2PPNA

Crystal structure of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppnA00
4W9OA 1F8AB 4QT3A 1D7IA 3KZ7A 4ODKA 2KE0A 2M08A 2RURA 2DG9A 4TNSA 3TCZA 3KAGA 4LAWA 4DROA 4LAYA 2XP6A 4U86A 4DRKA 3O5IA 2ZQUA 5DITA 3FAPA 3JYMA 2F4EA 2K8IA 3O5FA 2AWGA 3IK8A 3UQBA 1JNSA 5I98A 2XP7A 2IF4A 2XP8A 2F2DA 4DRPA 3H9RB 3I6CA 4U85A 3VAWA 1FKFA 2N87A 3CGMA 4MSPA 1PBKA 1Q1CA 2MLXA 3EY6A 3KABA 4N19A 2PPOA 2XP9A 1Y0OA 2VN1A 4FN2A 4LAXA 3UF8A 1N1AA 3O5PA 5DIUA 1FKDA 2RSEA 5D75A 4ODRA 2MNTA 4ODMA 1FKHA 3WH0A 1KT1A 1YW5A 3RFWA 1BL4A 5HW7A 3O5QA 4JFIA 3JYJA 4TW7A 2RQSA 3O5GA 2RUDA 4JYSA 1FKSA 1T11A 4TYOA 4JFKA 1QPFA 5GPGA 3KAFA 4DRHA 1FKBA 4DZ3A 5J6EA 4DZ2A 3O5DA 1U79A 2L2SA 5HT1A 4O2TA 4IQ2A 4ODNA 4GGQA 2PPPA 1NSGA 3MDYB 2MPHA 1FKTA 1BKFA 2KR7A 1FKGA 2F21A 4JFMA 2M2AA 1J4RA 3NTPA 5HKGA 5HUAA 4J4NA 4IPXA 2PV1A 2MLZA 2VCDA 1FD9A 3KACA 2MLYA 4JFLA 3UI6A 2ZR4A 2XP4A 4G50A 2XP5A 2ZQTA 1YATA 2RUCA 2XPBA 3JXVA 1P5QA 1B6CA 1FKJA 1NMWA 2ZQSA 2ZR6A 3PRDA 3UI5A 1C9HA 3UQIA 4DRQA 1D7JA 2XP3A 1D7HA 3KADA 4JFJA 3GPKA 4DRMA 3IHZA 2DG4A 2D9FA 3O5JA 3CGNA 3O5RA 1QZ2A 2MF9A 3NI6A 4R0XA 1NMVA 1PINA 3O5KA 1M5YA 4TX0A 1R9HA 3KAIA 1EYMA 1J4HA 4TW8A 2OFNA 2PV2A 2PBCA 1FJDA 2LPVA 1ROUA 4ODLA 5HW8A 4DRIA 2KO7A 3LUOA 1FAPA 3PRBA 4NNRA 1F40A 5HW6A 4ODPA 2ZQVA 2ITKA 3PA7A 2FAPA 3TDBA 5BXJA 5HWBA 3KAHA 3O5LA 4GIVA 3TC5A 3UQAA 1A7XA 2DG3A 4BF8A 4FAPA 2RUQA 1L1PA 2Q5AA 4TW6A 3O5OA 2UZ5A 3OOBA 4MGVA 1W26A 2KGJA 1FKLA 1KT0A 4W9QA 5HTGA 2XPAA 4ITZA 4QT2A 4W9PA 5B8IC 1EQ3A 3O5EA 4DT4A 3IKDA 1ZK6A 4LAVA 5DIVA 2KI3A 1Q6UA 4DH0A 2Y78A 4G2PA 3NRKA 5HWCA 2ZR5A 3IKGA 3O5MA 1Q6IA 4IQCA 4J4OA 3B7XA 2PPNA 4DRJA 1JNTA 1J4IA 4DRNA 1FKRA 4DIPA 4ODOA 2FKEA 4U84A 1JVWA 1TCOC 2M1IA 1FKIA 1D6OA 4QIBA 1HXVA 1Q6HA 2PV3A 3UI4A 1ROTA 2JZVA 2KFWA 4C02B 3RGCA 2LGOA 2LJ4A 1QPLA 1FKKA 2LKNA 3KCEA 3ODKA 1J6YA 4ODQA 1ZCNA
chains in the Genus database with same CATH superfamily
4Z2IA 1XRVA 1W1PA 2WK2A 2PI6A 4P8UA 3CHDA 4ZS6A 3O5IA 1E44A 1ZBCA 5GQBA 3UQBA 1GRJA 2IF4A 2F2DA 4MNKA 3AS3A 1FKFA 2N87A 2O9OA 1Q1CA 4P8XA 2PPOA 3EIPA 1FKDA 1E15A 3WH0A 4ODMA 1KT1A 3ARWA 3O5QA 4TW7A 2DSWA 1WNOA 4JYSA 1FKSA 1T11A 4DZ3A 2L2SA 4Z2HA 3BXWA 4GGQA 1NSGA 2KR7A 5HKGA 2PV1A 2PN0A 1HJVA 2ZQTA 1YATA 2RUCA 2XPBA 1B6CA 1FKJA 1GOIA 2ZR6A 4MTVA 4DRQA 1C9HA 1UR8A 3O5JA 3O5RA 1QZ2A 2MF9A 3O5KA 1R9HA 1EYMA 3CHFA 1FFQA 4LGXA 4WK9A 4WKHA 3PRBA 5JH8A 3WKZA 3UQAA 5GPRA 3O5LA 3TC5A 4DWSA 4BF8A 4FAPA 2RUQA 3O5OA 1W26A 4W9QA 4ITZA 4W9PA 3IKDA 5DIVA 4IT6A 4G2PA 4WIWA 1W1VA 2DSVA 3WL1A 3WD3A 1W9VA 3B7XA 4ML4A 2YBTA 4DRJA 1JNTA 1J4IA 2FKEA 1JVWA 3UI4A 1ROTA 4WKAA 1W1TA 3RGCA 1H0IA 1NWTA 3WD0A 4Z2GA 1ZCNA 1E6PA 4DIPA 1JNSA 4W9OA 4P8WA 1ITXA 1GUVA 1WAWA 1F8AB 1HJXA 4QT3A 4ODKA 1H0GA 4TNSA 5DITA 3FAPA 2K8IA 3G6MA 3IK8A 2XP7A 2XP8A 1NWUA 3WD2A 3VAWA 3AS0A 4MSPA 3KABA 2MLXA 3EY6A 4DWSB 3ARYA 1Y0OA 2VN1A 4QZVB 3UF8A 1N1AA 2RSEA 5D75A 1FKHA 5HW7A 3GU0A 1BL4A 5DO2A 4JFIA 2RQSA 2RUDA 1KFWA 4R5EA 1QPFA 4S3KA 3BMBA 4XAKA 4ZPTR 4WKFA 3MDYB 4MPKA 2MPHA 1BKFA 1HKIA 3WQWA 2M2AA 3NTPA 2MLZA 2VCDA 1FD9A 3FXYA 4G50A 3WL0A 1NH6A 1NMWA 3B9DA 1LJYA 2O92A 1D7JA 4DRMA 1ZBVA 3IHZA 2DG4A 2D9FA 3CGNA 3NI6A 4R0XA 1NMVA 1PINA 1M5YA 2ESCA 1J4HA 2DT2A 2PBCA 2LPVA 4Q7NA 5HW8A 4NNRA 1OGGA 4KR0B 3PA7A 2FAPA 2G41A 4URIA 5BXJA 4HBOA 5HWBA 1ZB5A 2DG3A 1E6NA 2DT1A 2A3CA 1FKLA 1KT0A 5HTGA 4QT2A 4MNJA 3O5EA 4MNMA 4AY1A 1Q6UA 2A3EA 3NRKA 5DEZA 2WM0A 2P4VA 3IKGA 3O5MA 4IQCA 3ARPA 1FKRA 4KQZA 4U84A 1TCOC 1D6OA 1HXVA 1Q6HA 1LL4A 2LGOA 1K9TA 3ARUA 3KCEA 1J6YA 4MNLA 3KZ7A 2A3AA 3KAGA 4LAYA 4U86A 3FY1A 4IT4A 2IUZA 2ZQUA 2F4EA 3WQVA 4U85A 1E6ZA 3CGMA 1LQ0A 1VF8A 4N19A 4FN2A 4LAXA 3O5PA 4ODRA 4Z2KA 3RMEA 1HJWA 1NWRA 3B8SA 3ARXA 4JFKA 4DRHA 3OA5A 5J6EA 4DZ2A 3O5DA 1U79A 1E6RA 5HT1A 1FFRA 4O2TA 4IQ2A 4ZPVR 4P8VA 1ZBWA 1FKTA 2A3BA 4MAVA 1ZL1A 4J4NA 4IPXA 2MLYA 4JFLA 3UI6A 2ZR4A 1EIBA 1P5QA 3PRAA 2ZQSA 3UI5A 2DT0A 1UR9A 3UQIA 2XP3A 4JFJA 4WJXA 1IX5A 4Z2LA 4W5UA 1NWSA 3KAIA 4TW8A 1ROUA 3RM8A 3ARSA 2KO7A 3LUOA 1FAPA 1F40A 1E9LA 5HW6A 4ODPA 3KAHA 4GIVA 1ZU8A 3CZ8A 1L1PA 2Q5AA 4TW6A 2UZ5A 3OOBA 4MGVA 4S3JA 1X6NA 5DF0A 2XPAA 1EQ3A 4PTMA 3CHEA 4DT4A 1SYTA 2ETNA 2WLZA 3G6LA 4LAVA 2KI3A 2Y78A 2ZR5A 2AOSA 1Q6IA 3WD4A 1RD6A 1HKJA 3PR9A 4ODOA 1LG2A 4Q22A 4QIBA 1JNDA 2PV3A 2KFWA 1JNEA 1EDQA 3ARQA 2LKNA 4HARA 2FDMA 1D7IA 3AQUA 3ARZA 2KE0A 2M08A 2RURA 2DG9A 3TCZA 4DROA 4DRKA 4LAWA 2XP6A 3JYMA 3O5FA 2AWGA 5I98A 4DRPA 3H9RB 3CH9A 2F23A 3I6CA 3ARTA 1W9UA 1PBKA 3AS2A 2G8ZA 2XP9A 2DPEA 4HBEA 2DT3A 2OLHA 5DIUA 1WB0A 1X6LA 4L72B 2MNTA 3ALGA 1YW5A 3B9AA 3RFWA 3JYJA 1GPFA 3O5GA 3RM4A 4TYOA 3CHCA 5GPGA 1W1YA 3KAFA 1FKBA 4DWSD 2QF8A 4ZPWR 1HKKA 4ODNA 2PPPA 4Z2JA 2YBUA 1FKGA 2F21A 4JFMA 1J4RA 5HUAA 1TFVA 1JCHB 3KACA 2XP4A 3RM9A 2XP5A 3JXVA 2WLYA 3PRDA 1HKMA 1D7HA 3KADA 4NZCA 3GPKA 3W4RA 2EULA 4DWSC 1D2KA 1OWQA 4TX0A 1LL6A 3B9EA 5HBFA 1LG1A 2OFNA 3WIJA 2PV2A 1FJDA 4NSBA 4ODLA 3ARVA 4DRIA 1SR0A 2ZQVA 2ITKA 3TDBA 3WD1A 1A7XA 2B5UB 4L3NA 3QOKA 1LL7A 1CTNA 2KGJA 3GTYX 1EHNA 2DSZA 5B8IC 1W9PA 1ZK6A 1O6IA 4DH0A 2DSUA 5HWCA 3ARRA 4UDMA 4J4OA 2PPNA 4DRNA 3AS1A 1OGBA 3ALFA 2M1IA 1FKIA 2JZVA 4C02B 1XHGA 2B31A 2LJ4A 1QPLA 1FKKA 1ZBKA 3ODKA 3AROA 4ODQA
chains in the Genus database with same CATH topology
4Z2IA 1XRVA 1W1PA 2WK2A 2PI6A 4P8UA 3CHDA 4ZS6A 3O5IA 1ZBCA 5GQBA 3UQBA 2IF4A 2F2DA 4MNKA 3AS3A 1FKFA 2N87A 2O9OA 1Q1CA 4P8XA 2PPOA 1FKDA 1E15A 3WH0A 4ODMA 1KT1A 3ARWA 3O5QA 4TW7A 2DSWA 1WNOA 4JYSA 1FKSA 1T11A 4DZ3A 2L2SA 4Z2HA 3BXWA 4GGQA 1NSGA 2KR7A 5HKGA 2PV1A 1HJVA 2ZQTA 1YATA 2RUCA 2XPBA 1B6CA 1FKJA 1GOIA 2ZR6A 4MTVA 4DRQA 1C9HA 1UR8A 3O5JA 3O5RA 1QZ2A 2MF9A 3O5KA 1R9HA 1EYMA 3CHFA 1FFQA 4LGXA 4WK9A 4WKHA 3PRBA 5JH8A 3WKZA 3UQAA 5GPRA 3O5LA 3TC5A 4DWSA 4BF8A 4FAPA 2RUQA 3O5OA 1W26A 4W9QA 4ITZA 4W9PA 3IKDA 5DIVA 4IT6A 4G2PA 4WIWA 1W1VA 2DSVA 3WL1A 3WD3A 1W9VA 3B7XA 4ML4A 2YBTA 4DRJA 1JNTA 1J4IA 2FKEA 1JVWA 3UI4A 1ROTA 4WKAA 1W1TA 3RGCA 1H0IA 1NWTA 3WD0A 4Z2GA 1ZCNA 1E6PA 4DIPA 1JNSA 4W9OA 4P8WA 1ITXA 1GUVA 1WAWA 1F8AB 1HJXA 4QT3A 4ODKA 1H0GA 4TNSA 5DITA 3FAPA 2K8IA 3G6MA 3IK8A 2XP7A 2XP8A 1NWUA 3WD2A 3VAWA 3AS0A 4MSPA 3KABA 2MLXA 3EY6A 4DWSB 3ARYA 1Y0OA 2VN1A 4QZVB 3UF8A 1N1AA 2RSEA 5D75A 1FKHA 5HW7A 1BL4A 5DO2A 4JFIA 2RQSA 2RUDA 1KFWA 4R5EA 1QPFA 4S3KA 4XAKA 4ZPTR 4WKFA 3MDYB 4MPKA 2MPHA 1BKFA 1HKIA 3WQWA 2M2AA 3NTPA 2MLZA 2VCDA 1FD9A 3FXYA 4G50A 3WL0A 1NH6A 1NMWA 3B9DA 1LJYA 2O92A 1D7JA 4DRMA 1ZBVA 3IHZA 2DG4A 2D9FA 3CGNA 3NI6A 4R0XA 1NMVA 1PINA 1M5YA 2ESCA 1J4HA 2DT2A 2PBCA 2LPVA 4Q7NA 5HW8A 4NNRA 1OGGA 4KR0B 3PA7A 2FAPA 2G41A 4URIA 5BXJA 4HBOA 5HWBA 1ZB5A 2DG3A 1E6NA 2DT1A 2A3CA 1FKLA 1KT0A 5HTGA 4QT2A 4MNJA 3O5EA 4MNMA 4AY1A 1Q6UA 2A3EA 3NRKA 5DEZA 2WM0A 3IKGA 3O5MA 4IQCA 3ARPA 1FKRA 4KQZA 4U84A 1TCOC 1D6OA 1HXVA 1Q6HA 1LL4A 2LGOA 1K9TA 3ARUA 3KCEA 1J6YA 4MNLA 3KZ7A 2A3AA 3KAGA 4LAYA 4U86A 3FY1A 4IT4A 2IUZA 2ZQUA 2F4EA 3WQVA 4U85A 1E6ZA 3CGMA 1LQ0A 1VF8A 4N19A 4FN2A 4LAXA 3O5PA 4ODRA 4Z2KA 3RMEA 1HJWA 1NWRA 3B8SA 3ARXA 4JFKA 4DRHA 3OA5A 5J6EA 4DZ2A 3O5DA 1U79A 1E6RA 5HT1A 1FFRA 4O2TA 4IQ2A 4ZPVR 4P8VA 1ZBWA 1FKTA 2A3BA 4MAVA 1ZL1A 4J4NA 4IPXA 2MLYA 4JFLA 3UI6A 2ZR4A 1EIBA 1P5QA 3PRAA 2ZQSA 3UI5A 2DT0A 1UR9A 3UQIA 2XP3A 4JFJA 4WJXA 1IX5A 4Z2LA 4W5UA 1NWSA 3KAIA 4TW8A 1ROUA 3RM8A 3ARSA 2KO7A 3LUOA 1FAPA 1F40A 1E9LA 5HW6A 4ODPA 3KAHA 4GIVA 1ZU8A 3CZ8A 1L1PA 2Q5AA 4TW6A 2UZ5A 3OOBA 4MGVA 4S3JA 1X6NA 5DF0A 2XPAA 1EQ3A 4PTMA 3CHEA 4DT4A 1SYTA 3G6LA 2WLZA 4LAVA 2KI3A 2Y78A 2ZR5A 2AOSA 1Q6IA 3WD4A 1RD6A 1HKJA 3PR9A 4ODOA 1LG2A 4Q22A 4QIBA 1JNDA 2PV3A 2KFWA 1JNEA 1EDQA 3ARQA 2LKNA 4HARA 2FDMA 1D7IA 3AQUA 3ARZA 2KE0A 2M08A 2RURA 2DG9A 3TCZA 4DROA 4DRKA 4LAWA 2XP6A 3JYMA 3O5FA 2AWGA 5I98A 4DRPA 3H9RB 3CH9A 3I6CA 3ARTA 1W9UA 1PBKA 3AS2A 2G8ZA 2XP9A 2DPEA 4HBEA 2DT3A 2OLHA 5DIUA 1WB0A 1X6LA 4L72B 2MNTA 3ALGA 1YW5A 3B9AA 3RFWA 3JYJA 1GPFA 3O5GA 3RM4A 4TYOA 3CHCA 5GPGA 1W1YA 3KAFA 1FKBA 4DWSD 2QF8A 4ZPWR 1HKKA 4ODNA 2PPPA 4Z2JA 2YBUA 1FKGA 2F21A 4JFMA 1J4RA 5HUAA 1TFVA 3KACA 2XP4A 3RM9A 2XP5A 3JXVA 2WLYA 3PRDA 1HKMA 1D7HA 3KADA 4NZCA 3GPKA 3W4RA 4DWSC 1D2KA 1OWQA 4TX0A 1LL6A 3B9EA 5HBFA 1LG1A 2OFNA 3WIJA 2PV2A 1FJDA 4NSBA 4ODLA 3ARVA 4DRIA 1SR0A 2ZQVA 2ITKA 3TDBA 3WD1A 1A7XA 4L3NA 3QOKA 1LL7A 1CTNA 2KGJA 1EHNA 2DSZA 5B8IC 1W9PA 1ZK6A 1O6IA 4DH0A 2DSUA 5HWCA 3ARRA 4J4OA 2PPNA 4DRNA 3AS1A 1OGBA 3ALFA 2M1IA 1FKIA 2JZVA 4C02B 1XHGA 2B31A 2LJ4A 1QPLA 1FKKA 1ZBKA 3ODKA 3AROA 4ODQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9O A;  1F8A B;  4QT3 A;  1D7I A;  3KZ7 A;  4ODK A;  2KE0 A;  2M08 A;  2RUR A;  2DG9 A;  4TNS A;  3TCZ A;  3KAG A;  4LAW A;  4DRO A;  4LAY A;  2XP6 A;  4U86 A;  4DRK A;  3O5I A;  2ZQU A;  5DIT A;  3FAP A;  3JYM A;  2F4E A;  2K8I A;  3O5F A;  2AWG A;  3IK8 A;  3UQB A;  1JNS A;  5I98 A;  2XP7 A;  2IF4 A;  2XP8 A;  2F2D A;  4DRP A;  3H9R B;  3I6C A;  4U85 A;  3VAW A;  1FKF A;  2N87 A;  3CGM A;  4MSP A;  1PBK A;  1Q1C A;  2MLX A;  3EY6 A;  3KAB A;  4N19 A;  2PPO A;  2XP9 A;  1Y0O A;  2VN1 A;  4FN2 A;  4LAX A;  3UF8 A;  1N1A A;  3O5P A;  5DIU A;  1FKD A;  2RSE A;  5D75 A;  4ODR A;  2MNT A;  4ODM A;  1FKH A;  3WH0 A;  1KT1 A;  1YW5 A;  3RFW A;  1BL4 A;  5HW7 A;  3O5Q A;  4JFI A;  3JYJ A;  4TW7 A;  2RQS A;  3O5G A;  2RUD A;  4JYS A;  1FKS A;  1T11 A;  4TYO A;  4JFK A;  1QPF A;  5GPG A;  3KAF A;  4DRH A;  1FKB A;  4DZ3 A;  5J6E A;  4DZ2 A;  3O5D A;  1U79 A;  2L2S A;  5HT1 A;  4O2T A;  4IQ2 A;  4ODN A;  4GGQ A;  2PPP A;  1NSG A;  3MDY B;  2MPH A;  1FKT A;  1BKF A;  2KR7 A;  1FKG A;  2F21 A;  4JFM A;  2M2A A;  1J4R A;  3NTP A;  5HKG A;  5HUA A;  4J4N A;  4IPX A;  2PV1 A;  2MLZ A;  2VCD A;  1FD9 A;  3KAC A;  2MLY A;  4JFL A;  3UI6 A;  2ZR4 A;  2XP4 A;  4G50 A;  2XP5 A;  2ZQT A;  1YAT A;  2RUC A;  2XPB A;  3JXV A;  1P5Q A;  1B6C A;  1FKJ A;  1NMW A;  2ZQS A;  2ZR6 A;  3PRD A;  3UI5 A;  1C9H A;  3UQI A;  4DRQ A;  1D7J A;  2XP3 A;  1D7H A;  3KAD A;  4JFJ A;  3GPK A;  4DRM A;  3IHZ A;  2DG4 A;  2D9F A;  3O5J A;  3CGN A;  3O5R A;  1QZ2 A;  2MF9 A;  3NI6 A;  4R0X A;  1NMV A;  1PIN A;  3O5K A;  1M5Y A;  4TX0 A;  1R9H A;  3KAI A;  1EYM A;  1J4H A;  4TW8 A;  2OFN A;  2PV2 A;  2PBC A;  1FJD A;  2LPV A;  1ROU A;  4ODL A;  5HW8 A;  4DRI A;  2KO7 A;  3LUO A;  1FAP A;  3PRB A;  4NNR A;  1F40 A;  5HW6 A;  4ODP A;  2ZQV A;  2ITK A;  3PA7 A;  2FAP A;  3TDB A;  5BXJ A;  5HWB A;  3KAH A;  3O5L A;  4GIV A;  3TC5 A;  3UQA A;  1A7X A;  2DG3 A;  4BF8 A;  4FAP A;  2RUQ A;  1L1P A;  2Q5A A;  4TW6 A;  3O5O A;  2UZ5 A;  3OOB A;  4MGV A;  1W26 A;  2KGJ A;  1FKL A;  1KT0 A;  4W9Q A;  5HTG A;  2XPA A;  4ITZ A;  4QT2 A;  4W9P A;  5B8I C;  1EQ3 A;  3O5E A;  4DT4 A;  3IKD A;  1ZK6 A;  4LAV A;  5DIV A;  2KI3 A;  1Q6U A;  4DH0 A;  2Y78 A;  4G2P A;  3NRK A;  5HWC A;  2ZR5 A;  3IKG A;  3O5M A;  1Q6I A;  4IQC A;  4J4O A;  3B7X A;  2PPN A;  4DRJ A;  1JNT A;  1J4I A;  4DRN A;  1FKR A;  4DIP A;  4ODO A;  2FKE A;  4U84 A;  1JVW A;  1TCO C;  2M1I A;  1FKI A;  1D6O A;  4QIB A;  1HXV A;  1Q6H A;  2PV3 A;  3UI4 A;  1ROT A;  2JZV A;  2KFW A;  4C02 B;  3RGC A;  2LGO A;  2LJ4 A;  1QPL A;  1FKK A;  2LKN A;  3KCE A;  3ODK A;  1J6Y A;  4ODQ A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 4Z2I A;  1XRV A;  1W1P A;  2WK2 A;  2PI6 A;  4P8U A;  3CHD A;  4ZS6 A;  3O5I A;  1E44 A;  1ZBC A;  5GQB A;  3UQB A;  1GRJ A;  2IF4 A;  2F2D A;  4MNK A;  3AS3 A;  1FKF A;  2N87 A;  2O9O A;  1Q1C A;  4P8X A;  2PPO A;  3EIP A;  1FKD A;  1E15 A;  3WH0 A;  4ODM A;  1KT1 A;  3ARW A;  3O5Q A;  4TW7 A;  2DSW A;  1WNO A;  4JYS A;  1FKS A;  1T11 A;  4DZ3 A;  2L2S A;  4Z2H A;  3BXW A;  4GGQ A;  1NSG A;  2KR7 A;  5HKG A;  2PV1 A;  2PN0 A;  1HJV A;  2ZQT A;  1YAT A;  2RUC A;  2XPB A;  1B6C A;  1FKJ A;  1GOI A;  2ZR6 A;  4MTV A;  4DRQ A;  1C9H A;  1UR8 A;  3O5J A;  3O5R A;  1QZ2 A;  2MF9 A;  3O5K A;  1R9H A;  1EYM A;  3CHF A;  1FFQ A;  4LGX A;  4WK9 A;  4WKH A;  3PRB A;  5JH8 A;  3WKZ A;  3UQA A;  5GPR A;  3O5L A;  3TC5 A;  4DWS A;  4BF8 A;  4FAP A;  2RUQ A;  3O5O A;  1W26 A;  4W9Q A;  4ITZ A;  4W9P A;  3IKD A;  5DIV A;  4IT6 A;  4G2P A;  4WIW A;  1W1V A;  2DSV A;  3WL1 A;  3WD3 A;  1W9V A;  3B7X A;  4ML4 A;  2YBT A;  4DRJ A;  1JNT A;  1J4I A;  2FKE A;  1JVW A;  3UI4 A;  1ROT A;  4WKA A;  1W1T A;  3RGC A;  1H0I A;  1NWT A;  3WD0 A;  4Z2G A;  1ZCN A;  1E6P A;  4DIP A;  1JNS A;  4W9O A;  4P8W A;  1ITX A;  1GUV A;  1WAW A;  1F8A B;  1HJX A;  4QT3 A;  4ODK A;  1H0G A;  4TNS A;  5DIT A;  3FAP A;  2K8I A;  3G6M A;  3IK8 A;  2XP7 A;  2XP8 A;  1NWU A;  3WD2 A;  3VAW A;  3AS0 A;  4MSP A;  3KAB A;  2MLX A;  3EY6 A;  4DWS B;  3ARY A;  1Y0O A;  2VN1 A;  4QZV B;  3UF8 A;  1N1A A;  2RSE A;  5D75 A;  1FKH A;  5HW7 A;  3GU0 A;  1BL4 A;  5DO2 A;  4JFI A;  2RQS A;  2RUD A;  1KFW A;  4R5E A;  1QPF A;  4S3K A;  3BMB A;  4XAK A;  4ZPT R;  4WKF A;  3MDY B;  4MPK A;  2MPH A;  1BKF A;  1HKI A;  3WQW A;  2M2A A;  3NTP A;  2MLZ A;  2VCD A;  1FD9 A;  3FXY A;  4G50 A;  3WL0 A;  1NH6 A;  1NMW A;  3B9D A;  1LJY A;  2O92 A;  1D7J A;  4DRM A;  1ZBV A;  3IHZ A;  2DG4 A;  2D9F A;  3CGN A;  3NI6 A;  4R0X A;  1NMV A;  1PIN A;  1M5Y A;  2ESC A;  1J4H A;  2DT2 A;  2PBC A;  2LPV A;  4Q7N A;  5HW8 A;  4NNR A;  1OGG A;  4KR0 B;  3PA7 A;  2FAP A;  2G41 A;  4URI A;  5BXJ A;  4HBO A;  5HWB A;  1ZB5 A;  2DG3 A;  1E6N A;  2DT1 A;  2A3C A;  1FKL A;  1KT0 A;  5HTG A;  4QT2 A;  4MNJ A;  3O5E A;  4MNM A;  4AY1 A;  1Q6U A;  2A3E A;  3NRK A;  5DEZ A;  2WM0 A;  2P4V A;  3IKG A;  3O5M A;  4IQC A;  3ARP A;  1FKR A;  4KQZ A;  4U84 A;  1TCO C;  1D6O A;  1HXV A;  1Q6H A;  1LL4 A;  2LGO A;  1K9T A;  3ARU A;  3KCE A;  1J6Y A;  4MNL A;  3KZ7 A;  2A3A A;  3KAG A;  4LAY A;  4U86 A;  3FY1 A;  4IT4 A;  2IUZ A;  2ZQU A;  2F4E A;  3WQV A;  4U85 A;  1E6Z A;  3CGM A;  1LQ0 A;  1VF8 A;  4N19 A;  4FN2 A;  4LAX A;  3O5P A;  4ODR A;  4Z2K A;  3RME A;  1HJW A;  1NWR A;  3B8S A;  3ARX A;  4JFK A;  4DRH A;  3OA5 A;  5J6E A;  4DZ2 A;  3O5D A;  1U79 A;  1E6R A;  5HT1 A;  1FFR A;  4O2T A;  4IQ2 A;  4ZPV R;  4P8V A;  1ZBW A;  1FKT A;  2A3B A;  4MAV A;  1ZL1 A;  4J4N A;  4IPX A;  2MLY A;  4JFL A;  3UI6 A;  2ZR4 A;  1EIB A;  1P5Q A;  3PRA A;  2ZQS A;  3UI5 A;  2DT0 A;  1UR9 A;  3UQI A;  2XP3 A;  4JFJ A;  4WJX A;  1IX5 A;  4Z2L A;  4W5U A;  1NWS A;  3KAI A;  4TW8 A;  1ROU A;  3RM8 A;  3ARS A;  2KO7 A;  3LUO A;  1FAP A;  1F40 A;  1E9L A;  5HW6 A;  4ODP A;  3KAH A;  4GIV A;  1ZU8 A;  3CZ8 A;  1L1P A;  2Q5A A;  4TW6 A;  2UZ5 A;  3OOB A;  4MGV A;  4S3J A;  1X6N A;  5DF0 A;  2XPA A;  1EQ3 A;  4PTM A;  3CHE A;  4DT4 A;  1SYT A;  2ETN A;  2WLZ A;  3G6L A;  4LAV A;  2KI3 A;  2Y78 A;  2ZR5 A;  2AOS A;  1Q6I A;  3WD4 A;  1RD6 A;  1HKJ A;  3PR9 A;  4ODO A;  1LG2 A;  4Q22 A;  4QIB A;  1JND A;  2PV3 A;  2KFW A;  1JNE A;  1EDQ A;  3ARQ A;  2LKN A;  4HAR A;  2FDM A;  1D7I A;  3AQU A;  3ARZ A;  2KE0 A;  2M08 A;  2RUR A;  2DG9 A;  3TCZ A;  4DRO A;  4DRK A;  4LAW A;  2XP6 A;  3JYM A;  3O5F A;  2AWG A;  5I98 A;  4DRP A;  3H9R B;  3CH9 A;  2F23 A;  3I6C A;  3ART A;  1W9U A;  1PBK A;  3AS2 A;  2G8Z A;  2XP9 A;  2DPE A;  4HBE A;  2DT3 A;  2OLH A;  5DIU A;  1WB0 A;  1X6L A;  4L72 B;  2MNT A;  3ALG A;  1YW5 A;  3B9A A;  3RFW A;  3JYJ A;  1GPF A;  3O5G A;  3RM4 A;  4TYO A;  3CHC A;  5GPG A;  1W1Y A;  3KAF A;  1FKB A;  4DWS D;  2QF8 A;  4ZPW R;  1HKK A;  4ODN A;  2PPP A;  4Z2J A;  2YBU A;  1FKG A;  2F21 A;  4JFM A;  1J4R A;  5HUA A;  1TFV A;  1JCH B;  3KAC A;  2XP4 A;  3RM9 A;  2XP5 A;  3JXV A;  2WLY A;  3PRD A;  1HKM A;  1D7H A;  3KAD A;  4NZC A;  3GPK A;  3W4R A;  2EUL A;  4DWS C;  1D2K A;  1OWQ A;  4TX0 A;  1LL6 A;  3B9E A;  5HBF A;  1LG1 A;  2OFN A;  3WIJ A;  2PV2 A;  1FJD A;  4NSB A;  4ODL A;  3ARV A;  4DRI A;  1SR0 A;  2ZQV A;  2ITK A;  3TDB A;  3WD1 A;  1A7X A;  2B5U B;  4L3N A;  3QOK A;  1LL7 A;  1CTN A;  2KGJ A;  3GTY X;  1EHN A;  2DSZ A;  5B8I C;  1W9P A;  1ZK6 A;  1O6I A;  4DH0 A;  2DSU A;  5HWC A;  3ARR A;  4UDM A;  4J4O A;  2PPN A;  4DRN A;  3AS1 A;  1OGB A;  3ALF A;  2M1I A;  1FKI A;  2JZV A;  4C02 B;  1XHG A;  2B31 A;  2LJ4 A;  1QPL A;  1FKK A;  1ZBK A;  3ODK A;  3ARO A;  4ODQ A; 
#chains in the Genus database with same CATH homology
 4Z2I A;  1XRV A;  1W1P A;  2WK2 A;  2PI6 A;  4P8U A;  3CHD A;  4ZS6 A;  3O5I A;  1ZBC A;  5GQB A;  3UQB A;  2IF4 A;  2F2D A;  4MNK A;  3AS3 A;  1FKF A;  2N87 A;  2O9O A;  1Q1C A;  4P8X A;  2PPO A;  1FKD A;  1E15 A;  3WH0 A;  4ODM A;  1KT1 A;  3ARW A;  3O5Q A;  4TW7 A;  2DSW A;  1WNO A;  4JYS A;  1FKS A;  1T11 A;  4DZ3 A;  2L2S A;  4Z2H A;  3BXW A;  4GGQ A;  1NSG A;  2KR7 A;  5HKG A;  2PV1 A;  1HJV A;  2ZQT A;  1YAT A;  2RUC A;  2XPB A;  1B6C A;  1FKJ A;  1GOI A;  2ZR6 A;  4MTV A;  4DRQ A;  1C9H A;  1UR8 A;  3O5J A;  3O5R A;  1QZ2 A;  2MF9 A;  3O5K A;  1R9H A;  1EYM A;  3CHF A;  1FFQ A;  4LGX A;  4WK9 A;  4WKH A;  3PRB A;  5JH8 A;  3WKZ A;  3UQA A;  5GPR A;  3O5L A;  3TC5 A;  4DWS A;  4BF8 A;  4FAP A;  2RUQ A;  3O5O A;  1W26 A;  4W9Q A;  4ITZ A;  4W9P A;  3IKD A;  5DIV A;  4IT6 A;  4G2P A;  4WIW A;  1W1V A;  2DSV A;  3WL1 A;  3WD3 A;  1W9V A;  3B7X A;  4ML4 A;  2YBT A;  4DRJ A;  1JNT A;  1J4I A;  2FKE A;  1JVW A;  3UI4 A;  1ROT A;  4WKA A;  1W1T A;  3RGC A;  1H0I A;  1NWT A;  3WD0 A;  4Z2G A;  1ZCN A;  1E6P A;  4DIP A;  1JNS A;  4W9O A;  4P8W A;  1ITX A;  1GUV A;  1WAW A;  1F8A B;  1HJX A;  4QT3 A;  4ODK A;  1H0G A;  4TNS A;  5DIT A;  3FAP A;  2K8I A;  3G6M A;  3IK8 A;  2XP7 A;  2XP8 A;  1NWU A;  3WD2 A;  3VAW A;  3AS0 A;  4MSP A;  3KAB A;  2MLX A;  3EY6 A;  4DWS B;  3ARY A;  1Y0O A;  2VN1 A;  4QZV B;  3UF8 A;  1N1A A;  2RSE A;  5D75 A;  1FKH A;  5HW7 A;  1BL4 A;  5DO2 A;  4JFI A;  2RQS A;  2RUD A;  1KFW A;  4R5E A;  1QPF A;  4S3K A;  4XAK A;  4ZPT R;  4WKF A;  3MDY B;  4MPK A;  2MPH A;  1BKF A;  1HKI A;  3WQW A;  2M2A A;  3NTP A;  2MLZ A;  2VCD A;  1FD9 A;  3FXY A;  4G50 A;  3WL0 A;  1NH6 A;  1NMW A;  3B9D A;  1LJY A;  2O92 A;  1D7J A;  4DRM A;  1ZBV A;  3IHZ A;  2DG4 A;  2D9F A;  3CGN A;  3NI6 A;  4R0X A;  1NMV A;  1PIN A;  1M5Y A;  2ESC A;  1J4H A;  2DT2 A;  2PBC A;  2LPV A;  4Q7N A;  5HW8 A;  4NNR A;  1OGG A;  4KR0 B;  3PA7 A;  2FAP A;  2G41 A;  4URI A;  5BXJ A;  4HBO A;  5HWB A;  1ZB5 A;  2DG3 A;  1E6N A;  2DT1 A;  2A3C A;  1FKL A;  1KT0 A;  5HTG A;  4QT2 A;  4MNJ A;  3O5E A;  4MNM A;  4AY1 A;  1Q6U A;  2A3E A;  3NRK A;  5DEZ A;  2WM0 A;  3IKG A;  3O5M A;  4IQC A;  3ARP A;  1FKR A;  4KQZ A;  4U84 A;  1TCO C;  1D6O A;  1HXV A;  1Q6H A;  1LL4 A;  2LGO A;  1K9T A;  3ARU A;  3KCE A;  1J6Y A;  4MNL A;  3KZ7 A;  2A3A A;  3KAG A;  4LAY A;  4U86 A;  3FY1 A;  4IT4 A;  2IUZ A;  2ZQU A;  2F4E A;  3WQV A;  4U85 A;  1E6Z A;  3CGM A;  1LQ0 A;  1VF8 A;  4N19 A;  4FN2 A;  4LAX A;  3O5P A;  4ODR A;  4Z2K A;  3RME A;  1HJW A;  1NWR A;  3B8S A;  3ARX A;  4JFK A;  4DRH A;  3OA5 A;  5J6E A;  4DZ2 A;  3O5D A;  1U79 A;  1E6R A;  5HT1 A;  1FFR A;  4O2T A;  4IQ2 A;  4ZPV R;  4P8V A;  1ZBW A;  1FKT A;  2A3B A;  4MAV A;  1ZL1 A;  4J4N A;  4IPX A;  2MLY A;  4JFL A;  3UI6 A;  2ZR4 A;  1EIB A;  1P5Q A;  3PRA A;  2ZQS A;  3UI5 A;  2DT0 A;  1UR9 A;  3UQI A;  2XP3 A;  4JFJ A;  4WJX A;  1IX5 A;  4Z2L A;  4W5U A;  1NWS A;  3KAI A;  4TW8 A;  1ROU A;  3RM8 A;  3ARS A;  2KO7 A;  3LUO A;  1FAP A;  1F40 A;  1E9L A;  5HW6 A;  4ODP A;  3KAH A;  4GIV A;  1ZU8 A;  3CZ8 A;  1L1P A;  2Q5A A;  4TW6 A;  2UZ5 A;  3OOB A;  4MGV A;  4S3J A;  1X6N A;  5DF0 A;  2XPA A;  1EQ3 A;  4PTM A;  3CHE A;  4DT4 A;  1SYT A;  3G6L A;  2WLZ A;  4LAV A;  2KI3 A;  2Y78 A;  2ZR5 A;  2AOS A;  1Q6I A;  3WD4 A;  1RD6 A;  1HKJ A;  3PR9 A;  4ODO A;  1LG2 A;  4Q22 A;  4QIB A;  1JND A;  2PV3 A;  2KFW A;  1JNE A;  1EDQ A;  3ARQ A;  2LKN A;  4HAR A;  2FDM A;  1D7I A;  3AQU A;  3ARZ A;  2KE0 A;  2M08 A;  2RUR A;  2DG9 A;  3TCZ A;  4DRO A;  4DRK A;  4LAW A;  2XP6 A;  3JYM A;  3O5F A;  2AWG A;  5I98 A;  4DRP A;  3H9R B;  3CH9 A;  3I6C A;  3ART A;  1W9U A;  1PBK A;  3AS2 A;  2G8Z A;  2XP9 A;  2DPE A;  4HBE A;  2DT3 A;  2OLH A;  5DIU A;  1WB0 A;  1X6L A;  4L72 B;  2MNT A;  3ALG A;  1YW5 A;  3B9A A;  3RFW A;  3JYJ A;  1GPF A;  3O5G A;  3RM4 A;  4TYO A;  3CHC A;  5GPG A;  1W1Y A;  3KAF A;  1FKB A;  4DWS D;  2QF8 A;  4ZPW R;  1HKK A;  4ODN A;  2PPP A;  4Z2J A;  2YBU A;  1FKG A;  2F21 A;  4JFM A;  1J4R A;  5HUA A;  1TFV A;  3KAC A;  2XP4 A;  3RM9 A;  2XP5 A;  3JXV A;  2WLY A;  3PRD A;  1HKM A;  1D7H A;  3KAD A;  4NZC A;  3GPK A;  3W4R A;  4DWS C;  1D2K A;  1OWQ A;  4TX0 A;  1LL6 A;  3B9E A;  5HBF A;  1LG1 A;  2OFN A;  3WIJ A;  2PV2 A;  1FJD A;  4NSB A;  4ODL A;  3ARV A;  4DRI A;  1SR0 A;  2ZQV A;  2ITK A;  3TDB A;  3WD1 A;  1A7X A;  4L3N A;  3QOK A;  1LL7 A;  1CTN A;  2KGJ A;  1EHN A;  2DSZ A;  5B8I C;  1W9P A;  1ZK6 A;  1O6I A;  4DH0 A;  2DSU A;  5HWC A;  3ARR A;  4J4O A;  2PPN A;  4DRN A;  3AS1 A;  1OGB A;  3ALF A;  2M1I A;  1FKI A;  2JZV A;  4C02 B;  1XHG A;  2B31 A;  2LJ4 A;  1QPL A;  1FKK A;  1ZBK A;  3ODK A;  3ARO A;  4ODQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...