3RM8A

Amcase in complex with compound 2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 133
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm8A01
1JNEA 1FHLA 3BAJA 3FY1A 1JYVA 3AXHA 2J7GA 1UR4A 5AYIA 4UFLA 3DYMA 2YA0A 1V0NA 4Z2KA 4MJ4A 2PF0A 1NP0A 1MQRA 4PEEA 3CUIA 5DT5A 4GQRA 1QHOA 3T0DA 1G01A 2QLYA 1UD8A 1B3WA 2VT0A 2VCAA 1VENA 2ZUTA 1FOBA 1C8QA 2D23A 2DIEA 2VO5A 2XIBA 2QV4A 2BHZA 3GZAA 1JFXA 1E72M 4B9YA 2GSJA 1CECA 3W25A 3WSUA 4E4PA 3W26A 4D1JA 4W8LA 4EE9A 1I1XA 3CH9A 2XVPA 1JYXA 2AAAA 3PBGA 2CERA 1CIUA 3PTQA 3UG4A 3RM8A 1UWTA 3ZJKA 2WC4A 3GNRA 1W1VA 4MB5A 2VMFA 3AMDA 3WD0A 4KRTA 4Q7NA 4W88A 5JIPA 3ARTA 1E3XA 3MUY1 3LPGA 4B15A 4HPHA 5JBEA 1GOIA 1SMAA 5D9NA 2XG9A 4PMYA 1WZMA 1E4NA 1UHVA 5E0FA 3ZT7A 3VDAA 4D6HA 1GHSA 4UOQA 4CN1A 1RD6A 1BF2A 3VGBA 2BVYA 5DO8A 4OUEA 5FOOA 1OT1A 1B3XA 4PMRA 4WSKA 3CTTA 1JZ5A 4U3CA 1CZ1A 3W53A 2V3EA 2J75A 3RCNA 5AC5A 1HT6A 3AMGA 2BY0A 3SCPA 1U33A 1HVXA 1W9XA 3UG3A 3KWXA 1HKJA 2E9BA 4PCSA 3SCQA 3WF3A 3L4WA 1E3ZA 2OSWA 1WB0A 1LG2A 4IPNB 4BQ4A 1DHKA 2XWEA 4MAVA 2XM1A 2XIIA 3MU7A 4D1IA 2J47A 5BWFA 1W91A 1HXJA 3FXYA 4FK9A 4J3TA 5LA2A 4C7GA 1JXKA 1C8YA 1V3KA 2WWCA 3SEPA 4GINA 4PRWA 4XZBA 1VB9A 1R8LA 2PWHA 2ZUSA 3AHTA 2VC9A 1EH9A 4Z2HA 2XGBA 3J7HA 4AD5A 3M07A 4P7QA 1JXJA 3MUZ1 2WVUA 5HBFA 5A8MA 1V6VA 2GJPA 4AZCA 3ARUA 3MANA 2VJXA 4QLKA 4KH2A 4AZIA 1NWUA 8A3HA 1QI3A 3LMYA 2WMIA 1CXHA 1VEOA 3SCWA 3WH8A 1E1EA 1E5JA 2E3ZA 5BXSA 5AC4A 1BAGA 1MXGA 4S3JA 4W84A 3OIHA 3WFLA 1VFMA 1JAKA 4HU0A 1W3HA 1ISVA 1C8XA 4CN6A 1GW1A 1GORA 4D6EA 2X1IA 2FGZA 3QOMA 1JYWA 1QW8A 4AD2A 3AIBA 1VFFA 3AJ7A 1QBAA 1RP8A 1BSIA 3T0BA 1PIFA 3L4YA 1TFVA 4LPCA 1JZ7A 1JI2A 4P7RA 3OGVA 3AIVA 3RMEA 5F7UA 3AHVA 2D0HA 1V03A 3AHYA 2UY4A 4ZFMA 1FP8A 5DEZA 3B9AA 4DM1A 1B2YA 5FKYA 4TVCA 1TUXA 3UESA 1DWAM 1JNDA 5E6YA 5A1AA 1A47A 4JL2A 5EBAA 5IFTA 4QCFA 3VGFA 3EMCA 5CGMA 1CXFA 4EK7A 1H3GA 1KR1A 2XJ7A 4EAMA 4D71A 2UWFA 2DPEA 4M8UA 1BYCA 1J0HA 4UNIA 4M29A 1CXKA 1DWJM 3MV11 3VDHA 2XUCA 3HJEA 2DH3A 5CPTA 4GPNA 2PBOA 3AROA 4MDOA 2A3CA 4R5EA 1UD6A 4JCMA 3QOKA 4GIAA 1E0XA 1R87A 3WNKA 2VX4A 4ATWA 4MTVA 3RJXA 2XPKA 2WLZA 3DHUA 4RE2A 1VJZA 5CLTA 1SYTA 2WZHA 4L4OA 1TCMA 1KQZA 2RGLA 4UFKA 1DEDA 4J3XA 4P7NA 3RM9A 4HPGA 4PMVA 3PTKA 2EPKX 3GXDA 4MB1A 1BQCA 1CXIA 3WN6A 1XSIA 1ODUA 1UQZA 4X0NA 1H49A 2VCBA 3VIHA 5DF0A 1HJWA 1QNOA 4AZCB 1UD2A 5CSYA 3WIJA 2C8NA 1I75A 3CGTA 2WMIB 1V0KA 2CBUA 2ZIDA 4OIFA 3FHAA 2VRKA 5BXPA 3CO4A 1GONA 1E6PA 2X2YA 2J62A 3M6DA 1BHGA 2CXGA 5D8WA 2ZX7A 2J7HA 1IZJA 1LG1A 3BAWA 5E70A 1CDGA 1H41A 2BNJA 1D2KA 4LYPA 1ISWA 4UR9A 1ESWA 2VR5A 4AIEA 1EXPA 1W9BM 5FL0A 2QF8A 3ARSA 3NDYA 4X9YA 2XHYA 3AMCA 2FHFA 1VEMA 1UYQA 1E5NA 3F5KA 1F4AA 2W63A 3AQUA 3NJ3A 3BLKA 1UD5A 1J9YA 4HMDA 4UOJA 4J27A 1OD8A 1W1PA 1MW1A 3WL1A 2OSXA 5I79A 3AZTA 4QAWA 3NIYA 1Q6GA 4LGXA 2E9LA 5A6SA 1XCXA 1XYZA 3VVGA 1B0IA 2D3NA 2WZEA 1KGWA 2Y24A 1GVIA 1HJSA 2Y8VA 3SCSA 3NSNA 1BVNP 2CEQA 1E43A 3T09A 8CGTA 2TAAA 3IANA 4PUEA 3WUGA 2VUYA 3SURA 3WEMA 3GM8A 2ZUMA 3WD4A 2EPLX 4XB3A 2DSVA 1DWFM 1BG4A 4W85A 3TTQA 3RPMA 1EO5A 4YN5A 2W66A 3WBAA 4P8UA 1XC6A 3CZ8A 4CU8A 4ACYA 3CMGA 3B8SA 1CGWA 4RE4A 3THCA 3UR7A 4DWSC 1HJQA 2WSKA 3UEQA 2XVLA 2VURA 3IK2A 4JFVA 2WWDA 3AYRA 3TP4A 2W5FA 2EJ1A 5I6SA 1B3YA 2J7CA 2UY2A 1IV8A 1J0YA 1JL8A 3D5HA 2CKSA 4X0VA 1UQYA 1PX8A 4P8XA 1OGGA 1XV8A 4E8CA 3VD5A 2D0FA 4RE3A 5D9MA 1V02E 1UWQA 4JL1A 3FAXA 3VD9A 2JIEA 4V27A 3MV01 3QGVA 5HOSA 4OJYA 3OLEA 1GQKA 1WZKA 1HX0A 5ABHA 3CMJA 2V5DA 2FH8A 1CENA 1V3LA 6A3HA 4OBSA 1MVYA 3DECA 3EDFA 2J79A 5BYWA 5D4YA 5IHSA 4HZ7A 9CGTA 7TAAA 5CJ5A 1WZLA 1QI2A 2VRQA 2PBGA 1CGTA 4CD4A 1E4MM 1ZJBA 1MW0A 2WMFA 4F79A 2XVNA 3MSDA 1WAWA 1L8NA 5HXMA 4YPJA 3N15A 1W3KA 4FLQA 4GI6A 4J3SA 2NT1A 3AZRA 3AFBA 3WDHA 1BGGA 4N42A 3WUBA 4JZ5A 5EB8A 5FD0A 2VCCA 1IT0A 5IXEA 1W2PA 2WZIA 5BXTA 4YHGA 5HDRA 2BXYA 5I3DA 3GTNA 4UQEA 1GOKA 4UFJA 3L4XA 2Y4SA 1ISZA 3VGEA 3RJYA 4BF7A 3ZJ6A 2E9MA 2G3NA 1WE5A 2CBIA 2W91A 5BRQA 3VIMA 1U30A 1FFRA 4QFUA 3AS2A 3ARZA 4JHOA 1ZL1A 4WKAA 1SR0A 4KGJA 1PIGA 2ZWZA 5AYBA 4XX6A 4ZENA 2XFFA 1LQ0A 1EDQA 1HKKA 1OGSA 2VZOA 3ZSTA 3AS3A 5FIPA 3T0AA 1OT2A 2DT0A 2YA1A 1V6UA 3CZEA 5DT7A 2QMJA 4JCLA 1UKTA 4XV0A 3VPLA 3KL3A 2CESA 3W37A 4ZEPA 3POHA 1E71M 4A3YA 1MW2A 3KZSA 1V0LA 1BYBA 1NOFA 1K9TA 1CGYA 1AQ0A 2J7FA 3ZT5A 3B9EA 3NYDA 1H1NA 2EPMX 1Q6EA 2VQUA 2V5CA 1TZ7A 3OZPA 4V2XA 1CPUA 5C71A 3ARYA 1H0IA 3O6AA 3PZQA 2WC7A 3VIKA 2WBGA 2VQTA 3B9DA 2ZX8A 2Z1KA 2WHJA 1MQPA 1VF8A 3MUIA 3I3DA 3BLPX 1QHPA 1X1NA 2BS9A 1H11A 3VIGA 1VJSA 2JE8A 3WQ8A 4PUDA 3I3EA 1LL6A 3RIKA 5ABEA 5FL1A 1G9HA 5AY7A 3WUEA 5KEZA 2A3HA 2EXOA 1G1YA 4DM2A 4B3KA 2PWDA 1QOXA 1FA2A 4CD7A 3QHNA 2HISA 4URIA 2AMGA 3PTMA 1NWSA 3AISA 2ZE0A 4AZ7A 1UG6A 3FNDA 3VU2A 4LYQA 3ZQ9A 1E6XM 1UZ1A 2VX5A 1VFUA 1K9DA 1EGZA 2XSBA 1TVPA 3KL5A 3THDA 4CCDA 5A6BA 1XSJA 1H2JA 3WNLA 1W1YA 2OWWA 1QHZA 4CU7A 2BY1A 3N12A 3W28A 2D22A 3WFZA 5C70A 2OSYA 3OG2A 3IAQA 3SCNA 1G0CA 3UR8A 4MNKA 3D3AA 3ZR5A 1M03A 1W2VA 2PWFA 3T2OA 3EDKA 3WMBA 1E4IA 3WF1A 2J7BA 2V3FA 3PZIA 4GKLA 4HTYA 2BFGA 3WL0A 1E73M 4ATLA 1LWHA 2G3JA 5GNYA 1JIBA 1A3HA 4UQDA 1WKYA 1J0JA 4WLCA 1KXVA 3WBEA 4UQBA 4CN4A 2DSUA 3N17A 3FN9A 4GQQA 3BAYA 2D3LA 1ZBCA 1X6NA 3DYOA 4U5IA 2O9RA 1GOMA 1ZU8A 3W6MA 2AOSA 2GDUA 4J7RA 1G94A 1HF6A 2QPUA 4B9ZA 3WH6A 4TOQA 5I23A 1R85A 3K4AA 3AIWA 2ZXAA 3SUSA 2C0HA 5A6AA 4Z2IA 3MMDA 1B9ZA 2YL8A 3TONA 1MXDA 4IISA 2BXZA 1J0IA 4GXPA 4CGTA 1NWTA 3A4WA 1UD4A 2WVSA 4GZEA 1PAMA 2WKLA 1W9PA 1Z32X 1NQ6A 2WMJA 1CEOA 3CHEA 2J25A 2MANA 4KWUA 3U5UA 3F5LA 4B16A 4CCCA 1LL4A 4MNJA 3MMUA 5CZKA 1VIWA 3AIUA 4PSRA 3K8KA 4TXEA 4PMZA 5CG0A 1OCQA 2WHKA 1TVNA 3AIQA 3G6LA 4GO8A 1ZJAA 4DWSA 3L4ZA 3SUWA 3TTOA 1E4LA 2W62A 1S46A 4D6JA 1MQQA 4BZYA 3WEZA 3NSMA 2G41A 5I5RA 1KBBA 1Q6FA 1RPKA 1QNPA 3SUVA 2VZSA 2GK1A 1B1YA 5CPSA 3SCTA 1UWRA 1W9DM 4LQ1A 1KCLA 4K68A 4W7UA 2WXDM 2JF7A 2JF6A 1E6ZA 3BSGA 3AXIA 3GDBA 1WNOA 1E0WA 2ZXQA 5A6KA 5D9PA 3WQVA 1FH7A 3WNOA 3WD1A 1E70M 4ZE4A 3W38A 1OM0A 3AIEA 2B31A 1ISXA 3L2LA 4AY1A 2DGAA 3WUFA 2ZUUA 3IJ9A 2QHAA 1WDSA 1L0PA 3MUAA 3A47A 1NWRA 4M81A 5HPOA 3VM5A 4AZ6A 1JZ4A 3WY1A 2OYMA 3AMKA 1AMYA 4P8WA 1B3ZA 5A2AA 4OBRA 5TD4A 1QNSA 4W86A 4JFSA 3GH5A 4MPKA 2CHOA 1J11A 2D1ZA 1M53A 3VIOA 3SCRA 5CLWA 2XM2A 4AD4A 5I24A 1B90A 5IDIA 3WH5A 2V3GA 4E2OA 3EMQA 5M03A 2J7EA 3BAIA 2ZUNA 2X8RA 4UFHA 1B3VA 2EPNA 1KGXA 4AEFA 3AHZA 2X0YA 3OBAA 4W8BA 3RO8A 4DUWA 2WLYA 3GH4A 4NF7A 2DSKA 1X6LA 4H2CA 1NP2A 3W24A 4AYSA 5A6BD 2QMKA 2ZUWA 4CKQA 5JUVA 4W7WA 3BSHA 1KWKA 5BROA 3VOCA 4Z2GA 1GZJA 2JIWA 4DWSB 3VGHA 4L4PA 5A6JA 3ARVA 2WANA 1KXHA 4UZSA 3VD3A 2F61A 4JFWA 4W93A 2O9PA 4WKHA 4PTWA 2CBJA 2WVTA 1XD1A 1W3JA 2GK1B 5KZ6A 1V6WA 2YBUA 2EBNA 1UR1A 1IZKA 3PZUA 1C91A 3U7VA 4NSBA 3U7BA 4TUFA 1OIFA 4FMVA 4AD3A 3OGSA 1UH3A 5DMYA 3ARPA 1FFQA 3L4TA 4U31A 5LYRA 4DUVA 4MB3A 3S6TA 2CPUA 4IPLA 4OZOA 1VAHA 1LLOA 3SCOA 3SIMA 3NUKA 3POCA 2D24A 3VINA 2FHCA 1LWJA 6CGTA 4PCTA 3AHXA 1V6YA 1V0MA 1BLIA 3AICA 4QLJA 5JBDA 4F66A 2IUZA 4FLRA 4Y7EA 3CZLA 3NDZA 2Q8XA 3CUFA 1QPKA 4AIUA 4AMCA 1JD9A 2JEPA 1CXLA 3BXWA 1M7XA 3GXMA 3ARRA 1QW9A 1UA3A 4HOWA 1EOKA 1OSEA 3T08A 1R86A 3GBDA 1ZS2A 2FDMA 1GOWA 1J0ZA 2WW5A 3VIIA 3GNOA 4CU6A 2YJQA 3LPOA 4AC1X 2VOTA 5CSUA 1LL7A 1W9UA 4DWSD 1SFSA 3SCVA 3K8MA 4ATDA 2DDXA 5I2UA 2XVKA 2WKGA 2VTFA 4U5KA 2OLHA 1HP5A 2DIJA 3UETA 3WDRA 3O2LA 3BAXA 1EIBA 1OWQA 4PTXA 1Q4NX 2E0PA 4WF7A 2EPOA 2XWDA 3AZSA 1PZ2A 3TTYA 1XHGA 4Q22A 5E0CA 1JDCA 1UR0A 2VVNA 1Q6DA 2JALA 5IFPA 3WQ6A 4BA0A 5A69A 3DYPA 4YHEA 3K4DA 1KBKA 3M46A 2WSPA 2A3AA 4P8VA 1OGBA 3A4AA 3OLGA 3A4XA 1J10A 3JUGA 3BC9A 4W7VA 5I78A 1BPLB 1E0VA 4JFTA 3ZMRA 2ZX9A 1JAEA 3OZOA 1CGUA 1W9VA 2WNWA 3UG5A 4AZ5A 2YL6A 4XUYA 4M80A 2J78A 3T2PA 5A6MA 4UQAA 3RDKA 4U33A 5A94A 2BVDA 2OWXA 1V3HA 1DWHM 2DT3A 1I1WA 3U5YA 1GUVA 1C7TA 2WYSA 2DEPA 4H8UA 2DQXA 5A95A 3UERA 3CHCA 1ITCA 1SMDA 5CPQA 4WIWA 2CIPA 4HZ6A 2VZUA 3PZ9A 4HU8A 1ODZA 1O6IA 5BXRA 4DUXA 4JAWA 4H7VA 1QI0A 3OB8A 1CWYA 1PPIA 1J12A 3ALGA 2GVYA 2XVGA 4PBGA 1FH9A 1JI1A 4PTMA 1WCGA 1MYRA 1WDPA 3VNZA 3WMCA 3N04A 2J77A 4A3HA 1JYNA 4PMDA 3N13A 3T2QA 5FCZA 4GI8A 4MJ2A 2WM0A 3WNMA 4D6IA 4AIOA 5BCAA 3CZGA 5IHRA 3WELA 2EO7A 2ZICA 4B3LA 1WDQA 2F8QA 3ZSSA 1BGAA 2CYGA 2GUYA 1E6SM 4ZXLA 1EHAA 4MAZA 2GJXA 4HMEA 3A3HA 5DFAA 2RGMA 1EQCA 1E9LA 1FHDA 3ZJ7A 3PZNA 4NZCA 3GH7A 1J0KA 1UWSA 2NT0A 3F4VA 2YDSA 1DTUA 4PYSA 4HOZA 3F5JA 1U2YA 2VNCA 2IXUA 4U2YA 4HP5A 2VX7A 4FF5A 2JFEX 2WVVA 4D6GA 2ZXDA 1UOKA 5JIWA 5A6LA 1HKMA 4AD1A 1GOQA 4AW7A 4RL3A 2BY2A 4EANA 1W32A 1F4HA 1H09A 3KL0A 4U3AA 3VDCA 2ZWYA 5A8OA 1XH0A 1V02A 4OOUA 2XSAA 2QPSA 2YOCA 3CHFA 4TTGA 1W3LA 2CKRA 1KGUA 1HIZA 4CCEA 2VI0A 1UR9A 1NARA 2A3BA 2EEXA 5A2CA 4CVWA 1CLXA 2OWCA 2CETA 3BMWA 2WK2A 1M01A 4PMXA 1OB0A 1GNXA 4P7LA 1EDGA 7A3HA 1PX3A 1PBGA 3L4VA 3QR3A 4UQCA 1AQMA 1OD0A 4KGLA 4TTUA 2DSWA 3K8LA 2E4TA 2XFYA 4M82A 1CBGA 4IM4A 4N0RA 1QI5A 3ZM8A 1ECEA 3PHAA 4UFMA 2J8GA 4CD5A 4WKFA 4ACZA 1EO7A 2VZTA 4BS0A 3ARWA 5JH8A 4LX4A 3WQ5A 5HNNA 4CVUA 3ECQA 1GQIA 1BYDA 5ABGA 4AWEA 4M1RA 2C7FA 1GPFA 1BFNA 1OINA 1V3JA 2BHYA 2YBTA 3SUUA 4P7OA 1XD0A 3WDIA 3WDQA 1V3IA 1GQLA 2WCAA 1J18A 1N82A 1UWUA 1JZ8A 3N11A 4D6FA 4HA3A 3N1AA 1E56A 3CZJA 2YDQA 1UWIA 4HZ8A 1WDRA 4AXNA 4BCEA 2J4GA 2O9TA 2BHUA 4BQ2A 1WO2A 1ZBKA 3TA9A 1XSKA 4MNMA 2GJXB 1KXQA 3O9NA 4S3KA 4GO9A 4AZGA 4CUCA 1EHNA 1JFHA 2WBKA 1D3CA 1UR2A 3SCUA 4JKMA 1CYGA 1EOMA 1VEPA 1GHRA 2YDRA 1LJYA 1TG7A 2J7DA 1K6AA 4HMCA 4CD6A 1OBAA 3RILA 2ZXBA 3OGRA 2PWGA 2WVVB 1ZBVA 1XH2A 3AOFA 1AVAA 5A8PA 2CNCA 3KE0A 4UCFA 3APGA 4E8DA 2JEQA 5A8NA 4W5ZA 1VBRA 2X09A 4TX8A 3NCOA 3W0KA 1RH9A 4H41A 2J8FA 4F9JA 3IJ7A 3L2MA 2GFTA 2WAGA 2WHLA 4AZBA 5M17A 5CGTA 3VIPA 3WKZA 1CGVA 1E6NA 7CGTA 1JZ3A 1VFOA 4F8XA 1UKSA 2XTKA 5E9AA 3VKKA 3W4RA 1C3FA 3ZOAA 3BGAA 3S2CA 1TR1A 1ITXA 1UKPA 5HPCA 3FAWA 1H5VA 2X05A 1PJ9A 2ZX6A 5ECUA 1GQJA 1D7FA 4KRUA 4FLSA 3K46A 5JBFA 4JKLA 2FH6A 4GZJA 3QHMA 3VM7A 5I0DA 3MSGA 1E1FA 2J74A 2YKKA 5ABFA 3BH4A 1H4PA 1P6WA 4Z2JA 1HL8A 4UTFA 4KMQA 3CHDA 4U2ZA 1W1TA 1C7SA 5EMYA 1US2A 4WJXA 1BYAA 3WNPA 3WH7A 3FW6A 4ACZB 4AISA 5LA1A 1EDTA 2IXVA 4D72A 1XGZA 2XYLA 2YL5A 4XZWA 3WDJA 5D8ZA 2PI6A 5E09A 1V6XA 5M3WA 3II1A 2PC8A 1AQHA 4ZE5A 1JG9A 5M5DA 2WMGA 2F2HA 3GNPA 4J28A 3EBVA 3N18A 4PMUA 4GZIA 3MO4A 1E55A 1QNQA 4WK9A 3WNNA 4BQ3A 1V08A 3CPUA 5A2BA 3TOPA 4W89A 1UR8A 3SUTA 3AS1A 4ZXOA 1WP6A 1R7OA 2BVTA 1JGIA 2WMKA 4ML4A 2G3MA 2CHNA 4PSPA 1CLVA 4A4AA 1JDAA 4HA1A 1JZ6A 1HJVA 1KFWA 3W82A 1HL9A 1PX4A 4TX6A 1QBBA 2WC3A 3WDPP 5LA0A 2CITA 1GJWA 2BV9A 3AI0A 3WF0A 1TA3A 4H8HA 4UQ9A 3VIFA 3CIVA 4D6DA 1JF5A 1HVQA 3VO0A 3LPFA 1HP4A 5CQ1A 2YIHA 1Q6CA 2VVSA 1R7AA 2VZVA 2DT1A 1ISYA 4JIEA 1K9EA 1NOUA 3VIJA 1BVZA 4HOXA 2XGIA 1Y7VA 1HKIA 2V3DA 5EFDA 4PMNA 1FP9A 4D6CA 5CXPA 2VX6A 3ZT6A 3GXIA 1B30A 2WHMA 1KR0A 3AMLA 1YQ2A 3I3BA 1KCKA 3PZOA 4M24A 1UKQA 4H8VA 3UCQA 1JZ2A 1NH6A 1GVYA 2ESCA 3WQWA 1QI4A 3VTRA 1TE1A 2W67A 4OKDA 1O7AA 3W27A 3DHPA 3IAPA 1UH4A 4V28A 3WENA 3VGDA 3GBEA 3L4UA 5EFFA 3WD3A 4QDMA 1DWGM 2D2OA 1M04A 2WCGA 5ABFB 1EQPA 1MW3A 2OYLA 2YLLA 1UD3A 1YHTA 2Y5EA 3VD4A 1FH8A 4UOZA 3N9KA 3DC0A 3OLIA 3ZIZA 5GNZA 3IJ8A 1XH1A 5GQBA 2PB1A 4TVUA 3EMZA 2ZOXA 2VL4A 4R27A 1PEZA 4QP0A 5A3HA 1NM9A 5I77A 3G6MA 5D9OA 3MKKA 1G5AA 3VMNA 3BCFA 2BY3A 1E6QM 1UUQA 4F9DA 4WSJA 1WZAA 3VGGA 2V38A 3GXFA 3AS0A 4C7DA 1KWGA 3VDBA 1BTCA 4AD0A 2G8ZA 4AZHA 1MWOA 4H04A 3CUHA 1H0GA 4MDPA 4AEEA 3ZO9A 3AIRA 4QLLA 4CD8A 1BG9A 4PMOA 3W6LA 1WPCA 2YL9A 4NI3A 1E15A 3ALFA 3E1F1 3VILA 1DWIM 1UA7A 1LF1A 2G4FA 1JF6A 4PMQA 4JHZA 3ZR6A 1V3MA 3VUPA 1TA3B 4C7FA 4UZUA 1UH2A 2EQDA 2D20A 1C92A 2E40A 2D0GA 1UKOA 2ZUVA 1XYFA 1HJXA 1CGXA 3BCDA 4HA4A 3VD7A 4MB4A 3WMSA 2UY3A 1C93A 2YLAA 2FHBA 1UZ4A 3WEOA 4PN2A 1VBUA 3CUJA 1ZBWA 2NW0A 1JDDA 3QHOA 3VMOA 2O9OA 4JKKA 1HN1A 1VRXA 3ZJ8A 5A8QA 1XRVA 3W29A 2W61A 1E6RA 1DP0A 1KQYA 4W8AA 1TMQA 1GJUA 2DSZA 3W81A 1RP9A 2GDVA 3PZTA 2VRJA 2WPGA 3GYCA 2Y2WA 2E8ZA 4J3WA 4M56A 4NRRA 2A3EA 3WQ4A 3LPPA 4LYRA 4W87A 1OIMA 2XFRA 3EDEA 3PZVA 3AYSA 2NSXA 5GPRA 3HMCA 1QNRA 4UFIA 3PN8A 3CBWA 3WF4A 3CLWA 3CZKA 1CXEA 2FGLA 1GCYA 4FLOA 2OYKA 3VMPA 2W4XA 4LXFA 2UY5A 2HVMA 5GNXA 3OLDA 2X0HA 4BQ5A 3MMWA 4MNLA 2CCRA 1HJUA 2ZX5A 1GOOA 2WCSA 5E6ZA 1QVBA 3WH9A 2WB5A 3EDDA 2WMHA 5BRPA 3VX0A 3FHQA 3AXXA 4IUGA 1E40A 2G3IA 2W92A 4OOZA 3PZMA 3WD2A 4TVDA 3EDJA 3HN3A 2E8YA 3RM4A 3A6OA 1CTNA 3CUGA 1C90A 3TTSA 1XCWA 3VNYA 2VR4A 1K9FA 1CNVA 1KXTA 1MFUA 1PZ3A 5C8BB 3MS8A 3PZGA 4W5UA 3BAKA 4MADA 2CBVA 4EKJA 3HU7A 3WF2A 3VX1A 1ZB5A 4GI9A 3KEHA 1EA9C 3EYPA 2O92A 1J01A 3U57A 4JFUA 3BMVA 1NOWA 2GJRA 3NSXA 3M7SA 1KB3A 1HNYA 1B31A 2DH2A 3ARXA 2YA2A 2PWEA 4PTVA 3OA5A 2Z1SA 4QCEA 4NRSA 2Y8KA 3K1DA 6TAAA 3ARQA 1MFVA 4J3VA 1JD7A 4Z2LA 4J3UA 1US3A 2DT2A
chains in the Genus database with same CATH superfamily
3BAJA 3BLLA 1JYVA 3O5IA 2ADAA 1TWZA 4Z2KA 4MJ4A 3EPNA 5TQLA 1B4EA 5I3JA 5DT5A 1H50A 1G01A 7XIMA 3IUDA 1QK0A 2VT0A 2VCAA 3RG6A 2HS8A 1MUCA 4L1WA 3C5QA 1OVDA 3W7KA 1F61A 3GZAA 3WSUA 3ABRA 4D1JA 2F7FA 4W8LA 2ZRZA 2Z7KA 4EE9A 3QEZA 3CH9A 2J13A 2CERA 2IQ0A 4Q7BA 1SM9A 3ZJKA 3LPGA 4HPHA 5JBEA 7REQA 4PMYA 4NZFA 4WQ6A 1UHVA 3ZT7A 2F21A 1GHSA 4BF5A 4D6HA 4CN1A 1ZSXA 1RD5A 4IX2A 4WSKA 4JEJA 3MHGA 3Q58A 4RDYA 4U3CA 1CZ1A 3EGJA 2V3EA 5AC5A 2O55A 4N9EA 5LHFA 4Q32A 1HVXA 3QJAA 3LLXA 2IKJA 3DKJA 4EX4A 1W9XA 3UG3A 5FJTA 3WF3A 4PCSA 3KVKA 3GVWA 4GXWA 2OSWA 4K3ZA 2Y85A 3XINA 3ISIX 4L61A 3FXGA 4O17A 1B3OA 2TSYA 4MAVA 3CUXA 2PV1A 2YCKX 3QTPA 4MZ1A 2XP8A 1UCWA 3A24A 4DZ5A 5DMNA 4JTHA 1FQ0A 2JGYA 2ZRXA 3GR4A 4HJFA 4DX3A 2PDPA 3LUOA 4OTKA 1GKQA 4FK9A 3LOTA 1YE6A 2FZ9A 3ORWA 4LS2A 2PCQA 3SM0A 1KKOA 2PWHA 3QPZA 1ZTVA 2ZUSA 1ML1A 5G2HA 2VC9A 2JQXA 3P60A 1RBAA 4P7QA 1G67A 1JXJA 3KDOA 5F4XA 3CC1A 5HBFA 5A8MA 5K9XA 3FVDA 4XAZA 4C1LA 4F0HA 3C4UA 1XYMA 1NWUA 8A3HA 3THAA 4WR3A 2FDSA 4J40A 1SW0A 2XH7A 4H3DA 4NJKA 4MFDA 1IX5A 2DV0A 1W3HA 4CN6A 3NZ1A 4AYGA 1GORA 4D6EA 3GU1A 4AD2A 4HBEA 1E1CA 3B8IA 1VFFA 3HPZA 2N87A 1QBAA 3VC6A 3H55A 3UPWA 1BSIA 4Q4SA 3L4YA 3PVFA 4IQCA 4GUGA 3XISA 5K2ZA 1YATA 4P7RA 3AIVA 3A4JA 5ECVA 2NWSA 1POKA 3AHVA 1FWSA 4XSLA 2X30A 1YW5A 4HSOA 5AB3A 3CYVA 3DAQA 2RSEA 1ZJIA 2PDKA 1WKEA 3UESA 3B8VA 3HPFA 2Q8ZA 3P2VA 2TRSA 3RYSA 4XG1A 3WCZA 1P0EA 1A47A 4QJ1A 2NVDA 3BZGA 1N8WA 1EJRC 4RDWA 1JCMP 4YTQA 3EMCA 4PH6A 5LZLA 3U2OA 4NXSA 1DJXA 4XZIA 2ETNA 2ZA3A 4JTQA 2GJNA 4KEZA 4D71A 2VDIA 2QXWA 1JUKA 1BYCA 4K1GA 4M29A 3MV11 3S6OA 4GY7A 3VDHA 4K38A 4GPNA 3G24A 3AROA 3C61A 3O5DA 4GX8A 4JCMA 3QOKA 1E0XA 5LSMA 4GFIA 1N1AA 1VPYA 4C5ZA 3E74A 4Z17A 1SYTA 3C56A 3SRKA 1TTPA 3B0PA 4NZ3A 4P7NA 4B5XA 1FJDA 3PTKA 3V1HA 3GXDA 1GVQA 2YCLB 4JFJA 1TPB1 5H1WA 3IRSA 2Z1VA 1XG3A 3H2FA 2A21A 2WJDA 4JFKA 5CSYA 4QTGA 3WIJA 2FFCA 1GJPA 1I75A 3REQA 2WMIB 1V0KA 4IPJA 5DMLA 3RMJA 4B5SA 3DH7A 3PSWA 2J24A 2VN1A 2X2YA 4DRMA 3M6DA 3XIMA 1FKLA 1BHGA 3UBPC 3ME3A 2J7HA 3R8RA 1IZJA 1CDGA 4UR9A 2IQDA 1SPQA 4AIEA 2ZQSA 2L5HA 4IFOA 4B4FA 1W5MA 2IQTA 3E49A 4X9YA 2HS6A 1UYQA 1E5NA 3F5KA 3NXFA 3KVMA 5CSRA 2PU0A 2OZ3A 4QISA 4UTWA 4HMDA 4J27A 4E2DA 2ALDA 1OD8A 1EJXC 3P5YA 3HQ1A 3NWRA 1Y5VA 2I17A 3IIXA 5I79A 4GHRA 3KFTA 2DY3A 3W7RA 2WJFA 3G8RA 2Z6JA 5C7VA 3KOFA 4O57A 3FFSA 4X61A 1XYZA 4K8GA 2YGYA 2IKHA 4RJEA 2Y24A 1GVIA 1E43A 3V3WA 4QIBA 1RLDA 8CGTA 1Q1CA 3GM8A 3FGCA 3WD4A 5CZ0A 5FAJA 3W2LA 4W85A 3C3NA 1XXXA 1RA0A 4M0XA 4P8UA 1XC6A 3CZ8A 4CU8A 4ZOBA 3OIXA 4IQEA 3T9PA 5H8UA 1A5BA 4MF4A 2OO6A 5T26A 1IR1A 2WWDA 2W5FA 2EJ1A 3PPGA 2CXEA 1M3UA 5I6SA 1B3YA 1IIHA 1IV8A 1J0YA 1S2VA 2CKSA 3CEUA 4X0VA 3UXLA 3A5FA 3KLKA 3NPUA 3EWXA 4LVBA 4PR4A 4Q8QA 3BK0A 4W9PA 4G7EB 1ADDA 1M6JA 4CQ9A 1V02E 1UWQA 3VD9A 2G96A 2JIEA 4V27A 2YXOA 3MV01 5HNRA 5FF4A 3N14A 3W1LA 2NX1A 2GSEA 5HOSA 3OLEA 1GQKA 5ABHA 3H2OA 2IKIA 4FAPA 3MB9A 1GKPA 4X22A 4MMWA 1MVYA 4PE8A 3IKDA 2J79A 3LCHA 1KBLA 5HA7A 5DN1A 4HZ7A 2F38A 4ERGA 1JRBA 3KAFA 2KFWA 1EC8A 4GQ0A 4WOQA 3SO7A 2YZ5A 4FSAA 3LLFA 1IWBA 1QPLA 2XVNA 1JNSA 4GGQA 1WAWA 4FLQA 3TLQA 1NVMA 2NXIA 1OFBA 2QV5A 1J5SA 1BGGA 1FHUA 4JZ5A 2KE0A 1W8SA 2YYTA 1EYMA 2D2HA 5GJMA 2KX9A 2VCCA 1K8CA 4EWJA 5IXEA 3RX3A 1W2PA 5BMWA 3MA8A 3NL2A 5I3DA 3GTNA 4UFJA 1O5RA 3L4XA 2Y4SA 1ISZA 4QSFA 3QBUA 2Z6IA 2CBIA 4I9AA 1U30A 3NQCA 4N6FA 1FFRA 3HGJA 5HMDA 4XAGA 1RLCL 1U5VA 1XBZA 2H90A 3VAWA 4O28A 2PUZA 1I2RA 3SDOA 3S1WA 2XH0A 4H9UA 5AHIA 2Z24A 1PIGA 4XX6A 1OK4A 2XFFA 3CEPA 1TV5A 4MWAB 1QFEA 3LHYA 3T6CA 3WLJA 1OGSA 3A5VA 4DZAA 4H7CA 3T7VA 1FWDC 3NO1A 5D2VA 5AZ1A 3VA8A 4C6PA 4LJ3A 3O63A 1V6UA 2V5LA 1BXBA 1TPVA 3DHFA 3H24A 3VABA 4IHCA 3BWWA 2FJKA 4XV0A 4PMJA 3FAPA 4O19A 1VLWA 3WLPA 4ZEPA 3PR9A 2V0TA 4A3YA 1PHQA 3PG8A 2FGBA 3KZSA 2GVGA 4C6IA 1NOFA 3VDGA 3LENA 1AQ0A 5HUAA 4LTSA 3WLRA 1R3SA 3OZPA 4V2XA 3CV6A 2Y7FA 1H0IA 3PZQA 3LTSA 3VIKA 3CGNA 2VQTA 2ZX8A 4Q8WA 4A35A 1MQPA 4F4RA 3MUIA 3I3DA 3BLPX 3DGRA 1PTDA 1X1NA 3W73A 3N2XA 1DJZA 2VEPA 4HJWA 1H11A 4QX4A 2E7FA 1GEQA 4JQAA 3TQ0A 3RIKA 5KEZA 4J2PA 2EXOA 4DM2A 3KHDA 1ME9A 4ZL1A 5HNTA 1QOXA 3PF3A 4CD7A 3QHNA 3UFYA 4LOCA 2HEJA 1ROUA 4ADTA 4AZ7A 1UG6A 3ZQ9A 2KO7A 3OYXA 3IJ6A 2NUWA 3N4AA 1K9DA 1TVPA 3BCJA 4WY0F 3THDA 4CCDA 1F40A 1XSJA 5CBJA 4LS0A 1H2JA 4IFKB 1W1YA 2OWWA 1QHZA 2BY1A 4GGBA 5C70A 3IARA 3IAQA 4DUOA 4A8RA 4YIWA 1LYXA 1W2VA 1DQUA 1IR2A 1E4IA 1YBQA 3RPTA 3NO3A 2F2KA 4TMBA 4PBEA 3WL0A 1E73M 3O5OA 3Q67A 3QFWA 4XD4A 4QT3A 1JIBA 1TREA 3GSMA 3H53A 4WLCA 3FJ4A 1GZGA 4GKTA 3T1GA 2C79A 1S39A 4Z42C 4ZO7A 3M64A 2Y1HA 4NY2A 3DYOA 4U5IA 4Y2WA 3M0JA 1ZU8A 3R25A 1LOQA 1G94A 2VEIA 2PMQA 3NNTA 3IJQA 3NZRA 4NJGA 3K4AA 2XZ7A 2BX7A 3S0CA 4JIIX 3SUSA 5A6AA 1E0TA 3CUZA 4YTSA 6ENLA 2ON3A 3TONA 4IXXA 2R1PA 4EXQA 1F74A 1J0IA 1XLAA 1UD4A 4GZEA 1PAMA 3GDRA 1W9PA 2CZFA 1NQ6A 1I60A 1W17A 3CHEA 2MANA 3L21A 1F07A 1I6NA 2Z0IA 4GVHA 1F6YA 4MNJA 3MMUA 1VIWA 3AIUA 4PSRA 3U2EA 5AVHA 2YZRA 1NFGA 3BDKA 2PLMA 3G6LA 1ZJAA 1LQAA 4N2YA 3CXOA 1JCJA 3MPGA 4BZYA 2OZTA 1KBBA 1US0A 3WK1A 4X63A 2RJGA 2PTDA 2FLIA 3F1QA 2XH2A 2ZBTA 2PTXA 1MEWA 4NT0A 3G0SA 3RCYA 1WUEA 3UZZA 1UWRA 1JPIA 2VGBA 1PCKA 4LQ1A 2ISFA 3LN3A 1TV4A 4POCA 4RZ5A 2JF7A 1EL3A 5EMKA 4HNLA 4KFNA 5CBBA 4LUTB 1E0WA 2ZXQA 4F0LA 4HYVA 3U8GA 2Y78A 3WD1A 5BOFA 1I9CB 3W38A 3L2LA 4F40A 3STGA 3GNDA 2QHAA 5BWAA 3O05A 5I98A 3H21A 3MUAA 4RXGA 1NWRA 2H3BA 3LYEA 4IMGA 3VM5A 5MKGB 3NG3A 3AMKA 2A1YA 4O2TA 4P8WA 4ASTA 3OG3A 3GFXA 4LEFA 6XIMA 1YDOA 1B3ZA 3NOEA 2MLYA 3TSBA 1PO9A 1ME8A 3UI5A 4UMCA 4S3FA 2LPVA 1CI1A 1QNSA 2G5WA 3GH5A 4MPKA 5T8GA 3I7RA 3ZLGA 1XLHA 2D1ZA 2ISWA 3B3DA 2CLLA 3SCRA 3WQCA 3W7PA 5I24A 4NHVA 4FR6A 3WH5A 1A80A 1L9WA 1AA1B 1SZRA 5M03A 2ZRUA 3B4UA 1KGXA 4H6RA 1GYNA 4L64A 3G3DA 5F4SA 1C9HA 1JEZA 3BOLA 1XS2A 4W8BA 3RO8A 1FDJA 1ICPA 4UCGA 4DUWA 4GI4A 4ROQA 4H9XA 4P61A 4H2CA 1X6UA 4E3VA 4PBFA 3W24A 1TV8A 4JTSA 2CLIA 1QTWA 3VOCA 3ONBA 3VNLA 4DWSB 5AHNA 3V0UA 3ARVA 2WANA 1KXHA 4UZSA 2J6VA 4AFYA 3B40A 2OLSA 3RU6A 3PUGA 3QQ0A 3O07A 4PODA 3O7UA 1PYFA 3SRDA 3VK5A 3G1HA 5C6MA 2QEZA 4OECA 1W3JA 4NNCA 1YX1A 2YBUA 4UTLA 1UR1A 5FESA 1C91A 3EA2A 4HN4A 1A5CA 3QTGA 1JCXA 2YCJA 1EF2A 4TUFA 4AD3A 2HNEA 4ICNA 4YMZA 5CPMA 4WEVX 4MB3A 3S6TA 4DF2A 2AL2B 3E2SA 1AH4A 1DE6A 1BWLA 1VAHA 1LLOA 1PL9A 3SIMA 3NUKA 2D24A 6CGTA 1LWJA 3RX2A 1ZPTA 4QLJA 3MCOA 2Q8XA 1XLDA 3CUFA 1MO0A 4G56A 4NNBA 4MZYA 3GIYA 2Z28A 4AMCA 1JD9A 4GYJA 1SW3A 4W9TA 3GXMA 3ARRA 1XIGA 1OSEA 1D6OA 3T08A 4TMCA 1SUXA 3GBDA 2QT3A 1GOWA 3RLHA 4KWVA 3ELFA 2VOTA 3O1NA 2F23A 1LL7A 3SCVA 3ITTA 5I2UA 1V93A 4Q6JA 2DIJA 1K3UA 2PDMA 4WCJA 3WDRA 1OWQA 1NAL1 1ONWA 3CPGA 4AX6A 4Z1BA 5HJXA 3KS5A 4Q22A 5HK4A 2EKGA 3TC5A 4NIRA 1JDCA 3EX2A 1EX5A 7ODCA 5BW6A 4QJ5B 3L5LA 4AY7A 3T4WA 3DYPA 4GCAA 2WSPA 4P8VA 4TX0A 4CQAA 4C91A 2YSWA 2CW6A 3NEVA 3G1YA 4GQGA 5LNSA 3MWCA 5XIMA 1E0VA 2GVEA 2YDAA 3KOZA 4IPPA 4YWIA 1KKRA 4CQDA 2ZR4A 3TC3A 2DZXA 4Z1DA 3UG5A 3ZR4A 1S5VA 3APYA 3I4EA 4M80A 3RDKA 4U33A 2BVDA 3NVTA 1GT8A 4C6LA 1TRDA 3U5YA 1GUVA 1C7TA 4MPQA 4S3DA 1A3WA 1RA5A 2DJLA 4KEVA 1S5MA 3VI2A 3LERA 5HQMA 3GHSA 3BMBA 2R94A 1EJVC 4H7ZA 5BXRA 3IIPA 4NJIA 2I16A 3Q65A 1QI0A 4C6DA 1QPNA 3I10A 3UW6A 2HXUA 3FDKA 3PBUA 3TMLA 1UJQA 2VDHA 3UZJA 3HFTA 4U10A 4A3HA 1NDVA 2AGTA 3N13A 3LM7A 1VYRA 2CZVA 4DEFA 4D6IA 1L6GA 1FWCC 1WDWA 3C3UA 5BCAA 3CZGA 4K37A 3KBSA 2M08A 2ZICA 4B3LA 3M9YA 1BGAA 3QZEA 3GG8A 1UBPC 2QCDB 1E6SM 4HMEA 3FLUA 3AWOA 3BG9A 2H8XA 1EQCA 4R85A 1W31A 3TYAA 1E9LA 5EMLA 3GH7A 5AYZA 1J0KA 4GH3A 1KM5A 1UWSA 3F4VA 2J66A 1ZZMA 4PYSA 2OQYA 4HOZA 1U2YA 4F0MA 2V68A 3D6NA 4HP5A 2VX7A 4YCPA 4R33A 3TC6A 2PS2A 3WQEA 3GX9A 4LUYA 5JIWA 1YYAA 2DG4A 3W86A 2WKJA 1OK6A 4K1WA 4RL3A 5H91A 3LBCA 1WAUA 4EANA 3BW4A 2ODOA 3VDCA 1Y0OA 4NZ1A 1V5XA 1XH0A 4OOUA 2XSAA 2VDGA 1EBGA 2YOCA 3R6IA 5AYYA 2CKRA 4QQUA 4LC6A 3E12A 2DUZA 2A3BA 4ODRA 1CLXA 4DJDC 4UMBA 4MY1A 1T0OA 4KKXA 4XAFA 1PWLA 1DTNA 1AQMA 4FX8A 3QKEA 4C6JA 3U2ZA 4Q8NA 3C0SA 1R30A 2I5IA 2ASHA 2PURA 4IM4A 1QI5A 1ECEA 4UFMA 1XIBA 2VZTA 2CLHA 3S5OA 4I7VA 4DHGA 3SN4A 1OEPA 4AWEA 5E9XA 1Q45A 1RJPA 4ZSTA 4P7OA 1XD0A 3WDQA 3NM3A 3HA1A 3O6CA 5H6HA 1KRAC 4FX6M 1TMLA 3W1AA 2POZA 3UZXA 4HA3A 5I03A 1E9IA 3CZJA 3W6YA 2A3LA 1WDRA 2J4GA 3VNJA 3HO8A 1TIWA 1XSKA 4MNMA 1UIPA 2GJXB 1KXQA 3O9NA 4GO9A 4R88A 1YDYA 4AZGA 4M7SA 1WXYA 3VZYA 4XKMA 1EWDA 1X96A 1J2BA 3HQPA 2J7DA 1K6AA 4G7FA 4RW3A 3RRAA 1R2TA 4JPGA 2VCDA 3OGRA 4BI5A 4BF8A 1DQXA 1XH2A 3RF9A 1XC4A 5A8PA 3KE0A 4NZ4A 1Q85A 1J79A 2PP3A 4E8DA 3U4AA 2JEQA 2RURA 1VC4A 4TX8A 3QMTA 5KZDA 3MQTA 2J8FA 4F9JA 3IJ7A 1XYLA 4HYWA 3CL6A 2WHLA 4NAEA 2FZMA 1SJBA 5CGTA 3VIPA 4I90A 7CGTA 3EOUA 1QW7A 3NQAA 4KETA 4IPIA 1F6KA 3N3TA 1VFOA 1JZ3A 3B9OA 1NEYA 3MJYA 3R4IA 5E9AA 1Q6OA 1C3FA 3DFQA 4PTNA 1ITXA 4KERA 3DKLA 2V69A 2C3ZA 1H5VA 4MGGA 2ZX6A 4MYXA 3UWWA 3K46A 4QE1A 2A79A 4GZJA 2ZA1A 3O06A 4QEHA 4AU0A 3V7PA 4RZ4A 1EX1A 1H4PA 1P6WA 4TNSA 3DEQA 1F8MA 7REQB 3MBFA 2ALRA 4RNHA 4WJXA 3W7LA 2Q71A 1UB3A 3WNPA 5DBTA 3BLFA 3WH7A 4BJHA 1T40A 2HPIA 2IXVA 4R9XA 4US5A 4XZWA 2C91A 5D8ZA 4DRNA 3H2EA 5F2LA 1ENUA 2ABAA 4FNRA 2WMGA 4C6EA 2VGGA 1KCXA 2I5GA 4L4LA 3MO4A 1SFJA 1QNQA 4ZPVR 5I3KA 4BQ3A 1V08A 4CEXC 3NGFA 3NZGA 4TU1A 3B06A 4W89A 1WKFA 1RPXA 3HG4A 4ZXOA 2HBVA 3E02A 2BVTA 2WMKA 2G3MA 1VZWA 2CZDA 4PSPA 1CLVA 2XPAA 4A4AA 1JDAA 2PA6A 1HJVA 3LZ3A 1KFWA 3CQJA 3W82A 4FF7A 1HL9A 4ZQPA 1W56A 3MBDA 1N8FA 5LA0A 3GE7A 4H8HA 4UQ9A 1JF5A 2GGHA 1Z3NA 2HE5A 2YIHA 4ZMGA 2VVSA 1R7AA 3R8HA 2P3EA 3ITYA 3LNMA 5FAGA 3VIJA 3G77A 1BVZA 3RAOA 2XGIA 1H60A 4JTTA 4K39A 1CB7B 3EWZA 4Y9NA 4D6CA 3QQWA 2VX6A 1B30A 3AMLA 4M24A 1UKQA 4GUJA 2Y61A 3H54A 4FNQA 4X3ZA 1TSIA 1RK6A 4OGZA 1J6OA 3MDUA 3SAZA 4YYFA 1TJRA 4OKDA 4GXMA 3O5JA 1Z89A 1XLKA 2WPBA 2DG9A 3IAPA 1JPKA 1IE7C 2ZQ0A 1UH4A 5TF0A 4GISA 4A05A 2HPMA 2D2OA 2O0TA 1MW3A 1N7KA 1TTQA 2Y5EA 1EP1A 4UOZA 3N9KA 2MPHA 3ZIZA 3IJ8A 1LROA 3EPMA 4TVUA 1SJCA 4R27A 1XLBA 1ADOA 1FWHC 4QP0A 1NM9A 2TODA 3NPXA 3QSRA 3PM6A 1FWEC 1QPOA 9XIMA 5D9OA 4E5TA 3CV7A 4S3BA 4O0QA 5FSDC 5HWBA 2QCHA 3OU8A 3VGGA 3QW4B 3GVRA 4JEQA 1ZP3A 4AY8A 3N2MA 4XD6A 1G4PA 3NYZA 4QLLA 4CD8A 1W1B1 4PMOA 3W6LA 5EU9A 4NI3A 3E1F1 1F3EA 3BICA 3H2NA 2GGJA 3ATZA 4JHZA 3ZR6A 4DJFC 1RSCA 3S1VA 3VUPA 2Z25A 4C7FA 1VFHA 4UZUA 4RPPA 1UH2A 2EQDA 1TVLA 1IXOA 2FZDA 2V81A 1KTNA 2VEFA 1QXLA 2D0GA 4M3PA 4OE7A 3BCDA 4HA4A 3VD7A 3LK6A 2UY3A 2YLAA 2PF8A 4KWWA 2FHBA 3QMRA 5DITA 1CX9A 1FCBA 1VBUA 3CUJA 5CC7A 2PE4A 3CTLA 3BANA 4ZB5A 4JKKA 3SJ3A 1IT8A 1JCLA 3ZJ8A 9RUBA 1UBSA 1TMQA 5HMSA 4FX7A 2P8CA 1M1BA 4CLMA 2DZSA 3GYCA 2Y5SA 3JW7A 3WQ4A 4NRRA 1JCHB 4LYRA 1TX0A 4I8DA 3JZEA 2XFRA 4Z08A 1LOLA 3AYSA 1K6WA 2NSXA 3HMCA 4UFIA 5CKSA 1RR2A 3CZKA 2FGLA 2OYKA 3VMPA 2W4XA 1EJTC 2CZ5A 1KA9F 3EWBX 1J2WA 5GNXA 4QDPA 4PA8A 4WJEA 3W7CA 5IBXC 3UZWA 2NLYA 4XWUA 1LT8A 3TCSA 3VX0A 4UTIA 3HTWA 3V36A 1HO4A 2QUNA 4EACA 4ZOEA 1E40A 2G3IA 4OOZA 3PZMA 4TVDA 4L9ZA 4B2DA 1EZ2A 3RM4A 3SBFA 1CTNA 2D2GA 1FXPA 1JVWA 5BMXA 3CUGA 1C90A 3VNYA 1BTMA 1LTDA 1THFD 4TW6A 3MS8A 3HGSA 3BAKA 3PG9A 4MADA 2X2GA 3WF2A 3S9IA 3M0VA 5RUBA 1EA9C 3EYPA 3LTPA 4E4FA 1ZAHA 4J35A 2QR6A 1XW8A 4JFUA 3M5YA 3BMVA 3S2LA 3NSXA 3HPXA 1T99A 2DH2A 3ARXA 4ZQOA 3IACA 4NRSA 2Y8KA 1MUMA 1M5WA 5AVNA 4GYPA 1EP3A 2KGJA 3K1DA 3ARQA 1K4HA 1MFVA 2TPSA 3UJEA 1PB0A 1UMLA 3E0IA 3AXHA 4XVEA 5BU6A 3CV2A 2Y7DA 2YA0A 1V0NA 4L5ZA 5MF5A 1M9HA 3RGTA 3STEA 3CUIA 2P4VA 2Y6ZA 1SZGA 3DENA 4D9PA 3T0DA 3C8NA 2QLYA 4H1ZA 3NGJA 4OV9A 4PGLA 2ZUTA 4KW2A 1IGSA 1L6FA 4WHBA 4YXGA 2QV4A 4DJDD 2BWGA 4S3GA 1X7IA 2MF9A 1E72M 3UWZA 4E4PA 3GIPA 2Z29A 2GZXA 5C2GA 2RUCA 2B7NA 5CAHA 4GBDA 1RK5A 2AAAA 4HK5A 5L6UA 1ZAIA 2OGJA 3PTQA 2VR2A 3HG3A 1PHWA 1M65A 2VMFA 4KRTA 5JIPA 1E3XA 2VOMA 1AJ0A 2ZCGA 4ZOAA 1SMAA 3AU2A 3UYIA 2QNEA 2XG9A 1OQFA 3BV4A 3VGBA 5DO8A 4OUEA 2B5UB 4GUHA 4JNMA 1B3XA 2FPVA 3AALA 2WJZA 1XM3A 3CTTA 6XIAA 1JZ5A 3MP3A 1HT6A 2BY0A 3SCPA 2NVCA 4O54A 3FSTA 3AC0A 1QAPA 4A8LA 3RN6A 3SCQA 3P84A 1VCGA 4BEUA 4ERAA 3L4WA 3N6QA 4I7WA 5CCZA 3OOBA 4MZ8A 3UF9A 4ZGYA 4R53A 1LG2A 1M68A 2PPPA 1DHKA 3AXMA 4D1IA 5BWFA 1XR2A 2R9RA 3LX9A 2ISVA 3ZXWA 1FRBA 4X2PA 4C6NA 2PTYA 3FA5A 3YPIA 5FF7A 3S2MA 3W7QA 2WWCA 4IGMA 4GINA 2V6AA 5C7HA 2BZNA 3UA4A 3KBNA 3LCIA 1SJDA 3O5PA 4QHRA 3AHTA 3TLLA 2C71A 2WO5A 1EH9A 2XGBA 2YCLA 4L72B 4AD5A 5JVLA 2OPJA 2VENA 3LRKA 3WLOA 1QNVA 3WLHA 4QZVB 4J1OA 1QI3A 2WMIA 4XBKA 1E5JA 3GDTA 1J4IA 3ENLA 2YW4A 3KS6A 3OIHA 2JK2A 3O5GA 1C8XA 3CAQA 1GW1A 1H7XA 1WYIA 3TVAA 3MI3A 2X1IA 1JYWA 1QW8A 4QBXA 1EEXA 2A7NA 3AJ7A 1RP8A 4WDWA 4A8NA 1A49A 4N4PA 4AWSA 4LPCA 4F0SA 3M4HA 2DQWA 2QVHA 3W07A 1F8AB 2D0HA 3G2GA 1GVSA 2UY4A 2BXVA 2VKZG 4WDTA 2X7WA 2PC4A 1UPMB 4TV5A 4GX9A 4NQ1A 4TVCA 2NUYA 2MUCA 2PDJA 4UNKA 2GGGA 3W2JA 3IJDA 1DWAM 1JNDA 3OP2A 3E38A 4IICA 3UXIA 2QKFA 2GGIA 3NTYA 3HPSA 5EBAA 5IFTA 3PPHA 4BR1A 4XIMA 4DRHA 2E67A 5CGMA 1HW6A 1CXFA 4EK7A 4K2SA 2DZUA 1KRBC 2DPEA 1M41A 4MFEA 4N02A 5J5DA 5SWUA 1J0HA 4QGCA 3RK8A 2NX3A 4R7JA 3KRZA 2OU4A 3EOSA 2FKEA 1E0UA 2XUCA 2DH3A 1RBLA 1ITUA 4R5EA 4DAFA 3S9ZA 4JTGA 4QXIA 1DPMA 3HV9A 4TIMA 4ATWA 4B90A 2E68A 4MTVA 3RJXA 2WLZA 3CJPA 2WJEA 3OVPA 3DHUA 4HNNA 4NAFB 1VJZA 2Q5AA 3W1NA 4S39A 3QV8A 3WG6A 2I56A 4ICMA 1Q5MA 4HPGA 3K2GA 1NSGA 2EPKX 1BQCA 1XSIA 4G7EA 4X0NA 1YXYA 4JTAA 2ZZ6A 2C15A 4NASA 4JTIA 3W7EA 1QNOA 1H62A 4IP7A 3OPSA 1UW9A 1NQKA 2CBUA 3FHAA 3URAA 2OEMA 5BXPA 1GONA 3B8UA 3QQ1A 2J62A 2X0SA 4Q4QA 1LBFA 2PTWA 3EKGA 4Q33A 3AAMA 1XCFA 4LYPA 1D2KA 3DOPA 3VNIA 3V0TA 3KCJA 2PWVA 1AG1O 1EGVA 4IL2A 2QF8A 3LGDA 2XHYA 2FHFA 4LV9A 1X98A 2O7SA 1NFBA 1F4AA 1I2OA 3KCOA 1L8PA 2W63A 2HNHA 3L5MA 1HO1A 3GTFA 1J9YA 3A23A 1K03A 3R13A 3GNXA 4HN8A 3WL1A 2OSXA 4QAWA 3RRXA 4NYUA 1S5TA 2J9YA 4Z1YA 2E9LA 2HTMA 2FTPA 5A6SA 1XCXA 3THUA 3QFEA 2PPNA 3UJSA 1Q63A 5G4WA 3IV3A 1HJSA 3NSNA 2CEQA 5G5IA 1A5SA 2GLKA 1D7JA 4LBSA 2TAAA 3IANA 4O16A 3WUGA 2VUYA 1BRLB 3SURA 3WEMA 5EBUA 1LWIA 3ZS4A 1ZCNA 1ZJHA 2Y0FA 4XB3A 1JCTA 2DSVA 1AJZA 1DWFM 2D69A 1VCVA 3TTQA 4IMFA 2NSOA 4MWAA 4IIDA 3HG2A 5JMUA 4JIHA 2QW5A 3B8SA 1CGWA 4RE4A 4DJFD 4E4UA 2H6RA 4F3HA 4GC4A 2WSKA 2XVLA 3SGUA 4WY0B 4GH1A 2IPJA 3KVLA 2OT0A 2J7CA 4QG8A 3HB9A 3D5HA 4A2RA 1AH3A 4P8XA 3PK7A 1KNWA 4TO8A 2PWUA 1OGGA 3TDBA 4PUNA 1XWYA 4HHMA 3VD5A 2D0FA 4RE3A 3S47A 2ZRWA 4MM1A 3TW7A 4JL1A 2XP3A 3QW3A 3RO6A 1S5NA 3QGVA 4G50A 4JTFA 4OJYA 2ZKMX 5FJPA 4AVNA 3LCLA 4US5D 3CMJA 3PBWA 3S2JA 1CENA 2OX4A 3I6EA 2QJJA 3DECA 1DIEA 5D4YA 5CPOA 3T55A 3KLLA 4MSPA 5IHSA 1GYLA 4NX0A 4GLEA 7TAAA 1TIMA 5CJ5A 1Q7MA 2BGQA 4DPPA 1E4MM 1MW0A 3CO8A 2X1TA 3O6YX 1XIFA 4MKVA 4HK6A 1VBGA 3GB6A 2ANUA 4MJMA 1P7TB 1KFBA 5LNRA 2WOQA 4J3SA 2NT1A 1XI3A 1BD0A 4C65A 5EMMA 2Z1WA 1I0BA 4EPDC 1HKWA 2WZIA 2BXYA 3TIMA 3NZQA 3BL3A 4IFKA 3A64A 3EWUA 2QAPA 2LKNA 3U6WA 1YTKA 2E9MA 2G3NA 3ZJ6A 4C60A 5PTDA 3ARZA 2VXNA 4WKAA 5ABTA 3WX7A 3B97A 4IMAA 1NFPA 3K5XA 4ADSA 5F1VA 4GJ1A 5AYBA 4DT4A 1LQ0A 3W9ZA 1YADA 2IPWA 5FIPA 3MJMA 1OT2A 4L6DA 2YA1A 1ROTA 1RAKA 3U0HA 3CMFA 1VFTA 3PTDA 1XIHA 5DCBA 4XQ6A 3KL3A 3W37A 3P6LA 3JYJA 1MW2A 2X1SA 1XG4A 3B9EA 4QS6A 5GJNA 2FB3A 1H1NA 3TOYA 3QLDA 1TZ7A 1CPUA 5C71A 3O6AA 4MUZA 2WC7A 4X60A 2ZZ4A 4HT3A 2Z1KA 2WHJA 5KITA 3PAJA 3KTSA 3R7MA 1QHPA 1AL7A 2AAMA 3JXVA 3IVTA 3VIGA 1R9ZA 3WQ8A 3W7OA 3AO0A 1G9HA 2DZTA 1G1YA 3P8IA 2YFNA 2PWDA 5F1UA 2PDBA 1RUSA 2AL1A 3AISA 2ZE0A 3DFNA 1OFDA 5K4XA 1E6XM 4RZBA 2VX5A 3GQYA 4B91A 1RJRA 2XSBA 2PDGA 1LQ2A 2VWSA 4LUTA 3L5AA 3GG1A 3W28A 2D22A 1TKKA 3E9AA 1G0CA 3VOHA 3UR8A 3D3AA 3ZR5A 5LGZA 2PWFA 3QV7A 3WF1A 4GKLA 2A6LA 2R91A 4ATLA 1LWHA 3MSYA 4MLJA 2QDHA 1RVKA 5MKGA 3BOFA 2W9MA 1J0JA 5DMMA 5EKYA 1DJYA 3V18A 4UQBA 4CN4A 5D2WA 3FN9A 4GQQA 3BAYA 5IRPA 3LGGA 3MI6A 4PUJA 3ZFHA 2YXXA 3TSDA 2AOSA 2GDUA 1HF6A 3WH6A 4UB9A 3AIWA 2ZXAA 2C0HA 1D8CA 4FXRA 2AKZA 4Z1CA 2WV8A 1PIIA 4GXPA 4L6OA 4CGTA 2WVSA 4IG2B 3IUIA 4KT2A 3S83A 2BTMA 1HXVA 2J25A 1PWMA 3LG3A 2INEA 1TB3A 3F5LA 1EA0A 4QE4A 2PZNA 1W5PA 4WSHA 1YEYA 4JR5A 5U4NA 5FF0A 4PMZA 3KBMA 1EUNA 1OCQA 1XBXA 2OO0A 4GO8A 3GNNA 4DWSA 1E4LA 1GKRA 1YPIA 2RH9A 3O5LA 3M0IA 3VOJA 3TX9A 1MQQA 3NSMA 2G41A 1Q6FA 3ES7A 2POTA 4L80A 1ALDA 3UP8A 1FWAC 2CWXA 5MHBA 3EXSA 2QCMA 3D0CA 3IK4A 3CNYA 3SUVA 3QGKC 1K7EA 2VZSA 1B1YA 4LC8A 3CL7A 5CPSA 1Q3NA 5CC3A 3NZPA 1KCLA 3LCXA 1UZDA 1E6ZA 1A5MC 3UI6A 5D9PA 3WQVA 2V8ZA 4JYFA 1CLKA 3VAVA 2QCLA 2AL2A 2P88A 1N55A 4ZE4A 1OM0A 2B31A 1PTGA 2RKXA 1ISXA 3H7UA 4AY1A 2KI3A 4DLMA 1D3HA 3CAWA 4RDZA 3N2OA 1KRMA 2PDFA 4MKNA 2AQWA 4RNJA 3HG5A 4ZS6A 4KCWA 1SU5A 1UC5A 2QUUA 4IWWA 4CQCA 3BUVA 4HNTA 3UI4A 4Y9PA 3LHUA 4OBRA 3K30A 3PRAA 4KRZA 4W86A 1J96A 1PE1A 2CHOA 2P1FA 1TV3A 4PRRA 1RBOB 2PGWA 4DO5A 5HUOA 3VIOA 4CNPA 1Q2SA 2R24A 1SVDA 3SQMA 1B90A 4HTBA 2R82A 4J4OA 1P0DA 3NQBA 3GDLA 5LXXA 3URBA 4UFHA 3LHWA 4WVXA 2VD8A 1F05A 2VFIA 4FI4A 1S5WA 3AHZA 2E09A 3ERPA 1PSCA 3HM7A 4ENLA 2PDQA 2IS7A 2WLYA 1AODA 1O5XA 2DFAA 2DSKA 4DYJA 1X6LA 4XO6A 3VOIA 4DRKA 4IXHA 2WSRA 5A6BD 1NMWA 2ZUWA 4CKQA 5JUVA 4W7WA 3HURA 1KWKA 2FTWA 5BROA 2ZVRA 4GOAA 3LU2A 5BZAA 5HMEA 5HQLA 4HSNA 3VGHA 1NU5A 4L4PA 2W3ZA 1PYMA 4GACA 1OX4B 1Y0EA 4JFWA 2OVLA 4W93A 1WUFA 4WKHA 4PTWA 1YXDA 1K70A 2V5BA 2GK1B 1R5YA 2BBFA 1AW2A 1IZKA 3U7VA 1XDLA 3IS4A 4ORMA 4JY8A 4DBSA 4FMVA 5DIUA 1ZCOA 2R1KA 3SGGA 3FCPA 3ANUA 4GNJA 4DUVA 4MLRA 2CPUA 1Q6IA 3P0XA 3EWDA 4OZOA 4G1KA 4JDYA 4HPNA 5A6TC 4HHLA 2LGOA 2FHCA 3VINA 3V5FA 4JYSA 3GC2A 4PCTA 5D32A 3AHXA 3W1PA 1A0DA 1V6YA 2EULA 3QKZA 4IMEA 3LUTA 3AICA 1X97A 5AHMA 3OOQA 3EOOA 2P0IA 2V67A 3GS6A 1CXLA 3BXWA 4NJHA 3PJWA 3VYLA 1UA3A 4A3QA 1DJQA 3BG3A 3I6RA 1R3QA 1R86A 3VIIA 3GDMA 5CZJA 5HJYA 1TQJA 5JH2A 1A0EA 4JS3A 4CU6A 3QGAC 1Y5WA 5CSUA 4JBRA 4O0ZA 4ATDA 2DDXA 2WKGA 2VTFA 4Q4OA 1LLWA 3EX6A 4EXAA 2DZWA 4MG4A 1YNYA 2QCDA 4HCLA 4K8HA 1P0BA 3I6TA 3GTIA 1YRRA 2I1OA 2QQ6A 1BQGA 3O2LA 3BAXA 1EIBA 4PTXA 2E0PA 3M0XA 3GWQA 3SZ8A 1K77A 3AZSA 1PZ2A 1RCXB 5AECA 1UR0A 2VVNA 1VHNA 2OR2A 3W2KA 1SZEA 1RXOB 2A4AA 1KBKA 1F6PA 2OXNA 4LEQA 3ZVIA 3FA3A 1OGBA 2I5QA 3OLGA 1S2UA 3S1GA 1MMFA 3BC9A 3CQHA 1XGEA 3KAIA 3CL8A 4JFTA 4ODMA 2HE8A 2ZX9A 3TZFA 3OZOA 1CGUA 4O13A 5D04C 1W9VA 4AUBA 1LT7A 5I3GA 4HPXA 4UQAA 1PTAA 2OWXA 2DT3A 3C8FA 3GYEA 4H8UA 2DQXA 1FKRA 2P3ZA 3G0UA 3UERA 1MUWA 3CHCA 3FIGA 2OZ8A 1ZALA 2Z00A 4E0CA 1QOQA 2OCZA 4PB3A 3B0XA 1O6IA 5REQB 4DUXA 4ZQNA 3QV9A 2VELA 3W7JA 4H7VA 4NILA 3OB8A 1XX1A 5CPNA 1PPIA 1J12A 2C1GA 3ALGA 2XVGA 4PBGA 5E0KA 1QASA 3G1XA 2OQLA 4O12A 3TROA 3QN3A 1EJ7L 3WMCA 3CLMA 3N04A 2J77A 1JYNA 3S1XA 3T2QA 4DLFA 1A5UA 4GI8A 2OEKA 5HMFA 2WM0A 1OC6A 1X38A 4LBUA 3OHMB 3WLMA 2J9XA 3WBWA 5IHRA 3VKBA 1CT5A 3WELA 3S5ZA 2X16A 4LF2A 1XIIA 1WV2A 1TV2A 4HQVA 1XGDA 2CYGA 3CB8A 2R8WA 2W6RA 3G1VA 5M2FX 1EHAA 4ORIA 2GJXA 1DXEA 3A3HA 3H7RA 1VLIA 4U85A 3V4BA 3EXTA 2Q02A 1FKBA 3R79A 3PZNA 1L2UA 3UJ2A 4ZO8A 3DHDA 1S38A 2NT0A 2PD9A 4Y8FA 5F4WA 1YNPA 4U2YA 4ICCX 2V5KA 2JFEX 4O4VA 3UY8A 4D6GA 3QY8A 2ZXDA 1HKMA 3GKFA 4RX0A 1ONEA 3UWVA 1T6MA 2EPHA 2OFJA 4S3CA 1F4HA 1H09A 1DVJA 3KL0A 5BNKA 1N8IA 3UXKA 1AZ1A 3GAYA 1DQWA 4J4NA 1KGUA 3T44A 4Q4RA 1HG3A 5IOBA 4GGHA 4CCEA 1NARA 1XLJA 5A2CA 4K6AA 1EBHA 4CVWA 3LRLA 2CETA 3BMWA 3EY6A 2WK2A 1U1UA 1M01A 1OB0A 2CLKA 3Q37A 1GNXA 1NY1A 1PX3A 1PBGA 3QR3A 3BQ5A 4O1EA 2RAGA 4HHPA 1OD0A 4KGLA 1FWGC 3MHFA 4O50A 4CNTA 2E4TA 2XFYA 4AMAA 4M82A 1CBGA 5TBOA 2J8GA 1HFBA 1OCNA 3I7SA 3E3HA 4I5UA 5HNNA 4CVUA 3PA7A 4WD0A 4UBPC 3WQGA 3P3BA 2ATMA 2J9ZA 1OINA 3SUUA 1D7IA 4P5UA 1JRCA 1I45A 2WCAA 3FYPA 3NQMA 1N82A 1JZ8A 3N11A 4ONVA 3NA8A 3QVQA 3N1AA 5I3FA 1GVFA 3N34A 4HZ8A 2BHUA 4G8TA 3TA9A 3TH6A 4GY0A 3L23A 1EHNA 2WBKA 2EHHA 1WKDA 3G5EA 1D3CA 1ONXA 1UR2A 2VYOA 1MI3A 1SFTA 1IYXA 1FY6A 1S2AA 5EYWA 1TZ9A 3IJLA 1LJYA 1TG7A 3DUGA 1TTIA 2ZXBA 1DJGA 2PWGA 1AVAA 2CNCA 3E0WA 3APGA 3M5XA 3W72A 3RR1A 1VBRA 1E9YB 1RCOB 1RH9A 4H41A 1AL8A 1CW2A 3TK7A 2GFTA 4Q4KA 3FX4A 4AH7A 2WAGA 1ICQA 5M17A 2RJHA 1CGVA 3UPBA 1R9HA 1MDRA 3MWAA 4F8XA 1UKSA 1R9YA 2XTKA 1OCJA 4H9TA 3N6JA 3TJ4A 3E0VA 3DXIA 4OBTA 5H8PA 3KW3A 4DNMA 2ABBA 2QZRA 4O4WA 2QJMA 2YKKA 2ZA2A 3NVDA 1C29A 4BI7A 1Z69A 5EMYA 1TWDA 1SQ7A 1TQXA 3FW6A 4YTRA 4LT9A 4ACZB 5LA1A 2YPIA 1EDTA 4D72A 1DJHA 3KOXA 3KP1A 3R0DA 2CFFA 5E09A 1V6XA 4ZE5A 1A5OC 1EJSC 4GJJA 2F2HA 2F84A 1J4HA 1DE5A 3GNPA 1PS9A 4PMUA 3W1RA 3URNA 1ZK6A 1E55A 5A2BA 2D9FA 5FI8A 4KCUA 2YX0A 4C6KA 1UR8A 3AS1A 3TKFA 1X1ZA 5FJUA 4DBDA 3W3OA 4AHPA 1MNZA 4HNUA 2CHNA 5HQEA 1JZ6A 2NZLA 4HA1A 3EPOA 2IPGA 2QDGA 3HQNA 4JQ3A 3P8JA 1QBBA 1OZQA 4U4MA 1CB2A 1Q6QA 1TZZA 1GJWA 3AI0A 4H01A 3V16A 3TYEA 4UUIA 1HP4A 1LM1A 5BOOA 2VZVA 1O95A 4S23A 1NOUA 3DX5A 4HOXA 1VJIA 5B80A 1Y7VA 3OW1A 2G3FA 2E5BA 3EXRA 1H7PA 3W7IA 1HKIA 4PMNA 4DQWA 5CXPA 3W7DA 3RFAA 2X1RA 1KR0A 3MP4A 3M5VA 1O4UA 1KCKA 3PZOA 4RW5A 5FJOA 5E5CA 2ZRYA 4H8VA 4D8AA 4RXFA 1LBMA 1NH6A 2GUUA 2HK1A 2C13A 2Y89A 4CNSA 3W88A 5G2IA 3O15A 4ZFCA 4GVGA 2F2DA 3DU0A 1O7AA 2HVNA 1Q2RA 3DHPA 3L12A 1FKXA 2XN0A 4XBSA 5EFFA 4QDMA 3QM3A 1DWGM 2WCGA 3KCEA 1EQPA 1O66A 2R1MA 2YLLA 2CLEA 1UD3A 1NMVA 1KC7A 2MNRA 4MY8A 2WNZA 5D30A 1M7JA 4RUBA 2E6YA 1XH1A 3EMZA 2QCFA 3TW9A 4RCXA 5FEPA 2OMAA 1Z8AA 3G6MA 3UCDA 5HINA 4O1DA 3MKKA 1G5AA 4E3TA 1OYCA 3BCFA 1UUQA 3LBMA 2ZC1A 4V33A 4C7DA 3GXFA 3AS0A 3SN0A 1JUBA 3R2GA 3TAKA 4DI9A 4AD0A 1I2QA 4AZHA 1QPFA 3WFAA 2I57A 4H04A 5AHEA 2MNTA 3T8QA 4AEEA 2AGKA 3OTRA 3STPA 1BG9A 2BGSA 4ZO6A 4A29A 1C8VA 1TPC1 2IPFA 4WGHA 2K8IA 3ALFA 4JN8A 1DWIM 2VGIA 1JF6A 4O11A 4PMQA 4KESA 3H8AA 1TA3B 2D20A 3ZZ1A 1C92A 4DB7A 4I7UA 3PFMA 1UKOA 2QJGA 1W5OA 1CGXA 2ZTKA 3AU6A 1QR7A 1OX6A 3UXAA 4GRSA 1SJAA 1F3TA 4JQ4A 3CYJA 5I02A 2YB1A 3QXBA 4PN2A 1XYCA 5DLCA 1GG0A 2FZ8A 1BWKA 4NYYA 5D2TA 2EKCA 2O9OA 4HVXA 1HN1A 1J93A 1VRXA 4G2DA 1GVEA 2W61A 2V82A 1QRQA 1E6RA 1Q7ZA 1KQYA 3EEZA 1GJUA 2DSZA 3W81A 7PTDA 2VRJA 1GVRA 3DERA 4JTCA 2E8ZA 4IT1A 3IJIA 4ZPTR 1AH0A 1QU4A 3WQPA 1O1ZA 1VPQA 5GPRA 1Z44A 4IJCA 3ABOA 3ITLA 3CBWA 5HWMA 2VFEA 3OQEA 1WA3A 3VE9A 2QDDA 1GCYA 2IKGA 4JFIA 3EX1A 1JJKA 3RPDA 1MNSA 4DJEA 4FR1A 4MNLA 4KQNA 2CCRA 2ZX5A 4G2PA 1GOOA 1QVBA 2WB5A 4LNYA 1FHVA 3DN5A 1XP3A 3VZXA 1X8CA 4BWLA 2W92A 4IQ2A 3OVGA 3SFWA 4GNKB 3OYZA 3FS2A 2E8YA 3W1UA 3KABA 3BLOA 2EG8A 2HZGA 1JCNA 1PKNA 4B5UA 1CNVA 4IP5A 1PZ3A 5C8BB 1JVNA 3CT2A 3GO2A 4W5UA 3WLQA 2CBVA 3LY0A 3UG8A 3DDMA 4BEQA 1ZB5A 5I07A 4GI9A 3KEHA 3GFZA 4ODKA 5CGQA 4L7ZA 2EGZA 3W23A 3PULA 5CC5A 4IMDA 5HWJA 1HNYA 1KB3A 3M7SA 4EF9A 3GLCA 2YA2A 2PWEA 4QCEA 1ZAJA 3WLLA 4LVDA 3FVMA 4LBRA 3TR2A 5IM51 3AJXA 3GDKA 1MZRA 3TUUA 1KW1A 4S1FA 2R1LA 2J88A 6TAAA 5HULA 4YNGA 4UTWC 4Z0SA 1WBJA 2J7GA 1UR4A 4UFLA 3DYMA 2YXGA 2LJ4A 2PF0A 1NP0A 1MQRA 3C2YA 1QHOA 3G1RA 1UD8A 3AUOA 4M6PA 1LRNA 1VENA 3M43A 3TV8A 1FOBA 4DRJA 1C8QA 1Q13A 4DRQA 3GRIA 2GSJA 3EZ4A 3TSMA 1OFOA 3NQGA 2XP9A 4DXKA 1I1XA 3RFWA 2XINA 1JYXA 1FDZA 3KOYA 3RM8A 4FAMA 4IIHA 3BSMA 1W1VA 4MB5A 3WD0A 1UC4A 3MUY1 4B15A 1P5QA 3A21A 4U28A 3BE7A 5E0FA 4AVFA 2ATSA 3CIWA 5DANA 4UOQA 2PDNA 5KZEA 2PGRA 2BVYA 2FQIA 1LZOA 1BWVA 1H1ZA 3QRHA 4NNRA 2ZQTA 1F2JA 2Y7GA 5AC7A 3RCNA 2QJIA 3A9BA 1EWEA 1U33A 4Y9MA 1QO5A 4DWDA 1B9BA 3KWXA 3USZA 2OOFA 2NQLA 1E3ZA 4PFHA 2UBPC 1GTEA 4V1YA 1YTEA 3F03K 3TTEA 4IPNB 4BQ4A 3M16A 2XIOA 3W74A 1FUYA 2XWEA 2XIIA 5HWCA 3MU7A 3BGJA 3G18A 4ODLA 3S5SA 4TV6A 5LA2A 2B0MA 4I5RA 2VC6A 4LU0A 4C7GA 1GTHA 3B9NA 1JXKA 3PP7A 4NAFA 1R8LA 2QUTA 3ITOA 3WLIA 4Z2HA 2DIKA 3MUZ1 3S6DA 2HK0A 4XISA 5B7YA 1V6VA 3GVVA 1OG6A 3MANA 2VJXA 4DJEC 2PLJA 4AZIA 1AZ2A 3LMYA 3SCWA 2E3ZA 1S3HA 3NR0A 5AC4A 1BAGA 3Q94A 3PPFA 4FPSA 3ABZA 3WJSA 3L2IA 4NP7A 3MZNA 2A85A 1JAKA 3T78A 4HU0A 5HW6A 1ISVA 1GOXA 1EC7A 3LCWA 5TIMA 2FGZA 1EYEA 3QOMA 1Q6UA 4M6UA 3N19B 3AIBA 3OBKA 3SECA 1M7OA 4LV4A 1ONRA 3T0BA 1ZGDA 3GR7A 1TFVA 3DI0A 2PV3A 1JZ7A 3OGVA 3RMEA 3DFSA 4GUIA 5F7UA 1EKOA 1V03A 3L66A 4IQDA 4ZFMA 5DEZA 2Y8UA 3VKJA 4DM1A 1B2YA 3SY5A 4FALA 1TPFA 4NL1A 4ALDA 4N9DA 3T40A 2E6AA 4XD5A 2REQB 3L65A 1O12A 3VGFA 4XAYA 3WQDA 1H3GA 1FAPA 5BXJA 2XJ7A 5G1TA 3NEHA 3VFCA 4M8UA 1S2TA 4MY9A 4UNIA 1BRLA 1CXKA 1DWJM 2VEMA 3GHTA 3MP5A 1WOBA 4E8GA 1TYGA 3GG0A 3HJEA 3TJIA 3UR5A 4MOZA 2PBOA 4MDOA 4XZNX 3LXCA 2M1IA 3UU0A 1UD6A 4ODOA 1R87A 3WNKA 4REQB 2XPKA 5FA5A 4FXSA 3EB2A 3W2MA 2Z1XA 2R6OA 1XRFA 4E6MA 2OKTA 4WY0A 3TYZA 3SQSA 2ZVIA 2QS8A 3LMZA 3HMJG 1FWRA 4R7WA 2RGLA 4J3XA 3RM9A 1JPDX 4PMVA 4UTKA 3WK3A 4MB1A 3T0CA 1D7HA 4IQJA 5D03A 1H49A 1A0CA 1L6YA 3VIHA 1XLCA 1HJWA 4AZCB 1UD2A 1U1JA 3CGTA 4C1NB 1KFCA 1UP3A 4OIFA 3U48A 3KRUA 4PB5A 1A5NC 1IHIA 2CHRA 1OZMA 3DFPA 2DZBA 2FVLA 5D8WA 5EMUA 1GW9A 3G8EA 3BAWA 2NXGA 1J8VA 1ESWA 4V15A 2VR5A 1EXPA 1W9BM 1V7YA 5FL0A 4OUIA 3ARSA 2BG5A 1GGOA 4DZIA 4ODNA 3O5FA 2NXHA 1VEMA 3QPEA 2AWGA 5AC6A 3AQUA 3BLKA 1UD5A 3BJTA 3EWWA 1P7TA 1GQNA 1PV8A 1XQLA 3KRSA 3PS7A 4LVGA 1FKKA 4W4QA 1MW1A 1GVOA 3NQDA 2C14A 1XIJA 2BODX 3MDWA 4LGXA 2ZQUA 3GUWA 2X1UA 4DO4A 2QIWA 3VVGA 1P48A 2NWRA 1B0IA 4I6VA 2D3NA 2WZEA 5FEZA 1KGWA 4ZCWA 3Q4DA 3SCSA 1BVNP 2BASA 5G2WA 3SR7A 3R94A 3A13A 4PUEA 4QIUA 4O1CA 1E51A 4KEMA 1POJA 3H70A 3O8AA 5C54A 1ZHAA 4DPQA 1UROA 1BG4A 4E2VA 3RPMA 2I9EA 4I9TA 3B03A 2W66A 1OFEA 1FKTA 3WBAA 4TQTA 3A3XA 4H6KA 3CMGA 1WQ5A 3UR7A 1HJQA 3BV7A 3M41A 2E5DA 2OELA 3KAOA 3UEQA 2VURA 3IK2A 4JFVA 3AYRA 4AF0B 2Z7GA 4J4KA 3GK0A 1JL8A 1UQYA 3QY6A 1PX8A 3MHUA 4JTLA 3UWQA 4CNUA 4E8CA 4IIBA 1QPQA 1OY0A 5D9MA 2ZZ3A 3FAXA 3F7JA 3WH0A 4HA0A 1FKSA 5AKQA 3B8WA 3GC5A 5CAKA 3HPAA 1IF2A 5G1YA 4JX6A 1WZKA 4S2BA 4DYKA 1HX0A 4KS0A 3SGZA 3KCLA 2V5DA 2FH8A 3BGGA 4EOUA 4XO7A 3W87A 1V3LA 3UCCA 4OBSA 4KF1A 1VGAA 3QY7A 1OFPA 5HW7A 4QS5A 3IVUA 3NAVA 1V6TA 3QR1A 4HNCA 1WZLA 3SN1A 3SSZA 2PDCA 2VRQA 4CD4A 4O53A 2OOGA 1IZCA 3O5MA 3O0KA 3I6CA 3VXGA 4F79A 2DP3A 3MSDA 4YVVA 5HXMA 1SO3A 4YPJA 3N15A 3LTYA 1W3KA 1FKHA 4GI6A 3AFBA 3WDHA 5EL1A 3WUBA 2GOKA 3H6OA 1WX0A 3L68A 1BKFA 3P67A 3WK0A 3S9YA 1IT0A 2NQ9A 4YHGA 2BVWA 4UQEA 4JFMA 2QAFA 3VGEA 3RJYA 1UUMA 1A4LA 4FP1A 2OEJA 2W91A 4RLIA 4A21A 3AS2A 3M47A 1VBHA 3TQKA 1IIGA 3EB3A 3W70A 2VC7A 4KGJA 1ICSA 3TAOA 4IH3A 4ZENA 5C0QA 4GCXA 4ZTXA 2PEVA 4UC5A 5KMYA 1EDQA 1HKKA 1JQXA 4M7TA 2VZOA 4C02B 1JPHA 1TTJA 3AS3A 1R3YA 3D46A 4DXVA 2DT0A 1SSDA 2Q6ZA 3M0HA 2C18A 3MVTA 3MYOA 5DT7A 2QMJA 1RQHA 2PDUA 1UKTA 5DBUA 1FTXA 5GVJA 1E9ZB 3VPLA 1K8XA 2CESA 5AZ0A 3HOJA 3CH0A 4DIAA 1V7AA 3POHA 1E71M 2PU1A 2QJHA 2WSQA 3N73A 4BKNA 1PXGA 2ISDA 3H9RB 3W85A 3TN5A 1K9TA 3ZVHB 1CGYA 4JQ1A 1TWIA 2J7FA 3ZT5A 3O0FA 4JXCA 4IG2A 2DVXA 4HSHA 5JU6A 2EPMX 2INZA 2XIJA 2FJUB 2ZRVA 2VQUA 2XU2A 3ARYA 4XSMA 3OA3A 3SQLA 2VM8A 4MKSA 4Q8VA 4DZ2A 4KWOA 3PJUA 2RUDA 3H22A 4G5DA 1VJSA 2JE8A 5FEWA 3S2NA 5KINA 1I4NA 4PUDA 5TAOA 3I3EA 1LL6A 5ABEA 2A3HA 2GSHA 3K13A 2QCNA 4EAYA 2BB0A 3S1UA 3Q2DA 1IXPA 2HISA 3A22A 4URIA 2AMGA 1IEWA 4PCNA 1NWSA 3HBLA 3SFKA 3VU2A 4LYQA 1VFUA 4K7VA 4XKYB 1EGZA 3JRKA 3BLDA 2P5NA 3OBEA 3LCFA 2NV1A 3WNLA 1DJIA 5HWNA 3UQAA 1PKLA 3DGBA 3M0KA 1M03A 4MVAA 4NXKA 3KOWA 4FZIA 3WMBA 5FEXA 1LDCA 1W8GA 3VKCA 2V3FA 3PZIA 5C55A 4HTYA 1DXIA 3C2RA 4ZO9A 3K1GA 1IXQA 1WKYA 4LCQA 4HMNA 1JDEA 1KXVA 3DIPA 3N17A 4DRSA 4EPKA 2D3LA 1ZBCA 1X6NA 3SIZA 5CSSA 1AW1A 1IWAA 3GD6A 1S1RA 3IPWA 4J2MA 3BARA 4YJ5A 4KPLA 5D38A 4B9ZA 2PPOA 3CASA 3ICJA 3VOGA 5I23A 1R85A 4EVZA 2ISSA 4Z2IA 3EX3A 4DROA 1B9ZA 2YL8A 3TNOA 1MXDA 3TJLA 4IISA 1A4MA 1NWTA 1QZ2A 3A4WA 1XFBA 4GYFA 3GR8A 2WKLA 1Z32X 1BKHA 3PPCA 1K1DA 4RNIA 3ATYA 2VP8A 2YBVA 4UMAA 4DJED 4GIYA 1HGWA 4TYOA 4DN1A 1JUEA 1XIEA 1LL4A 3VKDA 4CCZA 4DF1A 5CZKA 2ZZ5A 3U4FA 3NQ2A 3K8KA 5A5WA 1RALA 5CG0A 3FEQA 1TELA 3NL6A 2WHKA 4HYRA 4IZGA 1TVNA 4IT6A 2RDWA 4GK8A 5D33A 1S46A 4D6JA 3WEZA 5I5RA 1XICA 1RPKA 1OX4A 1QNPA 2PRHA 1K8ZA 1P6CA 1NDYA 3HFYA 2V9DA 2XSXA 4LWWA 3VFLA 3WBXA 1V79A 1SO5A 2GK1A 3SCTA 3HQOA 1FKIA