4MAVA 2KO7A 3CZ8A 3KAFA 1JCHB 1WNOA 2ZQTA 4MTVA 4U84A 1NWRA 1XHGA 1EHNA 3PA7A 3PRAA 4IQ2A 2M2AA 2VCDA 4N19A 1OGGA 3EIPA 1QPFA 2KR7A 3ARXA 1LL4A 3FXYA 3WD3A 2FKEA 2N87A 1O6IA 3NI6A 4URIA 1NSGA 1GPFA 1HXVA 4QIBA 2LKNA 1EQ3A 2DG9A 4J4OA 3KAGA 5HUAA 2Q5AA 1UR8A 4IT4A 4ZS6A 1QZ2A 3WQWA 1PBKA 3JXVA 4MNMA 1E44A 4NZCA 4ODOA 4WKAA 4NNRA 3G6LA 2WK2A 4U86A 4O2TA 2QF8A 4W9OA 1NWSA 1A7XA 3CHDA 4FAPA 1E9LA 1UR9A 2XP3A 3QOKA 3O5OA 4HBOA 2F23A 4DRNA 2K8IA 4JFIA 4HARA 4DRPA 1ZB5A 3GPKA 1X6NA 1M5YA 2XP5A 2DSVA 2KGJA 4WIWA 2XP9A 1TFVA 3O5PA 2KI3A 4ODMA 4WKFA 3KZ7A 3ODKA 1H0IA 1JNTA 4DRJA 1VF8A 1ZL1A 2OFNA 1NWTA 4DWSA 3NTPA 4MPKA 2DT1A 2WLYA 4JFLA 2RUDA 4G50A 4NSBA 1KFWA 2DT2A 2F2DA 4TYOA 3O5DA 2XP7A 4JFJA 2AOSA 4TW7A 4AY1A 2M08A 4P8WA 1NMVA 4S3KA 5HTGA 1BKFA 3FY1A 2XP8A 4WJXA 1FKFA 4LGXA 1E6PA 4PTMA 3PR9A 1FKTA 2F21A 3RM4A 3O5KA 4KQZA 5GPRA 5HW7A 4QZVB 2O9OA 3WH0A 1EDQA 3TCZA 2PPPA 1Q6UA 2A3AA
chains in the Genus database with same CATH topology
1D7JA 4ODNA 1E6ZA 2RQSA 4J4NA 1K9TA 1ZK6A 2PPOA 4IQCA 4Z2HA 1LL7A 4DIPA 1Q1CA 1FKDA 3WIJA 3TDBA 3O5LA 4HBEA 3ARTA 4DZ3A 2MF9A 1D6OA 2KE0A 2YBTA 3IK8A 5HKGA 3CHFA 2FDMA 4MSPA 2ZQVA 4MNLA 1F40A 2G8ZA 3WD2A 1TCOC 3VAWA 1HJWA 2ZR6A 1T11A 4L3NA 4TW8A 2DT0A 5HBFA 2MLYA 1SYTA 3H9RB 2MLZA 1QPLA 1N1AA 4W9PA 5BXJA 2IUZA 4BF8A 5HWCA 3AS1A 4C02B 3AQUA 4ZPTR 1ITXA 1FD9A 2XP6A 2XP4A 1SR0A 5DO2A 1CTNA 2RUCA 3ALFA 2MPHA 1LL6A 5J6EA 5DITA 1W1YA 2PV1A 1W9VA 3PRDA 1E15A 1LG2A 1FFQA 3KADA 5B8IC 2XPAA 1W1TA 3RGCA 1J4HA 3O5JA 2DSUA 2WLZA 2LPVA 3AS2A 4S3JA 5DIVA 3AS0A 4TW6A 2MLXA 3O5EA 2XPBA 1X6LA 3RFWA 4R0XA 2A3CA 5HW8A 4LAYA 1HKKA 2JZVA 5I98A 1JNEA 2A3EA 1ROTA 2ITKA 2VN1A 4DRQA 3O5MA 1FKKA 3UQBA 3KACA 2DG3A 1J4RA 2UZ5A 3G6MA 3TC5A 4Z2GA 3ARPA 4ODQA 2RSEA 3KAIA 4IPXA 2WM0A 1ZCNA 3CHCA 2LGOA 1ROUA 3OA5A 1W26A 4Z2KA 3B9EA 1BL4A 2F4EA 3B8SA 1FKLA 4ODKA 3IHZA 3EY6A 1D7IA 1R9HA 3NRKA 1FJDA 5DF0A 1OWQA 2IF4A 3WQVA 5JH8A 4W9QA 3PRBA 5HT1A 1D7HA 1GOIA 3CHEA 3MDYB 4JFKA 4GIVA 1W1VA 1E6NA 1XRVA 3UQAA 2PV3A 1KT0A 1W9UA 4Z2IA 4DRHA 2ZQUA 4ODLA 4ODPA 3JYJA 4DWSD 4ITZA 2G41A 5GQBA 2DSZA 5DIUA 3UI5A 2PPNA 1HKMA 2DG4A 2RUQA 1B6CA 3WL1A 3W4RA 5HWBA 3O5FA 4FN2A 2D9FA 2DT3A 3WD4A 1Y0OA 3O5QA 5D75A 5HW6A 4DH0A 1HKIA 3B9DA 4P8VA 3O5GA 3FAPA 4W5UA 1FAPA 1NMWA 4DRIA 4LAWA 1FKBA 2DSWA 2O92A 4DROA 4MNJA 2DPEA 3UQIA 3CGMA 1E6RA 1LJYA 2ZR4A 4Q22A 1YW5A 1FKRA 1WB0A 1PINA 4DZ2A 3KAHA 3ARQA 3BXWA 1ZBVA 3ARUA 1EIBA 1HJXA 4MNKA 1NWUA 3WD1A 1OGBA 3ALGA 1J6YA 1HKJA 2LJ4A 4DRMA 2ZQSA 1ZBKA 3UF8A 2YBUA 3WKZA 1NH6A 4JFMA 4TNSA 2M1IA 3B7XA 4P8UA 3KCEA 5GPGA 1WAWA 3WL0A 3IKGA 1HJVA 1U79A 3I6CA 3RM8A 2A3BA 1ZBWA 1FKHA 1JNDA 3AROA 3ARWA 2OLHA 1D2KA 4KR0B 4Q7NA 4DWSC 5DEZA 4LAXA 1EYMA 4G2PA 4ML4A 1F8AB 4Z2LA 4P8XA 1JNSA 3LUOA 1FKJA 1IX5A 2ZR5A 1KT1A 1JVWA 3WD0A 1FKIA 1YATA 1C9HA 4R5EA 4IT6A 4DWSB 4Z2JA 4WKHA 3O5IA 1LQ0A 3KABA 3B9AA 2L2SA 2MNTA 3ARYA 4XAKA 3JYMA 4WK9A 2FAPA 2RURA 4LAVA 3OOBA 3CGNA 2Y78A 1ZBCA 1L1PA 4ZPWR 1J4IA 1Q6HA 1FFRA 3CH9A 1FKSA 2ESCA 1Q6IA 3IKDA 1P5QA 3RM9A 4GGQA 1ZU8A 4TX0A 4QT2A 1GUVA 3O5RA 3ARZA 2PI6A 1W1PA 4QT3A 2B31A 1H0GA 1W9PA 3ARVA 4L72B 3ARRA 1LG1A 4JYSA 2KFWA 3UI6A 4U85A 4DRKA 4ODRA 2PV2A 3ARSA 1FKGA 3RMEA 3UI4A 1RD6A 4ZPVR 4MGVA 2AWGA 2PBCA 3AS3A 4DT4A 4MAVA 2KO7A 3CZ8A 3KAFA 1WNOA 2ZQTA 4MTVA 4U84A 1NWRA 1XHGA 1EHNA 3PA7A 3PRAA 4IQ2A 2M2AA 2VCDA 4N19A 1OGGA 1QPFA 2KR7A 3ARXA 1LL4A 3FXYA 3WD3A 2FKEA 2N87A 1O6IA 3NI6A 4URIA 1NSGA 1GPFA 1HXVA 4QIBA 2LKNA 1EQ3A 2DG9A 4J4OA 3KAGA 5HUAA 2Q5AA 1UR8A 4IT4A 4ZS6A 1QZ2A 3WQWA 1PBKA 3JXVA 4MNMA 4NZCA 4ODOA 4WKAA 4NNRA 3G6LA 2WK2A 4U86A 4O2TA 2QF8A 4W9OA 1NWSA 1A7XA 3CHDA 4FAPA 1E9LA 1UR9A 2XP3A 3QOKA 3O5OA 4HBOA 4DRNA 2K8IA 4JFIA 4HARA 4DRPA 1ZB5A 3GPKA 1X6NA 1M5YA 2XP5A 2DSVA 2KGJA 4WIWA 2XP9A 1TFVA 3O5PA 2KI3A 4ODMA 4WKFA 3KZ7A 3ODKA 1H0IA 1JNTA 4DRJA 1VF8A 1ZL1A 2OFNA 1NWTA 4DWSA 3NTPA 4MPKA 2DT1A 2WLYA 4JFLA 2RUDA 4G50A 4NSBA 1KFWA 2DT2A 2F2DA 4TYOA 3O5DA 2XP7A 4JFJA 2AOSA 4TW7A 4AY1A 2M08A 4P8WA 1NMVA 4S3KA 5HTGA 1BKFA 3FY1A 2XP8A 4WJXA 1FKFA 4LGXA 1E6PA 4PTMA 3PR9A 1FKTA 2F21A 3RM4A 3O5KA 4KQZA 5GPRA 5HW7A 4QZVB 2O9OA 3WH0A 1EDQA 3TCZA 2PPPA 1Q6UA 2A3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7J A;  1NSG A;  1HXV A;  1FKH A;  4QIB A;  3TC5 A;  4ODN A;  4ODQ A;  2LKN A;  2RSE A;  2RQS A;  3KAI A;  4IPX A;  1EQ3 A;  2DG9 A;  4J4N A;  4J4O A;  1ZK6 A;  3KAG A;  1ZCN A;  2PPO A;  5HUA A;  4LAX A;  2LGO A;  1ROU A;  4IQC A;  1W26 A;  1EYM A;  4DIP A;  2Q5A A;  4G2P A;  1BL4 A;  2F4E A;  1Q1C A;  1FKD A;  1FKL A;  1F8A B;  1QZ2 A;  3O5L A;  4ODK A;  3IHZ A;  3TDB A;  4DZ3 A;  1PBK A;  1JNS A;  3LUO A;  1FKJ A;  2MF9 A;  1D6O A;  2KE0 A;  3EY6 A;  1D7I A;  2ZR5 A;  3IK8 A;  1R9H A;  1KT1 A;  3JXV A;  3NRK A;  1FJD A;  1JVW A;  1FKI A;  4ODO A;  5HKG A;  1YAT A;  1C9H A;  2IF4 A;  4NNR A;  4MSP A;  2ZQV A;  4W9Q A;  4U86 A;  3PRB A;  4O2T A;  5HT1 A;  1D7H A;  1F40 A;  3MDY B;  4JFK A;  4W9O A;  4FAP A;  1A7X A;  4GIV A;  1TCO C;  3O5I A;  2XP3 A;  3UQA A;  3VAW A;  3KAB A;  3O5O A;  2PV3 A;  4DRN A;  1KT0 A;  2K8I A;  4JFI A;  4DRH A;  2L2S A;  2ZQU A;  4ODL A;  2MNT A;  4ODP A;  2ZR6 A;  1T11 A;  3JYJ A;  4DRP A;  4TW8 A;  4ITZ A;  3JYM A;  5DIU A;  2MLY A;  3GPK A;  2FAP A;  1M5Y A;  2DG4 A;  2PPN A;  2RUR A;  3H9R B;  2RUQ A;  3UI5 A;  4LAV A;  2XP5 A;  1B6C A;  2MLZ A;  3OOB A;  3CGN A;  2Y78 A;  1QPL A;  1N1A A;  2KGJ A;  4W9P A;  5HWB A;  3O5F A;  5BXJ A;  4BF8 A;  4FN2 A;  1L1P A;  2D9F A;  5HWC A;  2XP9 A;  1Y0O A;  3O5P A;  3O5Q A;  1J4R A;  4C02 B;  5D75 A;  2KI3 A;  4ODM A;  5HW6 A;  1J4I A;  1Q6H A;  3KZ7 A;  3ODK A;  4DH0 A;  1FKS A;  3I6C A;  1Q6I A;  3IKD A;  1P5Q A;  3FAP A;  1JNT A;  1FAP A;  1FD9 A;  1NMW A;  3O5G A;  4DRJ A;  4DRI A;  2XP6 A;  4LAW A;  1FKB A;  4GGQ A;  4TX0 A;  2OFN A;  4QT2 A;  3O5R A;  2XP4 A;  4DRO A;  3NTP A;  4QT3 A;  3UQI A;  4JFL A;  2RUD A;  3CGM A;  2ZR4 A;  4G50 A;  4JYS A;  1YW5 A;  1FKR A;  2KFW A;  2F2D A;  4TYO A;  3O5D A;  4U85 A;  2XP7 A;  4JFJ A;  3UI6 A;  4DRK A;  4ODR A;  2PV2 A;  2RUC A;  4TW7 A;  1PIN A;  2MPH A;  5J6E A;  1FKG A;  3UI4 A;  5DIT A;  4DZ2 A;  4MGV A;  2AWG A;  2PBC A;  2PV1 A;  3PRD A;  2M08 A;  3KAH A;  4DT4 A;  1NMV A;  3KAD A;  5B8I C;  2XPA A;  5HTG A;  1BKF A;  3RGC A;  1J4H A;  3O5J A;  2KO7 A;  2XP8 A;  2LPV A;  1FKF A;  5DIV A;  4TW6 A;  2MLX A;  1FKT A;  3O5E A;  2XPB A;  3KAF A;  2ZQT A;  1J6Y A;  3RFW A;  2F21 A;  4R0X A;  3O5K A;  4U84 A;  5HW8 A;  5HW7 A;  4LAY A;  2LJ4 A;  3PA7 A;  4DRM A;  2JZV A;  4IQ2 A;  2M2A A;  2VCD A;  4N19 A;  5I98 A;  2ZQS A;  3WH0 A;  1QPF A;  1ROT A;  2ITK A;  2VN1 A;  3UF8 A;  4DRQ A;  2KR7 A;  3TCZ A;  4JFM A;  3O5M A;  4TNS A;  1FKK A;  3UQB A;  2M1I A;  3B7X A;  2PPP A;  3KAC A;  2FKE A;  3KCE A;  2DG3 A;  2N87 A;  5GPG A;  1Q6U A;  3IKG A;  3NI6 A;  1U79 A;  2UZ5 A; 
#chains in the Genus database with same CATH topology
 1D7J A;  4ODN A;  1E6Z A;  2RQS A;  4J4N A;  1K9T A;  1ZK6 A;  2PPO A;  4IQC A;  4Z2H A;  1LL7 A;  4DIP A;  1Q1C A;  1FKD A;  3WIJ A;  3TDB A;  3O5L A;  4HBE A;  3ART A;  4DZ3 A;  2MF9 A;  1D6O A;  2KE0 A;  2YBT A;  3IK8 A;  5HKG A;  3CHF A;  2FDM A;  4MSP A;  2ZQV A;  4MNL A;  1F40 A;  4UDM A;  2G8Z A;  3WD2 A;  1TCO C;  3VAW A;  1HJW A;  2ZR6 A;  1T11 A;  4L3N A;  4TW8 A;  2DT0 A;  5HBF A;  2MLY A;  1SYT A;  3H9R B;  2MLZ A;  1QPL A;  1N1A A;  4W9P A;  5BXJ A;  2IUZ A;  4BF8 A;  5HWC A;  3AS1 A;  4C02 B;  3AQU A;  4ZPT R;  1ITX A;  1FD9 A;  2XP6 A;  3BMB A;  2PN0 A;  2XP4 A;  1SR0 A;  5DO2 A;  1CTN A;  3GTY X;  2RUC A;  3ALF A;  2MPH A;  1LL6 A;  5J6E A;  5DIT A;  1W1Y A;  2PV1 A;  1W9V A;  3PRD A;  1E15 A;  1LG2 A;  1FFQ A;  3KAD A;  5B8I C;  2XPA A;  1W1T A;  3RGC A;  1J4H A;  3O5J A;  2DSU A;  2WLZ A;  2LPV A;  3AS2 A;  4S3J A;  5DIV A;  3AS0 A;  4TW6 A;  2MLX A;  3O5E A;  2XPB A;  1X6L A;  3RFW A;  4R0X A;  2A3C A;  5HW8 A;  4LAY A;  1HKK A;  2JZV A;  5I98 A;  1JNE A;  2A3E A;  1ROT A;  2ITK A;  2VN1 A;  4DRQ A;  3GU0 A;  3O5M A;  1FKK A;  3UQB A;  3KAC A;  2DG3 A;  1J4R A;  2UZ5 A;  3G6M A;  3TC5 A;  4Z2G A;  3ARP A;  4ODQ A;  2RSE A;  3KAI A;  4IPX A;  2WM0 A;  1ZCN A;  3CHC A;  2LGO A;  1ROU A;  3OA5 A;  1W26 A;  4Z2K A;  3B9E A;  1BL4 A;  2F4E A;  3B8S A;  1FKL A;  4ODK A;  3IHZ A;  3EY6 A;  1D7I A;  1R9H A;  2EUL A;  3NRK A;  1FJD A;  5DF0 A;  1OWQ A;  2IF4 A;  3WQV A;  5JH8 A;  4W9Q A;  3PRB A;  5HT1 A;  1D7H A;  1GOI A;  3CHE A;  3MDY B;  4JFK A;  4GIV A;  1W1V A;  1E6N A;  1XRV A;  3UQA A;  2PV3 A;  1KT0 A;  1W9U A;  4Z2I A;  4DRH A;  2ZQU A;  4ODL A;  4ODP A;  3JYJ A;  4DWS D;  4ITZ A;  2G41 A;  5GQB A;  2DSZ A;  5DIU A;  3UI5 A;  2PPN A;  1HKM A;  2DG4 A;  2RUQ A;  1B6C A;  3WL1 A;  3W4R A;  5HWB A;  3O5F A;  4FN2 A;  2D9F A;  2DT3 A;  3WD4 A;  1Y0O A;  3O5Q A;  5D75 A;  5HW6 A;  4DH0 A;  1HKI A;  3B9D A;  4P8V A;  3O5G A;  3FAP A;  4W5U A;  1FAP A;  1NMW A;  4DRI A;  4LAW A;  1FKB A;  2DSW A;  2O92 A;  4DRO A;  4MNJ A;  2DPE A;  3UQI A;  3CGM A;  1E6R A;  1LJY A;  2ZR4 A;  4Q22 A;  1YW5 A;  1FKR A;  1WB0 A;  1PIN A;  4DZ2 A;  2ETN A;  3KAH A;  3ARQ A;  3BXW A;  1ZBV A;  3ARU A;  1EIB A;  1HJX A;  4MNK A;  1NWU A;  3WD1 A;  1OGB A;  3ALG A;  1J6Y A;  1HKJ A;  2LJ4 A;  4DRM A;  2ZQS A;  1ZBK A;  3UF8 A;  2YBU A;  3WKZ A;  1NH6 A;  4JFM A;  4TNS A;  2M1I A;  3B7X A;  4P8U A;  3KCE A;  5GPG A;  1WAW A;  3WL0 A;  3IKG A;  1HJV A;  1U79 A;  3I6C A;  3RM8 A;  2A3B A;  1ZBW A;  1FKH A;  1JND A;  3ARO A;  3ARW A;  2OLH A;  1D2K A;  4KR0 B;  4Q7N A;  4DWS C;  5DEZ A;  4LAX A;  1EYM A;  4G2P A;  4ML4 A;  1F8A B;  4Z2L A;  4P8X A;  1JNS A;  3LUO A;  1FKJ A;  1IX5 A;  2ZR5 A;  1KT1 A;  1JVW A;  3WD0 A;  1FKI A;  1YAT A;  1GRJ A;  1C9H A;  4R5E A;  4IT6 A;  4DWS B;  4Z2J A;  4WKH A;  3O5I A;  1LQ0 A;  3KAB A;  3B9A A;  2L2S A;  2MNT A;  3ARY A;  4XAK A;  3JYM A;  4WK9 A;  2FAP A;  2RUR A;  4LAV A;  3OOB A;  3CGN A;  2Y78 A;  1ZBC A;  1L1P A;  2B5U B;  4ZPW R;  1J4I A;  1Q6H A;  1FFR A;  3CH9 A;  1FKS A;  2ESC A;  1Q6I A;  3IKD A;  1P5Q A;  2P4V A;  3RM9 A;  4GGQ A;  1ZU8 A;  4TX0 A;  4QT2 A;  1GUV A;  3O5R A;  3ARZ A;  2PI6 A;  1W1P A;  4QT3 A;  2B31 A;  1H0G A;  1W9P A;  3ARV A;  4L72 B;  3ARR A;  1LG1 A;  4JYS A;  2KFW A;  3UI6 A;  4U85 A;  4DRK A;  4ODR A;  2PV2 A;  3ARS A;  1FKG A;  3RME A;  3UI4 A;  1RD6 A;  4ZPV R;  4MGV A;  2AWG A;  2PBC A;  3AS3 A;  4DT4 A;  4MAV A;  2KO7 A;  3CZ8 A;  3KAF A;  1JCH B;  1WNO A;  2ZQT A;  4MTV A;  4U84 A;  1NWR A;  1XHG A;  1EHN A;  3PA7 A;  3PRA A;  4IQ2 A;  2M2A A;  2VCD A;  4N19 A;  1OGG A;  3EIP A;  1QPF A;  2KR7 A;  3ARX A;  1LL4 A;  3FXY A;  3WD3 A;  2FKE A;  2N87 A;  1O6I A;  3NI6 A;  4URI A;  1NSG A;  1GPF A;  1HXV A;  4QIB A;  2LKN A;  1EQ3 A;  2DG9 A;  4J4O A;  3KAG A;  5HUA A;  2Q5A A;  1UR8 A;  4IT4 A;  4ZS6 A;  1QZ2 A;  3WQW A;  1PBK A;  3JXV A;  4MNM A;  1E44 A;  4NZC A;  4ODO A;  4WKA A;  4NNR A;  3G6L A;  2WK2 A;  4U86 A;  4O2T A;  2QF8 A;  4W9O A;  1NWS A;  1A7X A;  3CHD A;  4FAP A;  1E9L A;  1UR9 A;  2XP3 A;  3QOK A;  3O5O A;  4HBO A;  2F23 A;  4DRN A;  2K8I A;  4JFI A;  4HAR A;  4DRP A;  1ZB5 A;  3GPK A;  1X6N A;  1M5Y A;  2XP5 A;  2DSV A;  2KGJ A;  4WIW A;  2XP9 A;  1TFV A;  3O5P A;  2KI3 A;  4ODM A;  4WKF A;  3KZ7 A;  3ODK A;  1H0I A;  1JNT A;  4DRJ A;  1VF8 A;  1ZL1 A;  2OFN A;  1NWT A;  4DWS A;  3NTP A;  4MPK A;  2DT1 A;  2WLY A;  4JFL A;  2RUD A;  4G50 A;  4NSB A;  1KFW A;  2DT2 A;  2F2D A;  4TYO A;  3O5D A;  2XP7 A;  4JFJ A;  2AOS A;  4TW7 A;  4AY1 A;  2M08 A;  4P8W A;  1NMV A;  4S3K A;  5HTG A;  1BKF A;  3FY1 A;  2XP8 A;  4WJX A;  1FKF A;  4LGX A;  1E6P A;  4PTM A;  3PR9 A;  1FKT A;  2F21 A;  3RM4 A;  3O5K A;  4KQZ A;  5GPR A;  5HW7 A;  4QZV B;  2O9O A;  3WH0 A;  1EDQ A;  3TCZ A;  2PPP A;  1Q6U A;  2A3A A; 
#chains in the Genus database with same CATH homology
 1D7J A;  4ODN A;  1E6Z A;  2RQS A;  4J4N A;  1K9T A;  1ZK6 A;  2PPO A;  4IQC A;  4Z2H A;  1LL7 A;  4DIP A;  1Q1C A;  1FKD A;  3WIJ A;  3TDB A;  3O5L A;  4HBE A;  3ART A;  4DZ3 A;  2MF9 A;  1D6O A;  2KE0 A;  2YBT A;  3IK8 A;  5HKG A;  3CHF A;  2FDM A;  4MSP A;  2ZQV A;  4MNL A;  1F40 A;  2G8Z A;  3WD2 A;  1TCO C;  3VAW A;  1HJW A;  2ZR6 A;  1T11 A;  4L3N A;  4TW8 A;  2DT0 A;  5HBF A;  2MLY A;  1SYT A;  3H9R B;  2MLZ A;  1QPL A;  1N1A A;  4W9P A;  5BXJ A;  2IUZ A;  4BF8 A;  5HWC A;  3AS1 A;  4C02 B;  3AQU A;  4ZPT R;  1ITX A;  1FD9 A;  2XP6 A;  2XP4 A;  1SR0 A;  5DO2 A;  1CTN A;  2RUC A;  3ALF A;  2MPH A;  1LL6 A;  5J6E A;  5DIT A;  1W1Y A;  2PV1 A;  1W9V A;  3PRD A;  1E15 A;  1LG2 A;  1FFQ A;  3KAD A;  5B8I C;  2XPA A;  1W1T A;  3RGC A;  1J4H A;  3O5J A;  2DSU A;  2WLZ A;  2LPV A;  3AS2 A;  4S3J A;  5DIV A;  3AS0 A;  4TW6 A;  2MLX A;  3O5E A;  2XPB A;  1X6L A;  3RFW A;  4R0X A;  2A3C A;  5HW8 A;  4LAY A;  1HKK A;  2JZV A;  5I98 A;  1JNE A;  2A3E A;  1ROT A;  2ITK A;  2VN1 A;  4DRQ A;  3O5M A;  1FKK A;  3UQB A;  3KAC A;  2DG3 A;  1J4R A;  2UZ5 A;  3G6M A;  3TC5 A;  4Z2G A;  3ARP A;  4ODQ A;  2RSE A;  3KAI A;  4IPX A;  2WM0 A;  1ZCN A;  3CHC A;  2LGO A;  1ROU A;  3OA5 A;  1W26 A;  4Z2K A;  3B9E A;  1BL4 A;  2F4E A;  3B8S A;  1FKL A;  4ODK A;  3IHZ A;  3EY6 A;  1D7I A;  1R9H A;  3NRK A;  1FJD A;  5DF0 A;  1OWQ A;  2IF4 A;  3WQV A;  5JH8 A;  4W9Q A;  3PRB A;  5HT1 A;  1D7H A;  1GOI A;  3CHE A;  3MDY B;  4JFK A;  4GIV A;  1W1V A;  1E6N A;  1XRV A;  3UQA A;  2PV3 A;  1KT0 A;  1W9U A;  4Z2I A;  4DRH A;  2ZQU A;  4ODL A;  4ODP A;  3JYJ A;  4DWS D;  4ITZ A;  2G41 A;  5GQB A;  2DSZ A;  5DIU A;  3UI5 A;  2PPN A;  1HKM A;  2DG4 A;  2RUQ A;  1B6C A;  3WL1 A;  3W4R A;  5HWB A;  3O5F A;  4FN2 A;  2D9F A;  2DT3 A;  3WD4 A;  1Y0O A;  3O5Q A;  5D75 A;  5HW6 A;  4DH0 A;  1HKI A;  3B9D A;  4P8V A;  3O5G A;  3FAP A;  4W5U A;  1FAP A;  1NMW A;  4DRI A;  4LAW A;  1FKB A;  2DSW A;  2O92 A;  4DRO A;  4MNJ A;  2DPE A;  3UQI A;  3CGM A;  1E6R A;  1LJY A;  2ZR4 A;  4Q22 A;  1YW5 A;  1FKR A;  1WB0 A;  1PIN A;  4DZ2 A;  3KAH A;  3ARQ A;  3BXW A;  1ZBV A;  3ARU A;  1EIB A;  1HJX A;  4MNK A;  1NWU A;  3WD1 A;  1OGB A;  3ALG A;  1J6Y A;  1HKJ A;  2LJ4 A;  4DRM A;  2ZQS A;  1ZBK A;  3UF8 A;  2YBU A;  3WKZ A;  1NH6 A;  4JFM A;  4TNS A;  2M1I A;  3B7X A;  4P8U A;  3KCE A;  5GPG A;  1WAW A;  3WL0 A;  3IKG A;  1HJV A;  1U79 A;  3I6C A;  3RM8 A;  2A3B A;  1ZBW A;  1FKH A;  1JND A;  3ARO A;  3ARW A;  2OLH A;  1D2K A;  4KR0 B;  4Q7N A;  4DWS C;  5DEZ A;  4LAX A;  1EYM A;  4G2P A;  4ML4 A;  1F8A B;  4Z2L A;  4P8X A;  1JNS A;  3LUO A;  1FKJ A;  1IX5 A;  2ZR5 A;  1KT1 A;  1JVW A;  3WD0 A;  1FKI A;  1YAT A;  1C9H A;  4R5E A;  4IT6 A;  4DWS B;  4Z2J A;  4WKH A;  3O5I A;  1LQ0 A;  3KAB A;  3B9A A;  2L2S A;  2MNT A;  3ARY A;  4XAK A;  3JYM A;  4WK9 A;  2FAP A;  2RUR A;  4LAV A;  3OOB A;  3CGN A;  2Y78 A;  1ZBC A;  1L1P A;  4ZPW R;  1J4I A;  1Q6H A;  1FFR A;  3CH9 A;  1FKS A;  2ESC A;  1Q6I A;  3IKD A;  1P5Q A;  3RM9 A;  4GGQ A;  1ZU8 A;  4TX0 A;  4QT2 A;  1GUV A;  3O5R A;  3ARZ A;  2PI6 A;  1W1P A;  4QT3 A;  2B31 A;  1H0G A;  1W9P A;  3ARV A;  4L72 B;  3ARR A;  1LG1 A;  4JYS A;  2KFW A;  3UI6 A;  4U85 A;  4DRK A;  4ODR A;  2PV2 A;  3ARS A;  1FKG A;  3RME A;  3UI4 A;  1RD6 A;  4ZPV R;  4MGV A;  2AWG A;  2PBC A;  3AS3 A;  4DT4 A;  4MAV A;  2KO7 A;  3CZ8 A;  3KAF A;  1WNO A;  2ZQT A;  4MTV A;  4U84 A;  1NWR A;  1XHG A;  1EHN A;  3PA7 A;  3PRA A;  4IQ2 A;  2M2A A;  2VCD A;  4N19 A;  1OGG A;  1QPF A;  2KR7 A;  3ARX A;  1LL4 A;  3FXY A;  3WD3 A;  2FKE A;  2N87 A;  1O6I A;  3NI6 A;  4URI A;  1NSG A;  1GPF A;  1HXV A;  4QIB A;  2LKN A;  1EQ3 A;  2DG9 A;  4J4O A;  3KAG A;  5HUA A;  2Q5A A;  1UR8 A;  4IT4 A;  4ZS6 A;  1QZ2 A;  3WQW A;  1PBK A;  3JXV A;  4MNM A;  4NZC A;  4ODO A;  4WKA A;  4NNR A;  3G6L A;  2WK2 A;  4U86 A;  4O2T A;  2QF8 A;  4W9O A;  1NWS A;  1A7X A;  3CHD A;  4FAP A;  1E9L A;  1UR9 A;  2XP3 A;  3QOK A;  3O5O A;  4HBO A;  4DRN A;  2K8I A;  4JFI A;  4HAR A;  4DRP A;  1ZB5 A;  3GPK A;  1X6N A;  1M5Y A;  2XP5 A;  2DSV A;  2KGJ A;  4WIW A;  2XP9 A;  1TFV A;  3O5P A;  2KI3 A;  4ODM A;  4WKF A;  3KZ7 A;  3ODK A;  1H0I A;  1JNT A;  4DRJ A;  1VF8 A;  1ZL1 A;  2OFN A;  1NWT A;  4DWS A;  3NTP A;  4MPK A;  2DT1 A;  2WLY A;  4JFL A;  2RUD A;  4G50 A;  4NSB A;  1KFW A;  2DT2 A;  2F2D A;  4TYO A;  3O5D A;  2XP7 A;  4JFJ A;  2AOS A;  4TW7 A;  4AY1 A;  2M08 A;  4P8W A;  1NMV A;  4S3K A;  5HTG A;  1BKF A;  3FY1 A;  2XP8 A;  4WJX A;  1FKF A;  4LGX A;  1E6P A;  4PTM A;  3PR9 A;  1FKT A;  2F21 A;  3RM4 A;  3O5K A;  4KQZ A;  5GPR A;  5HW7 A;  4QZV B;  2O9O A;  3WH0 A;  1EDQ A;  3TCZ A;  2PPP A;  1Q6U A;  2A3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...