2PPNA

Crystal structure of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppnA00
1BL4A 3O5LA 3UI5A 4U85A 4JYSA 2ZR5A 2VN1A 1FKGA 2XP6A 3O5QA 3KAIA 3NI6A 4ODKA 2PV3A 4TW7A 1B6CA 2M08A 5HT1A 1JNTA 3UF8A 2OFNA 1FKKA 1D7IA 1D7JA 4ODOA 4R0XA 5DIVA 3IK8A 4LAVA 2XP9A 4ODLA 2MNTA 2L2SA 5HWBA 1T11A 4DRIA 5HWCA 2RSEA 2MF9A 3EY6A 4LAXA 2N87A 1N1AA 1Q6UA 3KADA 4NNRA 3JYJA 2FKEA 3JYMA 4IQCA 4O2TA 2IF4A 2LJ4A 2RUDA 2ZR4A 3O5FA 3RFWA 4DRHA 1PINA 1R9HA 1F40A 1ZCNA 3O5MA 1NMWA 2F2DA 2XP7A 3NRKA 3KAGA 4TNSA 1QPFA 1EYMA 1FKIA 3KAHA 1JVWA 2LPVA 5HKGA 4W9PA 1JNSA 1Q6HA 2KGJA 4JFKA 2MPHA 3O5IA 4GIVA 3O5EA 2LKNA 4JFMA 4TX0A 4U86A 3FAPA 4JFLA 4DRPA 3O5PA 1QZ2A 1FKJA 1J6YA 4GGQA 2ZQVA 4IPXA 1J4RA 5DIUA 1FD9A 3UI6A 1EQ3A 1Q6IA 5DITA 1FKFA 4DZ3A 1QPLA 2KR7A 4QT2A 2PV1A 2Y78A 1KT0A 4TW6A 3TC5A 1FKHA 1FKBA 2DG9A 2AWGA 2DG3A 4DROA 5HW6A 3UQAA 5B8IC 4C02B 3PRBA 5D75A 4DRJA 1YW5A 1KT1A 2MLYA 3TDBA 3KAFA 1PBKA 4ITZA 1FKTA 2ZR6A 3IHZA 4DRQA 5I98A 4DZ2A 1D6OA 1TCOC 4TW8A 3UQIA 1J4IA 4FAPA 1FKRA 2XP4A 3PRDA 3IKDA 4QT3A 1BKFA 3GPKA 4FN2A 3O5JA 1HXVA 3B7XA 4DRMA 3H9RB 1W26A 4J4OA 4DRNA 2PBCA 4IQ2A 2KI3A 5HUAA 2KE0A 2KO7A 3O5RA 4G50A 1ZK6A 2ZQSA 4QIBA 2M1IA 3TCZA 1C9HA 3KCEA 2UZ5A 2D9FA 2MLZA 3I6CA 2RUQA 4LAWA 2LGOA 3O5KA 2RUCA 4ODMA 1Q1CA 3KACA 2MLXA 1FKLA 2F21A 3MDYB 3CGMA 3O5GA 2RURA 1U79A 2M2AA 5HW8A 3IKGA 3WH0A 2KFWA 1ROTA 2XP3A 2PV2A 2ZQTA 3OOBA 2XP8A 4J4NA 2Q5AA 2F4EA 4DRKA 1FKDA 2PPOA 2ITKA 4N19A 4BF8A 1D7HA 1FKSA 1FAPA 3LUOA 1NMVA 4DH0A 1A7XA 2K8IA 2XP5A 4JFIA 3VAWA 5HTGA 4U84A 2JZVA 4W9OA 3UI4A 1ROUA 4G2PA 2ZQUA 3RGCA 3JXVA 4JFJA 2PPNA 3O5DA 4LAYA 3KZ7A 1NSGA 1F8AB 4ODRA 2VCDA 4W9QA 1L1PA 4ODQA 1YATA 3UQBA 2DG4A 2RQSA 2XPAA 4ODNA 3O5OA 1P5QA 4ODPA 4MGVA 3ODKA 1FJDA 1J4HA 2XPBA 5BXJA 4MSPA 2PPPA 3CGNA 4TYOA 5GPGA 5J6EA 3NTPA 1M5YA 4DT4A 5HW7A 3KABA 1Y0OA 3PA7A 2FAPA 4DIPA
chains in the Genus database with same CATH superfamily
3O5LA 4JYSA 2ZR5A 2VN1A 1FKGA 3O5QA 3WQWA 1H0GA 2P4VA 1LL7A 1ZBCA 1ITXA 1D7IA 4MTVA 4R0XA 1ZU8A 4ODLA 2MNTA 2L2SA 5HWBA 3B9DA 1Q6UA 2DT1A 1LG2A 1ZL1A 1EHNA 2DT0A 3O5FA 5DEZA 1PINA 4TNSA 3NRKA 1JNSA 1JNDA 1FKIA 3KAHA 3WL1A 2KGJA 4JFKA 2MPHA 4GIVA 4ZPWR 3PRAA 3B8SA 3AQUA 2ZQVA 1HKIA 1E6PA 2PV1A 2Y78A 4TW6A 1GPFA 1FKHA 3CHDA 4DROA 3PR9A 4C02B 4DRQA 3RM4A 4DZ2A 1HKKA 1VF8A 1J4IA 1FKRA 1UR9A 2F23A 3ALFA 3IKDA 4W5UA 3GPKA 1W9UA 2PBCA 4DWSA 4IQ2A 4G50A 2ZQSA 2M1IA 1C9HA 5DF0A 2UZ5A 3I6CA 1WNOA 2PI6A 3KACA 2F21A 3O5GA 1U79A 1HKJA 2IUZA 3GU0A 2PV2A 2ZQTA 3ARVA 3OOBA 2F4EA 3WL0A 2PPOA 4Q22A 4DH0A 1FAPA 2K8IA 3VAWA 4P8UA 4W9OA 3UI4A 3WD0A 2PPNA 1NWRA 3ARUA 1F8AB 3CHFA 4ODRA 5JH8A 4W9QA 4UDMA 1L1PA 4ODQA 3UQBA 2RQSA 2O9OA 1KFWA 4DWSB 3ARQA 3GTYX 1D2KA 4TYOA 1HJXA 1Y0OA 1W1YA 1GRJA 4ZS6A 2DSVA 1BL4A 2XP6A 4HBEA 3KAIA 2PV3A 1B6CA 5HT1A 2ETNA 1K9TA 3UF8A 1RD6A 1W1PA 1JNEA 4Z2LA 1T11A 4DRIA 4Z2GA 3EY6A 1N1AA 1W9VA 3JYJA 3JYMA 4DRHA 1W1VA 3RFWA 1F40A 3O5MA 1NMWA 2F2DA 4QZVB 1QPFA 1GUVA 1HJWA 1JVWA 4WKHA 4MNLA 2DSUA 1NWUA 2O92A 4TX0A 1XHGA 4JFLA 1FFQA 3BMBA 1OWQA 4GGQA 4WKAA 4IPXA 2B31A 1FD9A 3UI6A 1TFVA 4DZ3A 4QT2A 1KT0A 2DG9A 4WKFA 5HW6A 2QF8A 4ITZA 1PBKA 2ZR6A 2PN0A 2DT2A 3PRDA 1W1TA 2A3CA 1HXVA 4WJXA 3B7XA 4DRMA 5GPRA 4J4OA 4DRNA 1LL6A 1ZB5A 1W9PA 3FY1A 3AS1A 2KE0A 5HBFA 2A3AA 2D9FA 2RUQA 3O5KA 4ODMA 2MLXA 3CGMA 3WIJA 2M2AA 4P8VA 3IKGA 5HW8A 3WH0A 1ROTA 2Q5AA 4DRKA 2ITKA 4BF8A 1FKSA 3G6LA 3CH9A 4S3KA 1NMVA 3FXYA 4JFIA 4AY1A 2WLZA 2B5UB 1LJYA 3RGCA 2ZQUA 4JFJA 4KQZA 3O5DA 4LAYA 1HKMA 1LG1A 1ZBKA 2XPAA 4ODNA 3O5OA 3ODKA 1FJDA 4ML4A 1SYTA 1CTNA 4NZCA 1E6RA 3QOKA 5GPGA 5J6EA 4P8WA 3KABA 3PA7A 4MNJA 4URIA 4DIPA 3WD1A 4TW7A 3NI6A 1NH6A 2M08A 1JNTA 3W4RA 1FKKA 2G8ZA 4DWSC 3IK8A 4LAVA 4Z2KA 1OGBA 2MF9A 4WIWA 2N87A 4NNRA 2FKEA 4IQCA 4O2TA 2LJ4A 2RUDA 2ZR4A 3WD4A 1R9HA 1EYMA 5GQBA 4S3JA 1Q6HA 4U86A 2LKNA 3RM8A 1QZ2A 4LGXA 1J6YA 3ARSA 2OLHA 1J4RA 5DIUA 1EIBA 4MPKA 1EQ3A 5DITA 1QPLA 2DSWA 4Z2IA 3UQAA 5B8IC 3ARYA 3ARZA 3PRBA 5D75A 2MLYA 1NWSA 3TDBA 2WM0A 3WD2A 1FKTA 5I98A 1D6OA 1TCOC 4TW8A 4FAPA 2WLYA 2XP4A 1FFRA 2FDMA 3H9RB 1W26A 2KI3A 1GOIA 3CHCA 4L3NA 3O5RA 2KO7A 5HUAA 3TCZA 2MLZA 4MNKA 4LAWA 3BXWA 2RUCA 3MDYB 2RURA 2G41A 4HARA 2XP3A 4J4NA 3ARXA 1WAWA 4N19A 3ARTA 1A7XA 2XP5A 2DT3A 3WKZA 5HTGA 1E6NA 1ROUA 3JXVA 1H0IA 3KZ7A 1NSGA 4L72B 4IT6A 2VCDA 3B9EA 2DG4A 3ARRA 1X6NA 1E15A 4HBOA 1P5QA 4ODPA 2DSZA 4MGVA 3WD3A 1J4HA 2XPBA 4MSPA 4MAVA 4DT4A 5HW7A 4IT4A 3AS0A 2FAPA 3OA5A 3UI5A 4U85A 2A3EA 1IX5A 2WK2A 4ODKA 2OFNA 3CHEA 4P8XA 1D7JA 4ODOA 5DIVA 1XRVA 2XP9A 3ARWA 2EULA 5HWCA 2RSEA 4ZPVR 4LAXA 3KADA 4KR0B 5DO2A 2IF4A 1ZCNA 2AOSA 2XP7A 3KAGA 2LPVA 5HKGA 4W9PA 1OGGA 3O5IA 3O5EA 4JFMA 3G6MA 3FAPA 4DRPA 4DWSD 1UR8A 3O5PA 4Z2JA 4NSBA 1FKJA 4MNMA 3CZ8A 2YBTA 1JCHB 4Z2HA 2YBUA 2DPEA 1LL4A 1WB0A 1Q6IA 1FKFA 3AROA 2KR7A 4PTMA 1FKBA 4WK9A 3TC5A 2AWGA 2DG3A 3RM9A 4DRJA 1YW5A 1KT1A 3KAFA 1SR0A 4Q7NA 1O6IA 3IHZA 3UQIA 4XAKA 3RMEA 4ZPTR 4QT3A 1BKFA 4FN2A 3O5JA 1E6ZA 3AS2A 1E9LA 1ZK6A 4QIBA 3WQVA 3KCEA 2LGOA 1X6LA 1ZBWA 1Q1CA 1FKLA 2KFWA 2A3BA 3AS3A 2XP8A 1HJVA 1FKDA 1D7HA 3LUOA 1EDQA 1ZBVA 2ESCA 4U84A 2JZVA 3ALGA 4G2PA 1NWTA 1YATA 1E44A 4R5EA 3B9AA 5BXJA 3ARPA 2PPPA 3CGNA 1LQ0A 3NTPA 1M5YA 3EIPA
chains in the Genus database with same CATH topology
3O5LA 4JYSA 2ZR5A 2VN1A 1FKGA 3O5QA 3WQWA 1H0GA 1LL7A 1ZBCA 1ITXA 1D7IA 4MTVA 4R0XA 1ZU8A 4ODLA 2MNTA 2L2SA 5HWBA 3B9DA 1Q6UA 2DT1A 1LG2A 1ZL1A 1EHNA 2DT0A 3O5FA 5DEZA 1PINA 4TNSA 3NRKA 1JNSA 1JNDA 1FKIA 3KAHA 3WL1A 2KGJA 4JFKA 2MPHA 4GIVA 4ZPWR 3PRAA 3B8SA 3AQUA 2ZQVA 1HKIA 1E6PA 2PV1A 2Y78A 4TW6A 1GPFA 1FKHA 3CHDA 4DROA 3PR9A 4C02B 4DRQA 3RM4A 4DZ2A 1HKKA 1VF8A 1J4IA 1FKRA 1UR9A 3ALFA 3IKDA 4W5UA 3GPKA 1W9UA 2PBCA 4DWSA 4IQ2A 4G50A 2ZQSA 2M1IA 1C9HA 5DF0A 2UZ5A 3I6CA 1WNOA 2PI6A 3KACA 2F21A 3O5GA 1U79A 1HKJA 2IUZA 2PV2A 2ZQTA 3ARVA 3OOBA 2F4EA 3WL0A 2PPOA 4Q22A 4DH0A 1FAPA 2K8IA 3VAWA 4P8UA 4W9OA 3UI4A 3WD0A 2PPNA 1NWRA 3ARUA 1F8AB 3CHFA 4ODRA 5JH8A 4W9QA 1L1PA 4ODQA 3UQBA 2RQSA 2O9OA 1KFWA 4DWSB 3ARQA 1D2KA 4TYOA 1HJXA 1Y0OA 1W1YA 4ZS6A 2DSVA 1BL4A 2XP6A 4HBEA 3KAIA 2PV3A 1B6CA 5HT1A 1K9TA 3UF8A 1RD6A 1W1PA 1JNEA 4Z2LA 1T11A 4DRIA 4Z2GA 3EY6A 1N1AA 1W9VA 3JYJA 3JYMA 4DRHA 1W1VA 3RFWA 1F40A 3O5MA 1NMWA 2F2DA 4QZVB 1QPFA 1GUVA 1HJWA 1JVWA 4WKHA 4MNLA 2DSUA 1NWUA 2O92A 4TX0A 1XHGA 4JFLA 1FFQA 1OWQA 4GGQA 4WKAA 4IPXA 2B31A 1FD9A 3UI6A 1TFVA 4DZ3A 4QT2A 1KT0A 2DG9A 4WKFA 5HW6A 2QF8A 4ITZA 1PBKA 2ZR6A 2DT2A 3PRDA 1W1TA 2A3CA 1HXVA 4WJXA 3B7XA 4DRMA 5GPRA 4J4OA 4DRNA 1LL6A 1ZB5A 1W9PA 3FY1A 3AS1A 2KE0A 5HBFA 2A3AA 2D9FA 2RUQA 3O5KA 4ODMA 2MLXA 3CGMA 3WIJA 2M2AA 4P8VA 3IKGA 5HW8A 3WH0A 1ROTA 2Q5AA 4DRKA 2ITKA 4BF8A 1FKSA 3G6LA 3CH9A 4S3KA 1NMVA 3FXYA 4JFIA 4AY1A 2WLZA 1LJYA 3RGCA 2ZQUA 4JFJA 4KQZA 3O5DA 4LAYA 1HKMA 1LG1A 1ZBKA 2XPAA 4ODNA 3O5OA 3ODKA 1FJDA 4ML4A 1SYTA 1CTNA 4NZCA 1E6RA 3QOKA 5GPGA 5J6EA 4P8WA 3KABA 3PA7A 4MNJA 4URIA 4DIPA 3WD1A 4TW7A 3NI6A 1NH6A 2M08A 1JNTA 3W4RA 1FKKA 2G8ZA 4DWSC 3IK8A 4LAVA 4Z2KA 1OGBA 2MF9A 4WIWA 2N87A 4NNRA 2FKEA 4IQCA 4O2TA 2LJ4A 2RUDA 2ZR4A 3WD4A 1R9HA 1EYMA 5GQBA 4S3JA 1Q6HA 4U86A 2LKNA 3RM8A 1QZ2A 4LGXA 1J6YA 3ARSA 2OLHA 1J4RA 5DIUA 1EIBA 4MPKA 1EQ3A 5DITA 1QPLA 2DSWA 4Z2IA 3UQAA 5B8IC 3ARYA 3ARZA 3PRBA 5D75A 2MLYA 1NWSA 3TDBA 2WM0A 3WD2A 1FKTA 5I98A 1D6OA 1TCOC 4TW8A 4FAPA 2WLYA 2XP4A 1FFRA 2FDMA 3H9RB 1W26A 2KI3A 1GOIA 3CHCA 4L3NA 3O5RA 2KO7A 5HUAA 3TCZA 2MLZA 4MNKA 4LAWA 3BXWA 2RUCA 3MDYB 2RURA 2G41A 4HARA 2XP3A 4J4NA 3ARXA 1WAWA 4N19A 3ARTA 1A7XA 2XP5A 2DT3A 3WKZA 5HTGA 1E6NA 1ROUA 3JXVA 1H0IA 3KZ7A 1NSGA 4L72B 4IT6A 2VCDA 3B9EA 2DG4A 3ARRA 1X6NA 1E15A 4HBOA 1P5QA 4ODPA 2DSZA 4MGVA 3WD3A 1J4HA 2XPBA 4MSPA 4MAVA 4DT4A 5HW7A 4IT4A 3AS0A 2FAPA 3OA5A 3UI5A 4U85A 2A3EA 1IX5A 2WK2A 4ODKA 2OFNA 3CHEA 4P8XA 1D7JA 4ODOA 5DIVA 1XRVA 2XP9A 3ARWA 5HWCA 2RSEA 4ZPVR 4LAXA 3KADA 4KR0B 5DO2A 2IF4A 1ZCNA 2AOSA 2XP7A 3KAGA 2LPVA 5HKGA 4W9PA 1OGGA 3O5IA 3O5EA 4JFMA 3G6MA 3FAPA 4DRPA 4DWSD 1UR8A 3O5PA 4Z2JA 4NSBA 1FKJA 4MNMA 3CZ8A 2YBTA 4Z2HA 2YBUA 2DPEA 1LL4A 1WB0A 1Q6IA 1FKFA 3AROA 2KR7A 4PTMA 1FKBA 4WK9A 3TC5A 2AWGA 2DG3A 3RM9A 4DRJA 1YW5A 1KT1A 3KAFA 1SR0A 4Q7NA 1O6IA 3IHZA 3UQIA 4XAKA 3RMEA 4ZPTR 4QT3A 1BKFA 4FN2A 3O5JA 1E6ZA 3AS2A 1E9LA 1ZK6A 4QIBA 3WQVA 3KCEA 2LGOA 1X6LA 1ZBWA 1Q1CA 1FKLA 2KFWA 2A3BA 3AS3A 2XP8A 1HJVA 1FKDA 1D7HA 3LUOA 1EDQA 1ZBVA 2ESCA 4U84A 2JZVA 3ALGA 4G2PA 1NWTA 1YATA 4R5EA 3B9AA 5BXJA 3ARPA 2PPPA 3CGNA 1LQ0A 3NTPA 1M5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  3O5L A;  3UI5 A;  4U85 A;  4JYS A;  2ZR5 A;  2VN1 A;  1FKG A;  2XP6 A;  3O5Q A;  3KAI A;  3NI6 A;  4ODK A;  2PV3 A;  4TW7 A;  1B6C A;  2M08 A;  5HT1 A;  1JNT A;  3UF8 A;  2OFN A;  1FKK A;  1D7I A;  1D7J A;  4ODO A;  4R0X A;  5DIV A;  3IK8 A;  4LAV A;  2XP9 A;  4ODL A;  2MNT A;  2L2S A;  5HWB A;  1T11 A;  4DRI A;  5HWC A;  2RSE A;  2MF9 A;  3EY6 A;  4LAX A;  2N87 A;  1N1A A;  1Q6U A;  3KAD A;  4NNR A;  3JYJ A;  2FKE A;  3JYM A;  4IQC A;  4O2T A;  2IF4 A;  2LJ4 A;  2RUD A;  2ZR4 A;  3O5F A;  3RFW A;  4DRH A;  1PIN A;  1R9H A;  1F40 A;  1ZCN A;  3O5M A;  1NMW A;  2F2D A;  2XP7 A;  3NRK A;  3KAG A;  4TNS A;  1QPF A;  1EYM A;  1FKI A;  3KAH A;  1JVW A;  2LPV A;  5HKG A;  4W9P A;  1JNS A;  1Q6H A;  2KGJ A;  4JFK A;  2MPH A;  3O5I A;  4GIV A;  3O5E A;  2LKN A;  4JFM A;  4TX0 A;  4U86 A;  3FAP A;  4JFL A;  4DRP A;  3O5P A;  1QZ2 A;  1FKJ A;  1J6Y A;  4GGQ A;  2ZQV A;  4IPX A;  1J4R A;  5DIU A;  1FD9 A;  3UI6 A;  1EQ3 A;  1Q6I A;  5DIT A;  1FKF A;  4DZ3 A;  1QPL A;  2KR7 A;  4QT2 A;  2PV1 A;  2Y78 A;  1KT0 A;  4TW6 A;  3TC5 A;  1FKH A;  1FKB A;  2DG9 A;  2AWG A;  2DG3 A;  4DRO A;  5HW6 A;  3UQA A;  5B8I C;  4C02 B;  3PRB A;  5D75 A;  4DRJ A;  1YW5 A;  1KT1 A;  2MLY A;  3TDB A;  3KAF A;  1PBK A;  4ITZ A;  1FKT A;  2ZR6 A;  3IHZ A;  4DRQ A;  5I98 A;  4DZ2 A;  1D6O A;  1TCO C;  4TW8 A;  3UQI A;  1J4I A;  4FAP A;  1FKR A;  2XP4 A;  3PRD A;  3IKD A;  4QT3 A;  1BKF A;  3GPK A;  4FN2 A;  3O5J A;  1HXV A;  3B7X A;  4DRM A;  3H9R B;  1W26 A;  4J4O A;  4DRN A;  2PBC A;  4IQ2 A;  2KI3 A;  5HUA A;  2KE0 A;  2KO7 A;  3O5R A;  4G50 A;  1ZK6 A;  2ZQS A;  4QIB A;  2M1I A;  3TCZ A;  1C9H A;  3KCE A;  2UZ5 A;  2D9F A;  2MLZ A;  3I6C A;  2RUQ A;  4LAW A;  2LGO A;  3O5K A;  2RUC A;  4ODM A;  1Q1C A;  3KAC A;  2MLX A;  1FKL A;  2F21 A;  3MDY B;  3CGM A;  3O5G A;  2RUR A;  1U79 A;  2M2A A;  5HW8 A;  3IKG A;  3WH0 A;  2KFW A;  1ROT A;  2XP3 A;  2PV2 A;  2ZQT A;  3OOB A;  2XP8 A;  4J4N A;  2Q5A A;  2F4E A;  4DRK A;  1FKD A;  2PPO A;  2ITK A;  4N19 A;  4BF8 A;  1D7H A;  1FKS A;  1FAP A;  3LUO A;  1NMV A;  4DH0 A;  1A7X A;  2K8I A;  2XP5 A;  4JFI A;  3VAW A;  5HTG A;  4U84 A;  2JZV A;  4W9O A;  3UI4 A;  1ROU A;  4G2P A;  2ZQU A;  3RGC A;  3JXV A;  4JFJ A;  2PPN A;  3O5D A;  4LAY A;  3KZ7 A;  1NSG A;  1F8A B;  4ODR A;  2VCD A;  4W9Q A;  1L1P A;  4ODQ A;  1YAT A;  3UQB A;  2DG4 A;  2RQS A;  2XPA A;  4ODN A;  3O5O A;  1P5Q A;  4ODP A;  4MGV A;  3ODK A;  1FJD A;  1J4H A;  2XPB A;  5BXJ A;  4MSP A;  2PPP A;  3CGN A;  4TYO A;  5GPG A;  5J6E A;  3NTP A;  1M5Y A;  4DT4 A;  5HW7 A;  3KAB A;  1Y0O A;  3PA7 A;  2FAP A;  4DIP A; 
#chains in the Genus database with same CATH topology
 3O5L A;  4JYS A;  2ZR5 A;  2VN1 A;  1FKG A;  3O5Q A;  3WQW A;  1H0G A;  2P4V A;  1LL7 A;  1ZBC A;  1ITX A;  1D7I A;  4MTV A;  4R0X A;  1ZU8 A;  4ODL A;  2MNT A;  2L2S A;  5HWB A;  3B9D A;  1Q6U A;  2DT1 A;  1LG2 A;  1ZL1 A;  1EHN A;  2DT0 A;  3O5F A;  5DEZ A;  1PIN A;  4TNS A;  3NRK A;  1JNS A;  1JND A;  1FKI A;  3KAH A;  3WL1 A;  2KGJ A;  4JFK A;  2MPH A;  4GIV A;  4ZPW R;  3PRA A;  3B8S A;  3AQU A;  2ZQV A;  1HKI A;  1E6P A;  2PV1 A;  2Y78 A;  4TW6 A;  1GPF A;  1FKH A;  3CHD A;  4DRO A;  3PR9 A;  4C02 B;  4DRQ A;  3RM4 A;  4DZ2 A;  1HKK A;  1VF8 A;  1J4I A;  1FKR A;  1UR9 A;  2F23 A;  3ALF A;  3IKD A;  4W5U A;  3GPK A;  1W9U A;  2PBC A;  4DWS A;  4IQ2 A;  4G50 A;  2ZQS A;  2M1I A;  1C9H A;  5DF0 A;  2UZ5 A;  3I6C A;  1WNO A;  2PI6 A;  3KAC A;  2F21 A;  3O5G A;  1U79 A;  1HKJ A;  2IUZ A;  3GU0 A;  2PV2 A;  2ZQT A;  3ARV A;  3OOB A;  2F4E A;  3WL0 A;  2PPO A;  4Q22 A;  4DH0 A;  1FAP A;  2K8I A;  3VAW A;  4P8U A;  4W9O A;  3UI4 A;  3WD0 A;  2PPN A;  1NWR A;  3ARU A;  1F8A B;  3CHF A;  4ODR A;  5JH8 A;  4W9Q A;  4UDM A;  1L1P A;  4ODQ A;  3UQB A;  2RQS A;  2O9O A;  1KFW A;  4DWS B;  3ARQ A;  3GTY X;  1D2K A;  4TYO A;  1HJX A;  1Y0O A;  1W1Y A;  1GRJ A;  4ZS6 A;  2DSV A;  1BL4 A;  2XP6 A;  4HBE A;  3KAI A;  2PV3 A;  1B6C A;  5HT1 A;  2ETN A;  1K9T A;  3UF8 A;  1RD6 A;  1W1P A;  1JNE A;  4Z2L A;  1T11 A;  4DRI A;  4Z2G A;  3EY6 A;  1N1A A;  1W9V A;  3JYJ A;  3JYM A;  4DRH A;  1W1V A;  3RFW A;  1F40 A;  3O5M A;  1NMW A;  2F2D A;  4QZV B;  1QPF A;  1GUV A;  1HJW A;  1JVW A;  4WKH A;  4MNL A;  2DSU A;  1NWU A;  2O92 A;  4TX0 A;  1XHG A;  4JFL A;  1FFQ A;  3BMB A;  1OWQ A;  4GGQ A;  4WKA A;  4IPX A;  2B31 A;  1FD9 A;  3UI6 A;  1TFV A;  4DZ3 A;  4QT2 A;  1KT0 A;  2DG9 A;  4WKF A;  5HW6 A;  2QF8 A;  4ITZ A;  1PBK A;  2ZR6 A;  2PN0 A;  2DT2 A;  3PRD A;  1W1T A;  2A3C A;  1HXV A;  4WJX A;  3B7X A;  4DRM A;  5GPR A;  4J4O A;  4DRN A;  1LL6 A;  1ZB5 A;  1W9P A;  3FY1 A;  3AS1 A;  2KE0 A;  5HBF A;  2A3A A;  2D9F A;  2RUQ A;  3O5K A;  4ODM A;  2MLX A;  3CGM A;  3WIJ A;  2M2A A;  4P8V A;  3IKG A;  5HW8 A;  3WH0 A;  1ROT A;  2Q5A A;  4DRK A;  2ITK A;  4BF8 A;  1FKS A;  3G6L A;  3CH9 A;  4S3K A;  1NMV A;  3FXY A;  4JFI A;  4AY1 A;  2WLZ A;  2B5U B;  1LJY A;  3RGC A;  2ZQU A;  4JFJ A;  4KQZ A;  3O5D A;  4LAY A;  1HKM A;  1LG1 A;  1ZBK A;  2XPA A;  4ODN A;  3O5O A;  3ODK A;  1FJD A;  4ML4 A;  1SYT A;  1CTN A;  4NZC A;  1E6R A;  3QOK A;  5GPG A;  5J6E A;  4P8W A;  3KAB A;  3PA7 A;  4MNJ A;  4URI A;  4DIP A;  3WD1 A;  4TW7 A;  3NI6 A;  1NH6 A;  2M08 A;  1JNT A;  3W4R A;  1FKK A;  2G8Z A;  4DWS C;  3IK8 A;  4LAV A;  4Z2K A;  1OGB A;  2MF9 A;  4WIW A;  2N87 A;  4NNR A;  2FKE A;  4IQC A;  4O2T A;  2LJ4 A;  2RUD A;  2ZR4 A;  3WD4 A;  1R9H A;  1EYM A;  5GQB A;  4S3J A;  1Q6H A;  4U86 A;  2LKN A;  3RM8 A;  1QZ2 A;  4LGX A;  1J6Y A;  3ARS A;  2OLH A;  1J4R A;  5DIU A;  1EIB A;  4MPK A;  1EQ3 A;  5DIT A;  1QPL A;  2DSW A;  4Z2I A;  3UQA A;  5B8I C;  3ARY A;  3ARZ A;  3PRB A;  5D75 A;  2MLY A;  1NWS A;  3TDB A;  2WM0 A;  3WD2 A;  1FKT A;  5I98 A;  1D6O A;  1TCO C;  4TW8 A;  4FAP A;  2WLY A;  2XP4 A;  1FFR A;  2FDM A;  3H9R B;  1W26 A;  2KI3 A;  1GOI A;  3CHC A;  4L3N A;  3O5R A;  2KO7 A;  5HUA A;  3TCZ A;  2MLZ A;  4MNK A;  4LAW A;  3BXW A;  2RUC A;  3MDY B;  2RUR A;  2G41 A;  4HAR A;  2XP3 A;  4J4N A;  3ARX A;  1WAW A;  4N19 A;  3ART A;  1A7X A;  2XP5 A;  2DT3 A;  3WKZ A;  5HTG A;  1E6N A;  1ROU A;  3JXV A;  1H0I A;  3KZ7 A;  1NSG A;  4L72 B;  4IT6 A;  2VCD A;  3B9E A;  2DG4 A;  3ARR A;  1X6N A;  1E15 A;  4HBO A;  1P5Q A;  4ODP A;  2DSZ A;  4MGV A;  3WD3 A;  1J4H A;  2XPB A;  4MSP A;  4MAV A;  4DT4 A;  5HW7 A;  4IT4 A;  3AS0 A;  2FAP A;  3OA5 A;  3UI5 A;  4U85 A;  2A3E A;  1IX5 A;  2WK2 A;  4ODK A;  2OFN A;  3CHE A;  4P8X A;  1D7J A;  4ODO A;  5DIV A;  1XRV A;  2XP9 A;  3ARW A;  2EUL A;  5HWC A;  2RSE A;  4ZPV R;  4LAX A;  3KAD A;  4KR0 B;  5DO2 A;  2IF4 A;  1ZCN A;  2AOS A;  2XP7 A;  3KAG A;  2LPV A;  5HKG A;  4W9P A;  1OGG A;  3O5I A;  3O5E A;  4JFM A;  3G6M A;  3FAP A;  4DRP A;  4DWS D;  1UR8 A;  3O5P A;  4Z2J A;  4NSB A;  1FKJ A;  4MNM A;  3CZ8 A;  2YBT A;  1JCH B;  4Z2H A;  2YBU A;  2DPE A;  1LL4 A;  1WB0 A;  1Q6I A;  1FKF A;  3ARO A;  2KR7 A;  4PTM A;  1FKB A;  4WK9 A;  3TC5 A;  2AWG A;  2DG3 A;  3RM9 A;  4DRJ A;  1YW5 A;  1KT1 A;  3KAF A;  1SR0 A;  4Q7N A;  1O6I A;  3IHZ A;  3UQI A;  4XAK A;  3RME A;  4ZPT R;  4QT3 A;  1BKF A;  4FN2 A;  3O5J A;  1E6Z A;  3AS2 A;  1E9L A;  1ZK6 A;  4QIB A;  3WQV A;  3KCE A;  2LGO A;  1X6L A;  1ZBW A;  1Q1C A;  1FKL A;  2KFW A;  2A3B A;  3AS3 A;  2XP8 A;  1HJV A;  1FKD A;  1D7H A;  3LUO A;  1EDQ A;  1ZBV A;  2ESC A;  4U84 A;  2JZV A;  3ALG A;  4G2P A;  1NWT A;  1YAT A;  1E44 A;  4R5E A;  3B9A A;  5BXJ A;  3ARP A;  2PPP A;  3CGN A;  1LQ0 A;  3NTP A;  1M5Y A;  3EIP A; 
#chains in the Genus database with same CATH homology
 3O5L A;  4JYS A;  2ZR5 A;  2VN1 A;  1FKG A;  3O5Q A;  3WQW A;  1H0G A;  1LL7 A;  1ZBC A;  1ITX A;  1D7I A;  4MTV A;  4R0X A;  1ZU8 A;  4ODL A;  2MNT A;  2L2S A;  5HWB A;  3B9D A;  1Q6U A;  2DT1 A;  1LG2 A;  1ZL1 A;  1EHN A;  2DT0 A;  3O5F A;  5DEZ A;  1PIN A;  4TNS A;  3NRK A;  1JNS A;  1JND A;  1FKI A;  3KAH A;  3WL1 A;  2KGJ A;  4JFK A;  2MPH A;  4GIV A;  4ZPW R;  3PRA A;  3B8S A;  3AQU A;  2ZQV A;  1HKI A;  1E6P A;  2PV1 A;  2Y78 A;  4TW6 A;  1GPF A;  1FKH A;  3CHD A;  4DRO A;  3PR9 A;  4C02 B;  4DRQ A;  3RM4 A;  4DZ2 A;  1HKK A;  1VF8 A;  1J4I A;  1FKR A;  1UR9 A;  3ALF A;  3IKD A;  4W5U A;  3GPK A;  1W9U A;  2PBC A;  4DWS A;  4IQ2 A;  4G50 A;  2ZQS A;  2M1I A;  1C9H A;  5DF0 A;  2UZ5 A;  3I6C A;  1WNO A;  2PI6 A;  3KAC A;  2F21 A;  3O5G A;  1U79 A;  1HKJ A;  2IUZ A;  2PV2 A;  2ZQT A;  3ARV A;  3OOB A;  2F4E A;  3WL0 A;  2PPO A;  4Q22 A;  4DH0 A;  1FAP A;  2K8I A;  3VAW A;  4P8U A;  4W9O A;  3UI4 A;  3WD0 A;  2PPN A;  1NWR A;  3ARU A;  1F8A B;  3CHF A;  4ODR A;  5JH8 A;  4W9Q A;  1L1P A;  4ODQ A;  3UQB A;  2RQS A;  2O9O A;  1KFW A;  4DWS B;  3ARQ A;  1D2K A;  4TYO A;  1HJX A;  1Y0O A;  1W1Y A;  4ZS6 A;  2DSV A;  1BL4 A;  2XP6 A;  4HBE A;  3KAI A;  2PV3 A;  1B6C A;  5HT1 A;  1K9T A;  3UF8 A;  1RD6 A;  1W1P A;  1JNE A;  4Z2L A;  1T11 A;  4DRI A;  4Z2G A;  3EY6 A;  1N1A A;  1W9V A;  3JYJ A;  3JYM A;  4DRH A;  1W1V A;  3RFW A;  1F40 A;  3O5M A;  1NMW A;  2F2D A;  4QZV B;  1QPF A;  1GUV A;  1HJW A;  1JVW A;  4WKH A;  4MNL A;  2DSU A;  1NWU A;  2O92 A;  4TX0 A;  1XHG A;  4JFL A;  1FFQ A;  1OWQ A;  4GGQ A;  4WKA A;  4IPX A;  2B31 A;  1FD9 A;  3UI6 A;  1TFV A;  4DZ3 A;  4QT2 A;  1KT0 A;  2DG9 A;  4WKF A;  5HW6 A;  2QF8 A;  4ITZ A;  1PBK A;  2ZR6 A;  2DT2 A;  3PRD A;  1W1T A;  2A3C A;  1HXV A;  4WJX A;  3B7X A;  4DRM A;  5GPR A;  4J4O A;  4DRN A;  1LL6 A;  1ZB5 A;  1W9P A;  3FY1 A;  3AS1 A;  2KE0 A;  5HBF A;  2A3A A;  2D9F A;  2RUQ A;  3O5K A;  4ODM A;  2MLX A;  3CGM A;  3WIJ A;  2M2A A;  4P8V A;  3IKG A;  5HW8 A;  3WH0 A;  1ROT A;  2Q5A A;  4DRK A;  2ITK A;  4BF8 A;  1FKS A;  3G6L A;  3CH9 A;  4S3K A;  1NMV A;  3FXY A;  4JFI A;  4AY1 A;  2WLZ A;  1LJY A;  3RGC A;  2ZQU A;  4JFJ A;  4KQZ A;  3O5D A;  4LAY A;  1HKM A;  1LG1 A;  1ZBK A;  2XPA A;  4ODN A;  3O5O A;  3ODK A;  1FJD A;  4ML4 A;  1SYT A;  1CTN A;  4NZC A;  1E6R A;  3QOK A;  5GPG A;  5J6E A;  4P8W A;  3KAB A;  3PA7 A;  4MNJ A;  4URI A;  4DIP A;  3WD1 A;  4TW7 A;  3NI6 A;  1NH6 A;  2M08 A;  1JNT A;  3W4R A;  1FKK A;  2G8Z A;  4DWS C;  3IK8 A;  4LAV A;  4Z2K A;  1OGB A;  2MF9 A;  4WIW A;  2N87 A;  4NNR A;  2FKE A;  4IQC A;  4O2T A;  2LJ4 A;  2RUD A;  2ZR4 A;  3WD4 A;  1R9H A;  1EYM A;  5GQB A;  4S3J A;  1Q6H A;  4U86 A;  2LKN A;  3RM8 A;  1QZ2 A;  4LGX A;  1J6Y A;  3ARS A;  2OLH A;  1J4R A;  5DIU A;  1EIB A;  4MPK A;  1EQ3 A;  5DIT A;  1QPL A;  2DSW A;  4Z2I A;  3UQA A;  5B8I C;  3ARY A;  3ARZ A;  3PRB A;  5D75 A;  2MLY A;  1NWS A;  3TDB A;  2WM0 A;  3WD2 A;  1FKT A;  5I98 A;  1D6O A;  1TCO C;  4TW8 A;  4FAP A;  2WLY A;  2XP4 A;  1FFR A;  2FDM A;  3H9R B;  1W26 A;  2KI3 A;  1GOI A;  3CHC A;  4L3N A;  3O5R A;  2KO7 A;  5HUA A;  3TCZ A;  2MLZ A;  4MNK A;  4LAW A;  3BXW A;  2RUC A;  3MDY B;  2RUR A;  2G41 A;  4HAR A;  2XP3 A;  4J4N A;  3ARX A;  1WAW A;  4N19 A;  3ART A;  1A7X A;  2XP5 A;  2DT3 A;  3WKZ A;  5HTG A;  1E6N A;  1ROU A;  3JXV A;  1H0I A;  3KZ7 A;  1NSG A;  4L72 B;  4IT6 A;  2VCD A;  3B9E A;  2DG4 A;  3ARR A;  1X6N A;  1E15 A;  4HBO A;  1P5Q A;  4ODP A;  2DSZ A;  4MGV A;  3WD3 A;  1J4H A;  2XPB A;  4MSP A;  4MAV A;  4DT4 A;  5HW7 A;  4IT4 A;  3AS0 A;  2FAP A;  3OA5 A;  3UI5 A;  4U85 A;  2A3E A;  1IX5 A;  2WK2 A;  4ODK A;  2OFN A;  3CHE A;  4P8X A;  1D7J A;  4ODO A;  5DIV A;  1XRV A;  2XP9 A;  3ARW A;  5HWC A;  2RSE A;  4ZPV R;  4LAX A;  3KAD A;  4KR0 B;  5DO2 A;  2IF4 A;  1ZCN A;  2AOS A;  2XP7 A;  3KAG A;  2LPV A;  5HKG A;  4W9P A;  1OGG A;  3O5I A;  3O5E A;  4JFM A;  3G6M A;  3FAP A;  4DRP A;  4DWS D;  1UR8 A;  3O5P A;  4Z2J A;  4NSB A;  1FKJ A;  4MNM A;  3CZ8 A;  2YBT A;  4Z2H A;  2YBU A;  2DPE A;  1LL4 A;  1WB0 A;  1Q6I A;  1FKF A;  3ARO A;  2KR7 A;  4PTM A;  1FKB A;  4WK9 A;  3TC5 A;  2AWG A;  2DG3 A;  3RM9 A;  4DRJ A;  1YW5 A;  1KT1 A;  3KAF A;  1SR0 A;  4Q7N A;  1O6I A;  3IHZ A;  3UQI A;  4XAK A;  3RME A;  4ZPT R;  4QT3 A;  1BKF A;  4FN2 A;  3O5J A;  1E6Z A;  3AS2 A;  1E9L A;  1ZK6 A;  4QIB A;  3WQV A;  3KCE A;  2LGO A;  1X6L A;  1ZBW A;  1Q1C A;  1FKL A;  2KFW A;  2A3B A;  3AS3 A;  2XP8 A;  1HJV A;  1FKD A;  1D7H A;  3LUO A;  1EDQ A;  1ZBV A;  2ESC A;  4U84 A;  2JZV A;  3ALG A;  4G2P A;  1NWT A;  1YAT A;  4R5E A;  3B9A A;  5BXJ A;  3ARP A;  2PPP A;  3CGN A;  1LQ0 A;  3NTP A;  1M5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...