3RM8A

Amcase in complex with compound 2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
total genus 133
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm8A01
4UOZA 5IFTA 1UKQA 1P6WA 4BF7A 3PZIA 1EXPA 1V08A 3CPUA 3ZJ6A 5M17A 4C7DA 3WQ4A 3VOCA 2C8NA 1V3IA 5D4YA 3VGGA 1UD6A 2JE8A 2Y24A 3T2OA 4BQ4A 1AQHA 4U31A 3VIIA 1C92A 1J10A 5JIWA 4PMXA 2XM1A 3UETA 4GZJA 1MQPA 4AIOA 2GJPA 3VNZA 1H2JA 1VF8A 1W3HA 1FHLA 5AC5A 3AYRA 2VQUA 3PZMA 2JALA 3W53A 1E3XA 3WFZA 1BPLB 3N04A 4PTVA 1JDDA 2V3GA 3GBDA 1C90A 2GDVA 4W85A 1EO7A 4WKAA 1MW1A 3WNNA 3AS2A 4Z2JA 2Q8XA 4AD3A 5BROA 2J7CA 4UR9A 4MJ2A 2WCSA 3VILA 4JFVA 4BQ5A 3POCA 1IT0A 3SCVA 5HNNA 4D6JA 2J7DA 1V02A 4UOJA 3PZVA 1EQPA 3MMWA 3FNDA 1N82A 2VUYA 3CO4A 3MMUA 5ABGA 3T0BA 4B9ZA 5LYRA 1OT1A 2EBNA 2JF7A 1H0GA 1ECEA 3VIPA 2G41A 1E40A 1E5JA 5JBFA 3M07A 3AICA 3VDBA 1E1FA 1BLIA 5LA0A 1XH1A 4XX6A 4R27A 1W9UA 2WVUA 2X0HA 2CIPA 3GDBA 4HMCA 4D6GA 1KXHA 3ZQ9A 3RILA 4TX8A 3FXYA 3TTSA 5JUVA 2YL5A 1HJUA 4L4PA 3S2CA 3VM5A 2PC8A 1UD5A 4CKQA 1QW8A 1XYZA 2G4FA 3MMDA 3ARVA 4AW7A 4AD2A 4QAWA 3FHQA 5CGMA 5ABFB 4DUXA 4W8BA 3KZSA 1M01A 2QF8A 5CJ5A 1RD6A 1GPFA 1W32A 4PSRA 2QV4A 4ML4A 3AIRA 2VR5A 1UQYA 5I3DA 1VRXA 5A2CA 1V6XA 3K8KA 1KQZA 2WMIB 3FAXA 3EMQA 3B9AA 5I6SA 4B9YA 5I78A 1SR0A 3WELA 2WWCA 3AMKA 2CKRA 2NT0A 3W6MA 1CYGA 4M82A 2XWDA 3AXHA 3T08A 1O7AA 4PMVA 1JAKA 2VNCA 3SCWA 4MPKA 4AIUA 3GH5A 5C8BB 3BMVA 2CBJA 4GZEA 1W2PA 1E73M 3ARXA 1R7AA 4P8UA 4J3UA 5CXPA 3VGDA 1E4NA 5JH8A 2BVDA 2WLZA 2E9BA 3G6LA 1LG2A 4QFUA 1VFMA 4PMYA 1Q6DA 2PBGA 4M1RA 4PCSA 5KEZA 3RJYA 2WHMA 1XSIA 1I1XA 1NQ6A 1KCKA 2DGAA 3T2QA 2YOCA 1UYQA 1MW3A 2ZE0A 3CZGA 1H5VA 1KR0A 5DT7A 2CERA 4W8AA 1XSKA 2ZXDA 1FH7A 4PMOA 3VIOA 1W3JA 3N18A 5EBAA 1BYCA 4WK9A 1FH9A 1UR0A 3AXIA 3WDJA 1VJSA 1LQ0A 2ZUVA 1JXJA 2X0YA 3NYDA 3AIVA 3WDHA 3ZJ7A 6CGTA 2WBKA 2WPGA 3UG3A 4AZCA 3CUIA 2ZX6A 1EHAA 5EFFA 2CITA 4HA3A 5CG0A 2ZIDA 2DH2A 1VBUA 2NSXA 4PBGA 2OLHA 1GHSA 4LYQA 2X2YA 2MANA 2Y8KA 1VBRA 4HOXA 4PMNA 1ODUA 1JAEA 4OOUA 5CPQA 3BAJA 1G01A 1EQCA 3WSUA 1HX0A 4V2XA 3L4TA 4NI3A 1OGBA 2EJ1A 4HPGA 3WBAA 2X05A 3AIUA 1CXHA 4NRSA 4QLJA 1V0KA 2CBVA 1GQIA 4AY1A 4JFSA 1EOMA 5C70A 3DHUA 1GJUA 3OGSA 1B2YA 2E8ZA 4LXFA 1E72M 4CVWA 4RL3A 1J0HA 3A4AA 4PUDA 1UWQA 4W5UA 5HPCA 3AHVA 4HOWA 4PTMA 2XJ7A 4M80A 2YLLA 2GUYA 1FH8A 2J8FA 3VDHA 4MJ4A 5FD0A 1CXLA 3APGA 2O9OA 2GFTA 1VFFA 2D24A 1SMDA 4JL1A 1KXTA 4GQRA 1YQ2A 3AMLA 1BF2A 1BVZA 4HU0A 2ZUWA 2WK2A 2BS9A 4OKDA 3D5HA 1ITCA 1CIUA 4E2OA 2CHOA 3GXMA 3W29A 2WSKA 3DYOA 1XH2A 3PTMA 4YHEA 2YDQA 3IAPA 1QI4A 4N0RA 1XSJA 3F4VA 2BHYA 2VR4A 4WKHA 1NH6A 4X9YA 4W89A 3RO8A 1GVYA 2J25A 2CYGA 4J3SA 4BQ2A 1AQMA 1SMAA 4GQQA 3SCTA 2WCAA 3AROA 1QHOA 3OLGA 2VRJA 5AC4A 1B3ZA 4F9DA 2E40A 3AIWA 3PZTA 1JZ8A 1WZKA 1CGYA 1NWSA 3CHDA 1E9LA 4DWSC 1UR4A 2XG9A 1MQRA 3U5UA 4RE2A 1E3ZA 4AZBA 3PZQA 2EPNA 1DWGM 1UWUA 1W2VA 3GTNA 2XIIA 3ZT6A 1JXKA 4OBRA 4JFWA 3WEMA 1BG9A 3WUBA 1W3KA 4XUYA 4FMVA 1B31A 4HOZA 1PIFA 7CGTA 3I3EA 3RM4A 1K9TA 3W24A 1H09A 3PZGA 3ZOAA 4UTFA 5BYWA 2UY5A 5LA1A 1VFOA 4F8XA 1J01A 3ARSA 3EDJA 3OLDA 5IDIA 3ARQA 4WF7A 1X6LA 2WHKA 1JYNA 1W1YA 3GH7A 1UH3A 4KGJA 3SUTA 1PBGA 1JNDA 1HP5A 4W7UA 1W9DM 3UCQA 3RJXA 2D3NA 1KWKA 1WZLA 1NWUA 5CLTA 1TZ7A 5A3HA 4AZGA 4W86A 1XC6A 1PX4A 2D0HA 1UH2A 4JHZA 5ECUA 1WNOA 1KWGA 3ARWA 1MFUA 3M7SA 5A8MA 5IFPA 5HOSA 5HBFA 3GBEA 4BS0A 1UR1A 1GNXA 2D23A 3T09A 1GQLA 4AD5A 4W7VA 3WDPP 1Z32X 5I2UA 2XVKA 1W1VA 1HKIA 3PBGA 3DYMA 1TVPA 3WFLA 1JNEA 4UZUA 2VX5A 3AYSA 7TAAA 2J74A 3WQWA 4ZXLA 3F5JA 1SFSA 1MFVA 2OYMA 1JF6A 1K9DA 2D0GA 4W93A 3VMOA 4OIFA 4AZ5A 3ZT5A 4CN6A 3BH4A 2ZX8A 2V5DA 3W6LA 4AIEA 1XCWA 1E6SM 2J7EA 3PZUA 4PMDA 2JEPA 5ABEA 3B9DA 3N1AA 1HXJA 3AS3A 3GXDA 3PHAA 1BGAA 3UR8A 2WMGA 5A2BA 3VD4A 3RIKA 3I3DA 3WDQA 1GCYA 3E1F1 3BCFA 1XD1A 1DP0A 2BY0A 2J8GA 1GQKA 4GKLA 3QGVA 1GW1A 1WPCA 4C7FA 2CBIA 2J79A 5CQ1A 3SCPA 4WJXA 2BVTA 3EMZA 1E0XA 2CESA 3WH6A 3M6DA 1SYTA 1J0ZA 1J0YA 4GIAA 3BSHA 1ZJAA 2DT0A 4U5KA 6TAAA 1CBGA 1E6RA 5IXEA 3AHXA 3NSNA 1J11A 3SCNA 4CN4A 2EPMX 2BHUA 3KL5A 1FFRA 2YKKA 3SIMA 2NT1A 2IUZA 3BLKA 4B16A 1E5NA 1QI3A 1TA3A 4PN2A 3ZR6A 4CCEA 1KGWA 1FP9A 3U7BA 3MSDA 4P7OA 5BXSA 1E43A 2QMKA 2F61A 3MANA 1JF5A 1UD4A 4AD4A 1ZJBA 2W67A 1E4IA 3AZRA 4YHGA 1OD0A 4KWUA 3AZSA 3LPOA 3AHYA 3GH4A 3N11A 3CTTA 3N12A 1NOFA 1K6AA 5A6BD 1E4LA 4HU8A 3O2LA 2V3DA 3KE0A 4JL2A 3WNPA 3VMNA 1BFNA 4U5IA 4CN1A 2J7FA 1L0PA 3RMEA 3WL1A 3MSGA 5GNZA 4QLLA 4E8DA 2O9TA 2W63A 1HJXA 2WZHA 2YDRA 1KQYA 3AIEA 4B15A 4ZE4A 3MV01 5A6KA 1HJQA 3RDKA 1BYAA 3UG5A 5HXMA 2EEXA 4PYSA 2ZICA 1EH9A 3UESA 1Q6EA 2GK1B 3AISA 2J47A 3SUVA 3UERA 1KXVA 4XB3A 2A3HA 2W66A 1G9HA 3GXIA 2VZUA 3VIJA 3G6MA 1HN1A 4MAZA 5E0FA 8A3HA 1JZ3A 1CXIA 3WF4A 4C7GA 1IV8A 2E8YA 1V3KA 3T0DA 2BY3A 3GNRA 4DWSA 3RCNA 5FL0A 3NDYA 2ZX9A 2JEQA 3CZKA 3AZTA 3L4UA 3POHA 1JYVA 5A8PA 1HKMA 5A6AA 2Y5EA 4PMRA 3ECQA 3ZR5A 1R86A 3IJ9A 4AWEA 2QPSA 4OZOA 4PTWA 4AYSA 1AVAA 4UNIA 4M56A 2BY1A 3WEOA 4IPNB 1NWTA 3CZLA 5A6SA 2O9PA 5E70A 1TA3B 2EPKX 4HPHA 4JCMA 1US3A 1B3YA 4V28A 3RM8A 2RGLA 1JZ7A 2W92A 4W88A 5E6ZA 1HKJA 1ISYA 2WNWA 2V38A 4K68A 2WHJA 4P7RA 1NP2A 3UEQA 2E0PA 3OG2A 5CGTA 1VEMA 4MB3A 3OIHA 3WNLA 2WBGA 1CWYA 4MB4A 1DTUA 4HZ6A 2D22A 2VCAA 4PEEA 2E3ZA 1QOXA 3CUHA 3CIVA 1VAHA 3DHPA 1XHGA 4AD0A 1KGUA 1H11A 2AOSA 2X1IA 2CEQA 3AJ7A 1UHVA 1DWIM 4AEEA 2XFRA 3ZSSA 2V5CA 4GPNA 3L4WA 4ATDA 4GXPA 5CZKA 1WB0A 1UQZA 2WAGA 1HJVA 3IAQA 1ISVA 2A3BA 1JIBA 2XPKA 1EDGA 1RPKA 3GZAA 4UFJA 3BAIA 3TOPA 2EPOA 2Y2WA 1J0JA 4CUCA 3WD1A 1W3LA 2YA1A 2WC7A 3J7HA 5IHSA 4H8HA 1WDSA 2J7BA 3BLPX 3WDIA 2FH8A 4NRRA 5A6LA 3ALGA 4U2ZA 1ZBKA 3VIFA 1R8LA 2FDMA 4BZYA 1B3XA 1TE1A 3VPLA 2B31A 2DSWA 4TX6A 3VX0A 2VZVA 2YBTA 3GM8A 1M7XA 5A8QA 2ZXAA 4P8XA 2AAAA 3LPPA 2YA2A 2QHAA 4PMUA 1QBBA 3TTOA 2V3FA 3PZNA 3EBVA 3QR3A 1FHDA 2OYKA 1HKKA 4EANA 1JZ2A 1QNSA 4B3KA 2BNJA 4D6DA 1G5AA 3ZMRA 3ZIZA 2X09A 1BQCA 1IZJA 3CZJA 2GJXB 2WM0A 4JZ5A 5GPRA 1MXGA 4EK7A 1NWRA 2WB5A 3WQVA 4P8VA 1R85A 1V6UA 1JD9A 4D6CA 4JKKA 3VIMA 3W0KA 3WENA 1QPKA 3WKZA 4FK9A 2XYLA 4N42A 3NJ3A 4Y7EA 3VO0A 4HMDA 1UUQA 1JZ6A 4QDMA 2PI6A 1CXKA 1ZL1A 4WSKA 2JF6A 4KMQA 2PWGA 4URIA 2VZSA 1F4HA 1KGXA 5D8ZA 3SCSA 2BFGA 3VIHA 1V6WA 4GI6A 5A2AA 2ZX7A 1C8QA 4W84A 2WZEA 1TFVA 1JFXA 2D2OA 3WNOA 5M3WA 1U2YA 4WSJA 4LGXA 3BXWA 1D2KA 4J7RA 4CGTA 2A3EA 1OD8A 3KEHA 5CPSA 2DSKA 1LJYA 5A6JA 2BVYA 3EDFA 2YL9A 4ZE5A 4R5EA 3SUWA 4D6EA 5FL1A 4TTUA 2DDXA 4DUWA 3WEZA 4M29A 2VMFA 4PRWA 2J78A 2UY2A 3BMWA 1AMYA 1DWAM 1E6ZA 4UQ9A 2DIEA 2FHFA 1VFUA 4P7LA 1JYWA 2VRKA 1RP8A 3FY1A 3WH7A 3NIYA 4HZ7A 4CU6A 5EMYA 4W87A 3O9NA 5BRQA 1CZ1A 4LX4A 3AIQA 1EDQA 3BAKA 4P8WA 1ZBCA 1GOIA 4UFMA 1V3MA 3AOFA 3ZO9A 3KL0A 1JDAA 3L2MA 2WXDM 1QHPA 3VIKA 3ZJKA 3CLWA 1E15A 3VX1A 5EFDA 4M8UA 3WH9A 1KCLA 1B1YA 5DO8A 2DSUA 1BG4A 2A3AA 3OLIA 2YDSA 2CBUA 4KH2A 1EHNA 2XSBA 4QCEA 3NCOA 4Z2GA 2WWDA 2J7GA 2XGIA 3VD5A 5BRPA 1XYFA 3N13A 3U7VA 1ESWA 3VGEA 4P7QA 5I24A 4MNJA 2XGBA 2PWFA 3KWXA 3VUPA 2EXOA 3LPGA 1MYRA 4W8LA 3WH5A 1J0KA 4HTYA 1CXFA 1LL6A 2WCGA 1J0IA 2WVTA 2XSAA 4TVUA 5A95A 3NSXA 4JCLA 4H41A 3AMDA 2G3IA 1K9EA 2XIBA 2VL4A 3VMPA 3EYPA 1FOBA 4MTVA 3WF1A 1JYXA 5DFAA 3SEPA 1G94A 1E6NA 4JFTA 2DPEA 2Y8VA 5C71A 1UG6A 1R7OA 3FHAA 3ARUA 5E0CA 3EDEA 3BCDA 4D1JA 5ABHA 4Q7NA 4CU7A 1UKSA 4GINA 2YA0A 3BAWA 3EDDA 2OYLA 1NOUA 3VD9A 2BV9A 3VNYA 1NOWA 4RE4A 3NDZA 5GNXA 3IJ8A 1UD2A 3K46A 5JIPA 5I23A 1E0VA 4U33A 4QLKA 2CPUA 2PBOA 2EQDA 3VTRA 1M53A 1W91A 1XH0A 3BC9A 1WO2A 1NP0A 1GOWA 4CCCA 3A4XA 2ZOXA 4MNLA 3BGAA 5M5DA 4XZWA 3WD3A 1QW9A 5DEZA 1XV8A 4J3XA 2VZTA 2CCRA 1ZBVA 1LL7A 1GOQA 4AC1X 1DHKA 4PSPA 5D9MA 1WDQA 4UFKA 2DIJA 3FW6A 4M24A 1VEOA 3AFBA 3GXFA 2XTKA 4JIEA 2PWHA 3WQ8A 1UR8A 1CNVA 2X8RA 1UWSA 4W7WA 1CECA 3W26A 1J9YA 4ATLA 1GJWA 4ACZA 2BHZA 3CUJA 4AZCB 2G8ZA 5GQBA 4H7VA 1FP8A 4UFHA 5LA2A 3TP4A 1E55A 1OCQA 2JIEA 3VGFA 3ZT7A 2D0FA 4M81A 3OB8A 4ZFMA 2YLAA 2D3LA 1JI1A 2ZXQA 2V3EA 1PIGA 2PWDA 1CLXA 3L2LA 2WC4A 4YPJA 4P7NA 1OWQA 1XGZA 4S3KA 1DEDA 3LPFA 3FN9A 4Z2HA 1UKOA 4PMZA 1O6IA 3PTQA 3GNOA 5AYIA 1CGUA 2IXVA 1LF1A 3OA5A 3EMCA 8CGTA 1B3VA 3SCQA 2YJQA 3QHOA 1GVIA 2WMJA 3A47A 1VB9A 6A3HA 1A3HA 5A1AA 1V0LA 5A8OA 1UWRA 1EA9C 4D6HA 1HVQA 3N17A 4MNKA 3CHFA 1C7SA 2OSXA 2DH3A 2PWEA 2VX7A 4LYPA 5D8WA 3WIJA 1F4AA 4AZHA 2VURA 4DM2A 4CD6A 4MAVA 1WZMA 2OSWA 1CPUA 1EOKA 4DUVA 5D9PA 2GK1A 4LQ1A 1CGVA 1C8XA 1JGIA 1S46A 4H8UA 1E70M 1C3FA 5KZ6A 4X0NA 4BA0A 1EIBA 2E9LA 2FGLA 4UQEA 3AQUA 2W62A 1ISXA 4H04A 1C7TA 3WMCA 1Q6GA 1UOKA 3VKKA 3ZJ8A 1JG9A 5BXRA 3GYCA 3CZ8A 1B9ZA 4QP0A 1OM0A 1VJZA 3NSMA 3B9EA 4UFIA 2XUCA 2VVSA 3WBEA 2ZX5A 4MB1A 4GZIA 5EB8A 2EPLX 4TOQA 2VTFA 5F7UA 1UA7A 3MU7A 2GSJA 2A3CA 2C7FA 4D1IA 1WP6A 4MB5A 3W82A 1G0CA 1B3WA 3WN6A 4NF7A 3OGVA 3ARZA 1OGGA 1G1YA 1GONA 7A3HA 1TCMA 1V6YA 2D20A 3AHTA 2PF0A 4V27A 1WAWA 2WVVA 4A4AA 5ABFA 2DT3A 1C91A 2EO7A 1WDRA 2WANA 3VGHA 3W81A 1PZ2A 3RPMA 3BAXA 1J18A 4AMCA 2WHLA 2TAAA 1RH9A 1KXQA 1X1NA 2WSPA 1UH4A 1MWOA 2DQXA 1DWJM 4UOQA 2QPUA 2W61A 1CENA 3WUEA 1OB0A 2XWEA 1YHTA 1E6PA 1HL9A 4AD1A 1X6NA 2QMJA 2D1ZA 3VDAA 3UG4A 3HMCA 4AXNA 3L4XA 1EDTA 3WDRA 2IXUA 3II1A 3CMJA 4D6FA 5AYBA 2UY3A 4IISA 1E71M 3ZM8A 4D72A 3N15A 2VT0A 3L4ZA 4J27A 3KL3A 3IANA 1JI2A 1MVYA 4BQ3A 3W27A 3NUKA 4TVDA 1UA3A 1IZKA 3WF0A 4ACZB 5IHRA 3VINA 4ZXOA 1B0IA 1UWIA 3CHCA 1OGSA 1Q6FA 5FKYA 5I77A 3AS1A 4B3LA 4CD4A 1JD7A 2Z1KA 5A94A 1VIWA 2CXGA 4H2CA 1H0IA 5FOOA 4Q22A 4KRTA 4J3WA 1E0WA 3A6OA 4HA1A 2VQTA 4FLRA 2JIWA 2XVLA 1V02E 1OSEA 2W91A 4FLOA 3DECA 3DC0A 2ZUUA 2ZUTA 1OINA 2WLYA 3K1DA 3WQ5A 3WUGA 4UQDA 3LMYA 1WZAA 1W9BM 2GDUA 1HNYA 1UWTA 1E56A 4EKJA 4ZENA 3ARTA 3K4DA 1FA2A 3AIBA 1XD0A 3IK2A 5CLWA 2YIHA 1PX8A 2CHNA 1BTCA 3VD3A 2VX4A 3T2PA 3MS8A 2UY4A 3OGRA 3WY1A 1GQJA 3N9KA 4NZCA 3O6AA 1JZ4A 2CNCA 4XZBA 1CLVA 3K4AA 1CGTA 3MO4A 1ISWA 3I3BA 2BXZA 4WLCA 1BAGA 1PAMA 3WF3A 4FF5A 3L4YA 4F9JA 1C8YA 3CUGA 2WMIA 2XVGA 3CUFA 5BXTA 5BXPA 4GI8A 2FH6A 1Y7VA 2OWWA 4MADA 3M46A 4AZ7A 2WVVB 5E09A 5BWFA 4TTGA 5HPOA 4A3YA 1AQ0A 2VI0A 4CCDA 2UWFA 1E1EA 2VC9A 3WQ6A 2VO5A 3PZOA 4HA4A 3MUZ1 4PUEA 1KBKA 1PJ9A 5D9OA 3WD4A 3S6TA 2WKGA 2XFYA 5DF0A 3HJEA 1UZ4A 4UQCA 2YL6A 4OJYA 2NW0A 3AI0A 1OT2A 1HF6A 1JFHA 4U3CA 3WMBA 3W25A 2J4GA 4JAWA 3SUSA 1V3LA 2WZIA 2ZXBA 4ACYA 2ZWYA 1QVBA 4CD5A 2OWCA 3MKKA 2J62A 1H3GA 2CKSA 1U30A 3UR7A 4IPLA 2VRQA 4QCFA 1DWHM 1HP4A 2C0HA 3HU7A 3PN8A 1K9FA 4FLSA 2XVPA 1XRVA 3HN3A 3QHNA 3AS0A 2XHYA 4AEFA 1OIFA 5A6MA 4TVCA 1JL8A 4EE9A 1W9VA 3WMSA 1MXDA 3JUGA 1BSIA 4J3VA 5DT5A 1KR1A 1D3CA 1QHZA 3ARRA 5JBEA 1HL8A 1M04A 1CXEA 2BY2A 4U3AA 3BAYA 1ZB5A 5M03A 1PEZA 4JFUA 1UKTA 4LPCA 3BSGA 2VZOA 1V0NA 1HJSA 4CU8A 2J7HA 3WNMA 4OUEA 3EDKA 4D6IA 4UFLA 4OBSA 2GJRA 3ALFA 2WVSA 3WF2A 3VIGA 3QOKA 1BYDA 1A47A 1QNRA 2VCBA 3VD7A 5A6BA 1NARA 1W9XA 1DWFM 3SCUA 4LYRA 4J28A 3WNKA 2JFEX 1CGXA 2XFFA 3B8SA 4JHOA 2O9RA 1OBAA 5BCAA 3ZSTA 3L4VA 1CEOA 1ISZA 1UD3A 1D7FA 3CH9A 2G3NA 1QI5A 4W5ZA 4HZ8A 3DYPA 4TXEA 3AXXA 2HISA 3VVGA 1V6VA 1H49A 1US2A 2W4XA 3GNPA 3CZEA 2OSYA 4UZSA 3OZOA 1QNPA 5A8NA 2O92A 1UKPA 2YL8A 5FCZA 4ZEPA 4Z2LA 1MW2A 1KBBA 4UQBA 2WW5A 2W5FA 5FIPA 2VJXA 4RE3A 1GUVA 3OBAA 1TR1A 3D3AA 4CD8A 2VOTA 1TVNA 4IM4A 3VDCA 5GNYA 1W1TA 3K8LA 4PCTA 1LWHA 4F79A 3F5LA 2DSZA 4JKMA 2ZUNA 3PZ9A 1ZU8A 1ZS2A 3AHZA 4DWSD 4XV0A 4H8VA 3TA9A 4TUFA 4MDOA 4JKLA 1ZBWA 2E9MA 3F5KA 2QLYA 4GO8A 1MW0A 4L4OA 1GZJA 1R87A 3WUFA 4AZ6A 3THCA 1XCXA 2XVNA 1MQQA 2J77A 1H41A 1PX3A 3AMCA 1L8NA 3FAWA 2RGMA 1GOKA 4HP5A 3MUAA 3VGBA 3A3HA 1QI0A 1LG1A 5HDRA 1HT6A 5TD4A 1QI2A 2ESCA 1FFQA 1U33A 1LL4A 5CSUA 1WKYA 2HVMA 3WL0A 1TUXA 2WMKA 1B30A 5JBDA 3W4RA 1V0MA 2G3MA 2VX6A 1VEPA 3T0AA 4OOZA 1V3HA 1CDGA 4EAMA 2XM2A 4S3JA 1TG7A 1UR2A 1GOOA 2ZUMA 3AMGA 4WKFA 3WD2A 1Q6CA 3QOMA 5DMYA 4IUGA 2VVNA 3K8MA 5E9AA 1QNOA 4DM1A 1QBAA 3THDA 1UZ1A 2WYSA 4AISA 1B90A 3VM7A 1J12A 1E4MM 2E4TA 5E6YA 3QHMA 2DT2A 4BCEA 3TTYA 2PB1A 1EGZA 1ITXA 2VCCA 1LWJA 4J3TA 4X0VA 2ZUSA 1PZ3A 2WMHA 1UR9A 4PMQA 4CD7A 4E8CA 1HVXA 1JZ5A 1HJWA 5I79A 2FHCA 1H4PA 4FLQA 1JDCA 3WD0A 4DWSB 5I0DA 4MDPA 5I5RA 4UCFA 2Y4SA 1RP9A 3OZPA 5CSYA 3VU2A 3MV11 2DT1A 1W1PA 1Q4NX 2J75A 4Z2KA 2FHBA 1ODZA 4E4PA 2CETA 3IJ7A 3PTKA 2WMFA 1KFWA 1I1WA 3A4WA 1QNQA 4HMEA 1W9PA 3SCRA 4GO9A 3MUIA 4A3HA 3CHEA 2DSVA 1V3JA 1WDPA 1OIMA 4CVUA 9CGTA 1NM9A 1UD8A 1M03A 2G3JA 1TMQA 2AMGA 1BHGA 2FGZA 4NSBA 1E6XM 1WCGA 1H1NA 1GORA 3OLEA 5AY7A 4ATWA 5A69A 3CGTA 5D9NA 1BGGA 2WC3A 3W37A 1BYBA 1VENA 1GHRA 4KGLA 1HIZA 3ARPA 1KB3A 2GVYA 2OWXA 4U2YA 1BVNP 3CBWA 2F2HA 4AZIA 4WIWA 3SURA 4Z2IA 1GOMA 3W38A 3TTQA 1V03A 4MNMA 3TONA 3CMGA 1C93A 2F8QA 1EO5A 2GJXA 3ARYA 3SCOA 3RM9A 2Z1SA 1E6QM 2ZWZA 4UQAA 3U57A 3U5YA 3WH8A 3SUUA 5CPTA 4D71A 1PPIA 1CTNA 4KRUA 3W28A 2YBUA 2DEPA 4F66A 1I75A 1WE5A 2BXYA 1CGWA 1LLOA 4GI9A 2WKLA 4YN5A 3MUY1 4PTXA
chains in the Genus database with same CATH superfamily
1XLMA 3WX7A 3HJZA 4BF7A 2YXOA 4M3PA 1V08A 1YDYA 5C9RA 3GSMA 1V3IA 5D4YA 5JU6A 5I3FA 1VBHA 1NU5A 2JE8A 2XP7A 1AQHA 5I02A 4U31A 3VIIA 1J10A 3IUIA 3G1VA 5C0QA 1SPQA 2ALRA 3AWOA 4GZJA 1E0UA 1LZOA 1VF8A 3UJFA 1E9IA 1W3HA 2YB1A 1FHLA 3D46A 2JALA 3W53A 1EYMA 1E3XA 3KHJA 1BPLB 2V3GA 3GBDA 3R13A 1EO7A 2VDGA 3R7MA 4ZSUA 4UR9A 3QC0A 1VLIA 2VENA 3L0GA 2XH7A 1ADOA 4LEFA 3VABA 1VCFA 3W2UA 1IT0A 4ODNA 5M1TA 2J7DA 4QG8A 3PZVA 2G3FA 3UJSA 3W2LA 4C6OA 1N82A 5DCBA 3BLIA 3VIPA 1ECEA 2V9DA 1DXFA 5F4XA 1YE4A 5JBFA 3AICA 4IP5A 1E1FA 1UCWA 1Y65A 4R27A 1W9UA 2WVUA 4N6EA 3O0FA 2CIPA 4A2SA 4HMCA 3GU0A 1KXHA 5I3KA 2NVDA 3PS7A 4JFLA 4AY7A 2YL5A 1HJUA 3DFPA 5I3JA 4L4PA 1IGSA 3U2ZA 1VCVA 3V7PA 3W7NA 2Q3OA 1QW8A 1W1A1 2ATMA 5DBTA 5IOBA 2AL2A 5CGMA 4R53A 4W8BA 3W70A 1ME9A 1QR7A 1RD6A 1KRMA 4AMAA 1QCWA 2ZADA 2PDYA 9XIMA 2QV4A 4ML4A 3AIRA 4IFKB 1UQYA 4P5UA 3TE9A 1VRXA 2V2HA 1MSSA 1S2VA 4IT6A 2MLXA 2FKPA 3B9AA 4B9YA 4D8AA 2EKGA 4ZFCA 2CKRA 2WO5A 4EXBA 3FDGA 3UYCA 4CCZA 2H6RA 3CL7A 1IEVA 3VZYA 3AXHA 3N2XA 3S5OA 1RY8A 1LLZA 1JAKA 2MNTA 4DF0A 3SCWA 4MPKA 5CKSA 5DLCA 1YX1A 3RRXA 2R1MA 2JKEA 4GZEA 1W2PA 1E73M 3ARXA 5CXPA 2HBVA 2HRWA 4DPPA 3PPFA 5C6MA 4I8YA 1SFJA 4Q8OA 1O95A 4DYEA 4HYVA 4M1RA 3NQAA 1YDVA 3RJYA 2H3BA 3P61A 3T7VA 3THUA 5F1VA 3GPKA 3LM7A 4XZHA 3BOLA 2J8TA 2ZE0A 3OHMB 1OFRA 3VAVA 3UG8A 2ZZ7A 4W8AA 1XSKA 2PE4A 4I5XA 1AA1B 1FH7A 3GDTA 1SVDA 3SJNA 3LGEA 1UR0A 4WK9A 4F40A 1FKRA 1LP6A 1VJSA 1FKLA 5LHEA 3NYDA 1U5HA 3E5PA 3ID7A 2WJFA 1XFCA 5AECA 2GVEA 3C52A 2WBKA 2WPGA 5JH1A 4U28A 3CUIA 1EHAA 5J8LA 3WLMA 1H63A 2POZA 3JW7A 3RPDA 4PBGA 2OLHA 1GHSA 2I7GA 2MANA 3GLCA 2VD9A 4H9VA 5H8UA 1KKOA 1ODUA 2KO7A 5I3IA 4LUTA 2R24A 2O4QA 4ODRA 1OX6A 4JTDA 4IIEA 4JYFA 5D30A 1G01A 1QUMA 2PZ0A 3DG7A 3DN5A 3F4CA 1AZ1A 1HX0A 3CC1A 4NI3A 3I6EA 4LUIA 2D9FA 3L9CA 4QROA 2X05A 2CZ5A 4NRSA 1NIUA 2BBFA 3MBFA 3URQA 2EG7A 4WCJA 4DYKA 1EOMA 3GC2A 2OZTA 1UUOA 5HATA 1GJUA 5AYZA 2PD5A 3M5ZA 4LXFA 3O5GA 2GQ8A 3A4AA 4PUDA 1UWQA 5AB3A 2Z1XA 3GX9A 4WGXA 2KR7A 5F4WA 1B6CA 2Y7EA 4M80A 3B04A 3GNDA 2YLLA 3KM8A 3VDHA 3WLJA 3APGA 2O9OA 4QS5A 2F21A 1KXTA 1VFLA 1CB7B 1YQ2A 4C6FA 3AMLA 3EOUA 1BF2A 3N14A 4GCXA 3H24A 2V6AA 2Q01A 2BS9A 4ICCX 4ZODA 1KLZA 4OKDA 3D5HA 1ITCA 1CIUA 3O0KA 4NYUA 2A0NA 2WSKA 4LY4A 1XH2A 1OX5A 2PPGA 1SZGA 4HBOA 2WM1A 2GUBA 3GUGA 1I0DA 2G4JA 5A8GA 4J2PA 1WBHA 3BW2A 2XP5A 1FKWA 2HS6A 4HK7A 1GVYA 4CQAA 1YPIA 2VEMA 1YE6A 4J3SA 5HANA 3SCTA 3AROA 4JQAA 5FESA 1ICPA 1OJXA 1MO0A 3HGSA 4F9DA 2E40A 5LNRA 2FPVA 3TYAA 1XWYA 1CGYA 3UWUA 1UR4A 3WQGA 2ZA2A 1XBZA 2EPNA 4AG0A 4RNFA 1W2VA 1RVKA 1JXKA 1YATA 4UUIA 1ZJIA 1FCUA 1SM9A 1LQ2A 4ZOEA 4HOZA 3RM4A 1K9TA 2FB3A 3ZOAA 5LA1A 1VFOA 4F8XA 1J01A 3UY8A 4FXRA 4KWVA 4S3DA 1X6LA 5HULA 1Q2SA 4QITA 1W1YA 3GH7A 1AH4A 1ALDA 3ES8A 4R9OA 1HP5A 3IGXA 1W9DM 3GG0A 3NAVA 4QQUA 2H8XA 5CLTA 1NF7A 1RZMA 1YNYA 5A3HA 3HG2A 1PX4A 1UH2A 2AMXA 2DFAA 1WNOA 5ECUA 1K7EA 1MFUA 3M7SA 1LUCB 2YCJA 3SSJA 4BS0A 1W5MA 1GNXA 3C4UA 4IIGA 3WDPP 3U2CA 4B2DD 1ZENA 4RJEA 2V5JA 4YNGA 3PBGA 3P3BA 3NXLA 7TAAA 1SFSA 5DMMA 3H23A 1JF6A 1A5MC 3VMOA 1QATA 1MEWA 4AZ5A 1EWEA 2HK0A 3O05A 1E6SM 3B03A 3PZUA 4DXKA 2JEPA 3KWSA 2PDFA 2X7WA 1HXJA 1R9YA 1S2TA 3GXDA 3UXLA 3UR8A 5EL1A 3VD4A 2QULA 3NEHA 3RIKA 3O6YX 4Q8VA 3WDQA 1GCYA 3E1F1 3ODKA 1FKKA 3VFLA 2ZZ4A 1I2QA 2BY0A 3PY2A 2ADAA 2J79A 4WJXA 4B5NA 3KOXA 1E0XA 3M6DA 3O63A 1SYTA 4GIAA 3VCNA 3VC6A 4XBSA 1ZJAA 2DT0A 4U5KA 3OTRA 3VK5A 1AW5A 3DERA 3NSNA 4FXSA 1ONEA 4CN4A 4G9PA 2RDUA 1RJQA 1FFRA 2YKKA 2E09A 2Y5JA 1GGOA 2NT1A 4B16A 5FAJA 1TA3A 4NJIA 4O4VA 1OF6A 1XUUA 3HV8A 1KGWA 2JQXA 1UD4A 5EMKA 1E4IA 2KGJA 3V75A 4PRRA 4KWUA 3QFWA 4Y96A 1EPXA 2HPMA 1DOSA 3N11A 3CTTA 2VR2A 4GJIA 1NOFA 3AUOA 5A6BD 4HU8A 4OT7A 4X3ZA 1DE5A 3KE0A 4JL2A 3UW6A 1BFNA 4U5IA 3K30A 2QJIA 4QLLA 4NT0A 3CL6A 4FF7A 4GY1A 2YDRA 1KQYA 4NJJA 2C14A 3IPWA 4GNVA 5A6KA 3G8EA 4TX0A 3RDKA 1UOZA 1UP0A 2CLEA 3D47A 3LUTA 5D38A 4F2UA 2PDNA 2ZICA 3TC6A 5G1YA 2ZRUA 2CLPA 3UP8A 1E1CA 1AJZA 3S5NA 2J47A 4PBEA 2F4EA 4MZYA 5F1UA 4FNRA 1CW2A 3BLDA 1HL2A 1EYEA 3V16A 4XB3A 1MI3A 1TV8A 4QE1A 5AZ1A 4N6FA 3EPMA 3LTYA 3HZ3A 1JZ3A 3MJYA 2OZ3A 4LUJA 1D8WA 2BY3A 5TBOA 1OG0A 3IKDA 1US0A 1G67A 3RCNA 1R38A 4GFSA 2C15A 4GYFA 3KW3A 1JVNA 3CZKA 3IHZA 4LRSA 1JPMA 1KTBA 3W22A 3I4KA 4YL2A 5A5WA 3FXGA 2ZTKA 4TV6A 2DZXA 1AG1O 4M56A 3TSMA 2BY1A 1P0BA 4IPNB 3QH2A 2EPKX 3EX4A 5G1TA 5JVLA 4E6MA 2XN2A 2WHJA 3PG9A 2YYTA 5DMLA 5CGTA 7PTDA 2VFFA 2J66A 3WNLA 1DL3A 1DTUA 4HZ6A 3SQLA 1BWLA 1UC5A 1XHGA 3KCEA 4OHQA 1DJHA 3WLPA 4S1FA 2AQVA 4TMBA 1K4HA 2ZRVA 4GY7A 1KW1A 1DWIM 2IQDA 3A4JA 2V5CA 3K13A 1M7OA 1RALA 2FDSA 5BRBA 4AFYA 2PC4A 3GYEA 4ATDA 2XIQA 4G1NA 2ISFA 2WAGA 4PGLA 4Z0JA 4ZPWR 1EDGA 1RPKA 3GZAA 4UFJA 3BTNA 3M0HA 2HXTA 3NTPA 3A5FA 1DJZA 4PUWA 2Z4GA 3G1FA 1LCOA 3J7HA 4UTTC 1KM0A 2O0TA 4E4FA 2XH2A 4ICMA 4LVBA 4MWAA 4AIBA 4U2ZA 3GWQA 1BD0A 3GY1A 2VFGA 1R6WA 3VZZA 1AW2A 2FDMA 5REQA 4BZYA 4IL2A 4RDZA 4US6A 2A4AA 1M7XA 3N34A 4LNYA 8RUCA 1RR2A 3PZNA 3MCOA 1FHDA 1HKKA 1RHCA 1P6CA 2QJMA 3OU8A 3STCA 2BNJA 3VYLA 4B3KA 3VFCA 3ZMRA 3IK8A 1W31A 4OTKA 3ZIZA 5K3VA 1BQCA 3WLKX 4EK7A 4FA3A 4P8VA 4M6VA 4KWWA 1JD9A 3VIMA 3T78A 2ZYFA 3ANYA 4PE8A 3RNDA 1UUQA 3LSCA 1TWWA 1XLLA 3SCSA 3ZLFA 2BFGA 3A23A 2F2DA 2ZX7A 3TN6A 4HYRA 1HKWA 2WZEA 1TFVA 3TH6A 3I4EA 3RHGA 4WSJA 3BXWA 1D2KA 2ISVA 2A3EA 1OG6A 3QM3A 1LJYA 2BVYA 3EDFA 1PTDA 4R5EA 1D7IA 4DF1A 4GUHA 5CAHA 3TXZA 2VMFA 2J78A 1X7FA 4K8GA 3L66A 2E5CA 4X22A 3MHFA 4UQ9A 3W01A 3MUCA 2BASA 1VFUA 4GC3A 3EA1A 3OVPA 3NIYA 4HZ7A 3W75A 2ACQA 3O9NA 1H7WA 4LX4A 4ZPTR 4WSHA 4WDTA 4AVOA 2JKAA 4P8WA 1VYSX 1GOIA 3BGGA 2VEKA 1V3MA 1RCXB 3IACA 3KL0A 1OCJA 1QHPA 2GQAA 2BOGX 1E15A 5EFDA 4TX9A 1KCLA 1HO4A 3MSRA 1T40A 2DSUA 1F3XA 2A3AA 5GPGA 2CBUA 3ABRA 1NJJA 2UZ9A 4DX3A 2J7GA 3MSYA 1XYFA 2ACRA 3N13A 1ESWA 4XO6A 4MNJA 2V68A 4YWSA 4LT9A 3LPGA 2AL1A 2AGTA 3IVTA 1LL6A 3NRKA 3LCFA 2XSAA 3H54A 4TVUA 3FOKA 3JZUA 3T8LA 2X1RA 3AMDA 3EWWA 2X30A 3A24A 3EAUA 4EF9A 4ZB0A 5KINA 1Y5XA 2HS8A 2PRMA 3WF1A 3MB9A 4K8EA 4LBRA 2UBPC 3UGVA 4DLFA 3SEPA 3QMTA 2YB4A 1E6NA 2CZVA 3Q4DA 1R7OA 4ZS6A 2HVOA 1Q85A 1IQ8A 3ARUA 1OFPA 3BCDA 3TA6A 2PDPA 2QCDA 5DRIA 3PWGA 4AQLA 2XN0A 3KTSA 4GINA 2QUNA 3FSTA 2YX0A 1NOWA 4GC4A 3NDZA 5GNXA 3IJ8A 5LKYA 5LIKX 2EULA 4G50A 3EKZA 3R5EA 1E0VA 2LGOA 4MJMA 1PUDA 2CPUA 4HHPA 4Y6GA 2EQDA 3VTRA 4ODQA 2PLJA 4IJBA 1QXLA 3TC7A 1M53A 4IX0A 5I00A 2PUZA 3R0DA 4LFYA 4QG6A 2VM8A 5AYYA 1WO2A 3LGGA 4QJ4B 1GVSA 2GUUA 4JTTA 4GLEA 4I7UA 4GRSA 4MNLA 1ITUA 4PEKA 4XZWA 1QW9A 1WOBA 1GKQA 4M7TA 5IDZA 3GKAA 4L6DA 4RXFA 2CCRA 4LEQA 4WXYA 4HU4A 4AC1X 1XYBA 2QCHA 1ITQA 4PSPA 5D9MA 4K39A 1WDQA 4G7FA 4N9BA 3G24A 4UFKA 3AFBA 3KFTA 3GXFA 3M41A 4JY8A 2RDTA 1K3UA 3ITCA 5D09A 1BL4A 4XKYA 3VC5A 3W26A 1E1CB 1H51A 3DKJA 3H7VA 2E5BA 5GQBA 4U86A 4H7VA 4NXKA 5LA2A 4UFHA 1OCQA 3ELFA 1R46A 1S39A 1PIGA 2PWDA 1CLXA 4YPJA 3AWNA 1OWQA 3NGFA 1A5LC 3GQYA 3LPFA 1EJRC 3FN9A 3QRHA 4PMZA 4QT2A 1Q65A 5AYIA 3MKVA 2Z2BA 4YMZA 3OA5A 3TXVA 1B3VA 2Q5AA 3SCQA 1F9CA 5C7HA 3TQ0A 2OU4A 2I14A 3ZWSA 2R9RA 3BL3A 3GG8A 4D6HA 4GACA 1HVQA 1G4SA 3N17A 4MNKA 3PANA 4XKMA 1A50A 2OSXA 2DH3A 3GVRA 1A5NC 4L4MA 2PTZA 4DM2A 1FX6A 4CQDA 2OOGA 2PDKA 4MAVA 2FQIA 4N2YA 2OT1A 1MNZA 2BXVA 1W1IE 3V3WA 1C8XA 4NVTA 7TIMA 4O1AA 1XR2A 5L9FA 4X0NA 4MKNA 4UQEA 3MHGA 3Q37A 3W86A 4I7VA 3AQUA 1WKDA 1GYLA 1PDZA 4H04A 5PTDA 1NVMA 3UPMA 3LSBA 3GYCA 4DN1A 4GUJA 5E0KA 5HWCA 4QP0A 1FHVA 1OM0A 2XUCA 2VVSA 3WBEA 4JTAA 2ZR6A 2YGYA 4JTIA 1J93A 5DIVA 3MU7A 2Q8ZA 4JBRA 2BGQA 2C7FA 1WP6A 4LVFA 4MB5A 3H4WA 1A80A 1ZZMA 4AY8A 1FWBC 2ETNA 3OGVA 4DJEC 3UWZA 1WAWA 4DH0A 3MQTA 4J4OA 1P5BA 4A4AA 2Z29A 2DT3A 4FX6M 4KIEA 5HK4A 3BAXA 2TAAA 3HQ1A 3W1AA 2WSPA 2HEJA 4TR9A 1KM4A 1LRNA 3N19B 3H12A 1E6PA 1OFBA 1EFZA 2QMJA 4F0LA 1VP5A 4Q4MA 3CV6A 3KOFA 5F2GA 2OLAA 4H9TA 4J4KA 3WDRA 3WJWA 2IXUA 3CMJA 4D6FA 5GJPA 5GJMA 1L2QA 5CCZA 5G4EA 1E71M 4D72A 3N15A 3L4ZA 3HPAA 4XUGA 3KL3A 4J27A 2VFDA 3IANA 4LBUA 3W27A 3M1ZA 1H60A 4XAFA 5IHRA 3HG3A 1EP2A 3VINA 4ZXOA 2YXGA 1B0IA 1UWIA 3DX5A 1OZMA 4L3NA 2PDJA 5H8PA 3PBYA 1JD7A 2Z1KA 1VIWA 2CXGA 2G95A 1H0IA 1OX4B 1OX4A 2Y85A 4KRTA 3FKKA 4HA1A 2VQTA 4A21A 2ZQUA 3GDRA 3MI6A 2W91A 4QDPA 2OEKA 1WXYA 1O1HA 2NVAA 2ZUUA 3TQVA 4W9TA 1TPH1 2VEPA 4UQDA 1WZAA 2QDHA 4B4FA 3H21A 4EWJA 1UWTA 1NY1A 4C6EA 4ZENA 3ARTA 3R1ZA 1XD0A 3IK2A 2YIHA 2CHNA 4E2BA 1BTCA 1EJUC 1XIDA 2PU0A 4LAUA 4OVXA 2HXUA 3TC3A 1ZTVA 4H9UA 4GE8A 3PPCA 3O6AA 4K38A 2CNCA 1FWGC 5FSEC 2BSLA 2ZQTA 4ODLA 2C1HA 3GRIA 3OYZA 5K9XA 2D69A 4WLCA 2WMIA 2VC7A 1P0DA 4M19A 4RK8A 4O0QA 4LTSA 3M44A 3Q67A 1VFTA 1F73A 1FKGA 3EWBX 3IVUA 1IIGA 3P0WA 5T9CE 2HROA 3W7MA 1SJAA 5E09A 4S38A 5HPOA 4O0ZA 3LN3A 3MCNA 1ZCNA 4NAFA 3UT0A 1TTJA 1L6SA 2UWFA 1E1EA 1ZAJA 2VC9A 2D73A 2PU1A 3NZPA 3CL8A 2QGYA 1UPMB 5C9ZA 2PPPA 1PJ9A 5D9OA 4B2DA 2WSYA 4ROPA 3WD4A 2XFYA 1UASA 1AMKA 4ODPA 3W83A 4Q6JA 1MDLA 2H3DA 3AI0A 3AC0A 1HF6A 1O1ZA 3SRDA 1YLVA 3GAKA 3H2FA 1LUCA 3MWAA 4GBUA 4IMFA 1QVBA 3TK7A 2QJHA 4EVZA 2QCCA 5FSDC 1H3GA 3W6YA 3G1AA 4X60A 5DY3A 4DRKA 2PPOA 2OJPA 4JX4A 4EXAA 2VRQA 4QCFA 1A53A 2VXNA 3HU7A 4DROA 1K9FA 4FLSA 4DRIA 1JPKA 3AS0A 1XYMA 3BLEA 4AEFA 1OIFA 1TYGA 3GHRA 3LOTA 1PDYA 4TVCA 3M9YA 3PJUA 1A49A 2C19A 3UBPC 3WK0A 1W9VA 3WMSA 5HQMA 1MXDA 4J3VA 5DT5A 4IIDA 2Y62A 3A64A 4NAEA 4YYCA 5JBEA 1M04A 1CXEA 3M0LA 4U3AA 1FCBA 4C6BA 1ZB5A 3CIXA 3TYEA 5M03A 3C5QA 3WG6A 3P60A 4LPCA 4GVFA 1Q8JA 2WZTA 5D02A 1P0EA 1J2BA 2J7HA 3WNMA 4OUEA 3NVTA 1R3QA 4JR5A 4OBSA 2GJRA 1GW9A 1YMYA 4L1GA 4PODA 3WF2A 4DJFA 3VIGA 1J4EA 1EYWA 3K4WA 3B3DA 1A47A 2PZNA 5A6BA 4O13A 3SB0A 3IJDA 4J28A 2JFEX 5DO2A 5CC7A 2XFFA 3EOOA 1TWSA 4UDMA 2PURA 2Y6ZA 4XZ9A 1MRQA 4HHHA 5TNVA 1R2SA 4C1NB 2HNHA 2G0WA 4M5PA 1P1XA 2Y88A 3PTDA 2LLEA 4TXEA 4L5ZA 1G4EA 4LRTA 1NTHA 1US2A 4LJ3A 2OSYA 1UR3M 4QGCA 3RUBL 5A8NA 5KTLA 5FCZA 4E4UA 4ZEPA 2OODA 3ISIX 1MW2A 1KBBA 1VFHA 3M0KA 4RE3A 2XFWA 3WLQA 1T5AA 3BWWA 3W7OA 1H1YA 3OBAA 4CD8A 3D3AA 3PM6A 4IM4A 4C6DA 1FDZA 2A2IA 4PCTA 2ODOA 3GXNA 4REQB 3BQ6A 4JKMA 4K7YA 2ZUNA 3QY6A 1S5MA 3PZ9A 1ZU8A 3M7WA 3ZXWA 4TUFA 3N25A 3CYVA 1IE7C 3GHSA 4GO8A 1QOQA 1KFBA 4R7WA 1R87A 3WUFA 1NELA 3RFWA 3THCA 1I2RA 3P5YA 4MY9A 3D6NA 1BSLA 1XXXA 3MDWA 1PKLA 1SJBA 4I5RA 2PDIA 4IGNA 3FAWA 3SY1A 5HMDA 3RU6A 1R5YA 4HP5A 3U8GA 1L9WA 4TO8A 2PP0A 5HDRA 4FS9A 1FFQA 2W79A 4LAOA 4NU7A 4DO7A 2WMKA 4Z08A 2V8ZA 1TIMA 4UTWC 1Z89A 4J5NA 2G3MA 5E5CA 1Z9AA 4NP7A 1X98A 2J9YA 2PTYA 5BOFA 1UR2A 1GOOA 4WKFA 3S6OA 1Q6CA 2PV2A 3KVKA 1NMVA 3KBWA 3MWCA 3OQ8A 1QK0A 1MRAA 1QNOA 4OFCA 1QBAA 3THDA 7REQB 2WYSA 5KSWA 1W56A 1B90A 1TVLA 8XIMA 2MPHA 1J12A 5HNTA 2JGQA 4BCEA 1Y0EA 1ZPTA 2ZUSA 2G37A 1UR9A 2Z24A 3AU6A 1N8WA 3N2BA 2IKIA 1REQB 2DVTA 5DXXA 4L6HA 3GFZA 3R0UA 2BTMA 4AF0B 1ZP4A 4IGMA 3ONCA 4G1KA 2J6VA 2DZPA 4H8NA 2J75A 3NQFA 3CIWA 2ONEA 4Z2KA 1H62A 4E4PA 1AJ0A 3IJ7A 2QCMA 4XD5A 4C6IA 4U84A 1I1WA 3A4WA 1QNQA 1TV4A 3MUIA 3ZZ1A 4KFPA 1V3JA 1WDPA 2EPHA 9CGTA 4YTQA 2Q6ZA 5DCDA 3MYPA 2XPBA 3EWUA 1ZP3A 1E6XM 4RZ6A 4MKSA 1GORA 1XJBA 1EIXA 3GHUA 1X39A 3OLEA 1LORA 3CGTA 4FR6A 5D9NA 3TCEA 1BGGA 2WC3A 4LCRA 3KS6A 1XQLA 4MGGA 2IQ0A 1WAUA 1GHRA 3UQNA 1S38A 1CI1A 4Q8UA 4JEJA 2QVHA 4U2YA 2GPTA 3U6WA 1M7JA 2FJUB 3VNIA 3APYA 3FK4A 1OCNA 1GOMA 2PF8A 3PJXA 3PWIA 3UZWA 3TTQA 3ZFHA 1W6TA 4RNJA 3RLHA 4JX6A 4JTRA 3TONA 1C93A 1EO5A 4GQ0A 4LVAA 5EPDA 3T8QA 4IQJA 1N8IA 2VP8A 3LNMA 5D04C 2DG4A 4Q8NA 1UW9A 1E6QM 3UPBA 3U57A 4ODKA 4JXCA 5CPTA 1XLKA 1CTNA 1T41A 4RLIA 2YBUA 3LBOA 4UTIA 2NXGA 1CGWA 4RXGA 3B40A 2GWNA 2AWGA 3LGDA 2WKLA 3NG3A 1DIOA 4YN5A 4S2CA 4Z0SA 3PZIA 4DXVA 5GVJA 3CPUA 3ZJ6A 4C7DA 3MVIA 2NZLA 3A22A 1GPWA 3W72A 4JTQA 2C8NA 3PB2A 4ZOAA 1UD6A 3T2OA 4BQ4A 3NQ2A 5D2TA 4O2TA 1DJIA 5CPLA 1D9EA 1MQPA 2GJPA 1TKKA 3LCWA 2J24A 4V15A 4W85A 4WKAA 2QPXA 4WY0B 4WY0A 4XD4A 3WNNA 2Q8XA 3C2YA 4JQ3A 1BTMA 4MJ2A 2FFIA 3DG6A 2WCSA 4PMJA 3VILA 3BJTA 1IIHA 2PDGA 4FOUA 4G8TA 3UXIA 4D6JA 3UWQA 3EPOA 4HTBA 5ABGA 3T0BA 4PR4A 3WJZA 2GQ9A 1XLHA 4L61A 3U3HA 4B9ZA 4K7VA 1VCGA 5KMYA 2EBNA 2JF7A 4L6OA 4DVOA 1TWIA 3M07A 1OFQA 1UZHA 2BODX 1BLIA 4XX6A 1Q66A 4LWWA 4HMNA 1EJSC 4O12A 4D6GA 4LUTB 5JUVA 4RNHA 1X6UA 3P81A 3S2CA 3VM5A 4WXZA 3NR0A 2PFHA 3QTPA 1SZFA 1VKFA 4C1NA 3JXVA 4X2PA 2EJAA 5ABFB 4L1XA 3B0YA 2QF8A 2BX7A 3BMBA 1W32A 4PSRA 2LJ4A 5LIYX 1KTCA 3K1GA 3KAGA 5I3DA 3CV7A 3NPVA 3O7UA 5A2CA 1V6XA 3K8KA 2WMIB 1M3UA 3FAXA 3EMQA 5I78A 3R8RA 3KVJA 4DBUA 5AFDA 3BZGA 1BWKA 3AMKA 3EX3A 4ZQCA 3P5ZA 4MY8A 1HFBA 3C2FA 1CYGA 3H4XA 3HIJA 2VNCA 5TF0A 4AIUA 3W1PA 3GH5A 3F03K 5C8BB 3BMVA 4S23A 4DRMA 3C2OA 2CBJA 1E44A 5IM51 1ROUA 5D2WA 4IL0A 2BG5A 2BVDA 5EA9A 3G6LA 3KRZA 3UWVA 1X8CA 4QFUA 3KDOA 5I7GA 1Q7MA 4PMYA 3STFA 1PBKA 1G4TA 2OMAA 1I1XA 4XSLA 1HKVA 1KCKA 2DGAA 4LUSA 3DAQA 4JN6A 1MW3A 1V77A 3LHWA 1VZWA 1EKOA 1KR0A 5DT7A 3SRKA 4QX4A 3O5LA 4DNHA 2HV5A 2ZXDA 1WKEA 4S2BA 1BF6A 4QG9A 3QPEA 3AXIA 1GOXA 2X0YA 3NQBA 3ZJ7A 2QDDA 3EZ4A 3F1QA 4GX9A 5EFFA 1HGYA 4O18A 3MO7A 4LYQA 3R6IA 1VBRA 4HOXA 2GOKA 3FCPA 3A3WA 5I3HA 3ABZA 4X9SA 4UTHA 3LHVA 3BAJA 4NXSA 2OFNA 3S9ZA 3M43A 4QSHA 4WDWA 1XGDA 1TJ2A 1OGBA 4HPGA 4ZL1A 2XU2A 1U83A 1CXHA 3IIPA 4QLJA 4ROQA 1V0KA 1J79A 4LAVA 2CBVA 4PCFA 5EKYA 1E0TA 2IMRA 3UXDA 1L6YA 1B2YA 4QQ3A 1FQ0A 4FIRA 1E72M 4XD6A 1UBPC 4QNEA 1XPYA 4AUBA 3B0XA 5HPCA 1A5KC 3EGJA 2GGIA 1ZQ5A 1YADA 1RVGA 4H3DA 4MJ4A 5D75A 4RUBA 1CXLA 5CC6A 1KRBC 1THFD 2GFTA 1J5TA 3E38A 4GQRA 4HU0A 1XC4A 3PBUA 2ZUWA 2WK2A 3I7QA 1TREA 4OWGA 1PWMA 2R91A 4ORIA 4E2OA 2PTWA 3VE7A 2CHOA 1A7XA 4EF8A 4Y2WA 3W29A 3DYOA 3PTMA 3N3TA 4NX0A 2FPYA 3N9SA 1QI4A 3WYZA 4ITZA 3MP5A 4LAYA 2H8ZA 4W89A 3HFTA 1AW1A 5BNKA 2J25A 4Z17A 3LENA 3PRBA 4GQQA 1G69A 1NMWA 3H7UA 2P76A 3HGRA 1QHOA 3QW3A 1R30A 1K8XA 5AC4A 3CV1A 2FPTA 4C1LA 4KFOA 2FKEA 2OZ8A 3EWZA 2ANUA 3XIMA 3TQPA 4DO4A 4AZBA 3CB8A 4MWAB 3NQ6A 3GTNA 3HG4A 3ZT6A 1JCJA 3TMQA 3RITA 1W3KA 3V36A 4XUYA 2ICSA 4FMVA 2AGKA 4TNSA 4YS1A 3UZZA 4H6EA 3PPHA 3I3EA 3KP0A 4LF2A 3W24A 1H09A 2R1PA 2VUNA 3FVDA 5AC8A 2B7NA 1XYCA 3ARSA 4QTGA 4WF7A 4DI8A 2Z2AA 3MZNA 1JYNA 1QASA 1UH3A 3SUTA 2J88A 4GH1A 1JNDA 2ATSA 3UI5A 4HPNA 3QZAA 3RJXA 1LDCA 4YVPA 1KWKA 1NWUA 2PV3A 3VNJA 2YZ5A 3N6HA 4AXKA 1FWTA 4GK8A 2OB3A 4JHZA 1F05A 1PZ0A 3TCZA 3D0CA 3ARWA 5A8MA 4NHVA 4CNTA 5FEXA 2D23A 1S1PA 4AD5A 4Z42C 1GG0A 1JCTA 3QJAA 3W2JA 4W9PA 5EY5A 3W7DA 4O1BA 3WFLA 3BG5A 1L2UA 3P93A 4LF1A 1TPUA 2OYMA 1K9DA 3VNKA 4XAPA 1YIXA 3NA8A 4CN6A 4XAZA 2NX9A 2ZX8A 3LMZA 3R79A 4GG9A 5C9XA 4AIEA 2C18A 1XCWA 4UTTA 4ZQPA 2ZVRA 3GXTA 3W1MA 3OBKA 5HTGA 4NUWA 3HO8A 4DQWA 5BU9A 1XD1A 5DBUA 2PS2A 2DZVA 4GKLA 4HARA 1GW1A 1WPCA 2F38A 2CBIA 3DEQA 2RAGA 3SCPA 2QT3A 2CESA 4H6RA 1J0ZA 1J0YA 3E2RA 3USBA 4ZTXA 3W00A 6TAAA 4U4MA 5LIWX 1PZ1A 1WUFA 1TX2A 2BHUA 2YFNA 3SIMA 2OLSA 4DHGA 3PBMA 4PN2A 1DORA 5CBBA 1FP9A 1OFDA 3LZ3A 5C2GA 2F61A 1JF5A 4PUNA 3AZRA 4DZIA 1XLDA 1OD0A 3GB6A 2VGBA 1SJCA 2F6XA 1W17A 3LPOA 3AHYA 1SR9A 2PGFA 5FACA 1KC7A 1F40A 3IWPA 3T42A 3SBFA 3V1PA 2WNZA 3DOPA 2X16A 3VMNA 5F4SA 1LOSA 2REQB 4CN1A 2XIMA 1RK6A 1L0PA 3RMEA 3MSGA 1EX1A 4E8DA 4NIRA 2W63A 3SJ3A 3WLOA 2P50A 3H2EA 3PFRA 4ZQNA 3LHYA 4ZE4A 1YDNA 2CLMA 2TPSA 2C6QA 2FB2A 3TDFA 3NURA 4QXIA 1Z44A 4AWSA 3P84A 4E5TA 1Q6OA 1XBYA 5HXMA 3STEA 5HWNA 1PCKA 2DZBA 1I6NA 7ENLA 1Q6EA 5BMWA 4NZ5A 1TPWA 1UMYA 3SUVA 1XBXA 3S1UA 4DBDA 3EA3A 1JNSA 2ZKMX 2A3HA 1G9HA 1RBLA 2OQHA 2VZUA 3OA3A 1Q45A 4MAZA 5E0FA 2RKXA 2D2JA 2YXXA 1BEUA 3GG1A 1DXEA 1JQXA 3G0XA 2NQLA 1RV8A 3THAA 1IV8A 1V3KA 4OU1A 4QE5A 4I8DA 3T0DA 3S9IA 4TYOA 4FXFA 3QV9A 1RLCL 3S2JA 1AFSA 1A5OC 5FL0A 1JUEA 4S3GA 1XM3A 2ZX9A 2JEQA 4A05A 1UUMA 1ZGDA 3AZTA 1S1RA 3POHA 1JYVA 5A8PA 1YTKA 5A6AA 3S42A 1ECQA 3C61A 3W3OA 4K1GA 2VDHA 4PMRA 4KETA 2NLIA 4HJFA 2QCLA 1QO5A 2PDXA 4RR4A 2W3ZA 4PTWA 3S1GA 4H01A 2QJNA 3LU2A 3MMTA 1NWTA 3CZLA 1GZ1A 5A6SA 1N7KA 1TX0A 4HZMA 4QJ3B 1TA3B 1KRAC 1US3A 3P8JA 3FAPA 3RM8A 1XLFA 5E6ZA 2WNWA 4DBWA 2V38A 3EWYA 4K68A 1WKFA 3OG2A 5LHFA 4MB3A 5A6TC 2WBGA 3P7YA 1CWYA 3P80A 1IEIA 3TJIA 3QR1A 2E3ZA 3RPTA 4UMAA 3CUHA 3CIVA 1VAHA 1WUEA 3DHPA 4IQLA 4DWDA 4O1FA 3WCZA 2AOSA 2X1IA 3UPWA 3IJ6A 1JCHB 1W3IA 2XFRA 3ZSSA 3KRUA 1Z69A 1I8JA 4R88A 4Q4PA 1D7JA 2XZ7A 4DJDC 3E0VA 3AXMA 1Q2RA 1KCXA 4CEUC 1SU5A 1JIBA 5FJIA 5CH9A 1IXPA 2F7FA 3BAIA 4I6VA 5FEPA 1KA9F 1YTEA 4UTUA 1W3LA 1LOLA 3OOQA 5DCEA 1A4LA 4IIBA 1AZ2A 3UWEA 4HCDA 4NJHA 3L0NA 2J7BA 1A5CA 5HW7A 1I0BA 3WDIA 1QDSA 4JYDA 4LYKA 3LZ5A 3C3UA 4PZVA 4GHRA 4GX8A 4TX6A 4IJCA 1EA0A 2IKJA 5A8QA 4P8XA 4NZFA 4MUPA 1SW3A 1K8YA 3M47A 2QHAA 2INEA 5KITA 4PMUA 1QBBA 2INFA 3TTOA 3EBVA 1D7KA 1W26A 4UNLA 2P10A 1JZ2A 3MI2A 2CLKA 1QNSA 4D6DA 3O5RA 2GSEA 4QEHA 2PGWA 1YYAA 2X09A 3CZJA 3VZXA 5EMMA 1QAPA 5HJYA 4JZ5A 1MXGA 3A13A 1IHIA 3MP3A 4Y9AA 1X97A 4D6CA 4JKKA 3LNPA 3W0KA 3WENA 1E9ZB 2XYLA 4PUKA 3SGGA 3TCSA 1T11A 4Y7EA 1QPOA 1JZ6A 4PTNA 1CXKA 4WSKA 2JF6A 2PWGA 5LNUA 4HN4A 4O19A 1KGXA 3VIHA 2PDUA 3PJWA 1JRCA 1FWWA 2RUDA 2YW3A 2PLCA 3WNOA 2D2OA 1FAPA 3O1NA 4LGXA 1TV5A 2X7VA 1OD8A 2DSKA 4XBJA 1X1ZA 1FKHA 1D3HA 3COTA 3G22A 3ITLA 3SUWA 2FZBA 3NNTA 1LBMA 4DUWA 3WEZA 4ZVJA 2UY2A 3BMWA 2ZQ0A 3AALA 1DWAM 1DJXA 2RUSA 1QPNA 1WOAA 1U1JA 2P3EA 3NL5A 1JYWA 1RP8A 3VCRA 3FY1A 3OO2A 2IPWA 3L5AA 4CU6A 5EMYA 3NYZA 5BRQA 3AIQA 1EDQA 3IK4A 2GL5A 1ZBCA 1ZK6A 4UFMA 1J6PA 3S2NA 4XTIA 3FV9A 1JQVA 3GHTA 3L21A 3BE7A 2QYGA 3KS5A 4HSNA 4NZ3A 3V0TA 3H9RB 4KH2A 2XSBA 2PRLA 1N8FA 1OC6A 3ABOA 5CAKA 3LCLA 2QCFA 4Z2GA 3TSDA 4MWAC 3VD5A 4LH8A 1PSCA 4KS0A 5I24A 4LB3A 2XH0A 1YDOA 2PWFA 3BZJA 4TV5A 3DC8A 1JUBA 3PP7A 2MUCA 1S2WA 1MYRA 4IICA 3TW9A 3WH5A 4YCOA 4MHBA 2WCGA 2WVTA 4O1EA 5A95A 3NSXA 1FCQA 4V33A 4E2VA 2QUTA 1M9HA 4JCLA 3SQMA 3E2VA 1HXVA 1OFAA 2G3IA 1K9EA 1EJWC 2OOFA 2XIBA 2Z7KA 3TEVA 4XSMA 1Z42A 2BOEX 3M0ZA 3NOEA 3GTIA 3TYZA 4LV4A 3H2NA 2Y8VA 4F0KA 1JDFA 1UG6A 5G5IA 3W1NA 4H7ZA 3NPWA 5E0CA 2ZC8A 3NWRA 3EDEA 3PF3A 3B0UX 1GJPA 2Y7FA 3E3HA 4Q7NA 4CU7A 1UKSA 2G97A 2FZNA 2OYLA 3VD9A 2BV9A 5DELA 1ZY9A 5JIPA 2QUUA 3IGHX 5FF0A 3GFYA 4UMBA 4UXDA 2R6OA 4F0HA 2ZFAA 4U33A 4YCPA 4QLKA 2ALDA 3V18A 2X42A 3JZEA 3BICA 3B7XA 1NP0A 3W1QA 4WRHA 4KQZA 1ICSA 2ZOXA 1XIHA 3E02A 3HGOA 4Q4OA 3BGAA 4I7WA 5M5DA 4YYFA 3WD3A 3OPSA 1FCVA 2RURA 2VZTA 1L6GA 3FEQA 4B4HA 5D2YA 1OFEA 3SECA 4BK9A 4ALDA 2DIJA 3KCJA 4Q6XA 1P5QA 1VEOA 5C9UA 2X0SA 1MUCA 3NGJA 4JIEA 3HPZA 1UR8A 5HMEA 1XS2A 4W7WA 2P88A 3G18A 4O17A 4LOCA 1CECA 1O60A 2IF4A 4ZO9A 1J9YA 4ACZA 3H53A 3CUJA 1XRFA 4B5TA 1FP8A 4MOZA 3HF3A 4LCSA 1E55A 1M5WA 4JTGA 2YLAA 3C8FA 3NQDA 4YTSA 1QZ2A 4Q4QA 3L2LA 4Y9NA 3SM0A 1NEYA 2XINA 4MFDA 4S3KA 3RX4A 4RDVA 4H6KA 3GNOA 3UI6A 1CGUA 1NFGA 1T7LA 2IXVA 1LF1A 8CGTA 2YJQA 1TRDA 4LY8A 4HQVA 1GVIA 1YEYA 4KCVA 3OVRA 6A3HA 3P62A 5CZSA 1V0LA 3IRSA 3R43A 2DQWA 4Z1AA 2G5WA 3N73A 1C7SA 4GIRA 4O54A 4HHMA 3B97A 4CD6A 3THQA 2R82A 1CPUA 4DUVA 1VLWA 5CC5A 1MUWA 5D9PA 5G1MA 5SWUA 5D05A 1ADSA 4JIIX 3WLNA 1C3FA 2QR6A 1YXYA 1EIBA 3JVAA 9RUBA 1FKXA 2QCEA 5FJOA 2W62A 4PULA 2Z1WA 1P0NA 4DXXA 1IGWA 1YKWA 4L1WA 4OECA 4GMEA 3CZ8A 5DY2A 2O55A 4ORMA 1MZRA 4MB1A 4GZIA 3B0PA 2EPLX 3OP2A 2VTFA 3C0QA 1UA7A 2QUMA 4M0XA 2A3CA 1DIDA 2D2GA 4NF7A 1IYXA 1OGGA 1G1YA 1V6YA 3WLIA 2PF0A 4ODOA 1D6OA 3ZWTA 4BF5A 2WANA 3P8IA 4BY3A 3UJRA 4DO5A 4ZMGA 4EPDC 3IEBA 2R94A 3CASA 2WHLA 1RH9A 3NTYA 4X2RA 1X1NA 1ML1A 1J4RA 1BWVA 2DQXA 1NF0A 2BLEA 2M1IA 1Q6RA 1KM1A 2WZMA 2XWEA 1T6MA 1SW7A 3KLLA 1K1DA 4AD1A 1UJPA 3VDAA 5T26A 3VKJA 4IIFA 4Q3MA 2MLZA 3UG4A 3Q45A 5AZ0A 3DDMA 3OG3A 3L4XA 4IT1A 1EX5A 4MYXA 3TSBA 4OBTA 3PA7A 3CB3A 3T4CA 3II1A 2YW4A 5AYBA 3AYVA 1VYPX 1DPMA 2Y61A 5LXEA 2VT0A 3DI0A 3ZVHB 1WXJA 3C8NA 3GTYX 4QJ1A 4N02A 1S3TC 5HKGA 2DZAA 1ZLPA 3WF0A 3FSUA 1Q6FA 4HBEA 3LBMA 1F8MA 4J1OA 2C71A 4CD4A 2PWVA 2AKMA 4H2CA 2FTYA 4Q22A 4D8ZA 3I6TA 4AYGA 2HDJA 4DPQA 4JNMA 3DECA 2DORA 2C0AA 1PKMA 1C8VA 1N1AA 2WQDA 3EWCA 1K4GA 3WUGA 3H7RA 5HMSA 1W9BM 2OT0A 3CWNA 3KBJA 4F4RA 4IMDA 3K4DA 3AIBA 3UQAA 3MS8A 2UY4A 4LVDA 5ENLA 3N9KA 5DN1A 1AD4A 4NZCA 5BW6A 3UNTA 1JZ4A 4IP7A 4G5DA 4XZBA 3K4AA 1CGTA 3I3BA 2WSQA 2OCZA 4F9JA 1PAMA 1VR6A 4GYPC 1XLCA 1GQNA 3GD6A 3L4YA 1C8YA 4ES4A 4DT4A 4UTWA 3C2EA 3G3MA 1RA0A 3CUFA 4XZMX 2VWTA 2YZRA 3ATYA 1LTDA 5BXPA 4GI8A 1LT8A 2FH6A 1Y7VA 4AZ7A 4O10A 2WVVB 3H2OA 4TTGA 1TV3A 4A3YA 2VHLA 3ITYA 3FLUA 3WQ6A 2VO5A 3GS6A 4HA4A 3DIPA 3W7JA 3DH7A 1KBKA 1SUXA 3E12A 4B92A 2ZRZA 3PPGA 4Q7IA 3UXAA 4C5ZA 3WMBA 2Y63A 5CPMA 5CZJA 3TX9A 5D33A 2P5NA 2XH4A 4JAWA 2GJLA 2WZIA 2ZWYA 4Q8MA 3N4AA 3CEPA 3FJLA 3MKKA 6XIMA 2FZ8A 2FVKA 1U30A 3UR7A 2C0HA 3PN8A 3KAOA 3OEXA 2B5UB 3HN3A 3NEVA 5LIUX 4HU3A 3I7RA 3O15A 1BRLB 1GVRA 3D3FA 4R3UA 1Q7QA 1HO1A 4DNMA 2GYIA 2VC6A 4QM1A 1KR1A 1D3CA 1IF2A 4PA8A 3VKCA 4JFUA 3U2EA 1UKTA 3BSGA 2VZOA 1HJSA 2NQZA 3AYTA 3EDKA 4IOTA 4WY0F 2P8BA 3BGJA 3W1XA 3GVGA 3IRDA 1XIEA 2RFGA 2FYMA 3QOKA 3UQIA 1T99A 7ODCA 1R3TA 1QNRA 2VCBA 4FNQA 3TYBA 1FDJA 4LYRA 2YCKX 3WNKA 3GR4A 3ABSA 1VQTA 1CGXA 3QC3A 3F2DA 1S2UA 2O9RA 3E2QA 2ZE3A 4GY0A 2V5LA 2PTDA 1OZQA 1RJPA 4PH6A 1D7FA 2G3NA 1DJYA 4B5SA 3AXXA 2DZTA 3SO7A 1B9BA 1V6VA 3OVGA 4IFOA 2W4XA 3GNPA 4DRNA 2P0OA 3M0YA 2RJGA 3CT7A 1G7VA 1KLYA 3MDUA 4PL2A 3TYUA 2PSNA 1XLEA 3O5KA 2W5FA 4UBPC 5FIPA 2VJXA 2QF7A 4PB4A 4ZOCA 1GUVA 3R8GA 3S4TA 1TR1A 3L7RA 1DVJA 1MUMA 2QQ6A 3CQKA 3VDCA 5LNSA 1U5VA 4F79A 3F5LA 3NO5A 4XV0A 1QWKA 5EMUA 3TA9A 4JKLA 1ZBWA 2E9MA 1LYXA 3F5KA 3U0HA 2VOMA 4K6AA 2XVNA 3VCCA 4O8AA 1H41A 1SQ7A 3VE9A 4NJGA 4F48A 2POTA 4KCUA 4O52A 3R4IA 4BEQA 1W8SA 3VGBA 1HT6A 1M6JA 1QI2A 1VYRA 5CSUA 4GVGA 1WKYA 2HVMA 4JFMA 1TUXA 2KI3A 5JBDA 2J13A 2CFFA 5B7ZA 1V0MA 4GNKB 2EG8A 2M2AA 2VX6A 3BV4A 2REQA 4FI4A 3AMGA 1NQKA 3M64A 4N7QA 5FI8A 4MF4A 4IUGA 2CZEA 1UROA 1ZCOA 4DM1A 3VOHA 4MLJA 4NZ4A 3VM7A 3W84A 5E6YA 3BVJA 5ECVA 4ZTYA 3TN4A 3GVQA 2PB1A 3FJ6A 4EX4A 4J3TA 3UGRA 4PMQA 4CLMA 1FKDA 1Q1CA 4OQVA 5E93A 2JBMA 1JZ5A 5G4WA 3N2CA 3GFXA 3ITGA 1RJRA 4FLQA 3IKGA 3M0JA 5I0DA 4MDPA 1JJKA 3F4DA 3DFSA 3L68A 3KBSA 2QGHA 4ODMA 4MIMA 1RP9A 3OZPA 5CSYA 3E74A 4CNNA 4NZ1A 3GW0A 2FHBA 1JCLA 3ONBA 1UP2A 3W1TA 2WMFA 5L6UA 5U4NA 1KFWA 4Q8TA 4GO9A 1OIMA 4CVUA 1HZYA 1FWHC 1M03A 1FD9A 4UTLA 1TMQA 2G3JA 1BHGA 2FGZA 5E9XA 2BP1A 2NVCA 3VOFA 4KWSA 1H1NA 3L5LA 4H4IA 4MYAA 3NVDA 4DO6A 3QV6A 3HMJG 3W37A 2O7QA 2Y89A 1MMFA 3BK0A 4QRNA 3B8IA 5I06A 3PUEA 4KGLA 3E9AA 3ARPA 1KB3A 2GVYA 4RKAA 3T9PA 1XDLA 3H55A 3BURA 4B5VA 4AZIA 3ITTA 3PVFA 3W38A 3NPUA 1JCMP 4QSFA 4JIHA 1PHQA 3G0UA 4MNMA 3ITVA 3CMGA 2F8QA 3QLLA 2V30A 3C0LA 4DJDD 2JKPA 3SCOA 1TE6A 3E5BA 3C86A 5KZMA 4WJ8A 3IUDA 2Q09A 3BDKA 1PPIA 1K7XA 1A3XA 3W28A 2E5DA 1CB2A 5HAOA 1AK5A 2BXYA 1LLOA 4ADTA 1XLIA 1OADA 3AUJA 4PTXA 4AHPA 1TZ9A 5IFTA 1PKYA 1EXPA 2QXWA 1Q63A 3B8VA 3KAIA 1EB3A 3VOCA 4TU1A 3HB9A 3S1XA 4IPXA 4ZCWA 3LTPA 2V67A 4IH3A 4PMXA 3A12A 2XM1A 4HIBA 1K8CA 3RU8X 3UETA 4AIOA 3VNZA 2Y7GA 2CLHA 2QCNA 1H2JA 3L0KA 1Q3NA 2CZFA 2ISDA 3GU9A 2QKFA 3AYRA 4BJHA 3PZMA 1MNSA 4FALA 3WFZA 4I9JA 1JDDA 3IUHA 1C90A 2GDVA 5LIXX 1MW1A 3MJMA 4CNSA 3AS2A 4Z2JA 1Q13A 4DZ2A 4KW2A 2J7CA 4ERGA 4AAJA 2GVJA 4BQ5A 3POCA 4UMCA 4ONVA 5HNNA 2PDBA 5CG7A 1V02A 3R10A 1EQPA 3MMWA 3FNDA 2VUYA 3CO4A 5LYRA 5T8GA 1OT1A 4EXQA 1XYLA 1H0GA 3TNBA 1EL3A 4A8IA 2G41A 1E40A 1W37A 2GJNA 3VDBA 5LA0A 3KOZA 4JY9A 2X0HA 3PNZA 3GDBA 1WX0A 4EOUA 3RILA 4TX8A 3FXYA 1AQFA 1GVQA 4IIHA 1UD5A 4CKQA 1XYZA 2G4FA 4C6NA 3RFAA 1TB3A 3DENA 4AW7A 2GZXA 4QAWA 4HNUA 1X8FA 2C79A 4FOJA 4L4LA 2PBCA 4WQ6A 4DUXA 3KZSA 1M01A 4RV8A 3RLGA 2QV5A 1FXPA 5AHMA 4DBEA 1TQXA 6REQA 2CWXA 2VDIA 4JTEA 2VWSA 5JXQA 1GEQA 1KQZA 1BVWA 1OYBA 2IPFA 4CQBA 4YU1A 5I6SA 1T96A 1GYMA 3GO2A 1V7AA 2E1WA 4IG2B 2NT0A 3W6MA 1PWLA 4LUYA 2E1DA 4M82A 3AO0A 2AKZA 2NUXA 4JTJA 1O7AA 3RG6A 1EEPA 3GKFA 3QFEA 3HURA 3VGDA 1L1PA 4KQNA 1XG3A 4UB9A 2I17A 2PDQA 3PBWA 3P74A 3CNYA 4ML9A 1VFMA 2GSHA 1UPPA 2N87A 2TRSA 1EP3A 1Q6DA 4PUJA 4GH3A 5KEZA 5LZLA 4XD3A 5AVNA 3TIMA 4C65A 3T2QA 2YOCA 4K2SA 3KXQA 3T0CA 4FXJA 3W73A 1H5VA 3BMXA 2VYOA 2CERA 4A22A 4PMOA 1EC9A 3VIOA 2NX1A 4O50A 1W3JA 3N18A 1PO9A 3TJ4A 4GXWA 3KRSA 4BWLA 2DG9A 2HCVA 4QISA 5U7SA 3KP1A 4IJRA 4M6PA 4WDXA 2ZUVA 4C91A 1D3GA 1Z8AA 3AIVA 2AL2B 1H7XA 3W87A 6CGTA 5H6HA 4H2HA 2ZX6A 3W1RA 2CITA 2R8WA 2P8CA 2I5GA 4IQCA 2DH2A 1VBUA 2NSXA 1J2WA 4XAGA 2OGJA 2I56A 4PTDA 5J5DA 1J4IA 2YYUA 2X2YA 3W7IA 3MTWA 4R33A 4E0CA 1TZZA 3OIXA 4IWWA 1P0KA 3W7HA 3RMJA 1VFSA 3A21A 3WQEA 1QFEA 2AQWA 1V79A 3L4TA 3UR2A 4RDWA 4RW5A 3WLLA 2EJ1A 3SRHA 3WBAA 5I07A 2CHRA 1JRBA 4KCWA 5FJUA 3FA5A 4PCPA 3UI4A 3O6DA 3CQJA 4JFSA 4DRQA 2CLOA 4LS0A 3UCDA 3KBVA 2DVXA 3G1YA 4G2DA 3VI2A 2E8ZA 4CVWA 4RL3A 7XIMA 1J0HA 3VOIA 3E6EA 3M5YA 3MY9A 2OPJA 4GUGA 4PTMA 1YNPA 2RJHA 4UR7A 5DQPA 2GUYA 1FH8A 1XKJA 3RAOA 1W1ZA 5FD0A 1VFFA 2D24A 4DBSA 4XIMA 3G2GA 3QQWA 3GR7A 1LROA 1RQHA 2P1FA 3C3NA 4HT3A 3KADA 1QOPA 1EJTC 3KVLA 3S2MA 4DLMA 1IEWA 3GXMA 1I60A 2YDQA 4TIMA 5K2ZA 3NFUA 4PRTA 2GGJA 1Q6IA 3O8AA 2INZA 2O4MA 4IXXA 2BHYA 1Z41A 1NH6A 4X9YA 4WEVX 3CQIA 3OYXA 4NG3A 1YPFA 1AQMA 1SMAA 3SN1A 3DCPA 1U22A 2VRJA 1B3ZA 2HE8A 4DZAA 5FEZA 1JZ8A 1WZKA 5XIAA 2YDAA 2EKCA 4L9XA 3UD6A 3CHDA 3FJ4A 1VHCA 1E9LA 2XG9A 4QIBA 1MQRA 3OVQA 3QPYA 3U5UA 2KAUC 4GISA 4LU0A 3PZQA 3ANUA 4GOAA 3I7SA 1DWGM 2XIIA 1SJDA 4OBRA 3LXCA 2NSOA 3KOWA 3NQEA 5HW8A 3WUBA 6TIMA 1KM5A 2HNEA 1B31A 1PIFA 2PLMA 1FKTA 3ZS4A 1UIOA 4WDUA 3R8HA 1JNTA 4IQ2A 1Y8BA 2ZRXA 5BYWA 2UY5A 3ICJA 3URNA 3EDJA 5IDIA 1F61A 3QZEA 5CZ0A 1Y5WA 3WLHA 4F2BA 2Y1HA 4KGJA 4YVVA 3LRLA 4UTKA 2E77A 3TWAA 4XIAA 4W7UA 3H4GA 3PNUA 3UCQA 4JN8A 1Z3NA 3VDGA 3MW7A 3N2OA 5E1QA 3PRAA 3STPA 1RK5A 4AZGA 4W86A 1XC6A 2D0HA 3FYOA 3IV3A 4HGXA 1KWGA 3TC5A 3A9BA 4LALA 1PB0A 4HD5A 4P2VA 3GBEA 1LQAA 3OZMA 5AOUA 1KFEA 3SZ8A 3T09A 4W7VA 3OW1A 1Z32X 3BLOA 3LLDA 2Y8UA 4WJEA 3CJPA 3QPZA 1W1VA 1EXBA 3DYMA 1TVPA 4UZUA 2VX5A 2NLYA 3AYSA 4J4NA 2J74A 2WSRA 4GQGA 3F5JA 4JS3A 4EIVA 1MFVA 4LNCA 4IMCA 4W93A 3VKAA 4F2TA 4OIFA 2UZ5A 3BH4A 2V5DA 2J7EA 2YSWA 3CQHA 5ABEA 3B9DA 4KEUA 3PHAA 5A2BA 2WMGA 3I3DA 1KKRA 1N2VA 3IJLA 1TPFA 2J8GA 4QS6A 1TCOC 1ZAIA 2X40A 3NZ1A 4C7FA 5CQ1A 3LCXA 4O16A 5TAOA 2BVTA 3EMZA 5LNWA 3QEZA 2OKTA 3WH6A 3SIZA 4MUZA 1W5PA 3BSHA 2FTWA 1RAKA 3KAHA 3UYIA 2TYSA 1XISA 4Q8PA 3AHXA 4IHCA 3SCNA 1SSGA 2E6AA 3GDLA 3KL5A 2YCEA 3GZ3A 3BLKA 1QI3A 1TWDA 1IXOA 2V69A 1WA3A 2LPVA 3ZR6A 4CCEA 1S3HA 3KUMA 4HSHA 4P7OA 1V93A 4MLRA 3LQLA 4AD4A 1ZJBA 2W67A 1F76A 5MHBA 2Z25A 3AZSA 4L9ZA 3GH4A 1UB3A 2OEJA 3WQFA 1K6AA 4N9EA 1E4LA 3O2LA 3V5FA 4IT4A 2V3DA 5HA7A 3S2LA 2FZ9A 4DB7A 3FVMA 3EX2A 4E2DA 2J7FA 4MWAE 4US5A 1UWAA 3GNNA 2A1YA 3CUZA 3FDKA 4Q4RA 5T9BG 1MXSA 1W3NA 1HJXA 2WZHA 3W88A 4CNPA 2FMOA 2DJXA 1EQ3A 1PHWA 3EXRA 1KM2A 3A3XA 3HQNA 1HJQA 1BYAA 4PFMA 4B5WA 1GVOA 5GJNA 2E6DA 1B3OA 4PYSA 3EX1A 1EH9A 3UESA 3V0SA 1DIEA 1TRIA 3R0KA 1SZEA 1ZAHA 1Q6QA 4MJZA 3UERA 4Y90A 1EF2A 3MT1A 3QQ0A 3QQ1A 1AD1A 1Q7ZA 2Q02A 2W66A 3GXIA 4QZVB 2F6KA 1ENUA 3G6MA 2PRHA 1TUFA 4JFIA 3M0MA 8A3HA 3WF4A 4HPXA 1U1UA 4C7GA 1RQBA 2DZUA 3W1LA 4DWSA 5G4HC 3DG3A 1EEXA 4GUIA 4H9XA 4G6CA 3U2OA 2A79A 1KBIA 1Z48A 2C91A 1FKSA 3EWXA 4M1BA 1I2PA 3EPNA 2Y5EA 3BOFA 4LAXA 4UC5A 5BOEA 2ZVIA 3LCGA 4WUIA 5I98A 3IJ9A 3OJGA 2QPSA 4R0XA 1PYMA 3LK6A 1AVAA 4V1YA 1Y5VA 5RUBA 4UNIA 3U4FA 3WEOA 3EOLA 4H9MA 4BI7A 4Q33A 2PLKA 5E70A 4HPHA 2E67A 1B3YA 2RGLA 5DXYA 1JZ7A 4W88A 2W92A 1F3EA 1ISYA 1DQWA 5HUPA 2H90A 2E0PA 3CAKA 4FNUA 1VEMA 3CWHA 4MB4A 2D22A 2VCAA 4MY1A 2VKZG 3B06A 2QW5A 3DHDA 4AD0A 1ZJHA 1KGUA 3DU0A 1H11A 1TPVA 2ISSA 4HK5A 5D2VA 1A0DA 1R2TA 2EHHA 2ZDRA 3QY7A 4GPNA 3SY5A 2QAPA 3HPFA 1ROTA 3H6OA 4KCTA 4YTUA 4GXPA 5CZKA 1XI3A 4WVXA 1O4UA 1P7TA 3U4AA 1JR1A 3IAQA 2A3BA 4ZQOA 2PP3A 2XPKA 3LQGA 3H2CA 1GT8A 2EPOA 3P67A 2ZCGA 2VCDA 2Y2WA 3PULA 1K8ZA 1J0JA 3SN4A 4CUCA 3WD1A 3ZLHA 3UZ5A 4LS1A 4C6PA 4NKCA 4GJJA<