3RM8A

Amcase in complex with compound 2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
total genus 133
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm8A01
3FAWA 2VX5A 5A8OA 2ZUUA 1FP9A 4HOZA 3L4ZA 2WK2A 5HBFA 4PMXA 3K8LA 1GOMA 3UR8A 1BGGA 2X05A 4OZOA 5JUVA 1UWRA 3F5JA 4P7LA 3N17A 2EEXA 1S46A 2CBVA 2W4XA 2ZXAA 4D6GA 3EMCA 3K8MA 4JFVA 2VO5A 3PZIA 1QPKA 5A2CA 1MQRA 2PF0A 2WXDM 3N04A 3WL1A 5DT7A 3ZJ8A 4BQ4A 1FHDA 1J0JA 3AI0A 1X1NA 2GSJA 4NRRA 2BY0A 8CGTA 3EDFA 4JHOA 3MUIA 1ISWA 3L4UA 4AD4A 2XFFA 3FHAA 1H4PA 1BQCA 4W84A 3B9AA 2W61A 3GBDA 4AZ6A 2Q8XA 2G3MA 3THCA 2W67A 4AMCA 3EDJA 3NJ3A 1X6NA 4JZ5A 4NSBA 3AOFA 1IT0A 1QNPA 2WSKA 4M80A 2YL6A 3NSXA 1Q6DA 5A6AA 1N82A 1MVYA 1W3KA 1GOOA 1BFNA 3N18A 1B3YA 4AZBA 3VD7A 1VFUA 3SIMA 1PJ9A 2ZXQA 5BXSA 1VBUA 1J0ZA 2VVSA 1AVAA 2JEQA 5E0CA 3GH5A 2D22A 2VR4A 4J3UA 1R85A 2O9PA 2VX7A 3GYCA 2QLYA 1B3XA 1BVZA 4D1IA 3D3AA 3KEHA 1WDPA 1M01A 4ATLA 4RE3A 3SCPA 5FOOA 3CBWA 1QHOA 3PZVA 4AISA 3AIRA 4JHZA 5E70A 1K9DA 2XTKA 1E1EA 1A3HA 1I1XA 4MB1A 4OIFA 5FL1A 4YN5A 1U2YA 5A8NA 2GUYA 1SMAA 3CGTA 2QHAA 4F9DA 3ZMRA 1UD5A 4Z2IA 1B3VA 3OBAA 1JZ5A 2OYMA 3DECA 1UD3A 4N0RA 3ZJKA 3MV01 4JIEA 2DH3A 2WMIB 1BHGA 2BS9A 4U31A 3K46A 1DEDA 2QMJA 2OLHA 2PBGA 2E8ZA 4C7DA 4UZSA 1VFOA 4ZXLA 1BG4A 3IANA 2J74A 1OCQA 5FD0A 4NRSA 4M24A 2PWFA 1Q6EA 1KQZA 3LPGA 3ZO9A 3WY1A 5FL0A 3MU7A 3S6TA 4QDMA 1KBKA 1NWUA 1NWSA 1GZJA 2CKRA 2JIWA 4AIOA 3HMCA 2E9LA 4E8CA 2G3IA 1RD6A 2CERA 2XVGA 2CYGA 1PIFA 1OINA 2XIIA 4Z2JA 2GDVA 2E40A 1UD4A 2VQTA 1V3JA 5BYWA 2VCBA 3CZKA 5I0DA 4FK9A 2YL5A 4WJXA 4U33A 1SR0A 1XD0A 1KXQA 1UD6A 1XHGA 3CH9A 3K4AA 3RCNA 5A1AA 1W3HA 2E0PA 1TA3B 4NF7A 1YHTA 3DYPA 4CU8A 1E5NA 4C7GA 5I23A 3CZEA 3N11A 3QOMA 3EDEA 4XUYA 2BXYA 1EIBA 4Y7EA 5DFAA 5A8QA 1QNOA 1W1YA 3ARTA 3W24A 1LL7A 1JDCA 3IAPA 3ARWA 1XSKA 3AZSA 1HIZA 1MXGA 3CZLA 4BF7A 3MSGA 4ACZA 4DWSC 2PWHA 4HZ6A 1UUQA 1W1VA 1V6XA 1JYWA 2WM0A 1A47A 1W1TA 1JAEA 1CGVA 4M56A 5HXMA 4PRWA 2OYKA 3WFLA 4TX6A 4IISA 4AZCA 4ACYA 3AIVA 1E0WA 3F4VA 1JXJA 3EMZA 4PYSA 2ZICA 5A8MA 1O6IA 1B90A 2GFTA 5GNZA 1CPUA 2UY5A 2A3AA 3QOKA 4J3TA 2RGMA 2XWEA 1VEOA 1VJSA 3CMGA 3T09A 1BYBA 4AYSA 1J0YA 5JBEA 2DSUA 1EO5A 4CGTA 1GVIA 4HU0A 2J7HA 1LF1A 3N15A 5D8WA 2DSZA 1UQZA 1LLOA 2WYSA 2XG9A 3MS8A 5ABGA 4C7FA 1I1WA 4CCCA 2O9TA 2VZUA 1B9ZA 3BCFA 1UA3A 1XCWA 1XYFA 4GI8A 1QI5A 4JKMA 5EFDA 3AXIA 2BY1A 2FHCA 1E4MM 2WMFA 3WNKA 3SCSA 1CDGA 2VTFA 2EBNA 1R86A 5CG0A 2O92A 3VINA 5IFTA 2J7EA 1EO7A 1M53A 1QNRA 1VFFA 1OSEA 4U5KA 3VUPA 1M03A 3GDBA 3D5HA 2XFYA 2CXGA 1ITCA 2UY4A 2WHLA 4NZCA 4LQ1A 4XX6A 3ARRA 3L4TA 3ARYA 2QMKA 2CBJA 4AXNA 1VIWA 4TUFA 1JF6A 1PZ3A 3WENA 4R5EA 4HOXA 4LPCA 3CZJA 1LG2A 1VFMA 3GNOA 3AROA 2DIJA 2X0YA 1B30A 3SUTA 4AZCB 1H09A 2XYLA 1U30A 2PWDA 1YQ2A 2OWWA 2QPUA 4QLLA 7A3HA 4RE4A 5E09A 5FIPA 1JZ8A 3VD5A 1HKJA 5HNNA 3WIJA 2CBUA 1B0IA 2XIBA 1ODZA 3GZAA 2CHOA 2QPSA 2J77A 1EOMA 3QR3A 1E43A 1WDQA 2CESA 2BY2A 1WAWA 5C71A 3NSMA 3O2LA 5ABFA 3GNRA 5JIPA 5ABHA 3AJ7A 1CENA 5A6MA 1E1FA 3A3HA 1JNEA 2FH6A 2XSBA 1GJUA 1JZ4A 1M7XA 4R27A 2GJXB 2XGBA 2EJ1A 3UG4A 4WSKA 4CU6A 4TTUA 2DDXA 4GO9A 1G9HA 1MW2A 4CVWA 3WKZA 4XB3A 1TVPA 4WIWA 2EO7A 4FLRA 4PN2A 2EPMX 1KGUA 2YOCA 4W85A 3UEQA 1C91A 3AHXA 5M5DA 2F8QA 2J79A 5A95A 5HDRA 1GOQA 4M81A 1FHLA 1US2A 5A6BD 3CUFA 4WKAA 3HJEA 1E70M 3OG2A 3WD4A 4GINA 5A2BA 4CCDA 1QBBA 4GI6A 2DEPA 1J12A 4V28A 1E5JA 2XSAA 4B15A 3W27A 1JD9A 4GO8A 6A3HA 2X0HA 3AHYA 2WMHA 4W5UA 3OB8A 1R7OA 5E9AA 1QI2A 1O7AA 3FAXA 3LMYA 1WKYA 5A6SA 3U7BA 3WDJA 4URIA 4HOWA 2ZWZA 1TG7A 5BXTA 3ZT6A 5I6SA 3ECQA 3TA9A 2WLYA 4AZHA 4W7VA 4CD8A 5M3WA 3WF0A 1GPFA 2WLZA 4PCTA 4RL3A 4DUWA 1LJYA 3VNZA 4PMQA 4YPJA 1W3LA 1V3HA 1UHVA 1W9XA 2GVYA 3PZOA 3PTMA 5A6BA 1HJSA 1OB0A 3BMWA 3W25A 2D23A 3LPPA 1C8XA 3PBGA 2W92A 3PZNA 1C3FA 4UNIA 4Z2LA 4QLJA 4Z2KA 3J7HA 3SUWA 1UWUA 3VIMA 3VDBA 2YA1A 1JAKA 1OGSA 1H11A 2O9RA 4ZXOA 1EHNA 1X6LA 4UQEA 1DWIM 4Z2HA 2XWDA 2YL8A 1CZ1A 1UZ4A 4HMDA 4MB4A 3WH9A 3W26A 1HT6A 4PCSA 1BG9A 5IHSA 1AQHA 4MPKA 2JEPA 1C8QA 5IXEA 2DH2A 3VD4A 4PUDA 1XH2A 1WCGA 4B3KA 1JI1A 2G41A 3ARUA 5HPCA 4CVUA 2A3HA 1WP6A 1H49A 2XGIA 3EDKA 5GNYA 2GJXA 1UR4A 4DUXA 3BAWA 1DWAM 1V3LA 4UFMA 3WQ8A 1KXVA 3VU2A 2YLLA 3O9NA 1E3ZA 4YHEA 1LG1A 1V3IA 3VM7A 4S3KA 1UOKA 2G3NA 3POCA 2YDQA 4MNJA 2WNWA 1H1NA 3VIPA 3VM5A 5D8ZA 1BPLB 5LYRA 4AIUA 1SMDA 2HVMA 3M7SA 1LWJA 4MTVA 5BRPA 2AOSA 3IK2A 4EK7A 5I77A 3VO0A 2WZHA 1HKMA 3AXXA 3CHDA 3BGAA 3G6LA 2CKSA 2BVYA 4MADA 2WVTA 2VUYA 4AEFA 1W32A 3AICA 4MB5A 5GNXA 2WVVA 3BH4A 5GPRA 1J0HA 4P7QA 5HOSA 1KXTA 2YBUA 3VGBA 2WBKA 3WL0A 2VZSA 1GVYA 3VIIA 4D71A 4EAMA 4UZUA 4AEEA 2VZTA 3AS0A 4QFUA 4U3CA 1UWSA 1KGWA 2PBOA 3F5LA 3OA5A 1CXFA 2V3DA 2X8RA 1C8YA 4PMRA 4AD2A 3VIFA 4TVDA 1H0IA 3WDRA 3RMEA 3SUSA 3WD0A 4B9ZA 5M03A 5DT5A 3T0DA 2D3NA 3UCQA 4H2CA 3PTQA 3ZOAA 5AY7A 2HISA 3WSUA 3A4AA 2XJ7A 3AIQA 1PZ2A 1HF6A 3MMDA 2EPNA 4WKHA 3THDA 2X1IA 1ECEA 1GQJA 4LYPA 1UKPA 3GNPA 1BSIA 1UKTA 3PHAA 5ECUA 2A3CA 3KL5A 2Y24A 3OIHA 5CJ5A 1ODUA 1AMYA 3CTTA 1HX0A 1BYDA 1C7TA 5EB8A 3B9DA 2ZE0A 3OLGA 2YIHA 4AD0A 3WUFA 3AFBA 3AXHA 4PMUA 3DHPA 2W5FA 5A94A 1TE1A 3AIEA 1HL9A 4HMCA 3RPMA 4D6EA 2XFRA 2GJPA 1V3MA 2J7CA 3VD9A 2D24A 3CUIA 3UG5A 4EANA 1VF8A 5BCAA 4F66A 2ZX5A 1V6YA 1ZJBA 2DT2A 3FY1A 1ITXA 3KL0A 2E4TA 1IZJA 3AMCA 4UOQA 4BA0A 1JYNA 3K1DA 1VRXA 1CGWA 1GQIA 2GJRA 4KGJA 4W8AA 4GZJA 2V3EA 4JFSA 1W91A 1ZBCA 3VX1A 5DEZA 4P8XA 3PZQA 4CUCA 4AY1A 3WQWA 5AC4A 2W63A 3WDQA 4WF7A 3WNMA 2PC8A 1H41A 4DWSA 1XRVA 2J8GA 2WBGA 3L4WA 1E6RA 4QCEA 1Q6GA 1B31A 4P7RA 4B16A 4Z2GA 5EBAA 2ZUMA 3BAYA 1C93A 4AZGA 2YA0A 1NQ6A 3KWXA 9CGTA 4HP5A 3WMBA 1R87A 4BQ2A 5I3DA 1C7SA 3KZSA 2E8YA 4M82A 5I79A 4UCFA 1EHAA 2YLAA 1BTCA 1OT1A 3ARSA 4GI9A 2WHMA 1TVNA 2F2HA 1GQLA 5BXPA 4CD7A 5I2UA 1GQKA 1JDAA 4ZE5A 3WMSA 1V0LA 4KRTA 1DWGM 3FW6A 2OSYA 2ZX8A 1QBAA 3ZQ9A 4WSJA 3WDHA 1GUVA 1KGXA 1PX4A 2Y8KA 1NP2A 1AQ0A 2VJXA 1QNQA 1Y7VA 2UWFA 1IZKA 4JL1A 1H5VA 2DT1A 1HJVA 3AYRA 2C7FA 3CIVA 4UQCA 3LPFA 3MUAA 2QV4A 1BYAA 1ZS2A 3ZJ6A 3WQ6A 5BXRA 5KEZA 1WDRA 5D4YA 2XVKA 3VNYA 4P8WA 3TP4A 4A4AA 3FXYA 1KQYA 1EGZA 4XZBA 2UY3A 4W8BA 4BQ3A 4GZEA 4TVUA 1E6NA 1BGAA 4V2XA 3ZSTA 3RM4A 3VVGA 3JUGA 2OSWA 3AIWA 1CGYA 1JG9A 1MFUA 3PZ9A 1NOFA 2XVNA 4B3LA 2FDMA 1M04A 2CPUA 2WC7A 3BXWA 3HN3A 1NOWA 3WQVA 3BSGA 2VI0A 1J18A 2OWXA 3A6OA 2C0HA 3AZTA 1ZB5A 2J25A 1UKOA 3T0BA 1V0NA 3CPUA 4BZYA 4DM2A 4OOUA 1MW1A 3APGA 2VCCA 1JZ2A 3AISA 1TZ7A 1WE5A 4IPNB 4AW7A 1BLIA 5DMYA 3MANA 3AIBA 2DSKA 4QCFA 4LGXA 2D0GA 3FHQA 3PN8A 2VVNA 4X0NA 1OWQA 2VZOA 2FHBA 5BROA 1GJWA 3IJ8A 2ZUWA 1UWTA 1E9LA 4UTFA 2YA2A 1MW3A 4MNLA 4D72A 1GHRA 4FLSA 2WVSA 1Q6FA 1E3XA 2XM2A 4A3YA 2MANA 3N9KA 3W0KA 3W53A 2WVUA 4GXPA 1G1YA 4PBGA 4H8UA 3F5KA 3L2MA 4HZ7A 1JYXA 2D0HA 2CNCA 1GNXA 4FF5A 1GOWA 3GXFA 1CIUA 4JKLA 2EXOA 2CETA 5CGMA 3L2LA 2CHNA 2JF7A 3RJXA 1ZL1A 1HNYA 4JCLA 1CECA 2WCAA 4IPLA 1W9UA 1HJWA 1GORA 1UKSA 4IM4A 1JL8A 1LQ0A 4JAWA 1OM0A 2WMIA 1R8LA 1PAMA 1FH9A 4E4PA 4M8UA 3VIGA 4BQ5A 3WFZA 4H41A 4MAZA 3M46A 2WAGA 5FCZA 2O9OA 3WF3A 2BFGA 2NSXA 1E0VA 2EQDA 3NYDA 1VAHA 1MQPA 5F7UA 1E40A 1HL8A 1V0MA 3AHZA 1EOKA 3GXIA 4PMYA 4MB3A 2OSXA 3VDCA 1UQYA 3SCTA 4P8VA 3K8KA 1NH6A 1ISXA 1Q6CA 3QHNA 1QNSA 3BAJA 4UOJA 1CBGA 3GTNA 1RH9A 3VOCA 4J7RA 4Q7NA 5ABEA 5CPQA 4OOZA 1D7FA 1SYTA 2Y2WA 3U5YA 2DSWA 1WO2A 3W37A 3WBAA 1K6AA 3W6LA 2GK1A 3WH8A 1V6VA 1HN1A 1AQMA 1HJQA 1HJXA 3CUJA 4D6IA 4KRUA 2VZVA 1XH1A 1CGTA 2GK1B 1BF2A 4W88A 3N1AA 2V38A 4PMDA 5LA1A 3OGVA 4WLCA 2YDRA 1TFVA 2WVVB 1E71M 2CIPA 2J47A 1W9PA 1TMQA 1MW0A 1XV8A 2WPGA 4UR9A 4D6DA 2BHYA 2DPEA 4ZEPA 1CXHA 2JE8A 3VDAA 3PZMA 4D6CA 5E0FA 5HPOA 1V6WA 1V08A 5FKYA 3RM9A 4X0VA 3ARQA 3AMLA 3RJYA 3CZGA 3NIYA 1FP8A 4BS0A 4UFIA 4LYRA 1DHKA 3CHEA 1NOUA 2VRQA 3SCVA 3ARXA 3AS1A 4DWSD 1FH8A 1CGUA 4HMEA 1EDGA 2D2OA 3PTKA 4U2YA 5CQ1A 4JFTA 1LL6A 3AS3A 4L4OA 5AYBA 3RM8A 2ZIDA 4D6FA 1JFXA 5C70A 1E15A 4D1JA 1BYCA 2B31A 3BAIA 5CLWA 3GXDA 3SUVA 3CHCA 1XGZA 2CBIA 3BCDA 1TA3A 1HVQA 3OZPA 1JGIA 1UG6A 1E6XM 1W1PA 3EYPA 3WEMA 5D9MA 3W4RA 2WC4A 5TD4A 4GQRA 1XCXA 4PUEA 4AWEA 1TCMA 2UY2A 2DIEA 5CLTA 2WB5A 3B8SA 5CPSA 2VURA 4TXEA 1QW8A 1FFQA 3VMNA 3WH6A 1WB0A 1UR0A 4PTWA 3A47A 2BHUA 1QW9A 2WMKA 3WELA 3B9EA 1W9BM 1MWOA 4UFKA 3EMQA 4FMVA 2XUCA 3G6MA 4GQQA 1BAGA 3SCQA 3WQ4A 3VIHA 1GW1A 1OD8A 4CU7A 4FLQA 2GDUA 3SURA 2Y5EA 1CXEA 2D20A 2E9BA 1ISYA 3VDHA 3ZR6A 1UH2A 3ARPA 1F4HA 2WZEA 3SCWA 1JZ7A 2J78A 2D3LA 3GM8A 4F8XA 3WD1A 2Y8VA 1EQPA 3SCRA 1KCLA 4J3WA 2CITA 1L8NA 1KBBA 3OLIA 3II1A 1TUXA 3IJ9A 2WW5A 3MSDA 6CGTA 3TOPA 4TVCA 1VJZA 3BLPX 3KE0A 1EXPA 4QP0A 4J3SA 1JF5A 4UQBA 3VGGA 4W7WA 4PTVA 2J8FA 2YKKA 1XH0A 1J9YA 4PMVA 4F9JA 2W66A 4PMNA 3ALGA 2ZUVA 1VB9A 2CEQA 3BSHA 1PBGA 1B2YA 2PWEA 3L4VA 3T2OA 3NUKA 1I75A 2VRKA 2VT0A 4CD4A 1RP9A 3KL3A 4OBRA 3W29A 1VEPA 1KR0A 1FFRA 3OLEA 3BMVA 1J0KA 4ZFMA 4P7NA 2ZUNA 5LA0A 3ARVA 2ZXDA 1HP4A 1U33A 3OZOA 3FNDA 5CSYA 1QVBA 1FOBA 2A3EA 5IDIA 1QHZA 3AS2A 1J0IA 4TOQA 2IUZA 3T2PA 3ZR5A 1W9DM 5E6YA 1G01A 1B1YA 3LPOA 5AYIA 1CEOA 3SCNA 3CLWA 4UQDA 1NWTA 1V0KA 3TTYA 1W9VA 1US3A 4HA3A 4LXFA 3IAQA 3E1F1 1KCKA 3UETA 2J7DA 4UQAA 4PTXA 1XSIA 4JL2A 3VGFA 1MFVA 3K4DA 4FLOA 1OIFA 4U5IA 3AHVA 3ALFA 1V03A 3VGHA 3ZM8A 3RDKA 4GIAA 2YBTA 4XZWA 4UOZA 3IJ7A 4S3JA 1FA2A 3O6AA 3VMPA 4CN6A 3VKKA 4BCEA 7TAAA 1P6WA 4QAWA 1GONA 3TTSA 3AZRA 2XVPA 2FH8A 3OLDA 2EPOA 4W87A 4HU8A 2Y4SA 4ACZB 1QOXA 4P8UA 1OD0A 2NW0A 3TTOA 5IHRA 4AD5A 2DQXA 1IV8A 8A3HA 5CPTA 1CTNA 1Q4NX 4E8DA 3WNPA 5JH8A 2WWDA 4H8VA 1JDDA 2WMJA 2JALA 1E6ZA 4WK9A 1W2VA 2XM1A 4JKKA 4AZ5A 1HKKA 4UFLA 1C90A 2NT0A 1DWJM 3T0AA 5CXPA 1E6PA 3QHOA 3OGSA 4PMZA 4L4PA 3WUGA 1Z32X 1R7AA 4MJ2A 2DGAA 1HJUA 5A3HA 3TONA 4ZENA 5A69A 5A2AA 1VENA 1JI2A 1B3ZA 5GQBA 2DT0A 3I3DA 1EQCA 5D9NA 1JNDA 3VIOA 3WEOA 1W3JA 4MAVA 3I3EA 1UR9A 1XD1A 3U57A 3MUZ1 3MO4A 5LA2A 3CUGA 3WNNA 2WSPA 1D2KA 7CGTA 3NDYA 3VGEA 1PEZA 2J62A 2AMGA 1DWFM 5I24A 1E4IA 2XHYA 4ZE4A 3WMCA 3VPLA 4OJYA 3CO4A 1E4NA 3WUEA 3POHA 2G4FA 5EMYA 2YL9A 1PX3A 1ZBKA 4D6HA 4J3XA 3WD3A 5E6ZA 3WUBA 3WD2A 1B3WA 3CUHA 1G5AA 3CHFA 1J10A 2XPKA 4OBSA 1OGBA 1HP5A 4DM1A 1CXKA 3UG3A 4HPGA 4ML4A 3AMDA 2ZOXA 1RP8A 3NDZA 3S2CA 4CD6A 2DSVA 4H04A 1UD2A 3DC0A 1OT2A 1G94A 4CKQA 1KB3A 1E0XA 1J01A 3WDPP 1WZLA 2PB1A 1UA7A 1SFSA 1GCYA 1JYVA 4H8HA 2A3BA 4MDPA 4W89A 3NSNA 4ATDA 3AHTA 2ZX9A 4HTYA 1MYRA 4Q22A 4KMQA 1CXLA 4MJ4A 1EH9A 1UR2A 4DUVA 3RIKA 1EDQA 1V3KA 1EDTA 4TX8A 4QLKA 1MQQA 3M6DA 4KH2A 1L0PA 1J11A 3DHUA 5D9PA 3TTQA 3AQUA 4NI3A 4HA4A 4D6JA 2G3JA 3N12A 2BV9A 2VR5A 3QGVA 2BVDA 3EDDA 3NCOA 4AZIA 4OUEA 1JIBA 2CCRA 3ZJ7A 1HKIA 4PSPA 2VC9A 4W5ZA 3VIKA 3MKKA 5EFFA 1JZ3A 1CLXA 4N42A 2IXUA 1GOKA 2PI6A 1GOIA 2VOTA 4XV0A 2OYLA 4CD5A 4A3HA 4J3VA 2V3GA 4AD3A 5A6KA 4M29A 3MMUA 2WMGA 1LL4A 1TR1A 3L4YA 1QHPA 1WDSA 1OGGA 3M07A 1XC6A 4X9YA 1CXIA 2EPKX 3VILA 1E6QM 2ZX7A 1ISVA 2XVLA 3W82A 2V3FA 3ARZA 2QF8A 3WF2A 5M17A 2VX4A 1BVNP 2WWCA 4KGLA 2WKLA 2FGLA 3WBEA 4GZIA 1WZAA 2J4GA 1DTUA 3WNOA 2D0FA 4UQ9A 4AIEA 4OKDA 4HA1A 2OWCA 1UR1A 2WC3A 1UYQA 2E3ZA 2EPLX 2X2YA 2V5DA 1JXKA 1E72M 4PSRA 4CCEA 2FHFA 1G0CA 4AD1A 3UR7A 3BLKA 2TAAA 3BAXA 3EBVA 1UR8A 5D9OA 4GPNA 3W81A 1V02A 3GXMA 3ZIZA 3WNLA 2WANA 3AIUA 4M1RA 4IUGA 1GHSA 3SCOA 1JD7A 2X09A 1JFHA 4MDOA 1V02E 4W86A 5DF0A 3VMOA 3WDIA 5IFPA 1ZBVA 1UD8A 1UKQA 3OGRA 2WHKA 1K9FA 2JFEX 2VNCA 1EA9C 2J7GA 2BXZA 1PIGA 4UFJA 2ZUTA 2IXVA 1UZ1A 2ZX6A 1H3GA 2E9MA 1UWIA 3RO8A 3CZ8A 3ZT7A 1WNOA 4UFHA 2WKGA 1RPKA 4EE9A 1NWRA 1MXDA 4MNMA 3WH7A 5JBFA 3T08A 1PX8A 5C8BB 5I5RA 4V27A 3MMWA 4EKJA 5A8PA 2YJQA 4E2OA 4RE2A 1ZJAA 3MV11 3U7VA 2NT1A 1KR1A 3BAKA 1KWGA 4HZ8A 4JFWA 2ZXBA 3BC9A 3WF1A 2FGZA 1E6SM 2D1ZA 3PZTA 1W2PA 4W93A 4AZ7A 3U5UA 3SEPA 2AAAA 5BRQA 4ATWA 2JF6A 3GBEA 1UWQA 2G8ZA 2Z1KA 1WZKA 1LWHA 2W91A 5CZKA 3L4XA 2VX6A 1KXHA 3WH5A 2WCSA 1ZU8A 3VTRA 1CNVA 2VCAA 3GH4A 3UERA 3PZGA 4LYQA 4F79A 3WEZA 4MNKA 3T2QA 6TAAA 3DYOA 2J7FA 1D3CA 2WZIA 2BHZA 2VL4A 5I78A 1OBAA 2RGLA 4CN1A 4DWSB 3AMGA 4JFUA 3UESA 2JIEA 2WHJA 2BY3A 4KWUA 3A4WA 3W28A 3CMJA 3AYSA 3VD3A 2J75A 3N13A 3I3BA 1ESWA 4W8LA 4AC1X 1VBRA 5A6JA 1OIMA 2DT3A 2J7BA 3PZUA 3HU7A 1E73M 1VEMA 1XYZA 1E55A 3FN9A 2WCGA 1H0GA 2BNJA 2VMFA 1PPIA 2ESCA 1V6UA 2Z1SA 3DYMA 3WF4A 1CGXA 4YHGA 2YDSA 4TTGA 4GKLA 1H2JA 2V5CA 1E4LA 1UH3A 1DP0A 3W38A 1UH4A 4PMOA 3VX0A 1CYGA 3SCUA 3ZT5A 5JBDA 2C8NA 5JIWA 1FH7A 3ZSSA 5BWFA 1E56A 4JCMA 1QI3A 1NARA 3VIJA 4HPHA 4PEEA 5CGTA 4PTMA 2PWGA 3RILA 4J28A 3VGDA 4P7OA 1CLVA 1XSJA 1F4AA 1ZBWA 1KFWA 2VQUA 4J27A 5KZ6A 5CSUA 3AMKA 3W6MA 1CWYA 4U3AA 1KWKA 2W62A 4LX4A 5DO8A 1NM9A 1WPCA 3SUUA 1JZ6A 1HXJA 5A6LA 4K68A 1K9TA 4CN4A 4H7VA 1K9EA 2ZWYA 4U2ZA 4WKFA 1C92A 1NP0A 3A4XA 4W7UA 3QHMA 1ISZA 2ZUSA 1QI4A 2F61A 2BVTA 3GH7A 1QI0A 2VRJA 3WQ5A 5AC5A 5ABFB 1DWHM 3MUY1 1HVXA 1WZMA 4B9YA 3WN6A
chains in the Genus database with same CATH superfamily
3FAWA 4TW7A 1S38A 4EP8C 3L4ZA 4PMXA 1GOMA 3W7JA 1J5TA 4OZOA 2VEIA 1UWRA 5G2IA 4Z0JA 3QKZA 2EEXA 2V6AA 1S46A 3GTIA 3VCNA 4D6GA 4YLWA 1YPFA 3LA4A 3W84A 1MQRA 3DFHA 1ZLPA 5HR7A 3F4DA 1FHDA 4I5UA 1J0JA 3AI0A 1X1NA 3TZNA 4NRRA 3EDFA 3U4FA 3LZ3A 4XAPA 1ISWA 1H4PA 2FPYA 3B97A 2ZFAA 1OFDA 3TR9A 1WX0A 1LM1A 4U28A 3GBDA 2WSQA 5HWJA 3DN5A 2W6RA 4D2JA 1W37A 3M0MA 7ENLA 5CSSA 3PR2A 4JZ5A 2FGBA 3QQ0A 1QNPA 2WSKA 5G4HC 3KVLA 2V5KA 2PLMA 3CL6A 1N82A 4DELA 1W3KA 1BFNA 4FP1A 4H9MA 5J8LA 3BANA 2PDPA 4H7CA 4UTWA 2QW5A 1AVAA 2JEQA 3VNKA 5CBIA 1QO5A 2R24A 3GYCA 4LVGA 5I7GA 4PUUA 4JYSA 1W54A 2G37A 5FOOA 3DOPA 3EEGA 5EPDA 2R6OA 3PZVA 3QBUA 4GIRA 2C14A 3SFWA 5FL1A 4Q8OA 1NMVA 1SMAA 4F9DA 4UMCA 3IGUA 3CIWA 4RNIA 3KUMA 4HJFA 4N0RA 4MLRA 2NVAA 3MV01 4HJWA 2DJXA 3I4KA 3N3TA 3Q37A 1BHGA 1YDVA 4NZ1A 2BS9A 2PDBA 3GR4A 4U31A 3K46A 1J6YA 3KADA 2PRHA 2FLIA 3W1TA 3W74A 1G6CA 4NRSA 1VBJA 3C2RA 2DFAA 3DFSA 4M24A 4GWEA 5LGXA 1XPYA 4DO6A 2BOFX 3W7GA 4L9ZA 1XJBA 5FL0A 1NFGA 2I5GA 3G8RA 4BI5A 1NWSA 2CKRA 2KO7A 1R5YA 2E9LA 3DI1A 1REQA 2G3IA 2X2GA 4IMDA 4IQEA 2H3BA 1OINA 2XIIA 1K8YA 3LHYA 4Z2JA 3EOSA 1UD4A 1V3JA 2IKIA 5DO2A 5LNSA 2VCBA 4LU0A 3CZKA 3BW3A 3GG1A 3FJ4A 1FUYA 3A24A 4U33A 4JYEA 4C6NA 3EOUA 2QCLA 5A1AA 1TA3B 4IX2A 4DUOA 5I23A 4M6QA 1CI1A 3EWXA 4IJBA 4XUYA 2BXYA 1EIBA 3E3HA 5DFAA 1QNOA 4KWVA 2AL2B 4D8LA 3JS3A 2KGJA 3QY6A 3ARWA 1LQ2A 1YXYA 1R9HA 2DUAA 3AZSA 1HIZA 3GSMA 2FZ9A 5CC6A 1Q2RA 3MSGA 4DNHA 1UUQA 2PZNA 4CNSA 1S1PA 4K7VA 2RFGA 1P0DA 3DESA 4M56A 5HXMA 3NWRA 5FJTA 5K4XA 2OYKA 4IFKA 1E51A 4PYSA 5A8MA 5DCDA 6TIMA 2R1NA 1B90A 3L67A 4MG4A 2GFTA 3INPA 3U2OA 4J3TA 1RQBA 4PODA 3ME3A 1F5ZA 2A6NA 1J2WA 3O5LA 1EO5A 2OEKA 4G2DA 4U10A 4CGTA 4NNAA 3HB9A 5D8WA 1O94A 4QM1A 3IJIA 4C7FA 1I1WA 3WLOA 2VZUA 3SQLA 3QC0A 3WX7A 3H9RB 3C2EA 1HKWA 4ZQMA 2HE8A 5HQMA 4JKMA 2OELA 4Y9MA 5HNRA 3AXIA 5JVLA 1CDGA 5TF0A 4JICA 2O92A 2FTWA 3WLPA 1OSEA 5FA5A 1M03A 4M1BA 3MCNA 1YW1A 3O5EA 3IEBA 3LDVA 3K2GA 3ZFHA 2CBJA 1Y5VA 4GVHA 2O4QA 4DPQA 4HD5A 1TPWA 3M1ZA 4O17A 3WENA 4RXGA 2JQXA 3G77A 2FZDA 4HHHA 4Q7BA 3W86A 5MKGB 3TZFA 3AROA 3GNOA 3SUTA 4BKNA 2V8ZA 4LVDA 7A3HA 1L1PA 3PY2A 1AD1A 4KF1A 1HKJA 1O5QA 4MWAE 3WIJA 2XIBA 3W83A 3GZAA 2VENA 2CHOA 2JKAA 4RK8A 3KVJA 3VK5A 1WDQA 2CESA 4EF8A 4S2BA 5C71A 2O55A 1IE7C 3RU6A 5D2TA 4JTAA 5JIPA 5ABHA 3RGCA 4O1EA 3VNLA 2EJ1A 4WSKA 4RKAA 1GPWA 2EGZA 1K3UA 1QR7A 2A7RA 4PE8A 2HPMA 3W23A 4RPQA 4HNTA 2YOCA 4R34A 3W1UA 3O0FA 3AHXA 2PPOA 2E6DA 2IQDA 5M5DA 3BMBA 2F8QA 2FTYA 4JNMA 1ZK6A 2CZ5A 5CZJA 3CUFA 4WKAA 5CAHA 3WMLA 3T6CA 4YS1A 4GI6A 1VS1A 3U0HA 4V28A 3NQVA 3UP8A 2ZRZA 2XSAA 4CQAA 1PV8A 3M7WA 1OF6A 3BW2A 4JYFA 1JD9A 4B5VA 2TMDA 4XK2A 1PTGA 4W5UA 3C0JA 1RSCA 1J6PA 1UP2A 1J4EA 3FAXA 1WKYA 1XKYA 2RURA 1TG7A 5I6SA 3ECQA 3TA9A 4ORIA 2WLYA 5AHIA 4NJJA 3WF0A 4PCTA 2LPVA 4PMQA 4MF4A 1UHVA 3PZOA 1HJSA 1OB0A 3BMWA 3SGUA 1EYMA 1R30A 4B2DA 4RPPA 2GJNA 4FN2A 3IHZA 4QRNA 1C3FA 4Z2KA 4Y2WA 4R9XA 1UWUA 3VIMA 4LAMA 1OGSA 1PVNA 6XIMA 1F2JA 1DWIM 5BWAA 4Z2HA 2XWDA 1UCWA 3LCWA 4MB4A 3W26A 5I02A 4H9TA 1BG9A 3SRHA 4MPKA 1IXQA 4ZB2A 1VFTA 2GVJA 5HMDA 3GDMA 4B3KA 3BV7A 3FYYA 1Q6IA 3VKAA 5KETA 4RDZA 4JY9A 3FYOA 2RH9A 3VU2A 2YLLA 1JUKA 3QEZA 2Z24A 5B8IC 2V82A 3POCA 3GYEA 2WNWA 3CUXA 1H1NA 3VIPA 4ZO8A 4IPIA 2P53A 2ZRYA 4EWJA 1UPPA 2V30A 1HO4A 1JCHB 3FV9A 5EGRA 5BRPA 3NM3A 3LCGA 4GVGA 2WZHA 3NVTA 1RY0A 2DY3A 2CKSA 1M9HA 2OGJA 1ZQ5A 2WVTA 1W32A 1W5OA 1QWGA 5RUBA 1H7PA 2WVVA 3LCHA 4A2SA 5G2HA 1J0HA 4P7QA 5U7SA 3MYOA 3WL0A 4ODMA 4XZNX 4S3FA 1C29A 5BRBA 3CQJA 3BZGA 1GTHA 4YWSA 4ODKA 6ENLA 2ABAA 4D71A 4EAMA 1YLVA 4H1ZA 4UZUA 4FNPA 1LBLA 2VZTA 1OC7A 3SRDA 4QFUA 2PBOA 3F5LA 3OA5A 1CXFA 1C9HA 2X8RA 4PMRA 3SJNA 2ZQSA 1H0IA 3R10A 3IARA 2MF9A 1P5BA 3PR9A 4QNEA 3MBFA 2D3NA 1AFSA 4Y8EA 1EUNA 2PLKA 5AY7A 4XSMA 1LCOA 1BWLA 4AY8A 2W9MA 3ABSA 4F0SA 3R8GA 3PUGA 4DZ3A 3CUZA 4XD4A 2EPNA 2VUNA 3B04A 4DEFA 4IGMA 3W1NA 4LYPA 1XPGA 3EWYA 1TR9A 3FA4A 3LCFA 2Y24A 1XLMA 3CTTA 2ZR5A 3ITTA 1MEHA 3C5QA 5EB8A 1FY6A 1AW2A 4ZR8A 1ZPTA 2FKPA 3G22A 1XQKA 3DHPA 5A94A 4FI4A 4L1GA 3AIEA 1HL9A 4HMCA 3TAKA 2M1IA 1ZJHA 4DF0A 5MF5A 1XDJA 3CV1A 1FKRA 2NZLA 1VF8A 1JCMP 3OO2A 4NZJA 4F66A 4IXHA 3NXLA 1ZJBA 5FJOA 3KL0A 2E4TA 3CAKA 1IZJA 2PDMA 4DLFA 3O6DA 4ZSUA 4BA0A 4Y8FA 2WSYA 4HK5A 4QE4A 1ZCCA 3G8EA 1Z69A 4WX2A 3GFZA 3H22A 1VCFA 2V3EA 1W91A 1GVRA 1P6CA 2GGJA 2C18A 4IIGA 4CUCA 5FAGA 5AC4A 4FHAA 3FJLA 2QULA 3WDQA 1J2BA 2GSEA 5AN7A 3WNMA 5FEXA 4ZTXA 1XIDA 1H41A 1XRVA 2J8GA 2WBGA 1XLGA 1KW1A 2PBCA 4Z2GA 4AZGA 1TJRA 1XLDA 3CYVA 3B3DA 2DZAA 3KDOA 3KWXA 1IEVA 1YNYA 4BQ2A 2E8YA 5EYWA 2Z6JA 3VDGA 1OT1A 2WHMA 4FA3A 1TVNA 1PKYA 1LBMA 5BXPA 4QT3A 1DV7A 4ZE5A 3UCDA 3W1LA 3WMSA 1OZMA 2OSYA 1CCWB 1QBAA 1FXPA 4F2BA 3WDHA 1TWSA 1NP2A 2Y7FA 1CLKA 1QNQA 4AWUA 1Q5MA 4JL1A 4MJMA 4D8ZA 3BARA 4PUKA 2QV4A 1Q3NA 1BYAA 1R2TA 2IKJA 1TTQA 1ZS2A 1KM6A 4IMAA 3LTPA 1YX1A 4KEVA 4G2PA 5D4YA 1ZZMA 2I56A 4P8WA 3FXYA 1W8GA 4BQ3A 3TXVA 4GZEA 2QDGA 2PTDA 4TVUA 3WFAA 3W7QA 4RLIA 3SN1A 3QQ1A 1OYBA 1JG9A 3BJFA 1NOFA 2WNZA 4UTWC 4B3LA 2O4MA 2WC7A 3R11A 3HN3A 3WQVA 1YBQB 1ICSA 3URBA 2Z1XA 3A6OA 1TPVA 5HJYA 5H6HA 3AZTA 3P14A 2A79A 2J25A 1UKOA 5AOUA 2Q3OA 2VFFA 3V1PA 1XS2A 3APGA 1TZ7A 1W6TA 4IPNB 3G0UA 3SN4A 4KEMA 3KRZA 1BLIA 5EU9A 3R0KA 4IT6A 4QCFA 4LGXA 1I9CB 3CLMA 1X1OA 1UZHA 3GY1A 4GYFA 3E0IA 3EA2A 3PN8A 1Y8BA 2ZVIA 3W70A 2XH2A 1OWQA 1EUAA 2QJGA 4O10A 4CQ9A 1XXXA 3ANVA 1FWSA 3IJ8A 1UWTA 1VZWA 1MW3A 4BY3A 2D9FA 1P1MA 3LM7A 4W9TA 3B7XA 3GIYA 4FLSA 4N4QA 3XINA 1Q6FA 4A3YA 4JTCA 1GOXA 3N9KA 3W53A 3G1VA 1ME8A 3DDMA 3DFOA 3MZNA 2PDLA 4H8UA 3L2MA 3CQ0A 4A21A 3S1UA 4JX4A 4EAYA 1GOWA 1R46A 3PSVA 2EXOA 1SSDA 2P0IA 4RJEA 3RFWA 3N6HA 1ZL1A 1HNYA 4OT7A 1CECA 1N55A 3EX3A 4IG2B 1GORA 4TMBA 1JL8A 3UJ2A 4UMBA 1BXCA 1FH9A 2GPTA 4E4PA 1WBJA 4ZODA 3VIGA 2OT0A 1TCDA 2G95A 1SZGA 1EFZA 4B5NA 3MWAA 5C2CA 1E0VA 1L6YA 4NXKA 4EWND 3TDBA 1MQPA 1EJRC 3BLEA 4ODRA 3GWQA 4LH8A 3B8WA 3DG3A 3TWAA 4MY8A 1HL8A 3LYEA 4F2UA 3E9AA 3EWWA 1B57A 1R6WA 1XYCA 3GXIA 4IMCA 1F76A 4XIAA 3W7NA 4ERAA 1ISXA 1UROA 3E74A 5E5CA 1QNSA 4JTFA 1P0BA 4LANA 3BAJA 2L5HA 1CBGA 3NG3A 6REQB 1Z9AA 3GTNA 4C6PA 1TPDA 1XCFA 1HKVA 2C1IA 3VOCA 4Q7NA 4LC8A 4OOZA 1MNSA 1SYTA 2DSWA 3URQA 4G5DA 3TQKA 1V6VA 1KFBA 1HJQA 3CUJA 4D6IA 4S3AA 2XPAA 1Q8AA 1XH1A 2GK1B 1JPKA 4AU0A 4PBEA 8XIAA 4I6KA 1YBQA 3VAVA 4PUNA 4E38A 3BK0A 1TFVA 2WVVB 4GG9A 1XIHA 3U2EA 1TRIA 1XV8A 3T0TA 1N8FA 2WPGA 4D6DA 1U5JA 5HQLA 2RJGA 3W9ZA 3WBWA 2C13A 3C2OA 1CXHA 1H50A 1QO2A 4DRJA 4WRHA 2JE8A 3LHWA 3FFSA 3NPUA 1V08A 5FKYA 5AYZA 3RM9A 1VKFA 3G1FA 4X0VA 4YU1A 4LRSA 3AMLA 1EYWA 2QCNA 2XN1A 3NIYA 5K2ZA 3WLIA 3TCZA 2RJHA 4LYRA 5D75A 3T81A 1DHKA 2WKJA 1FWCC 4WR3A 4IPXA 4HNLA 3AS1A 1M7OA 3M0ZA 1DIKA 3EX6A 2FZNA 3PTKA 3JU2A 4KCTA 1QW7A 2BVWA 3P60A 4D6FA 1JFXA 1JVNA 1E15A 4D1JA 2B31A 3BAIA 3O07A 3BICA 5AKQA 3BCDA 1TA3A 4LUYA 1R47A 2PDKA 2OZ0A 3MC5A 1UG6A 2J9XA 2HNHA 5D9MA 1M68A 1XLKA 1A5CA 2PDHA 3UA3A 4S3GA 5FF7A 3VXGA 2UY2A 4XVEA 4DI8A 3IVUA 4O11A 4HCHA 3E5PA 3UNTA 3EWBX 5HULA 1WOBA 2WMKA 1W9BM 2XGZA 1BRLB 4UFKA 2F21A 4AAJA 3PRBA 4FMVA 3KVKA 3UFYA 2RQSA 1BRLA 2G4JA 3QPYA 1W3TA 3G1RA 4RDWA 1OD8A 4FLQA 1M65A 1CXEA 2WZEA 1XLAA 1EJTC 3SCRA 4PR4A 4WOZA 4HMNA 3UG8A 2TSYA 3GX9A 3II1A 4WY0B 3IJ9A 2WW5A 3EB4A 4R33A 1MI3A 2PMQA 1QMLA 3W2KA 1A5BA 2DZWA 1THFD 1LDCA 1QOPA 1F6PA 3OVQA 3KE0A 3N14A 4LV4A 4UQBA 2VWTA 3P62A 4W7WA 2Y7DA 2YKKA 1XH0A 4IQCA 1SQ7A 1FWIC 4F9JA 3KLLA 2A0NA 3AO0A 3LCIA 1PBGA 1B2YA 2QUUA 3KBNA 3N2MA 1S3TC 2VRKA 2VT0A 1Y5XA 3RLVA 3KL3A 1VEPA 1XWYA 4PB3A 1KTBA 3FKRA 4GNVA 4P7NA 5LA0A 1OK4A 3R12A 4KWSA 1HP4A 1QVBA 1FOBA 3KFTA 3N2TA 5IDIA 3DHFA 2J9ZA 2IUZA 3EKZA 4J3ZA 3SCNA 4BEQA 1LUCB 3MDWA 4GY7A 2OOFA 2PP1A 2AQWA 3CQIA 4LXFA 1FXQA 1KM3A 3IAQA 4LTSA 3TLLA 4B2DD 3THAA 1XL9A 2J7DA 4GH3A 3OVRA 3CAQA 4C1KA 3KP1A 4QE1A 2FIQA 4XWUA 3VGHA 3NQ6A 1LRQA 5EY5A 1XIEA 2BXVA 2DUXA 2PS2A 1RQHA 1P4CA 1FA2A 1TWWA 3V7PA 7TAAA 1GONA 4N6EA 3S5SA 3AZRA 4L9YA 2Y4SA 3UY8A 3L5LA 1OD0A 5C9WA 3VKCA 2VD8A 3TXZA 4NZ3A 2W27A 3H55A 2QJNA 4E8DA 4LOCA 3MI3A 2ATSA 4ZOAA 3KVMA 1E6ZA 1F05A 2Z0IA 4IF2A 3CL7A 2XM1A 3L65A 4GYPC 5AYYA 3PBMA 4LW7A 4A6GA 1C90A 1TB3A 4H6QA 3RXZA 3GTHA 3IUIA 1OX4B 1DWJM 1TSIA 3SGGA 2G50A 4KCUA 2F6KA 3N4FA 1NSGA 5M1TA 1DQUA 1R7AA 3HV8A 2DGAA 4GGQA 4UXDA 3VI2A 3TCSA 3F7JA 3WO8A 3IRDA 5A69A 1B3ZA 2DT0A 1EQCA 1XRSA 4Q4OA 3W7OA 3WCZA 3WEOA 2H9AB 5HTGA 4D8AA 4F0RA 2BB0A 4JS3A 4ZL1A 2XINA 1HO1A 3TQ0A 4LAVA 3U57A 3UXAA 4NYYA 2WO5A 3LZ5A 1PDZA 3IK4A 1KFEA 3BPWA 3NDYA 2J62A 1L6SA 3LNPA 4JDBA 2XHYA 5ABTA 3GNDA 3WMCA 2QUMA 3L68A 4HPNA 4FXFA 1UMLA 5I3IA 3KBVA 1RD5A 4PRRA 3R58A 1A3XA 4D6HA 1R0MA 4J3XA 4TQTA 3PRAA 3NQ8A 4XBJA 1M7PA 2GUBA 5M2FX 1J10A 4QISA 1OGBA 1HP5A 4DM1A 4E3TA 4PA8A 5D04C 2ZOXA 3NDZA 3GKFA 3S2CA 3G1DA 3B03A 1GVQA 1OT2A 1NEYA 4XD5A 5LNVA 1JQVA 1I2RA 3O5GA 1L2UA 3WDPP 2PB1A 1UA7A 1V8EA 1SFSA 4HHLA 4O18A 2QF7A 1CXLA 1I60A 2FZMA 5EL1A 3RIKA 3JR2A 1MQQA 3M6DA 4KH2A 2ZZ7A 2PAJA 2GQAA 2YGYA 4LB3A 3TTQA 1DBTA 4HU3A 3K30A 4IUOA 4HA0A 4NI3A 1FKBA 1EZ2A 1FWJC 1I2PA 4U86A 3PAJA 2PURA 3NCOA 3RK8A 4MUZA 4OUEA 1JIBA 4IH3A 3ZVHB 4DXVA 3KAGA 1HKIA 4PSPA 1NAL1 3VIKA 3S2MA 1RCXB 1CLXA 1SZEA 1EXBA 3A5FA 4I3GA 4GC4A 1V4YA 4NVTA 4XV0A 2OYLA 3ZLHA 4CD5A 1FWBC 2V3GA 1EIXA 5A6KA 4Q8VA 3H2AA 1LL4A 4MYXA 1EJVC 1EWDA 1Q66A 1QHPA 1WDSA 1IGSA 4C65A 1W8SA 3M07A 1O68A 2H8ZA 3O1NA 4GJIA 1E6QM 1VYPX 1ISVA 2XVLA 3WF2A 5M17A 2VX4A 5FEWA 2Q6ZA 3LERA 4KGLA 2OTDA 2ZDRA 3WBEA 4EF9A 5LIYX 2D0FA 5BU6A 3GW0A 4AIEA 1UR1A 3CAVA 4H6RA 1UYQA 4UTLA 3QFEA 5BOFA 5AVNA 3EWZA 4I9TA 2A6LA 3W7HA 4AD1A 3PNZA 2DW7A 4EX4A 4IJCA 5D9OA 4GPNA 4Z1AA 1V02A 4HCLA 4PTNA 1IWBA 5C9ZA 5AVHA 2KFWA 4G9PA 1HTIA 1AW1A 2CLOA 4IUGA 4EIVA 1JFHA 1Q6LA 5DF0A 3HMJG 5LHFA 5IFPA 1LTDA 3GAYA 3NVDA 1UKQA 3OGRA 1LRNA 3W7CA 4O4WA 2PU1A 2VNCA 1EA9C 4CNPA 2Z2UA 5KSWA 2BXZA 1PIGA 3MJMA 4NT0A 4M6UA 5FJPA 2Y0FA 4QG6A 3CQKA 3TJXA 3Q45A 3W3OA 2AKMA 4UTTA 3AALA 1KD0A 2WJFA 5HUAA 1BXBA 2C19A 3KRSA 1MXDA 5C7VA 5JBFA 1PX8A 3BQ6A 4V27A 2ZTJA 5DBUA 4UNKA 3P7YA 1J6OA 4DYJA 2ZQ0A 4RE2A 3MV11 2E6YA 1W31A 1KBJA 3T07A 3LRKA 3IUHA 1V7YA 3BAKA 4UR8A 2OZ8A 1KWGA 4L1WA 1NMWA 4JFWA 2BOEX 3SN0A 2HROA 2FGZA 1NTHA 2DVUA 2OX1A 2D1ZA 1BSLA 3MHUA 1FWFC 3LEPA 3GFXA 4YJ5A 3SEPA 5BRQA 2FPVA 2WPBA 1E1CB 4ZO7A 3TOYA 3K4WA 4IQ2A 2BP1A 3HFTA 1WZKA 5CZKA 3LN3A 3WH5A 1ZU8A 1CNVA 2VCAA 3RAOA 3GH4A 3TSBA 2PDUA 3UERA 2XN2A 4MNKA 2QVHA 1PINA 1A3WA 2WZIA 5AB3A 3PULA 4QROA 2UBPC 2GQ9A 1OBAA 4J1OA 3IJDA 3W7LA 4MSSA 4MPQA 1VCGA 4JFUA 1S2WA 1QT1A 3P5YA 2WHJA 1KM0A 3W28A 2HTMA 3NR0A 3P84A 1RVKA 2TYSA 5A6JA 4ORMA 3EPOA 1EJUC 2PUZA 1E73M 1VEMA 1XYZA 1Z6KA 4L72B 4LCSA 3FN9A 2WCGA 4RNHA 2VMFA 1QPFA 3IKGA 2YDSA 5FF3A 1W3NA 4GKLA 4DJED 1E4LA 1UH4A 4GUIA 3ZT5A 2X0SA 4ADTA 5JBDA 1GJPA 1SO5A 5JIWA 5CSRA 5BWFA 3IGSA 3TKFA 4MY9A 1RR2A 3PUEA 1GWJA 2PGWA 1VBGA 2P8BA 5CGTA 3V36A 2NQ5A 3GKAA 1G4TA 1JUEA 5AECA 3TH6A 2V81A 1ZBWA 4J27A 4LY4A 5CSUA 5FF2A 2B4GA 1N7KA 2FQIA 5F2MA 3WLTA 4DJDD 2W62A 5DO8A 5HJLA 4H9UA 4XZIA 2ISVA 3TSDA 3SUUA 1XBYA 5A6LA 1VR6A 5G5IA 3G1HA 1EYEA 1K9TA 2ZQTA 4U2ZA 4NJGA 4ROPA 5F4WA 1NP0A 3QYQA 2WM1A 2AL2A 4QHRA 4W7UA 4FNQA 1ISZA 2ZUSA 3LCLA 1QI4A 4HU4A 2PC4A 3UQBA 3WQ5A 1XIJA 3WN6A 4QIUA 2GSHA 1SJBA 3C61A 3BLFA 2YXOA 2ZUUA 1FP9A 1A49A 3WQDA 4R53A 4MFDA 3RPDA 4GE8A 3UR8A 4DXKA 2CLHA 2X05A 4JBRA 3CT2A 5HATA 4M5PA 5I98A 1X7IA 3UWZA 2CBVA 3W6YA 2BG5A 5D09A 1UIPA 2X40A 4FNTA 3EMCA 3FSTA 1SO3A 1V79A 1AQFA 1LP6A 1H5YA 1QPKA 4ADSA 5A2CA 5H1WA 3ZLFA 3GNXA 4FNUA 3NQ2A 3WL1A 5T9CE 1XDMA 4LAUA 3H2EA 4BQ4A 3NTYA 2V2DA 2GSJA 2BY0A 8CGTA 2C91A 4RW5A 3M0YA 4AIBA 1KM5A 7REQA 3HA1A 2XFFA 5D02A 5K7JA 4W84A 3B9AA 2W61A 1CX9A 3KM8A 3UR2A 3USZA 4MWAB 4AZ6A 1P0EA 5AC7A 4E3VA 5FJIA 3THCA 3LI1A 4BF5A 4KFOA 3FLUA 1UPMB 3NJ3A 3NO3A 1F07A 2NSOA 1XRFA 3M0VA 3SB0A 1LWIA 1Q6DA 3ABXA 4AVNA 5A6AA 3ISIX 4O1BA 4J5NA 4PBFA 3C2VA 4ZA0A 4DBSA 3N18A 1B3YA 1VJIA 4AZBA 1JPDX 3TFXA 4UC5A 1WKEA 3R2GA 4GQBA 1VBUA 1KRMA 4JNYA 4N9EA 1Y5WA 3TDFA 1KBLA 3GH5A 5GJPA 3PJTA 5C0QA 4E4FA 1BWVA 3EX2A 4PCPA 3STEA 3D3AA 3WJXA 1WDPA 1TZ9A 2GWGA 4EOUA 3CBWA 1XUUA 1TMLA 4AISA 4JHZA 4P2VA 1K9DA 4L7ZA 1E1EA 5LGZA 1GVFA 4MB1A 4OIFA 3SFKA 4YN5A 2XISA 1YTDA 5A8NA 1T7LA 4XSLA 1OX4A 1UD5A 4FR6A 1H7OA 2Z1VA 4KIRA 2E68A 2VEPA 4O28A 2ZZ3A 1D7KA 5I3GA 1AD4A 2WMIB 1YW5A 1ZAIA 3HPZA 2DVXA 3EX4A 4C7DA 4O0KA 4UZSA 3P8JA 4E5TA 2Y85A 3BVJA 1SZFA 5HQEA 5DBTA 4H83A 5FD0A 3S47A 3UXDA 1EF3A 1LOLA 2ZZ6A 1Q6EA 3LPGA 3ZO9A 1NVMA 2JK2A 3IIPA 2DIKA 1LBFA 3S6TA 3NNTA 1R9YA 3CWNA 3F4NA 2PD9A 2PDQA 1KBIA 4UIOA 1AJ2A 2TODA 3ES8A 1L9WA 2VGBA 3FGCB 4BWLC 3C0SA 4O54A 1AZ2A 1RPXA 2E40A 5BYWA 2PA6A 4HNVA 5J6EA 3DERA 3EXSA 3SBFA 2PTXA 3IS4A 4KBXA 3GE7A 2KR7A 4FK9A 2YL5A 4DRKA 3OA3A 4B4FA 4ITZA 3KHJA 5IBXC 4GK8A 1XD0A 1UD6A 3LRLA 3CH9A 1KRCC 3TN3A 3WLHA 3TYBA 3QV9A 2OT1A 3B0YA 4NL1A 1YHTA 2ANUA 4XD6A 3M9YA 4DZ2A 4JPGA 3N11A 2HBVA 5CC5A 1ZENA 4PGLA 5D38A 3W24A 2D69A 2DG9A 1OVDA 3GS6A 4AEOA 1W1VA 4M7TA 3RRXA 4WXYA 5FF0A 3M47A 3VKBA 1U5HA 3P6LA 5DANA 4FF7A 3HGOA 2AKZA 1AUSL 4PRWA 8XIMA 3STPA 5KZEA 1E0WA 3F4VA 1JXJA 3S0CA 2ZICA 2QNEA 2JGQA 5BMXA 4DBWA 4A3UA 4W4QA 3QOKA 2XWEA 3G0SA 1B3OA 1VJSA 1VP5A 3LY0A 1YIXA 3LGEA 1PXGA 1A0DA 3NOYA 2EKCA 4JIHA 4QG9A 2B7OA 2J7HA 3N15A 4JTQA 1P5QA 4H7ZA 3MW7A 2WYSA 3MS8A 4X3ZA 3NZQA 5ABGA 3E96A 4CCCA 1PBKA 3SQMA 3EWDA 1XCWA 2VKZG 3MWCA 1V93A 2NX1A 4BHYA 2BY1A 2WMFA 3WNKA 3SCSA 5FEZA 3SW6A 2VTFA 3S46A 5CPOA 4J4NA 3Q94A 4LAYA 5HWNA 3VINA 4Q8MA 4K1WA 1EO7A 1M53A 1BVWA 1VFFA 4LCRA 1L6FA 3H4XA 3PA7A 4DJFD 3D5HA 3R8HA 1U1JA 2WHLA 1R9ZA 2ZYFA 4BFAA 4LQ1A 2POTA 1A50A 3ARYA 1Y0OA 1FKDA 2PGRA 4AXNA 4TUFA 3AXMA 5CEWA 3CYJA 1PZ3A 5K9DA 2QDDA 4J40A 4ZBCA 1IWPA 1LG2A 2A3LA 1DE6A 3ES7A 3CV2A 1X1ZA 3GO2A 2Y78A 3W2LA 2DIJA 1U30A 5A5WA 1YQ2A 3KOWA 1JZ8A 3V35A 3TUUA 5HNNA 6REQA 1ODZA 1GYNA 1E43A 3LU2A 4IIBA 1WAWA 5A8GA 3CC1A 5E0KA 2QCHA 4DZAA 3H4GA 5A6MA 1E1FA 4O1AA 1GJUA 1M7XA 2VFDA 2GJXB 3ONBA 3KWSA 4WDWA 4GFIA 2DDXA 4GO9A 1MW2A 2Q3RA 3ZVHA 3UZ5A 1MSSA 4PN2A 2EPMX 4NYUA 1FCUA 1PTDA 2E5CA 4X22A 4X2PA 1GOQA 5I3KA 1FHLA 1US2A 5A6BD 2W3ZA 3SJ3A 3TTEA 4AQLA 3OG2A 3WD4A 4DRMA 3TW7A 4MM1A 2KZHA 1E5JA 1RVGA 3OIXA 4DRNA 1VHNA 4GO8A 6A3HA 2X0HA 3AHYA 4LJ3A 1AW5A 2WMHA 1UUOA 3DX5A 2XN0A 5E9AA 1QI2A 1LQAA 4QGCA 5A6SA 3U7BA 3WDJA 4URIA 5BXTA 5EMKA 3GU0A 3N6JA 4AZHA 3U6WA 3AUJA 4CD8A 5M3WA 3BOXA 1GPFA 4RL3A 1LJYA 4ERGA 1DQXA 1H7NA 4NZFA 5A6BA 4Q8QA 5XIAA 2QCDB 2W92A 3PZNA 2Z25A 3MT1A 2PDXA 4A29A 2POZA 1JQXA 2XZ9A 3FIGA 2YA1A 2D2JA 3G5EA 2FAPA 1J79A 4NASA 4KRZA 1F3WA 1PZ1A 2O9RA 2GWNA 3IVTA 3ITGA 2YL8A 3LHTA 1Q85A 4N02A 2YCLB 3FEQA 3R79A 3W01A 3PAOA 4PUDA 3LOTA 4ZO9A 5CKSA 4WGXA 2G41A 2FMNA 1REQB 5HPCA 2IMRA 5HW7A 2PRMA 1WP6A 1H49A 3PBVA 3EDKA 1Q6HA 2GYIA 2HVNA 1UR4A 1JR1A 1EBGA 1W5NA 1W1B1 3O9NA 1E3ZA 3IJ6A 2OO0A 3VM7A 1H51A 2YDQA 2ZVRA 3VM5A 3C3NA 3R8RA 1BPLB 4R7JA 1OZQA 4HBKA 1FX6A 2HVMA 3MP5A 1LWJA 4HBEA 1EPXA 4MTVA 3EB3A 5I77A 3W2JA 2C3ZA 4AUBA 5I3HA 3AXXA 1W0MA 2Y5SA 2J13A 3AICA 5GNXA 1VFSA 4UTMA 3BH4A 4IT1A 3WLKX 4MOZA 5DCEA 5D37A 3VGBA 2WBKA 2VZSA 3R1ZA 3P67A 3NL3A 4WJEA 5FJUA 3ORWA 4OGZA 3TYAA 2WJDA 4U3CA 1UWSA 5LIWX 4JFIA 4IGHA 1C8YA 4JY8A 3VIFA 2DZVA 3WDRA 5HJXA 5M03A 2CFFA 2WJZA 4H2CA 3UPBA 1VPYA 3C3UA 1SW0A 4R9OA 2HJPA 5I3JA 2I9EA 3WSUA 1PDYA 2C6QA 2X16A 3A4AA 3S42A 3AIQA 3MO7A 5CPNA 3JXVA 2GGIA 5KITA 4F0LA 1PZ2A 1HF6A 3MMDA 1YXCA 4MVAA 4WKHA 3WK3A 1ECEA 4ECLA 5ECUA 4GMEA 4X60A 5CJ5A 5HR6A 3EEZA 1C9WA 3OLGA 3BZJA 3CWOX 1SZNA 3H4WA 3AXHA 1R3WA 3RPMA 4D6EA 2MNRA 2LLEA 2J7CA 2C15A 3DBNA 3CUIA 3DC8A 1U5VA 5BCAA 1XG3A 2ZX5A 5HAOA 3TMLA 2ISDA 5H8PA 2DT2A 1ITXA 1MZRA 3LGDA 3HG3A 1SVDA 2RKXA 1ROTA 4NG3A 4UOQA 4OU1A 3LLDA 2N87A 4RE0A 3MDUA 1VRXA 1EEXA 1FTXA 3G0XA 3S1VA 4JTRA 4W8AA 4H8NA 4GZJA 4G1KA 9XIMA 2ACQA 5KZMA 2KE0A 1J96A 4P8XA 3STGA 3PZQA 4H9XA 5XIMA 3CWHA 4HSNA 2OXNA 1DJZA 2G5WA 1XG4A 3KOXA 5LNRA 3FX4A 5BOOA 3L4WA 3IACA 1P6BA 3W02A 1KCXA 1KLYA 5EBAA 2F4EA 2Y5JA 4LS2A 3UVAA 5BU9A 2YA0A 2PPNA 2ZE3A 1NQ6A 2UZ5A 1IR1A 1YYAA 2R14A 3WMBA 2PCQA 4FX7A 3NOEA 3KZSA 1SM9A 4JOMA 4RDVA 4K8GA 2YLAA 3E0FA 1HL2A 3W76A 1XBZA 4GI9A 4KETA 1GQKA 4LAXA 2RUCA 5JMUA 1V0LA 2ATMA 2ZX8A 1YDOA 4WSJA 1KKOA 1WUFA 4C6JA 1Z7AA 4ILSA 3UWVA 2VJXA 1V7AA 1HGWA 3N2OA 1XLLA 3AYRA 4HTBA 1MMFA 3LPFA 1FCBA 2NUXA 4QNWA 1FWWA 3LHVA 1IEIA 3PRDA 5BXRA 1TWDA 1WDRA 2ZRWA 2XVKA 3A23A 1T11A 1MDLA 4AHOA 2ZA1A 3ZWSA 1KQYA 1EGZA 1OFEA 4XZBA 2UY3A 4W8BA 3VFCA 1EC9A 1E6NA 4V2XA 3VVGA 3JUGA 3PZ9A 2XVNA 3EPMA 3OQ8A 1M04A 2CPUA 3BXWA 4JN6A 3SZ8A 1J18A 2OWXA 4DO5A 1ZB5A 1TJ2A 3KAFA 3CPUA 5DMLA 4OOUA 1MW1A 4Q4QA 2VCCA 1PKMA 3ICJA 1JZ2A 4PRTA 3CB8A 1WE5A 4AX7A 3A5VA 1T6MA 4H9ZA 4O50A 4Q4PA 3MANA 4I5XA 2OCZA 2J24A 2Y8UA 5LHEA 1JPMA 3FHQA 2YDAA 2GQ8A 2VVNA 4B5TA 5HANA 5BROA 4PL1A 4UTFA 4D72A 3MDYB 1GHRA 3M16A 2WVSA 2FDSA 2XM2A 4IMGA 5HINA 3WLLA 2MANA 1QASA 1WA3A 3QN3A 1G1YA 4HHMA 3F5KA 4JTGA 4HZ7A 4JX6A 4FX8A 1ADDA 5I3FA 2C1GA 2D0HA 4FF5A 3NURA 2Z26A 3UT0A 4AG0A 2CETA 3KAHA 2ACRA 3M43A 5J5RA 4BF8A 2AMXA 4B91A 2WCAA 4IPLA 4XTIA 4NI8A 1W9UA 1J4HA 1HJWA 4M19A 2NXGA 1OM0A 1ZCNA 1R8LA 1OX6A 4A8NA 4IHCA 4M8UA 3O5JA 3H23A 1SUXA 3S1WA 4BQ5A 4GQ0A 3CHVA 3MQTA 3M46A 2WAGA 1DXEA 5CH9A 2NSXA 3PWGA 1AMKA 3S5ZA 2F2KA 3L5AA 4ZVJA 3H7UA 3KACA 3U4AA 2AAMA 2VEFA 4B5WA 1EOKA 4A8RA 4PMYA 3KBSA 3VDCA 1UQYA 3K8KA 3MHFA 3QHNA 1Q6OA 5CBBA 1TIMA 1Y65A 4GYKA 5F1UA 3V3WA 1RH9A 3B4UA 3UXIA 4J7RA 2AGKA 3QVQA 5ABEA 2PP3A 2M08A 5CPQA 1D7FA 3U5YA 1A4LA 3WBAA 3I7RA 3WH8A 1ZCOA 1AQMA 3NEHA 4KRUA 1CGTA 2PDJA 2Y7EA 3N1AA 4HVXA 1B4EA 2V38A 4LAOA 1EBHA 1O5KA 3RR1A 1E71M 2SFPA 2CIPA 3O5RA 3O6YX 3KTSA 1W9PA 1F74A 3ZXWA 3CT7A 4ENLA 3KBJA 3OVGA 3GQYA 4UR9A 3D3FA 4ZSTA 4FIRA 4ZEPA 3LTYA 3ITVA 3VDAA 3GDLA 5E0FA 3E0VA 3RHGA 5HPOA 2PDGA 4IFOA 2IPJA 5D2WA 2WZTA 3N2CA 3GG0A 3EXTA 3A9IA 1YXDA 3CZGA 3OVPA 3VE7A 4E6MA 2FMOA 1FP8A 1K7FA 4K39A 3RCYA 2NX3A 2MNTA 3JYJA 4LS0A 1F3EA 1JEZA 4FR1A 1FH8A 4HMEA 1EDGA 2D2OA 1M1BA 2HE5A 5CQ1A 1WUEA 3R0DA 5CAKA 5AHEA 3NO1A 1LL6A 3LHZA 3W72A 3AS3A 4AF0A 5AYBA 4O1FA 5C70A 2ISWA 1BYCA 3SUVA 2CBIA 4DROA 1HVQA 3G1YA 1XLIA 3EYPA 3WEMA 5AC6A 5TD4A 1Q7QA 1TJ1A 1XCXA 4K38A 3A64A 4Q8NA 5LXEA 2O7SA 4RV8A 5DX7A 5DY3A 8RUCA 3JZEA 2DIEA 3FJ6A 3B8SA 1ZP3A 1ZFJA 3FXGA 1QPQA 1D8WA 1ME7A 4IMEA 4TXEA 1QW8A 1HUVA 3VMNA 4PTWA 2YFNA 2BHUA 2PV1A 4DYEA 1Q2SA 2YZRA 4WVXA 3S5OA 2R82A 3M0IA 1AJZA 4DF1A 1L6GA 4GJ1A 4DB7A 4CU7A 3SURA 1LLWA 3QZAA 3B8VA 1FKXA 3VDHA 1F4HA 4LUIA 2J78A 3GM8A 2Y8VA 2CITA 1L8NA 3TQPA 3HQ1A 3OLIA 1TUXA 1EC8A 2NQJA 3TOPA 5F4SA 3MYPA 4A8LA 4IIHA 1XGDA 3E2RA 1RZMA 2PLJA 1EXPA 1QPOA 4QP0A 5D30A 4Y96A 1G7VA 4C6QA 4TO8A 1JF5A 4QEHA 3CTLA 4N4PA 1OFBA 3C0QA 3VAWA 4PMVA 4PMNA 5DY2A 2XIQA 2CEQA 1XFBA 2PDFA 4NAEB 3T2OA 3ZWTA 5D2YA 4CD4A 4S3EA 1SO4A 3PNUA 1FDZA 3W29A 3AAMA 3B4YA 3OLEA 3UQIA 4NHVA 3LBOA 4PUMA 2I57A 5IM51 3CV7A 2PV2A 1XISA 5D2XA 1TV8A 1U33A 3FNDA 2P88A 2A3EA 3UI6A 3REQA 1AJ0A 4A22A 3ZR5A 1GW9A 1IT8A 1G01A 1B1YA 3ITXA 5AYIA 2VELA 3WBXA 3KTXA 2OZ3A 1BKFA 3O6CA 1US3A 4HA3A 4JQ4A 1AH4A 1EF2A 1KCKA 2ZA3A 4PCNA 4PTXA 1XSIA 3VGFA 1MFVA 3K4DA 4FLOA 4U5IA 3AHVA 3ZM8A 1ITUA 3RDKA 4Z1BA 3IJ7A 2G3FA 3GXNA 4CN6A 5HUPA 3VKKA 4IPPA 4BCEA 4QAWA 1NSJA 1P6WA 1ZUAX 3OLDA 5IHRA 3LS9A 3E02A 1PWMA 2QUTA 3DFNA 8A3HA 5CPTA 4UTJA 4BJHA 2PD5A 2NXIA 1JDDA 1E0TA 2WMJA 2JALA 3GRIA 4DZ5A 4E4UA 1X6UA 4IFKB 2VGGA 2Y89A 2ZBTA 1Q65A 4QSHA 1HKKA 1ONEA 3F4WA 4UUIA 3TX9A 3QHOA 3OGSA 4QJ5B 1QJWA 3KW3A 3WUGA 1Z32X 3WQFA 1FWHC 5A3HA 1UC4A 1LROA 4WHBA 1JI2A 1O1ZA 2ZKMX 2WNNA 3NA8A 1KKRA 4IJRA 3UI5A 1OQFA 2AWGA 1UR9A 2LKNA 3WNNA 2WSPA 7CGTA 3O5IA 3VGEA 4JHMA 2AMGA 4O1CA 4ZE4A 1EJSC 3CEUA 1TV4A 1KFCA 1IXOA 4ZQOA 3CO4A 3T8LA 1E4NA 3B0PA 3REQB 4HPXA 4ODPA 1PX3A 4C1NB 1XYAA 1UIOA 4GI4A 5E6ZA 5BZAA 3KLKA 3WQGA 1G5AA 1CXKA 4O52A 4ML4A 3AMDA 1H61A 1RP8A 1JCJA 4DBDA 3DG6A 1V77A 1UD2A 1G94A 4NUWA 4CKQA 1KB3A 4M3PA 2YPIA 3OHIA 1XIBA 4XISA 3OYZA 1GCYA 1JYVA 1PCKA 1WBHA 5IRPA 3AHTA 2C1HA 4MGVA 4AF0B 4HTYA 4DWDA 3I6CA 4Q22A 2F6UA 4KMQA 4DUVA 1UR2A 2VFGA 4C02B 3ABOA 4OQVA 2X7VA 3I6RA 2R8WA 1V3KA 2ON3A 4JEJA 4QLKA 3N9RA 1LLZA 1J11A 1UZDA 1XUZA 1EJXC 3AQUA 4HA4A 4FOJA 4LF2A 3H6OA 3TE9A 5HMEA 3DCPA 2FB2A 2BV9A 3KZ7A 1VBHA 3QGVA 2VOMA 4IFRA 4XTDA 3EDDA 1B54A 4MKSA 1RA0A 3IGHX 2F23A 3AU6A 2CCRA 4AXKA 3BGGA 1IEXA 3PPFA 5EFFA 1JZ3A 4Q4MA 2ODOA 3ZLGA 1GOKA 2HBXA 3EZ4A 1B4KA 1UWAA 3W1QA 4A3HA 4ODOA 4DN1A 4M29A 1UP3A 1TR1A 4DIAA 4PZVA 1XC6A 2IPGA 4X9YA 1CXIA 5AHFA 4YCOA 3DUGA 5I00A 1EP1A 3ARZA 4UTUA 3FA3A 2NUWA 3WJWA 1N8IA 5EA9A 3M5ZA 1TREA 2NWSA 5CBJA 3WJYA 4DAIA 2FGLA 1VC4A 1WZAA 2J4GA 3GG8A 2X1UA 2MLZA 3HG5A 6XIAA 1EL3A 4OKDA 1C9DA 3L9CA 2E3ZA 3LBMA 2QGYA 2X2YA 3M5YA 4WCJA 5FJRA 4CCEA 1O95A 3UZXA 4WGHA 4W9PA 1K8CA 2BX7A 3DGRA 3EBVA 3W81A 1YTEA 5HA7A 2PP0A 1JRCA 1PHWA 3RITA 3ZIZA 3GHSA 1FWDC 2VC7A 4K2SA 3M5XA 1PWLA 4NAEA 3KHDA 3CO8A 3WK1A 4MDOA 5HKGA 3HPXA 3WDIA 1FVPA 1CT5A 4IPJA 1F8IA 4JTUA 2V69A 2JFEX 4HT3A 3EB2A 4LWWA 4UFJA 2IXVA 1UZ1A 1GVOA 3PBYA 4S1FA 3TYEA 2GL5A 3OEXA 4PH6A 4WOQA 1H3GA 1RCOB 2E9MA 3CZ8A 1WNOA 2ZRVA 2V5JA 2CLMA 4GABA 1SR9A 1RPKA 4MNMA 3WQEA 3WH7A 3T08A 5I5RA 1DQWA 3N25A 2FVLA 3GU9A 3MMWA 3P0XA 4FXSA 5A8PA 4M6PA 4E2OA 4FNSA 2EAWA 3M5VA 5GJNA 4S23A 3WK0A 2NT1A 3W87A 1KR1A 4DY1A 5KZDA 3HURA 3MP3A 3P61A 3E38A 5LIKX 2Z7KA 2BDQA 1TWZA 1W5MA 1TWIA 2Z2BA 1A53A 3PZTA 4W93A 4US6A 4AZ7A 3U5UA 4TW6A 1U1UA 3TR2A 1FWAC 4C6FA 1NU5A 2QKFA 3N73A 2Z1KA 2OU4A 4C1LA 3H54A 5LSMA 8TIMA 4Q4KA 2L2SA 1KXHA 3OYXA 3PWAA 4F40A 1A0CA 1IF2A 4IP5A 4US5D 1LZOA 3S9YA 3PZGA 4DIPA 3WEZA 6TAAA 3UPWA 3USBA 3SY1A 2BHZA 3QR1A 1A7XA 4CN1A 1F8MA 3DENA 4KWUA 2BY3A 3A4WA 3I7QA 3CMJA 4Y90A 3VD3A 3MA8A 2J75A 3N13A 4AC1X 4LB4A 1OIMA 1QTWA 3PZUA 4XAGA 3HU7A 4XKYA 1XIIA 1V6UA 3WF4A 2Z1SA 4XKYB 1CGXA 4YHGA 1EGVA 2CLIA 4TTGA 4H00A 1H2JA 2V5CA 1KCZA 3DFQA 4PMOA 2PTYA 4JTHA 3LXAA 3IGXA 4GCAA 4NX5A 1FH7A 1E56A 1TTIA 1QWKA 3DKLA 2HCVA 1DIEA 3QM3A 3HOJA 4Y9NA 5AFDA 2C16A 1TX2A 4IIDA 3SY5A 2RUDA 4US5A 4JIPA 3PC0A 4J28A 1FKWA 4AC7C 4L3NA 5D2VA 1F4AA 3TYUA 5F2LA 3L0NA 3EIPA 3W6MA 2GVGA 1CWYA 1GGOA 2XFWA 2X1SA 4LEQA 5D05A 4U3AA 3RLUA 1GVSA 2PE4A 3KCOA 4A35A 1WPCA 2ACUA 1KA9F 4ML9A 4Y6GA 4O19A 1JZ6A 3GVQA 3EA1A 4K68A 3S1GA 3OBKA 2ZWYA 2A7NA 4WKFA 3O05A 3A4XA 1LORA 1KV8A 4GNKB 4LUJA 2F61A 4TW8A 1QI0A 3C56A 5AC5A 4L61A 3MUY1 4H9YA 4G7EB 2PDNA 2VX5A 5FACA 4Q6JA 3UYCA 3N6QA 2QCFA 1GZGA 5A8OA 6PTDA 4HOZA 1P0KA 1R38A 2WK2A 3K8LA 5G1TA 4C5ZA 1A5NC 3O5OA 4ZQPA 1TUFA 2VYOA 3F5JA 2O7QA 3O5PA 1LT8A 5FSEC 1D9EA 4V1XA 1XLJA 4Z42C 3BMXA 4J4OA 2W4XA 3BG5A 2ZXAA 4RW3A 3K8MA 4Z1CA 4JFVA 1LRTA 3PZIA 2PU0A 4FS9A 1X97A 4E2BA 4YTRA 1TIWA 3GDTA 3XISA 1S2UA 5KMYA 3ZJ8A 2JKPA 3CEPA 4QBXA 3ITCA 4IQDA 4LUSA 3WQPA 7TIMA 1N8WA 3E12A 1NFBA 3MUIA 2YCKX 4MMWA 1VH7A 3L4UA 4OBTA 3FHAA 3T9PA 4GKTA 3WYZA 3FVDA 1TRDA 3ELFA 4XUGA 2DG3A 5F4XA 3W1XA 4EXBA 2W67A 3PB2A 3DH7A 4BEUA 1WOAA 3MCOA 1X6NA 3U3HA 2H8XA 3F2DA 1IT0A 1F40A 3RPTA 1D7IA 1KV5A 3UI4A 4M80A 3NSXA 4RR4A 3I6EA 5CZTA 1XBVA 1SFLA 1GOOA 2VDGA 3FK4A 3K5XA 1VFLA 4DZIA 1QPNA 2YCJA 3SIMA 4R7WA 3NPXA 5BXSA 3QXBA 4I8DA 3GW3A 5AC8A 5E0CA 3EWUA 3RRAA 4B5UA 2VR4A 1NFPA 4J3UA 2QIIA 2Q5AA 1R85A 2NXHA 4DRSA 2QLYA 1B3XA 1BVZA 4D1IA 3KEHA 3V5OA 2DP3A 4ATLA 3SCPA 1J8VA 4KQZA 4ZO6A 5E70A 1A3HA 2DQWA 3QQWA 1I1XA 4HYVA 4Q8UA 4KQNA 2YXXA 1Q13A 4UWMA 3S3GA 3HGSA 3SECA 3CGTA 2QHAA 4Q8WA 1PHQA 3OBAA 4Z2IA 1JZ5A 3BLLA 2VXNA 3E0LA 2OYMA 7XIMA 3DECA 4I7VA 1TE6A 1IEWA 3E6EA 3TROA 3QH2A 4WQ6A 2DH3A 4A3QA 4AWTA 1FKHA 4NJIA 2E8ZA 5DRIA 4KPLA 1A5UA 3NPWA 1BG4A 2J74A 3I65A 3GB6A 4AWSA 1KT1A 2F9RA 1OCQA 1OX5A 1M5WA 4JTJA 1B9BA 2PWFA 1MUWA 4KFNA 2H3DA 1ONXA 1DL3A 2PGEA 4L64A 2FFCA 1HFBA 4QDMA 1KBKA 3URAA 1NWUA 1DXFA 3KTCA 2JIWA 4AIOA 2ZZ4A 3SRKA 3SY8A 3HMCA 4E8CA 2R1PA 5DIUA 1RD6A 5A6TC 2DZPA 2XVGA 2CYGA 1TZZA 1XIMA 4HSOA 2GDVA 1V6TA 4Z08A 3IUDA 3STFA 3M0XA 5DITA 1NJJA 3UD6A 3LX9A 4YTSA 3UJSA 4WJXA 4XO7A 2R1MA 1SR0A 3CS2A 1DKWA 3TAOA 2INZA 3K4AA 3KOFA 4LC6A 2E0PA 3VOGA 1HG3A 3C8FA 4NF7A 4CU8A 1E5NA 2I7GA 3B40A 3CZEA 1S5TA 3QOMA 5B80A 4Y7EA 3QV6A 1LL7A 4HZMA 1S39A 1XSKA 4O16A 2RHGA 3F4CA 3CZLA 4BF7A 4ACZA 2PWHA 1XGEA 4OTKA 1V6XA 2RAGA 2WM0A 4LUTA 2XP8A 1A47A 3MKVA 3JYMA 1CGVA 3TW9A 3OOQA 5DMNA 2DV0A 1YKWA 4X61A 2ZRXA 2DJLA 2OFJA 3BUVA 4IISA 5FEPA 4AZCA 4FNRA 4O53A 4F2TA 1W5QA 1O6IA 3KXQA 1VPXA 4ZB0A 1L6WA 2J6VA 1A0EA 2VEMA 5GNZA 1CPUA 2UY5A 3B0VC 1H7WA 2RGMA 3LHUA 1PCWA 2BTMA 2OX4A 3CMGA 1NELA 4Z17A 5K9CA 2Z29A 3T09A 1BYBA 4ICMA 4AYSA 5C54A 5JBEA 1GEQA 1OCBA 1GVIA 3S2LA 4N6FA 3DKJA 4S3DA 4G56A 3RNDA 5B7ZA 2DSZA 2A1YA 2UZ9A 2O9TA 1RCQA 3GK0A 1XYFA 3FCPA 1I0BA 4GI8A 1WXJA 1QI5A 3C4UA 5G4WA 3UGVA 5CPLA 1KFJA 1R86A 3MSYA 2J7EA 5EMLA 5CJMA 1VGAA 3W7RA 1CB2A 3RLGA 4JX5A 1F6KA 1QNRA 1QRQA 4MSPA 1RUSA 3CB3A 3GDBA 2DG4A 3ZZ1A 2GUUA 4L65A 2CXGA 4FAPA 3HPFA 4R7OA 4XX6A 4U4MA 7REQB 4MUPA 2QMKA 4JQAA 1MUMA 1JF6A 3NEVA 4R5EA 1AH0A 3JZUA 4JD4A 4HOXA 4LPCA 1TTJA 3CZJA 4HKPA 4EPEC 2Y6ZA 1VFMA 2X0YA 3I4EA 1H09A 4DZHA 3W7DA 2MLXA 4RE4A 5FIPA 3WK2A 4XBKA 1H62A 4N7QA 1FKIA 1W17A 1D8CA 3N29A 4ZFCA 3QC3A 2QPSA 4PEKA 2F84A 7ODCA 2BY2A 3NSMA 2OVLA 3DFYA 3O2LA 1DJQA 5ABFA 4M6VA 2Z6IA 3GNRA 3E5BA 1KFKA 3AJ7A 1CENA 1M5YA 1UASA 2ZZ5A 1JZ4A 1SJDA 4R27A 5G2WA 2KX9A 2FYMA 3THQA 1XP3A 2V2HA 4CU6A 1WKDA 1G9HA 4CVWA 1FWNA 3C52A 3QMRA 5I07A 1TVPA 4WIWA 2EO7A 4O0QA 1PYFA 4FLRA 1F7BA 1JVWA 4GY0A 1Q4WA 3LUOA 3XIMA 5CC7A 2XH4A 4HNUA 1C91A 1RK5A 2YFOA 1Z44A 3HIJA 3VA8A 5A95A 1R3YA 2J66A 3MCMA 2VFEA 3AWNA 2IQTA 1E70M 1XC4A 4GINA 4HNOA 3B0XA 3MHGA 4CCDA 1QBBA 1J12A 2EG6A 3UF9A 5ECVA 3UW6A 2VEGA 2Q01A 5BOEA 3CL8A 3ITOA 4G7FA 3W27A 5EMMA 1OEPA 3CH0A 4B90A 4DYKA 5HNUA 3OB8A 1R7OA 3KP0A 1P43A 4DRHA 1P7TA 4HOWA 2ITKA 1KRAC 3UA4A 3UVIA 4W7VA 4GNJA 2WLZA 4DUWA 4YPJA 1W3LA 1V3HA 3DU0A 2VHLA 5LXXA 3EY6A 3PBGA 3MBDA 2QR6A 4REQB 4Z2LA 1S5NA 3UPMA 2CZEA 3KCLA 3SUWA 2WSRA 1H11A 2A7PA 3D47A 4NZ5A 4ZXOA 3P74A 1X6LA 4UQEA 3TK7A 1UZ4A 4HMDA 3H53A 1HT6A 2I14A 5IHSA 4C6BA 2NVCA 1AQHA 1C8QA 5JH1A 5IXEA 1EQ3A 1XH2A 3KRUA 3ID7A 4K37A 1A80A 3UJRA 1J4RA 3PS7A 1QPLA 2GJXA 1EC7A 4QITA 4DUXA 3BAWA 4EPKA 1DWAM 1V3LA 3WQ8A 3DXIA 3B06A 1KXVA 4HNCA 3NL2A 1LG1A 2YR1A 3AC0A 4FO4A 4RDYA 3ANYA 3DIPA 4MNJA 4GISA 4EACA 1ADSA 2NV2A 1XYBA 3TIMA 1RLCL 5LYRA 1HW6A 2AOSA 3IK2A 4EK7A 2XP7A 1HKMA 1NY1A 3G6LA 1S2VA 3Q67A 4MADA 4AEFA 2EPHA 3B9OA 1J5SA 2PGFA 5GPRA 3EA3A 1PS9A 3W2MA 2YBUA 2HXTA 1YNQA 3W7PA 4LUTB 3UXLA 2XSXA 3UYIA 5T91A 1DYSA 1X8CA 4AEEA 3GC4A 3AS0A 2O56A 1KGWA 3NTPA 2V3DA 2PPGA 4AD2A 4DLMA 4TVDA 1IIHA 3MTWA 4LALA 3HGJA 3PVFA 3RMEA 1OC6A 3W85A 1X98A 3LQGA 3L2IA 3O15A 3T0DA 3UCQA 3BW4A 3PTQA 2LJ4A 3N2BA 4MGGA 5HNTA 2IF4A 2XJ7A 2PFHA 3L5MA 3NQAA 1XLCA 3VOHA 4ZQNA 3KABA 2ZQVA 2X1IA 1MO0A 3SGZA 1UKPA 1UKTA 4DRQA 3PHAA 3OIHA 5J04A 4U85A 5HT1A 3T8QA 1AMYA 1HX0A 2ZRUA 4JIRA 3B9DA 3VC6A 2YIHA 4I90A 2J27A 4AD0A 3UZJA 3WUFA 2W5FA 4F48A 2XFRA 4DO4A 1K7XA 1V3MA 4QT2A 4QIBA 3KS6A 3UG5A 2BGNE 1UP0A 4A2RA 4EANA 3H7VA 4A3RA 3QPZA 4OVXA 3AMCA 3WLQA 3SRFA 2JBMA 2OKOA 4L4LA 1JYNA 4EPDC 2Y1HA 1DVJA 1GQIA 2GJRA 4KGJA 3M6YA 1IHIA 4NILA 2X7WA 3VX1A 5KTLA 4TU1A 1K4HA 1T41A 3APYA 4YYCA 4C6DA 3GTYX 2EULA 4WF7A 1O5XA 2P3ZA 3GC5A 5EKYA 1E6RA 1K6WA 1B31A 4P7RA 4KKXA 4S3CA 3BAYA 2YYTA 1ZHAA 4C6IA 4PUJA 3W00A 4BK9A 1MNZA 3L23A 1VPQA 1AG1O 3E2SA 3I6TA 2X42A 1A5KC 2PDIA 2GOKA 2PRLA 4ONVA 4M82A 2VC6A 5I79A 1RBLA 4UCFA 5HWCA 1BTCA 1TPC1 3PB0A 1QU4A 2F2HA 1GQLA 2CC0A 4QG8A 3ABQA 4KRTA 1DWGM 3G18A 3PSWA 3ZQ9A 1Y0EA 1KGXA 1PX4A 5DMMA 3H70A 1Y7VA 4QZVB 2UWFA 1ELSA 1VQTA 4FX6M 1H5VA 3N34A 1R3RA 4UQCA 4N9DA<