3RM8A

Amcase in complex with compound 2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
377
structure length
377
Chain Sequence
YQLTCYFTNWAQYRPGLGRFMPDDINPCLCTHLIYAFAGMQNNEITTIEWNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNVKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Characterization of Acidic Mammalian Chitinase Inhibitors
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acidic mammalian chitinase
total genus 133
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rm8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3rm8A01
3VOCA 2WAGA 4M80A 4R5EA 2DQXA 4CN4A 3SEPA 2XWDA 3ZQ9A 1J10A 3KL3A 2NSXA 3AQUA 1UQYA 3VGGA 4AD5A 2FH6A 3GM8A 4PN2A 2WXDM 1IZJA 1HKJA 2Y4SA 4Z2IA 3D5HA 4GIAA 4QAWA 2Z1KA 1OD0A 3CPUA 3E1F1 4CU8A 4M24A 4UQCA 4MB1A 3S2CA 2CITA 1DTUA 2IXUA 3GZAA 3WH6A 3GH7A 3MS8A 1JZ5A 1V6WA 1DWJM 3NIYA 5DF0A 2YDQA 3WDIA 1V3HA 4A3HA 1XSIA 4AXNA 3PZNA 4GI9A 1GQIA 2W4XA 4QP0A 1WP6A 4H41A 4HZ6A 4HPHA 3MMUA 4D6JA 3CHFA 4BS0A 4J28A 3NSXA 1Q6CA 3GH5A 1D7FA 1QHZA 3VNZA 3WSUA 5FKYA 3W37A 4N0RA 1V0MA 3TP4A 5DFAA 1GOIA 4OBSA 3SCPA 3CUHA 4W8LA 2BV9A 1M53A 4CKQA 2WC3A 3AHVA 1JDAA 1QNRA 4H8VA 5HPCA 4UOQA 4ATLA 4YHEA 2XSAA 1UA3A 5A8MA 2ZX5A 2V38A 4J27A 3ZSTA 1C7SA 4IPNB 4WLCA 2UY3A 1JIBA 4JKMA 3ZJKA 3BAWA 2ZUTA 3CZ8A 1JFHA 3PTMA 1J0ZA 1EO5A 1GORA 4UZSA 1ISVA 3WUEA 2VQTA 4GINA 2PWHA 5DT7A 3VDHA 2Z1SA 4AISA 4JAWA 5A3HA 2XM2A 1XH2A 2DPEA 2PWFA 2ZUMA 1WCGA 5D9NA 3VVGA 4LX4A 2VR5A 1BTCA 5E9AA 3W26A 1C7TA 2ZX7A 2UY2A 3AIRA 2GFTA 3MANA 3AS3A 2YA1A 3CLWA 3UG5A 2Y2WA 4PTMA 4LYRA 5CLWA 1JZ3A 2E9MA 4GQQA 1BYCA 4PTVA 3ARQA 1GOMA 1V6XA 2J74A 4WJXA 2YA2A 3IAQA 3ARPA 4ZXOA 3F5KA 5A2BA 2GDUA 2BHUA 5CG0A 4D1IA 3A3HA 4D6FA 1E3XA 2W62A 2XFRA 5M5DA 3VUPA 1GONA 4HOZA 3F4VA 5DT5A 2OWCA 1GQJA 1W1TA 5JH8A 5A6KA 4WSKA 4AIUA 2WMKA 3ZJ7A 2VI0A 3VINA 2BY0A 1Q6EA 3OLGA 4W8BA 3IJ9A 2BXYA 5A6LA 1CXFA 3WF2A 2V5CA 3AZTA 2A3AA 2DIEA 3RM8A 4DWSA 4LQ1A 2OSWA 6A3HA 1ODZA 1V3KA 2XSBA 8CGTA 1KR0A 2XG9A 3RO8A 1Z32X 3WMSA 1OT2A 3ARXA 1KBBA 2O9RA 1G5AA 3KL0A 1UH3A 1E4NA 1CGWA 3W24A 1EOMA 3OB8A 4BF7A 1JYWA 1CGVA 5E0CA 3AYRA 1HJSA 3KL5A 1CXHA 3RPMA 2GK1A 4B16A 2CBUA 3PZ9A 4W87A 4AZHA 2VO5A 1FHLA 2BVTA 2DGAA 5ECUA 3PZMA 3WNKA 2VX6A 3F5LA 1GOOA 5D4YA 3WBEA 4Q7NA 2VMFA 3ZT6A 3OLIA 3ECQA 1E4LA 1EDGA 1KQZA 4IPLA 3G6LA 3CZLA 5IFPA 3VD3A 3CIVA 2VNCA 2J62A 4KGJA 5A2AA 4MPKA 2E9BA 4GZEA 5AC4A 1D3CA 3TOPA 5AC5A 2ZE0A 2BVYA 4GQRA 5CJ5A 1Q6GA 3OZOA 4WKHA 3WUFA 2EPLX 2J7EA 2JF6A 4FLQA 3DYOA 4PMXA 3GXDA 1H1NA 5I23A 3T2QA 3THDA 2GJXA 3CUJA 5CLTA 2EPMX 1BLIA 3OZPA 3L4XA 1CNVA 1NWSA 1UD5A 3CZKA 3ZJ6A 1B3YA 4X0VA 5A6BA 1HJQA 1JZ8A 1GVIA 4DWSB 1W9PA 1JL8A 2G4FA 3VILA 1JI2A 6CGTA 1J12A 4KMQA 1WDSA 1LL4A 1KWGA 1N82A 1BGAA 1QVBA 2RGMA 1QW9A 1JFXA 3CMGA 3VNYA 1XCWA 2YDRA 2F8QA 4DM1A 2ZUNA 3ZO9A 5IHSA 1WZAA 1UG6A 4TTGA 4RE2A 4U33A 1AVAA 5BYWA 1K9EA 1UR9A 5JUVA 3ARVA 1UH2A 5HBFA 1BPLB 4W86A 1UOKA 4ZXLA 1MYRA 3PZIA 3WF0A 1E6ZA 3W53A 2GUYA 5GNYA 3SUSA 1RH9A 2GDVA 1WO2A 1TE1A 5EBAA 1XHGA 3IAPA 4LPCA 2G3JA 5I5RA 1XRVA 4F9JA 1QBAA 2D3NA 2TAAA 1ZBKA 4JL1A 3SURA 3IK2A 4ACZA 2FH8A 4NF7A 3DC0A 1ISZA 1CXEA 5DMYA 4Z2GA 4AMCA 1C8YA 2G3NA 4J3WA 2O9OA 1HVQA 1HJWA 1YQ2A 3NDYA 3AICA 3NYDA 4QLKA 2WVUA 4M8UA 1H41A 3N11A 3W28A 3VIMA 3L4VA 3W6MA 3FNDA 3AMKA 1QNPA 3W25A 3RM4A 1WAWA 3GBDA 5A2CA 1BYAA 1VENA 3WQ4A 1R7AA 1UR8A 3AMGA 5ABHA 3U7BA 4PMOA 3N12A 1PZ3A 1UWRA 3MSGA 1W9VA 2Y24A 1GOKA 1JZ7A 1EIBA 5CZKA 3T0DA 2C8NA 2VCAA 2CCRA 3O6AA 4AYSA 3WELA 4GO8A 2OSXA 1B3WA 1FHDA 2PBGA 3VGFA 2JIWA 4V2XA 5GPRA 1GVYA 1CBGA 1L8NA 3MMDA 3J7HA 3WQVA 4WIWA 1C3FA 1JXJA 1H4PA 3WNMA 1UWQA 2W66A 1V0LA 2VR4A 1MW0A 4B9YA 1KXQA 2X2YA 1UYQA 2QHAA 4B15A 1WDQA 2VRJA 2VL4A 2DSVA 4J3SA 4DUXA 4TX8A 5DO8A 1KR1A 3WFZA 2CKRA 1OT1A 3VD7A 2V5DA 3VX0A 2JALA 4BQ5A 2OYLA 1E6XM 1QI3A 4W7UA 5F7UA 2V3GA 3ZJ8A 2OWXA 3NUKA 4W5ZA 3EYPA 5CSYA 1FFRA 2WBKA 4AZ5A 1WDPA 3PBGA 3N15A 2GSJA 2WBGA 4L4OA 3WIJA 5JBEA 2ZXBA 4PBGA 1B90A 3AMDA 3HU7A 2WM0A 4UFKA 3WEZA 4PMNA 1G9HA 5AY7A 1KQYA 4E8DA 1QHPA 5EB8A 1Q6DA 1E56A 4PEEA 2YBTA 3UESA 3BAXA 2BFGA 4KRUA 4DWSD 4UNIA 1V0KA 1KXHA 4OUEA 1E6NA 1OIFA 3CUIA 3WH8A 4EANA 1EDQA 1KXTA 1V02E 5GNXA 4D6CA 2VT0A 4NZCA 4YHGA 2YA0A 2YDSA 5D9MA 1WB0A 3VM7A 1CENA 2DT0A 1E70M 3KWXA 4J3VA 1JAEA 2UY4A 4GO9A 4AD0A 4PUDA 4HZ7A 3FAXA 1BG9A 2FHFA 2VZSA 2E0PA 4LXFA 1AQMA 1V08A 4GXPA 3CHEA 4PTXA 3SCSA 2CKSA 1L0PA 3BSHA 3K8KA 4D6HA 2Y5EA 1W91A 3A6OA 3OBAA 4P7OA 3W0KA 2VZVA 2J7BA 1E71M 3VDAA 1HP4A 4TOQA 2DT3A 4OJYA 1FOBA 1LJYA 7TAAA 3QOKA 4OOZA 4JCMA 5A8PA 4UQBA 1B0IA 1PZ2A 3M6DA 1GQLA 1LG1A 1Y7VA 2WWCA 3WQ5A 2WB5A 4F66A 4JHZA 5E09A 2XGIA 3SUTA 2JF7A 5LYRA 1ZS2A 4GI6A 2ZXQA 3KEHA 3BAKA 4PCTA 2J25A 1PAMA 4GI8A 3W4RA 2X8RA 5IHRA 3ZMRA 1MQRA 2PWDA 2WZIA 2CHNA 4CCDA 3CHCA 1ZL1A 1GJUA 3MV01 2CXGA 4D72A 3CGTA 1E3ZA 4UFHA 2JEPA 4J3XA 1B3XA 1UQZA 1BFNA 2J7HA 5JIWA 2XJ7A 3K4AA 4LGXA 1PEZA 2ZXDA 1U30A 4RL3A 3VDCA 4CVWA 4W7VA 3EBVA 5BRPA 2AOSA 1JAKA 4U3AA 1E5NA 3POHA 1KGWA 2WCGA 1JXKA 1XH1A 4UFLA 3PZOA 1DWIM 4HU8A 5LA2A 5BROA 1LG2A 1VEMA 3VIHA 3VMPA 5E70A 4B3LA 4XB3A 4CVUA 1VFFA 1LLOA 5D9PA 2CESA 4CU6A 1ISXA 1E43A 4F9DA 2WANA 3MU7A 5KEZA 4MJ2A 1E4MM 2CERA 4CUCA 1HKMA 3WMCA 5C71A 2C0HA 1HJVA 2UY5A 1ZJBA 2DH2A 4TVDA 2EBNA 2CEQA 3MKKA 1X6LA 4N42A 1K9DA 1VBRA 4C7FA 2YJQA 4U2ZA 3FN9A 4L4PA 4H2CA 1JNEA 1MW3A 3VO0A 2VX7A 2AAAA 3KZSA 5A95A 1SFSA 1WNOA 2XVGA 4UR9A 1NARA 1B3ZA 3W27A 1V02A 1DWFM 1CLXA 2ZX6A 1GOWA 3AMLA 1TG7A 2YL8A 4MAZA 4EAMA 4PCSA 4X9YA 3GXFA 1HL8A 2XFFA 4EE9A 2VCCA 2XUCA 1W1PA 4ACZB 1SR0A 1MW1A 4U3CA 3CZEA 5CPTA 4AEFA 1UD4A 1NWRA 3EDKA 1W3LA 3UG3A 2X1IA 1VFOA 1V3LA 4P7RA 1DWAM 1XYZA 4PMVA 4ATDA 1H3GA 5A6BD 4AZ7A 3APGA 4HU0A 3RJYA 2VZUA 3ZR6A 3I3EA 1M7XA 2WYSA 3MO4A 1HN1A 1BVNP 1S46A 2WLZA 1TA3A 2WMGA 3AMCA 1JD9A 2VJXA 3WH5A 3MMWA 4AWEA 3U5YA 2PWGA 4JCLA 4U31A 1W1VA 2WCSA 2ZX9A 3VIJA 1EXPA 3VGHA 1DHKA 1JYVA 2DEPA 1JZ6A 3RCNA 5A6JA 1DP0A 3I3DA 1PPIA 2J77A 5CPSA 2XFYA 2ZX8A 4ZFMA 3ARUA 5GNZA 4MB3A 4HZ8A 2YIHA 4Z2KA 2DSKA 1FH8A 5CQ1A 3BC9A 7A3HA 3L4ZA 3WDRA 1US3A 1UZ4A 1XSJA 2D0GA 3K4DA 4FLSA 1OB0A 4AD4A 3L4TA 1LL6A 4QLLA 3ARWA 4JFSA 3QHOA 4S3KA 1K9TA 2D0HA 1HVXA 2VX5A 5HNNA 4OKDA 3MSDA 4BZYA 3THCA 4MB5A 1BSIA 5ABGA 4K68A 1LL7A 1CXKA 1W3JA 2ESCA 1MWOA 2XHYA 4W5UA 1VBUA 4UFIA 1UD2A 1IT0A 4AIEA 3EMQA 3S6TA 1CPUA 4GPNA 1JDDA 3A4XA 4XZWA 2J8FA 4GKLA 2YBUA 4XZBA 4JFUA 4PMZA 3T0BA 4MDPA 3FY1A 1K9FA 2WSKA 3LPPA 2WMIA 3EMZA 4FLRA 1ZBWA 4UQ9A 2J75A 1CXIA 2A3CA 1CGTA 4Z2LA 3ZOAA 4PYSA 3JUGA 4D6EA 1B9ZA 2PB1A 3WF4A 3CZJA 4AZCB 3SCOA 3POCA 4Z2HA 2VRQA 2D20A 2BHZA 4UTFA 2EPKX 3LPGA 1BHGA 4CD7A 3TTOA 2G3IA 3WN6A 3L4UA 3BLPX 1QI5A 2GVYA 4E2OA 5CPQA 1R86A 2PI6A 5C8BB 1QBBA 2ZWYA 1KWKA 1QI4A 1M04A 1WDRA 3FAWA 4S3JA 5FOOA 3GTNA 1WPCA 2JFEX 2GJXB 1HNYA 5M3WA 2XVNA 4M82A 3WD1A 2DH3A 4UCFA 1NP2A 3VMOA 3GXIA 5I24A 2WC7A 3RILA 1PX8A 4HTYA 1XGZA 2QPUA 1E0VA 3UEQA 1M03A 3BXWA 1CEOA 2EO7A 4XX6A 3VIPA 2IUZA 4PMQA 1QI0A 3NDZA 1H0IA 2W92A 2BXZA 3W6LA 1UKPA 3IJ7A 4XUYA 1UD3A 1RP9A 5CGMA 3OGSA 3WUBA 4LYQA 3BCDA 4WK9A 1J0KA 3GXMA 3T09A 2CHOA 3U57A 1ISWA 3ALFA 2ZUVA 4W89A 5A8OA 2OYMA 3SCQA 1BGGA 4E8CA 1AMYA 3L4YA 2WMIB 3A47A 1NOUA 3VU2A 5E6ZA 1BYBA 1V3IA 2BY2A 4CCEA 1QNSA 3OA5A 1NP0A 2X09A 5CGTA 4H8HA 1ZBVA 1NOWA 4MNLA 3MUZ1 2VUYA 3ARTA 4QFUA 1E4IA 2BS9A 1UKSA 4MB4A 4M81A 1VEPA 2D23A 2VZTA 2J4GA 5M03A 1HXJA 1E1FA 8A3HA 1QNQA 1ITXA 4BQ3A 5JIPA 3WNPA 1FA2A 4UOJA 5A8NA 1V6UA 1ZU8A 3F5JA 1PIGA 2D1ZA 1FH7A 2WPGA 2JEQA 4H8UA 1G01A 1C8QA 3B9AA 5D8WA 1OD8A 1K6AA 3WFLA 3EDJA 3TA9A 2XWEA 2CBVA 1E0WA 3GH4A 3VIGA 2VC9A 4TX6A 1U2YA 4HMDA 1DWGM 3ZM8A 1VJSA 5LA1A 3SCWA 4MDOA 2W61A 5D9OA 3AZRA 3WQWA 2D24A 3T2PA 2YL9A 1JF6A 3BGAA 5BXSA 1GHSA 3WD2A 5ABFA 4AIOA 3K1DA 2PC8A 2VCBA 1V3JA 1G94A 1W3HA 1HP5A 5I78A 3QHMA 4P8UA 3ARRA 2VX4A 3WH9A 2ZUWA 1UUQA 3RIKA 1H49A 3WBAA 1WE5A 1PX4A 2W67A 5IXEA 1QOXA 1DWHM 2NT1A 3WQ6A 2WVVB 3SUUA 1MFUA 4IUGA 1MVYA 5CSUA 1CDGA 1UR4A 1E5JA 2YOCA 4HA4A 3EDEA 4Z2JA 2O9TA 3VIKA 3W29A 4F79A 2WHMA 3K8LA 1WKYA 3AXHA 3EDDA 4EKJA 2VURA 1KXVA 2X0YA 2F61A 1VFMA 3VPLA 3GNRA 2W63A 3LMYA 1GW1A 2DSUA 2DT2A 4AZGA 3CH9A 3L2LA 2V3FA 4BCEA 3PZUA 3ZT5A 1C93A 2WVSA 7CGTA 1XYFA 3VTRA 1ZB5A 3B9EA 1A3HA 4DWSC 4AZIA 1ODUA 2WK2A 1XSKA 2WMFA 4W7WA 2JE8A 4MNKA 2VOTA 4P7QA 2VVSA 1RD6A 4UFMA 3WMBA 1JF5A 1HJXA 4B9ZA 1CLVA 1MXGA 2ZXAA 5FL1A 1UHVA 3VD5A 2XIBA 1E0XA 2E8ZA 1EDTA 4CU7A 3WNOA 1C92A 1JDCA 1MFVA 1TVPA 3AIUA 3UETA 2GK1B 4A3YA 4KGLA 2WKLA 1CGXA 4CD6A 2CBIA 3PZTA 2HVMA 4OZOA 1C8XA 2WCAA 4JZ5A 4ML4A 2E40A 3VGBA 1XH0A 2WVVA 1GHRA 2D22A 1BYDA 1JYNA 1EHAA 2J7GA 2BY3A 3AXIA 3RDKA 2F2HA 1F4AA 4F8XA 1KGUA 2XVLA 3ALGA 4YPJA 4NRSA 1NQ6A 2EQDA 1W9DM 4QCEA 4RE3A 1MQQA 1U33A 5A6SA 2QV4A 5M17A 4JFTA 2NW0A 3UCQA 2WHLA 3TONA 1TUXA 3FHAA 3ARYA 4HA1A 4JFVA 1XCXA 1QHOA 3W38A 3AHXA 1XV8A 2XVPA 3M07A 1UR2A 1OWQA 5BRQA 1J0IA 2OYKA 2XVKA 2WC4A 1F4HA 3OIHA 2HISA 3BLKA 1ECEA 4WF7A 1BVZA 5HPOA 3T08A 2DT1A 1UWIA 4P8WA 5JBDA 3AHZA 3DYPA 1NOFA 4ZE4A 3VIOA 4GZIA 3AROA 4AY1A 2VRKA 3AS1A 4JFWA 5BWFA 1DEDA 3L4WA 2FDMA 2IXVA 2WSPA 1O7AA 3AJ7A 3WUGA 4AC1X 1CYGA 3WEOA 1PJ9A 1XD1A 1XC6A 4HA3A 5BXPA 4FMVA 1P6WA 4CN1A 4RE4A 5EFDA 3WNLA 1V3MA 2Y8VA 5BCAA 1BF2A 3VD9A 3AFBA 1V6YA 1ISYA 4J3UA 1OM0A 3N13A 4BQ4A 4XV0A 3O9NA 4LYPA 1PX3A 3BMVA 3OLDA 1QNOA 2ZIDA 3VX1A 4X0NA 3MV11 2J79A 1BQCA 5TD4A 4C7GA 1VEOA 1R87A 2FGZA 1VJZA 3BSGA 3N04A 3TTYA 5A94A 2EEXA 3WENA 3ZR5A 2WKGA 3VGDA 3CUFA 2XTKA 1E1EA 1VRXA 9CGTA 3T0AA 4OIFA 1US2A 4OOUA 4PRWA 3PZGA 5EMYA 4D1JA 1NH6A 4FLOA 3AISA 4C7DA 1CIUA 3MUAA 1FH9A 1WZLA 3UERA 1X1NA 3BH4A 1UH4A 1OSEA 2CYGA 2J7DA 1J0YA 4V27A 4A4AA 4PMRA 1AQHA 2GJPA 4HPGA 2DSWA 1VAHA 3TTSA 3GBEA 3U7VA 1SYTA 1TCMA 2YLAA 4EK7A 2W91A 4D71A 5E0FA 1TMQA 2WNWA 3OLEA 2GJRA 3SCUA 3I3BA 1YHTA 4JIEA 4D6DA 1JNDA 3RM9A 4BQ2A 1D2KA 5I3DA 1HKIA 4W88A 4JKKA 1UR0A 1C91A 3L2MA 3HMCA 3FHQA 4MJ4A 4YN5A 1JG9A 5FL0A 1TZ7A 4PUEA 4U2YA 1BG4A 3BAJA 2PF0A 2A3HA 3VDBA 2AMGA 4P7LA 5I6SA 4UFJA 1EH9A 4HMEA 4NI3A 1EGZA 4OBRA 3VMNA 1NM9A 1OBAA 1R7OA 2QMJA 2FHBA 3WDJA 4NRRA 3AIQA 3VKKA 4QDMA 2WLYA 1M01A 1EOKA 2VZOA 4AZ6A 1TA3B 3M46A 3NSMA 2XPKA 2OWWA 2FHCA 3HJEA 4TUFA 1NWUA 1GNXA 5IDIA 3T2OA 1H09A 1B2YA 4W8AA 1JI1A 5ABFB 3RMEA 1UD8A 4PMUA 4UQDA 2O92A 3CUGA 4V28A 1UWUA 1UD6A 1V03A 1CTNA 1E40A 2DDXA 6TAAA 3WF1A 1QW8A 1A47A 1MQPA 1EHNA 2JIEA 3EMCA 3OGRA 3QHNA 4M29A 5A1AA 2ZWZA 1I1XA 1MXDA 3WDHA 3AS2A 2J8GA 5ABEA 1GCYA 1B3VA 1JYXA 1HF6A 4AD3A 4FK9A 3CO4A 1J18A 2G8ZA 1JZ2A 2J7FA 3LPOA 3WNNA 4UQEA 4UOZA 4WKFA 3TTQA 5DEZA 1TFVA 1CZ1A 5FD0A 2X0HA 1W3KA 2YL6A 2Y8KA 1CGYA 1EA9C 1KB3A 3VIFA 3AHYA 1GJWA 4QCFA 1HJUA 1E73M 3IJ8A 3WKZA 2A3EA 2YL5A 4UZUA 3N18A 3UR7A 5HOSA 2VTFA 4E4PA 1OGSA 5E6YA 4W84A 3WEMA 2WMJA 1KCLA 4DUVA 4W93A 4BA0A 3AOFA 4B3KA 2WZHA 4UQAA 2O9PA 3AYSA 4Y7EA 1WZKA 3OG2A 1JGIA 1HT6A 3WD0A 1J01A 4MTVA 1W2PA 4DUWA 3K46A 1B30A 4AZCA 2WWDA 4M1RA 4PMYA 1LWJA 3W82A 4ATWA 1J11A 2E9LA 3WDQA 1W2VA 1UWTA 3N17A 2XGBA 1KCKA 1UKOA 3LPFA 2YLLA 3G6MA 5BXRA 1HIZA 3BAYA 1SMAA 5C70A 4U5KA 3A4AA 5AYBA 4AD1A 1FP9A 2QF8A 3BAIA 4URIA 2CBJA 3CHDA 3MUIA 5I2UA 3PN8A 5AYIA 2D2OA 2E4TA 4ACYA 1CGUA 1H11A 5GQBA 1FFQA 1HX0A 2ZUUA 1ESWA 3NJ3A 3ZSSA 2WVTA 1W9XA 3ARZA 1CXLA 3DHPA 3FW6A 4MAVA 1KFWA 1E6QM 2V3EA 4M56A 1PIFA 2DIJA 3CZGA 1E6PA 4J3TA 3QOMA 2XM1A 5I79A 3VM5A 1I75A 1UA7A 3ZT7A 3PTKA 4MADA 3AIBA 4P7NA 1H0GA 2WHJA 4H7VA 4QLJA 2X05A 1SMDA 1LWHA 1VFUA 4H04A 3EDFA 4AD2A 4J7RA 4TVCA 4AW7A 3BMWA 1UKTA 1WZMA 3UG4A 4HOXA 3NCOA 3W81A 3QGVA 4HOWA 1GUVA 1VB9A 4PTWA 1W32A 4TXEA 4Q22A 4CGTA 2NT0A 4KRTA 2EPOA 3MUY1 1O6IA 1ZJAA 1B1YA 3WY1A 4TVUA 3AIEA 4ZEPA 3PZQA 1W9BM 3AXXA 3WL1A 1Q6FA 3AHTA 4NSBA 1OGGA 2Q8XA 2ZUSA 4ZENA 3WF3A 2WW5A 1UKQA 4KH2A 4AEEA 4IISA 1OINA 1ZBCA 2D0FA 1TVNA 2J47A 1VIWA 3IANA 1GOQA 1CECA 5KZ6A 1E72M 1LF1A 3GNOA 2OLHA 5BXTA 3AIWA 1C90A 3GDBA 3A4WA 2WHKA 5CXPA 2V3DA 4CN6A 1GPFA 2WZEA 3M7SA 4R27A 4MNMA 2UWFA 4AZBA 1RPKA 2G41A 4P8VA 1E6RA 5I77A 5LA0A 3DECA 3U5UA 1W9UA 2E3ZA 2BY1A 3UR8A 3VD4A 3WH7A 3K8MA 2EJ1A 2CNCA 1AQ0A 2CPUA 3GYCA 3QR3A 2W5FA 2OSYA 1OGBA 1ITCA 1CWYA 1E55A 3ARSA 3PTQA 4CD8A 3N1AA 4TTUA 5A6MA 2BNJA 5IFTA 1OCQA 2FGLA 1HKKA 2EXOA 3B9DA 1JD7A 1LQ0A 1OIMA 3DHUA 1KGXA 3VIIA 4HMCA 3SCRA 1XD0A 3KE0A 1HL9A 4PSPA 3II1A 5EFFA 2ZICA 2A3BA 2PBOA 1GZJA 4JL2A 3WQ8A 1V6VA 3GNPA 3SCVA 1E6SM 4PMDA 1V0NA 2J78A 4IM4A 4P8XA 1EQCA 1H2JA 1R8LA 1G1YA 4U5IA 2D3LA 4ZE5A 3AS0A 1MW2A 3RJXA 4D6GA 5FIPA 1BAGA 5A69A 3VGEA 5A8QA 1G0CA 2DSZA 3CBWA 3N9KA 1J0HA 3DYMA 4JKLA 1VF8A 2MANA 1FP8A 3PHAA 3WD4A 2ZOXA 4FF5A 1QI2A 1JZ4A 1I1WA 2YKKA 1UR1A 1J9YA 3SUWA 3OGVA 3AIVA 3SCNA 4PSRA 5FCZA 2BVDA 3AI0A 3CMJA 3PZVA 5HXMA 3WL0A 3HN3A 2QMKA 2QLYA 1IZKA 1EQPA 4HP5A 3SCTA 3WD3A 3NSNA 4CD5A 4MNJA 1TR1A 2PWEA 5HDRA 1QPKA 4DM2A 1EO7A 3B8SA 2VVNA 1E15A 2RGLA 2CIPA 2J7CA 4D6IA 4W85A 3SIMA 5I0DA 2EPNA 1GQKA 3D3AA 4GZJA 1X6NA 1H5VA 4KWUA 2E8YA 3O2LA 4CD4A 2BHYA 5A6AA 1W1YA 1PBGA 1UZ1A 2XIIA 3ZIZA 4JHOA 3FXYA 1Q4NX 2G3MA 2QPSA 2VQUA 1E9LA 4WKAA 5JBFA 1NWTA 2XYLA 3SUVA 3CTTA 3WDPP 3BCFA 3AZSA 2C7FA 2WMHA 1B31A 1R85A 1KBKA 4WSJA 4CCCA 2B31A 5D8ZA 1J0JA 1IV8A 1RP8A 2CETA 1UWSA
chains in the Genus database with same CATH superfamily
3PG9A 4M80A 4YCOA 2YYTA 3OYZA 4NZ1A 1K7EA 4R5EA 4IQJA 1OG0A 4AIBA 3W72A 3FGCA 3FK4A 4MZ8A 2B7QA 2FH6A 3EGJA 2E1WA 4Y8FA 4GUJA 4DROA 1EYWA 4GX8A 1A5OC 3OZYA 5AC7A 4IIEA 4YNGA 4B2DA 1TTJA 4QG8A 4YTTA 4M24A 1DXFA 3GE7A 3EPNA 2CITA 1DTUA 3RNDA 3GH7A 5JQ9A 3DFSA 2XH7A 1DWJM 3W86A 4UWMA 3UR5A 1M41A 4RPPA 3WDIA 2PWUA 3GUWA 4AXNA 3PZNA 3BLOA 3ZZ1A 3BOXA 1PZ1A 2V9DA 3M5VA 2XSXA 4QITA 3UWYA 5C54A 3MMUA 2I9UA 3IK4A 5G2WA 4BS0A 1O66A 3NSXA 3HFYA 3SM0A 1Q6CA 4UTKA 2BTMA 4XUGA 4C6MA 5GPGA 2PRMA 3WSUA 3KAOA 4N0RA 3UQAA 1LRTA 2ZRWA 3NQCA 5DFAA 3SADA 3GVRA 3O06A 3MVTA 3BJFA 4LT9A 3TUUA 3CAVA 2P4VA 3AAMA 3B40A 4JYSA 4X63A 4C6FA 1AA1B 2NQ5A 1X39A 1UOZA 1XINA 1AUSL 4C1NA 5FJIA 3MC5A 3C8NA 1VBHA 4C6KA 1XGDA 3HGRA 1H7NA 4J27A 1N2VA 4FB7A 4ORMA 1C7SA 2PDCA 4WLCA 3OHMB 3HMJG 4JKMA 3UQNA 1PKMA 3BUVA 2RHGA 1JQVA 1EO5A 3M5XA 4XAFA 3WUEA 2QCEA 1QJWA 4AISA 3TW9A 1XH2A 2DPEA 1J4IA 1TTIA 1U5HA 2IMRA 1MUMA 2ACSA 1BTCA 1PWMA 5FSDC 3AIRA 4GJIA 3XINA 3MANA 3T4WA 1VS1A 6XIMA 1FAPA 3R0DA 4GC3A 3UWWA 2A7PA 3PUOA 1EJSC 1RK5A 3PULA 1GOMA 1A5CA 3VOIA 2YA2A 3TX9A 6XIAA 4D1IA 4IMGA 4J5NA 2W62A 3E0LA 3VUPA 3KAFA 3L12A 4HOZA 2P3EA 2ZE3A 4YJ5A 3DFQA 1KA9F 1MNSA 4WX2A 2LPVA 1TMHA 3ZJ7A 2VWSA 2NXHA 5H91A 1WOBA 2BY0A 4GNKB 3L5AA 4GISA 2XP6A 4RNHA 4KFNA 4KIEA 3IJ9A 2BXYA 3VFCA 2V5CA 4K39A 1XFBA 1Q7MA 6A3HA 4TW6A 2YBVA 2XP8A 8CGTA 1ITQA 1X1OA 2W3ZA 3CV7A 3ARXA 2HBXA 4MSPA 1E4NA 3TN3A 3OB8A 2XH0A 1BXBA 3GU9A 2A7NA 1CGVA 2XN1A 4E5TA 3KL5A 5I00A 3VCCA 4O1CA 4IIBA 3RPMA 4Z1DA 1JCXA 3B97A 3B8DA 1QO5A 2CBUA 3PZ9A 4ECLA 4HU3A 2PDGA 4ZB0A 3N19B 3O0KA 1J96A 2BVTA 4YYFA 3OHIA 3PZMA 2VX6A 3GC4A 1GOOA 3CWHA 4UNKA 3WBEA 3FJNA 3OLIA 5HULA 1EDGA 1KQZA 4IPLA 3CZLA 4KGJA 3BE7A 1I2QA 5A2AA 2GQ9A 1OYCA 4ZQCA 5E0KA 2RDUA 1GGOA 3GU0A 4UTLA 1F74A 1X8CA 4AVNA 3OZOA 3GIPA 4WKHA 3WUFA 3RX2A 3STPA 2EPLX 5DO2A 4FLQA 1UMLA 4KFPA 2BP1A 5I23A 2EPMX 3CC1A 3OZPA 4N02A 1OF6A 1B3YA 5C6MA 2OLAA 3UZYA 2A5HA 5A6BA 4HYVA 1EC7A 2IPWA 1OFQA 3QFEA 3GDTA 1JZ8A 4GK8A 7REQA 2ZC1A 2G4FA 2ZZ2A 5DRIA 1LL4A 1YLVA 5CC7A 3OZMA 1E44A 1XXXA 1QVBA 1WKEA 1HUVA 5KSWA 4GA8A 3CNYA 2F8QA 3UY7A 4B5UA 5HW8A 5IHSA 1JNSA 1T40A 4JNYA 2ONEA 4U33A 3NTPA 5KMYA 5BYWA 2Y7FA 5JUVA 3GRIA 1NEYA 4PEKA 2IQTA 3W87A 5EU9A 4HBKA 1UH2A 1LUCA 3FYYA 1UOKA 1MEHA 2J9XA 4ZXLA 1MYRA 1FHVA 3HPZA 2HPIA 3RFWA 4GXMA 2TPSA 1TE1A 1O12A 2VDHA 3LM7A 1QBAA 5DIUA 2D2GA 4R3UA 5LXXA 1OY0A 1ZBKA 3GSMA 4CQ9A 2PCEA 1B4EA 3IK2A 3H7VA 2FH8A 3SBFA 3U2OA 4NF7A 1GKQA 3A13A 3W2UA 4Z2GA 1C8YA 4J3WA 3SN4A 3O5PA 3LLXA 4KEMA 1ICSA 5K3VA 4M8UA 4M3PA 1M9HA 3VIMA 1XIGA 1KM0A 4QG6A 2BLEA 3GBDA 1BYAA 1XKYA 2ZKMX 3M64A 5D2VA 3T7VA 4DT4A 2MF9A 3R8HA 3XIMA 3GKFA 4TX9A 4OE7A 5JH2A 2G4JA 1JZ7A 1SFLA 5LGXA 2Z7KA 3O6AA 4E4UA 3HTWA 3WELA 4GO8A 1KCXA 1IYXA 1B3WA 3PRAA 4R7WA 2RJHA 2NWRA 4BI7A 5I3IA 3TC5A 4V2XA 5GPRA 2PTXA 3C0LA 1L8NA 4IGHA 2GVEA 2ASHA 3J7HA 3UA4A 3WQVA 3MVIA 3KTXA 3E5BA 1JXJA 4LU0A 4FX6M 2H9AB 3G1RA 2W66A 4N6FA 4TV6A 1R9HA 1MW0A 4UBPC 4B9YA 3QXBA 3IV8A 2HQAA 1J4EA 1WDQA 4O4WA 2C19A 5D02A 2VL4A 2DSVA 3CXOA 4GRSA 1WXYA 3Q94A 4BWLC 1KBLA 1OT1A 3VD7A 4ROQA 2OYLA 7XIMA 1Y0OA 3IV3A 2V3GA 2NQJA 3GD6A 3LG3A 5AECA 5DITA 1K4HA 1AG1O 3EYPA 4NNAA 5G4HC 4AZ5A 5FF7A 3V1HA 1WDPA 3N15A 3H9RB 2G97A 4L4OA 2PGWA 2ZXBA 3I68A 4PBGA 1B90A 1Q13A 3HU7A 3UQBA 1KRCC 4UFKA 4E8DA 3CMFA 1QHPA 1Q6DA 1E56A 2Y1HA 2XIMA 4I7WA 5G5IA 3QJAA 1KXHA 1RCOB 3BLDA 1OIFA 4XVDA 1EDQA 4FX7A 4FNUA 3I4KA 1V02E 3S83A 1Q6OA 5GNXA 4NZCA 1F8IA 2DZBA 3W75A 4QE1A 3W7KA 3ITVA 3NQ2A 3LGGA 4LCRA 5D9MA 1CENA 1GVRA 2DT0A 4BF8A 4RKAA 3A24A 4DRHA 4OU1A 1Q66A 3KWXA 1LWIA 2VD9A 2R14A 2X40A 1QASA 5F1UA 3P67A 1VYPX 2ICSA 3RGCA 2VZSA 1YDYA 1S39A 4LXFA 3A22A 3RPTA 3U4FA 1V08A 3CHEA 3SCSA 2CKSA 4D8AA 3BSHA 3VCRA 3A6OA 3OBAA 2OZTA 3W0KA 2GLKA 3IJIA 5HWCA 2ACQA 1HP4A 4MWAA 4OJYA 3W74A 4GQGA 1FOBA 1LJYA 1QWGA 7TAAA 1UASA 2J6XA 3IK8A 1ZK6A 3CAKA 4KWSA 2A0NA 4Q4PA 2PGFA 3O5RA 1LG1A 3FA4A 3QMRA 4F66A 2FZ8A 1PV8A 1ZS2A 4JTKA 1H7XA 3BAKA 4PCTA 2J25A 4QBXA 2ALDA 4RZ6A 4L5ZA 4CCDA 2PTZA 2CFFA 3MV01 1E3ZA 1OJXA 5AC8A 4JNMA 3WLPA 2JEPA 1QU4A 3O5QA 4MOZA 2XJ7A 1ICPA 1PEZA 2ZXDA 3VDCA 4W7VA 3VI2A 5CAHA 3KTSA 4ZPWR 1JAKA 3LB0A 1MMFA 3B8TA 3POHA 4E2DA 4C1LA 1PSCA 4IQ2A 4LB3A 1DWIM 1F07A 3AWOA 4GIRA 2E6FA 3T1GA 1B5TA 5AB3A 1NELA 4QM1A 4JICA 3VIHA 5E70A 4B3LA 3EOSA 4CVUA 4LSBA 1E43A 4F9DA 4H6QA 3SFKA 5TQLA 3KOZA 1TWSA 3TJ4A 2E68A 3PJXA 1XBVA 1HKMA 3WMCA 4HT3A 2C0HA 2ZRZA 1BF6A 2EBNA 3TU9A 1L6GA 1LBLA 2CEQA 3MKKA 3BCJA 2UZ5A 4N42A 1K9DA 1VBRA 4C7FA 3U3HA 5FJOA 1FKHA 2NUYA 1L9WA 4H2CA 1JNEA 2OVLA 3EA1A 3D3FA 3VO0A 3FJ4A 3V16A 3GFZA 1SFSA 1WNOA 2XVGA 4C5YA 4UR9A 4CNNA 1G7UA 3NEHA 3W27A 3EEZA 4WR3A 5HWBA 1CLXA 4XZHA 4HNLA 5C7HA 4WD0A 2PLMA 2XFFA 4DF2A 1UUOA 1M5YA 4EVZA 1W1PA 4U3CA 3S5ZA 1W3LA 1U79A 2IKGA 5DX7A 1LCOA 2YXXA 3BQ5A 3ABXA 4NP7A 1EFZA 3L23A 3KCLA 1AL8A 1PKNA 1L6YA 1A50A 4ZO9A 3LHVA 1EPVA 3RU6A 3RJYA 3W84A 3I3EA 3KCJA 4JQAA 3H4WA 1FKBA 2FTWA 5JVLA 5HWNA 1HN1A 1S46A 1TA3A 4AWEA 3O5EA 1JD9A 4XZIA 1K70A 3U5YA 2ACUA 3GTXA 2PWGA 5GJNA 1W1VA 2ABBA 1YNQA 3HG4A 4IQLA 1DHKA 2DEPA 3OA3A 5DBUA 3RCNA 1PHWA 4RDWA 3ARUA 3P8JA 5A5WA 3CV2A 3E0FA 4Z2KA 2DJLA 1IHIA 1UZ4A 3SRHA 5I3JA 3K4DA 5CJMA 4DAFA 1OFRA 2BVWA 1LL6A 1A0EA 2Z2UA 5K9CA 3NRKA 3K2GA 5HNNA 4S3GA 3W85A 2D9FA 1BSIA 4W5UA 2BB0A 3BG9A 4YMZA 2REQB 4FIQA 1UD2A 5CKSA 1IT0A 3EMQA 2BX7A 4GPNA 4XZWA 2J8FA 2YBUA 4DRMA 4PMZA 4FOKA 3FY1A 3FAPA 2RH9A 3MB9A 4HK7A 2BBFA 3H2OA 3ZWSA 3N4AA 4ICNA 4UQ9A 1V4YA 2Q8ZA 4JN8A 4JIRA 3GAYA 4EPBC 5HMFA 4Z2LA 3RRAA 3ZOAA 4DRNA 4AHPA 3S1GA 2PB1A 2GSEA 1UP0A 1RVKA 1G4PA 2INEA 4XTDA 3SN0A 5TBOA 2D20A 4XAKA 2EPKX 1SFJA 3QW4B 4MF4A 3BLPX 1QI5A 2OO6A 5CPQA 1B9BA 1KWKA 3CB8A 2ODOA 5FOOA 1VZWA 1I2PA 3GTNA 2GJXB 1HNYA 3WBWA 2P0OA 2PDJA 4NXKA 3WJSA 1IX5A 1GPWA 1FX6A 3VK5A 2ZADA 1AODA 1OFEA 3UD6A 2WJDA 1Z3NA 1OX4A 3PB2A 4S2CA 3MWCA 2XU2A 4ZODA 3RR1A 1Z41A 3DCPA 3BXWA 3W07A 4PMQA 2GQAA 4FIRA 1RV8A 3LHUA 2PN0A 1R46A 3WUBA 4LYQA 3MJMA 1S5NA 1IEXA 1G6CA 4YS1A 3A47A 1NOUA 3VU2A 4PUUA 1BYBA 1R3RA 1QNSA 1YTDA 3R11A 5G1MA 3OA5A 1NP0A 2X09A 1MSSA 1IT7A 1ZBVA 2WJZA 2FYMA 1KTNA 3TVAA 3GIYA 2AL2A 3PF3A 4M81A 1VEPA 2NSOA 2VZTA 1TTPA 2EG6A 4B4FA 5M03A 2Z27A 2DFAA 2G95A 4GGHA 5FEPA 1ITXA 1DVJA 5JIPA 2RUCA 5A8NA 1V6UA 1ZU8A 1O5QA 4DJFA 1OFAA 3NVDA 3S5YA 4ICCX 1S2CA 4H8UA 1G01A 1R9ZA 1F6YA 4Q8WA 5BW6A 4NYYA 3GFYA 2VFGA 3PS7A 5DRCA 1E0WA 3UJ2A 2VEKA 4HCDA 4KEUA 1E9ZB 4BEQA 3LBMA 1ZCOA 1ZTVA 4HNNA 2HDJA 1TWZA 3WD2A 3KBVA 1DJXA 3C8FA 3W3OA 4AF0B 3TEVA 4HKPA 2RJGA 1PINA 2V2HA 3W7GA 2ZUWA 5DN1A 4ZR8A 5D38A 3RIKA 2RUQA 1WV2A 4H8NA 3OU8A 2CZFA 1UIPA 4OV4A 4IIFA 1DWHM 2PU1A 1N1AA 1V7AA 4PUNA 3LA4A 4S23A 2XP4A 3QV9A 2B7NA 3Q37A 3SUUA 4PUJA 1MVYA 1REQB 3ELFA 4KS0A 3F4CA 3IJDA 3BTNA 4QS5A 1NF0A 1E5JA 1JULA 5HATA 1OZQA 4YIWA 1RD5A 3EDEA 3GXTA 4UNLA 1OF8A 1NF7A 1MI3A 3VIKA 3W29A 1XCFA 4UTWC 4NYUA 1LP6A 2POZA 3HV9A 3GNRA 1EZ2A 4Y6GA 2W63A 1UJPA 2VKZG 1G7VA 4L9XA 2E6DA 3W7MA 5KZMA 2WJEA 1YE6A 3JXVA 5KITA 2V3FA 1DXIA 3UI4A 1TKKA 7CGTA 4YVPA 4DZ5A 3PRBA 2PRLA 3LGEA 1MDRA 2WMFA 4W7WA 4RLIA 3E0WA 4WCJA 4MNKA 4P7QA 2VVSA 2Y5JA 4UFMA 3O5MA 3WMBA 1JF5A 3A64A 2ZXAA 1O1HA 1OFPA 1UHVA 1XF0A 2E8ZA 1JDCA 2PCQA 1TVPA 2FQIA 4IIDA 1CGXA 2CBIA 3QV6A 1BSLA 3PZTA 2EAWA 4OZOA 1MRQA 2HE8A 1FXQA 4G1KA 3CTLA 4ML4A 5J6EA 2E40A 4ERAA 3NZRA 1UPMB 2FVMA 4RXGA 1GHRA 1I0DA 4GYJA 1XBYA 2J7GA 1G4SA 3MUXA 4RNFA 1M68A 2ZTKA 3NO3A 1Y5WA 4YPJA 3MJYA 3VZYA 1SSGA 1HO4A 3UI5A 1E1CA 5CEWA 1X38A 5XIMA 4O17A 3ZS4A 1UCWA 3FHAA 1QOQA 3G1DA 4HA1A 3URAA 1QHOA 2QUTA 4A8IA 3W38A 3IACA 3C5QA 1J2WA 5BRQA 1RBOB 2C79A 4PRTA 4UCGA 1Z9AA 5LZLA 2OYKA 2XVKA 3R0UA 4LH8A 1F4HA 1XIMA 4G50A 3OIHA 2Y61A 3QFWA 2OLSA 1JR1A 2DW6A 2INZA 5TNVA 3BLKA 3WQFA 1ECEA 3W88A 1BVZA 3V1PA 2KFWA 3PUEA 1UWIA 2I5QA 4DI8A 4H83A 3LX9A 3VIOA 2G96A 1T5AA 2VRKA 1S2TA 3RLVA 1CYGA 1PJ9A 4HPJA 4CN1A 4RE4A 1BEUA 2Y8VA 4RNIA 4DJDC 3L0NA 2VC5A 3N13A 3CGNA 4XV0A 3U6WA 4LYPA 1I4NA 3KBJA 4UTHA 2JK2A 1QNOA 2ZIDA 3QEZA 1PHQA 2J79A 1W54A 1DYSA 2C15A 5TD4A 1VEOA 1Z42A 2FGZA 1VJZA 3N04A 1HGWA 3A12A 3WENA 4NIRA 2WKGA 9CGTA 1WXZA 5U4NA 3TQ0A 1JDEA 2ACRA 3LLFA 2F6KA 3R79A 2J9ZA 3O5OA 1IGSA 3AISA 4JDBA 1FH9A 1UW9A 4O1DA 4Y9PA 3W7RA 3L7RA 4JTEA 3CPGA 3I65A 1J6YA 4NJKA 1GW9A 1UH4A 4IX0A 3CUXA 4PUKA 1IEVA 2GGHA 4V27A 2GJPA 4C6BA 4F0RA 1N55A 4EK7A 3I10A 1AL7A 1SSDA 1ALDA 1XLAA 2WNWA 3MDUA 4O11A 3QPZA 4N19A 1A5SA 1VLWA 2QV5A 3I3BA 1V8EA 3FX4A 4D6DA 2D2HA 4JOMA 5FF4A 1MDLA 5D04C 1UB3A 4DXKA 3DAQA 4PB3A 1BKSA 5I3DA 1XM3A 3UZXA 2DZUA 4C6LA 3FHQA 4YN5A 1JG9A 5FL0A 4XIMA 1FD9A 3IGUA 3BAJA 3KW3A 2PF0A 5I6SA 4UDMA 2PRHA 3H70A 3HQOA 4UFJA 1SO3A 2C18A 3W2LA 3ID7A 4DWDA 4K8HA 1TV2A 1EGZA 1RCQA 3LSBA 1R7OA 2QMJA 2FHBA 3WDJA 1C9DA 4NRRA 4MLRA 3VKKA 2WZMA 1M01A 4AZ6A 1TA3B 1THFD 4E0CA 2DG4A 4KEZA 4OFCA 2NVDA 2XPKA 2OWWA 1LBFA 4GJJA 3PP7A 2GQ3A 3LTPA 3PK7A 3LUTA 1JI1A 3RMEA 1YW5A 4IGSA 1UWUA 4KCUA 1UD6A 3PUDA 2QCDA 1EEXA 4QGCA 1NAL1 1WXJA 1MQPA 5HANA 4M29A 2QVNA 5LHEA 1KKOA 2FZMA 1MXDA 3IVTA 4GFSA 2J8GA 2QJHA 3I4EA 3AWNA 2LKNA 1HF6A 2R9RA 1QPQA 4UOZA 2J88A 3W7NA 4K38A 5DEZA 1LRQA 1TFVA 3H2FA 1W3KA 3TZFA 3G3MA 4M5PA 5HUAA 1CGYA 2AQWA 2O7SA 2X7VA 3AHYA 4GGQA 1V7YA 1HJUA 1BD0A 1E73M 3WKZA 2F7FA 3S6OA 3HURA 4LNYA 4ADSA 5HR6A 1VD6A 3RMJA 2VTFA 3CB3A 4X3ZA 3W1TA 4HYRA 3DHDA 4LS2A 5E6YA 2V5LA 3WEMA 4M19A 1KCLA 4AQLA 1S5MA 4W93A 4BA0A 1NMWA 4HPNA 2O9PA 3F1QA 1M7OA 1VCVA 1PB0A 3MHFA 1TRIA 3K46A 4M1RA 4PMYA 1LWJA 2E9LA 4OV9A 1W1ZA 1UWTA 1UKOA 4QAIA 4FOJA 1XG3A 1GKPA 1R5YA 2YLLA 2VELA 3K13A 7TIMA 3W7JA 3EB2A 3A4AA 3BAIA 2CBJA 4PL2A 3W73A 4ACYA 2NZLA 5GQBA 1FFQA 1HX0A 3ABOA 3NL3A 1XYLA 2ZUUA 4QX4A 2WVTA 1W9XA 4GYFA 3G1AA 4G7EB 2HPMA 3FW6A 3GTFA 1IF2A 1HTIA 4WY0A 3ES7A 2V3EA 2DIJA 3UI6A 3BL3A 3ZFHA 2GWNA 3ZT7A 3PTKA 4DN1A 2PP1A 4P7NA 4H7VA 4ODRA 1FWSA 1D7HA 4BR1A 2X05A 4DBDA 1SMDA 1DIDA 1U22A 4O1EA 2EG8A 3EDFA 4AVOA 4AW7A 3M4HA 2OEJA 2DORA 3N6JA 3NZGA 1PL9A 3H55A 1I2RA 2Y6ZA 1WZMA 4F0MA 1X97A 1FY6A 3W81A 3K5XA 1GUVA 3NQMA 3CAWA 4TXEA 3E38A 3T40A 1EYEA 3W1XA 3GHTA 3N2BA 4H19A 2UZ9A 1L8PA 2EPOA 4KRTA 4DJED 3WQCA 5EMMA 2QJMA 4MY1A 3CM4A 4TVUA 3PZQA 1W9BM 3WL1A 5CBBA 1Q6FA 1CX9A 3THAA 1A53A 3G5EA 2Q8XA 4ZENA 7REQB 5EMUA 4QE5A 2J47A 1L6FA 1JVNA 3MT1A 3QQWA 4O13A 4JYFA 4YYCA 4I6VA 5B7YA 3A4WA 3DKJA 2V3DA 2ZZ5A 2WNNA 1TWDA 2Y85A 4O8RA 4GH1A 1RPKA 2G41A 1IEIA 2ZR4A 4DLFA 4QZVB 2Q71A 2XZ7A 3U5UA 3NQEA 1WUEA 3IKGA 4ZOBA 1W9UA 2OEMA 2C1GA 3WH7A 3TFXA 4NILA 1I0BA 1EJ7L 1GOXA 4GH3A 4EACA 3PVFA 1VCFA 3SW6A 3O5IA 4E3VA 3Q45A 3ARSA 4TTUA 2BNJA 1EP2A 1HKKA 3A3XA 4OGZA 2YX0A 3VIIA 3WFAA 3OODA 3CAQA 1TPWA 1TPEA 3NGFA 2PBOA 1GZJA 4JTTA 3WQ8A 3UGRA 2I14A 4HNVA 1RZMA 4P8XA 3UWZA 2P8CA 4U5IA 3W7OA 2D3LA 3O5KA 1ZSXA 4Q8UA 4K6AA 3U4AA 2F23A 1G0CA 5I3FA 1FJDA 3CBWA 4XZMX 3DYMA 4LUTB 4UXDA 3GLCA 2MANA 4UTJA 2I17A 2Q5AA 1L1PA 3WYZA 3OGVA 3AIVA 2DZSA 3SCNA 3DESA 2BVDA 1ZZMA 4KWVA 1A80A 4EXBA 2V82A 1IZKA 3QGAC 4MNJA 1X96A 3PC0A 5ECVA 5HDRA 1EO7A 2VVNA 5DQPA 2J7CA 1GTEA 4LBSA 4HZMA 3UFYA 1QRQA 2E5DA 3GPKA 5EPDA 5I3GA 2FTPA 5I0DA 4GZJA 2VGGA 3MCMA 5LNWA 2E8YA 2XN0A 3FXYA 2QT3A 3DKLA 2G3MA 4QR6A 5IBXA 1E9LA 4HA0A 3EKZA 1DE5A 1NWTA 2XYLA 4JD4A 4EPDC 2K8IA 4J4NA 4XBSA 4XKYB 3BCFA 1Z44A 2WMHA 5CC5A 2GJNA 3OOBA 4ZPTR 2ZZ3A 4LAZA 2YB4A 3UNDA 1J0JA 3V75A 2CETA 1DQWA 3VOCA 1XLFA 4JNZA 4L6OA 1KFBA 1KO0A 3UZWA 1SJAA 1VIZA 2AMXA 1JUBA 4CN4A 3ZQ9A 1NDVA 4Q4SA 4H7CA 3KL3A 1W8GA 2NSXA 3NQFA 2RUSA 2GZXA 3EX2A 4AD5A 3GM8A 3VDGA 3B0YA 2RUDA 2WXDM 1PBKA 1HKJA 3W71A 2KE0A 4GIAA 3NL5A 2Z1KA 1OD0A 3E1F1 2YZRA 3B7XA 2INFA 3G8RA 1FBAA 1KFCA 3GZAA 4LAVA 3N73A 3VAWA 1JZ5A 2IPJA 4HN4A 4B2DD 4ODNA 1ZNNA 2CLKA 4HNTA 2Y70A 2PLCA 1V3HA 4A3HA 1XSIA 2E7FA 1EC9A 4GI9A 1GQIA 2W4XA 4H41A 3VNLA 1KV8A 2PDYA 4D6JA 4HPHA 2FVKA 4RZ4A 2VP8A 4J28A 5DANA 4JEJA 4IZGA 3WLIA 3VNZA 1HG3A 1V0MA 3L5MA 3W1UA 3E5PA 3B8IA 2ZQVA 1CI1A 1F8AB 4CKQA 2WC3A 3NEVA 2F21A 3KRUA 1JDAA 1QNRA 4H8VA 2FKPA 1YPFA 2VYOA 5HPCA 7ENLA 1ZJIA 4YTUA 2XSAA 1UA3A 5A8MA 4F40A 2QUMA 2ZX5A 2V38A 1SPQA 5HMDA 3MTWA 4DZ3A 2UY3A 5I98A 2A6LA 4YWIA 3CZ8A 1XUZA 4IG2A 8XIAA 5HJXA 1GORA 4Z0JA 3VDHA 1Q6LA 2OZ0A 5A3HA 4JTFA 2ZUMA 1OYAA 5D9NA 3E2SA 4G9PA 3VVGA 5E9AA 1C7TA 2ZX7A 4JN6A 2UY2A 2VC6A 3CLWA 3UG5A 3RPDA 1JZ3A 1P5QA 3VKBA 3QN3A 3ATYA 3W1QA 1MO0A 1M6JA 4PTVA 3ARQA 3CQJA 1ZJHA 3C3UA 1JPDX 1ME7A 1V6XA 1C8VA 2QJGA 3A21A 3GTHA 4LOCA 1OG6A 3IAQA 1DXEA 3LNMA 2GDUA 4RZBA 1O94A 4D6FA 1G4TA 4DNMA 3LXBA 1IWAA 1W1TA 3LGDA 1R3YA 3PUGA 4AIUA 2PP3A 3LD5A 1QT1A 4NX5A 4W8BA 1IXPA 1CXFA 1TELA 3RM8A 1QXLA 4LQ1A 4DWSA 2GOUA 4L80A 2OSWA 5AC6A 1EJRC 2PEVA 1R3WA 4J2MA 1YXDA 3UR2A 1RALA 2XG9A 1XRSA 5AYZA 5HQEA 3WMSA 3OOQA 3WZ0E 1KBBA 2O9RA 3WCZA 3GY1A 3P3BA 2HS6A 3SAZA 1S3TC 2OT0A 3THQA 1ZFJA 2M1IA 3AYRA 1NY1A 1KBIA 5G1YA 4FR6A 1C9WA 4W87A 5K9XA 3ERPA 3B0XA 2ABAA 4K36A 3O7UA 3THUA 2OFJA 2DGAA 3WNKA 3F5LA 5D4YA 1UC4A 3SJNA 2HSAA 4DRJA 5IDZA 2VMFA 3I6TA 3ZVIA 1E4LA 3G6LA 2Z1VA 4GQBA 3M43A 2PFHA 1PIIA 1JGMA 3URQA 3GU1A 4MPKA 1XICA 3IARA 3S2NA 4V33A 2WNQA 3ZWTA 1D3CA 4FI4A 3GU2A 1FCUA 5AC5A 4TX0A 2R1MA 2BVYA 2OODA 4GQRA 3HPFA 1TPVA 1GYNA 3H23A 2GUBA 4GKTA 2JF6A 3DYOA 2OOGA 1H1NA 3GXDA 4R53A 2Q3OA 1ZCNA 3M47A 2RKXA 3ANYA 2ZZ4A 3C0JA 1FWDC 3L4XA 1J4RA 2BGNE 3CZKA 2I5GA 4X0VA 1XQKA 1KM4A 4A3RA 4Q4KA 4OTKA 4D9PA 3UT0A 4DWSB 4WXYA 3RHGA 1Q8JA 3VILA 3CGMA 1J12A 4TMBA 1WDSA 1KWGA 1BGAA 1QW9A 3TW7A 1XCWA 2YDRA 3WLMA 3TLQA 2ZUNA 3ZO9A 1WZAA 2B7OA 1UG6A 4TTGA 1AVAA 1TIMA 2HMCA 3UF9A 4B5TA 1XIIA 3LTYA 4FN2A 4LS0A 5ENLA 3ARVA 3LCLA 5HBFA 2V81A 4W86A 1E6ZA 3S6DA 3SUSA 3ZR4A 3BJTA 4PFMA 3SY5A 3EEGA 3UZZA 1R38A 1BVWA 2R91A 3KBNA 2G3JA 4F9JA 2D3NA 2TAAA 3G1SA 3K30A 5FJRA 3RO6A 3B8UA 4JL1A 2VM8A 1GQNA 3ITXA 2J8TA 3ISIX 3ITCA 4O28A 3BV4A 5KZDA 3K1GA 3DC0A 3W6YA 1ISZA 4LALA 2G50A 4NNBA 2PPNA 1X98A 1HVQA 1YQ2A 4H00A 4I9TA 4QLKA 4O52A 1FWRA 3V36A 3W28A 3L4VA 4MKNA 3W6MA 4XVEA 3P81A 5EL1A 3CT7A 1TRDA 1VP5A 4LWWA 1QNPA 4QJ1A 1QPRA 4CLMA 2F2KA 4C6OA 4S3DA 1VENA 3TLLA 1UR8A 1KRAC 5ABHA 3H8AA 2BZNA 2R94A 3EX3A 4EF9A 3M41A 2DZVA 3MSGA 1S38A 1W5MA 4IFOA 4CCZA 1WQ5A 2F2DA 2C8NA 1I2OA 3WBYA 2Q01A 4LY8A 2NUXA 1FHDA 4NZ3A 4AB4A 1BKHA 1OABA 4IMAA 4Q33A 3VGFA 4ROPA 1WX0A 3R94A 3TIMA 2GJLA 4KRZA 4C1NB 3DERA 3LRMA 1XIEA 2O56A 1C3FA 3TWAA 3LRKA 2HJPA 2ISWA 2DZAA 3WNMA 4PH6A 5DMLA 2VGIA 2VR4A 1Y5VA 3SRDA 3ANVA 4AX7A 1UYQA 2QHAA 4PZVA 2Z00A 1IE7C 1F7BA 4EF8A 4YVXA 2CKRA 4CQDA 3S9ZA 2OG9A 3ZVHA 2P50A 1U5JA 1XLMA 3VNIA 3SRFA 5D75A 4GVHA 4C91A 3OG3A 1D7KA 1NSGA 3MSYA 3NUKA 1A49A 4W5ZA 4JN7A 4JQ1A 3PBGA 5C0QA 1EEPA 2DZXA 1UIOA 2WBGA 1FKFA 2IQDA 2BOFX 2YPIA 4ENLA 2IS7A 2JKEA 5AY7A 1G9HA 4O14A 3JVAA 5EB8A 3U2ZA 4PEEA 2YBTA 3FKRA 3E02A 1XFCA 1E6NA 5CPLA 4O4VA 3WH8A 1KXTA 4Q6JA 4UB9A 1XDMA 3KXQA 4XO6A 3RR4A 3K4WA 4YHGA 4O2TA 3OQEA 4LW7A 1OX4B 1W8SA 1YMYA 2UY4A 3CEPA 4F0SA 1BG9A 2FHFA 4XD6A 3P80A 3NL6A 4PTXA 4K7VA 1CLKA 3O6DA 1L0PA 5D2YA 3K8KA 4D6HA 4IMCA 5U7SA 1W91A 4JTAA 3BMBA 3LZ3A 2VZVA 1E71M 2FIQA 1LZOA 4TOQA 3LCWA 1Y0EA 4CEXC 3QOKA 1KD0A 4PB4A 1PS9A 3ONBA 4UQBA 5A8PA 3M6DA 2EKGA 3RX3A 3AYVA 4JIIX 1Y7VA 4A6GA 3WQ5A 4O1BA 5F4WA 1RQBA 4L4LA 1EF2A 3SUTA 3WLNA 4DBEA 2JF7A 1QO2A 2CZDA 3MP4A 3H2CA 2E1DA 3KEHA 2ATMA 2PDHA 4XD3A 3AUJA 4GI8A 1I6NA 2X8RA 3ZMRA 1SZFA 2WZIA 3UCCA 3NQBA 2CHNA 1GJUA 4MMWA 1FWWA 2Y7DA 4WDUA 3UJSA 3CGTA 4GXWA 4J3XA 1YYAA 4E2VA 1BFNA 2J7HA 3TK7A 4LGXA 4FXJA 3CUZA 3W00A 4NX0A 4I7VA 4AWUA 4DXXA 2GGEA 1UUMA 3NO1A 3EBVA 4H9MA 1ROTA 1E5NA 1IWBA 5CZTA 5HQLA 1KGWA 3R89A 1JXKA 1W31A 4N4QA 1JNTA 2PTYA 3U2EA 2QF7A 2Y78A 3CEUA 3Q65A 4M7SA 1VEMA 1XWYA 2AKZA 1VFFA 5TIMA 2O55A 2CESA 3SJ3A 3VNMA 1PCWA 1EBHA 2WANA 3FOKA 3MU7A 4NAFB 3CJPA 1DJHA 1F8MA 4MJ2A 4Q8TA 2TSYA 2DV0A 1PTAA 1BRLB 1E4MM 4YTRA 2TMDA 3AU2A 3H54A 3TH6A 2QEZA 4I5XA 3W22A 2DH2A 1ADDA 3MO7A 1QW7A 1P6CA 3STEA 3TROA 1X6LA 2B7PA 4XBJA 2FDSA 3UA3A 2QDGA 5CC6A 1MW3A 5AYYA 3I6CA 4GYPA 4ERGA 2VX7A 2AAAA 2PDFA 4EIVA 4XBKA 4M6PA 3T81A 3UXIA 1K6WA 1V02A 4Q8PA 2KI3A 3RLGA 3W7QA 2ZX6A 2Q6ZA 4MLJA 4EAMA 4PCSA 1A4MA 3GXFA 1HL8A 4EE9A 3KHDA 2VCCA 1G69A 2XUCA 4JS3A 2G3FA 4JYDA 1SR0A 1TJ0A 1NWRA 2V5JA 2X1IA 4XAYA 1DWAM 1RY0A 1H3GA 1O1ZA 5A6BD 4PC8A 3KDOA 4AZ7A 3APGA 4HU0A 2PUZA 4MYAA 1V5XA 4QEHA 3RFAA 4GNJA 1M1BA 3N3TA 4G7FA 3MHUA 2E6AA 2QNEA 5LNRA 2WLZA 5D2WA 2WMGA 2VJXA 1Y8BA 1KFKA 4JCLA 1DOSA 4NAFA 4Y90A 3RITA 5AZ1A 1EXPA 3VGHA 1JYVA 2J77A 1IEWA 2XFYA 4PODA 4ZFMA 3IJQA 4MB3A 4MWAC 3C6CA 2YIHA 2NV1A 4MKSA 2DSKA 4F2BA 7A3HA 3BC9A 9XIMA 2CLHA 3L4ZA 5EBUA 2D0GA 2VEIA 4JFLA 4E4FA 3OBKA 3KUMA 4QS6A 1VHNA 1YW1A 3G1VA 4EX4A 1K9TA 3FJ6A 3MSDA 3THCA 2H9AA 1NFBA 4WHBA 1W3JA 2ESCA 2ZRUA 1XRFA 2GSHA 2QCCA 1Q65A 2H8ZA 3JZEA 1TV4A 3W76A 4AIEA 2RDTA 3ABRA 4BI6A 1IWPA 1LUCB 3Q2DA 5F1VA 4HYWA 4JFUA 2WMIA 3I6RA 3NL2A 4EWND 3B0PA 4X60A 4ZQRA 2J75A 1V51A 2BODX 2AWGA 2CLMA 1GJPA 1TYGA 3JUGA 3M0XA 3GDLA 3CZJA 3LZ5A 2VRQA 2Z28A 3U8GA 1I45A 3FGCB 4UTFA 4G8TA 2FZNA 4AWTA 2CZVA 3B04A 1LTDA 4C90A 4E2OA 3Q58A 4OECA 1YBQA 4QDPA 1QI4A 2XP3A 4S3JA 3N2XA 1YNYA 2X30A 5M3WA 3PNZA 4UC5A 1TPB1 3CO8A 3WD1A 2P3ZA 5D37A 4LF2A 4QISA 3KDNA 3TC6A 3WG6A 3RUBL 3ITGA 3H2MA 1X8FA 1R9XA 4MPQA 4XAGA 3PWIA 3RILA 2UV8G 4I90A 3ITTA 4IICA 1W3NA 4XX6A 5CBIA 2KR7A 5CZJA 4BJHA 5CCZA 2DIKA 4OHQA 4PGLA 3IJ7A 5B7ZA 4FEZA 1RP9A 4GG9A 1BQGA 5CGMA 3OGSA 4WK9A 1J0KA 3ZLHA 1B4KA 4ZO8A 1MZHA 1QFEA 2ZUVA 3NQ7A 4Y9NA 4PUWA 2Y89A 1VCGA 3M0LA 1HQTA 3TOYA 5CGTA 1JUKA 2PODA 3CV1A 5AKQA 4QFUA 4DEFA 4AU0A 2QQ6A 1UKSA 1ZAHA 3L67A 2PC4A 3O5FA 2Z2AA 2PDIA 4ZO6A 1LM1A 2QJIA 1TZZA 3MW7A 1KTCA 3QY8A 3SN1A 1HXJA 3LCIA 1FWTA 8A3HA 1QNQA 1RLDA 1DKWA 3EKGA 3W7IA 3TDFA 3WNPA 1IEQA 4I8YA 3B3DA 3W2NA 2D1ZA 3W02A 1C8QA 3DU0A 1J8VA 1FWJC 1P0BA 3TA9A 4G7EA 2ZRVA 3TR2A 5LIXX 3VIGA 2VC9A 4TX6A 4HMDA 3LYEA 4BHYA 4MJZA 2PPGA 2QGHA 3QF0A 3B9NA 4GACA 2OQYA 2IKHA 5AYXA 5BXSA 4DJDA 1GHSA 2F38A 3IHZA 2GVJA 1HP5A 1AW1A 3TDBA 4DPQA 1KTBA 1GVOA 1UZHA 2VX4A 3WH9A 5E5CA 3T0CA 2GWGA 5EMJA 2EJAA 1D8WA 1WE5A 2Z6JA 2W67A 4RDZA 5IXEA 2F4EA 1GTHA 3SQMA 2WVVB 3Q4DA 3SO7A 1FWCC 1UR4A 2ZVIA 3C3NA 1R47A 1HFBA 4DBSA 3LEPA 4Z2JA 4IMDA 2O9TA 1FKLA 3NPWA 1FWFC 1WKFA 2WHMA 4JDYA 1WKYA 3AXHA 3EDDA 3NA8A 1JRBA 2X42A 1XISA 4QJ4B 3VPLA 4MWAB 3W2MA 3PJWA 1GW1A 3QKEA 4H9TA 2PDLA 5T9CE 2DT2A 3HPAA 1A5LC 2Z24A 3P93A 3L2LA 3EOEA 3H24A 3PZUA 1XYFA 3VTRA 3O5JA 1ZB5A 1OK6A 4DWSC 2NLYA 5IOBA 4L61A 4Q8OA 2WK2A 2W6RA 2JE8A 2C14A 4KCVA 4AHOA 4EP8C 2HBVA 3MDWA 1MXGA 4FXRA 1EIXA 1E0XA 3UETA 2GK1B 4A3YA 2WKLA 2REQA 2Q02A 2XH4A 4QJ3B 1PVNA 5HW6A 4TMCA 3N14A 2XN2A 2PDPA 1C8XA 1JUEA 2WCAA 3UNTA 4IUOA 3NQAA 3GR4A 1G4EA 4U10A 1XH0A 2WVVA 1W26A 1SW3A 1S2AA 4NVTA 1GEHA 3D0CA 1EHAA 1H1ZA 3AXIA 3RDKA 1F4AA 5G1TA 1YXCA 2XVLA 3PBYA 4V1XA 1UJQA 4S3BA 4UMBA 4JFTA 2NW0A 1XLBA 3F4NA 1TUXA 3ARYA 1LOQA 4Z08A 3ICJA 1TMLA 1OWQA 3VUSA 4HNUA 3V4BA 3G1XA 4KBXA 2A4AA 4LTSA 2NQHA 4PE8A 2HISA 3WQPA 3NVTA 1BXCA 3C2OA 5RUBA 1XLKA 4C6CA 4DJFC 2ZRXA 3MKVA 5IRPA 3TSDA 2W27A 3DBPA 4E3TA 4MUPA 1M7PA 4ZE4A 5KTLA 3AS1A 5PTDA 5BMXA 3R5EA 1O7AA 2QYGA 4Z1AA 3AJ7A 3WUGA 1RVGA 3WEOA 1XD1A 1XC6A 1P6WA 3TCSA 4MFEA 4H6RA 1BF2A 3VD9A 4I3GA 1OM0A 2GVGA 3O9NA 3W2JA 4DZ2A 2R1NA 2BSLA 5DMMA 3IS4A 1TCDA 3VX1A 3S9IA 4X0NA 1JCHB 3UJRA 4C7GA 1BXNA 4GFIA 4PR4A 1ME8A 4IQDA 4J4KA 3FYPA 2OFNA 4NJGA 3KFTA 2CHRA 1US2A 1XLJA 1J4HA 5EMYA 1NH6A 4FPSA 1DJIA 2HXTA 2NX3A 4C6JA 1A0DA 4IPJA 3TAKA 3LNPA 3BH4A 2L5HA 1OSEA 4HBEA 2YGYA 2J7DA 2AGKA 3KX6A 3QKZA 3R43A 4HPGA 3TTSA 2OKOA 1V6TA 2OQLA 3U7VA 1SYTA 1TCMA 2OJPA 4OQVA 4LS1A 5AVHA 2JGQA 3SCUA 2GJRA 4LCQA 4DF0A 4WVXA 4FNQA 1XYCA 2XH2A 4US5D 2V30A 3DFTA 3RM9A 1KKRA 3QSTA 5AVNA 5DIVA 2YCLB 1UR0A 4D2JA 2X2GA 1R0MA 4I5UA 3GFXA 1EZWA 1MXSA 4U2YA 1BG4A 3AYTA 4PMJA 2AMGA 3O15A 4E8GA 4EXAA 2GQ8A 3VMNA 2IPGA 3CK5A 1NM9A 1OBAA 3UVIA 3C56A 4XKMA 2HCVA 3KAIA 2V5KA 4US6A 4REQA 3M46A 3KVMA 3NSMA 4Y9MA 4FS9A 2VOMA 1B54A 4TUFA 1NWUA 3TN5A 1DIKA 1C29A 1UD8A 2VHLA 3CUGA 3PJUA 4J1OA 3GHUA 4P2VA 4V28A 4ZQOA 1EPXA 3R7MA 1XDJA 4S3EA 3WJWA 1HGYA 3EMCA 1RJPA 4UIOA 3DENA 1FRBA 4Z1CA 4ODQA 3WDHA 3AS2A 3HQNA 5ABEA 1GCYA 3MYOA 3TZNA 1A3XA 3WK1A 1JYXA 5CGQA 4AD3A 3CO4A 1JZ2A 3LPOA 4WKFA 3PY2A 5CBJA 5HUPA 4FNPA 2YL6A 1TPFA 2Y8KA 3BG5A 3T05A 3GDKA 3RF9A 3EX1A 5HMEA 4QSFA 3IJ8A 2YL5A 4B5XA 2RAGA 4CQBA 1BRLA 1SO6A 4ZTYA 1EWDA 5HJYA 1OGSA 4KT2A 3UBPC 4W84A 2WMJA 4N9DA 2VR2A 4B3KA 4UQAA 2Z2BA 5DY3A 3WJZA 3FS2A 5FA5A 2J13A 4REQB 4DUWA 2MLYA 2PURA 2WWDA 4UUIA 3QV8A 2X1SA 3HG2A 4JY8A 3N17A 3MYPA 3G6MA 2CWNA 3L68A 1NMVA 3UYIA 1SMAA 4RJEA 3T42A 1E9IA 4URIA 2R82A 3CHDA 4WOQA 3UWVA 4DBWA 5AYIA 2E4TA 2VEGA 5EMLA 2QVHA 3NJ3A 4JQ3A 4QT2A 3ZSSA 3GC2A 1R30A 3ARZA 4Y2WA 3H26A 2JQXA 5DY2A 4CQ8A 1RQEA 2CZ5A 4CNSA 1E6QM 2Z25A 3PPGA 1PIFA 4J3TA 1E6PA 3B4UA 3QOMA 1J93A 3S1XA 4QXIA 4JX5A 3VM5A 4G1NA 1J2BA 3NQVA 2XDFA 2DUXA 4KFOA 1OK4A 1XLHA 1Q6IA 2EGZA 1VFUA 2XPBA 4FXFA 4H04A 4LF1A 4J7RA 4TVCA 5B80A 2HE5A 4NZ4A 2E25A 4R33A 3ONCA 1UKTA 4C65A 4MGVA 3NXFA 3W1LA 3NCOA 4PB5A 5KETA 1VB9A 4YL2A 4PTWA 2GDQA 2NT0A 4KWWA 3E6EA 5AFDA 1U1UA 1XLEA 3MUY1 4MVAA 1O6IA 1EUAA 3UPWA 3V5CA 7PTDA 3W1MA 1KRBC 4GWEA 4TW8A 1DQXA 1FHUA 3WF3A 1UKQA 1Q2RA 1A4LA 4AEEA 1OINA 1ZBCA 4F0LA 4HCHA 4DX3A 4QTGA 4B5WA 3G0XA 1XC4A 3GIQA 5T26A 1TCOC 4RR4A 4GYPC 5E93A 3LXCA 3GDBA 3BOLA 2WHKA 5CXPA 5BWAA 5L6UA 4MG4A 4CN6A 4BEUA 1TIWA 4R27A 4U85A 3BO9A 3PBMA 2YCJA 4P8VA 4ILSA 3DECA 4Y9OA 3KOFA 1FKJA 5M2FX 2ISDA 1X6UA 5ABTA 4K1GA 3KACA 4AWSA 2CPUA 3GYCA 2W5FA 3LDVA 3V5FA 1ITCA 2A79A 3HPXA 1CWYA 4IFKB 5DXXA 3NPXA 4V15A 4QQUA 3DEQA 4CD8A 3MI3A 5IFTA 2ZYFA 2PGRA 2PD9A 3WQDA 1OC6A 3ME3A 4ZL1A 1LQ0A 1I2NA 1T8XA 2GGGA 5D33A 4WDXA 3C61A 1K8CA 1PDYA 2W9MA 4EPKA 2ZICA 3BW3A 3M0ZA 4LUSB 2YW3A 1LLZA 4JL2A 1I9CB 4B90A 1V6VA 3SCVA 1BTMA 4H6KA 2DG3A 1LDCA 4AC7C 3MP5A 4GIYA 2J78A 3PSVA 1R8LA 1O5RA 1G1YA 4IL0A 3AS0A 5M1TA 1MW2A 3EY6A 3GW0A 1UPPA 1Q6HA 1V93A 3L0GA 2HVNA 3VGEA 5A8QA 1BKFA 3NURA 3KOYA 1NFPA 2E28A 3N9KA 1J0HA 1LROA 3QGKC 4JKLA 1QI2A 1I1WA 3UVAA 1J9YA 3SUWA 4ODKA 1QMLA 3PAJA 2X1UA 5FCZA 4O57A 1SZNA 1R9YA 5HXMA 1RBAA 1WDWA 2DZPA 2C3ZA 4HP5A 3WD3A 4CD5A 1TR1A 3GKAA 1E15A 3D6NA 1OQFA 4D6IA 1GYLA 4W85A 1YRRA 2VD8A 4E6MA 3SIMA 3FXGA 1JCJA 1E9YB 1GQKA 2EPNA 3EPMA 1H5VA 4DRSA 1PBGA 5B8IC 3ZIZA 1EP3A 2OOFA 1RLCL 2PBCA 3UJFA 2WQPA 2FTYA 4NJIA 4JHMA 3N4EA 3QSRA 2C0AA 3SUVA 2OT1A 8RUCA 3WDPP 1IIHA 3B0VC 3AZSA 4HBOA 1B31A 4WSJA 2I1OA 4CCCA 3HG5A 5D8ZA 1RSCA 3UXAA 1XUUA 1N82A 1XG4A 3BDKA 3VOJA 1AZ1A 5FF0A 2QCDB 4FF7A 4DJFD 3PBVA 4F0HA 3VOFA 5JH1A 4WEVX 1OFDA 3EOUA 3AQUA 3DFHA 4ODOA 1PUDA 3VGGA 1SZEA 2H90A 2VC7A 4PN2A 3EB3A 1L6SA 3ZLGA 4QAWA 3DOPA 3CPUA 3M0KA 1AK5A 2PD5A 1F6KA 4MB1A 4RE0A 5GVJA 2IXUA 3QPEA 1DJWA 4QT3A 3LY0A 1TQJA 3B03A 4L6DA 3W70A 1XYMA 5DF0A 3DZ1A 2YDQA 1GVQA 1TQXA 1TO3A 3GG8A 1WP6A 2I16A 4HZ6A 4ONVA 3CPRA 3LOTA 4GHRA 1D7FA 2QUUA 3TYBA 5FKYA 3W37A 2QCNA 1GOIA 4OBSA 3RN6A 1DORA 2QJJA 4W8LA 4BI5A 2BV9A 1MUWA 4PTDA 4G5DA 2Q09A 4LAYA 3IGXA 5DCBA 1I60A 2R8WA 4AXKA 3KRSA 3T44A 3GZ3A 1NTHA 1ITUA 3LBOA 3ZJKA 2ZUTA 5LNUA 3W7DA 1JFHA 3A9BA 3PTMA 1J0ZA 4UZSA 3WQOA 1ISVA 1EX5A 5AN7A 2VQTA 4GINA 1SU5A 2QCFA 4DJDD 2WZTA 3S5NA 2XM2A 4A05A 2PWFA 1IGWA 1Y5XA 5I02A 1QZ2A 4LX4A 2VR5A 3W26A 3QQ1A 3IPWA 1QUMA 2BWGA 3WK3A 1GZ1A 2V5BA 2GFTA 4H9YA 1IQ8A 2YA1A 2BOEX 2Y2WA 4LC6A 4LYRA 3OVRA 3CH0A 3SY1A 4FNRA 1BYCA 3S3GA 4YVVA 1XIDA 4K7YA 2J74A 4WJXA 3LQGA 2X16A 1XRTA 3ARPA 4PRRA 5A2BA 2KO7A 5C5YA 4M6VA 5CG0A 1VFTA 4LRTA 3A3HA 4PBFA 3O6YX 1NDYA 2POTA 2ALRA 2XFRA 5M5DA 3P5ZA 3VNJA 5JH8A 3ABSA 3CQ0A 4ZOAA 4WSKA 3SGGA 4N9CA 2WMKA 1R2SA 3QBUA 3VINA 3IGHX 2PTWA 3E12A 1AJ0A 1VFLA 3H22A 5A6LA 1NDZA 4FO4A 2GL5A 2DIEA 1T7LA 5F2MA 4XSLA 1ODZA 2XSBA 1TX0A 4GY1A 3QV7A 3RO8A 1Z32X 4I6KA 1JQXA 3TA6A 1YADA 4LUTA 4DLMA 3KL0A 3GWQA 4R7OA 4AY8A 2QUNA 1CGWA 3W24A 1JCLA 1EOMA 4ES4A 3AUOA 4BF7A 5E0CA 1PKYA 1XLLA 4MZYA 5D32A 3NXLA 4CNPA 1HJSA 1CXHA 1P4CA 4O1FA 1OVDA 1MRAA 2VO5A 3SECA 4Q32A 1FHLA 3SRKA 2QPXA 5ECUA 5AOUA 2VFDA 3LHZA 4Q7NA 3VE9A 3KZ7A 3ECQA 4J4OA 1X1ZA 3CIVA 2JGYA 1SW0A 3OYXA 1LT7A 3FVDA 4KR0B 2E9BA 2MUCA 4GZEA 5AC4A 2PDXA 4O0QA 4IGNA 3TOPA 3BVJA 4N4PA 1JCTA 3W83A 5CJ5A 1KNWA 2B81A 2J7EA 4PMXA 3DI0A 3T2QA 3THDA 2GJXA 3CUJA 4RCXA 1CNVA 1UD5A 4J35A 1HXVA 3SR7A 1RUSA 1HJQA 3BPWA 1GVIA 1W9PA 1JL8A 1YX1A 1FCVA 1SR9A 1QK2A 2E67A 2P8BA 2RGMA 4O18A 3GTIA 3EOOA 2C16A 3CMGA 1JFXA 3VNYA 1FCBA 1OCNA 2QUVA 1W56A 1VFHA 2WSRA 4AVFA 4IP7A 1XI3A 4TO8A 3EWDA 1K9EA 1ZGDA 2TODA 3B06A 1W5NA 2A1YA 2CLEA 1Q4WA 3WLHA 3PZIA 4JBRA 2GUYA 5GNYA 3KVLA 3AJXA 2DP3A 3VXGA 3QY7A 4G56A 4I7UA 1VHCA 1XHGA 3LCXA 1EJXC 2O7QA 3IAPA 1A3WA 4LPCA 3GC5A 3TQKA 1XRVA 4XIAA 5FF2A 1V79A 3KWSA 2WNZA 8XIMA 2PDKA 3FEQA 1NSJA 3WLLA 1JJKA 5DMYA 2G3NA 3NQDA 2DZWA 3VKCA 1HJWA 2M08A 3AXMA 3TYUA 3E49A 3UG8A 1H41A 4JFKA 2M2AA 1KRMA 3FNDA 3AMKA 4X22A 4JTUA 2PLKA 6ALDA 2PZ0A 3WBXA 2WSYA 2PDWA 3KOWA 1R7AA 3AMGA 3WQ4A 5REQA 3MKCA 1BWKA 2C71A 4AH7A 4FA3A 4PFHA 3U7BA 2OU4A 3LCFA 1PZ3A 1ZY9A 1QNVA 2CCRA 1TJPA 4Q8QA 2OSXA 4M7TA 4HN8A 2PBGA 3L65A 3F03K 4ZQMA 1M7JA 1D3GA 4U28A 5FAGA 1GVYA 1KBJA 3EWWA 4IPXA 3HB9A 4WIWA 3L21A 2R1LA 1OC7A 1UWQA 1YDVA 1FWBC 1KXQA 2X2YA 3IVSA 2RFGA 1RK6A 3LM3A 4DUXA 4Z42C 4TX8A 5BU6A 3P0WA 5DO8A 1RXOB 3OQ8A 2OZ8A 1KR1A 4UTUA 3IUHA 2V5DA 1YPXA 1AD1A 4BQ5A 1E6XM 1FQ0A 1QI3A 4B5NA 2CLFA 3IWPA 4LAKA 4IXHA 3ZJ8A 2YYUA 2V68A 4DI9A 2FAPA 1FFRA 2WBKA 5E9XA 4F4RA 2FFCA 3GK0A 2GSJA 5I03A 3WJXA 1QTWA 3WIJA 5JBEA 1FWEC 2Y8UA 2WM0A 1H61A 4PMNA 4GVGA 3EWXA 3ITLA 1K3UA 3G8EA 3BAXA 4KRUA 4MM1A 4DWSD 4UNIA 1N7KA 4NASA 4OUEA 4S2BA 2FJKA 3CUIA 1P1MA 2DUZA 3KP1A 4EANA 2XP5A 1BWLA 4Q4RA 4D6CA 2VT0A 3NFUA 2YA0A 4FXSA 1WB0A 1DPMA 5HK4A 3VM7A 3VC6A 3T07A 2E77A 3NDOA 4J3VA 4GO9A 3ITOA 1ECQA 4HZ7A 3PR9A 4L1XA 3FAXA 3CWOX 3DG6A 1RY8A 4ZB5A 2E0PA 4DZIA 3G1HA 2ZZ7A 3L66A 2P53A 4RX0A 2Y5EA 2JZVA 2OTDA 2J7BA 2KGJA 3GYEA 5BOFA 1YATA 4OOZA 4RK8A 3FSTA 1B0IA 3N2CA 5DELA 3IGSA 3PPFA 2WB5A 4JHZA 3MWAA 4GI6A 1PDZA 2ISVA 3W4RA 3TYAA 4TQTA 4L72B 5HTGA 2PWDA 1ZL1A 1O5XA 6REQA 3SQSA 1ADSA 3NTYA 2OX4A 4UFHA 2Z26A 3VNKA 1TV5A 3T4CA 1KM6A 1B3XA 1UQZA 1ZENA 5CC3A 3C2EA 5C7VA 2YXOA 2HNEA 1U30A 4RL3A 4CVWA 3EWCA 4KCTA 3FA5A 5I3KA 1VPYA 2WCGA 4W9OA 4NAEB 1XH1A 4W9PA 4UFLA 3PZOA 2Y62A 4HU8A 5LA2A 5LXEA 5BROA 3RCYA 3LI1A 2CW6A 3VMPA 2Z7GA 3EWBX 1YIXA 4GLEA 4Q8NA 1YNPA 3MBDA 4DRQA 4CU6A 5DMNA 1ISXA 2DQWA 2D73A 2H3BA 4C6DA 3S1WA 2JKPA 2HVOA 4DPPA 3GHRA 1A5NC 5KEZA 3CL8A 3E3HA 2EKCA 1KFLA 4A22A 4HIBA 3KLKA 3GVVA 3KBMA 3KCEA 4N9EA 4JXCA 1ZJBA 3BK0A 1IZCA 1ZALA 4GBUA 3QW3A 3FN9A 4L4PA 2RSEA 1VR6A 5A95A 3AU6A 1L2UA 1TREA 4DRKA 1NDWA 1WBJA 5L9FA 1C9HA 1NARA 2FB2A 3AXKA 1O4UA 4WUIA 3W7CA 1ROUA 1UWAA 1GOWA 2YL8A 4UMCA 4X9YA 4TYOA 1XIJA 4ACZB 1GEQA 2ZQTA 1MW1A 1WOAA 3E96A 3CZEA 5CPTA 4AEFA 2NX1A 3JW7A 1UD4A 1F3WA 2W79A 4H6EA 1ICQA 5DLCA 1VFOA 1V3LA 4P7RA 4L4MA 1YE4A 2D2JA 1XYZA 5H2ZA 3SGZA 4CEUC 1T8QA 3G0UA 1FUYA 1M7XA 2QULA 4HK5A 3UU0A 1VQTA 2PDNA 3AMCA 3TJIA 3WH5A 3FDGA 3PPHA 5GJMA 3DG3A 4X61A 4DF1A 3O5LA 2WCSA 2ZX9A 4DIAA 2E6YA 1Q1CA 3KAHA 4QHRA 2XZ9A 1JZ6A 5A6JA 1DP0A 1W1B1 3I3DA 3RRXA 1R3VA 2YR1A 5CPSA 4TW7A 4RV8A 2ZX8A 5GNZA 1B57A 2ETNA 2HS8A 1SFTA 4GUIA 5CQ1A 3HOJA 2PU0A 1K02A 3WDRA 5BOOA 3S9YA 3MUCA 1XIBA 4FLSA 4AD4A 4FSAA 4JFSA 3QHOA 4LAMA 1XBXA 4S3KA 4GI4A 3EWUA 2VX5A 3NZQA 1TVLA 3GR7A 4OKDA 4KF1A 3VOHA 4BZYA 1ZP3A 4DO6A 4MB5A 3M16A 2OPJA 4KESA 5ABGA 4K68A 1MWOA 2XHYA 1VBUA 4UFIA 2VGFA 5J5DA 2P0IA 3UYCA 1R3SA 3D47A 1TUFA 4N7QA 1CPUA 1Z8AA 1JDDA 4GKLA 5IM51 3SZ8A 5C9WA 2QAFA 4Q4OA 3EXTA 3T0BA 4MDPA 2CWXA 3GVGA 3HQ1A 3LPPA 4B91A 2ZR5A 4C6NA 3EMZA 1YKWA 3TYZA 3DXIA 5MKGB<