2PPNA

Crystal structure of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppnA00
1JNTA 2ZR5A 1C9HA 4ODNA 1J4RA 4ODLA 4ODOA 2VCDA 4BF8A 2PV3A 3IHZA 4R0XA 2MLYA 2RUDA 3O5GA 5DIUA 2RQSA 4DZ3A 2ITKA 3UI6A 1R9HA 1N1AA 3ODKA 2VN1A 1HXVA 2N87A 5I98A 1BL4A 3KABA 1FKIA 4QT3A 2MLXA 5HT1A 1Q6IA 2MF9A 1NMWA 5HUAA 3MDYB 2LGOA 3NTPA 1Q6UA 4GGQA 2K8IA 1Q1CA 2DG9A 2XP3A 2PPNA 2ZQVA 4FN2A 1ROTA 3PRDA 2DG3A 5J6EA 3IKDA 1FAPA 1FKDA 4JFJA 1A7XA 4W9PA 3O5FA 2UZ5A 4MGVA 4DRQA 1NSGA 4ODRA 1KT1A 3UI4A 3CGNA 4ITZA 3TCZA 4G50A 3JXVA 2PPOA 2F4EA 1F8AB 1D7IA 1EYMA 4C02B 2PV1A 4N19A 4DRNA 3O5PA 2M08A 5GPGA 2XPAA 3IKGA 4FAPA 4DIPA 3O5OA 1YATA 3KAGA 1FKJA 3KAIA 2RUQA 1FD9A 1PBKA 2XP6A 2PBCA 1B6CA 3KADA 4TW7A 4DRMA 1QPFA 2OFNA 2RUCA 3O5DA 3OOBA 4QIBA 2MLZA 2XP5A 4DZ2A 4DT4A 4J4NA 4DRJA 3O5MA 3WH0A 2JZVA 2KO7A 3H9RB 1Q6HA 2KI3A 2RURA 5HWCA 3KAFA 5DIVA 3FAPA 1J4HA 1ZK6A 1FKSA 4U86A 1QPLA 4J4OA 3KACA 4O2TA 5HKGA 2M1IA 5B8IC 5HW8A 1PINA 2L2SA 4QT2A 5HWBA 3RGCA 3NI6A 1P5QA 4TW8A 1J6YA 1T11A 4LAYA 2RSEA 4ODQA 2XPBA 3JYMA 4IPXA 2PPPA 3NRKA 4W9QA 3O5LA 2MPHA 2F21A 4LAVA 4ODPA 5D75A 3PA7A 2XP7A 1J4IA 3RFWA 1JNSA 2KE0A 3O5RA 1FKLA 4DROA 4JFKA 2ZQTA 1QZ2A 2XP4A 1BKFA 3KZ7A 3KCEA 1TCOC 4NNRA 1W26A 1JVWA 3EY6A 4JFIA 1NMVA 1U79A 2ZR6A 3O5JA 1FKGA 1FKKA 4JFLA 4DRPA 1D7HA 1EQ3A 2Y78A 3O5QA 3IK8A 2XP8A 2D9FA 2MNTA 3PRBA 4MSPA 3TC5A 5BXJA 4W9OA 2KFWA 2IF4A 3O5KA 4LAXA 1YW5A 4GIVA 1FKFA 2ZQSA 2LPVA 1FKHA 1FKBA 2LJ4A 3B7XA 4ODMA 3UI5A 4DRHA 3GPKA 2ZQUA 3JYJA 1D6OA 2FAPA 5HW6A 2ZR4A 1D7JA 3UQBA 4TNSA 2LKNA 1FKRA 2KR7A 1FKTA 5HTGA 1FJDA 5DITA 1ROUA 4DH0A 1L1PA 2AWGA 4U85A 3UQAA 1KT0A 2M2AA 4TYOA 3KAHA 3I6CA 2PV2A 3CGMA 4TX0A 4JYSA 4U84A 1Y0OA 4IQ2A 1F40A 2Q5AA 4DRKA 4ODKA 4TW6A 4DRIA 2F2DA 4JFMA 3UQIA 2XP9A 3O5EA 3LUOA 4IQCA 3TDBA 3UF8A 1ZCNA 5HW7A 4G2PA 2DG4A 4LAWA 2KGJA 3VAWA 1M5YA 3O5IA 2FKEA
chains in the Genus database with same CATH superfamily
2O92A 1C9HA 2O9OA 4BF8A 2VCDA 2PV3A 2RUDA 1D2KA 1GRJA 4NZCA 1ZL1A 1JNDA 1E15A 5HT1A 4KR0B 3PRDA 3AS1A 3WKZA 3GU0A 4JFJA 4XAKA 4ODRA 4ITZA 3TCZA 4G50A 3JXVA 4Z2JA 2A3BA 2PV1A 3CHDA 3G6LA 4ZPVR 1YATA 2PBCA 3KADA 3RM4A 4TW7A 2OFNA 1OGGA 4W5UA 4DZ2A 3WH0A 2KI3A 5HWCA 3KAFA 2PI6A 1QPLA 4O2TA 2M1IA 5HW8A 2L2SA 1NWUA 5HWBA 1J6YA 1T11A 1XHGA 2RSEA 4LAYA 3ARUA 3NRKA 2DT2A 4W9QA 5D75A 4P8VA 1J4IA 3RFWA 1JNSA 2KE0A 3O5RA 4AY1A 4JFKA 1LJYA 4Z2LA 1GOIA 1TCOC 3EY6A 4JFIA 3O5JA 1EQ3A 1FKKA 1D7HA 1NWTA 3O5QA 3IK8A 2XP8A 2D9FA 2MNTA 3CHCA 4Z2KA 5BXJA 3WIJA 4LAXA 1E6NA 1W1PA 2YBTA 5J6EA 1FKBA 5HW6A 4TNSA 2KR7A 2ESCA 4DH0A 3UQAA 2M2AA 2A3AA 1H0GA 1NWSA 1KFWA 1EHNA 4TW6A 4Z2HA 2F2DA 3ARWA 1EIBA 3O5EA 1JNEA 1M5YA 3B9DA 1W9VA 4ODLA 4ODOA 5DO2A 4L3NA 3IHZA 4R0XA 1EDQA 5DIUA 2WK2A 2RQSA 1FFQA 1N1AA 3ODKA 2VN1A 1GPFA 3KABA 3QOKA 5I98A 2DT1A 4QT3A 2MLXA 1Q6IA 2MF9A 4MPKA 4MNLA 3WL1A 1ZBCA 5HBFA 1HKMA 4HARA 5JH8A 2DG3A 4PTMA 1FAPA 1FKDA 3AROA 3ARXA 2UZ5A 4MGVA 4DRQA 2P4VA 3CHEA 3CGNA 2F4EA 3AS3A 1F8AB 1CTNA 3ARTA 1D7IA 1HKJA 4DRNA 3O5PA 2B31A 4MNJA 2XPAA 3IKGA 5DEZA 5GPGA 4FAPA 3B8SA 1WNOA 2RUQA 1PBKA 3GTYX 1QPFA 3O5DA 2MLZA 1H0IA 4MTVA 4MAVA 2JZVA 2KO7A 3H9RB 2RURA 2G41A 4MNMA 1ZK6A 1GUVA 2DSVA 1X6NA 5B8IC 5GQBA 3B9AA 2QF8A 4QT2A 3WD4A 3NI6A 1W9PA 4ODQA 2F21A 3RMEA 1FFRA 3ARSA 1HKKA 1OGBA 1QZ2A 3WQWA 3KZ7A 4DRPA 1NMVA 1E6PA 2Y78A 3CHFA 4HBOA 2DT3A 4MSPA 3PRBA 4Q7NA 3WD3A 1FKFA 2ZQSA 1RD6A 1ZB5A 4HBEA 2ZQUA 2FAPA 1WB0A 1O6IA 3UQBA 2LKNA 4S3KA 1HJXA 2A3CA 5DITA 2WLZA 2AWGA 3ARYA 2PV2A 4TX0A 4JYSA 1Y0OA 3ARZA 1F40A 4DRKA 4DRIA 3AS2A 3LUOA 1ITXA 4IQCA 1TFVA 5HW7A 4R5EA 1LG1A 1LL4A 1JNTA 2DSZA 3O5GA 4WIWA 3AQUA 4DZ3A 3UI6A 4NSBA 2N87A 1FKIA 5DF0A 2DPEA 1W1VA 4GGQA 2XP3A 2PPNA 2ZQVA 4P8WA 1ROTA 1LL6A 3O5FA 1W9UA 1NSGA 2AOSA 1KT1A 3UI4A 3FXYA 1HJVA 1ZBWA 3CZ8A 2PPOA 1IX5A 1EYMA 4N19A 5GPRA 4DIPA 3O5OA 3KAGA 1E44A 3KAIA 4DRMA 3ARPA 2ETNA 4DT4A 3O5MA 1NH6A 1HJWA 1J4HA 1LG2A 5HKGA 2A3EA 4LGXA 3RGCA 1HKIA 3JYMA 4IPXA 4IT4A 2MPHA 2IUZA 3ARVA 1X6LA 1FKLA 3G6MA 2ZQTA 4URIA 1BKFA 3KCEA 1W26A 1JVWA 1WAWA 1U79A 2ZR6A 1FKGA 4JFLA 4KQZA 4UDMA 2FDMA 2KFWA 2IF4A 3O5KA 1YW5A 3WQVA 3B7XA 3UI5A 4ODMA 4DWSB 3CH9A 3GPKA 1OWQA 4S3JA 3JYJA 2B5UB 1D6OA 1SR0A 2ZR4A 1FKTA 4WKFA 3RM9A 1ROUA 3ALGA 1KT0A 1NWRA 4P8UA 3I6CA 3CGMA 1LL7A 1ZBKA 4P8XA 4U84A 1ZU8A 4JFMA 3UF8A 3TDBA 1ZCNA 4G2PA 2DG4A 2KGJA 3B9EA 3O5IA 3EIPA 4DWSC 2ZR5A 4ODNA 2G8ZA 4MNKA 1J4RA 4Q22A 2MLYA 3WL0A 1E9LA 2ITKA 2WLYA 1R9HA 3ALFA 1HXVA 3WD0A 3ARQA 1BL4A 2F23A 5HUAA 1NMWA 3MDYB 2LGOA 3NTPA 1Q6UA 4Z2IA 2K8IA 1Q1CA 3PR9A 2DG9A 4IT6A 4FN2A 1UR8A 4WJXA 3IKDA 3BXWA 1A7XA 4W9PA 3ARRA 4ZS6A 4C02B 4QZVB 2YBUA 3RM8A 2M08A 1ZBVA 4IQ2A 1FKJA 3OA5A 1FD9A 2XP6A 1B6CA 2DSWA 3W4RA 1VF8A 4DWSA 2RUCA 3OOBA 4QIBA 4ZPWR 2XP5A 4J4NA 4DRJA 1XRVA 2OLHA 1Q6HA 3WD1A 5DIVA 3FAPA 1FKSA 4U86A 3WD2A 4J4OA 3KACA 2EULA 2PN0A 1LQ0A 3FY1A 1PINA 3BMBA 4WKHA 3AS0A 1P5QA 4TW8A 2XPBA 2PPPA 3O5LA 4LAVA 4ODPA 3PA7A 2XP7A 4DROA 2XP4A 4NNRA 2DT0A 4ML4A 3TC5A 2DSUA 4W9OA 4ZPTR 4WKAA 4GIVA 2LPVA 1FKHA 2LJ4A 4DRHA 1E6ZA 4Z2GA 4DWSD 1D7JA 1JCHB 1FKRA 5HTGA 4L72B 1FJDA 1K9TA 1L1PA 4U85A 4TYOA 1SYTA 3KAHA 1W1TA 1E6RA 1W1YA 2Q5AA 4WK9A 4ODKA 2WM0A 3PRAA 3UQIA 2XP9A 4LAWA 1UR9A 3VAWA 2FKEA
chains in the Genus database with same CATH topology
2O92A 1C9HA 2O9OA 4BF8A 2VCDA 2PV3A 2RUDA 1D2KA 4NZCA 1ZL1A 1JNDA 1E15A 5HT1A 4KR0B 3PRDA 3AS1A 3WKZA 4JFJA 4XAKA 4ODRA 4ITZA 3TCZA 4G50A 3JXVA 4Z2JA 2A3BA 2PV1A 3CHDA 3G6LA 4ZPVR 1YATA 2PBCA 3KADA 3RM4A 4TW7A 2OFNA 1OGGA 4W5UA 4DZ2A 3WH0A 2KI3A 5HWCA 3KAFA 2PI6A 1QPLA 4O2TA 2M1IA 5HW8A 2L2SA 1NWUA 5HWBA 1J6YA 1T11A 1XHGA 2RSEA 4LAYA 3ARUA 3NRKA 2DT2A 4W9QA 5D75A 4P8VA 1J4IA 3RFWA 1JNSA 2KE0A 3O5RA 4AY1A 4JFKA 1LJYA 4Z2LA 1GOIA 1TCOC 3EY6A 4JFIA 3O5JA 1EQ3A 1FKKA 1D7HA 1NWTA 3O5QA 3IK8A 2XP8A 2D9FA 2MNTA 3CHCA 4Z2KA 5BXJA 3WIJA 4LAXA 1E6NA 1W1PA 2YBTA 5J6EA 1FKBA 5HW6A 4TNSA 2KR7A 2ESCA 4DH0A 3UQAA 2M2AA 2A3AA 1H0GA 1NWSA 1KFWA 1EHNA 4TW6A 4Z2HA 2F2DA 3ARWA 1EIBA 3O5EA 1JNEA 1M5YA 3B9DA 1W9VA 4ODLA 4ODOA 5DO2A 4L3NA 3IHZA 4R0XA 1EDQA 5DIUA 2WK2A 2RQSA 1FFQA 1N1AA 3ODKA 2VN1A 1GPFA 3KABA 3QOKA 5I98A 2DT1A 4QT3A 2MLXA 1Q6IA 2MF9A 4MPKA 4MNLA 3WL1A 1ZBCA 5HBFA 1HKMA 4HARA 5JH8A 2DG3A 4PTMA 1FAPA 1FKDA 3AROA 3ARXA 2UZ5A 4MGVA 4DRQA 3CHEA 3CGNA 2F4EA 3AS3A 1F8AB 1CTNA 3ARTA 1D7IA 1HKJA 4DRNA 3O5PA 2B31A 4MNJA 2XPAA 3IKGA 5DEZA 5GPGA 4FAPA 3B8SA 1WNOA 2RUQA 1PBKA 1QPFA 3O5DA 2MLZA 1H0IA 4MTVA 4MAVA 2JZVA 2KO7A 3H9RB 2RURA 2G41A 4MNMA 1ZK6A 1GUVA 2DSVA 1X6NA 5B8IC 5GQBA 3B9AA 2QF8A 4QT2A 3WD4A 3NI6A 1W9PA 4ODQA 2F21A 3RMEA 1FFRA 3ARSA 1HKKA 1OGBA 1QZ2A 3WQWA 3KZ7A 4DRPA 1NMVA 1E6PA 2Y78A 3CHFA 4HBOA 2DT3A 4MSPA 3PRBA 4Q7NA 3WD3A 1FKFA 2ZQSA 1RD6A 1ZB5A 4HBEA 2ZQUA 2FAPA 1WB0A 1O6IA 3UQBA 2LKNA 4S3KA 1HJXA 2A3CA 5DITA 2WLZA 2AWGA 3ARYA 2PV2A 4TX0A 4JYSA 1Y0OA 3ARZA 1F40A 4DRKA 4DRIA 3AS2A 3LUOA 1ITXA 4IQCA 1TFVA 5HW7A 4R5EA 1LG1A 1LL4A 1JNTA 2DSZA 3O5GA 4WIWA 3AQUA 4DZ3A 3UI6A 4NSBA 2N87A 1FKIA 5DF0A 2DPEA 1W1VA 4GGQA 2XP3A 2PPNA 2ZQVA 4P8WA 1ROTA 1LL6A 3O5FA 1W9UA 1NSGA 2AOSA 1KT1A 3UI4A 3FXYA 1HJVA 1ZBWA 3CZ8A 2PPOA 1IX5A 1EYMA 4N19A 5GPRA 4DIPA 3O5OA 3KAGA 3KAIA 4DRMA 3ARPA 4DT4A 3O5MA 1NH6A 1HJWA 1J4HA 1LG2A 5HKGA 2A3EA 4LGXA 3RGCA 1HKIA 3JYMA 4IPXA 4IT4A 2MPHA 2IUZA 3ARVA 1X6LA 1FKLA 3G6MA 2ZQTA 4URIA 1BKFA 3KCEA 1W26A 1JVWA 1WAWA 1U79A 2ZR6A 1FKGA 4JFLA 4KQZA 2FDMA 2KFWA 2IF4A 3O5KA 1YW5A 3WQVA 3B7XA 3UI5A 4ODMA 4DWSB 3CH9A 3GPKA 1OWQA 4S3JA 3JYJA 1D6OA 1SR0A 2ZR4A 1FKTA 4WKFA 3RM9A 1ROUA 3ALGA 1KT0A 1NWRA 4P8UA 3I6CA 3CGMA 1LL7A 1ZBKA 4P8XA 4U84A 1ZU8A 4JFMA 3UF8A 3TDBA 1ZCNA 4G2PA 2DG4A 2KGJA 3B9EA 3O5IA 4DWSC 2ZR5A 4ODNA 2G8ZA 4MNKA 1J4RA 4Q22A 2MLYA 3WL0A 1E9LA 2ITKA 2WLYA 1R9HA 3ALFA 1HXVA 3WD0A 3ARQA 1BL4A 5HUAA 1NMWA 3MDYB 2LGOA 3NTPA 1Q6UA 4Z2IA 2K8IA 1Q1CA 3PR9A 2DG9A 4IT6A 4FN2A 1UR8A 4WJXA 3IKDA 3BXWA 1A7XA 4W9PA 3ARRA 4ZS6A 4C02B 4QZVB 2YBUA 3RM8A 2M08A 1ZBVA 4IQ2A 1FKJA 3OA5A 1FD9A 2XP6A 1B6CA 2DSWA 3W4RA 1VF8A 4DWSA 2RUCA 3OOBA 4QIBA 4ZPWR 2XP5A 4J4NA 4DRJA 1XRVA 2OLHA 1Q6HA 3WD1A 5DIVA 3FAPA 1FKSA 4U86A 3WD2A 4J4OA 3KACA 1LQ0A 3FY1A 1PINA 4WKHA 3AS0A 1P5QA 4TW8A 2XPBA 2PPPA 3O5LA 4LAVA 4ODPA 3PA7A 2XP7A 4DROA 2XP4A 4NNRA 2DT0A 4ML4A 3TC5A 2DSUA 4W9OA 4ZPTR 4WKAA 4GIVA 2LPVA 1FKHA 2LJ4A 4DRHA 1E6ZA 4Z2GA 4DWSD 1D7JA 1FKRA 5HTGA 4L72B 1FJDA 1K9TA 1L1PA 4U85A 4TYOA 1SYTA 3KAHA 1W1TA 1E6RA 1W1YA 2Q5AA 4WK9A 4ODKA 2WM0A 3PRAA 3UQIA 2XP9A 4LAWA 1UR9A 3VAWA 2FKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNT A;  2ZR5 A;  1C9H A;  4ODN A;  1J4R A;  4ODL A;  4ODO A;  2VCD A;  4BF8 A;  2PV3 A;  3IHZ A;  4R0X A;  2MLY A;  2RUD A;  3O5G A;  5DIU A;  2RQS A;  4DZ3 A;  2ITK A;  3UI6 A;  1R9H A;  1N1A A;  3ODK A;  2VN1 A;  1HXV A;  2N87 A;  5I98 A;  1BL4 A;  3KAB A;  1FKI A;  4QT3 A;  2MLX A;  5HT1 A;  1Q6I A;  2MF9 A;  1NMW A;  5HUA A;  3MDY B;  2LGO A;  3NTP A;  1Q6U A;  4GGQ A;  2K8I A;  1Q1C A;  2DG9 A;  2XP3 A;  2PPN A;  2ZQV A;  4FN2 A;  1ROT A;  3PRD A;  2DG3 A;  5J6E A;  3IKD A;  1FAP A;  1FKD A;  4JFJ A;  1A7X A;  4W9P A;  3O5F A;  2UZ5 A;  4MGV A;  4DRQ A;  1NSG A;  4ODR A;  1KT1 A;  3UI4 A;  3CGN A;  4ITZ A;  3TCZ A;  4G50 A;  3JXV A;  2PPO A;  2F4E A;  1F8A B;  1D7I A;  1EYM A;  4C02 B;  2PV1 A;  4N19 A;  4DRN A;  3O5P A;  2M08 A;  5GPG A;  2XPA A;  3IKG A;  4FAP A;  4DIP A;  3O5O A;  1YAT A;  3KAG A;  1FKJ A;  3KAI A;  2RUQ A;  1FD9 A;  1PBK A;  2XP6 A;  2PBC A;  1B6C A;  3KAD A;  4TW7 A;  4DRM A;  1QPF A;  2OFN A;  2RUC A;  3O5D A;  3OOB A;  4QIB A;  2MLZ A;  2XP5 A;  4DZ2 A;  4DT4 A;  4J4N A;  4DRJ A;  3O5M A;  3WH0 A;  2JZV A;  2KO7 A;  3H9R B;  1Q6H A;  2KI3 A;  2RUR A;  5HWC A;  3KAF A;  5DIV A;  3FAP A;  1J4H A;  1ZK6 A;  1FKS A;  4U86 A;  1QPL A;  4J4O A;  3KAC A;  4O2T A;  5HKG A;  2M1I A;  5B8I C;  5HW8 A;  1PIN A;  2L2S A;  4QT2 A;  5HWB A;  3RGC A;  3NI6 A;  1P5Q A;  4TW8 A;  1J6Y A;  1T11 A;  4LAY A;  2RSE A;  4ODQ A;  2XPB A;  3JYM A;  4IPX A;  2PPP A;  3NRK A;  4W9Q A;  3O5L A;  2MPH A;  2F21 A;  4LAV A;  4ODP A;  5D75 A;  3PA7 A;  2XP7 A;  1J4I A;  3RFW A;  1JNS A;  2KE0 A;  3O5R A;  1FKL A;  4DRO A;  4JFK A;  2ZQT A;  1QZ2 A;  2XP4 A;  1BKF A;  3KZ7 A;  3KCE A;  1TCO C;  4NNR A;  1W26 A;  1JVW A;  3EY6 A;  4JFI A;  1NMV A;  1U79 A;  2ZR6 A;  3O5J A;  1FKG A;  1FKK A;  4JFL A;  4DRP A;  1D7H A;  1EQ3 A;  2Y78 A;  3O5Q A;  3IK8 A;  2XP8 A;  2D9F A;  2MNT A;  3PRB A;  4MSP A;  3TC5 A;  5BXJ A;  4W9O A;  2KFW A;  2IF4 A;  3O5K A;  4LAX A;  1YW5 A;  4GIV A;  1FKF A;  2ZQS A;  2LPV A;  1FKH A;  1FKB A;  2LJ4 A;  3B7X A;  4ODM A;  3UI5 A;  4DRH A;  3GPK A;  2ZQU A;  3JYJ A;  1D6O A;  2FAP A;  5HW6 A;  2ZR4 A;  1D7J A;  3UQB A;  4TNS A;  2LKN A;  1FKR A;  2KR7 A;  1FKT A;  5HTG A;  1FJD A;  5DIT A;  1ROU A;  4DH0 A;  1L1P A;  2AWG A;  4U85 A;  3UQA A;  1KT0 A;  2M2A A;  4TYO A;  3KAH A;  3I6C A;  2PV2 A;  3CGM A;  4TX0 A;  4JYS A;  4U84 A;  1Y0O A;  4IQ2 A;  1F40 A;  2Q5A A;  4DRK A;  4ODK A;  4TW6 A;  4DRI A;  2F2D A;  4JFM A;  3UQI A;  2XP9 A;  3O5E A;  3LUO A;  4IQC A;  3TDB A;  3UF8 A;  1ZCN A;  5HW7 A;  4G2P A;  2DG4 A;  4LAW A;  2KGJ A;  3VAW A;  1M5Y A;  3O5I A;  2FKE A; 
#chains in the Genus database with same CATH topology
 2O92 A;  1C9H A;  2O9O A;  4BF8 A;  2VCD A;  2PV3 A;  2RUD A;  1D2K A;  1GRJ A;  4NZC A;  1ZL1 A;  1JND A;  1E15 A;  5HT1 A;  4KR0 B;  3PRD A;  3AS1 A;  3WKZ A;  3GU0 A;  4JFJ A;  4XAK A;  4ODR A;  4ITZ A;  3TCZ A;  4G50 A;  3JXV A;  4Z2J A;  2A3B A;  2PV1 A;  3CHD A;  3G6L A;  4ZPV R;  1YAT A;  2PBC A;  3KAD A;  3RM4 A;  4TW7 A;  2OFN A;  1OGG A;  4W5U A;  4DZ2 A;  3WH0 A;  2KI3 A;  5HWC A;  3KAF A;  2PI6 A;  1QPL A;  4O2T A;  2M1I A;  5HW8 A;  2L2S A;  1NWU A;  5HWB A;  1J6Y A;  1T11 A;  1XHG A;  2RSE A;  4LAY A;  3ARU A;  3NRK A;  2DT2 A;  4W9Q A;  5D75 A;  4P8V A;  1J4I A;  3RFW A;  1JNS A;  2KE0 A;  3O5R A;  4AY1 A;  4JFK A;  1LJY A;  4Z2L A;  1GOI A;  1TCO C;  3EY6 A;  4JFI A;  3O5J A;  1EQ3 A;  1FKK A;  1D7H A;  1NWT A;  3O5Q A;  3IK8 A;  2XP8 A;  2D9F A;  2MNT A;  3CHC A;  4Z2K A;  5BXJ A;  3WIJ A;  4LAX A;  1E6N A;  1W1P A;  2YBT A;  5J6E A;  1FKB A;  5HW6 A;  4TNS A;  2KR7 A;  2ESC A;  4DH0 A;  3UQA A;  2M2A A;  2A3A A;  1H0G A;  1NWS A;  1KFW A;  1EHN A;  4TW6 A;  4Z2H A;  2F2D A;  3ARW A;  1EIB A;  3O5E A;  1JNE A;  1M5Y A;  3B9D A;  1W9V A;  4ODL A;  4ODO A;  5DO2 A;  4L3N A;  3IHZ A;  4R0X A;  1EDQ A;  5DIU A;  2WK2 A;  2RQS A;  1FFQ A;  1N1A A;  3ODK A;  2VN1 A;  1GPF A;  3KAB A;  3QOK A;  5I98 A;  2DT1 A;  4QT3 A;  2MLX A;  1Q6I A;  2MF9 A;  4MPK A;  4MNL A;  3WL1 A;  1ZBC A;  5HBF A;  1HKM A;  4HAR A;  5JH8 A;  2DG3 A;  4PTM A;  1FAP A;  1FKD A;  3ARO A;  3ARX A;  2UZ5 A;  4MGV A;  4DRQ A;  2P4V A;  3CHE A;  3CGN A;  2F4E A;  3AS3 A;  1F8A B;  1CTN A;  3ART A;  1D7I A;  1HKJ A;  4DRN A;  3O5P A;  2B31 A;  4MNJ A;  2XPA A;  3IKG A;  5DEZ A;  5GPG A;  4FAP A;  3B8S A;  1WNO A;  2RUQ A;  1PBK A;  3GTY X;  1QPF A;  3O5D A;  2MLZ A;  1H0I A;  4MTV A;  4MAV A;  2JZV A;  2KO7 A;  3H9R B;  2RUR A;  2G41 A;  4MNM A;  1ZK6 A;  1GUV A;  2DSV A;  1X6N A;  5B8I C;  5GQB A;  3B9A A;  2QF8 A;  4QT2 A;  3WD4 A;  3NI6 A;  1W9P A;  4ODQ A;  2F21 A;  3RME A;  1FFR A;  3ARS A;  1HKK A;  1OGB A;  1QZ2 A;  3WQW A;  3KZ7 A;  4DRP A;  1NMV A;  1E6P A;  2Y78 A;  3CHF A;  4HBO A;  2DT3 A;  4MSP A;  3PRB A;  4Q7N A;  3WD3 A;  1FKF A;  2ZQS A;  1RD6 A;  1ZB5 A;  4HBE A;  2ZQU A;  2FAP A;  1WB0 A;  1O6I A;  3UQB A;  2LKN A;  4S3K A;  1HJX A;  2A3C A;  5DIT A;  2WLZ A;  2AWG A;  3ARY A;  2PV2 A;  4TX0 A;  4JYS A;  1Y0O A;  3ARZ A;  1F40 A;  4DRK A;  4DRI A;  3AS2 A;  3LUO A;  1ITX A;  4IQC A;  1TFV A;  5HW7 A;  4R5E A;  1LG1 A;  1LL4 A;  1JNT A;  2DSZ A;  3O5G A;  4WIW A;  3AQU A;  4DZ3 A;  3UI6 A;  4NSB A;  2N87 A;  1FKI A;  5DF0 A;  2DPE A;  1W1V A;  4GGQ A;  2XP3 A;  2PPN A;  2ZQV A;  4P8W A;  1ROT A;  1LL6 A;  3O5F A;  1W9U A;  1NSG A;  2AOS A;  1KT1 A;  3UI4 A;  3FXY A;  1HJV A;  1ZBW A;  3CZ8 A;  2PPO A;  1IX5 A;  1EYM A;  4N19 A;  5GPR A;  4DIP A;  3O5O A;  3KAG A;  1E44 A;  3KAI A;  4DRM A;  3ARP A;  2ETN A;  4DT4 A;  3O5M A;  1NH6 A;  1HJW A;  1J4H A;  1LG2 A;  5HKG A;  2A3E A;  4LGX A;  3RGC A;  1HKI A;  3JYM A;  4IPX A;  4IT4 A;  2MPH A;  2IUZ A;  3ARV A;  1X6L A;  1FKL A;  3G6M A;  2ZQT A;  4URI A;  1BKF A;  3KCE A;  1W26 A;  1JVW A;  1WAW A;  1U79 A;  2ZR6 A;  1FKG A;  4JFL A;  4KQZ A;  4UDM A;  2FDM A;  2KFW A;  2IF4 A;  3O5K A;  1YW5 A;  3WQV A;  3B7X A;  3UI5 A;  4ODM A;  4DWS B;  3CH9 A;  3GPK A;  1OWQ A;  4S3J A;  3JYJ A;  2B5U B;  1D6O A;  1SR0 A;  2ZR4 A;  1FKT A;  4WKF A;  3RM9 A;  1ROU A;  3ALG A;  1KT0 A;  1NWR A;  4P8U A;  3I6C A;  3CGM A;  1LL7 A;  1ZBK A;  4P8X A;  4U84 A;  1ZU8 A;  4JFM A;  3UF8 A;  3TDB A;  1ZCN A;  4G2P A;  2DG4 A;  2KGJ A;  3B9E A;  3O5I A;  3EIP A;  4DWS C;  2ZR5 A;  4ODN A;  2G8Z A;  4MNK A;  1J4R A;  4Q22 A;  2MLY A;  3WL0 A;  1E9L A;  2ITK A;  2WLY A;  1R9H A;  3ALF A;  1HXV A;  3WD0 A;  3ARQ A;  1BL4 A;  2F23 A;  5HUA A;  1NMW A;  3MDY B;  2LGO A;  3NTP A;  1Q6U A;  4Z2I A;  2K8I A;  1Q1C A;  3PR9 A;  2DG9 A;  4IT6 A;  4FN2 A;  1UR8 A;  4WJX A;  3IKD A;  3BXW A;  1A7X A;  4W9P A;  3ARR A;  4ZS6 A;  4C02 B;  4QZV B;  2YBU A;  3RM8 A;  2M08 A;  1ZBV A;  4IQ2 A;  1FKJ A;  3OA5 A;  1FD9 A;  2XP6 A;  1B6C A;  2DSW A;  3W4R A;  1VF8 A;  4DWS A;  2RUC A;  3OOB A;  4QIB A;  4ZPW R;  2XP5 A;  4J4N A;  4DRJ A;  1XRV A;  2OLH A;  1Q6H A;  3WD1 A;  5DIV A;  3FAP A;  1FKS A;  4U86 A;  3WD2 A;  4J4O A;  3KAC A;  2EUL A;  2PN0 A;  1LQ0 A;  3FY1 A;  1PIN A;  3BMB A;  4WKH A;  3AS0 A;  1P5Q A;  4TW8 A;  2XPB A;  2PPP A;  3O5L A;  4LAV A;  4ODP A;  3PA7 A;  2XP7 A;  4DRO A;  2XP4 A;  4NNR A;  2DT0 A;  4ML4 A;  3TC5 A;  2DSU A;  4W9O A;  4ZPT R;  4WKA A;  4GIV A;  2LPV A;  1FKH A;  2LJ4 A;  4DRH A;  1E6Z A;  4Z2G A;  4DWS D;  1D7J A;  1JCH B;  1FKR A;  5HTG A;  4L72 B;  1FJD A;  1K9T A;  1L1P A;  4U85 A;  4TYO A;  1SYT A;  3KAH A;  1W1T A;  1E6R A;  1W1Y A;  2Q5A A;  4WK9 A;  4ODK A;  2WM0 A;  3PRA A;  3UQI A;  2XP9 A;  4LAW A;  1UR9 A;  3VAW A;  2FKE A; 
#chains in the Genus database with same CATH homology
 2O92 A;  1C9H A;  2O9O A;  4BF8 A;  2VCD A;  2PV3 A;  2RUD A;  1D2K A;  4NZC A;  1ZL1 A;  1JND A;  1E15 A;  5HT1 A;  4KR0 B;  3PRD A;  3AS1 A;  3WKZ A;  4JFJ A;  4XAK A;  4ODR A;  4ITZ A;  3TCZ A;  4G50 A;  3JXV A;  4Z2J A;  2A3B A;  2PV1 A;  3CHD A;  3G6L A;  4ZPV R;  1YAT A;  2PBC A;  3KAD A;  3RM4 A;  4TW7 A;  2OFN A;  1OGG A;  4W5U A;  4DZ2 A;  3WH0 A;  2KI3 A;  5HWC A;  3KAF A;  2PI6 A;  1QPL A;  4O2T A;  2M1I A;  5HW8 A;  2L2S A;  1NWU A;  5HWB A;  1J6Y A;  1T11 A;  1XHG A;  2RSE A;  4LAY A;  3ARU A;  3NRK A;  2DT2 A;  4W9Q A;  5D75 A;  4P8V A;  1J4I A;  3RFW A;  1JNS A;  2KE0 A;  3O5R A;  4AY1 A;  4JFK A;  1LJY A;  4Z2L A;  1GOI A;  1TCO C;  3EY6 A;  4JFI A;  3O5J A;  1EQ3 A;  1FKK A;  1D7H A;  1NWT A;  3O5Q A;  3IK8 A;  2XP8 A;  2D9F A;  2MNT A;  3CHC A;  4Z2K A;  5BXJ A;  3WIJ A;  4LAX A;  1E6N A;  1W1P A;  2YBT A;  5J6E A;  1FKB A;  5HW6 A;  4TNS A;  2KR7 A;  2ESC A;  4DH0 A;  3UQA A;  2M2A A;  2A3A A;  1H0G A;  1NWS A;  1KFW A;  1EHN A;  4TW6 A;  4Z2H A;  2F2D A;  3ARW A;  1EIB A;  3O5E A;  1JNE A;  1M5Y A;  3B9D A;  1W9V A;  4ODL A;  4ODO A;  5DO2 A;  4L3N A;  3IHZ A;  4R0X A;  1EDQ A;  5DIU A;  2WK2 A;  2RQS A;  1FFQ A;  1N1A A;  3ODK A;  2VN1 A;  1GPF A;  3KAB A;  3QOK A;  5I98 A;  2DT1 A;  4QT3 A;  2MLX A;  1Q6I A;  2MF9 A;  4MPK A;  4MNL A;  3WL1 A;  1ZBC A;  5HBF A;  1HKM A;  4HAR A;  5JH8 A;  2DG3 A;  4PTM A;  1FAP A;  1FKD A;  3ARO A;  3ARX A;  2UZ5 A;  4MGV A;  4DRQ A;  3CHE A;  3CGN A;  2F4E A;  3AS3 A;  1F8A B;  1CTN A;  3ART A;  1D7I A;  1HKJ A;  4DRN A;  3O5P A;  2B31 A;  4MNJ A;  2XPA A;  3IKG A;  5DEZ A;  5GPG A;  4FAP A;  3B8S A;  1WNO A;  2RUQ A;  1PBK A;  1QPF A;  3O5D A;  2MLZ A;  1H0I A;  4MTV A;  4MAV A;  2JZV A;  2KO7 A;  3H9R B;  2RUR A;  2G41 A;  4MNM A;  1ZK6 A;  1GUV A;  2DSV A;  1X6N A;  5B8I C;  5GQB A;  3B9A A;  2QF8 A;  4QT2 A;  3WD4 A;  3NI6 A;  1W9P A;  4ODQ A;  2F21 A;  3RME A;  1FFR A;  3ARS A;  1HKK A;  1OGB A;  1QZ2 A;  3WQW A;  3KZ7 A;  4DRP A;  1NMV A;  1E6P A;  2Y78 A;  3CHF A;  4HBO A;  2DT3 A;  4MSP A;  3PRB A;  4Q7N A;  3WD3 A;  1FKF A;  2ZQS A;  1RD6 A;  1ZB5 A;  4HBE A;  2ZQU A;  2FAP A;  1WB0 A;  1O6I A;  3UQB A;  2LKN A;  4S3K A;  1HJX A;  2A3C A;  5DIT A;  2WLZ A;  2AWG A;  3ARY A;  2PV2 A;  4TX0 A;  4JYS A;  1Y0O A;  3ARZ A;  1F40 A;  4DRK A;  4DRI A;  3AS2 A;  3LUO A;  1ITX A;  4IQC A;  1TFV A;  5HW7 A;  4R5E A;  1LG1 A;  1LL4 A;  1JNT A;  2DSZ A;  3O5G A;  4WIW A;  3AQU A;  4DZ3 A;  3UI6 A;  4NSB A;  2N87 A;  1FKI A;  5DF0 A;  2DPE A;  1W1V A;  4GGQ A;  2XP3 A;  2PPN A;  2ZQV A;  4P8W A;  1ROT A;  1LL6 A;  3O5F A;  1W9U A;  1NSG A;  2AOS A;  1KT1 A;  3UI4 A;  3FXY A;  1HJV A;  1ZBW A;  3CZ8 A;  2PPO A;  1IX5 A;  1EYM A;  4N19 A;  5GPR A;  4DIP A;  3O5O A;  3KAG A;  3KAI A;  4DRM A;  3ARP A;  4DT4 A;  3O5M A;  1NH6 A;  1HJW A;  1J4H A;  1LG2 A;  5HKG A;  2A3E A;  4LGX A;  3RGC A;  1HKI A;  3JYM A;  4IPX A;  4IT4 A;  2MPH A;  2IUZ A;  3ARV A;  1X6L A;  1FKL A;  3G6M A;  2ZQT A;  4URI A;  1BKF A;  3KCE A;  1W26 A;  1JVW A;  1WAW A;  1U79 A;  2ZR6 A;  1FKG A;  4JFL A;  4KQZ A;  2FDM A;  2KFW A;  2IF4 A;  3O5K A;  1YW5 A;  3WQV A;  3B7X A;  3UI5 A;  4ODM A;  4DWS B;  3CH9 A;  3GPK A;  1OWQ A;  4S3J A;  3JYJ A;  1D6O A;  1SR0 A;  2ZR4 A;  1FKT A;  4WKF A;  3RM9 A;  1ROU A;  3ALG A;  1KT0 A;  1NWR A;  4P8U A;  3I6C A;  3CGM A;  1LL7 A;  1ZBK A;  4P8X A;  4U84 A;  1ZU8 A;  4JFM A;  3UF8 A;  3TDB A;  1ZCN A;  4G2P A;  2DG4 A;  2KGJ A;  3B9E A;  3O5I A;  4DWS C;  2ZR5 A;  4ODN A;  2G8Z A;  4MNK A;  1J4R A;  4Q22 A;  2MLY A;  3WL0 A;  1E9L A;  2ITK A;  2WLY A;  1R9H A;  3ALF A;  1HXV A;  3WD0 A;  3ARQ A;  1BL4 A;  5HUA A;  1NMW A;  3MDY B;  2LGO A;  3NTP A;  1Q6U A;  4Z2I A;  2K8I A;  1Q1C A;  3PR9 A;  2DG9 A;  4IT6 A;  4FN2 A;  1UR8 A;  4WJX A;  3IKD A;  3BXW A;  1A7X A;  4W9P A;  3ARR A;  4ZS6 A;  4C02 B;  4QZV B;  2YBU A;  3RM8 A;  2M08 A;  1ZBV A;  4IQ2 A;  1FKJ A;  3OA5 A;  1FD9 A;  2XP6 A;  1B6C A;  2DSW A;  3W4R A;  1VF8 A;  4DWS A;  2RUC A;  3OOB A;  4QIB A;  4ZPW R;  2XP5 A;  4J4N A;  4DRJ A;  1XRV A;  2OLH A;  1Q6H A;  3WD1 A;  5DIV A;  3FAP A;  1FKS A;  4U86 A;  3WD2 A;  4J4O A;  3KAC A;  1LQ0 A;  3FY1 A;  1PIN A;  4WKH A;  3AS0 A;  1P5Q A;  4TW8 A;  2XPB A;  2PPP A;  3O5L A;  4LAV A;  4ODP A;  3PA7 A;  2XP7 A;  4DRO A;  2XP4 A;  4NNR A;  2DT0 A;  4ML4 A;  3TC5 A;  2DSU A;  4W9O A;  4ZPT R;  4WKA A;  4GIV A;  2LPV A;  1FKH A;  2LJ4 A;  4DRH A;  1E6Z A;  4Z2G A;  4DWS D;  1D7J A;  1FKR A;  5HTG A;  4L72 B;  1FJD A;  1K9T A;  1L1P A;  4U85 A;  4TYO A;  1SYT A;  3KAH A;  1W1T A;  1E6R A;  1W1Y A;  2Q5A A;  4WK9 A;  4ODK A;  2WM0 A;  3PRA A;  3UQI A;  2XP9 A;  4LAW A;  1UR9 A;  3VAW A;  2FKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...