2PPNA

Crystal structure of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppnA00
2M2AA 2XP3A 1KT0A 4U86A 2LGOA 1Y0OA 2RUDA 5D75A 2XP9A 5BXJA 1FKSA 3H9RB 2ZQTA 3O5FA 1FKTA 4C02B 2PPPA 4W9QA 3CGNA 2FAPA 4QT3A 4QT2A 2K8IA 3O5KA 3IKGA 3O5QA 1PBKA 4IQCA 2F21A 4U85A 3EY6A 4JFJA 2N87A 4TYOA 1FKRA 3KAFA 4JFKA 1U79A 1FKGA 1ROUA 3B7XA 4ODKA 4DRNA 1YATA 4LAXA 2MLZA 5HT1A 2XPAA 4DRMA 3IKDA 1M5YA 1C9HA 1N1AA 2F2DA 3NI6A 4GGQA 2XP4A 1D7HA 3O5JA 2Y78A 1R9HA 4ODLA 2XP5A 4O2TA 5DIUA 5DIVA 4TW7A 1KT1A 2JZVA 4ODQA 4DZ2A 3JYMA 5HTGA 1FKKA 4TNSA 1J4RA 1QPLA 4N19A 1FAPA 1P5QA 2RUCA 3O5PA 4TW6A 1JNTA 3O5LA 1FKHA 4DRJA 5HW8A 1EYMA 3ODKA 4DROA 2RQSA 3I6CA 4DT4A 2MLYA 1D7IA 2DG3A 1L1PA 2VN1A 3KAIA 3PRBA 5GPGA 4G2PA 4LAWA 4JFIA 3MDYB 4BF8A 5DITA 2ZR6A 3GPKA 3NRKA 4R0XA 2PPNA 4DRIA 1W26A 3CGMA 4JYSA 2L2SA 2M08A 1YW5A 2MPHA 1F40A 1T11A 3NTPA 2KE0A 3WH0A 3FAPA 4MGVA 2FKEA 4DRKA 4ODMA 4LAYA 2ITKA 2PV1A 3UI5A 1FKJA 2ZR5A 4ODNA 4DH0A 3UQIA 4DRQA 2KFWA 3KZ7A 2VCDA 1ZCNA 1ROTA 3UF8A 3O5EA 3O5DA 3PA7A 3UI4A 2ZQSA 2M1IA 4MSPA 5HKGA 3UQBA 3KAHA 5HWCA 1JNSA 3O5OA 3TDBA 3O5RA 4DZ3A 4J4NA 1D6OA 2MF9A 3TCZA 1FJDA 1FKBA 1FKDA 2D9FA 1Q1CA 2KR7A 2PBCA 3O5MA 1EQ3A 2RUQA 4W9OA 2ZR4A 2AWGA 5HW6A 2ZQVA 3RGCA 4IPXA 3LUOA 2UZ5A 3KADA 3O5GA 3UQAA 5I98A 1J4IA 2KGJA 1QZ2A 4FAPA 1FKIA 1BKFA 4DRPA 2DG4A 2MLXA 4GIVA 1JVWA 4QIBA 1TCOC 3JXVA 1A7XA 1FKFA 1F8AB 2LPVA 4FN2A 4JFLA 4LAVA 3RFWA 2IF4A 2LJ4A 2XPBA 4ODRA 2XP8A 3PRDA 1Q6IA 3UI6A 2XP6A 3TC5A 1D7JA 2PPOA 4JFMA 1QPFA 1NMVA 1ZK6A 1HXVA 1NMWA 1J6YA 2DG9A 4G50A 4W9PA 1PINA 3KACA 2ZQUA 5HW7A 3VAWA 5B8IC 3JYJA 1J4HA 3OOBA 3IHZA 1Q6HA 2PV3A 3KCEA 2RSEA 4ITZA 4J4OA 4ODOA 5HWBA 3KABA 2LKNA 2RURA 3IK8A 2KO7A 4TX0A 1NSGA 3O5IA 1BL4A 5HUAA 1FKLA 3KAGA 4TW8A 4U84A 2KI3A 2F4EA 2Q5AA 2MNTA 2OFNA 2XP7A 4NNRA 4ODPA 4DIPA 1FD9A 1Q6UA 4DRHA 4IQ2A 2PV2A 1B6CA 5J6EA
chains in the Genus database with same CATH superfamily
2M2AA 1JNDA 3B9DA 1Y0OA 2XP9A 4QT2A 4QZVB 4ZPWR 1PBKA 2N87A 3ALGA 1FKRA 4ODKA 4DRMA 1C9HA 1HJWA 3BXWA 1LL7A 1D7HA 1CTNA 1SR0A 2XP4A 3O5JA 5DEZA 2XP5A 5DIUA 1WB0A 3RM8A 5HTGA 3WD0A 1J4RA 4ZPTR 4WK9A 1P5QA 3ARTA 1GUVA 4DWSA 4TW6A 4DROA 4DT4A 1LQ0A 2VN1A 3PRBA 1EDQA 5GPGA 4BF8A 3CZ8A 4DRIA 1W26A 2F23A 2L2SA 3ARYA 1T11A 4MGVA 4LAYA 4DH0A 2ZR5A 4ODNA 4DRQA 3KZ7A 2DT1A 2VCDA 1ZCNA 1ROTA 3O5DA 1K9TA 5HKGA 2DSWA 1JNSA 4KR0B 4W5UA 2PI6A 2MF9A 4IT4A 4AY1A 1W1TA 1E6RA 5HW6A 5DO2A 4DWSC 3UQAA 5I98A 2DG4A 5JH8A 1LG1A 1JVWA 4QIBA 1A7XA 3AQUA 1F8AB 4LAVA 4ODRA 2PPOA 4URIA 2YBTA 1ZK6A 1NMVA 1O6IA 1E6ZA 1ZBVA 1Q6HA 4J4OA 4ODOA 3BMBA 3FXYA 3IK8A 4TX0A 3O5IA 1BL4A 3WD3A 2B5UB 3ARZA 4TW8A 1XRVA 2F4EA 2KI3A 2Q5AA 2MNTA 2XP7A 4NNRA 3QOKA 2PV2A 1J6YA 1B6CA 1VF8A 2XP3A 3FY1A 4U86A 3WD1A 1FKSA 4C02B 1FKTA 2PPPA 2DT2A 3EY6A 4JFJA 4TYOA 3B9AA 3WD2A 5J6EA 3CHFA 3B7XA 4DRNA 4LAXA 3PRAA 2XPAA 2P4VA 3NI6A 1W9VA 1XHGA 3G6MA 4NZCA 4Z2IA 1X6LA 2DT0A 3CH9A 4O2TA 4MTVA 1KT1A 4ODQA 4DZ2A 2WM0A 3JYMA 3W4RA 4N19A 1FAPA 3O5PA 3ODKA 4MNKA 2MLYA 1D7IA 2ESCA 1W1VA 4ZPVR 4G2PA 2ZR6A 3GPKA 5GPRA 3CHEA 2PPNA 3CGMA 1YW5A 2MPHA 1F40A 2QF8A 3FAPA 1ZBWA 1E9LA 4WIWA 4WKFA 4DRKA 3WQWA 2ITKA 2PV1A 4MAVA 1D2KA 1LJYA 2G41A 1EIBA 3UF8A 3WIJA 3O5EA 2A3EA 1W9UA 3KAHA 1ZBKA 4HBOA 4S3KA 4DZ3A 1LL6A 1FKBA 1FKDA 2D9FA 1Q1CA 3AS2A 2ZQVA 3RGCA 4R5EA 1OGGA 3ARXA 3LUOA 3O5GA 4WJXA 4WKAA 1BKFA 4DRPA 4ML4A 2O92A 2OLHA 1FFQA 4ZS6A 3WKZA 1TCOC 3JXVA 2LPVA 5DF0A 1ZL1A 2IF4A 2LJ4A 5GQBA 2DPEA 2O9OA 1WNOA 1Q6IA 2FDMA 1QPFA 2A3BA 1PINA 1HKIA 1LL4A 3ARSA 3JYJA 1J4HA 1HXVA 3KCEA 2A3CA 1TFVA 1HKKA 1NWSA 4P8WA 1NSGA 4MNMA 5HUAA 1FKLA 2DSZA 3ARPA 3RMEA 1FFRA 4ODPA 3AS1A 1Q6UA 3OA5A 1KT0A 5D75A 2RUDA 2ZQTA 3O5FA 1IX5A 4QT3A 2K8IA 3ARQA 3IKGA 2F21A 4U85A 4Z2KA 1U79A 1ROUA 1W9PA 4FAPA 1YATA 2ETNA 4P8UA 1N1AA 2F2DA 1W1PA 2Y78A 1R9HA 4ODLA 4HARA 1LG2A 2DSUA 5DIVA 1QPLA 1GOIA 2RUCA 5HW8A 3O5LA 1FKHA 4DRJA 4WKHA 4MNLA 1ZBCA 1E15A 3ARVA 3KAIA 4JFIA 3MDYB 3PR9A 5HBFA 2DSVA 2WK2A 4R0XA 4JYSA 1HJVA 1HKMA 3NTPA 3WH0A 3UI5A 1FKJA 3CHDA 3PA7A 2ZQSA 4MSPA 4Z2GA 4P8VA 1UR9A 3EIPA 3O5OA 3TDBA 4J4NA 1D6OA 3TCZA 3ARUA 2EULA 4DWSD 1E44A 3O5MA 2RUQA 4W9OA 1EQ3A 4MNJA 3WL1A 1HKJA 4IPXA 3KADA 1J4IA 2KGJA 2IUZA 1E6PA 4Q7NA 4Z2LA 4DWSB 2MLXA 3AROA 4GIVA 4L72B 4L3NA 4JFLA 3RFWA 4KQZA 3PRDA 3WQVA 2XP6A 1ZU8A 1D7JA 4Z2HA 1H0IA 4G50A 3KACA 1EHNA 2ZQUA 4LGXA 3VAWA 1HJXA 3OOBA 3WD4A 2B31A 2RSEA 5HWBA 2LKNA 2WLYA 3WL0A 1GRJA 3KAGA 4U84A 2OFNA 4XAKA 4MPKA 4NSBA 1ITXA 2LGOA 5BXJA 4Z2JA 1ZB5A 3H9RB 3CGNA 2FAPA 1NWUA 3O5KA 3O5QA 1JNEA 4IQCA 4IT6A 1WAWA 3RM9A 3KAFA 4JFKA 4P8XA 3CHCA 1FKGA 2MLZA 5HT1A 3IKDA 1M5YA 4GGQA 3AS3A 4S3JA 4TW7A 2JZVA 1JCHB 1FKKA 4TNSA 4PTMA 1JNTA 1EYMA 2RQSA 3I6CA 2DG3A 1L1PA 4UDMA 3ARWA 4LAWA 5DITA 3NRKA 2DT3A 2M08A 2KE0A 1W1YA 2WLZA 2A3AA 2FKEA 4ODMA 1H0GA 3GTYX 3UQIA 2KFWA 3B9EA 3UI4A 2M1IA 3UQBA 5HWCA 3ARRA 1SYTA 3G6LA 3O5RA 1E6NA 1FJDA 1NWRA 2KR7A 2PBCA 2ZR4A 2AWGA 3RM4A 2YBUA 2UZ5A 4HBEA 1QZ2A 1FKIA 1OWQA 3ALFA 1NH6A 4Q22A 1GPFA 1KFWA 1FKFA 1UR8A 4FN2A 2XPBA 2PN0A 2XP8A 3UI6A 3TC5A 2AOSA 1OGBA 4JFMA 1NMWA 2DG9A 2G8ZA 4W9PA 5HW7A 5B8IC 1X6NA 4ITZA 3IHZA 2PV3A 3KABA 2RURA 2KO7A 1NWTA 3AS0A 4DIPA 3GU0A 1FD9A 3B8SA 4DRHA 4IQ2A 4W9QA 1RD6A
chains in the Genus database with same CATH topology
2M2AA 1JNDA 3B9DA 1Y0OA 2XP9A 4QT2A 4QZVB 4ZPWR 1PBKA 2N87A 3ALGA 1FKRA 4ODKA 4DRMA 1C9HA 1HJWA 3BXWA 1LL7A 1D7HA 1CTNA 1SR0A 2XP4A 3O5JA 5DEZA 2XP5A 5DIUA 1WB0A 3RM8A 5HTGA 3WD0A 1J4RA 4ZPTR 4WK9A 1P5QA 3ARTA 1GUVA 4DWSA 4TW6A 4DROA 4DT4A 1LQ0A 2VN1A 3PRBA 1EDQA 5GPGA 4BF8A 3CZ8A 4DRIA 1W26A 2L2SA 3ARYA 1T11A 4MGVA 4LAYA 4DH0A 2ZR5A 4ODNA 4DRQA 3KZ7A 2DT1A 2VCDA 1ZCNA 1ROTA 3O5DA 1K9TA 5HKGA 2DSWA 1JNSA 4KR0B 4W5UA 2PI6A 2MF9A 4IT4A 4AY1A 1W1TA 1E6RA 5HW6A 5DO2A 4DWSC 3UQAA 5I98A 2DG4A 5JH8A 1LG1A 1JVWA 4QIBA 1A7XA 3AQUA 1F8AB 4LAVA 4ODRA 2PPOA 4URIA 2YBTA 1ZK6A 1NMVA 1O6IA 1E6ZA 1ZBVA 1Q6HA 4J4OA 4ODOA 3FXYA 3IK8A 4TX0A 3O5IA 1BL4A 3WD3A 3ARZA 4TW8A 1XRVA 2F4EA 2KI3A 2Q5AA 2MNTA 2XP7A 4NNRA 3QOKA 2PV2A 1J6YA 1B6CA 1VF8A 2XP3A 3FY1A 4U86A 3WD1A 1FKSA 4C02B 1FKTA 2PPPA 2DT2A 3EY6A 4JFJA 4TYOA 3B9AA 3WD2A 5J6EA 3CHFA 3B7XA 4DRNA 4LAXA 3PRAA 2XPAA 3NI6A 1W9VA 1XHGA 3G6MA 4NZCA 4Z2IA 1X6LA 2DT0A 3CH9A 4O2TA 4MTVA 1KT1A 4ODQA 4DZ2A 2WM0A 3JYMA 3W4RA 4N19A 1FAPA 3O5PA 3ODKA 4MNKA 2MLYA 1D7IA 2ESCA 1W1VA 4ZPVR 4G2PA 2ZR6A 3GPKA 5GPRA 3CHEA 2PPNA 3CGMA 1YW5A 2MPHA 1F40A 2QF8A 3FAPA 1ZBWA 1E9LA 4WIWA 4WKFA 4DRKA 3WQWA 2ITKA 2PV1A 4MAVA 1D2KA 1LJYA 2G41A 1EIBA 3UF8A 3WIJA 3O5EA 2A3EA 1W9UA 3KAHA 1ZBKA 4HBOA 4S3KA 4DZ3A 1LL6A 1FKBA 1FKDA 2D9FA 1Q1CA 3AS2A 2ZQVA 3RGCA 4R5EA 1OGGA 3ARXA 3LUOA 3O5GA 4WJXA 4WKAA 1BKFA 4DRPA 4ML4A 2O92A 2OLHA 1FFQA 4ZS6A 3WKZA 1TCOC 3JXVA 2LPVA 5DF0A 1ZL1A 2IF4A 2LJ4A 5GQBA 2DPEA 2O9OA 1WNOA 1Q6IA 2FDMA 1QPFA 2A3BA 1PINA 1HKIA 1LL4A 3ARSA 3JYJA 1J4HA 1HXVA 3KCEA 2A3CA 1TFVA 1HKKA 1NWSA 4P8WA 1NSGA 4MNMA 5HUAA 1FKLA 2DSZA 3ARPA 3RMEA 1FFRA 4ODPA 3AS1A 1Q6UA 3OA5A 1KT0A 5D75A 2RUDA 2ZQTA 3O5FA 1IX5A 4QT3A 2K8IA 3ARQA 3IKGA 2F21A 4U85A 4Z2KA 1U79A 1ROUA 1W9PA 4FAPA 1YATA 4P8UA 1N1AA 2F2DA 1W1PA 2Y78A 1R9HA 4ODLA 4HARA 1LG2A 2DSUA 5DIVA 1QPLA 1GOIA 2RUCA 5HW8A 3O5LA 1FKHA 4DRJA 4WKHA 4MNLA 1ZBCA 1E15A 3ARVA 3KAIA 4JFIA 3MDYB 3PR9A 5HBFA 2DSVA 2WK2A 4R0XA 4JYSA 1HJVA 1HKMA 3NTPA 3WH0A 3UI5A 1FKJA 3CHDA 3PA7A 2ZQSA 4MSPA 4Z2GA 4P8VA 1UR9A 3O5OA 3TDBA 4J4NA 1D6OA 3TCZA 3ARUA 4DWSD 3O5MA 1EQ3A 2RUQA 4W9OA 4MNJA 3WL1A 1HKJA 4IPXA 3KADA 1J4IA 2KGJA 2IUZA 1E6PA 4Q7NA 4Z2LA 4DWSB 2MLXA 3AROA 4GIVA 4L72B 4L3NA 4JFLA 3RFWA 4KQZA 3PRDA 3WQVA 2XP6A 1ZU8A 1D7JA 4Z2HA 1H0IA 4G50A 3KACA 1EHNA 2ZQUA 4LGXA 3VAWA 1HJXA 3OOBA 3WD4A 2B31A 2RSEA 5HWBA 2LKNA 2WLYA 3WL0A 3KAGA 4U84A 2OFNA 4XAKA 4MPKA 4NSBA 1ITXA 2LGOA 5BXJA 4Z2JA 1ZB5A 3H9RB 3CGNA 2FAPA 1NWUA 3O5KA 3O5QA 1JNEA 4IQCA 4IT6A 1WAWA 3RM9A 3KAFA 4JFKA 4P8XA 3CHCA 1FKGA 2MLZA 5HT1A 3IKDA 1M5YA 4GGQA 3AS3A 4S3JA 4TW7A 2JZVA 1FKKA 4TNSA 4PTMA 1JNTA 1EYMA 2RQSA 3I6CA 2DG3A 1L1PA 3ARWA 4LAWA 5DITA 3NRKA 2DT3A 2M08A 2KE0A 1W1YA 2WLZA 2A3AA 2FKEA 4ODMA 1H0GA 3UQIA 2KFWA 3B9EA 3UI4A 2M1IA 3UQBA 5HWCA 3ARRA 1SYTA 3G6LA 3O5RA 1E6NA 1FJDA 1NWRA 2KR7A 2PBCA 2ZR4A 2AWGA 3RM4A 2YBUA 2UZ5A 4HBEA 1QZ2A 1FKIA 1OWQA 3ALFA 1NH6A 4Q22A 1GPFA 1KFWA 1FKFA 1UR8A 4FN2A 2XPBA 2XP8A 3UI6A 3TC5A 2AOSA 1OGBA 4JFMA 1NMWA 2DG9A 2G8ZA 4W9PA 5HW7A 5B8IC 1X6NA 4ITZA 3IHZA 2PV3A 3KABA 2RURA 2KO7A 1NWTA 3AS0A 4DIPA 1FD9A 3B8SA 4DRHA 4IQ2A 4W9QA 1RD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2A A;  2XP3 A;  1KT0 A;  4U86 A;  2LGO A;  1Y0O A;  2RUD A;  5D75 A;  2XP9 A;  5BXJ A;  1FKS A;  3H9R B;  2ZQT A;  3O5F A;  1FKT A;  4C02 B;  2PPP A;  4W9Q A;  3CGN A;  2FAP A;  4QT3 A;  4QT2 A;  2K8I A;  3O5K A;  3IKG A;  3O5Q A;  1PBK A;  4IQC A;  2F21 A;  4U85 A;  3EY6 A;  4JFJ A;  2N87 A;  4TYO A;  1FKR A;  3KAF A;  4JFK A;  1U79 A;  1FKG A;  1ROU A;  3B7X A;  4ODK A;  4DRN A;  1YAT A;  4LAX A;  2MLZ A;  5HT1 A;  2XPA A;  4DRM A;  3IKD A;  1M5Y A;  1C9H A;  1N1A A;  2F2D A;  3NI6 A;  4GGQ A;  2XP4 A;  1D7H A;  3O5J A;  2Y78 A;  1R9H A;  4ODL A;  2XP5 A;  4O2T A;  5DIU A;  5DIV A;  4TW7 A;  1KT1 A;  2JZV A;  4ODQ A;  4DZ2 A;  3JYM A;  5HTG A;  1FKK A;  4TNS A;  1J4R A;  1QPL A;  4N19 A;  1FAP A;  1P5Q A;  2RUC A;  3O5P A;  4TW6 A;  1JNT A;  3O5L A;  1FKH A;  4DRJ A;  5HW8 A;  1EYM A;  3ODK A;  4DRO A;  2RQS A;  3I6C A;  4DT4 A;  2MLY A;  1D7I A;  2DG3 A;  1L1P A;  2VN1 A;  3KAI A;  3PRB A;  5GPG A;  4G2P A;  4LAW A;  4JFI A;  3MDY B;  4BF8 A;  5DIT A;  2ZR6 A;  3GPK A;  3NRK A;  4R0X A;  2PPN A;  4DRI A;  1W26 A;  3CGM A;  4JYS A;  2L2S A;  2M08 A;  1YW5 A;  2MPH A;  1F40 A;  1T11 A;  3NTP A;  2KE0 A;  3WH0 A;  3FAP A;  4MGV A;  2FKE A;  4DRK A;  4ODM A;  4LAY A;  2ITK A;  2PV1 A;  3UI5 A;  1FKJ A;  2ZR5 A;  4ODN A;  4DH0 A;  3UQI A;  4DRQ A;  2KFW A;  3KZ7 A;  2VCD A;  1ZCN A;  1ROT A;  3UF8 A;  3O5E A;  3O5D A;  3PA7 A;  3UI4 A;  2ZQS A;  2M1I A;  4MSP A;  5HKG A;  3UQB A;  3KAH A;  5HWC A;  1JNS A;  3O5O A;  3TDB A;  3O5R A;  4DZ3 A;  4J4N A;  1D6O A;  2MF9 A;  3TCZ A;  1FJD A;  1FKB A;  1FKD A;  2D9F A;  1Q1C A;  2KR7 A;  2PBC A;  3O5M A;  1EQ3 A;  2RUQ A;  4W9O A;  2ZR4 A;  2AWG A;  5HW6 A;  2ZQV A;  3RGC A;  4IPX A;  3LUO A;  2UZ5 A;  3KAD A;  3O5G A;  3UQA A;  5I98 A;  1J4I A;  2KGJ A;  1QZ2 A;  4FAP A;  1FKI A;  1BKF A;  4DRP A;  2DG4 A;  2MLX A;  4GIV A;  1JVW A;  4QIB A;  1TCO C;  3JXV A;  1A7X A;  1FKF A;  1F8A B;  2LPV A;  4FN2 A;  4JFL A;  4LAV A;  3RFW A;  2IF4 A;  2LJ4 A;  2XPB A;  4ODR A;  2XP8 A;  3PRD A;  1Q6I A;  3UI6 A;  2XP6 A;  3TC5 A;  1D7J A;  2PPO A;  4JFM A;  1QPF A;  1NMV A;  1ZK6 A;  1HXV A;  1NMW A;  1J6Y A;  2DG9 A;  4G50 A;  4W9P A;  1PIN A;  3KAC A;  2ZQU A;  5HW7 A;  3VAW A;  5B8I C;  3JYJ A;  1J4H A;  3OOB A;  3IHZ A;  1Q6H A;  2PV3 A;  3KCE A;  2RSE A;  4ITZ A;  4J4O A;  4ODO A;  5HWB A;  3KAB A;  2LKN A;  2RUR A;  3IK8 A;  2KO7 A;  4TX0 A;  1NSG A;  3O5I A;  1BL4 A;  5HUA A;  1FKL A;  3KAG A;  4TW8 A;  4U84 A;  2KI3 A;  2F4E A;  2Q5A A;  2MNT A;  2OFN A;  2XP7 A;  4NNR A;  4ODP A;  4DIP A;  1FD9 A;  1Q6U A;  4DRH A;  4IQ2 A;  2PV2 A;  1B6C A;  5J6E A; 
#chains in the Genus database with same CATH topology
 2M2A A;  1JND A;  3B9D A;  1Y0O A;  2XP9 A;  4QT2 A;  4QZV B;  4ZPW R;  1PBK A;  2N87 A;  3ALG A;  1FKR A;  4ODK A;  4DRM A;  1C9H A;  1HJW A;  3BXW A;  1LL7 A;  1D7H A;  1CTN A;  1SR0 A;  2XP4 A;  3O5J A;  5DEZ A;  2XP5 A;  5DIU A;  1WB0 A;  3RM8 A;  5HTG A;  3WD0 A;  1J4R A;  4ZPT R;  4WK9 A;  1P5Q A;  3ART A;  1GUV A;  4DWS A;  4TW6 A;  4DRO A;  4DT4 A;  1LQ0 A;  2VN1 A;  3PRB A;  1EDQ A;  5GPG A;  4BF8 A;  3CZ8 A;  4DRI A;  1W26 A;  2F23 A;  2L2S A;  3ARY A;  1T11 A;  4MGV A;  4LAY A;  4DH0 A;  2ZR5 A;  4ODN A;  4DRQ A;  3KZ7 A;  2DT1 A;  2VCD A;  1ZCN A;  1ROT A;  3O5D A;  1K9T A;  5HKG A;  2DSW A;  1JNS A;  4KR0 B;  4W5U A;  2PI6 A;  2MF9 A;  4IT4 A;  4AY1 A;  1W1T A;  1E6R A;  5HW6 A;  5DO2 A;  4DWS C;  3UQA A;  5I98 A;  2DG4 A;  5JH8 A;  1LG1 A;  1JVW A;  4QIB A;  1A7X A;  3AQU A;  1F8A B;  4LAV A;  4ODR A;  2PPO A;  4URI A;  2YBT A;  1ZK6 A;  1NMV A;  1O6I A;  1E6Z A;  1ZBV A;  1Q6H A;  4J4O A;  4ODO A;  3BMB A;  3FXY A;  3IK8 A;  4TX0 A;  3O5I A;  1BL4 A;  3WD3 A;  2B5U B;  3ARZ A;  4TW8 A;  1XRV A;  2F4E A;  2KI3 A;  2Q5A A;  2MNT A;  2XP7 A;  4NNR A;  3QOK A;  2PV2 A;  1J6Y A;  1B6C A;  1VF8 A;  2XP3 A;  3FY1 A;  4U86 A;  3WD1 A;  1FKS A;  4C02 B;  1FKT A;  2PPP A;  2DT2 A;  3EY6 A;  4JFJ A;  4TYO A;  3B9A A;  3WD2 A;  5J6E A;  3CHF A;  3B7X A;  4DRN A;  4LAX A;  3PRA A;  2XPA A;  2P4V A;  3NI6 A;  1W9V A;  1XHG A;  3G6M A;  4NZC A;  4Z2I A;  1X6L A;  2DT0 A;  3CH9 A;  4O2T A;  4MTV A;  1KT1 A;  4ODQ A;  4DZ2 A;  2WM0 A;  3JYM A;  3W4R A;  4N19 A;  1FAP A;  3O5P A;  3ODK A;  4MNK A;  2MLY A;  1D7I A;  2ESC A;  1W1V A;  4ZPV R;  4G2P A;  2ZR6 A;  3GPK A;  5GPR A;  3CHE A;  2PPN A;  3CGM A;  1YW5 A;  2MPH A;  1F40 A;  2QF8 A;  3FAP A;  1ZBW A;  1E9L A;  4WIW A;  4WKF A;  4DRK A;  3WQW A;  2ITK A;  2PV1 A;  4MAV A;  1D2K A;  1LJY A;  2G41 A;  1EIB A;  3UF8 A;  3WIJ A;  3O5E A;  2A3E A;  1W9U A;  3KAH A;  1ZBK A;  4HBO A;  4S3K A;  4DZ3 A;  1LL6 A;  1FKB A;  1FKD A;  2D9F A;  1Q1C A;  3AS2 A;  2ZQV A;  3RGC A;  4R5E A;  1OGG A;  3ARX A;  3LUO A;  3O5G A;  4WJX A;  4WKA A;  1BKF A;  4DRP A;  4ML4 A;  2O92 A;  2OLH A;  1FFQ A;  4ZS6 A;  3WKZ A;  1TCO C;  3JXV A;  2LPV A;  5DF0 A;  1ZL1 A;  2IF4 A;  2LJ4 A;  5GQB A;  2DPE A;  2O9O A;  1WNO A;  1Q6I A;  2FDM A;  1QPF A;  2A3B A;  1PIN A;  1HKI A;  1LL4 A;  3ARS A;  3JYJ A;  1J4H A;  1HXV A;  3KCE A;  2A3C A;  1TFV A;  1HKK A;  1NWS A;  4P8W A;  1NSG A;  4MNM A;  5HUA A;  1FKL A;  2DSZ A;  3ARP A;  3RME A;  1FFR A;  4ODP A;  3AS1 A;  1Q6U A;  3OA5 A;  1KT0 A;  5D75 A;  2RUD A;  2ZQT A;  3O5F A;  1IX5 A;  4QT3 A;  2K8I A;  3ARQ A;  3IKG A;  2F21 A;  4U85 A;  4Z2K A;  1U79 A;  1ROU A;  1W9P A;  4FAP A;  1YAT A;  2ETN A;  4P8U A;  1N1A A;  2F2D A;  1W1P A;  2Y78 A;  1R9H A;  4ODL A;  4HAR A;  1LG2 A;  2DSU A;  5DIV A;  1QPL A;  1GOI A;  2RUC A;  5HW8 A;  3O5L A;  1FKH A;  4DRJ A;  4WKH A;  4MNL A;  1ZBC A;  1E15 A;  3ARV A;  3KAI A;  4JFI A;  3MDY B;  3PR9 A;  5HBF A;  2DSV A;  2WK2 A;  4R0X A;  4JYS A;  1HJV A;  1HKM A;  3NTP A;  3WH0 A;  3UI5 A;  1FKJ A;  3CHD A;  3PA7 A;  2ZQS A;  4MSP A;  4Z2G A;  4P8V A;  1UR9 A;  3EIP A;  3O5O A;  3TDB A;  4J4N A;  1D6O A;  3TCZ A;  3ARU A;  2EUL A;  4DWS D;  1E44 A;  3O5M A;  2RUQ A;  4W9O A;  1EQ3 A;  4MNJ A;  3WL1 A;  1HKJ A;  4IPX A;  3KAD A;  1J4I A;  2KGJ A;  2IUZ A;  1E6P A;  4Q7N A;  4Z2L A;  4DWS B;  2MLX A;  3ARO A;  4GIV A;  4L72 B;  4L3N A;  4JFL A;  3RFW A;  4KQZ A;  3PRD A;  3WQV A;  2XP6 A;  1ZU8 A;  1D7J A;  4Z2H A;  1H0I A;  4G50 A;  3KAC A;  1EHN A;  2ZQU A;  4LGX A;  3VAW A;  1HJX A;  3OOB A;  3WD4 A;  2B31 A;  2RSE A;  5HWB A;  2LKN A;  2WLY A;  3WL0 A;  1GRJ A;  3KAG A;  4U84 A;  2OFN A;  4XAK A;  4MPK A;  4NSB A;  1ITX A;  2LGO A;  5BXJ A;  4Z2J A;  1ZB5 A;  3H9R B;  3CGN A;  2FAP A;  1NWU A;  3O5K A;  3O5Q A;  1JNE A;  4IQC A;  4IT6 A;  1WAW A;  3RM9 A;  3KAF A;  4JFK A;  4P8X A;  3CHC A;  1FKG A;  2MLZ A;  5HT1 A;  3IKD A;  1M5Y A;  4GGQ A;  3AS3 A;  4S3J A;  4TW7 A;  2JZV A;  1JCH B;  1FKK A;  4TNS A;  4PTM A;  1JNT A;  1EYM A;  2RQS A;  3I6C A;  2DG3 A;  1L1P A;  4UDM A;  3ARW A;  4LAW A;  5DIT A;  3NRK A;  2DT3 A;  2M08 A;  2KE0 A;  1W1Y A;  2WLZ A;  2A3A A;  2FKE A;  4ODM A;  1H0G A;  3GTY X;  3UQI A;  2KFW A;  3B9E A;  3UI4 A;  2M1I A;  3UQB A;  5HWC A;  3ARR A;  1SYT A;  3G6L A;  3O5R A;  1E6N A;  1FJD A;  1NWR A;  2KR7 A;  2PBC A;  2ZR4 A;  2AWG A;  3RM4 A;  2YBU A;  2UZ5 A;  4HBE A;  1QZ2 A;  1FKI A;  1OWQ A;  3ALF A;  1NH6 A;  4Q22 A;  1GPF A;  1KFW A;  1FKF A;  1UR8 A;  4FN2 A;  2XPB A;  2PN0 A;  2XP8 A;  3UI6 A;  3TC5 A;  2AOS A;  1OGB A;  4JFM A;  1NMW A;  2DG9 A;  2G8Z A;  4W9P A;  5HW7 A;  5B8I C;  1X6N A;  4ITZ A;  3IHZ A;  2PV3 A;  3KAB A;  2RUR A;  2KO7 A;  1NWT A;  3AS0 A;  4DIP A;  3GU0 A;  1FD9 A;  3B8S A;  4DRH A;  4IQ2 A;  4W9Q A;  1RD6 A; 
#chains in the Genus database with same CATH homology
 2M2A A;  1JND A;  3B9D A;  1Y0O A;  2XP9 A;  4QT2 A;  4QZV B;  4ZPW R;  1PBK A;  2N87 A;  3ALG A;  1FKR A;  4ODK A;  4DRM A;  1C9H A;  1HJW A;  3BXW A;  1LL7 A;  1D7H A;  1CTN A;  1SR0 A;  2XP4 A;  3O5J A;  5DEZ A;  2XP5 A;  5DIU A;  1WB0 A;  3RM8 A;  5HTG A;  3WD0 A;  1J4R A;  4ZPT R;  4WK9 A;  1P5Q A;  3ART A;  1GUV A;  4DWS A;  4TW6 A;  4DRO A;  4DT4 A;  1LQ0 A;  2VN1 A;  3PRB A;  1EDQ A;  5GPG A;  4BF8 A;  3CZ8 A;  4DRI A;  1W26 A;  2L2S A;  3ARY A;  1T11 A;  4MGV A;  4LAY A;  4DH0 A;  2ZR5 A;  4ODN A;  4DRQ A;  3KZ7 A;  2DT1 A;  2VCD A;  1ZCN A;  1ROT A;  3O5D A;  1K9T A;  5HKG A;  2DSW A;  1JNS A;  4KR0 B;  4W5U A;  2PI6 A;  2MF9 A;  4IT4 A;  4AY1 A;  1W1T A;  1E6R A;  5HW6 A;  5DO2 A;  4DWS C;  3UQA A;  5I98 A;  2DG4 A;  5JH8 A;  1LG1 A;  1JVW A;  4QIB A;  1A7X A;  3AQU A;  1F8A B;  4LAV A;  4ODR A;  2PPO A;  4URI A;  2YBT A;  1ZK6 A;  1NMV A;  1O6I A;  1E6Z A;  1ZBV A;  1Q6H A;  4J4O A;  4ODO A;  3FXY A;  3IK8 A;  4TX0 A;  3O5I A;  1BL4 A;  3WD3 A;  3ARZ A;  4TW8 A;  1XRV A;  2F4E A;  2KI3 A;  2Q5A A;  2MNT A;  2XP7 A;  4NNR A;  3QOK A;  2PV2 A;  1J6Y A;  1B6C A;  1VF8 A;  2XP3 A;  3FY1 A;  4U86 A;  3WD1 A;  1FKS A;  4C02 B;  1FKT A;  2PPP A;  2DT2 A;  3EY6 A;  4JFJ A;  4TYO A;  3B9A A;  3WD2 A;  5J6E A;  3CHF A;  3B7X A;  4DRN A;  4LAX A;  3PRA A;  2XPA A;  3NI6 A;  1W9V A;  1XHG A;  3G6M A;  4NZC A;  4Z2I A;  1X6L A;  2DT0 A;  3CH9 A;  4O2T A;  4MTV A;  1KT1 A;  4ODQ A;  4DZ2 A;  2WM0 A;  3JYM A;  3W4R A;  4N19 A;  1FAP A;  3O5P A;  3ODK A;  4MNK A;  2MLY A;  1D7I A;  2ESC A;  1W1V A;  4ZPV R;  4G2P A;  2ZR6 A;  3GPK A;  5GPR A;  3CHE A;  2PPN A;  3CGM A;  1YW5 A;  2MPH A;  1F40 A;  2QF8 A;  3FAP A;  1ZBW A;  1E9L A;  4WIW A;  4WKF A;  4DRK A;  3WQW A;  2ITK A;  2PV1 A;  4MAV A;  1D2K A;  1LJY A;  2G41 A;  1EIB A;  3UF8 A;  3WIJ A;  3O5E A;  2A3E A;  1W9U A;  3KAH A;  1ZBK A;  4HBO A;  4S3K A;  4DZ3 A;  1LL6 A;  1FKB A;  1FKD A;  2D9F A;  1Q1C A;  3AS2 A;  2ZQV A;  3RGC A;  4R5E A;  1OGG A;  3ARX A;  3LUO A;  3O5G A;  4WJX A;  4WKA A;  1BKF A;  4DRP A;  4ML4 A;  2O92 A;  2OLH A;  1FFQ A;  4ZS6 A;  3WKZ A;  1TCO C;  3JXV A;  2LPV A;  5DF0 A;  1ZL1 A;  2IF4 A;  2LJ4 A;  5GQB A;  2DPE A;  2O9O A;  1WNO A;  1Q6I A;  2FDM A;  1QPF A;  2A3B A;  1PIN A;  1HKI A;  1LL4 A;  3ARS A;  3JYJ A;  1J4H A;  1HXV A;  3KCE A;  2A3C A;  1TFV A;  1HKK A;  1NWS A;  4P8W A;  1NSG A;  4MNM A;  5HUA A;  1FKL A;  2DSZ A;  3ARP A;  3RME A;  1FFR A;  4ODP A;  3AS1 A;  1Q6U A;  3OA5 A;  1KT0 A;  5D75 A;  2RUD A;  2ZQT A;  3O5F A;  1IX5 A;  4QT3 A;  2K8I A;  3ARQ A;  3IKG A;  2F21 A;  4U85 A;  4Z2K A;  1U79 A;  1ROU A;  1W9P A;  4FAP A;  1YAT A;  4P8U A;  1N1A A;  2F2D A;  1W1P A;  2Y78 A;  1R9H A;  4ODL A;  4HAR A;  1LG2 A;  2DSU A;  5DIV A;  1QPL A;  1GOI A;  2RUC A;  5HW8 A;  3O5L A;  1FKH A;  4DRJ A;  4WKH A;  4MNL A;  1ZBC A;  1E15 A;  3ARV A;  3KAI A;  4JFI A;  3MDY B;  3PR9 A;  5HBF A;  2DSV A;  2WK2 A;  4R0X A;  4JYS A;  1HJV A;  1HKM A;  3NTP A;  3WH0 A;  3UI5 A;  1FKJ A;  3CHD A;  3PA7 A;  2ZQS A;  4MSP A;  4Z2G A;  4P8V A;  1UR9 A;  3O5O A;  3TDB A;  4J4N A;  1D6O A;  3TCZ A;  3ARU A;  4DWS D;  3O5M A;  1EQ3 A;  2RUQ A;  4W9O A;  4MNJ A;  3WL1 A;  1HKJ A;  4IPX A;  3KAD A;  1J4I A;  2KGJ A;  2IUZ A;  1E6P A;  4Q7N A;  4Z2L A;  4DWS B;  2MLX A;  3ARO A;  4GIV A;  4L72 B;  4L3N A;  4JFL A;  3RFW A;  4KQZ A;  3PRD A;  3WQV A;  2XP6 A;  1ZU8 A;  1D7J A;  4Z2H A;  1H0I A;  4G50 A;  3KAC A;  1EHN A;  2ZQU A;  4LGX A;  3VAW A;  1HJX A;  3OOB A;  3WD4 A;  2B31 A;  2RSE A;  5HWB A;  2LKN A;  2WLY A;  3WL0 A;  3KAG A;  4U84 A;  2OFN A;  4XAK A;  4MPK A;  4NSB A;  1ITX A;  2LGO A;  5BXJ A;  4Z2J A;  1ZB5 A;  3H9R B;  3CGN A;  2FAP A;  1NWU A;  3O5K A;  3O5Q A;  1JNE A;  4IQC A;  4IT6 A;  1WAW A;  3RM9 A;  3KAF A;  4JFK A;  4P8X A;  3CHC A;  1FKG A;  2MLZ A;  5HT1 A;  3IKD A;  1M5Y A;  4GGQ A;  3AS3 A;  4S3J A;  4TW7 A;  2JZV A;  1FKK A;  4TNS A;  4PTM A;  1JNT A;  1EYM A;  2RQS A;  3I6C A;  2DG3 A;  1L1P A;  3ARW A;  4LAW A;  5DIT A;  3NRK A;  2DT3 A;  2M08 A;  2KE0 A;  1W1Y A;  2WLZ A;  2A3A A;  2FKE A;  4ODM A;  1H0G A;  3UQI A;  2KFW A;  3B9E A;  3UI4 A;  2M1I A;  3UQB A;  5HWC A;  3ARR A;  1SYT A;  3G6L A;  3O5R A;  1E6N A;  1FJD A;  1NWR A;  2KR7 A;  2PBC A;  2ZR4 A;  2AWG A;  3RM4 A;  2YBU A;  2UZ5 A;  4HBE A;  1QZ2 A;  1FKI A;  1OWQ A;  3ALF A;  1NH6 A;  4Q22 A;  1GPF A;  1KFW A;  1FKF A;  1UR8 A;  4FN2 A;  2XPB A;  2XP8 A;  3UI6 A;  3TC5 A;  2AOS A;  1OGB A;  4JFM A;  1NMW A;  2DG9 A;  2G8Z A;  4W9P A;  5HW7 A;  5B8I C;  1X6N A;  4ITZ A;  3IHZ A;  2PV3 A;  3KAB A;  2RUR A;  2KO7 A;  1NWT A;  3AS0 A;  4DIP A;  1FD9 A;  3B8S A;  4DRH A;  4IQ2 A;  4W9Q A;  1RD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...