3RM8A

Amcase in complex with compound 2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
total genus 133
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm8A01
3CUIA 2EBNA 5AC5A 2JF7A 1K9FA 4AZCA 1XHGA 4UFMA 3THCA 4V2XA 1HP4A 3AXHA 2XIIA 5BXTA 2OLHA 2XFYA 1HP5A 1K6AA 3ARQA 1J18A 1GVIA 1V0KA 2WKGA 2BY3A 3WQ6A 4AIOA 3AMLA 1W2PA 3VGHA 4PBGA 3ZQ9A 1B0IA 3KE0A 1WKYA 4PTMA 3WL0A 1XH2A 2XYLA 2D1ZA 3WN6A 1B3XA 4EKJA 1K9TA 3ARXA 1W9UA 3PTQA 3SCVA 1I1XA 3WQ4A 1GHRA 4AW7A 1RD6A 1OD8A 1KQZA 5E9AA 1QBAA 4B3LA 3WD4A 3K8MA 2CYGA 1UA3A 5ECUA 2G41A 1MYRA 2WZIA 1JZ7A 1XD0A 4DWSC 4X0NA 4P7QA 4D6JA 4GO9A 3K46A 4XV0A 3MV11 1H0GA 4W93A 3VO0A 1GOOA 2PB1A 3W82A 3WF2A 3W0KA 4LGXA 3TP4A 3N1AA 4H8UA 5EFDA 4AD3A 3LPGA 5A3HA 4AZ5A 1UWTA 1ESWA 4GI8A 4AD1A 2A3HA 3UR8A 3WF1A 1M7XA 2JEPA 4D6HA 3RILA 4YHEA 2YJQA 4BZYA 2VX5A 1HJQA 1L0PA 3IJ9A 2WHJA 3WNLA 3RO8A 5A69A 1GQIA 2J8GA 3SCWA 3WIJA 2BY0A 1LG1A 1MQQA 2J7DA 3AFBA 2XFFA 5D9PA 3ARYA 2BHZA 1W91A 1UR0A 2WMIA 5DEZA 3OGSA 3WUBA 1VRXA 3ARTA 4PMUA 3UR7A 4JHZA 3WMSA 1A47A 1KQYA 1B1YA 1QOXA 3K4AA 1OIFA 2WWDA 1EOMA 1GHSA 4EANA 1CBGA 1HNYA 4CCEA 3MUY1 4UQCA 4GO8A 3ARWA 3NUKA 1CXLA 3L4XA 1DWAM 1WCGA 3TONA 4UFKA 2CCRA 5E0FA 1ZBKA 4P8VA 2ZUMA 5M5DA 1QW9A 1CLXA 1LWJA 4AEFA 1E56A 1CZ1A 2EJ1A 1Q6FA 1UWSA 3MMWA 4P8UA 2ZOXA 6CGTA 5A8NA 1E3ZA 5A6AA 4P7NA 1UH4A 2DSWA 1GW1A 2VX6A 4D6GA 5I24A 4URIA 1VFUA 5HBFA 1JI2A 3M7SA 5JIWA 3WEMA 3AHYA 1HL8A 3PN8A 2JFEX 3VIPA 2VUYA 3WD1A 4X0VA 1TFVA 4WK9A 2V3DA 1GPFA 5CJ5A 2DPEA 3CLWA 5D9NA 1E43A 3EBVA 1CXFA 1HL9A 4W88A 1EA9C 4YHGA 1ZJBA 3AHTA 3RDKA 7TAAA 2FGZA 1FP8A 2NSXA 2DSKA 3L4ZA 3VNZA 3OLDA 4D1IA 1B9ZA 5BXRA 4PUDA 1WDSA 5E09A 3APGA 3AZRA 1OINA 2BY2A 4RE4A 3MU7A 1GOWA 3U5YA 4M1RA 4WIWA 4YPJA 5CPTA 1NARA 4TXEA 2PWGA 3VUPA 2ZUVA 5CPQA 4ATWA 2RGMA 3OBAA 1E4MM 2WKLA 3GXDA 4FLQA 4CGTA 1BYAA 1NOWA 4AZGA 2YL6A 3AIRA 4UFHA 4UQAA 4BQ4A 2BXYA 3ZO9A 4AZ7A 3BAXA 4P7OA 3VIJA 4Z2GA 4Z2IA 2QHAA 2JF6A 4JFUA 4W7UA 3SCTA 2Z1KA 5A6KA 1PBGA 4QLJA 1V0NA 3IANA 3PTMA 4PCTA 1MQPA 1E0VA 4AZ6A 4CU8A 2PI6A 2W62A 1B30A 3AIVA 4WKFA 3CHDA 4MTVA 1UZ4A 3AZTA 5CLWA 4U3AA 1HN1A 1BYDA 2WVVB 2WWCA 3RMEA 2VX4A 2CHNA 1EXPA 3OZOA 3WNOA 1HVQA 2XM1A 2VCBA 2O9TA 2JEQA 4DUWA 2UY3A 3UG4A 1WO2A 1CYGA 2E0PA 1GORA 5I78A 2YL8A 1HKJA 4AZCB 5A8OA 1W3KA 2WMGA 2X0HA 5A2AA 4GKLA 4EK7A 3O6AA 3HN3A 1Q6GA 2D3NA 3AHVA 1H3GA 1B2YA 3SIMA 2X0YA 2WAGA 4BF7A 3VX1A 1PEZA 4LYRA 2D0FA 3WUFA 4HTYA 1VEOA 2YDSA 1XV8A 3BSHA 2J74A 4TX8A 2VO5A 4UOQA 3T0BA 1J10A 1HXJA 1QNRA 1V02A 3NDYA 3AS2A 3A3HA 1ODZA 1JXKA 3CMGA 1MW0A 5GQBA 2DH2A 1NWRA 3GNOA 4HPGA 2IXVA 4A3HA 3LMYA 1V08A 2C7FA 2WCSA 4MNLA 3GBDA 2DT3A 4OJYA 3VGEA 3WH7A 1V6WA 1RPKA 5CGMA 3RCNA 1OGBA 1UZ1A 1EQCA 3AHXA 1ZBWA 2C8NA 1OCQA 5M03A 4E8DA 1G01A 3VILA 5E70A 2CPUA 1SFSA 3WH9A 4M82A 2G3NA 3VMPA 2DH3A 4U5IA 5KZ6A 2FHBA 3WNKA 1UR2A 3AIUA 1LQ0A 5HPOA 5CQ1A 3WD2A 1CENA 1E0XA 2ZX7A 3RM8A 1ZS2A 2ZUWA 3AMKA 1GVYA 3WDPP 3SUWA 4M56A 4QLLA 1CGYA 1V3IA 3BLPX 3L2MA 3CHFA 1KWKA 1CEOA 2FGLA 1ZBVA 2WCGA 1BPLB 1JZ4A 2JIEA 1QNOA 3ZR5A 2E40A 1UKPA 2AOSA 1QHZA 2GVYA 1J0JA 1EDQA 2W4XA 1JNDA 2J79A 2WMIB 3WDRA 1IV8A 1V3KA 1QNSA 3MUZ1 1KGXA 1QNPA 3MUAA 1YQ2A 3BH4A 4MADA 3WMCA 3A6OA 4AIUA 3GYCA 3F5LA 3I3DA 3AROA 4PUEA 5IHRA 4IISA 1JGIA 3BGAA 2CBVA 2BV9A 2WW5A 4MNMA 3WENA 3W6LA 4TVDA 1RP8A 2Q8XA 1W9BM 2ZIDA 1NP0A 5FD0A 1EHAA 3W25A 1LF1A 3WQ5A 1HT6A 1UUQA 2X09A 1J0KA 3AI0A 4IPLA 1DWGM 4AMCA 4D1JA 3AMCA 4M81A 1V03A 3N18A 2YDRA 4KH2A 2YBTA 3PZOA 3PZNA 4PMVA 4P7RA 2ZX6A 3FW6A 1K9EA 2E9LA 2D3LA 2G3JA 4NI3A 4UFLA 3SCRA 3VIHA 4HZ8A 5FCZA 3BC9A 4JAWA 4HA3A 2EPKX 5M17A 1GOQA 2VURA 1HVXA 5F7UA 1KBKA 1TR1A 4CD8A 1WZLA 2PWDA 1UKSA 2WSPA 4D6IA 5C8BB 3ZM8A 2RGLA 2XFRA 1E3XA 1R8LA 5DF0A 3ALFA 4E4PA 2WZEA 3AJ7A 3DYPA 5LA2A 4HA4A 4PSRA 3EDDA 4UZSA 3SUTA 3VKKA 1UD4A 3WD0A 2GSJA 2W67A 4WLCA 1MFVA 3VDBA 1UQYA 2VZVA 4JZ5A 3CZ8A 3VD3A 3U7BA 1B31A 4YN5A 2VNCA 4S3JA 2IUZA 2ZUNA 2WHLA 4P8WA 1W9PA 1GJUA 1JFXA 1OB0A 3WQ8A 4JHOA 4ZE5A 1O7AA 2O9PA 5I77A 2F2HA 3GXIA 3L4VA 2WSKA 2DT0A 1WNOA 4PMOA 3UG3A 4HMDA 1C3FA 1ISVA 1PZ2A 2BS9A 2DT1A 4AZBA 3RIKA 5FIPA 3U5UA 2YA2A 1UD3A 4JFTA 1E6QM 1LL4A 1E6RA 2XVKA 3AS1A 4WKHA 2A3CA 1UOKA 4J3SA 1XGZA 1TCMA 2YA1A 3N04A 1M04A 3DC0A 4PMXA 4UOJA 4GQQA 2W92A 1UD6A 4J28A 2J77A 1JDCA 3WBEA 4LX4A 3OB8A 1W32A 2W91A 4XZBA 2A3BA 2X2YA 2IXUA 2J47A 1KBBA 4CD7A 1WP6A 3BAWA 1FHDA 3VDHA 4K68A 5HNNA 1MXGA 5IDIA 1W2VA 5C70A 3QOKA 1Z32X 5E6ZA 2V3FA 2VTFA 1EIBA 2XGIA 1H11A 1HF6A 4PMDA 2OWCA 5BXSA 3L4YA 3VDAA 3U57A 4ATDA 3IAQA 2WLZA 5BROA 1JFHA 2WMFA 2Y2WA 4MJ2A 4KGLA 4UZUA 8A3HA 4JKLA 3CBWA 1NOFA 4D6DA 3N13A 3SUSA 3VGFA 4HU0A 5HPCA 5BRQA 2WYSA 2Y4SA 3IK2A 1K9DA 3AMDA 2CBUA 3F5JA 2WM0A 2G3IA 1UR8A 1GUVA 3MKKA 3PZ9A 2EO7A 1VJSA 3ZSTA 5IFPA 2XG9A 3WQVA 1UR9A 1IT0A 2CIPA 4H41A 3LPPA 2XGBA 3HJEA 1JD9A 1WE5A 4GZEA 1S46A 3AS0A 5BXPA 4CD5A 2VJXA 2OWXA 1HKIA 1KCLA 2XHYA 2PWEA 1NOUA 4QAWA 3VM5A 2UWFA 3AIWA 1VFFA 4WSKA 5EB8A 1HIZA 2DGAA 2GJPA 3T2PA 1JYWA 1GZJA 2XVNA 1NQ6A 3GNPA 4HU8A 1B90A 1X1NA 1E71M 2YIHA 1JZ8A 4MAVA 4UQBA 4QP0A 2QPSA 2WANA 5EFFA 4Y7EA 1L8NA 2J7GA 3CHEA 2OYKA 3IJ7A 1J0YA 2WPGA 4GINA 4TTUA 1GOMA 4JCMA 5I3DA 3B9AA 2NW0A 3VIIA 2ZWYA 3MANA 3G6MA 5HXMA 1DP0A 1M53A 1CGUA 1EDTA 2WC4A 1AMYA 4B9YA 1EGZA 4B9ZA 3ARSA 4CCDA 4KWUA 1JYNA 4XUYA 1KXTA 3MMDA 3SCQA 1JYVA 4JKMA 4BA0A 5E6YA 1BLIA 1QHOA 1QI2A 1VBUA 4W8LA 1M03A 2VVSA 3VGDA 5E0CA 3MS8A 5CG0A 1CWYA 1GQLA 5DO8A 4HMEA 2DSUA 3W6MA 2CBIA 1UH2A 4U2ZA 2XVPA 1E4LA 1U33A 4CN1A 1C91A 1C7SA 1V3LA 5AYIA 3EDKA 1GQJA 5A6SA 4D72A 3S6TA 1WDPA 3EDEA 5CSUA 2ZE0A 4J27A 4RE2A 1E72M 1RP9A 2CBJA 4Z2KA 4MNJA 4Z2LA 3ZIZA 3GXFA 5JBEA 1C90A 3GZAA 1BQCA 4D71A 3W81A 2PWFA 1BFNA 3RPMA 3BSGA 1HKKA 1H1NA 4J3VA 2EPOA 2BVYA 1UR4A 5I2UA 5JIPA 1CXHA 3WUEA 1XSIA 2G8ZA 2E4TA 4HZ6A 1R86A 1BF2A 3EMQA 4GI6A 4J3UA 1FH7A 4FLRA 1B3WA 2A3AA 3GDBA 3NSNA 2YKKA 3VMOA 2O9OA 1VBRA 5AYBA 4UFJA 1UD2A 4LQ1A 1E70M 4QFUA 3DECA 3A4XA 1VF8A 3MMUA 1V0MA 1WDQA 3ZT5A 1JF5A 4CKQA 1E55A 2ZXQA 2QV4A 2F61A 2GDVA 2XM2A 3W26A 1SMAA 1H5VA 2DT2A 5A8QA 5GPRA 3VX0A 5A6BA 2J75A 2FH6A 4D6FA 3W24A 1EH9A 4CD6A 2XPKA 1PPIA 1XCWA 4AZIA 3PZTA 4F9DA 2W5FA 2D2OA 2AAAA 5CZKA 5JBDA 1DTUA 5I79A 1CGXA 2GJXB 1F4AA 4CUCA 3PHAA 3ZOAA 1LL7A 3WFLA 1AVAA 5I5RA 2VCCA 2YOCA 4P7LA 2ZICA 1TZ7A 5A8PA 1BG9A 4FF5A 1W1YA 4M29A 4WF7A 4H8HA 1TG7A 4QCFA 4WKAA 3A4AA 1H4PA 1UD5A 1J9YA 7A3HA 3T0AA 1OT2A 1HJUA 3ZJKA 1W9DM 1I75A 1E6NA 4M24A 1HJXA 4JFSA 5A94A 3II1A 3L4UA 4W7VA 1JIBA 3AXXA 1FFQA 2HISA 3W53A 1Q6EA 1VFMA 3VPLA 1H09A 3KL5A 1CECA 5AC4A 3CUJA 1J11A 1ISXA 4OIFA 4C7DA 2EPLX 3UERA 4NF7A 1TA3B 4H7VA 2BNJA 3WBAA 2OSXA 1A3HA 1UKQA 1SR0A 3CMJA 4UR9A 4E8CA 1R85A 3GH4A 2WMKA 4UFIA 1KGWA 2VZUA 2VZTA 4OZOA 3VIGA 3GTNA 1VAHA 1JD7A 3CUGA 2HVMA 4DM1A 4ZXOA 4F9JA 3QHOA 1UA7A 3SURA 5JUVA 4PMYA 1KCKA 1PX8A 2VI0A 1TVNA 2E8YA 5D8WA 3NSMA 5DMYA 1JZ6A 4XB3A 4DUVA 1H0IA 2CXGA 2YL9A 3L4WA 3ZSSA 2O9RA 1Q6CA 4IM4A 2EPMX 2O92A 4LPCA 5ABGA 3CZGA 2Y5EA 1NM9A 1XD1A 1BAGA 1LWHA 2QMJA 3FAXA 3RJXA 2CERA 4PMRA 4TVUA 1UH3A 2JE8A 1WZKA 1OD0A 2Y24A 1ITXA 3SCPA 3ARRA 3WY1A 3AISA 3TTSA 1Q4NX 1PX4A 1LL6A 1GCYA 2J7BA 3AQUA 3I3BA 1E40A 2A3EA 2DQXA 2XUCA 3L4TA 1BYCA 2YDQA 2VVNA 4W8BA 2Y8VA 3VTRA 3TTQA 5A6LA 3CUHA 3EDFA 1EDGA 1DWIM 2EQDA 3U7VA 4W87A 1NH6A 1E73M 1KXVA 4UOZA 3PZVA 4F8XA 2VR4A 1GQKA 3QHNA 3WDJA 1UWIA 1KFWA 1BSIA 3AZSA 1W1VA 3WNNA 4XZWA 4A3YA 4BCEA 4TVCA 5ABFA 4ACZB 5CXPA 1ZB5A 1YHTA 2VX7A 1G9HA 5BCAA 1D7FA 1KR0A 2WVUA 4R5EA 2ZX8A 3ARZA 2OYMA 2XVLA 3W29A 1EO7A 4JFWA 1TVPA 4PMQA 3WEOA 1QI5A 3CZJA 1UR1A 1ISZA 1J0ZA 1U2YA 3AHZA 1WAWA 2UY4A 2D24A 3VOCA 1E6PA 3HMCA 3T0DA 4GPNA 4F66A 3OG2A 3TTYA 3CO4A 1PAMA 1E6XM 2ZXBA 3KWXA 1UYQA 2XSAA 4DWSA 1E4IA 5C71A 2ZXAA 5BYWA 3RM9A 3CTTA 3VGGA 4ZE4A 1IZJA 1UQZA 4NRRA 4AD0A 1Y7VA 1ISYA 2VZSA 3MV01 1PIGA 1OGGA 3WDHA 2E8ZA 5LA1A 1BG4A 3FN9A 3UCQA 5GNYA 4J3XA 2B31A 5BRPA 1QNQA 4AD5A 4PTVA 3K8KA 4M80A 1BHGA 1J0HA 1OBAA 2J4GA 4PCSA 1BTCA 1UWQA 2TAAA 2NT1A 1V6YA 5A6JA 2OWWA 1CXEA 1DWFM 4MPKA 1G5AA 3WF0A 1XH0A 3TTOA 1U30A 1E6ZA 1FOBA 4AD2A 4UQ9A 1H49A 1SYTA 2E9MA 2EEXA 3W4RA 1UD8A 1W9XA 4N0RA 3T08A 5CLTA 2PWHA 2W63A 4JCLA 1JXJA 1C8XA 4B3KA 2BXZA 2VQUA 1E1FA 1QI0A 4PEEA 1C8QA 2PBGA 2ZX5A 4CD4A 3OGVA 2CKSA 2VC9A 2GJXA 4KRTA 1MFUA 4AC1X 5TD4A 1KB3A 1JAEA 4FK9A 4ZFMA 3VM7A 2ESCA 1HX0A 1NP2A 1Q6DA 2VT0A 1OT1A 2WMHA 5LYRA 2WK2A 1AQ0A 2QPUA 4Z2HA 3NYDA 4QLKA 1E9LA 1CNVA 1MQRA 3AMGA 4C7GA 2MANA 3AYSA 5ABEA 2G3MA 3N15A 1ZJAA 4MB1A 1CPUA 5IHSA 5A6MA 3DHPA 3AOFA 1CXKA 1JZ3A 2VRQA 3EYPA 2V5DA 1CXIA 1XCXA 3UETA 1TE1A 2D20A 3AICA 1TA3A 4D6EA 2VR5A 4WJXA 2CNCA 2XWEA 3DYOA 4MB5A 3VDCA 4Q7NA 5FL0A 1JZ5A 2EPNA 4W85A 2F8QA 3OIHA 2GK1A 1R87A 3AYRA 2GUYA 1PJ9A 2QMKA 1KR1A 3WH6A 4FMVA 5CSYA 1WB0A 4GQRA 3NJ3A 1GOIA 3BAIA 3ZJ8A 2BHUA 1KGUA 2V5CA 1V3HA 2GJRA 5A6BD 1JL8A 2BVDA 1DHKA 2PBOA 2WC3A 3AIBA 5HDRA 3PZUA 1FH8A 1P6WA 4MNKA 2WBGA 3ZJ6A 4UQEA 1GOKA 1MWOA 4BQ2A 4CCCA 2DSZA 1VEPA 1WZAA 1JF6A 5A1AA 3BLKA 4W5ZA 4BS0A 2YLLA 1V6XA 3ALGA 1UG6A 2J78A 5GNZA 1QI4A 4MDOA 5I23A 2X1IA 2JALA 1DWJM 4U31A 1G0CA 3WNPA 4DUXA 1CTNA 3A4WA 1JI1A 5I6SA 5JH8A 3ARVA 3CH9A 3WFZA 1B3ZA 3NDZA 3N17A 4U3CA 3ARUA 2Z1SA 1GJWA 4HPHA 2VZOA 1JYXA 4AIEA 1W1PA 2UY2A 4AEEA 3N11A 3WD3A 1BVZA 3OLIA 6A3HA 3POCA 3JUGA 1BVNP 1OWQA 3SUUA 4AY1A 3WELA 2D22A 3VIKA 1W3LA 1WPCA 5DFAA 3WH5A 4ACZA 1C8YA 3WDQA 4AYSA 2CKRA 4ACYA 3K4DA 2CEQA 3CZLA 3MUIA 3CGTA 4GZIA 3MSGA 2E3ZA 3RM4A 1MW2A 3VD5A 3BCDA 4ZXLA 2ZWZA 3BAJA 3QOMA 4HOWA 4JIEA 2JIWA 3VD9A 4PYSA 1RH9A 3KEHA 1UKTA 1CGWA 1CIUA 1BGAA 4JFVA 1QW8A 4DM2A 3WQWA 2XVGA 1JG9A 4PMZA 2BVTA 3QGVA 1LG2A 3K1DA 4AZHA 5ABFB 3SUVA 2WMJA 1FH9A 4UQDA 4CN4A 1C93A 4MJ4A 3L2LA 2OSYA 2V3GA 1HKMA 4V28A 4A4AA 3UG5A 3N12A 2OSWA 1ECEA 4ATLA 4J3WA 3M6DA 1HJSA 3B8SA 3CZEA 4W84A 4NSBA 5FKYA 4ZENA 3VMNA 1KWGA 1KXHA 3MO4A 2FH8A 3UEQA 2ZX9A 4DWSB 4J3TA 2J7CA 3D3AA 4AISA 3EMCA 2NT0A 1MXDA 4QCEA 3FY1A 3ZR6A 4OUEA 1W3HA 4B16A 3PZGA 3AXIA 3T09A 5HOSA 4OBSA 1BGGA 2J7EA 4H04A 1JAKA 1C7TA 2EXOA 3FNDA 4X9YA 3VD4A 3VNYA 1QI3A 1ZL1A 1UWUA 1UKOA 4CU6A 3TOPA 3VU2A 4QDMA 1E0WA 2UY5A 2WVTA 4HA1A 2CHOA 4PTXA 1R7OA 2WHMA 1AQMA 2XIBA 1CLVA 4L4PA 5CGTA 3SCSA 2W66A 1QPKA 1JDDA 3FAWA 1N82A 2VQTA 3W28A 3THDA 1J01A 1EO5A 1I1WA 5DT5A 3AIQA 3FHQA 2XSBA 4CVWA 4B15A 4BQ5A 4WSJA 1C92A 1W3JA 3F5KA 4MDPA 3W27A 1GNXA 3O9NA 4AD4A 4IUGA 1VEMA 3WMBA 3VINA 4H8VA 4XX6A 2OYLA 2PF0A 3G6LA 4DWSD 5FL1A 4EE9A 3PZQA 3AS3A 1G1YA 2WZHA 3BAKA 1CGVA 1X6LA 2FHCA 2AMGA 1ISWA 4F79A 4D6CA 3AIEA 3WUGA 1HJVA 1E4NA 1ODUA 5D9MA 4UTFA 2WHKA 4NRSA 2GFTA 1VENA 3KL0A 1R7AA 2YLAA 2VRKA 2WLYA 4E2OA 3WF4A 2D0HA 3CHCA 1PIFA 4PMNA 3VIOA 1D2KA 2VCAA 3VVGA 1ZBCA 4HP5A 1V3MA 1QBBA 2E9BA 2WNWA 3A47A 1W9VA 2ZUUA 2J7FA 2BY1A 3F4VA 5LA0A 4ML4A 4L4OA 2BHYA 1LLOA 1SMDA 4TOQA 4GIAA 4LYQA 1JNEA 4OBRA 3WEZA 4KMQA 2J62A 4W86A 1VIWA 2WC7A 4RL3A 2GK1B 3VGBA 3BAYA 4PSPA 3IAPA 4MB4A 3ARPA 2ZUSA 3J7HA 3M07A 4GXPA 2CESA 1WDRA 4ZEPA 1VFOA 4AXNA 4J7RA 4EAMA 1TMQA 2YA0A 3W37A 2YBUA 1FFRA 1E6SM 3GNRA 3ZJ7A 4LYPA 1XYFA 3ZT7A 1V0LA 1X6NA 2DIEA 4CVUA 3I3EA 3TA9A 2BFGA 4AWEA 3SCOA 1EHNA 3T2QA 1HJWA 1XSJA 1OSEA 2FHFA 4C7FA 3PZIA 4Z2JA 8CGTA 1US3A 9CGTA 4UNIA 3DHUA 2XJ7A 1H2JA 1XH1A 2WB5A 3CUFA 2V38A 4W89A 1E5NA 2CITA 5IXEA 1EOKA 1ZU8A 1XC6A 4S3KA 4PTWA 4JL1A 1MW1A 2ZXDA 4U2YA 3VD7A 3B9EA 4BQ3A 3B9DA 4MAZA 2D23A 4IPNB 4N42A 5ABHA 4TTGA 2V3EA 1V02E 3LPFA 3VIFA 3EDJA 3M46A 3WKZA 2J7HA 3BCFA 4U5KA 1OGSA 2VOTA 5EMYA 4JKKA 2VRJA 1US2A 2GDUA 3LPOA 6TAAA 4V27A 1B3VA 5EBAA 1VB9A 1DWHM 3GM8A 1QVBA 1PZ3A 4NZCA 2QLYA 1FP9A 3NIYA 2FDMA 2D0GA 4UCFA 3EMZA 5GNXA 4TUFA 3KL3A 1E15A 2C0HA 5JBFA 3K8LA 1H41A 3DYMA 5A95A 3ECQA 5KEZA 1XYZA 3SCUA 5I0DA 2W61A 3BXWA 5IFTA 1WZMA 3CIVA 4CU7A 1F4HA 3HU7A 3FHAA 5D9OA 3IJ8A 3GH7A 3T2OA 4M8UA 3ZT6A 3OA5A 3S2CA 3WH8A 1CGTA 1V6VA 1LJYA 1OIMA 2XWDA 2DDXA 4R27A 4KRUA 4RE3A 1JDAA 3ZMRA 3OGRA 1DEDA 4KGJA 4GZJA 1IZKA 1G94A 5DT7A 5M3WA 2QF8A 2WVSA 4OKDA 1W1TA 3W38A 3PBGA 2Y8KA 4HOXA 3KZSA 1OM0A 1QHPA 4PN2A 7CGTA 1D3CA 1NWUA 1J0IA 3QHMA 1UHVA 3BMWA 3WNMA 3OLGA 2YL5A 4PRWA 3GBEA 1NWTA 4H2CA 2DEPA 4W5UA 1FHLA 1NWSA 3NSXA 3WDIA 1MVYA 5AY7A 1O6IA 3MSDA 1PX3A 1KXQA 3UESA 4LXFA 4U33A 1V3JA 3PZMA 4P8XA 2XTKA 3OLEA 4GI9A 4FLSA 4OOUA 5A8MA 2ZUTA 4W8AA 2J8FA 2VL4A 1EQPA 5A2BA 3N9KA 3FXYA 2VMFA 1XRVA 4HMCA 1AQHA 1BYBA 1ITCA 3POHA 4Q22A 4FLOA 4JL2A 2J25A 1UWRA 4HZ7A 3NCOA 4W7WA 1TUXA 3SEPA 3VIMA 2WCAA 2X05A 3WSUA 3SCNA 3WL1A 1E1EA 1M01A 3O2LA 3CZKA 3OZPA 1MW3A 1GONA 1CDGA 5A2CA 5D8ZA 2WBKA 3PTKA 4OOZA 5BWFA 1FA2A 4MB3A 2X8RA 2CETA 1E5JA 4TX6A 2WXDM 3D5HA 2DIJA 3WF3A 3RJYA 1J12A 1V6UA 3GH5A 5FOOA 3QR3A 2WVVA 3CPUA 1XSKA 5CPSA 1VJZA 2DSVA 3BMVA 3GXMA 4CN6A 4HOZA 1JZ2A 2PC8A 1B3YA 3E1F1 2G4FA 5D4YA
chains in the Genus database with same CATH superfamily
1D7IA 3CUIA 3MP5A 3Q58A 3FKKA 3GIPA 2OLHA 2XFYA 1V0KA 1EPVA 1H1YA 3Q67A 4B5XA 3M9YA 3S2JA 2BY3A 2M2AA 1GVSA 5DIUA 3AMLA 3IIVA 4O8AA 3DH7A 5E0KA 1W2PA 4PBGA 1B0IA 4PTMA 1W1A1 3WL0A 4NZ5A 3S4TA 4FP1A 4GLEA 3I6CA 1FKSA 3SGGA 3DC8A 3WQ4A 3NDOA 1OD8A 1U83A 1UA3A 4YYFA 3KOZA 4FI4A 3FJ4A 5FF3A 2QCFA 2V5BA 3VNJA 4DWSC 1ZQ5A 3NQ6A 3W1UA 4D6JA 4XBKA 1OYBA 4XV0A 4JR5A 3VO0A 1GOOA 1EJWC 3VCRA 3NRKA 1MRAA 4NASA 3R4IA 2QKFA 3TP4A 3W76A 3LPGA 5PTDA 1FKXA 9XIAA 1UWTA 1ESWA 4GI8A 1PWLA 2JEPA 3CL7A 4D6HA 1VLIA 2O0TA 2VEGA 1ROUA 2YJQA 1HJQA 3BLDA 2R1PA 3IJ9A 2HS6A 2WHJA 2WV8A 3RO8A 3CC1A 3UFYA 3Q94A 3WIJA 3B9OA 1V8EA 5FEZA 1I0BA 5D9PA 3ARYA 1W91A 1UR0A 1EWDA 2ZZ2A 3VCNA 1VRXA 3ARTA 3KDNA 3UR7A 3UNTA 3MHFA 2Z2AA 3DAQA 1NFPA 1A47A 2WNZA 3GNDA 1OIFA 2DZVA 1EOMA 1XYLA 1GHSA 2C18A 3I7RA 4EANA 1X7IA 3WQFA 2VP8A 4CCEA 4H9MA 2CLOA 1R9HA 2HXTA 3LBMA 1CXLA 1I2RA 3WMLA 1D8WA 1NAL1 5E0FA 2CCRA 4QIUA 4P8VA 3VOGA 1JCTA 4X2RA 5M5DA 3V36A 1LWJA 4AEFA 1TELA 3SRHA 4PRTA 1O95A 5A8NA 1Q63A 4GQ0A 1FX6A 4KWWA 5A6AA 2VX6A 4N19A 5I24A 3AUOA 5HBFA 4ECLA 3EB4A 1UJQA 5JIWA 2OKOA 2CLMA 3AHYA 1L6FA 1QO2A 4RLIA 3PN8A 3E49A 2HPIA 3BARA 3LCWA 3O63A 5EMMA 5D9NA 1E43A 1CXFA 1TREA 3NQAA 4S2BA 1IE7C 2I9UA 3L5AA 2DSKA 3QMSA 3URAA 3VNZA 3OLDA 4D1IA 2P53A 1Z42A 5E09A 2V69A 3APGA 4HBOA 3MU7A 4QNWA 3UWEA 4ILSA 5F4SA 2E6DA 4MUZA 4M1RA 3KWSA 4YPJA 4OUIA 3W88A 3W2MA 3VUPA 5CPQA 1XLBA 2RGMA 3OBAA 1U1UA 4CGTA 4L5ZA 1KCZA 4R34A 3FEMA 3MDYB 3AIRA 4UTKA 2BZNA 3QZAA 3W74A 4BQ4A 4ZQRA 3VIJA 1QFEA 3GXTA 1MNZA 1X97A 3AYVA 4IQEA 1MZRA 3N73A 4Z2GA 4W9PA 4NG3A 2JF6A 3ZVIA 1ZZMA 2XP9A 4NZFA 4QLJA 3NL5A 1QASA 5TF0A 1UIPA 2KX9A 1HO1A 1E0VA 3KLKA 2P3ZA 4AZ6A 2PI6A 2W62A 5AB3A 4MTVA 5CLWA 3UWVA 3KRSA 1BWVA 3NEVA 3P0WA 2VD9A 3W7QA 3O15A 3OZOA 2ZRUA 3WQEA 4C6NA 1IR2A 1Y5XA 1LT8A 2DZAA 2GOKA 3A64A 2DU2A 4BEQA 1GORA 3LHTA 1RQBA 1HKJA 1BXBA 5KZDA 2X0HA 4DO4A 4GKLA 3HN3A 4JN8A 4JY9A 3SIMA 1XKJA 2GPTA 3PNZA 2J88A 2QDHA 3VX1A 4LYRA 1N8IA 3WUFA 4HTYA 1VEOA 1XV8A 2HQAA 3AO0A 3BSHA 1HXJA 1V02A 2PDIA 3W2NA 3UWYA 4MJMA 4KERA 5BU6A 4ZBCA 4J9JA 3CMGA 1MW0A 4G7EB 3GFYA 2V5LA 1F9CA 3WG6A 3NFUA 1EUNA 3ATZA 3I6RA 2WCSA 2C7FA 4MNLA 4PULA 5L6UA 1PDZA 1V6WA 3L21A 1RPKA 4V1YA 1QCWA 3TR9A 3RCNA 4GXMA 1OGBA 1EZWA 1TWDA 3P62A 4E8DA 5K4ZA 1Q6IA 4XTDA 3UD6A 3DERA 3E96A 4U5IA 1P6BA 3G1YA 2FHBA 4UWMA 1LUCA 5HPOA 1CENA 3HJZA 2PGRA 1YXYA 3RLHA 1TZZA 3TTEA 1ZNNA 3WDPP 3SUWA 3O5GA 1CGYA 3BLPX 3ZVHB 3HMJG 4GX8A 3MYOA 1AH4A 3MHGA 2WCGA 5AHFA 1QNOA 2ZRYA 1Q85A 3W83A 4NXKA 2I5QA 2F21A 4GA8A 1Z3NA 4QAIA 3I4KA 1J0JA 2W4XA 2WMIB 2ACUA 1IZCA 2PTDA 3HG5A 3TCEA 1QNSA 3JR2A 4B4HA 1QNPA 2MF9A 4MADA 3DG6A 3KCLA 3F5LA 4QG6A 4RZ6A 4LB4A 1RLCL 2RHGA 1JGIA 3EA1A 4WDXA 4RK8A 2Y7EA 4MNMA 4TVDA 1XYBA 1PHWA 4Q4KA 2Q8XA 1ZPTA 2OO6A 5FD0A 3W25A 1IX5A 4UTLA 1RCXB 1HT6A 4LTSA 3AI0A 2HTMA 3AMCA 3TUUA 2YDRA 5JQ9A 3UBPC 2WSRA 5CGQA 4GIRA 2Y70A 3UU0A 1K9EA 5K9CA 3BOXA 2E9LA 1TRDA 4NI3A 6XIAA 5FA5A 1Q4WA 5FCZA 2PRLA 3KCOA 3ZWSA 4JAWA 1YATA 4I9TA 3T42A 1ZCCA 2QDGA 3GR7A 4HA3A 1H62A 3N6HA 2NUXA 4XZ9A 1G7VA 5FJPA 3LQLA 3G5EA 4FXJA 3SGZA 3TN5A 2ACSA 1WZLA 3CV2A 2DG4A 2WSPA 4DI8A 3KBVA 3SSZA 5I3GA 4YCOA 1KTNA 5C8BB 1SW3A 1E3XA 1R8LA 3ALFA 3H70A 3LV5A 3P81A 4LUJA 2RDUA 4LT9A 5LA2A 4HA4A 4PSRA 4MZ8A 4UZSA 3CWOX 4WGHA 4O52A 4JYEA 4KEZA 3WD0A 1EEXA 4NKCA 2VZVA 4JZ5A 3VOHA 2NV2A 1IR1A 5KETA 3LM7A 3U7BA 2F84A 5H1WA 3L7RA 1T5AA 1B31A 3PWIA 2VNCA 4HNCA 4S3JA 1X39A 4G56A 4NYYA 3WQ8A 1J6OA 5I77A 4J2PA 2F2HA 3L4VA 2DT0A 2AKMA 2PA6A 1J6PA 1QW7A 4NVTA 3B8DA 3UG3A 5BU9A 1VIZA 4LH8A 1PZ2A 1QWKA 2BS9A 5C9UA 4GXWA 1A5OC 1KKRA 2YA2A 1UD3A 5JXQA 4Y90A 1LL4A 3S6OA 1T8QA 5EGRA 1TV4A 3ZWTA 3G24A 1KRAC 4J3SA 1G67A 1R9XA 2YA1A 3BMXA 4I8DA 1EF2A 4KWSA 3MC5A 3W1NA 1LRQA 1UD6A 2ISWA 2J77A 3Q37A 2ZQ0A 5ENLA 4ZPTR 2W0UA 4XZBA 2A3BA 4UIOA 4UTTA 3MW7A 2Z27A 3UA3A 2XDFA 1KBBA 2HXUA 4B5WA 1GJPA 4J1OA 4QJ4B 1LROA 1FHDA 3VDHA 4K68A 4NNAA 2PDHA 4Y9NA 5D04C 1B5TA 3UJSA 4ROPA 3ANYA 1H11A 4K36A 5C9RA 1Z7AA 2QULA 3HG2A 4Z1AA 4A3UA 4IH3A 1W5QA 3VDAA 1W0MA 2IPJA 5AVNA 3IAQA 3TA6A 4XIMA 5XINA 5BROA 3A13A 1LZOA 4KGLA 3WO8A 4DZHA 3DESA 3SAZA 3N13A 3SUSA 4C90A 4HU0A 4GVGA 4XSMA 5HPCA 1TV7A 1UWAA 4BHYA 2WM0A 2PGWA 3VAVA 1XG4A 3FYYA 4F40A 3SY8A 5IFPA 1TJRA 2CIPA 1RUSA 1AZ1A 1JD9A 2VJXA 2OWXA 2ZKMX 4L9YA 1MMFA 3BMBA 2OMAA 1HIZA 2QCHA 4NT0A 5LNWA 1JYWA 2ZADA 5CAHA 2WZTA 4B91A 5AECA 4UQBA 4QP0A 3CGMA 4GYFA 4C6BA 4O53A 4FALA 3LHWA 3FJ6A 4JCMA 1KFEA 3FS2A 3G2GA 3G6MA 4L7ZA 2OKTA 4ERAA 3IIZA 4N6FA 3ARSA 2GJNA 3DN5A 4NX5A 4XUYA 1VBUA 1OFOA 1GQNA 4ZOAA 6ENLA 2VVSA 5E0CA 3MS8A 4HMEA 3W6MA 1Q5MA 3TN3A 2XVPA 4CN1A 3T55A 4O1EA 2C71A 1WDPA 3FJNA 4Y2WA 1RP9A 2CBJA 1Q65A 1YDOA 3GXFA 3LSCA 1C90A 4GQGA 4J3VA 2BVYA 3RMJA 3KTSA 1KW1A 3W9ZA 5JIPA 4XD3A 1CXHA 2E4TA 1BF2A 3CAVA 1A49A 3EMQA 4GI6A 1FH7A 3VNIA 4LAVA 1JPKA 4H9ZA 1KTBA 3OODA 3W7RA 2O9OA 3WQOA 4HMNA 2YCEA 2QJGA 1UD2A 1RJPA 1E70M 4ZA0A 4QFUA 2C1HA 2QQ6A 3DECA 2WSQA 1VF8A 4GNJA 4OFCA 3M44A 2QW5A 5BOOA 1JF5A 1F8AB 4CKQA 4MUPA 1KCXA 2QV4A 2Z00A 3W73A 3EX3A 4BI5A 3W26A 1QXLA 1TKKA 3SFWA 2DT2A 3HIJA 4S2CA 4FIRA 4D6FA 4YVXA 3C0LA 5AFDA 3MWAA 4QT2A 4DZ5A 3W24A 1DJIA 4GGQA 5EMUA 3EB3A 3FVMA 4F9DA 1U5HA 4JFLA 2V5JA 2D2OA 3RYSA 1F4AA 3ZOAA 1LL7A 3WFLA 1RA0A 5G5IA 4N02A 4FF5A 3ABRA 4H8HA 2XISA 2X1TA 2RH9A 2ASHA 3WLRA 1H4PA 4N9EA 4JNZA 2OODA 2HS8A 7A3HA 3ITVA 3BOFA 1W9DM 4W7VA 4TW8A 1NDZA 1JIBA 1FFQA 2HISA 3N2BA 1H09A 1CECA 4HVXA 3PWGA 3W7EA 1ISXA 5G1YA 4DBWA 2CZDA 4NF7A 1FCUA 1R0MA 5FSDC 3T0TA 3R12A 2VZTA 4OZOA 1UMLA 2I57A 1JD7A 4LAMA 3O5RA 3BWWA 3MB9A 2E09A 3PWAA 4G1NA 1UA7A 1DIKA 5JUVA 1F3TA 4JFJA 3M0ZA 2FTYA 1VQTA 3QFEA 3NSMA 4TO8A 1JZ6A 4XB3A 1GVOA 2P10A 1H0IA 4B2DD 2HVNA 4JDBA 3UZ5A 1F73A 1IEXA 1FDZA 4IM4A 3LQGA 3CZGA 1REQB 1NM9A 4HGXA 1FVPA 2QMJA 3FAXA 4XD5A 3WLSA 1WZKA 4L72B 4DZ2A 3WY1A 1IXPA 1FXQA 3K1GA 3TTSA 4FXRA 2ZQUA 4CCZA 3L65A 1Z89A 4XO7A 1GCYA 3N2OA 3I3BA 1E40A 1S2AA 1Q6LA 4MSPA 2YDQA 4AVOA 1V7AA 2MNTA 4YYCA 5HAOA 4H3DA 3C6CA 3CV6A 3NQ8A 4UOZA 4NJKA 5I3IA 2Z28A 4F8XA 4C6EA 1GQKA 3WDJA 1UWIA 1BSIA 3WNNA 4HHHA 1YNQA 2DORA 1ICQA 4A3YA 4BCEA 2FMNA 4ACZB 5CXPA 1XF0A 1YHTA 3FDGA 5XIAA 1BVWA 2HK0A 1PDYA 5BCAA 1D7FA 1UJPA 2WVUA 4R5EA 4FX7A 3U4FA 3WEOA 4DBEA 1UR1A 1J0ZA 4UMBA 1U2YA 4TMBA 4IICA 4JPGA 3V7PA 3VNKA 1WAWA 2D24A 1E6PA 4PFMA 3T0DA 4QJ3B 1K03A 1XX1A 3TTYA 1PAMA 1PINA 1SSGA 3KWXA 2XSAA 3HURA 2X0SA 4DWSA 1E4IA 3FSUA 3CQIA 2HDJA 4WGXA 3RM9A 3COTA 3VKJA 4JIHA 2KR7A 1IZJA 4JEJA 2VWSA 4GVFA 2C16A 4JTUA 4U85A 1TTQA 3CAWA 4KW2A 1PIGA 2BX7A 1SW7A 1FWCC 3FN9A 4DO7A 4ZOCA 4AD5A 2Q01A 2INFA 4IMFA 3QZEA 2OZ0A 4GBUA 2CFFA 2NT1A 2OWWA 1CXEA 3W7PA 1DWFM 4ZTYA 3TYEA 3WF0A 3D46A 3TTOA 1E6ZA 1FOBA 3N2TA 1Q6UA 4DZ3A 3DHFA 3RRXA 2EEXA 3QY8A 1UD8A 4N0RA 2BB0A 1GRJA 5C9ZA 1NQKA 3CO8A 3TV8A 2W63A 3TWBA 4FXFA 5CAKA 4B3KA 4XUGA 1E1FA 2FVKA 3STPA 2NXIA 3KCJA 2GGIA 4FR6A 2PBGA 3V1HA 2ZCGA 2CKSA 3WQPA 3B97A 3BLEA 3O16A 1KB3A 2M1IA 4PUKA 1EJXC 4FK9A 3RPTA 1UC4A 3SRKA 4ZFMA 3VKDA 3HGSA 1I0DA 4YCPA 2G3FA 2VT0A 3UJ2A 2WK2A 1AQ0A 3NYDA 4O54A 3LGEA 5CC5A 4QLKA 4Q32A 2MANA 3AYSA 4GFIA 3PULA 1TPDA 4HCHA 1CPUA 1P4CA 3PPFA 3DHPA 1QPQA 3QKEA 1FUYA 2VRQA 1K7FA 5I7GA 1EEPA 5FF4A 3AICA 3HTWA 1M7PA 4D6EA 2VR5A 4O4VA 2J9YA 2QUMA 2VUNA 1JZ5A 3F2BA 3OIHA 1QWGA 2GUYA 3W7GA 3E0FA 1ITQA 2H6RA 2A7RA 4LNCA 4QG8A 2VFFA 3M5XA 3BAIA 1TJ0A 3GHSA 3M16A 1RBAA 1TTIA 4L61A 4NIRA 4JFKA 2GJRA 4R53A 5A6BD 5EYWA 1EUAA 1EXBA 3A23A 1DHKA 3UPWA 5LNUA 1EBGA 2DZXA 3GDRA 5HDRA 1FH8A 4MNKA 3ZJ6A 4UQEA 1VEPA 3NQCA 5A1AA 5BMWA 4W5ZA 2F4EA 1REQA 2V5KA 2YLLA 2KI3A 4MDOA 5I23A 2YFOA 4MLJA 3LBCA 4U31A 2B81A 1G0CA 1MEWA 2YGYA 4RW3A 2XZ9A 4FNRA 1CTNA 1NF7A 4GJJA 1LYXA 2QCDB 4G2PA 3ARVA 1QOQA 3WFZA 4RNJA 4EPDC 3NDZA 2J9ZA 4U3CA 2DVUA 3ITYA 6REQB 3PBWA 4XG1A 1LOQA 4AIEA 3N11A 1BEUA 1ZAHA 3POCA 5KTLA 2M08A 1UCWA 1WUFA 2PS2A 3VIKA 3KOFA 3WH5A 4ACZA 4JEQA 4RUBA 2CKRA 5LIUX 1XG3A 2CEQA 3CGTA 4GZIA 4ZXLA 3RN6A 4PYSA 1GYLA 4L1GA 1MDLA 5REQB 3GUGA 4DM2A 3UY7A 4JDYA 4F3HA 2IKJA 3RU8X 1AUSL 4RDWA 3UPMA 3QGVA 1LG2A 4WHBA 4I3GA 5ABFB 2PDYA 5D2YA 4Q8TA 3SUVA 2PMQA 2ITKA 4XWUA 4WR3A 1DJYA 1OYAA 2QUVA 2BVWA 2OFJA 4S3AA 2YXOA 3UG5A 2ADAA 2NX3A 3E0WA 1RA5A 2OSWA 3M6DA 5T9BG 3ZLHA 3WQCA 5KITA 4AY8A 2CZEA 1UASA 1IEQA 4PBEA 3UEQA 2BLEA 3D3AA 2ZTKA 3M0HA 2NT0A 1XFCA 5H91A 3W1AA 5G2HA 3FY1A 4IX0A 3T09A 5HOSA 1C7TA 3U9IA 4J4NA 3CAQA 2FJUB 4KESA 3T4CA 3WBXA 3VNYA 1QI3A 3VD4A 3TOPA 4HYWA 4QDMA 1E0WA 2PDQA 4HA1A 3VFCA 1E9ZB 1CLVA 1S38A 3E2SA 4L4PA 5E93A 3SCSA 2VQTA 4ZO9A 1AH3A 2P0IA 4L80A 3VOIA 3TIMA 1YMYA 1C92A 1W3JA 5I09A 3W27A 4C6KA 3KBMA 4RJEA 4IUGA 3ZZ1A 1S1PA 4ZODA 3VINA 2J13A 4XX6A 3RLUA 5DITA 2OEKA 1XR2A 3EZ4A 1Q2RA 3BW3A 3A5VA 3BAKA 2FHCA 4E0CA 2GVLA 3AIEA 4KS0A 2G96A 3IJDA 1HJVA 4N6EA 1ODUA 4RNFA 3NR0A 4UTFA 4DJFC 2PDGA 2WHKA 3INPA 2YCLB 4LANA 5B7ZA 1PZ1A 4AHQA 3KL0A 2LJ4A 2YLAA 3AU2A 3QSTA 1Q7ZA 3VZZA 5EU9A 4E2OA 4XISA 2D0HA 1ZBCA 4DROA 3M5VA 3PPCA 1QBBA 3STCA 1GW9A 1ZP4A 3TYBA 1W9VA 5LA0A 3PPGA 4ML4A 1LLOA 4FPSA 3W2KA 1SMDA 1DE5A 3F7JA 3PVFA 1M68A 4FX8A 2ZDSA 1QK2A 4LYQA 4I5UA 1K02A 2Y78A 3WEZA 4KMQA 2CLHA 4W86A 2GK1B 2ZRZA 3VGBA 4MB4A 3ARPA 2ZUSA 3J7HA 1X1OA 4XZHA 7ENLA 4LRSA 2CESA 3N2CA 2PUZA 4L4MA 2ALRA 4EAMA 1TMQA 3APTA 4AF0B 1E6SM 2JGQA 3T40A 3LDVA 3MPGA 1EIXA 1WOAA 4KETA 3SM0A 1RPXA 2RUDA 1B9BA 1GGOA 2Y0FA 3QPZA 1OSEA 1US0A 2HV5A 4UCGA 5F1VA 3GTYX 4Y9AA 3P0XA 2PTXA 4Q3MA 6REQA 2Z7GA 3WK3A 4BJHA 4QGCA 2V38A 1E5NA 4YTUA 3PJWA 2WQDA 1ZU8A 4PB3A 3O5EA 1XRSA 4JL1A 3E2QA 2PLMA 1MW1A 4IG2A 1JCNA 3DGBA 4FEZA 3P61A 4CNSA 1QK0A 2B4GA 1GTHA 1IYXA 1V02E 3LPFA 3M46A 1GKPA 1OGSA 2VRJA 1US2A 5HWNA 3LPOA 4F4RA 2A1YA 1B3VA 1XUUA 1KFLA 5REQA 1K4GA 4IGMA 3EXSA 3CB3A 2QLYA 4C6LA 3LZ5A 4IP4A 2D0GA 3EMZA 2IKHA 4TUFA 2F23A 3C2YA 1OCNA 3OZYA 5A5WA 1TPB1 3CLMA 3LCXA 3DYMA 2Z26A 1X1ZA 4IXHA 4AUBA 1SPQA 5KEZA 5D2WA 4HD5A 1HG3A 3P80A 3PANA 2W61A 1XLFA 1FXPA 4DJFD 1D6OA 1AL7A 1ZLPA 2TPSA 2DVXA 1F4HA 2XGZA 1G4SA 3IJ8A 3GH7A 3T2OA 4M8UA 1A53A 2DW7A 1V6VA 1LJYA 4QT3A 3O5KA 1XKYA 2V82A 3KUMA 2XWDA 4ERIA 3DX5A 3KP0A 1M7JA 1K8ZA 3C0JA 3KRZA 3S1VA 3CEUA 4GZJA 3TAOA 2QF8A 1FWIC 2WVSA 1W1TA 1N2VA 3W38A 1EWEA 2Y8KA 1TWWA 2WJZA 3LYEA 1XLMA 3W1QA 2QVHA 1UHVA 1IXNA 1R46A 3R7MA 5FAJA 3TWAA 4L9XA 1NWTA 1EJRC 2AQVA 4PBFA 1XFBA 2CU0A 3I6TA 3L5MA 4W5UA 1NWSA 1OX5A 4I8YA 1H1ZA 1O6IA 4LSBA 1X6UA 4O14A 1YADA 1F74A 1OC6A 2PDKA 3SW6A 1B4EA 3OLEA 5G4WA 1J8VA 5BMXA 1YTDA 3TN4A 4OOUA 3UY8A 2J8FA 5I00A 3FXYA 4K1GA 3SQSA 4DEFA 1BWKA 1BYBA 3WLIA 2PP1A 3POHA 4Q22A 4JL2A 3CTLA 3N4AA 1LDCA 3NCOA 5BWAA 2HVOA 3NL6A 2PF8A 3OHIA 3ABSA 1OG0A 3PRAA 2VELA 4YVPA 1F76A 3GNNA 2P76A 1RSCA 2CLLA 1JPMA 3RCMA 1JCMP 5GJPA 3UGVA 4OOZA 5BWFA 2Y5JA 4MKVA 3TFCA 4RW5A 1VHCA 2ZVRA 4GUFA 4TX6A 3H24A 3WFAA 3D5HA 7REQB 4KPLA 2F6XA 1N8WA 3QM3A 1IXQA 3WF3A 3RJYA 2ZFAA 2PBCA 3UF8A 1RZMA 5JH2A 2ZTJA 5FOOA 3QR3A 4DJEC 1D9EA 1XSKA 1K7EA 3GSMA 1VJZA 1OYCA 3BMVA 1S3TC 3WJSA 4CN6A 2DQWA 3UI6A 1JEZA 4HOZA 2PC8A 1JZ2A 4HYVA 1XDMA 2HJPA 2VKZG 3TX9A 3E0IA 1QPFA 5AC5A 2FPVA 1XRFA 2AL2B 2JF7A 1K9FA 3GKAA 4AZCA 4UFMA 4V2XA 1GWJA 2XIIA 5D02A 3SIZA 4AF0A 1K6AA 3ARQA 1GVIA 2WKGA 4UDMA 2ZRVA 2Q8LA 3WQ6A 1AJZA 1JPHA 4PUNA 5DO2A 1XYAA 3W6YA 3W85A 1F61A 2QCEA 2GVEA 5FJJA 3ZQ9A 2HK1A 3KE0A 2A85A 3RO6A 1WKYA 1PB0A 3JRKA 4UBPC 2PE4A 3M0XA 4LOCA 4FOKA 4EPBC 4PZVA 3P3BA 3UVIA 2D1ZA 3KS5A 4EVZA 4X3ZA 5FJRA 4EKJA 1GEHA 3SCVA 2YYTA 3G8EA 4MWAC 1RD6A 1KQZA 1TWZA 3WD4A 2CYGA 3NPWA 4B3ZA 1J2BA 1MYRA 2WZIA 1Q6HA 1LRTA 3ANUA 4QDPA 4IMGA 4P7QA 4JS3A 3QFWA 4NILA 2PB1A 4Q4SA 4UTUA 2XH2A 2FZNA 4LGXA 1TMLA 4H8UA 4AD3A 3R58A 1FWRA 4C91A 3NZ1A 3FJLA 5FAGA 4AWUA 3EOUA 3O5JA 2D2HA 4AD1A 2A3HA 3UR8A 3WF1A 1M7XA 3NVDA 2W9MA 4K6AA 3TZNA 1EBHA 4NQ1A 3TMQA 2ANUA 2HBVA 3WBYA 4FOUA 1RD5A 2H3BA 5A69A 1YPXA 4POCA 4MLRA 2P1FA 2J7DA 2OCZA 2XFFA 5FF2A 4NU7A 3TC5A 3LV6A 3WUBA 3FKRA 1RXOB 3UI4A 4PMUA 4JHZA 3TYAA 3WMSA 4JXCA 3PR2A 2PODA 3TCZA 4LYKA 1QOXA 1EX5A 1Y5VA 1CBGA 3RLGA 2VFGA 4GIVA 3MUY1 5LSMA 2VC5A 1QRQA 1OF8A 1EZ2A 1BD0A 3B4UA 3L4XA 3TONA 3NO3A 1ZBKA 3S42A 2ZUMA 3DFQA 2HBXA 1OFRA 1SJBA 1KBLA 1QW9A 1E56A 1OF6A 1JPDX 1RV8A 3W7DA 3H8AA 4MKSA 2GYIA 5DRCA 3V18A 4RXFA 4WOZA 4DO6A 3QJAA 2ZOXA 4Q7IA 3CGNA 4ZO6A 1UP2A 2J6XA 4Y9MA 1XIFA 3NG3A 4JX5A 2YW3A 2DUXA 1EGVA 4G9PA 4G7FA 3LK6A 4LS0A 1KLYA 4J4KA 3W87A 1RQEA 3IGHX 2V0TA 2EPHA 2V3DA 5HMSA 2PN0A 1EC7A 1VFTA 1X8FA 3CLWA 1O1HA 2JGYA 1EA9C 4YHGA 1ZJBA 3RDKA 1ICSA 3T6CA 2FGZA 1P0EA 3LNPA 2Y5SA 5CH9A 1ZRQA 3R89A 3L4ZA 2ABBA 1Z41A 3TNBA 4S3EA 1B9ZA 3S1XA 4PUDA 4N2YA 1PS9A 3AZRA 4WDWA 2VGFA 2BY2A 2NVCA 5AC6A 4RE4A 3ONCA 4DQWA 4DLMA 3EPNA 3U5YA 1VKFA 1VYSX 1TPVA 4JGDA 2Q09A 3TYZA 3OQ8A 2PWGA 4K3ZA 4DELA 4MKNA 7REQA 5BZAA 2WKLA 3KOXA 3AC0A 4LVFA 4BR1A 1NOWA 5K9XA 4AZGA 4UQAA 4R9XA 4GY0A 3C52A 1F6KA 4AZ7A 3BAXA 4IMCA 2EAWA 4Z2IA 4O4WA 1OC5A 3SCTA 1YDVA 1R3SA 2AL2A 2Z1KA 5A6KA 4IT1A 4Q8OA 3H2MA 4O1AA 2Y6ZA 1B30A 3AIVA 3DFOA 4WKFA 3CHDA 1XICA 3T78A 1BYDA 2WVVB 4MMWA 2CHNA 1YBQA 1BL4A 2XM1A 2VCBA 2O9TA 2JEQA 1R3TA 4DXXA 2DZBA 2ZZ6A 3O7UA 4JTEA 4O50A 2E0PA 2FZBA 2XN0A 5I78A 3QH2A 4S3BA 3W1XA 4BWLA 1V93A 4DBUA 2WMGA 2QR6A 3TYCA 4ZQPA 3S5ZA 2D3NA 4E8GA 1IEVA 5G1TA 1QR7A 4BF7A 1DJGA 2D0FA 3NEHA 3RITA 1ONRA 3W01A 1XGDA 4LU0A 3GUWA 3NDYA 4C6CA 3LOTA 2P8CA 2TRSA 5GQBA 2PTYA 2D69A 2E67A 2OGJA 4HPGA 1RK5A 3BOLA 1XM3A 1Q6OA 5HMEA 1V08A 2QNEA 3ES8A 3G1SA 4OJYA 3VGEA 1P7TA 5CGMA 4QTGA 5IDZA 2HCVA 2MPHA 1G01A 2QCCA 4JIRA 3N9RA 4H7CA 3WLOA 3LGGA 3AIUA 1LQ0A 5CQ1A 3WD2A 1E0XA 3RM8A 4IPIA 3AMKA 3R0KA 1GVYA 1E0TA 3L2MA 1XLIA 3CHFA 2VEFA 4S39A 4N7QA 1CEOA 2XP3A 1XLAA 4OGZA 1IF2A 4KIEA 4RDYA 1EGMA 1BPLB 3LENA 5D2XA 4IQCA 3RF9A 3M5YA 1NU5A 2AOSA 1QHZA 1WAUA 2GVYA 1EDQA 3WLNA 4QX4A 1IV8A 1UUOA 1VJIA 3QC0A 3BH4A 3BV4A 2HNHA 3WMCA 3CV7A 3S3GA 3I3DA 4DRKA 2J8TA 3B0UX 2A7NA 5HW6A 3BGAA 2CBVA 2E1DA 1KC7A 3WENA 3KOWA 3W70A 1RP8A 2ZIDA 3C5QA 1U5JA 1RALA 3CH0A 4IXXA 4D1JA 4HU3A 4JBRA 4JX4A 5I3KA 3PZOA 2RSEA 5DIVA 3FW6A 3OEXA 4XZMX 4XSLA 4HZ8A 3MKVA 3BC9A 3D47A 3N19B 5D37A 1LCOA 1JQVA 2CLPA 3NQGA 4HJFA 2WOQA 2EPKX 1GOQA 1VCGA 1KBKA 2C1GA 1K8XA 1UKSA 3F2DA 3IGSA 2GL5A 1W1IE 2DZPA 2RGLA 2NX9A 2R1LA 3NWRA 2PZNA 1KTCA 4BFAA 3IUHA 2QZRA 1TYGA 3W75A 3AJ7A 3DYPA 3UG8A 2ZR5A 1EQ3A 4JIIX 3O5OA 3EDDA 3A9IA 3L5LA 4JX6A 3ABQA 1SU5A 4H8NA 2GSJA 2W67A 3NPVA 3M0JA 3R6IA 4GY1A 3VDBA 1XBXA 2DG9A 3VD3A 4K7YA 1XS2A 3MCOA 2O55A 1MEHA 2IUZA 2GGHA 1W9PA 1JFXA 3LTPA 4GKTA 4H9TA 4JHOA 1L1PA 2O9PA 3W7JA 3A3XA 3GXIA 1WNOA 2VWTA 1J6YA 2Z2BA 1C3FA 3H2AA 2G97A 4E3VA 3RIKA 2Q8ZA 5FIPA 3U5UA 1YIXA 5F1UA 3BPWA 4JFTA 1E6QM 1E6RA 4K7VA 3S5SA 4GK8A 1Q2SA 2A3CA 5EMLA 1XIMA 1XGZA 4IL0A 3M0IA 1O1ZA 3R0UA 1TCMA 3LRLA 2V81A 3H22A 2W92A 3GR4A 3SJNA 4IZGA 3G1FA 1R9YA 3IJLA 1JDCA 3R0DA 2AWGA 1ADSA 4Q8NA 2X2YA 3A3WA 3CT2A 3LHZA 5CPNA 1V6TA 2J47A 5F2LA 3N6QA 1WP6A 3BAWA 3BW2A 4ADUA 5HNNA 2NX1A 4B5NA 2ZDRA 5C70A 1Z32X 4XAYA 5E6ZA 4B5VA 3A12A 2IPWA 1W8GA 3H26A 1PHQA 4PMDA 2OWCA 4QEHA 1POJA 2VXNA 3VABA 3W22A 1L8PA 2WMFA 4MJ2A 3PBYA 4GUGA 4UZUA 2RUQA 4O10A 3SADA 1NOFA 8XIMA 3DFSA 5LHEA 1QAPA 2Y4SA 3F5JA 4FX6M 2G3IA 1UR8A 2FKEA 3GPKA 3MKKA 3PZ9A 4JYFA 4MZ1A 2EO7A 4GH1A 3LLDA 1UR9A 4HPXA 3TAKA 1IT0A 3S2MA 4H41A 1NVMA 3LPPA 1PO9A 4JNYA 3ISIX 4GZEA 5BRBA 1S46A 3KBNA 1HKIA 2WKJA 3LM3A 1TCOC 1KCLA 2XHYA 1NOUA 4LAUA 4WSKA 3REQB 2RKXA 2GJPA 3T2PA 1E0UA 1GZJA 2FFIA 5B7YA 1SO3A 4HU8A 5T8GA 1PCWA 1X1NA 1JZ8A 4IGSA 4MAVA 1Z8AA 4TYOA 1L8NA 2J7GA 3CHEA 4LS2A 2V63A 1J0YA 2WPGA 3M43A 4DRQA 4GINA 4G6CA 1V4YA 2NW0A 3CPRA 4K2SA 1H7PA 2BXVA 1H5YA 3GO2A 3GTXA 2CLKA 1EJ7L 3TNOA 1AMYA 4B9YA 1MSSA 4H9VA 9XIMA 1JYNA 3O05A 5AHIA 3BDKA 4JKMA 7TIMA 1HKWA 1T11A 1BLIA 2JZVA 1XDJA 1GTEA 4H4IA 2Y8UA 3VGDA 3LXAA 4KBXA 1XQLA 2DSUA 4QJ5B 1HTIA 1XLLA 1C91A 2EGZA 1V3LA 1ROTA 5AYIA 3FVDA 1J4EA 5A6SA 3GU0A 3S6TA 5CSUA 2WO5A 5AHLA 3GG1A 4H6RA 1M65A 4MNJA 5JBEA 4S1FA 2Z0IA 5H8PA 3R1ZA 1KT1A 3VUSA 4GMEA 3PJUA 4RZ5A 5HNRA 1HKKA 3GB6A 1H1NA 1SFLA 4KCWA 1RR2A 5I2UA 3KADA 4LAYA 1Q6RA 4WOQA 3WUEA 1XSIA 2G8ZA 2ZR6A 3L67A 5MKGA 4ODNA 4WDUA 1XBVA 4PB4A 2A3AA 3NSNA 4QXIA 1SZFA 1XI3A 1VP5A 3MCNA 3VI2A 1JJKA 3VMOA 3HZ3A 2O4QA 5AYBA 5CCZA 4N9DA 1NMWA 2OEJA 4OQVA 1EA0A 1JGMA 1XBYA 3UQBA 3GHTA 1V0MA 5DXYA 1FKBA 1TO3A 1XPYA 1NMVA 1LWIA 1R30A 3N4EA 4UNLA 5BOEA 1E55A 3ITTA 4GGHA 1WUEA 3B0VC 4KFPA 2PTWA 9RUBA 1F5ZA 1XIEA 4O28A 5A8QA 2IMRA 4JTTA 4S3FA 1XCWA 1A0DA 2Y85A 3PTDA 3C4UA 4IX2A 3HOJA 1DTUA 2GQ8A 3VNMA 2GJXB 1IWPA 4PODA 4XBSA 2QJHA 4RCXA 3VZYA 3I4EA 3UQIA 1XLEA 1TZ7A 3CB8A 4GUHA 4WF7A 4ZQNA 4JYDA 3EY6A 3H2NA 3YPIA 1EB3A 1B6CA 3M5ZA 3PG8A 1W5OA 1J9YA 3T0AA 5JVLA 3MA8A 1H7XA 4JFSA 2BWGA 3VKBA 1SJAA 3RCYA 3AXXA 1DQUA 1VFMA 3NQEA 1FKFA 1J11A 4NY2A 2QS8A 3UERA 3OBKA 2PTZA 2YW4A 3WBAA 2OSXA 1A3HA 1PSCA 1UKQA 4E8CA 5LZLA 2XINA 3WLLA 2VZUA 4V33A 3GTNA 1VAHA 4MGGA 1F07A 3EWYA 1TJ2A 4F9JA 3OIXA 4DPQA 4J2MA 5FF7A 1OVDA 3L0KA 1JCLA 1PX8A 3W1RA 1TVNA 4N9BA 4XO6A 2RDTA 3R8HA 5DMYA 3E2RA 1YNYA 2YL9A 3SO7A 4DXKA 3L4WA 2NV1A 2NSOA 4Y8FA 1Q6CA 1ME8A 1A5SA 1KNWA 3T05A 3U2ZA 3CASA 2PDXA 4DHGA 2QCMA 2GGGA 4I7VA 1TQXA 4MYXA 4HSHA 1BAGA 4NJHA 1IWBA 3U2OA 5DX7A 2CERA 2JE8A 4LV9A 5HA7A 4C6FA 1OD0A 3N2MA 2Y24A 1ITXA 3C2EA 4EPEC 4DJEA 5DCDA 4I5RA 1TV8A 1S39A 1SR9A 4YXGA 5HWBA 4U84A 3HF3A 4YL2A 1P6CA 2J7BA 1A5BA 1KRMA 5U7SA 4UTWC 2XUCA 1BYCA 3IGUA 4DYKA 2Y8VA 4PH6A 5JMUA 1DWIM 2QCLA 5CSRA 1KXVA 1S2TA 3N25A 3PZVA 4KR0B 2VR4A 3QHNA 5D33A 3IIXA 4XAGA 3AZSA 2VCDA 4JOMA 2F38A 1EJSC 4TVCA 4AH7A 1P1MA 4G50A 1KR0A 1R2RA 2GVGA 4IIGA 2XVLA 2OYMA 1Q1CA 1EO7A 3BJTA 2RQSA 1Q66A 1QI5A 5GVJA 1LRNA 4Q4OA 1A4MA 4MWAA 2UY4A 3PFMA 3O07A 3OVGA 1QTWA 4CQ8A 1E6XM 2ZXBA 1VPXA 3DG7A 4XD6A 2WQPA 3G1RA 2B5UB 2JQXA 4ZE4A 2YB4A 1UQZA 2FAPA 4GNVA 3IHZA 1S2WA 4AD0A 5DELA 1FWBC 4AQLA 1LOLA 4V15A 2VZSA 3DIPA 5LA1A 4PUJA 4WJ8A 4LVGA 1GPWA 4RV3A 4J3XA 1QNQA 5HWMA 2A5HA 2D2GA 3H53A 1XUZA 3TLLA 1UPMB 3W1TA 4O57A 1OBAA 2TAAA 5A6JA 3AWNA 3O5MA 3O5DA 2VR2A 4MPKA 3TDBA 5U4NA 1U30A 3HPFA 3WLJA 4AD2A 4LC8A 1FAPA 3MUXA 3P93A 3ABOA 4H01A 4O1CA 2BGNE 3I7QA 2E9MA 1JVWA 3SFKA 3RGCA 1UPPA 3KDOA 4M6VA 2FMOA 4CD4A 3OGVA 4CQCA 4F48A 1LQAA 2GJXA 4KRTA 7PTDA 1MFUA 4AC1X 4WRHA 1JAEA 4MVAA 4KQZA 2GQ9A 1SFTA 4GQBA 3VM7A 4UMCA 4WD0A 1ADDA 4O1BA 1TWSA 3KAFA 1OT1A 3WCZA 1HGYA 1UROA 4Z2HA 1E9LA 3EAUA 1P0NA 2E6YA 5ABEA 4AX7A 3F4CA 2JK2A 3N15A 1BQGA 4UTMA 3CQKA 3DBPA 5A6MA 4LBSA 3IJIA 3WLKX 1TV5A 3UETA 1TE1A 2B7QA 3MP4A 4JTQA 2D20A 1V7YA 1UUMA 5LNSA 3DCPA 2CNCA 4LEQA 4MB5A 3VDCA 5FL0A 2E28A 1VR6A 3KAHA 2ATSA 2CLIA 3AYRA 2ZC1A 3BG3A 5AOUA 5IRPA 3V4BA 3NAVA 1RCQA 3NJ3A 4LUYA 3ZJ8A 3IRSA 1M6JA 1ZCNA 2BVDA 1XWYA 5AYXA 3CM4A 4CCCA 3LXCA 1GOKA 3W02A 3CHVA 1WZAA 2RUSA 4W9OA 4US6A 1FBAA 2X7VA 2I7GA 4C6IA 4BS0A 1EPXA 3TU9A 1UG6A 4JIQA 3DUGA 1QI4A 3MT1A 4ICCX 4R7WA 4PCFA 3RX3A 4JTLA 4ODPA 3WNPA 1P5QA 3VDGA 3QC3A 4DUXA 5I06A 2AKZA 5G4EA 4PTNA 1JI1A 3LSBA 3A9BA 1L6SA 3CH9A 3ERPA 2C3ZA 1B3ZA 4U4MA 2HRWA 2VFEA 3N17A 4WQ6A 4UUIA 1FHUA 3CNYA 3QYSA 1VBGA 2BOEX 1JYXA 5AZ0A 4IIHA 1PWMA 3N14A 4Q8PA 4AEEA 3H21A 1BVZA 4CEXC 6A3HA 1ZY9A 3MVIA 3SUUA 3QXBA 2PZ0A 4AY1A 2D22A 4FNQA 3WZ0E 1WPCA 1GT8A 4PCPA 3GHUA 4PUUA 1I2NA 4Z1CA 3K4DA 3CZLA 3MUIA 3MSGA 3RM4A 1MW2A 3M4HA 1Y5WA 2ZWZA 1RJQA 4D8ZA 1QPNA 2JIWA 1OQFA 1RH9A 5E9XA 4HCLA 3KEHA 2GVJA 1UKTA 2X1SA 1CIUA 1L6YA 3L12A 1A5MC 4X9SA 2BVTA 3GFZA 4AHOA 3KVKA 3SECA 2XPAA 2E6FA 3K1DA 1RHCA 1T8XA 1YDYA 1H7OA 4BF9A 2ON3A 2G5WA 3VXGA 2OSYA 5G2WA 1BF6A 4V28A 1YDNA 3K5XA 4A4AA 4TIMA 4LB3A 4D8AA 3L66A 3QY6A 3GC5A 1YLVA 3MY9A 3B8SA 2BSLA 3CZEA 4NSBA 1JR1A 1BTMA 4RPPA 4W84A 4XKMA 2TSYA 4L3NA 4DRIA 1KXHA 2C13A 4OE7A 1QT1A 3QW4B 2FH8A 4PE8A 2F6KA 2ZX9A 4GX9A 4J3TA 2J7CA 1OC7A 4K37A 4ZPWR 3EMCA 1MXDA 3ZR6A 2EG8A 1JCXA 4OBSA 3FXGA 4H04A 2J7EA 3F03K 3BUVA 3FK4A 4HNVA 4IOTA 5C7HA 4X9YA 3GIYA 1WOBA 1UWUA 2OGYA 4GWEA 2WVTA 3KP1A 1Q7MA 3V3WA 2WHMA 1AQMA 4JTHA 2NQLA 5D38A 4RZ4A 2W66A 1JDDA 3FAWA 1N82A 4XVEA 4HBKA 5LGZA 1J01A 3USZA 1I1WA 3AIQA 4IP5A 4B15A 2VDHA 4WSJA 1OK6A 4MDPA 3VCCA 4KEMA 4X63A 2H9AB 1GNXA 4O15A 3O9NA 5L9FA 4HA0A 2DY3A 2C19A 1XLKA 2YDAA 1VEMA 3WMBA 1XIIA 3CL6A 1ONWA 2PF0A 3C61A 4DWSD 4EE9A 3AS3A 5F4XA 5LXXA 2WZHA 3WQDA 4DJDA 5I3HA 1X6LA 2YCJA 2AMGA 1E51A 3O3RA 3RR4A 1A3XA 5HANA 1E4NA 4O1DA 4LUSB 4HQVA 4IP7A 1DL3A 1VENA 1R7AA 4QNEA 3O6CA 5CPLA 3C2OA 4GE8A 3XINA 2WLYA 1KBIA 3W3OA 1HQTA 2YCIX 3LD5A 2XH7A 6PTDA 2D73A 3IS4A 2VCAA 1O12A 3VVGA 1JQXA 1V3MA 1KM1A 4UMAA 1XIGA 3USBA 3QN3A 4IFOA 3H9RB 1RY0A 3LHVA 1MO0A 5DCEA 1JNEA 5DLCA 4OBRA 3JYJA 3M0YA 4IQJA 2YPIA 4OWGA 3TC7A 4HNNA 1F8MA 3H4WA 4PSPA 3F4DA 1FWJC 2HSAA 3EWDA 3M07A 4PRRA 4ZEPA 3UJRA 4AXNA 3BK0A 2YA0A 3GNRA 1FFRA 4LYPA 3NA8A 2P3EA 3ZT7A 1V0LA 1X6NA 4CVUA 3SCOA 4ODMA 1EHNA 1FKGA 1SZGA 4KCUA 1XSJA 4M0XA 4JIPA 2FHFA 3C2RA 1EP1A 1BXNA 3PZIA 5FEWA 8CGTA 2GZXA 1VC4A 1O94A 1IXOA 5LIXX 4OU1A 3S2NA 5C9WA 1H2JA 4W89A 3BGGA 3P8IA 3EXTA 2PP0A 5HUAA 4S3KA 3H2OA 4BI7A 3MHUA 4NJIA 2VC7A 3E5PA 3RXZA 4N42A 4IPNB 3QLLA 4AIBA 3E3HA 4RDZA 3VIFA 1YE4A 5EPDA 3WKZA 1CW2A 2J7HA 3E0VA 4O19A 2VOTA 5EMYA 3PUGA 5F4WA 4A21A 6TAAA 3NPUA 4M6QA 1PZ0A 3GM8A 1QVBA 2VC6A 5J5DA 1JRBA 3PB0A 4JQ1A 2B0MA 4Q8UA 5GNXA 4AYGA 4B5SA 1D7JA 1E15A 5AYZA 4ROQA 3P6LA 2Y63A 5JBFA 3K8LA 3ECQA 1SO6A 5C7VA 1B54A 1VFHA 3SCUA 4A6GA 5IFTA 2ZC8A 5F2IA 3HGOA 2JKEA 3FA3A 1DQWA 4G8TA 3HU7A 3GX9A 3SQMA 5DCBA 5DBUA 2Z6JA 4J5NA 3WH8A 1PCKA 2PD5A 1OIMA 1KM0A 4Q6JA 3L0GA 2Q02A 3PRDA 4YTSA 1JDAA 4L64A 1TCDA 1DEDA 1QUMA 3TDFA 1TUFA 4LAWA 1LM1A 3OBEA 5DT7A 3UXIA 1V77A 1LBLA 3HBLA 4PN2A 7CGTA 1D3CA 1J4IA 1DXFA 1HGWA 1GG0A 3QHMA 4PL1A 3WNMA 2PURA 1DHPA 3I65A 4IPXA 3OLGA 3LUOA 3SJ3A 4ZOEA 3GBEA 5FI8A 2DEPA 4QE4A 2PLCA 4EIVA 4N4PA 3TJLA 2NLIA 4DI9A 2LKNA 1PX3A 3GAYA 4YLWA 1T96A 2H9AA 3PZMA 1M5YA 1MI3A 3V75A 2PDMA 1IEWA 1K70A 4FLSA 5TQLA 2ZUTA 5A8MA 4W8AA 1SO5A 2QT3A 1VCFA 5A2BA 1DBTA 1F7BA 4FN2A 1AW2A 2VMFA 4HMCA 2ZA3A 2VFIA 2CLFA 1Y0EA 2GWGA 1HFBA 2FTPA 4W7WA 1TUXA 1EJTC 3VIMA 2X05A 4LUSA 3PNUA 3SCNA 3WL1A 2WNQA 3O2LA 1HKVA 1GONA 1AMKA 3DEQA 5KINA 2WBKA 1DE6A 2A79A 3C8FA 1GEQA 2GSEA 3ZS4A 4INFA 1BKSA 3SZ8A 3CAKA 5IM51 4YNGA 3LGDA 3GFXA 1NEYA 1X8CA 1P0DA 3P67A 2MLZA 1I45A 5KSWA 1H61A 1V6UA 3RX2A 2UBPC 1IQ8A 4JTGA 1TV2A 3EA3A 5T9CE 2DSVA 2OT1A 3EWCA 4QE5A 1B3YA 2OOFA 1QU4A 2R91A 1NELA 3PBVA 1T41A 1L6GA 2EBNA 4WVXA 2FKPA 3EIPA 5DMNA 1XHGA 3QW3A 3THCA 3AXHA 3PSVA 2POTA 5EBUA 3LRMA 2UZ5A 2I1OA 1J18A 2YSWA 2V30A 4AIOA 3QF0A 4Y6GA 3V35A 4PC8A 3VYLA 3CYJA 1WV2A 5K9DA 2DG3A 4QEEA 1H63A 1KM2A 1XH2A 2XYLA 1LBMA 5LKYA 4IL2A 4YJ5A 1G69A 1AJ2A 4G7EA 4XKYB 2NQJA 3LUTA 3PTQA 2ACRA 5G4HC 1GHRA 1FCQA 4AW7A 4WY0F 4LFYA 2W79A 1QBAA 4I9MA 3K8MA 4O11A 3E74A 3MI2A 4I7UA 4CNPA 1JZ7A 1XD0A 2TMDA 5K7JA 4IQDA 4GO9A 3S9ZA 3PBUA 1TSIA 3MV11 1H0GA 4XZLX 1KD0A 3G1AA 3WF2A 4W9TA 4BEUA 3W00A 1J79A 3D3FA 2A6NA 3LLFA 3IRDA 1NTHA 5TNVA 1OX4B 2YR1A 1O4UA 5GPGA 4A8RA 2Y7GA 2VGIA 1JPIA 3ZVHA 4YHEA 4BZYA 4MF4A 3ZYZA 3ORWA 4GIYA 1SGJA 4FA3A 4W4QA 4K1WA 4Q33A 3SCWA 1LG1A 4DRHA 4JICA 1MQQA 6XIMA 2BHZA 2E25A 2WMIA 1R2TA 3OGSA 3CU2A 4ML9A 1YRRA 4N4QA 3K2GA 5CZTA 4K8GA 1KQYA 1MUCA 4ZO7A 1B1YA 5AHNA 3K4AA 3V5CA 3PA7A 2YZ5A 4F0LA 1HNYA 1R6WA 1GZGA 4J40A 3L23A 3FA4A 4UQCA 3VE9A 1P0BA 3ARWA 3NUKA 3PUOA 3UP8A 4F0MA 1GVEA 3B9NA 1X7FA 1DWAM 3ITGA 4C1LA 5D2TA 3MCMA 4RZBA 1NSGA 3QSRA 4KKXA 3PK7A 1X98A 1TPH1 1OZMA 2Z1BA 1XCFA 4QSHA 1VPQA 3KBSA 2CZVA 1UWSA 3MMWA 2KAUC 4P8UA 4QE1A 1E3ZA 4UNKA 4DN1A 3CUZA 3VNDA 3KFTA 1VFUA 4HHLA 2DZTA 4WXYA 3V0SA 3OQEA 2H90A 3WEMA 3B8WA 1HL8A 2PEVA 3KAGA 2DZWA 3VIPA 2VUYA 3MDWA 4MFEA 4X0VA 1FWWA 5DY2A 3FV9A 3CWNA 1TPC1 3BSMA 4IGHA 1OX6A 5CJ5A 1ZFJA 3ITOA 4UTWA 4Q6XA 2FQIA 3EBVA 1HL9A 3N9SA 3S5YA 3PUDA 3AHTA 7TAAA 5G2IA 1FP8A 3NO1A 5K3VA 3NGJA 2XN2A 1WX0A 4ZOBA 1WDSA 1OINA 4L1WA 2OEMA 2G95A 3EOSA 1E44A 1WDDA 5FEXA 3AU6A 4LCQA 3TQVA 2EG7A 2ZUVA 3MVTA 3P82A 1E4MM 3QBUA 4EX4A 4U86A 4PUWA 2XH4A 1V79A 3O06A 3QMTA 1LBFA 2YL6A 4KT2A 2BXYA 3GYEA 1LORA 1XIDA 3BGJA 4WJEA 4P7OA 3JYMA 1ZJIA 1FWTA 4C1NB 4JFUA 4W7UA 5C6MA 2OR2A 1V0NA 1ZALA 3IANA 1K3UA 4HSNA 1MQPA 4H9XA 3MYPA 3M41A 4JTAA 4CU8A 5KZEA 2RJGA 1X96A 1HN1A 3QGKC 3R25A 4GUJA 4I6KA 1ZGDA 2WWCA 1HVQA 1BKFA 2ZQVA 2GGEA 5M1TA 3S1UA 4DUWA 1JDEA 3GVVA 3UG4A 3PPHA 1WO2A 1CYGA 4ZCWA 2E77A 2DW6A 3W1MA 2PV1A 2YL8A 1SUXA 4XIAA 4PR4A 1OADA 4XKYA 3WJYA 3UR5A 2V67A 4NYUA 4C5YA 1VGAA 1FWSA 3WLHA 4HKPA 1B2YA 3E9AA 4WUIA 3QMRA 3GKFA 2WAGA 4HN4A 4DB7A 3FSTA 4K8HA 4YU1A 1OEPA 3STEA 3KRUA 2J74A 3QQ0A 4TX8A 2VO5A 4UOQA 3T0BA 3N6JA 3AS2A 1NIUA 1JXKA 1Y8BA 1D3GA 3GNOA 3U6WA 2IXVA 3ZLGA 4A3HA 3GBDA 2X40A 2KFWA 2DT3A 2VYOA 5LNVA 4NZ3A 1FCBA 3W1LA 1EQCA 3AHXA 4ODKA 2C8NA 1OCQA 3HB9A 5SWUA 5GJMA 4QS6A 5E70A 2CPUA 1SFSA 2RDXA 4GOAA 4M82A 2G3NA 3RHGA 2QGHA 5KZ6A 3WNKA 3ONBA 1O66A 2ZUWA 4LEFA 3NQBA 1GOXA 1R47A 2AQOA 4FZIA 4IJBA 4R0XA 1KWKA 5IOBA 2Y1HA 4J4OA 4A8LA 3U3HA 1UKPA 1K8CA 1UZHA 4OV9A 2J79A 4LF2A 1O5RA 3MUZ1 3MUAA 3FAPA 3A22A 4IIFA 1A5NC 4XAFA 3Q2DA 3A6OA 4AIUA 3GIQA 3GYCA 3UZYA 4A2RA 3C0QA 3CWHA 1XINA 3AROA 4XBJA 4XZNX 4IISA 3THUA 3W6LA 3KABA 4CQAA 4Z1BA 1DIDA 1W9BM 3S8HA 1SQ7A 3UZWA 2FZMA 1EHAA 1EF3A 1LF1A 4JTIA 1O60A 5FACA 2GDQA 3WQ5A 1C29A 2C14A 4Q8WA 1J0KA 4AMCA 2NVDA 2NQZA 1V03A 1J96A 3T0CA 1UC5A 1U1JA 2FVMA 2YBTA 2QAPA 3AYTA 3R13A 4FNTA 4PMVA 4P7RA 3T07A 2G3JA 4R3UA 3KTCA 3OVQA 3SCRA 3VIHA 4ADTA 3UZZA 1G4PA 3W23A 3EX1A 1PXGA 1T0OA 1J2WA 4JN6A 5CC3A 4DH0A 4FF7A 1Y65A 2DVTA 4A2SA 3GDTA 3H12A 5M17A 4FAMA 2Z6IA 1HVXA 1TR1A 4CD8A 2PWDA 5DN1A 4DZIA 4MWAE 5I07A 1IWAA 1AD4A 1QZ2A 4Q4QA 3IK4A 4GABA 3E12A 3ZM8A 3B7XA 4ERGA 4RX0A 3W1PA 2XFRA 3LLXA 1BWLA 4BWLC 5DF0A 4NXSA 2ATMA 2C91A 3PY2A 1A7XA 1XXXA 1UD4A 4L4LA 4WLCA 1UQYA 3MDUA 3S47A 3CZ8A 1AD1A 4A35A 5C2CA 1WQ5A 3G1DA 3EKGA 2ZUNA 2WHLA 3EPOA 1GJUA 4WY0B 4H9YA 4ZE5A 3ZXWA 3PG9A 1OFDA 1OCBA 3THQA 4LY8A 2O7SA 2XIMA 5HKGA 3TROA 4PMOA 2QJIA 1ISVA 4HB7A 2DT1A 3M47A 4H00A 1VS1A 2OLSA 2QDEA 1HO4A 4ES4A 3LN3A 4XK2A 4DAIA 3N04A 4EXBA 4M7TA 2QCNA 4YS1A 4IT4A 4UOJA 4GQQA 3TYUA 3WLQA 3VE7A 2NQ9A 1KFBA 1MEIA 4J28A 3OB8A 4HIBA 1W3IA 3O0FA 3N29A 1POKA 1YNPA 3QTGA 2X1UA 1R3VA 2F6UA 4X60A 4AC7C 3UGRA 2XP5A 4LVDA 2IXUA 3M0LA 2B7NA 2BBFA 2IS7A 1W8SA 3STGA 5IDIA 3QOKA 2V3FA 3BICA 1EIBA 3H2CA 1SZEA 2DV0A 2VFDA 3DFPA 3QKZA 4JNMA 1KA9F 3ITXA 3L4YA 1RCOB 3GLCA 2W27A 3U57A 1L2UA 1HL2A 3CIXA 4MPQA 3AAMA 2Y2WA 3VFLA 3W7NA 2VFHA 4JKLA 3OHMB 4KQNA 4D6DA 2PWUA 2XP8A 4C6OA 1AK5A 2OQYA 2WYSA 3IK2A 1K9DA 4XAKA 3AMDA 1Q3NA 3LTYA 3MP3A 1N8FA 1GUVA 3OW1A 4A05A 3BLLA 1VJSA 3ZSTA 2OO0A 3C3NA 5DMLA 4DF2A 1LLZA 1TQJA 3GTHA 2XGBA 3UWUA 3QQWA 3UXLA 4H83A 3ATYA 4CD5A 3IJ6A 2JKPA 3AIWA 1VFFA 5EB8A 2DGAA 2A2IA 1S5WA 2HEJA 3OPSA 2IQDA 3TVAA 1NQ6A 1OABA 4KEUA 3H4GA 4UC5A 3P8JA 5AN7A 2YIHA 3BJSA 3WK0A 3DKLA 2V2HA 2WANA 4Y7EA 1OFAA 3S0CA 3IJ7A 1LUCB 2X41A 2E5BA 1GOMA 2IQ0A 3DHDA 3B9AA 4EACA 5HMFA 2ZWYA 3MANA 3EA2A 5HXMA 1DP0A 1M53A 1EDTA 2WC4A 4P61A 3QGAC 4AFYA 2I14A 4CCDA 4KWUA 1KXTA 1JNTA 3C3UA 4QQ3A 3B0YA 3R5EA 4BA0A 1QHOA 3UWQA 4C6QA 2J6VA 3I7SA 1F3WA 4W8LA 1M03A 4KEVA 3H7RA 5CG0A 5DO8A 4GYPA 1IT7A 1WYIA 2NWRA 1UH2A 4U2ZA 3IARA 1TX0A 1E4LA 1U33A 1K8YA 1ITUA 3SN1A 3OYZA 2OX4A 3EDKA 1FQ0A 1OZQA 2RUCA 4GJIA 5HR6A 1HW6A 1JUBA 1E72M 4QSFA 4PGLA 4Z2KA 4AWTA 4Z2LA 4ASTA 1BFNA 4WCJA 1W1B1 3S9YA 1YKWA 3T1GA 3RPMA 1O5XA 4C6DA 1R9ZA 4R88A 1G6CA 2V2DA 3T7VA 4TW7A 4HZ6A 1R86A 3B06A 2Z1WA 2AMXA 2PU0A 4XZIA 4FLRA 3UW6A 2GJLA 3MWCA 2YKKA 4NHVA 2HE8A 1VBRA 1U79A 5FJOA 3QQ1A 4UFJA 2E6AA 4LQ1A 4IMEA 2W3ZA 3BURA 3A4XA 2FPTA 3CJPA 3N3MA 3B05A 1U1HA 1WDQA 3ZT5A 3HGRA 1A5AA 4NZ4A 2G4JA 4WY0A 3MQTA 2F61A 2O7QA