3RM8A

Amcase in complex with compound 2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
b'YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acidic mammalian chitinase
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 133
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm8A01
3L4YA 1E4NA 4JAWA 3II1A 1KQZA 2A3EA 3OB8A 1D3CA 4B3KA 1V0LA 1BVNP 3VGDA 3B9AA 4PTVA 3CUGA 3W6LA 1JZ2A 1H11A 2G3JA 3MMUA 3DECA 1UD2A 3PZTA 1UG6A 2D0GA 2XTKA 5A94A 3MUZ1 3EDKA 1E0XA 1NWSA 2E9LA 1ITCA 1IZKA 3APGA 4B3LA 9CGTA 4AY1A 3FY1A 3ALGA 3K8MA 2VZSA 1G01A 3EMZA 3UG3A 2J62A 2JIEA 4OIFA 1E6SM 3ZO9A 3UETA 3GXMA 3B9DA 3N17A 1QHOA 2XGBA 1LLOA 4KGJA 2J47A 1B3WA 3AMKA 1PPIA 4BA0A 4D6EA 3ARTA 4AD5A 1TR1A 5A1AA 5A6BD 2JALA 1HJQA 4M1RA 3SUVA 1OD8A 1XSIA 2YDSA 2O9TA 4GINA 4JHZA 3JUGA 5FCZA 3AXIA 2CPUA 3QGVA 2EQDA 4M82A 3AFBA 3F5JA 1JFXA 2EPKX 4U3AA 3PHAA 1B3ZA 1UH2A 3N1AA 4IUGA 1GUVA 4XB3A 3RJYA 1FA2A 2PWDA 3VIPA 5KZ6A 2DSZA 4PYSA 5E6ZA 2VR5A 4CU6A 2GDUA 1JAKA 1M53A 2E9BA 5GNYA 3ZSSA 1EXPA 1OCQA 3VIJA 1JZ5A 2G3NA 4S3JA 1VAHA 4OOUA 1G5AA 3WNPA 4LQ1A 3WUGA 4HA3A 3AZRA 2VURA 3ZJ7A 4W93A 4X9YA 5BCAA 1E5JA 1NQ6A 2D0HA 3EMCA 5AYBA 5DEZA 2BY2A 2VO5A 1JYVA 1KCLA 3MKKA 4U3CA 6CGTA 1L0PA 1E72M 5HDRA 3ARUA 3SCRA 3WUFA 4HMCA 1EDQA 3PZIA 1W3JA 4HP5A 4Q22A 3PTKA 4DWSA 5BXSA 1HKIA 3ALFA 4AEEA 5CZKA 1KWKA 3UR8A 1FFRA 1E6NA 1XCWA 4QLKA 1R7AA 1NH6A 4D71A 4GI9A 1VEPA 2FGZA 1CENA 3PTQA 1VFUA 1GQKA 2YL8A 1EOMA 4MAZA 1JXJA 1PIGA 1BPLB 1UH4A 2CBUA 3VGHA 5LA2A 4GIAA 1V03A 5ABEA 1RP9A 2XSAA 3M46A 3MMDA 1ZJBA 4UQCA 1ODUA 1O6IA 3BSHA 2WZHA 4LPCA 2WMGA 1MQPA 5GPRA 3RILA 1BLIA 1KBBA 1E73M 3RMEA 2BVYA 3ZSTA 3VMPA 3W81A 4V2XA 3CMGA 1W9DM 1KXTA 1UA3A 1QPKA 1UD3A 3BAJA 2GFTA 1NOFA 2WAGA 3ZMRA 3QOMA 2BVDA 3ZOAA 1XRVA 1M7XA 4PMQA 2WZIA 4HZ8A 3W6MA 1DWFM 2NW0A 2WVTA 4C7GA 2W66A 4KRUA 2WXDM 1BYBA 1JFHA 1GVYA 1G1YA 3AZTA 1KGXA 1U2YA 2WMFA 3OLGA 1WDPA 1WKYA 2Y2WA 2ZX7A 5DFAA 4HOWA 3K1DA 1E0WA 1PX3A 1E6ZA 4UFJA 3U5YA 2WANA 5AY7A 3AYSA 4AXNA 3AHTA 3SURA 5LA0A 1H41A 3U57A 3VM5A 1GJUA 1AVAA 3WH5A 1E71M 1J0ZA 2VT0A 7TAAA 1EDTA 1E4LA 1L8NA 4GQRA 3VIIA 1GQJA 5DT7A 5HXMA 4JHOA 5E0FA 1HP5A 1HJVA 1EO7A 3A4AA 3VIHA 1E3ZA 1H1NA 2UY3A 3OG2A 5AYIA 3SCPA 1C7SA 1K9EA 3W25A 3N11A 2D0FA 4YHEA 5D8WA 5I23A 2YBTA 2XJ7A 1NOWA 2GK1A 3MUIA 2C0HA 3CUIA 2WLZA 2A3BA 3T09A 3OZOA 3N12A 1E0VA 4QP0A 5D9NA 3NIYA 5A6KA 4DUXA 3VDAA 3VTRA 4Z2HA 1IV8A 4AZ6A 5ABHA 1PBGA 3BAXA 4EANA 3BAWA 1XD1A 1C91A 2UWFA 2OWWA 1KXVA 4IISA 4D72A 4MTVA 3WMCA 2WC3A 4XV0A 2YOCA 5CGTA 4QFUA 1PEZA 4CD6A 4UCFA 1E43A 5JBDA 3NCOA 5BRQA 4FLOA 5GQBA 2EXOA 4RL3A 4M56A 3SCUA 3WNMA 2QMKA 4UFHA 1DWAM 1TA3A 1EOKA 4WSJA 4NRRA 3IJ8A 3CUFA 4J3XA 4ZE5A 3OLDA 2OYMA 1E55A 1MYRA 1QHZA 4MJ2A 2XVNA 1B2YA 3VDBA 3RCNA 1DWIM 4F9DA 1VJSA 3AS2A 3WDJA 3A6OA 1HVXA 2VMFA 3GBEA 1B9ZA 4PSRA 4AD3A 1AMYA 3MMWA 4J28A 1HKMA 1QVBA 2EJ1A 3CIVA 4A3YA 1SMAA 1XD0A 1E70M 2CBIA 3ARXA 3VMNA 2V3EA 2WBGA 3ARSA 3RM9A 4QCEA 1R7OA 1WZMA 1ISZA 1WAWA 2WVUA 2ZE0A 2E8ZA 3SUSA 1LWJA 3ZQ9A 1EQCA 1WDRA 3FXYA 2WW5A 5HOSA 2W61A 3EDJA 3UR7A 4QCFA 2DQXA 2Y24A 6A3HA 2IXUA 5DT5A 4P7NA 3NDZA 2J7EA 3BAYA 4J3SA 4L4PA 4BF7A 3MV11 3HJEA 1MQQA 3NSXA 2CKSA 4Y7EA 3VGBA 1HN1A 3AZSA 3EYPA 4HU0A 2PWHA 4JKLA 5TD4A 4AZCA 2J7BA 4AZ7A 1QW9A 1C8QA 3A3HA 1ZU8A 4CD4A 3GH7A 3OIHA 5M17A 1QBBA 2HISA 4PTXA 1XCXA 4WSKA 3S6TA 1J01A 1J11A 1JZ8A 4JKKA 1JIBA 2XYLA 4EAMA 3M6DA 2YLAA 4PCTA 2OSXA 4DWSB 3F5LA 1LG2A 1KBKA 1BTCA 4WKAA 1Q6EA 2XIIA 5FKYA 2VX6A 3AXHA 3VX1A 3GXDA 1XH0A 2J74A 1XH1A 4PMRA 2WWDA 1QNSA 2GJXA 1EIBA 3UESA 1JDCA 2G4FA 1W32A 4TXEA 4IPNB 1B3VA 2HVMA 2G3MA 1B3YA 3NSMA 1VBUA 1W9XA 2JF7A 4E8DA 1TMQA 4UOJA 2Y5EA 2DT1A 1UD5A 4H8HA 2O9RA 3OGSA 3TTYA 5HPCA 2WMHA 4QLLA 1OSEA 2ZUMA 2X05A 3WBAA 4PMNA 2UY4A 2VZUA 2BHUA 1WPCA 1M04A 2VZVA 3WH9A 3UERA 4JKMA 3WNKA 3PZUA 1FH8A 3VIMA 3THDA 5I79A 2OSYA 1D2KA 2GJRA 3RM4A 6TAAA 1W2PA 5EFDA 3K4DA 4B9YA 4MNKA 2B31A 4HU8A 2J4GA 3AIQA 3VDCA 1WZLA 3KL0A 1PZ3A 1CGUA 1KGUA 2VX7A 4HOXA 1BSIA 1E5NA 1QHPA 4U2ZA 4OBSA 1OINA 5IHRA 4TX8A 4D6DA 3J7HA 1Q6FA 3AROA 2J79A 1K9DA 1Y7VA 2E3ZA 3T0DA 2DT3A 3VD3A 1IZJA 2ZUSA 3RDKA 3ARRA 5CGMA 3N04A 1OD0A 2ZXQA 5EB8A 4WIWA 3F5KA 5JBEA 3E1F1 1UH3A 4DM1A 1OIFA 1YQ2A 1ISVA 4CVWA 3PZOA 5FOOA 2NSXA 1RD6A 1FFQA 1J18A 3FHAA 3WIJA 3RJXA 4HMEA 5KEZA 5DMYA 1VJZA 4MDOA 4AD0A 1PJ9A 4HA4A 2ZUWA 3WEMA 3CTTA 1AQHA 3CO4A 3VKKA 4KWUA 1G94A 2AAAA 3CZEA 2CHOA 4WJXA 5A8MA 2G8ZA 2QMJA 1XGZA 1BGGA 3ZIZA 4CN6A 4UNIA 1H2JA 1QNRA 3AYRA 1CEOA 1P6WA 4MNMA 1WCGA 2VQTA 4LXFA 2BVTA 4NF7A 1N82A 3HN3A 1JZ3A 2O9PA 1W91A 4MDPA 8A3HA 3D3AA 3W27A 5HBFA 3TTSA 1OWQA 2ZXAA 1VF8A 1UWQA 4M24A 1BG4A 3VX0A 2WCAA 3NUKA 1E9LA 3VIOA 3G6LA 1TUXA 5CSYA 1E6RA 3TOPA 2XHYA 3AISA 1X6NA 3AQUA 2W4XA 1V3JA 4P7OA 4M29A 2CBJA 3GH4A 3GNOA 3ECQA 5JBFA 3SCQA 4AD2A 3WL1A 1VENA 5DO8A 1V02E 4W7VA 2FHFA 4P7RA 4DUWA 4M80A 3GXIA 1V3IA 2ZX5A 3NJ3A 2IUZA 3T2PA 1DWGM 2QV4A 1LQ0A 2CITA 1AQMA 1PZ2A 5BWFA 3CUHA 2DH2A 5A6SA 1LL7A 3IJ9A 4D6IA 2CESA 2JEQA 2WWCA 3NYDA 3WQ4A 3WUBA 4CD7A 1XV8A 3VGEA 2PB1A 5EMYA 4AIUA 4FF5A 1JNDA 3L4ZA 4AW7A 4ACZA 5BROA 2W67A 5CG0A 4W8LA 3CGTA 4Z2JA 1QW8A 3T0BA 1HKJA 2J7FA 1CXIA 5I2UA 3WD0A 1V0MA 4PTMA 2VJXA 4WKFA 4NRSA 1TVNA 5I3DA 2YKKA 1WO2A 1KWGA 2XVPA 3WQ6A 2ZUTA 5DF0A 4NSBA 1B31A 5I6SA 1PX8A 3K4AA 1UWUA 4PTWA 3ARPA 4NZCA 1FH7A 4ATLA 1PX4A 2CBVA 1GONA 3VNYA 1WE5A 3CBWA 2VZTA 3UCQA 3WDRA 1H3GA 3CZGA 3VD5A 2YA0A 1FHDA 1GQLA 2CYGA 5A6AA 2E9MA 4UZUA 3BAKA 4P7LA 4RE2A 1GVIA 1W1TA 2VZOA 4GZEA 4AZCB 5A6LA 1VB9A 5CXPA 1VBRA 1HF6A 1LF1A 2CERA 3GYCA 4CD5A 4PMYA 3BAIA 1UR0A 4BCEA 3L4UA 2VRQA 4FMVA 1O7AA 1JD7A 3LPOA 2AOSA 1CBGA 4CU8A 4KH2A 5A2CA 2WNWA 3AOFA 2VCAA 4Z2GA 1F4AA 3S2CA 1KFWA 1K6AA 3WBEA 3WQWA 5E0CA 3UEQA 3VO0A 5A8NA 5A6JA 1V6VA 4BZYA 3WL0A 2VL4A 3PZGA 4TVCA 1K9TA 1WDQA 3SUUA 3OGVA 4DM2A 3PZVA 2GJXB 2VX5A 2WLYA 1JAEA 2OLHA 4QLJA 1W1VA 1Q6GA 5JH8A 4ACYA 2J25A 3BLPX 3SCNA 1VRXA 2QF8A 3W29A 3N18A 2DT0A 4PMZA 3U7VA 4UOQA 2XSBA 4LYPA 1OBAA 4J3UA 1HL8A 2G3IA 2Z1SA 1GHSA 1H4PA 1SYTA 3WH6A 2DIJA 3PZMA 1OM0A 5EFFA 1ZBVA 2W91A 3BGAA 5M5DA 1V0NA 1W1PA 1VFOA 3TA9A 4AEFA 1KGWA 1R86A 5A69A 2XWEA 2CXGA 5M3WA 3WUEA 1DWJM 1X1NA 4KMQA 4LYQA 3DYMA 1ZBWA 4YHGA 2DSUA 2VOTA 3K46A 3W0KA 4AD4A 2FDMA 5CLWA 1V3KA 5D8ZA 4D6GA 1JZ7A 4CD8A 3BMVA 1OGBA 1UQZA 2GJPA 1GORA 1DP0A 4AZGA 2XM1A 1I75A 4P8WA 1ZB5A 4B16A 4QDMA 5F7UA 2JE8A 2WKGA 1NWRA 4D6FA 1OIMA 2IXVA 4CCCA 4H04A 2OYLA 4CVUA 1LJYA 2J77A 4E4PA 4PUDA 4JFTA 4OOZA 4QAWA 1JNEA 1ESWA 3VIFA 3IK2A 5AC4A 5E9AA 4W89A 4U5KA 1TZ7A 1J0HA 4GI8A 4URIA 3ZR5A 2XFRA 1ZS2A 4U33A 3AICA 2WHJA 3G6MA 4J3TA 4PMXA 4RE4A 3T0AA 1MW1A 1FHLA 2NT1A 2VCBA 2XVKA 1CGVA 3L2LA 2Y4SA 3BH4A 4W7WA 1WP6A 4BS0A 1US3A 4C7FA 3NDYA 2VRKA 2XGIA 1C7TA 1WZKA 2DPEA 5D4YA 3I3DA 4ZFMA 1VEMA 1Q4NX 3PZNA 4D1IA 1GOKA 4TVUA 3AS0A 3WMSA 3WF4A 3WSUA 3VGGA 3LPFA 2Y8VA 4PMUA 3ZJ8A 3VGFA 4WF7A 1OT2A 2EPMX 4JL2A 1HP4A 1UKTA 1BYAA 1JYWA 1ISXA 1QI4A 1ECEA 3IAQA 5EBAA 1RP8A 1BG9A 5HNNA 1J0KA 3AIEA 3FNDA 3UG4A 2PBGA 3T2OA 1A3HA 2Z1KA 2WHKA 1NWUA 1LL4A 2JIWA 1UD4A 3AMDA 4AZHA 5IXEA 7A3HA 3IJ7A 4HMDA 4EK7A 1GOOA 1VFFA 1HL9A 4AWEA 1F4HA 1GJWA 1UZ4A 4XX6A 5BYWA 4P8XA 3KEHA 3WELA 3PBGA 4Z2KA 2ZICA 4CUCA 3CZ8A 4ACZB 3KWXA 5E09A 2PWEA 5D9MA 3HU7A 1Q6CA 2OYKA 2ZX8A 1FH9A 1LWHA 1KXQA 1C3FA 2BHZA 2ZXDA 1CXFA 4GZIA 3VD4A 2X0YA 4JFVA 3MANA 5FIPA 4GXPA 3VILA 2WPGA 3SUTA 3QHOA 3AIWA 1FP8A 5A8QA 1V3MA 2CHNA 3NSNA 1BYDA 1JG9A 3KE0A 2W92A 4JIEA 3B8SA 2YA1A 1UKQA 2NT0A 3GBDA 5I78A 1LL6A 2VRJA 3IAPA 3PZ9A 4MB3A 1H09A 4ATDA 1KQYA 3WNLA 1BHGA 3GH5A 1E4IA 1UR4A 4H7VA 1OT1A 2JEPA 3BXWA 2OWXA 2CEQA 2OWCA 2WCGA 1UKPA 4AC1X 4X0NA 1W9VA 3FAXA 1ZJAA 2VCCA 1UUQA 4ZXLA 1GCYA 1HJUA 2WHLA 1XYFA 4K68A 2J7GA 1EGZA 1JI1A 1BF2A 3RO8A 2DSVA 1HJSA 3MU7A 5GNXA 2QHAA 4WKHA 3WKZA 4CN1A 4P8UA 3L4XA 4GZJA 2PWFA 4W8AA 2TAAA 3QHMA 3CZJA 2VI0A 4WLCA 5LYRA 3HMCA 4CGTA 4MADA 1E6PA 3OZPA 1G0CA 4PUEA 2D23A 5A95A 2ZOXA 3GDBA 1GOIA 1JL8A 4J3WA 1GHRA 1I1XA 2D3NA 4DWSC 1CWYA 5LA1A 1ISWA 4TTUA 3WQ8A 3SCOA 3LPPA 3ZJ6A 2BV9A 2XUCA 4A4AA 5I0DA 3QHNA 1RH9A 1CLXA 2ZUNA 2VR4A 1W1YA 1R87A 3MV01 2BHYA 1CLVA 2VX4A 2YIHA 1M03A 2W5FA 5FL0A 3WQ5A 5M03A 2GUYA 3W38A 5ABGA 4IPLA 1EO5A 2XM2A 5C8BB 2XG9A 3L4WA 4J3VA 1UWIA 3T08A 1FOBA 1EHNA 3T2QA 4D1JA 2WVVA 4B15A 3WH7A 1XSKA 1ZBKA 1PIFA 1VFMA 1ISYA 3ARQA 3THCA 3ZT6A 4HPHA 5D9OA 3AMLA 5CPTA 3WEZA 3WF2A 2DGAA 2GK1B 1QI2A 2J78A 4JCLA 3L4VA 1V0KA 2XFFA 5FL1A 3DHUA 4MPKA 1EQPA 1UA7A 4D6JA 3GZAA 1HX0A 5HPOA 1NWTA 1JF5A 4UFIA 4XZWA 2PBOA 2WSPA 3W37A 1E6QM 3GNPA 3N13A 4V27A 5CLTA 3GNRA 1C8YA 2WYSA 2ZUVA 4FLQA 3LMYA 2E8YA 1TG7A 1CZ1A 4UQEA 4F8XA 5C70A 5A2BA 2X09A 3VNZA 3MO4A 4PN2A 3WD1A 4P7QA 1JF6A 2DIEA 4L4OA 1JXKA 4U31A 3VOCA 4HOZA 5IHSA 4BQ3A 3N15A 4MB5A 1KXHA 3WF1A 2WC7A 1B1YA 1SR0A 4JFSA 2VUYA 3GTNA 4OJYA 2EBNA 1UR8A 4MJ4A 1UYQA 3CPUA 2V5DA 1TA3B 2EO7A 4CCDA 1CECA 3RIKA 2PF0A 3A47A 3PTMA 4JFWA 3KL3A 1WZAA 3L4TA 3IANA 4CU7A 3OLEA 2V3DA 1NP2A 1GPFA 1C8XA 4UFLA 3WNNA 1CIUA 1G9HA 1CXHA 3UG5A 1C90A 1EDGA 4X0VA 1E3XA 1TCMA 1QNPA 4Q7NA 5ABFA 1XSJA 1W3KA 3AXXA 1CGXA 1CGWA 1HVQA 2C8NA 3LPGA 5D9PA 1KCKA 4D6HA 1FP9A 1DEDA 2X8RA 4AIOA 5CJ5A 3WDIA 1MQRA 1UWSA 1E6XM 1H5VA 2DEPA 5GNZA 4W84A 1TFVA 1MW2A 1V02A 4UTFA 2VQUA 2A3AA 1D7FA 1CGYA 1W3LA 3VMOA 3WF0A 1J0IA 4GI6A 2A3CA 4XZBA 2O9OA 4JCMA 3W26A 1U30A 4CN4A 1CNVA 4WK9A 2D24A 4OUEA 1H49A 2ZX6A 1NP0A 3AIVA 5CPQA 4MNLA 3PZQA 2RGMA 1UR2A 3O2LA 3M7SA 2CNCA 1UOKA 1QI0A 2BXZA 1NOUA 1V6WA 3TP4A 3EMQA 2W63A 1V3LA 3VVGA 1R85A 3AHYA 3KL5A 1SFSA 2WMIA 4AYSA 3W28A 1ITXA 4AIEA 3BCFA 4F66A 2C7FA 4PBGA 4A3HA 2XVLA 1CGTA 2EPOA 1E4MM 2BY0A 2ZIDA 1JZ4A 1B90A 4UQAA 3AMGA 1CTNA 1MW0A 3CLWA 2WK2A 4PCSA 1MFUA 4UQBA 3WN6A 4AD1A 5IFPA 1KR0A 2QLYA 1MVYA 3VINA 3ARYA 2DH3A 4UQ9A 1NARA 2A3HA 4HZ6A 1OGGA 1E15A 4W85A 1C92A 2YBUA 5C71A 1U33A 4OBRA 3RM8A 2YL6A 3O9NA 3AIBA 3ARZA 5I77A 2Y8KA 4MB4A 1UZ1A 1XC6A 3WF3A 3I3BA 4YPJA 3CMJA 2W62A 4N0RA 2CCRA 1SMDA 4UOZA 1WNOA 2MANA 4N42A 1E56A 4KGLA 3KZSA 4TX6A 3K8KA 3K8LA 4TVDA 3WEOA 8CGTA 2OSWA 5IFTA 4D6CA 3WH8A 1A47A 2DSKA 3POCA 3MSGA 1EA9C 3VUPA 4S3KA 1UWTA 1QI5A 3VIGA 4W7UA 1EH9A 5BXTA 2BXYA 3U5UA 2VVNA 2DSWA 2D20A 1ZL1A 1NM9A 4PSPA 4W88A 4AZ5A 1JYXA 1J0JA 2X1IA 4YN5A 3CUJA 3WENA 3VPLA 1I1WA 2F8QA 4FLRA 1CXKA 3CH9A 4UR9A 3FHQA 1J0YA 4ATWA 4W86A 4PMVA 3GXFA 2E40A 3D5HA 4B9ZA 3CHDA 1YHTA 2WBKA 7CGTA 2WCSA 2FGLA 4KRTA 1B30A 2O92A 2D1ZA 2XVGA 4H8VA 1BFNA 1CPUA 4E8CA 5I5RA 2V3GA 1GQIA 4W5ZA 3AIRA 2VNCA 3W53A 1XYZA 4ZEPA 3AHXA 3FW6A 4R5EA 3B9EA 4MAVA 1B0IA 2WVVB 5BXPA 1IT0A 4OKDA 2ESCA 3ZJKA 1UWRA 3OBAA 3POHA 3AS1A 3SEPA 4H41A 2BS9A 1MXDA 3AMCA 4U2YA 2ZUUA 4M8UA 2E4TA 2XIBA 2XWDA 3A4WA 1W3HA 2V38A 4ML4A 3ZT5A 2AMGA 1Q6DA 4NI3A 1US2A 3PN8A 1XHGA 1B3XA 2PI6A 1C93A 1HIZA 3W4RA 1J10A 1OGSA 1GOQA 1ZBCA 2BNJA 3WDPP 1CDGA 4GO9A 1UR1A 4C7DA 3OLIA 3CHFA 1V6XA 1HXJA 2VC9A 3SCTA 3ZT7A 5BRPA 4ZXOA 1W9PA 3W82A 3EDEA 5BXRA 1CYGA 5AC5A 2XFYA 4AZIA 2WSKA 1LG1A 1TVPA 4DWSD 3EDFA 1JGIA 5A8OA 2BFGA 1WB0A 2FH8A 3WNOA 5FD0A 1KR1A 5ECUA 3QOKA 4AMCA 3FN9A 1JI2A 3A4XA 2E0PA 2J7DA 3TTQA 1CXLA 2WMKA 4MB1A 1VEOA 4E2OA 2YDQA 2ZX9A 2V3FA 4U5IA 2J75A 3BLKA 3OA5A 2GSJA 3SIMA 2GDVA 3GM8A 3VIKA 4BQ2A 2WKLA 3L2MA 5IDIA 2YL9A 1UR9A 5ABFB 1QNQA 4LYRA 3I3EA 1GZJA 1JZ6A 2ZWZA 2J8GA 1HJWA 3SCVA 1VIWA 4M81A 1CXEA 2CKRA 1JD9A 3VDHA 3TONA 4LGXA 2F2HA 1ODZA 1UKOA 2WVSA 1JDAA 3MUAA 3WDHA 3MUY1 2JF6A 4CKQA 1QNOA 1UKSA 3VD7A 3U7BA 1BQCA 1QI3A 1W9UA 4RE3A 2QPSA 2X2YA 2J7CA 3MSDA 2UY5A 5CQ1A 3ZR6A 1JYNA 1AQ0A 1E1FA 2XPKA 1V08A 1RPKA 4F79A 1V6UA 3F4VA 3WQVA 4DUVA 4GKLA 3AS3A 4H2CA 1MWOA 3AI0A 4PEEA 2JFEX 3WMBA 4HPGA 1BVZA 4W87A 4OZOA 2GVYA 2WMIB 1K9FA 4UFMA 1PAMA 5A8PA 5I24A 1E1EA 3AJ7A 4J27A 3EDDA 1HJXA 5JIWA 2FHCA 2QPUA 3TTOA 3BCDA 1XH2A 2WZEA 4H8UA 2D3LA 1H0IA 3SUWA 3VD9A 2WHMA 4IM4A 3VU2A 4HZ7A 4Z2LA 4PMDA 4V28A 1W9BM 4BQ5A 1DWHM 2EPLX 2YL5A 5A6BA 4FLSA 1GOMA 4PMOA 3ARVA 4GQQA 1UD8A 1X6LA 1GW1A 1OB0A 4LX4A 2WM0A 4AZBA 4J7RA 2ZXBA 4MNJA 4JFUA 1JDDA 3AIUA 3RPMA 2YJQA 3CZKA 2RGLA 4GO8A 4AISA 2UY2A 5CSUA 1QOXA 3VM7A 1KB3A 3DHPA 2WB5A 2YA2A 1BYCA 2DT2A 1DHKA 5JIPA 4BQ4A 1J9YA 2ZWYA 1Z32X 1GOWA 4CCEA 3WD2A 4GPNA 2PC8A 4EE9A 2BY1A 3AHZA 3OGRA 3CHCA 3M07A 2D2OA 2EPNA 3ZM8A 1UQYA 2PWGA 4FK9A 5A6MA 3BMWA 4PRWA 5JUVA 3CHEA 2DDXA 1E40A 3WD3A 2YDRA 1HKKA 5E6YA 1W2VA 1WDSA 2VTFA 3MS8A 5E70A 1UD6A 5A3HA 3ARWA 1MXGA 4ZENA 4EKJA 4W8BA 4TUFA 4R27A 2FH6A 3WFZA 3CZLA 3DC0A 3WFLA 3O6AA 3SCSA 4Z2IA 2VVSA 2Q8XA 2X0HA 1UHVA 4TTGA 1S46A 1H0GA 1QBAA 1DTUA 3AHVA 2EEXA 4UZSA 2V5CA 2CIPA 4UQDA 2YLLA 3BSGA 3BC9A 3WY1A 1TE1A 3EBVA 1BGAA 3N9KA 4JZ5A 4HTYA 1HT6A 4JL1A 4F9JA 5CPSA 3FAWA 4HA1A 2D22A 4P8VA 2WC4A 2J8FA 1V6YA 2WMJA 4ZE4A 4XUYA 4TOQA 2F61A 1HNYA 2G41A 4W5UA 3SCWA 1MFVA 1BAGA 1M01A 3QR3A 2BY3A 3DYOA 4UFKA 1MW3A 1GNXA 2CETA 3W24A 3DYPA 1R8LA 2J7HA 2FHBA 3WD4A 1J12A 1EHAA 1V3HA 5A2AA 3WDQA
chains in the Genus database with same CATH superfamily
2XPAA 4QQ3A 1E4NA 1PKNA 4JAWA 3UBPC 3II1A 3S46A 3DX5A 4O16A 2E6YA 1BKHA 4X61A 1H11A 1ALDA 3MMUA 3DECA 4AG0A 3WBXA 3CL7A 3FVDA 1GTHA 3LQGA 5C9WA 1J4HA 1DTNA 2HCVA 3EWCA 3C8NA 4LU0A 4YWIA 1PTDA 1UMYA 3K8MA 2VZSA 1G01A 2QCCA 5F4WA 5CC6A 3UG3A 5H6HA 3V18A 2W79A 2J62A 1E6SM 3B9DA 3N17A 5C2XA 5TQLA 2SFPA 2J47A 3AMKA 5CPMA 3HV9A 4AD5A 4L61A 4A3QA 4LSBA 2ZZ6A 4IJBA 1OD8A 4LV9A 2QIWA 2Y5SA 9XIMA 4JHZA 3JUGA 5FCZA 3AXIA 1L6YA 1CLKA 2Q71A 3WLKX 3N4EA 4HJWA 1N8FA 1XIHA 3PHAA 1B3ZA 3V75A 4L1WA 5C2CA 1A0DA 4IUGA 3CUXA 2DSZA 4CU6A 4LVDA 3UZXA 1TJRA 4OT7A 3VIJA 1OF6A 3IK4A 4XQ6A 4M3PA 2P8CA 5DANA 3A3XA 1G5AA 2RDTA 4JTFA 3LZ3A 1O5QA 4LQ1A 3WUGA 3EPMA 3LEPA 5C9UA 2E1DA 3QZEA 1LQ2A 2V5LA 3HG4A 3ZJ7A 1OVDA 3EA2A 2NUYA 2QDHA 4W93A 4Y9OA 2YGYA 3TW9A 3GFXA 3IV3A 2BY2A 1KNWA 5HW7A 5SWUA 1FRBA 1VKFA 4NT0A 1W5QA 4RXFA 3IJDA 3WUFA 5C6MA 4J4KA 4HP5A 1GOXA 4Q22A 1ML1A 2CLKA 3UR8A 3W1MA 1QTWA 1NDVA 1FFRA 3IIOA 1XLJA 4QLKA 3U2OA 3IIPA 3IRDA 2ZRVA 4GI9A 2I5QA 4ZB2A 4JFMA 1X7FA 2FGZA 3PTQA 2Z29A 1ZLPA 4DRQA 1GQKA 1ZENA 1EOMA 5HWCA 1VC4A 3UQIA 2GQ9A 2OX4A 1FWNA 1V03A 4PFHA 1SJBA 2E5BA 5EMMA 5BMXA 1O6IA 1P43A 2WZHA 2NQHA 1SO3A 2A4AA 2R14A 4Q6JA 4EF9A 5GPRA 1H5YA 2MNRA 5FJRA 3DG3A 3RMEA 3THUA 1VD6A 4V2XA 2OT1A 1UA3A 2J9YA 1UD3A 1AG1O 3GK0A 4G2DA 1NOFA 1UMLA 1QK2A 3QOMA 3GR4A 4KERA 2M2AA 2QZRA 1M7XA 2Y78A 4O15A 2E7FA 2HZGA 2NW0A 2GWGA 2WSQA 2Z27A 1KGXA 4GA8A 4DJDD 3TC5A 1WKYA 2Y2WA 3ITTA 4HOWA 5BRBA 2I9EA 4C6FA 4ZTXA 4UFJA 2WANA 3AYSA 1EX5A 4C6IA 1F3TA 2PDUA 1H41A 4TMCA 4X2RA 1AVAA 2OKOA 3R12A 3KZ7A 1J0ZA 2VT0A 7TAAA 4IHCA 1L8NA 4ZO9A 3VIIA 2HBXA 1LT7A 4PB4A 3S5SA 1KFKA 2GOKA 3QKEA 2ZA3A 1HJVA 2IPGA 5CZ0A 5E93A 3PBYA 3N34A 1H1NA 3KFTA 5AYIA 3SCPA 3W25A 1G4TA 2ICSA 2D0FA 2JBMA 2YFOA 4B90A 3RF9A 3WJYA 1HO4A 2A3BA 4QJ4B 1FKWA 3T09A 3OZOA 5F4SA 1RCQA 5CPLA 3KBWA 4O28A 4FX8A 5T8GA 3ES7A 1O95A 4CNUA 5HUAA 3S5OA 1U5JA 2ISVA 1EF2A 2M08A 1UC5A 2ZC1A 3BAWA 1PVNA 1HZYA 1XD1A 1C91A 2UWFA 2BXVA 3S1UA 1MRQA 1PO9A 1KXVA 4H3DA 4IISA 4EX4A 4YL2A 1SU5A 3WMCA 4XV0A 5CGTA 1I0DA 3NEVA 2V30A 3KRUA 3SIZA 2X7VA 4MG4A 4AF0B 2R1NA 1POJA 2XIJA 1E43A 4RZ5A 3NCOA 3D46A 3MP3A 3QYQA 4FLOA 5GQBA 3L21A 4RL3A 1A5NC 2QMKA 3EX4A 1EOKA 3PY2A 4NRRA 4WSJA 3IJ8A 4ZE5A 1XQKA 4Q8UA 2OQHA 1MYRA 1JDEA 3CMFA 1FKRA 1OC5A 5CAHA 3BV7A 3VDBA 4ZPWR 1JPKA 1DWIM 1UBSA 1KRMA 1VJSA 3NGFA 3A6OA 5G5IA 3A5VA 3GDTA 1B9ZA 4PSRA 2PLMA 4TW7A 1ZP4A 1HKMA 1QVBA 1S2WA 3NQVA 3H23A 3S42A 3S2NA 1E70M 4UNLA 2CBIA 3GU2A 1DQUA 5AZ1A 1F07A 4DX3A 3QH2A 4GE8A 2V3EA 1F5ZA 4QCEA 3S4TA 4P2VA 3LBCA 4HGXA 5DXXA 2ZE0A 2F6KA 2OO0A 4PC8A 4ODKA 3KHDA 3ES8A 3UR7A 4QCFA 4IG2B 2A7PA 2LJ4A 2IXUA 2AL1A 1TV4A 4DYEA 3D6NA 4MWAA 3H2FA 3VNIA 3PAOA 3OYZA 5E5CA 3O5LA 4Y7EA 3MJYA 1H7XA 1QK0A 1R6WA 2VWSA 2PRHA 2PWHA 1DL3A 1GVRA 3HO8A 4AZ7A 1VBGA 3IS4A 3A3HA 4IT1A 4JBRA 3GH7A 3MCOA 1J96A 2RAGA 4WSKA 4JKKA 3M6DA 4H83A 3G0UA 1ZK6A 1KBKA 1OFEA 2J9XA 1BTCA 3BL3A 1KV8A 1RBOB 2XIIA 1C8VA 5FJPA 4R7JA 1XH0A 2PCEA 3NZQA 1RV8A 3KAFA 2H3DA 3VKAA 3GVGA 3IVUA 1W32A 3UJEA 2HVMA 4EPBC 1LTDA 3B97A 2KFWA 1KM4A 3TFXA 3MKVA 2Y5EA 1UD5A 4DZ2A 2TRSA 4O0QA 2O9RA 1AL8A 4DRPA 2WMHA 4MZYA 4X3ZA 2ZUMA 5GJMA 4PMNA 4XTDA 4M19A 2VZUA 3T4CA 2VZVA 5ECVA 3WH9A 1JPHA 3GG7A 3WNKA 1EC7A 1MZHA 1FH8A 3W1RA 3PR9A 4ES4A 2BSLA 3VC6A 6TAAA 2ZE3A 2CC0A 1QU4A 3VDCA 3AIQA 4CNSA 2ZC8A 4Y90A 4I6VA 1SZFA 1KGUA 2VX7A 4HOXA 1BSIA 4ZSUA 2YCLB 3QV7A 7REQB 1QHPA 4WJEA 3EWBX 3UD6A 2NVCA 3UXDA 1EGVA 3M6YA 4TX8A 4D6DA 1L1PA 5DRCA 4JYDA 1CI1A 1PV8A 3W22A 1UIOA 2K8IA 4XBKA 4MGVA 3T0DA 1J79A 3C8FA 4LW7A 1IZJA 5TIMA 3N04A 1XLAA 4OFCA 3OTRA 2CLOA 1ISVA 4FXFA 3PZOA 1TWIA 1RD6A 3FHAA 1J18A 1XPYA 4PTNA 5CC5A 2AGKA 2ZUWA 4H7CA 2NQJA 3U8GA 3VKKA 3EY6A 4KWUA 2CHOA 1NELA 4WJXA 4PB5A 2G8ZA 1KD0A 3COTA 2QMJA 3RR4A 1XP3A 4QJ1A 3LA4A 2E6DA 2RUQA 3GTXA 3OODA 3BMXA 3T8LA 3S6DA 3PRBA 2BVTA 4J4OA 1AJZA 3HN3A 4FNSA 4DH0A 2DUAA 1RJQA 2PDMA 1KLYA 1W91A 8A3HA 3ABZA 1Q66A 5HUPA 3LV5A 1Q6QA 3EEZA 3HG5A 1BG4A 1PHQA 1QPFA 3VIOA 3IACA 3LV6A 1E6RA 3TOPA 3A9IA 2OMAA 4QQUA 4LAMA 1GYNA 3W2MA 2ZZ2A 2B5UB 2OEJA 4AD2A 4ZL1A 1C9WA 3GC2A 3F1QA 2OT0A 1DVJA 1XXXA 3FKRA 3M41A 3I6CA 4WDWA 3CC1A 3W6YA 4DEFA 5CJMA 3C4UA 3FLUA 4IF2A 3CUHA 4F4RA 2DH2A 3R11A 1LL7A 3IPWA 1IEIA 1WX0A 3RAOA 3VGEA 2PB1A 4YXGA 5LIXX 5EMYA 3DG6A 1KFCA 3QV8A 2NVAA 2HJPA 4PODA 3SI9A 4HZMA 3M0MA 3P84A 4Z2JA 3P5YA 1FWHC 1QW8A 3NPXA 3T0BA 2J7FA 3BK0A 3LSBA 4LT9A 3VXGA 4NRSA 4ERGA 3NQEA 4FOUA 3CAVA 5I3DA 4FI4A 4GH3A 2PGFA 2XVPA 2UZ5A 3ZR4A 4A22A 4NZ4A 3CPRA 1K1DA 3KXQA 1PX8A 3K4AA 2ZA1A 1UWUA 4I5RA 4B2DA 4BF8A 2R1KA 1GONA 3ZWTA 4A8LA 3VNYA 3N2MA 3QTGA 2VZTA 1W17A 3W7EA 3K1GA 3CZGA 4FXJA 4XZNX 1FHDA 5LZLA 3BAKA 5REQA 2PRLA 2C71A 1W1TA 3TJIA 1ZAIA 5A6LA 1K7XA 1VB9A 3VE9A 4M7TA 1TPH1 3TWAA 3P80A 5J5DA 3BAIA 1PDZA 2NQLA 2RJGA 2AOSA 2Z25A 3LPOA 2KI3A 3NZRA 4AHPA 2WNWA 2VCAA 2ONEA 1F4AA 2YSWA 4O1EA 3S2CA 1NQKA 1XFBA 2HSAA 3UEQA 3TQPA 1V6VA 3LERA 5FF2A 4BZYA 1OFBA 4CNPA 2QJGA 4BJHA 1EUAA 3WL0A 2VL4A 4ORIA 3KCOA 4TVCA 1K03A 1K70A 3OGVA 4DM2A 3PZVA 5FJOA 3HOJA 2WZMA 5KETA 3CGMA 1JAEA 3DFQA 4NVTA 2OLHA 3CQJA 3RNDA 5JH8A 2Y63A 3I4EA 3SCNA 1NMWA 3W29A 4L6DA 3VOHA 3B0VC 2DT0A 4AUBA 3U7VA 4UOQA 3F2BA 2F6XA 2VFHA 4LYPA 1Q1CA 4XZIA 2DU2A 2G3IA 1H4PA 1RSCA 2Q3OA 1V8EA 2DIJA 1OM0A 5EFFA 1ZBVA 3MT1A 3JYJA 2E28A 3URQA 3C3NA 1FWFC 4QGCA 1VFOA 2L5HA 4DPQA 2HPIA 1F9CA 3TXVA 3LDVA 3MP4A 4ECLA 1B6CA 5B7ZA 2XWEA 3P14A 5M3WA 1YW1A 3BVJA 1O66A 2YCEA 4KMQA 4B3ZA 3DYMA 3LZ5A 1VHCA 1H51A 4JXCA 3W0KA 4WUIA 4AD4A 3OEXA 1IQ8A 2PCQA 3JXVA 3JR2A 1MUMA 1TZ9A 2OEMA 4NUWA 3T07A 1UQZA 3H22A 4O2TA 1GORA 3QJAA 2XM1A 1I75A 3F4CA 2V82A 1ZB5A 4ZFCA 5F7UA 1TIMA 1VFSA 2JE8A 1NWRA 4CVUA 1LJYA 1EIXA 2J77A 1VLWA 4DROA 4UB9A 1ESWA 2PWVA 2PDPA 3IK2A 5AC4A 3CHVA 3MVIA 4U5KA 4K37A 4GZ7A 2C6QA 1LYXA 4E4UA 3TKFA 3TNOA 5TBOA 3CAWA 3IKDA 3T0AA 2OXNA 2XVKA 2OTDA 4M5PA 3NZ1A 4DJEA 6TIMA 2GGEA 4AQLA 2LKNA 4ICNA 2VRKA 3ANVA 2Y1HA 3UWVA 5D4YA 3I3DA 3E0FA 4A2RA 3GVRA 3PZNA 3NTYA 1GOKA 4TVUA 3WF4A 3WSUA 3VGGA 3LHZA 3LPFA 1G69A 3C86A 4QZVB 2Y61A 5FJJA 4JL2A 3C2OA 3MWCA 1UKTA 3SN4A 1EZ2A 4XKYB 5IM51 1JYWA 2QR6A 5A5WA 4GFSA 3O16A 3S0CA 1ECEA 1YBQA 3O0KA 3IAQA 3UG8A 4LAYA 4I9AA 4FP1A 1KFBA 4K39A 1LUCB 5HNNA 3TZFA 5FAGA 3FNDA 2QF7A 4YWSA 4IJRA 2REQB 1NWUA 5H2ZA 3TN5A 5IXEA 2D73A 7A3HA 4IIGA 3FYOA 1GOOA 1DE6A 1VRDA 1HL9A 1GJWA 3WELA 3PBGA 4CUCA 3CZ8A 4S39A 4NZJA 1EFZA 3HU7A 4Y2WA 1UR3M 4IGNA 1FH9A 1LWHA 2BHZA 3M7WA 4JTIA 5A6TC 2VEGA 1CXFA 1GZGA 4GZIA 3VD4A 1I9CB 3B40A 2E09A 3IGUA 2J6XA 4C1NB 4C60A 1FP8A 3A13A 3USZA 2O4MA 3RCYA 4UTTC 3EA3A 4FNRA 3B8SA 1TREA 2I5GA 4V15A 2NXHA 1EX1A 4MB3A 2V5BA 4ATDA 1KQYA 4N6EA 1UR4A 4CLMA 3TYBA 3FYPA 3GTHA 2JEPA 4JIHA 1JNTA 2OWXA 3G1FA 1OG6A 4YCOA 4FNQA 4W4QA 3QN3A 2WCGA 3VNDA 1UKPA 3K2GA 4I6KA 1ZP3A 1ZJAA 4NX5A 1WAUA 2J7GA 1VQTA 1F6PA 1KBIA 1ICSA 2RFGA 4XK2A 3MU7A 5GNXA 4KFOA 3LHTA 3S9IA 3RHGA 4I7WA 1KKOA 4GZJA 3DIPA 1JDFA 3CZJA 5LYRA 4Q8NA 3QY8A 3U3HA 2YB1A 4L3NA 4MADA 4J4NA 2HXTA 4PUEA 4JHMA 3SGUA 5JH2A 3HGRA 3NXFA 5EMUA 4PL1A 4AH7A 2HRWA 3OZMA 1I1XA 1YNPA 4DWSC 5LA1A 1ISWA 4TTUA 4X9SA 3ZJ6A 4LBSA 4LH8A 5IBXC 4A4AA 3QHNA 5LIKX 2VR4A 1W1YA 1U83A 4RE0A 2VX4A 3TFCA 2YIHA 1M03A 5KINA 2QJJA 1BXBA 4ERIA 1XIJA 1V7YA 3RLGA 1YKWA 5ABGA 4N19A 5K4ZA 5C8BB 3A12A 3GVWA 3RRAA 2XH0A 3KVKA 3GC4A 4D1JA 1PSCA 3T2QA 4XZLX 1DJQA 3SRHA 4DIPA 1OYCA 3CL8A 4GYJA 2VEPA 1VFMA 1P1XA 3N2CA 3WLRA 4HPHA 5D9OA 1QNVA 4AMAA 2OX1A 2DGAA 4JCLA 3PPFA 5FL1A 4JX4A 4D6JA 1ONWA 5HPOA 5LIUX 2G0WA 2PA6A 3GTFA 1T5AA 1IXPA 1DORA 4A29A 3KOZA 2YCJA 4V27A 3O5OA 3VDGA 4GISA 3W7JA 3NM1A 4MMWA 1IXQA 1CZ1A 4R3UA 4XZMX 5A2BA 5EPDA 1ZJIA 2X09A 3VNZA 3G22A 3TQKA 1U5HA 1GG0A 3WFAA 3URBA 4QBXA 1JF6A 3SRKA 4HJFA 4AF0A 3U6WA 4L4OA 1OZMA 3IJLA 5IHSA 4OVXA 1A5OC 3N15A 1KXHA 3WF1A 1SR0A 4IPJA 2VUYA 4OJYA 4YMZA 2EBNA 4C6CA 1TA3B 3T1GA 4MGGA 5B7YA 1E0UA 3FYYA 4ENLA 4CU7A 2OJPA 2ZQVA 3KWSA 4US5D 1C8XA 3HPZA 6REQA 1RVGA 3QLLA 3N2OA 4LVFA 4NHVA 3UG5A 1C90A 4K7YA 2W6RA 1TZZA 3SGGA 1BRLB 3MMTA 3MKCA 4W9QA 4RDYA 3HFTA 1QNPA 1YATA 4Q7NA 3G77A 4UTWC 1FKDA 1CGXA 3AXMA 1FWGC 4RZ6A 1RVKA 5D9PA 4AU0A 1EJSC 1DXEA 2LGOA 4HPXA 3WDIA 1GK8A 3HTWA 2OVLA 1H5VA 1TFVA 4UTFA 2PF8A 5EBUA 1CGYA 3WF0A 2A3CA 3E96A 3EXRA 4CN4A 3UZWA 1H49A 3IVTA 2ZX6A 2AMXA 3AIVA 5CPQA 3N3MA 4MNLA 4BI6A 2CNCA 1ADDA 3GRIA 2VEMA 4M51A 2BXZA 3DXIA 3TP4A 5H8PA 1QDSA 1V3LA 3TC3A 1SFSA 3W28A 5BWAA 4F66A 1ROTA 4A3HA 2EPOA 1E4MM 5FA5A 5C55A 1DIKA 1US0A 2PE4A 2PLJA 1Q13A 1IXNA 1UJPA 5D30A 3ITCA 1CTNA 4KIRA 2P10A 4UQBA 3OQEA 5IFPA 5HJXA 3WK3A 1QO5A 5L6UA 2X0SA 4HZ6A 1YDOA 2X2GA 1Y5XA 4F0RA 1U33A 3GKFA 1HGWA 3O9NA 3AIBA 3WQEA 3WLTA 5I77A 4HQVA 3WF3A 1M5YA 4YPJA 4FZIA 3R94A 1SMDA 4UOZA 1WNOA 1LZOA 2VENA 2MANA 4YU1A 2FKPA 2YR1A 4DB7A 3G0SA 3DN5A 5IFTA 4XUGA 4JN7A 5AECA 1T41A 4G6CA 2DSKA 3GIQA 4WDXA 3TMLA 3GNNA 3GR7A 3VUPA 4S3KA 2BBFA 2QKFA 2OG9A 4W7UA 3SSZA 1YE4A 4IP5A 1PIIA 4LFYA 4IIHA 5FSEC 2JQXA 1WUFA 3NVDA 2X1IA 3H2OA 5U7SA 3WENA 4DXXA 3VPLA 3N4AA 4JIRA 3F03K 3L0GA 3LY0A 1CXKA 2PZNA 1PCWA 3FHQA 5LHFA 4PMVA 3HQPA 2E40A 3KOFA 3FFSA 3GVVA 2WBKA 3W7RA 2D1ZA 4H8VA 3CASA 3IJQA 1BFNA 1HFBA 3MI6A 1CPUA 1DOSA 2Z00A 3LCFA 1MO0A 2A5HA 4W5ZA 2VNCA 3W53A 1A0CA 3TCEA 3EOOA 3VC5A 3BG5A 4MAVA 1B0IA 1IT0A 1A5BA 4ZPTR 4LUJA 3POHA 1VBHA 2I57A 3ITYA 2EG8A 1EC8A 5FEPA 2XH4A 4DO4A 3VE7A 1L6SA 4GCAA 3O05A 4M8UA 2XIBA 2XWDA 3ELFA 1YDYA 1TPWA 2V38A 2AMGA 1US2A 1KCXA 3PN8A 1YX1A 4UTUA 1FKTA 3P7YA 2PI6A 2IKIA 3G1VA 1HIZA 3W4RA 4JIIX 4DBWA 2VDIA 1OGSA 3LHUA 1JUBA 4PBFA 1CDGA 4EACA 2VC9A 3ATYA 1W9PA 3ITOA 3W82A 1U1HA 2BWGA 3EDEA 2XFYA 4AZIA 2Z1VA 3EDFA 1JGIA 3WNOA 5LGZA 4TMBA 4EOUA 3FN9A 4EXQA 3A4XA 5FF7A 2QCEA 3TTQA 1CXLA 4Q4MA 1F3XA 1VEOA 2NZLA 2YDQA 1YADA 3Q67A 4BFAA 1AL7A 3O5RA 3OVQA 1ZGDA 1QOQA 3BLKA 5KMYA 3H53A 3MHFA 3B3DA 3GM8A 1G6CA 3B8WA 3WZ0E 2WKLA 3L2MA 3I3EA 1VGAA 2OQYA 2HWGA 4XZHA 5IRPA 4DF0A 3KAIA 4ASTA 3K13A 4JTUA 1ICQA 1FD9A 2QW5A 1Q7MA 1VIWA 3CQ0A 4M81A 2CKRA 4DJDC 2WQDA 4O8RA 4GQ0A 1EUNA 1K4GA 1ODZA 1UKOA 2WVSA 1FDJA 1LOQA 3MUAA 1LBLA 2HDJA 4CKQA 1DBTA 3ONCA 2J7CA 2UY5A 2C3ZA 5HQLA 4PCNA 3M16A 2GVEA 1JYNA 3W9ZA 1AQ0A 1E1FA 2XPKA 2GL5A 4F79A 3P61A 4L5ZA 4LAZA 4ZVJA 3GFZA 3AS3A 3FSUA 3WMBA 4A8NA 1W37A 4HPGA 1BVZA 1K9FA 3KTSA 2E77A 1PAMA 4PH6A 3QY7A 1E1EA 2XPBA 5DCEA 3EDDA 4ZQPA 3CYVA 4NJGA 3TTOA 2GQAA 3MCNA 1Q63A 4KFPA 4IQEA 4AVNA 1H0IA 2DUXA 2H90A 3SUWA 3VD9A 5DRIA 1PKMA 1EQ3A 4HBKA 3QR1A 3PUOA 2UZ9A 4QSFA 2IF4A 4BQ5A 1D6OA 1TQJA 3LS9A 5A6BA 4Q8QA 1QWKA 2IS7A 4FAPA 3KADA 4L9ZA 1X6LA 1OB0A 4TW6A 2YJQA 5DMLA 4UMAA 3GB6A 4GO8A 2UY2A 2B7QA 3PG8A 5CSUA 1FY6A 2FTYA 2WB5A 1BYCA 5D2TA 3M0KA 3E6EA 1OEPA 2PGRA 1HXVA 1I4NA 5JIPA 1J8VA 4IMAA 1TUFA 1FWCC 2ZWYA 1PHWA 8RUCA 2HVOA 1YPFA 3WD2A 4GPNA 1JUEA 3LU2A 4C6QA 3NOYA 4YVPA 4WY0A 1AZ1A 3AHZA 3CHCA 4K7VA 2ETNA 2PWGA 5LNUA 1GG1A 4PRWA 3V0TA 3IVSA 5JUVA 2PC4A 3CHEA 3W7CA 3SZ8A 4G8TA 1DE5A 5E70A 3LCLA 3JZUA 4YNGA 5A3HA 2ZZ7A 3S3GA 5H8MA 1D3GA 2V5KA 4C91A 5CCZA 5G2WA 1TJ2A 2ZYFA 3O6AA 3M0YA 2LPVA 1XF0A 1S46A 2Q3RA 3PFMA 1QPRA 3AHVA 2NV2A 1EYWA 4JTQA 3EWDA 4CQ8A 3GX9A 1TE1A 3N9KA 1BGAA 4JZ5A 3C2RA 2BB0A 4J1OA 3FAWA 2WC4A 1WXJA 2J8FA 1PYMA 3LM3A 4XAPA 3BQ6A 3AWOA 1R3SA 1M01A 3QR3A 2YW4A 5D75A 4RLIA 4UFKA 4O18A 1W1IE 5AVHA 5I98A 1O1HA 3V35A 1V3HA 3OG3A 4QS6A 5A2AA 1XISA 2NQ5A 3UW6A 3WDQA 3P8JA 3L4YA 4B3KA 4LNCA 4ZA0A 3B9AA 3PA7A 2ZVRA 1QWGA 2ZZ1A 3E02A 4LALA 4FNPA 3EX3A 4L4MA 2WJZA 4WD0A 1YDVA 4KBXA 3EB4A 2ODOA 3MUZ1 1ADOA 3EDKA 1NWSA 2C1HA 3LXAA 5F1VA 1ITCA 1IZKA 4B3LA 3STGA 2X7WA 9CGTA 3AU2A 3M0JA 3WQPA 2YZRA 4J40A 2J9ZA 4O1BA 4YTUA 3VKDA 1PBKA 3ZO9A 4FS9A 3DHDA 2XGBA 4JTEA 4KGJA 2FB2A 3S83A 3BANA 4D6EA 4BA0A 4DXKA 3ARTA 2ZDRA 1G67A 1QAPA 1TR1A 1WDDA 3HPFA 5A6BD 1HJQA 4GVGA 3KABA 2OLAA 4M1RA 4WEVX 1YTKA 4IQCA 5AZ0A 2M1IA 3UXAA 2O9TA 2JZVA 3DZ1A 4JY8A 4KCUA 2EQDA 3QVQA 4M82A 2QT3A 3W2JA 3BZGA 1Q2RA 3AO0A 1XLMA 3SB0A 2IPFA 4U3AA 3O7UA 3TA6A 4E2BA 1FA2A 3VIPA 3LG3A 4Y9MA 4PYSA 2DZPA 4KQNA 4CEUC 5C2GA 5HR7A 1PKYA 4GFIA 5FSDC 1XIIA 1VP5A 3VK5A 3UZZA 1M53A 2E9BA 5GNYA 1P7TB 2JKPA 3MPGA 3OO2A 2AQOA 1FTXA 1VAHA 2C15A 2H9AA 4OOUA 1N8IA 3W02A 4JPGA 3WNPA 2XINA 1MZRA 1PL9A 4YJ5A 4HA3A 4GJ1A 4LJ3A 4IIDA 4GNKB 4OTKA 5BCAA 3PNZA 1P5BA 1NQ6A 3BLFA 4LYKA 5DEZA 3GAKA 1KCLA 4REQB 3MTWA 1S2AA 4U3CA 1L0PA 1E72M 3ARUA 1XLIA 4IGMA 4HMCA 1EDQA 2PD9A 3PZIA 1W3JA 2WPBA 1KFLA 3PTKA 2FPVA 3N9SA 3ALFA 4AEEA 3ENLA 1LT8A 4LVAA 3E0LA 2BGSA 1IR2A 1NH6A 1XIFA 2G3FA 1U1UA 2P0OA 3EX6A 4AHOA 1MEWA 1C9DA 1J4RA 1HW6A 1ZNNA 4S3DA 1X39A 2PBCA 4JQ2A 5ABEA 4NZ3A 4MWAC 4UQCA 3BLEA 1BEUA 6PTDA 4I9TA 5K9CA 1BLIA 5HA7A 1AUSL 3KCLA 4F0HA 3VMPA 3W81A 3CMGA 1W9DM 2F21A 2P8BA 3BAJA 5DN1A 3GHTA 1FBAA 3ZOAA 4NNBA 4A21A 1XRVA 1NFBA 3W7GA 1BQGA 2EG7A 3W6MA 1DWFM 3YPIA 4NNRA 3O5GA 2WVTA 4KRUA 2WXDM 1JFHA 1TQXA 4JD4A 3LBOA 4RNHA 2WMFA 2DG9A 3FA5A 3KP1A 3TLQA 2ISFA 2YDAA 3QZ6A 5DFAA 3K1DA 1E0WA 1XLKA 4WGXA 1PX3A 1A5CA 4R9OA 3O15A 2H6RA 4G7EB 5AHLA 3AHTA 1AW1A 1S5VA 3VM5A 1GJUA 1KKRA 1E1CB 4Q8MA 3WH5A 4HU4A 2W27A 4KEZA 4GQRA 1J6OA 3O6CA 2E5DA 4FAMA 1HP5A 1XDMA 3OP2A 1EO7A 3VIHA 1TPVA 1VS1A 3PVFA 4B91A 2VDGA 1K9EA 1F76A 1YW5A 1KFEA 5I23A 3WLIA 1XFCA 2C0HA 5C0QA 2DVUA 2CXEA 4QG9A 3PJTA 1FWWA 1P0KA 3N12A 4CEXC 3NIYA 5A6KA 3VDAA 1R3QA 1GRJA 1TTJA 2PRMA 1IV8A 1PWLA 1PBGA 4N4PA 4EANA 1XYMA 3TAOA 3HG2A 4R7OA 3LGDA 3W1TA 2YOCA 1EP1A 2TYSA 3M64A 1SUXA 3VFCA 3QBUA 3SECA 2F2KA 4IPPA 3EWXA 5JBDA 2GUUA 3MI2A 3RLUA 4PBEA 3B9OA 4JN8A 2EXOA 3SCUA 4H1ZA 1TA3A 4UFHA 4XISA 1R3TA 3CUFA 3R0DA 3OLDA 1KBLA 2PDQA 4U4MA 3KLLA 3VZYA 3UWEA 4M7SA 1BWVA 1W8GA 5KZMA 1B9BA 2XVNA 1B2YA 5FJTA 3KACA 5B80A 3CV1A 1HVXA 5KZDA 3GBEA 4LB3A 3WLSA 3MMWA 4J28A 3V0UA 2NUXA 2EJ1A 4NY2A 1Y0EA 1FCVA 1QPLA 1XLBA 4GY1A 4JYSA 1XYCA 4E2DA 2WVUA 2V6AA 3GNDA 1N2VA 2E8ZA 4UTKA 1MDLA 3HGSA 4JTJA 3W7HA 1LWJA 3FXYA 2WW5A 1H7RA 2BMBA 4DYJA 4HSHA 5GJPA 4GUGA 2Y24A 6A3HA 4A35A 5DT5A 3BCJA 4Z1YA 3EB3A 2HS6A 3W70A 1XQLA 4JTCA 4YYCA 3BAYA 5RUBA 3NRKA 3LM7A 4L4PA 1MQQA 3NSXA 2CKSA 4K1WA 4HU0A 4JNYA 1CB2A 3CPGA 4JKLA 4KF1A 3O5QA 3MWAA 5TD4A 1J4EA 1LOSA 4FIQA 1AZ2A 2J7BA 3UJSA 2DJLA 1C8QA 4CD4A 3TN3A 3OIHA 1LLZA 4GH1A 4GY0A 1ZZMA 1D7JA 4FX6M 1XRTA 4PCTA 1WQ5A 3DGRA 2GGGA 1VZWA 2ISSA 2ZRUA 4WKAA 4DRMA 5FKYA 1AK5A 1PCKA 2VX6A 1J6YA 2Y6ZA 3TK7A 1JCNA 4PMRA 4FB7A 4YVVA 1EIBA 3UESA 2G4FA 2ACUA 3UJRA 1B3VA 4TO8A 3M47A 3NSMA 1VBUA 3MUXA 4XSLA 1GEQA 1VFHA 4MFEA 4V33A 4IIEA 3CT7A 1OSEA 1A50A 2X05A 3WBAA 2UY4A 2BHUA 3S2MA 4HNTA 4WX2A 3VIMA 2PUZA 3S5ZA 5I79A 2OSYA 3EOSA 4B4HA 1D2KA 2GJRA 1W2PA 5D2XA 5EFDA 2Q09A 5G4WA 3VOIA 4DRHA 2FVMA 1WZLA 1AA1B 4S3EA 1PZ3A 1CGUA 4GX9A 1QATA 3DAQA 4NP7A 1OINA 4BK9A 4DJFA 3SGZA 4FR1A 5IHRA 1R3YA 4KWSA 4A8RA 1B3OA 2PDLA 2WKJA 1LBMA 4TV5A 2VYOA 2J79A 3TJXA 3BDKA 4BY3A 1K9DA 2Z7GA 4DZHA 2VOMA 3C0SA 2DT3A 3UZ5A 4E5TA 2ZUSA 3RDKA 5CGMA 5HKGA 5EB8A 4I8YA 4UTIA 5JBEA 2ZQTA 3E1F1 1R38A 1UH3A 4DM1A 1OIFA 3PTDA 3TR2A 4H6QA 5FOOA 2NSXA 1M7OA 3L0NA 3RJXA 1VJZA 1PJ9A 3OVPA 2YCKX 5LIYX 1XJBA 4IUOA 3CO4A 1XIGA 3R0UA 5I06A 4IQJA 3CZEA 4Q4PA 1XGZA 4CN6A 3I7QA 3W86A 3CM4A 3C6CA 2VQTA 3CV7A 4DY1A 4NF7A 3PUDA 4LAXA 1VPXA 1MDRA 2QAFA 4PRRA 4JTRA 1L6FA 4M1BA 2O9PA 4KWOA 4C90A 3STFA 4MDPA 5D2WA 3N2XA 4DELA 4IX2A 5HBFA 3AXKA 3N6QA 4YTRA 4NU7A 4RDZA 5JMUA 1VF8A 1OFPA 1UWQA 4M24A 2HXUA 3NUKA 1KRAC 4NZ1A 2IQ0A 3B4UA 1TUXA 3AISA 4XD6A 1VCFA 2F7FA 3N29A 3AQUA 2RDXA 1UPMB 2QNEA 4O0ZA 1RUSA 4M29A 5AKQA 3SCQA 4RXGA 2I56A 2G5WA 3PG9A 3WJZA 5J5RA 5DO8A 4W7VA 4M80A 1Q6OA 4TV6A 3GXIA 3V5CA 2ZX5A 1LQAA 2IUZA 1Q3NA 2ALRA 3NQ7A 2NSOA 1TTQA 3M44A 1AQMA 4R53A 5A6SA 3H2NA 2CESA 3L5AA 4XAKA 3NYDA 2R82A 3FSTA 1R46A 4DJEC 1R3VA 4AIUA 4M6UA 1S3HA 3RCMA 1RBAA 1XCFA 4ZCWA 5HMEA 3UF8A 1R9YA 4DBEA 4Q8VA 3RK8A 4F2UA 4IMFA 1RCXB 4E3TA 1HKJA 2HE8A 3CU2A 1TELA 2FYMA 1TTIA 2A85A 4B5XA 1CXIA 3VKJA 3NQ6A 2VJXA 4WKFA 1BL4A 1TVNA 5C9RA 3V7PA 3GHUA 2GSEA 2X42A 4NSBA 1B31A 3HBLA 4FSAA 5I6SA 1LM1A 2PDBA 4JQ3A 4DZ5A 2J27A 4MKSA 1W1B1 3DHFA 4ATLA 3TCZA 4IGSA 4MWAB 1K7EA 1WE5A 4QDPA 3UCQA 3WDRA 3VD5A 2YA0A 3V36A 1GQLA 5A6AA 4IPXA 2E9MA 4RE2A 1VPQA 2VZOA 4YS1A 2J13A 4KESA 3Q2DA 1GKPA 2BZNA 4N9EA 2QCMA 3T81A 1VBRA 1HF6A 2CERA 3GYCA 2DJXA 4PMYA 3WLQA 3L4UA 2VRQA 3E9AA 1A5AA 1F74A 3OQ8A 3C2YA 3UWUA 4CU8A 1W5OA 1RK5A 4GHRA 3AOFA 3GYEA 4B4FA 1K6AA 1S5TA 3DFOA 5FJIA 3WBEA 3VO0A 1NTHA 5HQMA 4Z0JA 4KKXA 1YLVA 3TQVA 3BOXA 2WLYA 1KM2A 4LY8A 5LXXA 1W1VA 5HWMA 3IUHA 2DFAA 2PDJA 4ACYA 3CEUA 5E0KA 3QFWA 3UYCA 1V79A 1V4YA 1VRXA 4DBDA 3RX3A 2QF8A 2F2DA 1P1MA 3RLVA 2XSBA 4J5NA 3K4WA 1SJAA 1HL8A 2Z1SA 4CNTA 1WBJA 2ZR6A 3PZMA 3UY7A 4H19A 2Z1BA 3BGAA 2PTWA 3QZAA 1K02A 3TA9A 1Q7QA 4AEFA 3SW6A 3TJ4A 3UNDA 4UUIA 4JTKA 5EMLA 3WUEA 4WR3A 4DZ3A 3O5PA 5MKGA 4LYQA 2PTDA 1ZBWA 4JTGA 4Q8WA 3K46A 1M68A 1X7IA 1W6TA 2INFA 1I2OA 1F8AB 2WJEA 1RZMA 5BOEA 3EA1A 1AW2A 3RPDA 3APTA 3BMVA 3UGVA 3JVAA 3JYMA 1Q2SA 2GJPA 1L9WA 2XFWA 1FWTA 1JPIA 3BGGA 4QDMA 2VELA 3CIXA 6ALDA 4D6FA 4CCCA 2OYLA 4PA8A 1W1ZA 3TYAA 1DHPA 5MF5A 4E4PA 4JFTA 3MQTA 3FDGA 4YTSA 4OOZA 1JNEA 1I8JA 1M7PA 4W89A 2QIIA 4L7ZA 4URIA 3CWOX 3JRKA 1OK6A 4BI5A 1ZS2A 2YXOA 4XD5A 2WHJA 4G1NA 2ABAA 5M1TA 4Z1AA 3QQ1A 1CGVA 1P5QA 4LRTA 4W7WA 1WP6A 1U79A 3P82A 4W9TA 4JTAA 4DBUA 5GPGA 1LBFA 3URAA 1FWEC 1C7TA 1WZKA 3W3OA 1F2JA 4F3HA 2CHRA 2ZCGA 3KRSA 4KR0B 1VEMA 3CS2A 4ROPA 7ODCA 3NR0A 3AS0A 3C0LA 2R1MA 1OJXA 4PMUA 3VGFA 4UNKA 4F0LA 3THQA 3QKZA 2YFNA 5G1TA 1HP4A 1XPGA 3C2EA 4AWUA 5C7VA 5AHMA 4MYAA 4S1FA 4LNYA 4RW3A 4QIUA 3I68A 1IT8A 3CLMA 4H4IA 1FJDA 5EBAA 1RP8A 1BG9A 2C13A 4F0SA 2ZQUA 3EKGA 2QGHA 3T2OA 4JIPA 2PV1A 3G1AA 1LL4A 4AZHA 5EKYA 4HMDA 3B9NA 1R2TA 1B4EA 5CGQA 3GTIA 1BXNA 4XX6A 3UQNA 4HK5A 1M1BA 3HIJA 3O5MA 4P8XA 4JTDA 3KWXA 2GQ8A 1E9ZB 2PWEA 1P7TA 3DGBA 5D9MA 1Q6CA 1B4KA 2G37A 2Q02A 2I16A 3DI1A 1RCOB 4MSSA 1XLHA 3W87A 4JFVA 4C6DA 3MANA 2PWUA 4LC8A 3W71A 2XP3A 4O10A 3FJNA 5A8QA 2QCGA 4LOCA 2CHNA 2HNHA 3KE0A 1JG9A 2W92A 2YA1A 1UKQA 4OQVA 2NT0A 3WQCA 4WHBA 4LF1A 1B57A 2V8ZA 5EYWA 1H09A 2FTWA 1OC7A 1RPXA 1WDWA 3NQDA 2VD9A 4HMNA 4LEFA 5F4XA 4ODPA 2I9UA 3GH5A 4QX4A 1E4IA 5REQB 1BWKA 4H7VA 4JGDA 4EPDC 3LXBA 3B8VA 4GK8A 4UMBA 4ONVA 1W9VA 3FAXA 2PDFA 4DAFA 4ZXLA 1EBGA 3G8RA 4GIVA 3VAWA 1GCYA 1XYFA 4K68A 1JI1A 4DRJA 1KFJA 3LNMA 3RO8A 2QHAA 4AIBA 4WKHA 4CN1A 3L4XA 4IGHA 1NFPA 4W8AA 3LYEA 3HMCA 3LOTA 4CGTA 5KSWA 4ADUA 1TO3A 1OYBA 4LEQA 1EWDA 5FEWA 3QGKC 4WCJA 1GOIA 2QCFA 1DJZA 4XTIA 1GYMA 1YNQA 3OVGA 2OU4A 3LTSA 2E68A 4NI8A 4N02A 3ZVHA 3CNYA 3I7SA 2C1IA 4K8EA 2BHYA 3FJ4A 3ZLHA 1YNYA 4U85A 1XUUA 3OBKA 2HMCA 2W5FA 2ABBA 5FL0A 1X1ZA 2I1OA 4UR7A 3W38A 1BF6A 1DJNA 2XM2A 4RPPA 1TPDA 1JCMP 1T8XA 2G95A 1OF8A 3NPUA 2HNEA 2DG3A 3T08A 4PCFA 5AHEA 5DXYA 3KW3A 1IWPA 4HCDA 1KRBC 1GPWA 2WVVA 4B15A 3WH7A 5EGRA 1PIFA 5J6EA 3GG0A 2TSYA 1UZHA 2Q6ZA 2O7SA 3WEZA 4J9JA 2GK1B 3SFKA 2J78A 3O07A 3UZJA 5DMMA 1V0KA 1Y5WA 4ICCX 5T26A 3AC0A 3QW4B 3GZAA 4KEVA 4XZWA 1I6NA 4WJ8A 3W37A 1E6QM 4JNMA 5CLTA 5I07A 1VYPX 2FB3A 1XR2A 2ZUVA 4K2SA 3U4FA 5C70A 4XVDA 3KX6A 1XRSA 3URNA 3MO4A 3GLCA 3UGRA 3R0KA 4E38A 1CB7B 2GDQA 2PDKA 4JICA 4GLEA 4U31A 3LRLA 3VOCA 4HOZA 3R4IA 4L72B 2TMDA 4B5UA 1TV5A 5EU9A 2WC7A 3BMBA 1S5NA 3TSDA 3KRZA 4EAYA 1K8CA 1D7KA 4FHAA 4A8IA 4GUJA 3R8RA 3CPUA 1ELSA 3MZNA 3RIKA 2PF0A 3PTMA 1P6BA 4KETA 3R2GA 2J6VA 3HPSA 4AWTA 1GPFA 4GQGA 1CIUA 4H9ZA 1G9HA 2XZ7A 1W3NA 1EDGA 3EOUA 4Y8FA 1VIZA 1TCMA 2HROA 4FEZA 1XSJA 3KS5A 3B0UX 1YBQB 4K1GA 4ORMA 3ITXA 4IQLA 1J2BA 3T8QA 3EZ4A 5HWNA 3LHYA 1KCKA 1FP9A 4UMCA 4GJIA 2O7QA 3BJSA 1MQRA 4Y9AA 3UFYA 1UWSA 1E6XM 5F2MA 2DEPA 5GNZA 3BGJA 4CQ9A 2V67A 1GQNA 2VQUA 4CQDA 1WXYA 1W3LA 1R9HA 1UUMA 2F4EA 3AUOA 4C5ZA 2J66A 4DBSA 2OKTA 1A4MA 3EXTA 4ZQOA 1NP0A 3CWNA 3W1XA 3PZQA 3O2LA 3M7SA 3FGCA 3NTPA 2GVGA 3W1NA 3TEVA 3EIPA 1NOUA 2NX3A 3EMQA 4ML9A 2W63A 1Q8AA 1R85A 3AHYA 3A3WA 3BOLA 3MHUA 2KZHA 1UP2A 3SRDA 1I2RA 2BDQA 1ME7A 4M0XA 4PBGA 2XVLA 3EWYA 4QEHA 5D37A 1D9EA 2C0AA 1DQWA 3LGEA 4G50A 1TJPA 1JZ4A 5D02A 4UQAA 4CQCA 4O1CA 1YTDA 1D7IA 3CLWA 1Q4WA 1J6PA 2QLYA 1XKJA 1XICA 1YXCA 2Q8ZA 3ARYA 2DH3A 1NARA 2A3HA 3U4AA 3RMJA 4W85A 2Y7DA 2YX0A 2YBUA 1TYGA 2PDGA 3RM8A 3PB2A 1Z7AA 3UCDA 2EG6A 2J88A 1EP3A 4MB4A 1XC6A 3GVQA 1WUEA 3RU6A 3CMJA 1W5PA 3LD5A 8TIMA 1NDWA 3M0IA 4KGLA 1K3UA 5LSMA 1XYAA 2QV5A 1EPXA 4ZODA 2A1YA 4YCPA 4HKPA 4AFYA 3P3BA 1XWYA 2P1FA 1A47A 4BEQA 4L56A 1XC4A 1EA9C 4Z17A 3E3HA 1KRCC 2Q8LA 4OUIA 2DSWA 1ZL1A 4PSPA 4W88A 4AZ5A 1IWBA 3KS6A 1J0JA 4I8DA 2NV1A 1WA3A 3E5BA 2DVTA 4RNJA 3H2CA 4YN5A 5HATA 1I1WA 2F8QA 1GVSA 5EY5A 3VYLA 1B5TA 4UR9A 2FGBA 2RHGA 3IEBA 4HN8A 4W86A 2PP0A 3GXFA 1YHTA 1RJPA 2WCSA 2XVGA 2O92A 5E1QA 4DT4A 3RR1A 3UJ2A 4BWLC 2MLXA 3VI2A 3O5EA 4E8CA 2V9DA 2CLIA 3AIRA 4DNMA 4Z1CA 2ESCA 2EF9A 3ZJKA 3OBAA 1KA9F 3SEPA 4XAFA 2XSXA 2ASHA 3M5XA 3AMCA 6XIMA 2WZTA 2ZUUA 2F6UA 4E8GA 4M6PA 3A4WA 1JQVA 3H4GA 2QUUA 1RLDA 1OABA 1RY0A 4Z1DA 3W00A 1DXFA 4N9CA 4Q8TA 1GOQA 2BNJA 1M6JA 3WDPP 1MSSA 4FXRA 1V6XA 3ZT7A 3HGOA 5BRPA 1R9XA 3HPAA 3CAKA 5IDZA 3ZZ1A 2WSKA 4MVAA 2Z1WA 1TVPA 4LS2A 3TC6A 3GO2A 1RA0A 1EYMA 4I5UA 5A8OA 5AB3A 3H21A 5FI8A 3EWUA 2IPJA 2E0PA 2J7DA 4O14A 2WMKA 1EP2A 3WG6A 4PB3A 2YPIA 2ZX9A 2XP8A 3L0KA 3RXZA 3OA5A 4UC5A 2INEA 6REQB 4JFLA 1VFLA 2PLKA 2VFIA 4GYKA 3V0SA 2YL9A 3A23A 1QNQA 4LYRA 1I0BA 4R88A 8XIMA 3TAKA 1GZJA 2E5CA 3F7JA 4I9MA 2ZWZA 1HJWA 4HARA 4IQ2A 5CKSA 3M43A 5HULA 3LCWA 5C9XA 3NL6A 1D8CA 4LGXA 2VXNA 1FDYA 4Q7BA 3T0CA 2HQAA 1UW9A 1Z69A 4HVXA 2JF6A 1S38A 1QNOA 1UKSA 3O8AA 1L6GA 3VD7A 4E4FA 4L1GA 1QI3A 1SZEA 3GWQA 4H8NA 4RE3A 3H26A 1TTPA 2G50A 1FKJA 4DUOA 4W9OA 4ZSTA 3W84A 1V08A 2YCIX 2AQWA 2Y62A 3S9ZA 1MWOA 2D69A 3AI0A 4PEEA 2JFEX 3JZEA 4C65A 1PB0A 4UFMA 3KAOA 4GBDA 3ITVA 5I24A 2BLEA 3SADA 1DJXA 5AHFA 4J27A 3WMLA 5I03A 1RQEA 5HJYA 2EHHA 1XG4A 2FHCA 1L6WA 2LLEA 3EEGA 2D3LA 5HNRA 3H6OA 3T6CA 3W75A 2WHMA 4Q32A 4AX6A 1W9BM 1FWDC 1DWHM 3L68A 3LCIA 2YL5A 1GOMA 3P74A 4JX5A 1O1ZA 4LUTA 3C0QA 2PPOA 4B92A 4GQQA 1UD8A 2Z28A 2WM0A 4MNJA 4JFUA 3DKJA 1EXBA 1Q6HA 2ATSA 5F2IA 1RLCL 1TX2A 1KB3A 1W1A1 3BPWA 5DY2A 1PKLA 5AVNA 1FCQA 1X6UA 2RUSA 4JTHA 1KLZA 3RG6A 3EX2A 3O3RA 3QLDA 3BQ5A 3D0CA 2BY1A 4ZO8A 5D38A 1U5VA 3CV6A 3NO1A 3O5DA 5K3VA 1UQYA 5A6MA 3E12A 1S1PA 3S1VA 2GLKA 1V93A 2ZQ0A 1E40A 4DLMA 3WD3A 2YDRA 1HKKA 1W2VA 4QTGA 3MS8A 4QT3A 1Z42A 2TPSA 4I5XA 3WBYA 2Z0IA 5HJLA 1MXGA 4ZENA 4W8BA 4WXYA 1FUYA 1O4UA 4R27A 4RR4A 5IOBA 3WFZA 1TX0A 3WFLA 3O5JA 2CZVA 2VFFA 1TJ1A 3GS6A 2VVSA 2G4JA 4GNVA 2RURA 3WK0A 5CPNA 1PZ0A 2MPHA 1H0GA 1QBAA 1E0TA 2EEXA 1D3HA 4UZSA 4FA3A 2YLLA 3W23A 3BC9A 4B5VA 3SM0A 3AJXA 1HT6A 3OYXA 3TYDA 5CBBA 1UWAA 1P0DA 3BJTA 2D22A 2ALDA 5LNSA 4ZZ9A 3S47A 4RJEA 1RY8A 1IZCA 3S9YA 4IMCA 2G41A 4IFRA 1FKHA 3DYOA 3UCCA 1MW3A 1GNXA 4XSMA 1EGMA 1K8YA 2CETA 4H7ZA 1VFTA 2VFDA 1QPOA 4MWAD 3MY9A 4IICA 5I00A 3NPVA 2BGNE 3G5EA 1KQZA 4O4VA 2A3EA 3OB8A 1D3CA 5BU6A 1V0LA 3VGDA 1PWMA 3CUGA 4MKVA 5LKYA 2G3JA 4R33A 4XAGA 4YTQA 1UD2A 1UG6A 2D0GA 3CUZA 4NL1A 2Y7FA 1HKWA 1E0XA 3GSMA 2FPYA 3S5YA 4F40A 2EULA 1F40A 1UASA 1JPMA 4Z42C 2GYIA 3QGAC 3W7QA 1TKKA 4OIFA 3GXMA 4MSPA 4RK8A 2MNTA 4B5TA 3R8GA 1QHOA 3D47A 4BHYA 2GJNA 3NURA 1OFQA 4GIYA 1B3WA 1PPIA 2FDSA 3DFSA 4O11A 3HJZA 3M5YA 5A1AA 2Z1XA 2AGTA 1N1AA 2JALA 5FESA 3EKLA 1A5KC 4S3FA 2YDSA 4GINA 4Z08A 1NDZA 1UPPA 2OZTA 4FX7A 2CPUA 3QGVA 2ZDSA 4WXZA 1ZCNA 3AFBA 1XBVA 4TNSA 3F5JA 1JFXA 1T40A 2EPKX 2NVDA 1FDZA 3IIZA 3W72A 1W31A 4R34A 4K6AA 1UH2A 2HK1A 1GUVA 5KZ6A 2VR5A 2Z2AA 3NYZA 1DJHA 3KP0A 3PJWA 2PV2A 1XGDA 1EXPA 1TWZA 4HYVA 3D3FA 1JZ5A 1R2SA 3A22A 3KCEA 4S3JA 2BODX 2RUDA 3GDMA 1H61A 3AZRA 4O4WA 2VURA 3QFEA 4JQ1A 1E5JA 2W3ZA 5AYBA 4C6BA 2NXIA 2C19A 4WQ6A 2VO5A 1JYVA 3MKKA 3ZLFA 5HDRA 2BOGX 3QQWA 4HU3A 4NAFA 4C5YA 3KTCA 4DWSA 5BXJA 3BOFA 5BXSA 5I7GA 4WY0F 4NKCA 1KM0A 3KCJA 1YYAA 1I2QA 1E6NA 4GI4A 4D71A 5TAOA 5GJNA 1H60A 1XIBA 3G1DA 3DKLA 3O5KA 1VFUA 1EEPA 5AFDA 1H7PA 5D2YA 1PIGA 1BPLB 3WYZA 2QUTA 3VGHA 1SW0A 1EJWC 2HV5A 5LA2A 4GIAA 4U10A 3MMDA 1OFOA 1ZJBA 1ODUA 3MZ2A 1VYSX 3BSHA 3ISIX 4ZOEA 3ICJA 2OELA 1KBBA 1GYLA 3DFNA 3OPSA 3GHRA 1KXTA 1QPKA 4H6RA 2PTXA 4J3ZA 2GFTA 1TR9A 2PODA 2WAGA 3LUTA 4GABA 4L4LA 1UP0A 3RX4A 5AOUA 2OLSA 1BYBA 3UZYA 2IKJA 1G1YA 2CW6A 2BGQA 3AUJA 1U2YA 3P81A 1ONXA 2ZX7A 3FDKA 3R8HA 4IJCA 2X16A 4C6EA 4WY0B 2X1SA 5LA0A 3U57A 1WKDA 1QT1A 3NGJA 4GG9A 1E71M 1EDTA 1Q65A 1E4LA 3JU2A 4BR1A 1GQJA 1GT8A 1TMHA 1M9HA 2PTZA 5HXMA 4HTBA 4JEJA 1QCWA 4JHOA 5E0FA 4PUUA 1AMKA 3WX7A 2XP4A 1LLWA 3A4AA 3BO9A 2FMOA 3N25A 1E3ZA 2UY3A 1SZNA 1C7SA 1XGEA 4YHEA 3REQA 3UXLA 3EX1A 1NOWA 2OPJA 2GZXA 2GK1A 4GXWA 3C2FA 1M7JA 2DZBA 3M9YA 4O13A 2QJIA 4GMEA 4H9VA 3W2UA 3FX4A 1D7HA 2CLHA 3H7UA 2R1LA 2PPNA 3MI3A 4TQTA 4DJFC 4AZ6A 5ABHA 4UTWA 4JY9A 1KM1A 3LI1A 3VCNA 1P0NA 4YIWA 1A4LA 4DRNA 3XINA 1V6TA 3HGJA 4LRSA 4B2DD 4MTVA 1XKYA 2WC3A 3K5XA 3C56A 2P4VA 1MI3A 1TVLA 4S3CA 2FMNA 1P6CA 2Y89A 1PEZA 3OOBA 4CD6A 3GTYX 2B7OA 1EC9A 4JTLA 3WNMA 2FAPA 4MZ8A 4GUIA 2OYMA 1E55A 1IWAA 4JFJA 4LCRA 4DO6A 4ODLA 1XINA 4MJ2A 1Y65A 5C7HA 2AQVA 2DIKA 3B03A 2Z6JA 1GJPA 1QOPA 2H8XA 3AS2A 3WDJA 1Z6KA 2VMFA 4DI8A 4LS0A 2ACSA 1JCYA 1QPQA 1AMYA 1TMLA 1DXIA 5CEWA 1SMAA 3WQGA 1XD0A 1Q7ZA 2YZ5A 1H7NA 3VMNA 4GYPC 3U48A 2WBGA 3ARSA 5DLCA 1WZMA 1ISZA 1WAWA 1O94A 3M5VA 4H9XA 1S5WA 3SUSA 5MHBA 1TPB1 1EQCA 1WDRA 2YXGA 1TCOC 2ISDA 3GG8A 1P0EA 2DQXA 2HBVA 2XIMA 1QMLA 1FWAC 3IGHX 4C6OA 4C6JA 4P7NA 3NDZA 4NJIA 3LCGA 3RPTA 4BF7A 3MV11 1TPC1 2H9AB 3HJEA 3E0IA 5LHEA 1HN1A 3PUEA 4ADTA 1ADSA 2VCDA 3FS2A 4AZCA 2XGZA 5DELA 3PPHA 1RBLA 1H7WA 3G0XA 5M17A 1K8ZA 4LC6A 1EJXC 2HISA 1XCXA 5HT1A 3S6TA 3LRKA 1J11A 4GNJA 1JIBA 2YLAA 2OSXA 3BLIA 4JTSA 3M0HA 3PB0A 2DZXA 1Q6EA 2OFJA 2ACQA 3U2CA 3M0ZA 3PUGA 3IV8A 2J74A 3LCHA 1LRTA 3L23A 5AYYA 1QNSA 2GJXA 4TXEA 4IPNB 2G3MA 1B3YA 4XVEA 1W9XA 2JF7A 4E8DA 4UOJA 3Q37A 1JJKA 5DX7A 3EWWA 3OGSA 5FF0A 4ZB5A 3TTYA 1P4CA 4ADSA 4GQBA 4L1XA 5HPCA 4ZO7A 4O53A 4QLLA 1H62A 3SN1A 3G1YA 4FOKA 1WPCA 1M04A 3V4BA 1O5RA 4DJED 2WOQA 3W1QA 2ZBTA 1Z9AA 3UNTA 4O52A 4F0MA 3RM4A 1Q45A 3K4DA 1XYLA 5DIUA 4B9YA 3LTYA 2B31A 4HU8A 2J4GA 4RX0A 3GUWA 1EJ7L 3PR2A 1AQFA 1JGMA 1E5NA 4U2ZA 4JEQA 3OA3A 1HKVA 4ODRA 1Q6FA 4GY7A 4B5NA 4EPKA 2QCNA 1Y7VA 4LAUA 2E3ZA 3VD3A 4IMDA 3HM7A 1OG0A 1A7XA 1OD0A 3DU0A 3LN3A 3P60A 1NDYA 2ZXQA 2NX1A 4WIWA 1TWSA 3TSBA 1IGSA 3E0VA 2DZAA 1NU5A 1QUMA 1HG3A 2EKCA 3WIJA 4DNHA 5KEZA 5DMYA 1VPYA 1V7AA 4AXKA 2A6LA 4HA4A 3WEMA 3L67A 3DFPA 3T9PA 2POZA 2R1PA 1G94A 1RXOB 1BGGA 3H8AA 4UNIA 1QNRA 4O17A 2QJMA 1CEOA 2ZRZA 1P6WA 1WCGA 4F0KA 1PE1A 4LXFA 4AEOA 3O6DA 2CLFA 1P48A 2CWXA 3NWRA 3D3AA 3W27A 3TTSA 1OWQA 1WKFA 5XIAA 4HHPA 4Z1BA 4EXBA 3VX0A 4QNWA 1W5MA 4DJDA 3NXLA 2CLLA 3G6LA 3LX9A 4N9BA 3KBJA 2WNNA 2PMQA 1AJ2A 3JW7A 2W4XA 4O54A 1MRAA 1DIDA 2HEJA 1O12A 2CBJA 3GH4A 3KOXA 4ROQA 3QYSA 1OCBA 3H2AA 3QQ0A 4GGHA 4CQBA 3WL1A 1DIEA 2NLYA 4RCXA 2A7RA 2BOFX 4HYWA 4P7RA 3FXGA 4P61A 3E38A 3IGSA 3PAJA 1DWGM 3TVAA 1LQ0A 2CITA 2PP3A 1PZ2A 2XN0A 3MHGA 4QJ3B 1CT5A 1IX5A 3VAVA 1T6MA 3WQ4A 3WUBA 3VABA 4CD7A 1XV8A 5B8IC 2I17A 1OX6A 2FZNA 4FF5A 1JNDA 3L4ZA 4ACZA 3LHWA 4MIMA 4IWWA 5BROA 3ITGA 2W67A 4R7WA 4ITZA 2VGBA 4ZQNA 4MOZA 1ONEA 3APYA 3CIWA 1GVQA 5I02A 5JQ9A 4QHRA 4JQ4A 1OQFA 3BLLA 5I2UA 1ZY9A 1V0MA 2YKKA 4NYYA 4MJZA 1WO2A 1KWGA 4Q7IA 3WQ6A 3TYCA 5DF0A 3C3UA 1YDNA 3WLOA 4PTWA 4IT6A 3ARPA 1FH7A 2P50A 1PX4A 5DMNA 1A3WA 1YMYA 2VFEA 4LCQA 3CBWA 1OY0A 1H3GA 5HTGA 1Y8BA 3GIYA 4MUZA 3QPZA 3PSVA 1GVIA 2ZA2A 3QM3A 3WLMA 1L8PA 5CXPA 3GPKA 1ITUA 1VR6A 2NQZA 2D2GA 3V3WA 1OX5A 2AKZA 1JD7A 4S38A 1CBGA 4KH2A 5A2CA 3E74A 3CQKA 1KFWA 4NAEA 1NIUA 5E0CA 2KX9A 5A6JA 3Q65A 2GPTA 1K9TA 1WDQA 3SUUA 3ODKA 4IOTA 3ZS4A 4OU1A