1Q1CA

Crystal structure of n(1-260) of human fkbp52
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
237
structure length
237
Chain Sequence
EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D structure of human FK506-binding protein 52: Implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 4
total genus 58
structure length 237
sequence length 237
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1q1cA02
1T11A 4N19A 2XP4A 4DRKA 2KR7A 2RQSA 2KO7A 1NMWA 2MLZA 2PV2A 3O5IA 3PA7A 2MLYA 2DG9A 3TDBA 4IQCA 4U86A 1HXVA 2KE0A 1FKTA 1FAPA 2XP7A 2N87A 4J4NA 3TC5A 2RSEA 3WH0A 2IF4A 2UZ5A 1FKDA 2Q5AA 1B6CA 4ODKA 2LKNA 3NRKA 5BXJA 4TX0A 2PPPA 3O5RA 2M08A 2F21A 2AWGA 1KT1A 2ITKA 2L2SA 2LGOA 2VCDA 3UQIA 5HWBA 1JNSA 2ZQSA 1FKFA 4ITZA 4DT4A 1FKKA 4W9QA 1JNTA 1YATA 3I6CA 4MGVA 4W9OA 5HWCA 4ODNA 4NNRA 1TCOC 4ODLA 2PV1A 1Q6IA 1ZCNA 4DRPA 3KAHA 1NMVA 3NI6A 1J6YA 2FAPA 3KCEA 2ZQTA 3O5FA 1D7JA 1FD9A 3JYMA 2PPOA 5I98A 4IQ2A 1J4HA 1JVWA 4LAWA 2MLXA 4GGQA 2RURA 4G50A 3IHZA 5HW7A 1FKSA 1FKIA 3KAFA 3KABA 5DIVA 1W26A 2KFWA 4DH0A 3VAWA 3UI6A 1BKFA 3UF8A 2XP6A 4BF8A 1Y0OA 2D9FA 3OOBA 4U84A 2M2AA 3KACA 2F2DA 3GPKA 1Q6HA 1BL4A 4JFJA 2ZQUA 4GIVA 5HW8A 3NTPA 4LAVA 1F40A 1FKBA 3IKGA 2KI3A 2KGJA 1ROTA 2M1IA 4DRJA 3UQAA 1R9HA 2DG3A 2MNTA 4FAPA 3IK8A 1L1PA 4JYSA 4DRQA 4ODPA 3UQBA 3IKDA 1YW5A 1P5QA 2PV3A 2XPAA 2XPBA 3B7XA 1N1AA 1ROUA 1D6OA 3KAIA 2XP8A 4FN2A 2ZR5A 1FKJA 1F8AB 2RUDA 3LUOA 3O5MA 4JFLA 1NSGA 2XP9A 4QT2A 5DIUA 4DIPA 2VN1A 2LJ4A 1M5YA 4DRNA 1J4RA 3CGNA 3KADA 4JFIA 2Y78A 2K8IA 4JFMA 2RUQA 3PRDA 1KT0A 4ODRA 4TW8A 3UI4A 2JZVA 1FKGA 3TCZA 4DRMA 4G2PA 3FAPA 3UI5A 1EQ3A 2DG4A 4DRHA 1EYMA 1QPFA 2FKEA 1QZ2A 2MF9A 4TW7A 1Q6UA 3O5QA 4TNSA 1FJDA 3H9RB 1FKRA 3ODKA 1A7XA 2XP5A 1D7IA 3O5PA 4QT3A 4DZ2A 3JYJA 2PBCA 3MDYB 4QIBA 1D7HA 5HUAA 4LAXA 4ODOA 5DITA 3KZ7A 1PINA 4U85A 2LPVA 1FKHA 1FKLA 2MPHA 2ZR6A 1C9HA 3KAGA 4TW6A 3O5OA 1PBKA 5D75A 2RUCA 4LAYA 4ODQA 4JFKA 1QPLA 4IPXA 1ZK6A 2ZR4A 3O5DA 3O5GA 4MSPA 4DROA 4TYOA 4ODMA 3RFWA 1U79A 3O5EA 3EY6A 2PPNA 3O5KA 3PRBA 4O2TA 3O5JA 5B8IC 4DRIA 4J4OA 5GPGA 5HW6A 3CGMA 2OFNA 1J4IA 1Q1CA 3JXVA 4C02B 4W9PA 3RGCA 5HTGA 5J6EA 2F4EA 3O5LA 2XP3A 2ZQVA 4DZ3A 5HT1A 5HKGA 4R0XA
chains in the Genus database with same CATH superfamily
4N19A 2G8ZA 3WL1A 3AROA 2KR7A 2RQSA 2PV2A 3B9DA 2MLYA 3TDBA 2A3BA 3AS3A 1UR8A 3CHCA 2XP7A 2RSEA 3B8SA 3CHEA 1FKDA 1B6CA 4MNLA 2PPPA 4TX0A 1ZBVA 1O6IA 1TFVA 1KT1A 2ITKA 4QZVB 5HWBA 1JNSA 2ZQSA 4ITZA 2YBTA 1FKKA 4W9QA 2O9OA 1YATA 1XRVA 1TCOC 4ODLA 2PV1A 2FDMA 1LL4A 3O5FA 1E9LA 1J4HA 4LGXA 3PRAA 2MLXA 4GGQA 3WKZA 2RURA 3RM8A 1FKSA 3CZ8A 2WK2A 1W26A 1BKFA 3ARUA 1GOIA 3UF8A 2XP6A 4BF8A 4IT4A 3KACA 1OGBA 1ZU8A 3GU0A 3ARYA 1F40A 4ZS6A 3UQAA 4WKFA 2M1IA 4DRJA 2DG3A 2MNTA 4PTMA 4DWSB 4WIWA 4IT6A 4DRQA 2A3AA 3B7XA 2XP8A 3WD1A 2RUDA 1FFRA 2XP9A 4QT2A 4WJXA 2DT0A 3ARVA 4JFIA 1H0GA 5DEZA 3UI5A 4MPKA 2DG4A 4DRHA 2B5UB 4DWSA 1W9VA 1Q6UA 1FKRA 3ODKA 1D7IA 2DT1A 4QT3A 5GQBA 1JNDA 2PBCA 1D7HA 4ODOA 5DITA 4U85A 2LPVA 3O5OA 1PBKA 1CTNA 2RUCA 4LAYA 2ETNA 1ZK6A 3BXWA 2ZR4A 3O5DA 4O2TA 3O5JA 1SR0A 4J4OA 3RMEA 2G41A 3GTYX 1NWSA 3JXVA 4W9PA 3RGCA 3W4RA 5J6EA 2XP3A 2ZQVA 3ALGA 4Z2IA 2XP4A 5GPRA 2KO7A 3PA7A 3WL0A 2KE0A 2ESCA 1ZBCA 4P8VA 1W1TA 4J4NA 3TC5A 3ARWA 1IX5A 2IF4A 5HBFA 4URIA 4ZPTR 2AOSA 1E6PA 2YBUA 2VCDA 3UQIA 3AS2A 4DWSD 1X6LA 4DT4A 4MGVA 4WK9A 1Q6IA 1NMVA 4HARA 4KQZA 1HJXA 2ZQTA 3RM9A 1FD9A 3WD2A 1ITXA 4IQ2A 4LAWA 4G50A 4ZPWR 5HW7A 3KABA 1NWRA 2KFWA 2WLZA 1E44A 1Y0OA 2D9FA 3ARSA 1ZBWA 4U84A 2M2AA 4Q22A 4JFJA 5HW8A 2ZQUA 2KI3A 2KGJA 2O92A 1H0IA 1R9HA 4L72B 2PV3A 2XPBA 4FN2A 4ODNA 4JFLA 3O5MA 4MNJA 4DIPA 1M5YA 3KADA 3UI4A 3AQUA 2RUQA 5DO2A 1KT0A 2JZVA 1FKGA 1X6NA 4HBOA 1QPFA 2MF9A 3ARZA 2A3CA 4TNSA 1FJDA 1A7XA 1W1VA 1HJVA 1UR9A 1WAWA 3ARTA 3MDYB 4QIBA 3AS0A 1GPFA 4Q7NA 4LAXA 1PINA 1ZBKA 1L1PA 2DSVA 3FXYA 4TW6A 1C9HA 4WKAA 4Z2HA 4S3KA 3CHFA 4Z2GA 1XHGA 4MSPA 4DROA 4DWSC 1LQ0A 2PPNA 3PRBA 2B31A 1NWTA 4DRIA 3CGMA 4NZCA 5HTGA 3WD3A 4DZ3A 3FY1A 5HT1A 1FFQA 1T11A 1HKKA 1NMWA 2MLZA 4MNMA 2DG9A 4IQCA 4U86A 3OA5A 3CH9A 1FAPA 3RM4A 2N87A 3WH0A 2PI6A 2UZ5A 2P4VA 4ODKA 2LKNA 3O5RA 2M08A 2AWGA 2LGOA 1D2KA 2WM0A 3I6CA 1RD6A 4P8XA 3KAHA 1LJYA 3NI6A 1J6YA 2EULA 1EIBA 3KCEA 4HBEA 1JCHB 1D7JA 3G6MA 2PPOA 2A3EA 2DSWA 1VF8A 3IHZA 5DIVA 3VAWA 2OLHA 1W9UA 3G6LA 3GPKA 1Q6HA 4GIVA 3ARXA 1FKBA 3IKGA 1ROTA 1LG2A 3IK8A 4S3JA 4JYSA 3WIJA 3WQVA 1P5QA 2XPAA 5HWCA 1N1AA 1ROUA 1D6OA 4FAPA 3WD4A 1FKJA 5DF0A 2VN1A 4DRNA 3CGNA 2Y78A 4NSBA 4TW8A 4ODRA 3PRDA 3TCZA 4XAKA 4R5EA 1QZ2A 1OGGA 2F23A 3O5QA 3JYJA 1W1YA 3KZ7A 1FKLA 2MPHA 5D75A 2IUZA 4JFKA 4IPXA 3WD0A 1HKMA 4Z2LA 1U79A 3O5EA 3EY6A 2DSUA 1E6NA 3EIPA 1W9PA 5GPGA 5HW6A 1WB0A 2WLYA 4P8UA 4ML4A 1J4IA 3PR9A 1LL6A 4C02B 3QOKA 2F4EA 2DPEA 3ALFA 4Z2JA 2QF8A 5HKGA 4R0XA 1E6ZA 4DRKA 1K9TA 1SYTA 3O5IA 1GUVA 1HXVA 1FKTA 1WNOA 3B9AA 3BMBA 2Q5AA 2PN0A 3WQWA 3NRKA 5BXJA 3ARRA 2F21A 3CHDA 1OWQA 2L2SA 1KFWA 1NWUA 1FKFA 1JNTA 4W9OA 1HKIA 4NNRA 1ZCNA 4DRPA 1HJWA 3ARQA 2FAPA 1E15A 2DT3A 3JYMA 5I98A 1JVWA 1E6RA 3AS1A 1FKIA 3KAFA 4DH0A 3UI6A 3ARPA 4AY1A 1EHNA 3OOBA 1ZL1A 4MAVA 4P8WA 2F2DA 1W1PA 1BL4A 3NTPA 4LAVA 3B9EA 1LL7A 1EDQA 4ODPA 3UQBA 3IKDA 1YW5A 1HKJA 3KAIA 2ZR5A 3LUOA 1F8AB 5DIUA 1JNEA 1NSGA 2LJ4A 1J4RA 4JFMA 2DT2A 2K8IA 4MTVA 4KR0B 4DRMA 4G2PA 3FAPA 4L3NA 1EQ3A 4ZPVR 1LG1A 1EYMA 2FKEA 4TW7A 3H9RB 2XP5A 3O5PA 4DZ2A 4WKHA 5HUAA 1FKHA 2ZR6A 3KAGA 2DSZA 1NH6A 4ODQA 4W5UA 1QPLA 1GRJA 3O5GA 4TYOA 4ODMA 3RFWA 3O5KA 4UDMA 5B8IC 2OFNA 1Q1CA 4MNKA 1ZB5A 3O5LA 4Z2KA 5JH8A
chains in the Genus database with same CATH topology
4N19A 2G8ZA 3WL1A 3AROA 2KR7A 2RQSA 2PV2A 3B9DA 2MLYA 3TDBA 2A3BA 3AS3A 1UR8A 3CHCA 2XP7A 2RSEA 3B8SA 3CHEA 1FKDA 1B6CA 4MNLA 2PPPA 4TX0A 1ZBVA 1O6IA 1TFVA 1KT1A 2ITKA 4QZVB 5HWBA 1JNSA 2ZQSA 4ITZA 2YBTA 1FKKA 4W9QA 2O9OA 1YATA 1XRVA 1TCOC 4ODLA 2PV1A 2FDMA 1LL4A 3O5FA 1E9LA 1J4HA 4LGXA 3PRAA 2MLXA 4GGQA 3WKZA 2RURA 3RM8A 1FKSA 3CZ8A 2WK2A 1W26A 1BKFA 3ARUA 1GOIA 3UF8A 2XP6A 4BF8A 4IT4A 3KACA 1OGBA 1ZU8A 3ARYA 1F40A 4ZS6A 3UQAA 4WKFA 2M1IA 4DRJA 2DG3A 2MNTA 4PTMA 4DWSB 4WIWA 4IT6A 4DRQA 2A3AA 3B7XA 2XP8A 3WD1A 2RUDA 1FFRA 2XP9A 4QT2A 4WJXA 2DT0A 3ARVA 4JFIA 1H0GA 5DEZA 3UI5A 4MPKA 2DG4A 4DRHA 4DWSA 1W9VA 1Q6UA 1FKRA 3ODKA 1D7IA 2DT1A 4QT3A 5GQBA 1JNDA 2PBCA 1D7HA 4ODOA 5DITA 4U85A 2LPVA 3O5OA 1PBKA 1CTNA 2RUCA 4LAYA 1ZK6A 3BXWA 2ZR4A 3O5DA 4O2TA 3O5JA 1SR0A 4J4OA 3RMEA 2G41A 1NWSA 3JXVA 4W9PA 3RGCA 3W4RA 5J6EA 2XP3A 2ZQVA 3ALGA 4Z2IA 2XP4A 5GPRA 2KO7A 3PA7A 3WL0A 2KE0A 2ESCA 1ZBCA 4P8VA 1W1TA 4J4NA 3TC5A 3ARWA 1IX5A 2IF4A 5HBFA 4URIA 4ZPTR 2AOSA 1E6PA 2YBUA 2VCDA 3UQIA 3AS2A 4DWSD 1X6LA 4DT4A 4MGVA 4WK9A 1Q6IA 1NMVA 4HARA 4KQZA 1HJXA 2ZQTA 3RM9A 1FD9A 3WD2A 1ITXA 4IQ2A 4LAWA 4G50A 4ZPWR 5HW7A 3KABA 1NWRA 2KFWA 2WLZA 1Y0OA 2D9FA 3ARSA 1ZBWA 4U84A 2M2AA 4Q22A 4JFJA 5HW8A 2ZQUA 2KI3A 2KGJA 2O92A 1H0IA 1R9HA 4L72B 2PV3A 2XPBA 4FN2A 4ODNA 4JFLA 3O5MA 4MNJA 4DIPA 1M5YA 3KADA 3UI4A 3AQUA 2RUQA 5DO2A 1KT0A 2JZVA 1FKGA 1X6NA 4HBOA 1QPFA 2MF9A 3ARZA 2A3CA 4TNSA 1FJDA 1A7XA 1W1VA 1HJVA 1UR9A 1WAWA 3ARTA 3MDYB 4QIBA 3AS0A 1GPFA 4Q7NA 4LAXA 1PINA 1ZBKA 1L1PA 2DSVA 3FXYA 4TW6A 1C9HA 4WKAA 4Z2HA 4S3KA 3CHFA 4Z2GA 1XHGA 4MSPA 4DROA 4DWSC 1LQ0A 2PPNA 3PRBA 2B31A 1NWTA 4DRIA 3CGMA 4NZCA 5HTGA 3WD3A 4DZ3A 3FY1A 5HT1A 1FFQA 1T11A 1HKKA 1NMWA 2MLZA 4MNMA 2DG9A 4IQCA 4U86A 3OA5A 3CH9A 1FAPA 3RM4A 2N87A 3WH0A 2PI6A 2UZ5A 4ODKA 2LKNA 3O5RA 2M08A 2AWGA 2LGOA 1D2KA 2WM0A 3I6CA 1RD6A 4P8XA 3KAHA 1LJYA 3NI6A 1J6YA 1EIBA 3KCEA 4HBEA 1D7JA 3G6MA 2PPOA 2A3EA 2DSWA 1VF8A 3IHZA 5DIVA 3VAWA 2OLHA 1W9UA 3G6LA 3GPKA 1Q6HA 4GIVA 3ARXA 1FKBA 3IKGA 1ROTA 1LG2A 3IK8A 4S3JA 4JYSA 3WIJA 3WQVA 1P5QA 2XPAA 5HWCA 1N1AA 1ROUA 1D6OA 4FAPA 3WD4A 1FKJA 5DF0A 2VN1A 4DRNA 3CGNA 2Y78A 4NSBA 4TW8A 4ODRA 3PRDA 3TCZA 4XAKA 4R5EA 1QZ2A 1OGGA 3O5QA 3JYJA 1W1YA 3KZ7A 1FKLA 2MPHA 5D75A 2IUZA 4JFKA 4IPXA 3WD0A 1HKMA 4Z2LA 1U79A 3O5EA 3EY6A 2DSUA 1E6NA 1W9PA 5GPGA 5HW6A 1WB0A 2WLYA 4P8UA 4ML4A 1J4IA 3PR9A 1LL6A 4C02B 3QOKA 2F4EA 2DPEA 3ALFA 4Z2JA 2QF8A 5HKGA 4R0XA 1E6ZA 4DRKA 1K9TA 1SYTA 3O5IA 1GUVA 1HXVA 1FKTA 1WNOA 3B9AA 2Q5AA 3WQWA 3NRKA 5BXJA 3ARRA 2F21A 3CHDA 1OWQA 2L2SA 1KFWA 1NWUA 1FKFA 1JNTA 4W9OA 1HKIA 4NNRA 1ZCNA 4DRPA 1HJWA 3ARQA 2FAPA 1E15A 2DT3A 3JYMA 5I98A 1JVWA 1E6RA 3AS1A 1FKIA 3KAFA 4DH0A 3UI6A 3ARPA 4AY1A 1EHNA 3OOBA 1ZL1A 4MAVA 4P8WA 2F2DA 1W1PA 1BL4A 3NTPA 4LAVA 3B9EA 1LL7A 1EDQA 4ODPA 3UQBA 3IKDA 1YW5A 1HKJA 3KAIA 2ZR5A 3LUOA 1F8AB 5DIUA 1JNEA 1NSGA 2LJ4A 1J4RA 4JFMA 2DT2A 2K8IA 4MTVA 4KR0B 4DRMA 4G2PA 3FAPA 4L3NA 1EQ3A 4ZPVR 1LG1A 1EYMA 2FKEA 4TW7A 3H9RB 2XP5A 3O5PA 4DZ2A 4WKHA 5HUAA 1FKHA 2ZR6A 3KAGA 2DSZA 1NH6A 4ODQA 4W5UA 1QPLA 3O5GA 4TYOA 4ODMA 3RFWA 3O5KA 5B8IC 2OFNA 1Q1CA 4MNKA 1ZB5A 3O5LA 4Z2KA 5JH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T11 A;  4N19 A;  2XP4 A;  4DRK A;  2KR7 A;  2RQS A;  2KO7 A;  1NMW A;  2MLZ A;  2PV2 A;  3O5I A;  3PA7 A;  2MLY A;  2DG9 A;  3TDB A;  4IQC A;  4U86 A;  1HXV A;  2KE0 A;  1FKT A;  1FAP A;  2XP7 A;  2N87 A;  4J4N A;  3TC5 A;  2RSE A;  3WH0 A;  2IF4 A;  2UZ5 A;  1FKD A;  2Q5A A;  1B6C A;  4ODK A;  2LKN A;  3NRK A;  5BXJ A;  4TX0 A;  2PPP A;  3O5R A;  2M08 A;  2F21 A;  2AWG A;  1KT1 A;  2ITK A;  2L2S A;  2LGO A;  2VCD A;  3UQI A;  5HWB A;  1JNS A;  2ZQS A;  1FKF A;  4ITZ A;  4DT4 A;  1FKK A;  4W9Q A;  1JNT A;  1YAT A;  3I6C A;  4MGV A;  4W9O A;  5HWC A;  4ODN A;  4NNR A;  1TCO C;  4ODL A;  2PV1 A;  1Q6I A;  1ZCN A;  4DRP A;  3KAH A;  1NMV A;  3NI6 A;  1J6Y A;  2FAP A;  3KCE A;  2ZQT A;  3O5F A;  1D7J A;  1FD9 A;  3JYM A;  2PPO A;  5I98 A;  4IQ2 A;  1J4H A;  1JVW A;  4LAW A;  2MLX A;  4GGQ A;  2RUR A;  4G50 A;  3IHZ A;  5HW7 A;  1FKS A;  1FKI A;  3KAF A;  3KAB A;  5DIV A;  1W26 A;  2KFW A;  4DH0 A;  3VAW A;  3UI6 A;  1BKF A;  3UF8 A;  2XP6 A;  4BF8 A;  1Y0O A;  2D9F A;  3OOB A;  4U84 A;  2M2A A;  3KAC A;  2F2D A;  3GPK A;  1Q6H A;  1BL4 A;  4JFJ A;  2ZQU A;  4GIV A;  5HW8 A;  3NTP A;  4LAV A;  1F40 A;  1FKB A;  3IKG A;  2KI3 A;  2KGJ A;  1ROT A;  2M1I A;  4DRJ A;  3UQA A;  1R9H A;  2DG3 A;  2MNT A;  4FAP A;  3IK8 A;  1L1P A;  4JYS A;  4DRQ A;  4ODP A;  3UQB A;  3IKD A;  1YW5 A;  1P5Q A;  2PV3 A;  2XPA A;  2XPB A;  3B7X A;  1N1A A;  1ROU A;  1D6O A;  3KAI A;  2XP8 A;  4FN2 A;  2ZR5 A;  1FKJ A;  1F8A B;  2RUD A;  3LUO A;  3O5M A;  4JFL A;  1NSG A;  2XP9 A;  4QT2 A;  5DIU A;  4DIP A;  2VN1 A;  2LJ4 A;  1M5Y A;  4DRN A;  1J4R A;  3CGN A;  3KAD A;  4JFI A;  2Y78 A;  2K8I A;  4JFM A;  2RUQ A;  3PRD A;  1KT0 A;  4ODR A;  4TW8 A;  3UI4 A;  2JZV A;  1FKG A;  3TCZ A;  4DRM A;  4G2P A;  3FAP A;  3UI5 A;  1EQ3 A;  2DG4 A;  4DRH A;  1EYM A;  1QPF A;  2FKE A;  1QZ2 A;  2MF9 A;  4TW7 A;  1Q6U A;  3O5Q A;  4TNS A;  1FJD A;  3H9R B;  1FKR A;  3ODK A;  1A7X A;  2XP5 A;  1D7I A;  3O5P A;  4QT3 A;  4DZ2 A;  3JYJ A;  2PBC A;  3MDY B;  4QIB A;  1D7H A;  5HUA A;  4LAX A;  4ODO A;  5DIT A;  3KZ7 A;  1PIN A;  4U85 A;  2LPV A;  1FKH A;  1FKL A;  2MPH A;  2ZR6 A;  1C9H A;  3KAG A;  4TW6 A;  3O5O A;  1PBK A;  5D75 A;  2RUC A;  4LAY A;  4ODQ A;  4JFK A;  1QPL A;  4IPX A;  1ZK6 A;  2ZR4 A;  3O5D A;  3O5G A;  4MSP A;  4DRO A;  4TYO A;  4ODM A;  3RFW A;  1U79 A;  3O5E A;  3EY6 A;  2PPN A;  3O5K A;  3PRB A;  4O2T A;  3O5J A;  5B8I C;  4DRI A;  4J4O A;  5GPG A;  5HW6 A;  3CGM A;  2OFN A;  1J4I A;  1Q1C A;  3JXV A;  4C02 B;  4W9P A;  3RGC A;  5HTG A;  5J6E A;  2F4E A;  3O5L A;  2XP3 A;  2ZQV A;  4DZ3 A;  5HT1 A;  5HKG A;  4R0X A; 
#chains in the Genus database with same CATH topology
 4N19 A;  2G8Z A;  3WL1 A;  3ARO A;  2KR7 A;  2RQS A;  2PV2 A;  3B9D A;  2MLY A;  3TDB A;  2A3B A;  3AS3 A;  1UR8 A;  3CHC A;  2XP7 A;  2RSE A;  3B8S A;  3CHE A;  1FKD A;  1B6C A;  4MNL A;  2PPP A;  4TX0 A;  1ZBV A;  1O6I A;  1TFV A;  1KT1 A;  2ITK A;  4QZV B;  5HWB A;  1JNS A;  2ZQS A;  4ITZ A;  2YBT A;  1FKK A;  4W9Q A;  2O9O A;  1YAT A;  1XRV A;  1TCO C;  4ODL A;  2PV1 A;  2FDM A;  1LL4 A;  3O5F A;  1E9L A;  1J4H A;  4LGX A;  3PRA A;  2MLX A;  4GGQ A;  3WKZ A;  2RUR A;  3RM8 A;  1FKS A;  3CZ8 A;  2WK2 A;  1W26 A;  1BKF A;  3ARU A;  1GOI A;  3UF8 A;  2XP6 A;  4BF8 A;  4IT4 A;  3KAC A;  1OGB A;  1ZU8 A;  3GU0 A;  3ARY A;  1F40 A;  4ZS6 A;  3UQA A;  4WKF A;  2M1I A;  4DRJ A;  2DG3 A;  2MNT A;  4PTM A;  4DWS B;  4WIW A;  4IT6 A;  4DRQ A;  2A3A A;  3B7X A;  2XP8 A;  3WD1 A;  2RUD A;  1FFR A;  2XP9 A;  4QT2 A;  4WJX A;  2DT0 A;  3ARV A;  4JFI A;  1H0G A;  5DEZ A;  3UI5 A;  4MPK A;  2DG4 A;  4DRH A;  2B5U B;  4DWS A;  1W9V A;  1Q6U A;  1FKR A;  3ODK A;  1D7I A;  2DT1 A;  4QT3 A;  5GQB A;  1JND A;  2PBC A;  1D7H A;  4ODO A;  5DIT A;  4U85 A;  2LPV A;  3O5O A;  1PBK A;  1CTN A;  2RUC A;  4LAY A;  2ETN A;  1ZK6 A;  3BXW A;  2ZR4 A;  3O5D A;  4O2T A;  3O5J A;  1SR0 A;  4J4O A;  3RME A;  2G41 A;  3GTY X;  1NWS A;  3JXV A;  4W9P A;  3RGC A;  3W4R A;  5J6E A;  2XP3 A;  2ZQV A;  3ALG A;  4Z2I A;  2XP4 A;  5GPR A;  2KO7 A;  3PA7 A;  3WL0 A;  2KE0 A;  2ESC A;  1ZBC A;  4P8V A;  1W1T A;  4J4N A;  3TC5 A;  3ARW A;  1IX5 A;  2IF4 A;  5HBF A;  4URI A;  4ZPT R;  2AOS A;  1E6P A;  2YBU A;  2VCD A;  3UQI A;  3AS2 A;  4DWS D;  1X6L A;  4DT4 A;  4MGV A;  4WK9 A;  1Q6I A;  1NMV A;  4HAR A;  4KQZ A;  1HJX A;  2ZQT A;  3RM9 A;  1FD9 A;  3WD2 A;  1ITX A;  4IQ2 A;  4LAW A;  4G50 A;  4ZPW R;  5HW7 A;  3KAB A;  1NWR A;  2KFW A;  2WLZ A;  1E44 A;  1Y0O A;  2D9F A;  3ARS A;  1ZBW A;  4U84 A;  2M2A A;  4Q22 A;  4JFJ A;  5HW8 A;  2ZQU A;  2KI3 A;  2KGJ A;  2O92 A;  1H0I A;  1R9H A;  4L72 B;  2PV3 A;  2XPB A;  4FN2 A;  4ODN A;  4JFL A;  3O5M A;  4MNJ A;  4DIP A;  1M5Y A;  3KAD A;  3UI4 A;  3AQU A;  2RUQ A;  5DO2 A;  1KT0 A;  2JZV A;  1FKG A;  1X6N A;  4HBO A;  1QPF A;  2MF9 A;  3ARZ A;  2A3C A;  4TNS A;  1FJD A;  1A7X A;  1W1V A;  1HJV A;  1UR9 A;  1WAW A;  3ART A;  3MDY B;  4QIB A;  3AS0 A;  1GPF A;  4Q7N A;  4LAX A;  1PIN A;  1ZBK A;  1L1P A;  2DSV A;  3FXY A;  4TW6 A;  1C9H A;  4WKA A;  4Z2H A;  4S3K A;  3CHF A;  4Z2G A;  1XHG A;  4MSP A;  4DRO A;  4DWS C;  1LQ0 A;  2PPN A;  3PRB A;  2B31 A;  1NWT A;  4DRI A;  3CGM A;  4NZC A;  5HTG A;  3WD3 A;  4DZ3 A;  3FY1 A;  5HT1 A;  1FFQ A;  1T11 A;  1HKK A;  1NMW A;  2MLZ A;  4MNM A;  2DG9 A;  4IQC A;  4U86 A;  3OA5 A;  3CH9 A;  1FAP A;  3RM4 A;  2N87 A;  3WH0 A;  2PI6 A;  2UZ5 A;  2P4V A;  4ODK A;  2LKN A;  3O5R A;  2M08 A;  2AWG A;  2LGO A;  1D2K A;  2WM0 A;  3I6C A;  1RD6 A;  4P8X A;  3KAH A;  1LJY A;  3NI6 A;  1J6Y A;  2EUL A;  1EIB A;  3KCE A;  4HBE A;  1JCH B;  1D7J A;  3G6M A;  2PPO A;  2A3E A;  2DSW A;  1VF8 A;  3IHZ A;  5DIV A;  3VAW A;  2OLH A;  1W9U A;  3G6L A;  3GPK A;  1Q6H A;  4GIV A;  3ARX A;  1FKB A;  3IKG A;  1ROT A;  1LG2 A;  3IK8 A;  4S3J A;  4JYS A;  3WIJ A;  3WQV A;  1P5Q A;  2XPA A;  5HWC A;  1N1A A;  1ROU A;  1D6O A;  4FAP A;  3WD4 A;  1FKJ A;  5DF0 A;  2VN1 A;  4DRN A;  3CGN A;  2Y78 A;  4NSB A;  4TW8 A;  4ODR A;  3PRD A;  3TCZ A;  4XAK A;  4R5E A;  1QZ2 A;  1OGG A;  2F23 A;  3O5Q A;  3JYJ A;  1W1Y A;  3KZ7 A;  1FKL A;  2MPH A;  5D75 A;  2IUZ A;  4JFK A;  4IPX A;  3WD0 A;  1HKM A;  4Z2L A;  1U79 A;  3O5E A;  3EY6 A;  2DSU A;  1E6N A;  3EIP A;  1W9P A;  5GPG A;  5HW6 A;  1WB0 A;  2WLY A;  4P8U A;  4ML4 A;  1J4I A;  3PR9 A;  1LL6 A;  4C02 B;  3QOK A;  2F4E A;  2DPE A;  3ALF A;  4Z2J A;  2QF8 A;  5HKG A;  4R0X A;  1E6Z A;  4DRK A;  1K9T A;  1SYT A;  3O5I A;  1GUV A;  1HXV A;  1FKT A;  1WNO A;  3B9A A;  3BMB A;  2Q5A A;  2PN0 A;  3WQW A;  3NRK A;  5BXJ A;  3ARR A;  2F21 A;  3CHD A;  1OWQ A;  2L2S A;  1KFW A;  1NWU A;  1FKF A;  1JNT A;  4W9O A;  1HKI A;  4NNR A;  1ZCN A;  4DRP A;  1HJW A;  3ARQ A;  2FAP A;  1E15 A;  2DT3 A;  3JYM A;  5I98 A;  1JVW A;  1E6R A;  3AS1 A;  1FKI A;  3KAF A;  4DH0 A;  3UI6 A;  3ARP A;  4AY1 A;  1EHN A;  3OOB A;  1ZL1 A;  4MAV A;  4P8W A;  2F2D A;  1W1P A;  1BL4 A;  3NTP A;  4LAV A;  3B9E A;  1LL7 A;  1EDQ A;  4ODP A;  3UQB A;  3IKD A;  1YW5 A;  1HKJ A;  3KAI A;  2ZR5 A;  3LUO A;  1F8A B;  5DIU A;  1JNE A;  1NSG A;  2LJ4 A;  1J4R A;  4JFM A;  2DT2 A;  2K8I A;  4MTV A;  4KR0 B;  4DRM A;  4G2P A;  3FAP A;  4L3N A;  1EQ3 A;  4ZPV R;  1LG1 A;  1EYM A;  2FKE A;  4TW7 A;  3H9R B;  2XP5 A;  3O5P A;  4DZ2 A;  4WKH A;  5HUA A;  1FKH A;  2ZR6 A;  3KAG A;  2DSZ A;  1NH6 A;  4ODQ A;  4W5U A;  1QPL A;  1GRJ A;  3O5G A;  4TYO A;  4ODM A;  3RFW A;  3O5K A;  4UDM A;  5B8I C;  2OFN A;  1Q1C A;  4MNK A;  1ZB5 A;  3O5L A;  4Z2K A;  5JH8 A; 
#chains in the Genus database with same CATH homology
 4N19 A;  2G8Z A;  3WL1 A;  3ARO A;  2KR7 A;  2RQS A;  2PV2 A;  3B9D A;  2MLY A;  3TDB A;  2A3B A;  3AS3 A;  1UR8 A;  3CHC A;  2XP7 A;  2RSE A;  3B8S A;  3CHE A;  1FKD A;  1B6C A;  4MNL A;  2PPP A;  4TX0 A;  1ZBV A;  1O6I A;  1TFV A;  1KT1 A;  2ITK A;  4QZV B;  5HWB A;  1JNS A;  2ZQS A;  4ITZ A;  2YBT A;  1FKK A;  4W9Q A;  2O9O A;  1YAT A;  1XRV A;  1TCO C;  4ODL A;  2PV1 A;  2FDM A;  1LL4 A;  3O5F A;  1E9L A;  1J4H A;  4LGX A;  3PRA A;  2MLX A;  4GGQ A;  3WKZ A;  2RUR A;  3RM8 A;  1FKS A;  3CZ8 A;  2WK2 A;  1W26 A;  1BKF A;  3ARU A;  1GOI A;  3UF8 A;  2XP6 A;  4BF8 A;  4IT4 A;  3KAC A;  1OGB A;  1ZU8 A;  3ARY A;  1F40 A;  4ZS6 A;  3UQA A;  4WKF A;  2M1I A;  4DRJ A;  2DG3 A;  2MNT A;  4PTM A;  4DWS B;  4WIW A;  4IT6 A;  4DRQ A;  2A3A A;  3B7X A;  2XP8 A;  3WD1 A;  2RUD A;  1FFR A;  2XP9 A;  4QT2 A;  4WJX A;  2DT0 A;  3ARV A;  4JFI A;  1H0G A;  5DEZ A;  3UI5 A;  4MPK A;  2DG4 A;  4DRH A;  4DWS A;  1W9V A;  1Q6U A;  1FKR A;  3ODK A;  1D7I A;  2DT1 A;  4QT3 A;  5GQB A;  1JND A;  2PBC A;  1D7H A;  4ODO A;  5DIT A;  4U85 A;  2LPV A;  3O5O A;  1PBK A;  1CTN A;  2RUC A;  4LAY A;  1ZK6 A;  3BXW A;  2ZR4 A;  3O5D A;  4O2T A;  3O5J A;  1SR0 A;  4J4O A;  3RME A;  2G41 A;  1NWS A;  3JXV A;  4W9P A;  3RGC A;  3W4R A;  5J6E A;  2XP3 A;  2ZQV A;  3ALG A;  4Z2I A;  2XP4 A;  5GPR A;  2KO7 A;  3PA7 A;  3WL0 A;  2KE0 A;  2ESC A;  1ZBC A;  4P8V A;  1W1T A;  4J4N A;  3TC5 A;  3ARW A;  1IX5 A;  2IF4 A;  5HBF A;  4URI A;  4ZPT R;  2AOS A;  1E6P A;  2YBU A;  2VCD A;  3UQI A;  3AS2 A;  4DWS D;  1X6L A;  4DT4 A;  4MGV A;  4WK9 A;  1Q6I A;  1NMV A;  4HAR A;  4KQZ A;  1HJX A;  2ZQT A;  3RM9 A;  1FD9 A;  3WD2 A;  1ITX A;  4IQ2 A;  4LAW A;  4G50 A;  4ZPW R;  5HW7 A;  3KAB A;  1NWR A;  2KFW A;  2WLZ A;  1Y0O A;  2D9F A;  3ARS A;  1ZBW A;  4U84 A;  2M2A A;  4Q22 A;  4JFJ A;  5HW8 A;  2ZQU A;  2KI3 A;  2KGJ A;  2O92 A;  1H0I A;  1R9H A;  4L72 B;  2PV3 A;  2XPB A;  4FN2 A;  4ODN A;  4JFL A;  3O5M A;  4MNJ A;  4DIP A;  1M5Y A;  3KAD A;  3UI4 A;  3AQU A;  2RUQ A;  5DO2 A;  1KT0 A;  2JZV A;  1FKG A;  1X6N A;  4HBO A;  1QPF A;  2MF9 A;  3ARZ A;  2A3C A;  4TNS A;  1FJD A;  1A7X A;  1W1V A;  1HJV A;  1UR9 A;  1WAW A;  3ART A;  3MDY B;  4QIB A;  3AS0 A;  1GPF A;  4Q7N A;  4LAX A;  1PIN A;  1ZBK A;  1L1P A;  2DSV A;  3FXY A;  4TW6 A;  1C9H A;  4WKA A;  4Z2H A;  4S3K A;  3CHF A;  4Z2G A;  1XHG A;  4MSP A;  4DRO A;  4DWS C;  1LQ0 A;  2PPN A;  3PRB A;  2B31 A;  1NWT A;  4DRI A;  3CGM A;  4NZC A;  5HTG A;  3WD3 A;  4DZ3 A;  3FY1 A;  5HT1 A;  1FFQ A;  1T11 A;  1HKK A;  1NMW A;  2MLZ A;  4MNM A;  2DG9 A;  4IQC A;  4U86 A;  3OA5 A;  3CH9 A;  1FAP A;  3RM4 A;  2N87 A;  3WH0 A;  2PI6 A;  2UZ5 A;  4ODK A;  2LKN A;  3O5R A;  2M08 A;  2AWG A;  2LGO A;  1D2K A;  2WM0 A;  3I6C A;  1RD6 A;  4P8X A;  3KAH A;  1LJY A;  3NI6 A;  1J6Y A;  1EIB A;  3KCE A;  4HBE A;  1D7J A;  3G6M A;  2PPO A;  2A3E A;  2DSW A;  1VF8 A;  3IHZ A;  5DIV A;  3VAW A;  2OLH A;  1W9U A;  3G6L A;  3GPK A;  1Q6H A;  4GIV A;  3ARX A;  1FKB A;  3IKG A;  1ROT A;  1LG2 A;  3IK8 A;  4S3J A;  4JYS A;  3WIJ A;  3WQV A;  1P5Q A;  2XPA A;  5HWC A;  1N1A A;  1ROU A;  1D6O A;  4FAP A;  3WD4 A;  1FKJ A;  5DF0 A;  2VN1 A;  4DRN A;  3CGN A;  2Y78 A;  4NSB A;  4TW8 A;  4ODR A;  3PRD A;  3TCZ A;  4XAK A;  4R5E A;  1QZ2 A;  1OGG A;  3O5Q A;  3JYJ A;  1W1Y A;  3KZ7 A;  1FKL A;  2MPH A;  5D75 A;  2IUZ A;  4JFK A;  4IPX A;  3WD0 A;  1HKM A;  4Z2L A;  1U79 A;  3O5E A;  3EY6 A;  2DSU A;  1E6N A;  1W9P A;  5GPG A;  5HW6 A;  1WB0 A;  2WLY A;  4P8U A;  4ML4 A;  1J4I A;  3PR9 A;  1LL6 A;  4C02 B;  3QOK A;  2F4E A;  2DPE A;  3ALF A;  4Z2J A;  2QF8 A;  5HKG A;  4R0X A;  1E6Z A;  4DRK A;  1K9T A;  1SYT A;  3O5I A;  1GUV A;  1HXV A;  1FKT A;  1WNO A;  3B9A A;  2Q5A A;  3WQW A;  3NRK A;  5BXJ A;  3ARR A;  2F21 A;  3CHD A;  1OWQ A;  2L2S A;  1KFW A;  1NWU A;  1FKF A;  1JNT A;  4W9O A;  1HKI A;  4NNR A;  1ZCN A;  4DRP A;  1HJW A;  3ARQ A;  2FAP A;  1E15 A;  2DT3 A;  3JYM A;  5I98 A;  1JVW A;  1E6R A;  3AS1 A;  1FKI A;  3KAF A;  4DH0 A;  3UI6 A;  3ARP A;  4AY1 A;  1EHN A;  3OOB A;  1ZL1 A;  4MAV A;  4P8W A;  2F2D A;  1W1P A;  1BL4 A;  3NTP A;  4LAV A;  3B9E A;  1LL7 A;  1EDQ A;  4ODP A;  3UQB A;  3IKD A;  1YW5 A;  1HKJ A;  3KAI A;  2ZR5 A;  3LUO A;  1F8A B;  5DIU A;  1JNE A;  1NSG A;  2LJ4 A;  1J4R A;  4JFM A;  2DT2 A;  2K8I A;  4MTV A;  4KR0 B;  4DRM A;  4G2P A;  3FAP A;  4L3N A;  1EQ3 A;  4ZPV R;  1LG1 A;  1EYM A;  2FKE A;  4TW7 A;  3H9R B;  2XP5 A;  3O5P A;  4DZ2 A;  4WKH A;  5HUA A;  1FKH A;  2ZR6 A;  3KAG A;  2DSZ A;  1NH6 A;  4ODQ A;  4W5U A;  1QPL A;  3O5G A;  4TYO A;  4ODM A;  3RFW A;  3O5K A;  5B8I C;  2OFN A;  1Q1C A;  4MNK A;  1ZB5 A;  3O5L A;  4Z2K A;  5JH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...