2PPNA

Crystal structure of fkbp12
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural coupling between FKBP12 and buried water.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 1A
total genus 30
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2ppnA00
2XPAA 2MLXA 2KFWA 4TNSA 2RUQA 4TW6A 3KZ7A 4DRPA 2Q5AA 2PPPA 3FAPA 5J6EA 3UF8A 2FKEA 2PV2A 1PINA 1FKJA 3CGNA 4U84A 1Y0OA 1QZ2A 4JYSA 4LAYA 3WH0A 4DZ3A 4IQ2A 3KABA 4IPXA 5HW8A 1A7XA 1J4IA 3GPKA 5HKGA 2LJ4A 2M2AA 2ZQUA 4MSPA 4JFJA 3O5GA 4QT3A 4W9PA 2KE0A 1FKHA 3NTPA 4TW7A 1FKRA 1Q6UA 2DG3A 1D7HA 1KT1A 2JZVA 3JXVA 1Q1CA 3KADA 4LAXA 4ODRA 4U85A 1F40A 1P5QA 1FD9A 4ODLA 1ZCNA 2XP3A 2F4EA 2ZR6A 4J4NA 1D7IA 1QPLA 2XP7A 4TW8A 2RQSA 1J4HA 2KGJA 1BKFA 1NSGA 2PPOA 3LUOA 3O5OA 2LKNA 1F8AB 2DG4A 5DIVA 3UQIA 5HW6A 1FKSA 1Q6IA 5BXJA 2PPNA 3UQBA 2OFNA 4DROA 3PRDA 2L2SA 4R0XA 1JVWA 4G50A 4ODOA 1L1PA 3NRKA 1FKFA 3TC5A 3O5DA 1J6YA 2AWGA 4N19A 1FKGA 2MF9A 2RSEA 3O5QA 1JNTA 4JFMA 4ODQA 1FKDA 1D6OA 1NMWA 1EYMA 1NMVA 1J4RA 2XP5A 2XP4A 3OOBA 2F2DA 4MGVA 1PBKA 1ROUA 2M08A 4TX0A 3I6CA 3MDYB 3NI6A 1FJDA 2ZQSA 3KAFA 3O5JA 3CGMA 2XPBA 1U79A 4DRNA 1FKBA 3O5MA 4DRJA 3UI6A 1JNSA 5I98A 1B6CA 1R9HA 1ROTA 3O5PA 2XP6A 3PRBA 4LAWA 4C02B 2PV1A 4W9OA 5DIUA 1FAPA 4LAVA 2KR7A 4O2TA 1YW5A 1EQ3A 4QIBA 3UQAA 1KT0A 3UI4A 4ODKA 4W9QA 4JFLA 5HTGA 2F21A 2RUDA 4DIPA 2ZQVA 3O5LA 2FAPA 2LPVA 1D7JA 2MNTA 4GGQA 3TCZA 2RURA 3KAGA 4J4OA 3TDBA 3JYJA 4DH0A 4DZ2A 1T11A 2ZR5A 1W26A 2D9FA 5DITA 2LGOA 2UZ5A 4GIVA 4JFIA 3KACA 3O5FA 4DRMA 5HT1A 2KI3A 4ODPA 2MLZA 3IHZA 4ITZA 2PV3A 2XP8A 5D75A 3O5RA 3IK8A 4QT2A 1BL4A 2DG9A 2RUCA 2IF4A 4FN2A 4DRKA 4ODMA 1Q6HA 4DRIA 2Y78A 3ODKA 3H9RB 1FKIA 1TCOC 4DRHA 3PA7A 3B7XA 2MPHA 2VCDA 1FKKA 1QPFA 2ZR4A 3EY6A 3RFWA 3KCEA 3VAWA 4U86A 3O5KA 3JYMA 4NNRA 4TYOA 1YATA 4DT4A 4ODNA 2ZQTA 5HUAA 1N1AA 1M5YA 5HWBA 5HWCA 2M1IA 3O5EA 2ITKA 2KO7A 4G2PA 2K8IA 3UI5A 1HXVA 5GPGA 4IQCA 3KAIA 2MLYA 3IKGA 1FKLA 4JFKA 4FAPA 1ZK6A 3IKDA 3KAHA 5HW7A 2N87A 2VN1A 3O5IA 3RGCA 4BF8A 4DRQA 5B8IC 1C9HA 2PBCA 2XP9A 1FKTA
chains in the Genus database with same CATH superfamily
1W1YA 4TNSA 1CTNA 1NWRA 5J6EA 3UF8A 2FKEA 1E6RA 2PV2A 2B31A 1OGGA 5HW8A 1VF8A 3GPKA 5HKGA 2M2AA 2KE0A 1HKJA 1K9TA 3CZ8A 3RGCA 2DG3A 2JZVA 2F23A 1FD9A 2F4EA 4J4NA 2DT2A 4Z2IA 2ESCA 4P8WA 3FY1A 1JNDA 2PPOA 3LUOA 5DIVA 2LKNA 3WD1A 1Q6IA 2PPNA 2YBUA 5GQBA 4ZPVR 1FKFA 1J6YA 2AWGA 3ARQA 3B9AA 4Z2KA 4ODQA 2WLYA 1D6OA 2XP4A 1EYMA 1J4RA 2F2DA 4MGVA 4DWSB 3I6CA 3MDYB 1W1VA 3WKZA 3KAFA 3CHEA 1ZBCA 1HKMA 4DRNA 1FKBA 3UI6A 3O5PA 2PV1A 4W9OA 4DWSC 1EHNA 1ZBWA 4QIBA 5HBFA 4DIPA 1WNOA 3KAGA 4J4OA 1ZBVA 2WK2A 4ZPTR 3AS2A 4UDMA 2LGOA 2UZ5A 1LQ0A 2KI3A 4ODPA 4Z2JA 4Q7NA 3ALFA 5D75A 1BL4A 2RUCA 1NH6A 4DRIA 3ODKA 4DRHA 3PA7A 1NWTA 1EDQA 3VAWA 2DSZA 3O5KA 3JYMA 4TYOA 4S3KA 1ZB5A 5HWCA 1M5YA 1SYTA 2A3EA 4IT6A 2M1IA 2ITKA 4G2PA 2A3BA 3UI5A 4MTVA 1H0GA 2YBTA 1FKLA 4WIWA 4FAPA 1ZK6A 1UR9A 4AY1A 2VN1A 2B5UB 1IX5A 2DT3A 2XP9A 2KFWA 3AS3A 3WL1A 4NZCA 2PPPA 3ARTA 1FKJA 2DT0A 1FFQA 1QZ2A 1Y0OA 1ZL1A 4LAYA 1X6NA 3WIJA 4DZ3A 3KABA 4IPXA 3AQUA 1HXVA 4JFJA 4QT3A 3NTPA 1FKHA 3PRAA 2DT1A 3JXVA 1D7HA 1KT1A 3KADA 1Q1CA 4MNJA 3ARVA 4KR0B 2DSVA 3BXWA 1WB0A 1BKFA 1NWUA 2DG4A 3B8SA 5DF0A 4DROA 3PRDA 2L2SA 4R0XA 4WK9A 3CHFA 4ODOA 1JNEA 3O5DA 4P8XA 3WD0A 1JCHB 4ML4A 4JFMA 1FKDA 3FXYA 2XP5A 1ROUA 3PR9A 1FJDA 3B9EA 2QF8A 3O5JA 3CGMA 2XPBA 1XRVA 1FAPA 4LAVA 4O2TA 3UQAA 3EIPA 2WM0A 1GRJA 5HTGA 2F21A 4HBOA 3O5LA 2LPVA 3WD4A 1D7JA 4GGQA 2RURA 4WKHA 1LJYA 1T11A 2AOSA 3ARPA 2ZR5A 2OLHA 2A3AA 3O5FA 1H0IA 3AS0A 3O5RA 1W9UA 3IK8A 4QT2A 2DG9A 4FN2A 2IF4A 1Q6HA 4WJXA 1TCOC 2ZR4A 2G41A 3RFWA 1SR0A 4NNRA 1YATA 1ZU8A 5GPRA 1E6ZA 1N1AA 2K8IA 5GPGA 3KAIA 2MLYA 3IKGA 1HJWA 4JFKA 3IKDA 3KAHA 2N87A 3O5IA 4BF8A 1C9HA 2PV3A 1W1TA 1FKRA 2XPAA 3GU0A 2DSWA 2PI6A 3KZ7A 2Q5AA 4DRPA 3ARUA 3ALGA 3ARYA 1EIBA 1W9VA 1PINA 3CGNA 4W5UA 4JYSA 1J4IA 2O9OA 4MSPA 3O5GA 4W9PA 4QZVB 1Q6UA 4LAXA 4ODRA 4R5EA 4U85A 1HKKA 1F40A 1P5QA 1W1PA 1ZCNA 2ZR6A 4MAVA 1D7IA 1QPLA 2XP7A 2RQSA 1J4HA 1GUVA 3WD3A 4Z2GA 4NSBA 1NSGA 3UQIA 5HW6A 1FKSA 2OFNA 3OA5A 4G50A 1L1PA 3NRKA 2O92A 4DWSA 1HKIA 4N19A 2RSEA 3OOBA 1NMVA 1WAWA 5DEZA 1HJVA 2M08A 4TX0A 3NI6A 4KQZA 4IT4A 4P8VA 1JNSA 2XP6A 4LAWA 1X6LA 5DIUA 2KR7A 1KT0A 3UI4A 4ODKA 4W9QA 4JFLA 1ITXA 3CHDA 2FAPA 4HBEA 3TCZA 3ARSA 3WL0A 3TDBA 3JYJA 4DH0A 4DZ2A 1W26A 2DPEA 3KACA 1TFVA 4DRMA 5HT1A 4ITZA 2XP8A 4Z2LA 2Y78A 3QOKA 3GTYX 2MPHA 1FKKA 1QPFA 4MPKA 3WD2A 2G8ZA 3CHCA 3KCEA 4U86A 4L72B 2IUZA 4S3JA 1OWQA 2A3CA 4IQCA 1D2KA 5HW7A 4LGXA 5DO2A 4DRQA 4P8UA 1ZBKA 4IQ2A 1FKTA 2MLXA 4XAKA 3RMEA 2RUQA 4TW6A 3RM8A 3FAPA 2P4VA 4U84A 3ARWA 3ARZA 3WH0A 1A7XA 1GPFA 1LL7A 1E6PA 2LJ4A 2ZQUA 4TW7A 3RM9A 3WQWA 4WKFA 1LL6A 4ODLA 2XP3A 4TW8A 3WQVA 2KGJA 2FDMA 3O5OA 1F8AB 1KFWA 3AS1A 5BXJA 3UQBA 3W4RA 1JVWA 4L3NA 3TC5A 3G6LA 4Q22A 4URIA 1FKGA 2MF9A 3O5QA 1JNTA 1NMWA 2ETNA 1PBKA 4MNMA 2ZQSA 2DSUA 1U79A 3O5MA 4DRJA 1LL4A 5I98A 1B6CA 1R9HA 1ROTA 3PRBA 1XHGA 1OGBA 4C02B 1YW5A 1EQ3A 3G6MA 3RM4A 2PN0A 1LG1A 2RUDA 2ZQVA 2MNTA 3ARXA 3CH9A 4DWSD 1UR8A 2WLZA 4ZPWR 1O6IA 2D9FA 5DITA 3B9DA 4GIVA 4JFIA 1E6NA 1NWSA 2MLZA 4PTMA 3IHZA 3AROA 1GOIA 1E44A 4DRKA 1E9LA 1LG2A 4ODMA 5JH8A 3H9RB 1E15A 1FKIA 4WKAA 3B7XA 2VCDA 4ZS6A 3BMBA 3EY6A 4MNKA 4DT4A 4Z2HA 4ODNA 1FFRA 2ZQTA 1HJXA 5HUAA 1W9PA 4MNLA 5HWBA 3O5EA 2KO7A 2EULA 1RD6A 3ARRA 4HARA 5B8IC 2PBCA
chains in the Genus database with same CATH topology
1W1YA 4TNSA 1CTNA 1NWRA 5J6EA 3UF8A 2FKEA 1E6RA 2PV2A 2B31A 1OGGA 5HW8A 1VF8A 3GPKA 5HKGA 2M2AA 2KE0A 1HKJA 1K9TA 3CZ8A 3RGCA 2DG3A 2JZVA 1FD9A 2F4EA 4J4NA 2DT2A 4Z2IA 2ESCA 4P8WA 3FY1A 1JNDA 2PPOA 3LUOA 5DIVA 2LKNA 3WD1A 1Q6IA 2PPNA 2YBUA 5GQBA 4ZPVR 1FKFA 1J6YA 2AWGA 3ARQA 3B9AA 4Z2KA 4ODQA 2WLYA 1D6OA 2XP4A 1EYMA 1J4RA 2F2DA 4MGVA 4DWSB 3I6CA 3MDYB 1W1VA 3WKZA 3KAFA 3CHEA 1ZBCA 1HKMA 4DRNA 1FKBA 3UI6A 3O5PA 2PV1A 4W9OA 4DWSC 1EHNA 1ZBWA 4QIBA 5HBFA 4DIPA 1WNOA 3KAGA 4J4OA 1ZBVA 2WK2A 4ZPTR 3AS2A 2LGOA 2UZ5A 1LQ0A 2KI3A 4ODPA 4Z2JA 4Q7NA 3ALFA 5D75A 1BL4A 2RUCA 1NH6A 4DRIA 3ODKA 4DRHA 3PA7A 1NWTA 1EDQA 3VAWA 2DSZA 3O5KA 3JYMA 4TYOA 4S3KA 1ZB5A 5HWCA 1M5YA 1SYTA 2A3EA 4IT6A 2M1IA 2ITKA 4G2PA 2A3BA 3UI5A 4MTVA 1H0GA 2YBTA 1FKLA 4WIWA 4FAPA 1ZK6A 1UR9A 4AY1A 2VN1A 1IX5A 2DT3A 2XP9A 2KFWA 3AS3A 3WL1A 4NZCA 2PPPA 3ARTA 1FKJA 2DT0A 1FFQA 1QZ2A 1Y0OA 1ZL1A 4LAYA 1X6NA 3WIJA 4DZ3A 3KABA 4IPXA 3AQUA 1HXVA 4JFJA 4QT3A 3NTPA 1FKHA 3PRAA 2DT1A 3JXVA 1D7HA 1KT1A 3KADA 1Q1CA 4MNJA 3ARVA 4KR0B 2DSVA 3BXWA 1WB0A 1BKFA 1NWUA 2DG4A 3B8SA 5DF0A 4DROA 3PRDA 2L2SA 4R0XA 4WK9A 3CHFA 4ODOA 1JNEA 3O5DA 4P8XA 3WD0A 4ML4A 4JFMA 1FKDA 3FXYA 2XP5A 1ROUA 3PR9A 1FJDA 3B9EA 2QF8A 3O5JA 3CGMA 2XPBA 1XRVA 1FAPA 4LAVA 4O2TA 3UQAA 2WM0A 5HTGA 2F21A 4HBOA 3O5LA 2LPVA 3WD4A 1D7JA 4GGQA 2RURA 4WKHA 1LJYA 1T11A 2AOSA 3ARPA 2ZR5A 2OLHA 2A3AA 3O5FA 1H0IA 3AS0A 3O5RA 1W9UA 3IK8A 4QT2A 2DG9A 4FN2A 2IF4A 1Q6HA 4WJXA 1TCOC 2ZR4A 2G41A 3RFWA 1SR0A 4NNRA 1YATA 1ZU8A 5GPRA 1E6ZA 1N1AA 2K8IA 5GPGA 3KAIA 2MLYA 3IKGA 1HJWA 4JFKA 3IKDA 3KAHA 2N87A 3O5IA 4BF8A 1C9HA 2PV3A 1W1TA 1FKRA 2XPAA 2DSWA 2PI6A 3KZ7A 2Q5AA 4DRPA 3ARUA 3ALGA 3ARYA 1EIBA 1W9VA 1PINA 3CGNA 4W5UA 4JYSA 1J4IA 2O9OA 4MSPA 3O5GA 4W9PA 4QZVB 1Q6UA 4LAXA 4ODRA 4R5EA 4U85A 1HKKA 1F40A 1P5QA 1W1PA 1ZCNA 2ZR6A 4MAVA 1D7IA 1QPLA 2XP7A 2RQSA 1J4HA 1GUVA 3WD3A 4Z2GA 4NSBA 1NSGA 3UQIA 5HW6A 1FKSA 2OFNA 3OA5A 4G50A 1L1PA 3NRKA 2O92A 4DWSA 1HKIA 4N19A 2RSEA 1NMVA 1WAWA 3OOBA 5DEZA 1HJVA 2M08A 4TX0A 3NI6A 4KQZA 4IT4A 4P8VA 1JNSA 2XP6A 4LAWA 1X6LA 5DIUA 2KR7A 1KT0A 3UI4A 4ODKA 4W9QA 4JFLA 1ITXA 3CHDA 2FAPA 4HBEA 3TCZA 3ARSA 3WL0A 3TDBA 3JYJA 4DH0A 4DZ2A 1W26A 2DPEA 3KACA 1TFVA 4DRMA 5HT1A 4ITZA 2XP8A 4Z2LA 2Y78A 3QOKA 2MPHA 1FKKA 1QPFA 4MPKA 3WD2A 2G8ZA 3CHCA 3KCEA 4U86A 4L72B 2IUZA 4S3JA 1OWQA 2A3CA 4IQCA 1D2KA 5HW7A 4LGXA 5DO2A 4DRQA 4P8UA 1ZBKA 4IQ2A 1FKTA 2MLXA 4XAKA 3RMEA 2RUQA 4TW6A 3RM8A 3FAPA 4U84A 3ARWA 3ARZA 3WH0A 1A7XA 1GPFA 1LL7A 1E6PA 2LJ4A 2ZQUA 4TW7A 3RM9A 3WQWA 4WKFA 1LL6A 4ODLA 2XP3A 4TW8A 3WQVA 2KGJA 2FDMA 3O5OA 1F8AB 1KFWA 3AS1A 5BXJA 3UQBA 3W4RA 1JVWA 4L3NA 3TC5A 3G6LA 4Q22A 4URIA 1FKGA 2MF9A 3O5QA 1JNTA 1NMWA 1PBKA 4MNMA 2ZQSA 2DSUA 1U79A 3O5MA 4DRJA 1LL4A 5I98A 1B6CA 1R9HA 1ROTA 3PRBA 1XHGA 1OGBA 4C02B 1YW5A 1EQ3A 3G6MA 3RM4A 1LG1A 2RUDA 2ZQVA 2MNTA 3ARXA 3CH9A 4DWSD 1UR8A 2WLZA 4ZPWR 1O6IA 2D9FA 5DITA 3B9DA 4GIVA 4JFIA 1E6NA 1NWSA 2MLZA 4PTMA 3IHZA 3AROA 1GOIA 4DRKA 1E9LA 1LG2A 4ODMA 5JH8A 3H9RB 1E15A 1FKIA 4WKAA 3B7XA 2VCDA 4ZS6A 3EY6A 4MNKA 4DT4A 4Z2HA 4ODNA 1FFRA 2ZQTA 1HJXA 5HUAA 1W9PA 4MNLA 5HWBA 3O5EA 2KO7A 1RD6A 3ARRA 4HARA 5B8IC 2PBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPA A;  2MLX A;  2KFW A;  4TNS A;  2RUQ A;  4TW6 A;  3KZ7 A;  4DRP A;  2Q5A A;  2PPP A;  3FAP A;  5J6E A;  3UF8 A;  2FKE A;  2PV2 A;  1PIN A;  1FKJ A;  3CGN A;  4U84 A;  1Y0O A;  1QZ2 A;  4JYS A;  4LAY A;  3WH0 A;  4DZ3 A;  4IQ2 A;  3KAB A;  4IPX A;  5HW8 A;  1A7X A;  1J4I A;  3GPK A;  5HKG A;  2LJ4 A;  2M2A A;  2ZQU A;  4MSP A;  4JFJ A;  3O5G A;  4QT3 A;  4W9P A;  2KE0 A;  1FKH A;  3NTP A;  4TW7 A;  1FKR A;  1Q6U A;  2DG3 A;  1D7H A;  1KT1 A;  2JZV A;  3JXV A;  1Q1C A;  3KAD A;  4LAX A;  4ODR A;  4U85 A;  1F40 A;  1P5Q A;  1FD9 A;  4ODL A;  1ZCN A;  2XP3 A;  2F4E A;  2ZR6 A;  4J4N A;  1D7I A;  1QPL A;  2XP7 A;  4TW8 A;  2RQS A;  1J4H A;  2KGJ A;  1BKF A;  1NSG A;  2PPO A;  3LUO A;  3O5O A;  2LKN A;  1F8A B;  2DG4 A;  5DIV A;  3UQI A;  5HW6 A;  1FKS A;  1Q6I A;  5BXJ A;  2PPN A;  3UQB A;  2OFN A;  4DRO A;  3PRD A;  2L2S A;  4R0X A;  1JVW A;  4G50 A;  4ODO A;  1L1P A;  3NRK A;  1FKF A;  3TC5 A;  3O5D A;  1J6Y A;  2AWG A;  4N19 A;  1FKG A;  2MF9 A;  2RSE A;  3O5Q A;  1JNT A;  4JFM A;  4ODQ A;  1FKD A;  1D6O A;  1NMW A;  1EYM A;  1NMV A;  1J4R A;  2XP5 A;  2XP4 A;  3OOB A;  2F2D A;  4MGV A;  1PBK A;  1ROU A;  2M08 A;  4TX0 A;  3I6C A;  3MDY B;  3NI6 A;  1FJD A;  2ZQS A;  3KAF A;  3O5J A;  3CGM A;  2XPB A;  1U79 A;  4DRN A;  1FKB A;  3O5M A;  4DRJ A;  3UI6 A;  1JNS A;  5I98 A;  1B6C A;  1R9H A;  1ROT A;  3O5P A;  2XP6 A;  3PRB A;  4LAW A;  4C02 B;  2PV1 A;  4W9O A;  5DIU A;  1FAP A;  4LAV A;  2KR7 A;  4O2T A;  1YW5 A;  1EQ3 A;  4QIB A;  3UQA A;  1KT0 A;  3UI4 A;  4ODK A;  4W9Q A;  4JFL A;  5HTG A;  2F21 A;  2RUD A;  4DIP A;  2ZQV A;  3O5L A;  2FAP A;  2LPV A;  1D7J A;  2MNT A;  4GGQ A;  3TCZ A;  2RUR A;  3KAG A;  4J4O A;  3TDB A;  3JYJ A;  4DH0 A;  4DZ2 A;  1T11 A;  2ZR5 A;  1W26 A;  2D9F A;  5DIT A;  2LGO A;  2UZ5 A;  4GIV A;  4JFI A;  3KAC A;  3O5F A;  4DRM A;  5HT1 A;  2KI3 A;  4ODP A;  2MLZ A;  3IHZ A;  4ITZ A;  2PV3 A;  2XP8 A;  5D75 A;  3O5R A;  3IK8 A;  4QT2 A;  1BL4 A;  2DG9 A;  2RUC A;  2IF4 A;  4FN2 A;  4DRK A;  4ODM A;  1Q6H A;  4DRI A;  2Y78 A;  3ODK A;  3H9R B;  1FKI A;  1TCO C;  4DRH A;  3PA7 A;  3B7X A;  2MPH A;  2VCD A;  1FKK A;  1QPF A;  2ZR4 A;  3EY6 A;  3RFW A;  3KCE A;  3VAW A;  4U86 A;  3O5K A;  3JYM A;  4NNR A;  4TYO A;  1YAT A;  4DT4 A;  4ODN A;  2ZQT A;  5HUA A;  1N1A A;  1M5Y A;  5HWB A;  5HWC A;  2M1I A;  3O5E A;  2ITK A;  2KO7 A;  4G2P A;  2K8I A;  3UI5 A;  1HXV A;  5GPG A;  4IQC A;  3KAI A;  2MLY A;  3IKG A;  1FKL A;  4JFK A;  4FAP A;  1ZK6 A;  3IKD A;  3KAH A;  5HW7 A;  2N87 A;  2VN1 A;  3O5I A;  3RGC A;  4BF8 A;  4DRQ A;  5B8I C;  1C9H A;  2PBC A;  2XP9 A;  1FKT A; 
#chains in the Genus database with same CATH topology
 1W1Y A;  4TNS A;  1CTN A;  1NWR A;  5J6E A;  3UF8 A;  2FKE A;  1E6R A;  2PV2 A;  2B31 A;  1OGG A;  5HW8 A;  1VF8 A;  3GPK A;  5HKG A;  2M2A A;  2KE0 A;  1HKJ A;  1K9T A;  3CZ8 A;  3RGC A;  2DG3 A;  2JZV A;  2F23 A;  1FD9 A;  2F4E A;  4J4N A;  2DT2 A;  4Z2I A;  2ESC A;  4P8W A;  3FY1 A;  1JND A;  2PPO A;  3LUO A;  5DIV A;  2LKN A;  3WD1 A;  1Q6I A;  2PPN A;  2YBU A;  5GQB A;  4ZPV R;  1FKF A;  1J6Y A;  2AWG A;  3ARQ A;  3B9A A;  4Z2K A;  4ODQ A;  2WLY A;  1D6O A;  2XP4 A;  1EYM A;  1J4R A;  2F2D A;  4MGV A;  4DWS B;  3I6C A;  3MDY B;  1W1V A;  3WKZ A;  3KAF A;  3CHE A;  1ZBC A;  1HKM A;  4DRN A;  1FKB A;  3UI6 A;  3O5P A;  2PV1 A;  4W9O A;  4DWS C;  1EHN A;  1ZBW A;  4QIB A;  5HBF A;  4DIP A;  1WNO A;  3KAG A;  4J4O A;  1ZBV A;  2WK2 A;  4ZPT R;  3AS2 A;  4UDM A;  2LGO A;  2UZ5 A;  1LQ0 A;  2KI3 A;  4ODP A;  4Z2J A;  4Q7N A;  3ALF A;  5D75 A;  1BL4 A;  2RUC A;  1NH6 A;  4DRI A;  3ODK A;  4DRH A;  3PA7 A;  1NWT A;  1EDQ A;  3VAW A;  2DSZ A;  3O5K A;  3JYM A;  4TYO A;  4S3K A;  1ZB5 A;  5HWC A;  1M5Y A;  1SYT A;  2A3E A;  4IT6 A;  2M1I A;  2ITK A;  4G2P A;  2A3B A;  3UI5 A;  4MTV A;  1H0G A;  2YBT A;  1FKL A;  4WIW A;  4FAP A;  1ZK6 A;  1UR9 A;  4AY1 A;  2VN1 A;  2B5U B;  1IX5 A;  2DT3 A;  2XP9 A;  2KFW A;  3AS3 A;  3WL1 A;  4NZC A;  2PPP A;  3ART A;  1FKJ A;  2DT0 A;  1FFQ A;  1QZ2 A;  1Y0O A;  1ZL1 A;  4LAY A;  1X6N A;  3WIJ A;  4DZ3 A;  3KAB A;  4IPX A;  3AQU A;  1HXV A;  4JFJ A;  4QT3 A;  3NTP A;  1FKH A;  3PRA A;  2DT1 A;  3JXV A;  1D7H A;  1KT1 A;  3KAD A;  1Q1C A;  4MNJ A;  3ARV A;  4KR0 B;  2DSV A;  3BXW A;  1WB0 A;  1BKF A;  1NWU A;  2DG4 A;  3B8S A;  5DF0 A;  4DRO A;  3PRD A;  2L2S A;  4R0X A;  4WK9 A;  3CHF A;  4ODO A;  1JNE A;  3O5D A;  4P8X A;  3WD0 A;  1JCH B;  4ML4 A;  4JFM A;  1FKD A;  3FXY A;  2XP5 A;  1ROU A;  3PR9 A;  1FJD A;  3B9E A;  2QF8 A;  3O5J A;  3CGM A;  2XPB A;  1XRV A;  1FAP A;  4LAV A;  4O2T A;  3UQA A;  3EIP A;  2WM0 A;  1GRJ A;  5HTG A;  2F21 A;  4HBO A;  3O5L A;  2LPV A;  3WD4 A;  1D7J A;  4GGQ A;  2RUR A;  4WKH A;  1LJY A;  1T11 A;  2AOS A;  3ARP A;  2ZR5 A;  2OLH A;  2A3A A;  3O5F A;  1H0I A;  3AS0 A;  3O5R A;  1W9U A;  3IK8 A;  4QT2 A;  2DG9 A;  4FN2 A;  2IF4 A;  1Q6H A;  4WJX A;  1TCO C;  2ZR4 A;  2G41 A;  3RFW A;  1SR0 A;  4NNR A;  1YAT A;  1ZU8 A;  5GPR A;  1E6Z A;  1N1A A;  2K8I A;  5GPG A;  3KAI A;  2MLY A;  3IKG A;  1HJW A;  4JFK A;  3IKD A;  3KAH A;  2N87 A;  3O5I A;  4BF8 A;  1C9H A;  2PV3 A;  1W1T A;  1FKR A;  2XPA A;  3GU0 A;  2DSW A;  2PI6 A;  3KZ7 A;  2Q5A A;  4DRP A;  3ARU A;  3ALG A;  3ARY A;  1EIB A;  1W9V A;  1PIN A;  3CGN A;  4W5U A;  4JYS A;  1J4I A;  2O9O A;  4MSP A;  3O5G A;  4W9P A;  4QZV B;  1Q6U A;  4LAX A;  4ODR A;  4R5E A;  4U85 A;  1HKK A;  1F40 A;  1P5Q A;  1W1P A;  1ZCN A;  2ZR6 A;  4MAV A;  1D7I A;  1QPL A;  2XP7 A;  2RQS A;  1J4H A;  1GUV A;  3WD3 A;  4Z2G A;  4NSB A;  1NSG A;  3UQI A;  5HW6 A;  1FKS A;  2OFN A;  3OA5 A;  4G50 A;  1L1P A;  3NRK A;  2O92 A;  4DWS A;  1HKI A;  4N19 A;  2RSE A;  3OOB A;  1NMV A;  1WAW A;  5DEZ A;  1HJV A;  2M08 A;  4TX0 A;  3NI6 A;  4KQZ A;  4IT4 A;  4P8V A;  1JNS A;  2XP6 A;  4LAW A;  1X6L A;  5DIU A;  2KR7 A;  1KT0 A;  3UI4 A;  4ODK A;  4W9Q A;  4JFL A;  1ITX A;  3CHD A;  2FAP A;  4HBE A;  3TCZ A;  3ARS A;  3WL0 A;  3TDB A;  3JYJ A;  4DH0 A;  4DZ2 A;  1W26 A;  2DPE A;  3KAC A;  1TFV A;  4DRM A;  5HT1 A;  4ITZ A;  2XP8 A;  4Z2L A;  2Y78 A;  3QOK A;  3GTY X;  2MPH A;  1FKK A;  1QPF A;  4MPK A;  3WD2 A;  2G8Z A;  3CHC A;  3KCE A;  4U86 A;  4L72 B;  2IUZ A;  4S3J A;  1OWQ A;  2A3C A;  4IQC A;  1D2K A;  5HW7 A;  4LGX A;  5DO2 A;  4DRQ A;  4P8U A;  1ZBK A;  4IQ2 A;  1FKT A;  2MLX A;  4XAK A;  3RME A;  2RUQ A;  4TW6 A;  3RM8 A;  3FAP A;  2P4V A;  4U84 A;  3ARW A;  3ARZ A;  3WH0 A;  1A7X A;  1GPF A;  1LL7 A;  1E6P A;  2LJ4 A;  2ZQU A;  4TW7 A;  3RM9 A;  3WQW A;  4WKF A;  1LL6 A;  4ODL A;  2XP3 A;  4TW8 A;  3WQV A;  2KGJ A;  2FDM A;  3O5O A;  1F8A B;  1KFW A;  3AS1 A;  5BXJ A;  3UQB A;  3W4R A;  1JVW A;  4L3N A;  3TC5 A;  3G6L A;  4Q22 A;  4URI A;  1FKG A;  2MF9 A;  3O5Q A;  1JNT A;  1NMW A;  2ETN A;  1PBK A;  4MNM A;  2ZQS A;  2DSU A;  1U79 A;  3O5M A;  4DRJ A;  1LL4 A;  5I98 A;  1B6C A;  1R9H A;  1ROT A;  3PRB A;  1XHG A;  1OGB A;  4C02 B;  1YW5 A;  1EQ3 A;  3G6M A;  3RM4 A;  2PN0 A;  1LG1 A;  2RUD A;  2ZQV A;  2MNT A;  3ARX A;  3CH9 A;  4DWS D;  1UR8 A;  2WLZ A;  4ZPW R;  1O6I A;  2D9F A;  5DIT A;  3B9D A;  4GIV A;  4JFI A;  1E6N A;  1NWS A;  2MLZ A;  4PTM A;  3IHZ A;  3ARO A;  1GOI A;  1E44 A;  4DRK A;  1E9L A;  1LG2 A;  4ODM A;  5JH8 A;  3H9R B;  1E15 A;  1FKI A;  4WKA A;  3B7X A;  2VCD A;  4ZS6 A;  3BMB A;  3EY6 A;  4MNK A;  4DT4 A;  4Z2H A;  4ODN A;  1FFR A;  2ZQT A;  1HJX A;  5HUA A;  1W9P A;  4MNL A;  5HWB A;  3O5E A;  2KO7 A;  2EUL A;  1RD6 A;  3ARR A;  4HAR A;  5B8I C;  2PBC A; 
#chains in the Genus database with same CATH homology
 1W1Y A;  4TNS A;  1CTN A;  1NWR A;  5J6E A;  3UF8 A;  2FKE A;  1E6R A;  2PV2 A;  2B31 A;  1OGG A;  5HW8 A;  1VF8 A;  3GPK A;  5HKG A;  2M2A A;  2KE0 A;  1HKJ A;  1K9T A;  3CZ8 A;  3RGC A;  2DG3 A;  2JZV A;  1FD9 A;  2F4E A;  4J4N A;  2DT2 A;  4Z2I A;  2ESC A;  4P8W A;  3FY1 A;  1JND A;  2PPO A;  3LUO A;  5DIV A;  2LKN A;  3WD1 A;  1Q6I A;  2PPN A;  2YBU A;  5GQB A;  4ZPV R;  1FKF A;  1J6Y A;  2AWG A;  3ARQ A;  3B9A A;  4Z2K A;  4ODQ A;  2WLY A;  1D6O A;  2XP4 A;  1EYM A;  1J4R A;  2F2D A;  4MGV A;  4DWS B;  3I6C A;  3MDY B;  1W1V A;  3WKZ A;  3KAF A;  3CHE A;  1ZBC A;  1HKM A;  4DRN A;  1FKB A;  3UI6 A;  3O5P A;  2PV1 A;  4W9O A;  4DWS C;  1EHN A;  1ZBW A;  4QIB A;  5HBF A;  4DIP A;  1WNO A;  3KAG A;  4J4O A;  1ZBV A;  2WK2 A;  4ZPT R;  3AS2 A;  2LGO A;  2UZ5 A;  1LQ0 A;  2KI3 A;  4ODP A;  4Z2J A;  4Q7N A;  3ALF A;  5D75 A;  1BL4 A;  2RUC A;  1NH6 A;  4DRI A;  3ODK A;  4DRH A;  3PA7 A;  1NWT A;  1EDQ A;  3VAW A;  2DSZ A;  3O5K A;  3JYM A;  4TYO A;  4S3K A;  1ZB5 A;  5HWC A;  1M5Y A;  1SYT A;  2A3E A;  4IT6 A;  2M1I A;  2ITK A;  4G2P A;  2A3B A;  3UI5 A;  4MTV A;  1H0G A;  2YBT A;  1FKL A;  4WIW A;  4FAP A;  1ZK6 A;  1UR9 A;  4AY1 A;  2VN1 A;  1IX5 A;  2DT3 A;  2XP9 A;  2KFW A;  3AS3 A;  3WL1 A;  4NZC A;  2PPP A;  3ART A;  1FKJ A;  2DT0 A;  1FFQ A;  1QZ2 A;  1Y0O A;  1ZL1 A;  4LAY A;  1X6N A;  3WIJ A;  4DZ3 A;  3KAB A;  4IPX A;  3AQU A;  1HXV A;  4JFJ A;  4QT3 A;  3NTP A;  1FKH A;  3PRA A;  2DT1 A;  3JXV A;  1D7H A;  1KT1 A;  3KAD A;  1Q1C A;  4MNJ A;  3ARV A;  4KR0 B;  2DSV A;  3BXW A;  1WB0 A;  1BKF A;  1NWU A;  2DG4 A;  3B8S A;  5DF0 A;  4DRO A;  3PRD A;  2L2S A;  4R0X A;  4WK9 A;  3CHF A;  4ODO A;  1JNE A;  3O5D A;  4P8X A;  3WD0 A;  4ML4 A;  4JFM A;  1FKD A;  3FXY A;  2XP5 A;  1ROU A;  3PR9 A;  1FJD A;  3B9E A;  2QF8 A;  3O5J A;  3CGM A;  2XPB A;  1XRV A;  1FAP A;  4LAV A;  4O2T A;  3UQA A;  2WM0 A;  5HTG A;  2F21 A;  4HBO A;  3O5L A;  2LPV A;  3WD4 A;  1D7J A;  4GGQ A;  2RUR A;  4WKH A;  1LJY A;  1T11 A;  2AOS A;  3ARP A;  2ZR5 A;  2OLH A;  2A3A A;  3O5F A;  1H0I A;  3AS0 A;  3O5R A;  1W9U A;  3IK8 A;  4QT2 A;  2DG9 A;  4FN2 A;  2IF4 A;  1Q6H A;  4WJX A;  1TCO C;  2ZR4 A;  2G41 A;  3RFW A;  1SR0 A;  4NNR A;  1YAT A;  1ZU8 A;  5GPR A;  1E6Z A;  1N1A A;  2K8I A;  5GPG A;  3KAI A;  2MLY A;  3IKG A;  1HJW A;  4JFK A;  3IKD A;  3KAH A;  2N87 A;  3O5I A;  4BF8 A;  1C9H A;  2PV3 A;  1W1T A;  1FKR A;  2XPA A;  2DSW A;  2PI6 A;  3KZ7 A;  2Q5A A;  4DRP A;  3ARU A;  3ALG A;  3ARY A;  1EIB A;  1W9V A;  1PIN A;  3CGN A;  4W5U A;  4JYS A;  1J4I A;  2O9O A;  4MSP A;  3O5G A;  4W9P A;  4QZV B;  1Q6U A;  4LAX A;  4ODR A;  4R5E A;  4U85 A;  1HKK A;  1F40 A;  1P5Q A;  1W1P A;  1ZCN A;  2ZR6 A;  4MAV A;  1D7I A;  1QPL A;  2XP7 A;  2RQS A;  1J4H A;  1GUV A;  3WD3 A;  4Z2G A;  4NSB A;  1NSG A;  3UQI A;  5HW6 A;  1FKS A;  2OFN A;  3OA5 A;  4G50 A;  1L1P A;  3NRK A;  2O92 A;  4DWS A;  1HKI A;  4N19 A;  2RSE A;  1NMV A;  1WAW A;  3OOB A;  5DEZ A;  1HJV A;  2M08 A;  4TX0 A;  3NI6 A;  4KQZ A;  4IT4 A;  4P8V A;  1JNS A;  2XP6 A;  4LAW A;  1X6L A;  5DIU A;  2KR7 A;  1KT0 A;  3UI4 A;  4ODK A;  4W9Q A;  4JFL A;  1ITX A;  3CHD A;  2FAP A;  4HBE A;  3TCZ A;  3ARS A;  3WL0 A;  3TDB A;  3JYJ A;  4DH0 A;  4DZ2 A;  1W26 A;  2DPE A;  3KAC A;  1TFV A;  4DRM A;  5HT1 A;  4ITZ A;  2XP8 A;  4Z2L A;  2Y78 A;  3QOK A;  2MPH A;  1FKK A;  1QPF A;  4MPK A;  3WD2 A;  2G8Z A;  3CHC A;  3KCE A;  4U86 A;  4L72 B;  2IUZ A;  4S3J A;  1OWQ A;  2A3C A;  4IQC A;  1D2K A;  5HW7 A;  4LGX A;  5DO2 A;  4DRQ A;  4P8U A;  1ZBK A;  4IQ2 A;  1FKT A;  2MLX A;  4XAK A;  3RME A;  2RUQ A;  4TW6 A;  3RM8 A;  3FAP A;  4U84 A;  3ARW A;  3ARZ A;  3WH0 A;  1A7X A;  1GPF A;  1LL7 A;  1E6P A;  2LJ4 A;  2ZQU A;  4TW7 A;  3RM9 A;  3WQW A;  4WKF A;  1LL6 A;  4ODL A;  2XP3 A;  4TW8 A;  3WQV A;  2KGJ A;  2FDM A;  3O5O A;  1F8A B;  1KFW A;  3AS1 A;  5BXJ A;  3UQB A;  3W4R A;  1JVW A;  4L3N A;  3TC5 A;  3G6L A;  4Q22 A;  4URI A;  1FKG A;  2MF9 A;  3O5Q A;  1JNT A;  1NMW A;  1PBK A;  4MNM A;  2ZQS A;  2DSU A;  1U79 A;  3O5M A;  4DRJ A;  1LL4 A;  5I98 A;  1B6C A;  1R9H A;  1ROT A;  3PRB A;  1XHG A;  1OGB A;  4C02 B;  1YW5 A;  1EQ3 A;  3G6M A;  3RM4 A;  1LG1 A;  2RUD A;  2ZQV A;  2MNT A;  3ARX A;  3CH9 A;  4DWS D;  1UR8 A;  2WLZ A;  4ZPW R;  1O6I A;  2D9F A;  5DIT A;  3B9D A;  4GIV A;  4JFI A;  1E6N A;  1NWS A;  2MLZ A;  4PTM A;  3IHZ A;  3ARO A;  1GOI A;  4DRK A;  1E9L A;  1LG2 A;  4ODM A;  5JH8 A;  3H9R B;  1E15 A;  1FKI A;  4WKA A;  3B7X A;  2VCD A;  4ZS6 A;  3EY6 A;  4MNK A;  4DT4 A;  4Z2H A;  4ODN A;  1FFR A;  2ZQT A;  1HJX A;  5HUA A;  1W9P A;  4MNL A;  5HWB A;  3O5E A;  2KO7 A;  1RD6 A;  3ARR A;  4HAR A;  5B8I C;  2PBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...